3SAJA

Crystal structure of glutamate receptor glua1 amino terminal domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
375
structure length
369
Chain Sequence
b'GAMPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 1
molecule tags Transport protein
publication title Crystal structure of the glutamate receptor GluA1 N-terminal domain.
pubmed doi rcsb
total genus 115
structure length 369
sequence length 375
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA01
3CG0A 1BDHA 4UHKA 4KVFA 1EHCA 4MGEA 1E2BA 1VKRA 1ZN2A 3LUGA 5TPWB 2YHBA 3OLZA 3O75A 2WJAA 4FE4A 1XHFA 4YV7A 2FW0A 3DLBA 3TO5A 1Y1LA 3HJFA 3KYIB 3MQ4A 5IEJA 3ILHA 3Q41A 4W5TA 2LBPA 3JVDA 3O2QB 3OQNA 1BDIA 2Q5CA 5EWMB 1APBA 5BQ3A 5DTEA 4GNRA 1LK0A 2YHAA 5KI6A 2FEKA 4RXTA 1Z26A 3EDCA 3Q7TA 3H75A 3R0JA 3ROTA 5TQJA 5IUJC 4F3TA 2NUBA 1U2PA 1JDNA 1LBHA 3NNDA 4Z9AA 1JF8A 1K66A 4IMJB 3RVQA 2WRZA 3RVMA 3DLHA 4NCBA 3O74A 1D2AA 4O1IA 2MYPA 3E3MA 5TQ2A 3RQIA 5B3JC 3SQNA 1DBWA 2NT4A 5FWYB 5IC5A 2WWVD 5T7BA 4RS3A 3S99A 2FLKA 2R4QA 3O2JA 5BRAA 3OLWA 5KWSA 3FGZA 5TQ2B 2PLNA 3CZ5A 3KSMA 3N8IA 3RVLA 2IPMA 4RK0A 4H3HB 5ABPA 2PMCA 1P6UA 3Q7SA 5JNWA 3GA5A 4F8JA 1Z13A 4S05A 3HDVA 1K68A 3UUGA 4N0QA 5TQ0B 2AYXA 2XDYA 4Y9TA 4LE1A 2F8SA 3RVRA 1ZGZA 2FMFA 4CBVA 3N53A 1Z17A 5IEBA 5CNJA 4TLLB 1NY5A 1SXIA 5D2CA 5KQLA 4QPJC 1JX6A 1NXTA 4OLBA 1PUXA 5ED4A 2A9OA 3MMNA 2ID9A 3I5AA 1MB0A 2QW1A 1BA2A 3KG2A 3LUFA 1RZRD 1EAYA 2LIVA 5CNIA 4MQEA 4QYMA 3OO0A 4RV5A 4KZKA 3BILA 2PAFA 4JA2A 2FN8A 1P8AA 1ZGGA 3OLXA 3FDFA 1NXXA 2IOYA 5KQMA 1ZH4A 3NBMA 1A2OA 3N0XA 1OXKB 4Z4EA 2E4XA 3EAFA 4MRMA 2PE5A 2QU7A 2L2QA 3NNNA 1U0SY 4OG2A 1XWWA 3C3MA 1USKA 3L49A 1YMVA 2MSKA 4KV7A 1JDPA 3P9YA 2PUBA 1PNTA 3IPAA 3H5OA 6ABPA 4Q6WA 3RVJA 5HKOA 1H9CA 4O1HA 2E4YA 3JVIA 3GV0A 1QP4A 1SD5A 3D8UA 3JPWA 3BRQA 4LZLA 3H1EA 1PNRA 2E4UA 1BDJA 2R47A 3HK2A 3LUAA 3TD9A 1QP7A 2BGGA 1E6LA 1Z2DA 2TMYA 1S8NA 1YVUA 2IYNA 3H1GA 4RK6A 1VPWA 1QO0A 2JRLA 3HSYA 1RPJA 3OMWA 1NXVA 1JL3A 5PNTA 2FTKE 4G0PA 3RVOA 3LKVA 4EGSA 1NXPA 2JB9A 4OBBA 2QSJA 4NV3A 4WXMA 5KC9A 4W5QA 1YS7A 1BAPA 3GT7A 3G1WA 2R48A 4Q6BA 2JVKA 4RKQA 2PUEA 3QLTA 4WUTA 1BVHA 4E7PA 4ETMA 3H6GA 3EULA 3QEMA 3N75A 1F51E 4XLTA 2I6FA 1YS6A 4G0YA 4ETIA 4EVSA 1DP4A 3GBPA 1JFTA 3MM4A 3OLYA 3QLVA 4RK7A 1JFSA 2W42A 4QICA 4ZJPA 1QO0D 3CTPA 4G0MA 4MR8B 4W5OA 3IPCA 2E4VA 4RY0A 2PUAA 2PL9A 4JB2A 3T6KA 4W5RA 3FFTA 2MSWA 2RJOA 1L5YA 1Z12A 1DC7A 2R25B 2LPMA 1YIOA 4G0QA 2P4UA 1QMPA 2M98A 4LX8A 4EY3A 5JNTA 4TMYA 1W9HA 5GOTA 1VRVA 2L17A 3BRSA 3N6VA 4UHJA 2QZJA 4RWEA 3OM1A 5JNVA 2PUDA 2MSLA 1D5WA 3GRCA 1NTRA 1W25A 2PKXA 3IP6A 1J56A 2QVCA 4MS3A 2GBPA 3L6UA 5FWXB 5B3JA 4MR7A 1CYEA 3QELB 1P2FA 3CS3A 3Q15C 4PZ0A 1DBPA 3HUUA 3KS9A 3NNSA 1AB5A 2NT3A 3D02A 2B1JA 4G0XA 1CHNA 5EWJB 3F7NA 1F4VA 2HPHA 1ISRA 4XFKA 3TMYA 2O20A 1LJLA 2PUGA 1I3CA 2MYNA 4YR7A 4KQ9A 5DCLA 1HEYA 5IULC 2KYRA 3UKJA 3F6CA 5EWLA 2RGYA 4KRFA 4ZMRA 3LUJA 2FEPA 1AB6A 2L18A 4Z9BA 9ABPA 1RZRA 2ZAYA 2WJWA 3O1IC 1URPA 2FN9A 4RK5A 2B4AA 3H5LA 5CNKA 3T8YA 4JP1A 3KLOA 1L5ZA 4MR9B 1DCKA 1EFAA 2HJ9A 4HNRA 6CHYA 1RXIA 4YP9A 1ISSA 3F6PA 3M9XA 4G0OA 5EWJA 3QK7A 7ABPA 5IX8A 1FQWA 2J48A 3T95A 3H6HA 1SRRA 2VK2A 1JYEA 3LUKA 4JB0A 4DQDA 5JNUA 5HM6A 4LE2A 1USIA 1U8TA 4Z4HA 4M88A 3BREA 1DJMA 1P6QA 1U04A 4MLCA 4YGXB 5KC8A 4Q7EA 3OO1A 4WXEA 3A0UA 3QEMB 2QR3A 3LUCA 3VNAA 3KJXA 3KLNA 3HDGA 3CZCA 3MA0A 3GBVA 4EUKA 2L19A 3CU5A 1U2QA 2PUCA 1DZ3A 2VUHB 4KFCA 1FFGA 4HYEA 5GQSA 3M6MD 2CHFA 3HEBA 4MQEB 3HM9A 1QQAA 1B00A 1JLKA 4MR8A 3IP5A 2E4WA 1JYFA 3O2SB 4EVRA 4WT7A 3O1HB 3I42A 4RU1A 4H60A 4PICA 1QKKA 4HNQA 5KQGA 2FQXA 2A9RA 2PL1A 2H3HA 2FQWA 2JK1A 4MS4B 4WZZA 1EWTA 3EGCA 4KK4A 3SG0A 1DG9A 3RVNA 4NICA 4EYQA 3OQOA 1FSPA 2IDMA 2FMHA 4OTZA 3HZHA 1M2FA 4YLEA 4N47A 1GLGA 4MS1B 2DRIA 3H5IA 3E61A 3B2NA 2FQYA 3MYYA 4XARA 3LUDA 3SAJA 4MPTA 4OLAA 1Z15A 3QLUA 1ZAYA 4IF4A 1KRWA 4LDZA 4RKRA 3N0WA 4D6YA 4D74A 1D1QA 2HQRA 4XAQA 3HUTA 3QEKA 3TB6A 4MRMB 4YS6A 5IBQA 1DRKA 4MAAA 5JNRA 5CHYA 1TVMA 4G0ZA 1OXBB 2JCGA 5FBHA 4WWHA 5TQ0A 4PE5B 4ML3A 3A10A 2MYTA 3C6QA 4TN5A 8ABPA 4KMRA 4DN6A 2WY2D 1DBQA 5TPZA 1PHRA 2VYCA 3A0RB 3HCWA 5CNMA 3H5VA 2QVGA 4O5AA 4YRZA 4LDAA 2IPNA 4FE7A 4PEVA 4E7OA 5IUKC 1YTUA 2WMYA 4DADA 2JVJA 4Z99A 4RDCA 5JNSA 3CHYA 4KREA 3JPYA 2MYUA 4EYKA 1NXOA 5FWYA 4MR9A 5DKFA 3SY8A 4N76A 2NZVG 1ZY2A 4JOQA 2JBAA 2F8TA 4Z4IA 3G85A 3ROFA 4RXMA 3H1FA 4MS4A 3M9WA 1Z2EA 4FB4A 1NATA 1MB3A 4EYOA 4HNSA 1A0OA 2FKAA 2FXIA 4GPAA 2CD7A 1ABFA 1KRXA 2ZWMA 2AYZA 3DGFC 4EVQA 3JS5A 3URMA 3Q7RA 4Z4CA 1TMYA 3HVRA 3CFYA 4G97A 2E4ZA 3EQ2A 1ZVVA 3C3WA 3EODA 1CEYA 1MIHA 3N0RA 4JAVC 3K9CA 4QYWA 4NCAA 3EQZA 2OQRA 5EWLB 3SM9A 2FMKA 3EJWA 3KHTA 4LRQA 3KCNA 3I09A 3NHZA 1QP0A 1SXGA 4F06A 2IKSA 5JS1A 2HQOA 2IPLA 3JY6A 4N41A 1D4ZA 4Z4FA 2IPAB 1M5UA 3W9SA 5JS2A 1SXHA 1KMIY 5I4CA 1DRJA 4EYGA 1GCAA 5FWXA 3KYJB 2H0AA 1MVOA 2FSPA 4H3KB 2NZUG 3HV2A 2RDMA 1Z25A 3QX8A 4RY8A 2VUIB 3OMXA 4IMIB 4L4UA 4MQFB 2M1ZA 1TLFA 1QPZA 2LP4Y 4F12A 3QLVC 1JHZA 3LMKA 2QXYA 2X7XA 4RK1A 1PEAA 1ZH2A 2LUOA 3OQMA 4LE0A 1JBEA 1LBIA 3GWGA 2CHEA 5TE9A 2JVIA 3DBIA 2A9QA 3DZDA 3IP9A 3KTOA 1FFSA 4KQCA 4F11A 4N03A 5TPWA 3LFTA 1M2EA 3LKBA 4RSMA 3HXMA 1KGSA 1PEYA 4P98A 3QELA 4S04A 4MS3B 4IILA 4MLDA 1JH9A 2FVYA 3UK0A 1Z16A 3CKMA 1D1PA 2ID7A 1C4WA 1GUBA 1YK0A 4XASA 3FMVA 3QLUC 1TJYA 2A9PA 2N9UA 3RVPA 1Z18A 3FFWA 5BRJA 4MQFA 4MYRA 3JTEA 1JFVA 4B09A 5IUNC 1GCGA 4KPYA 1RNLA 3IP7A 1TM2A 3QX9A 1ABEA 3KKEA 3TX6A 3CRNA 4P1ZA 3LTEA 4Z0NA 1E6MA 2PUFA 2RJNA 4MR7B 5HQJA 1QNLA 1JWLA 4ETNA 3OM0A 5T3YA 3GYBA 3O21A 1T34A 1R8JA 2GKGA 3OLVA 5KQPA 3HO1A 1WETA 3IDOA 4ZYLA 5E3JA 3H5WA 3FFXA 4L85A 3K4HA 1IIBA 2WB4A 4G86A 3A3KA 4YWHA 5C5CA 1VLZA 3C3KA 4KK3A 1MAVA 4PYRA 5FBKA 2FLWA 4W5NA 4RK4A 2HSGA 3LUHA 1XHEA 1NXSA 5DLEA 4RY9A 3LOPA 1RXEA 4NQRA 4RZSA 5DGCA 3T38A 1USGA 2CWDA 1A04A 3DGEC 2HQBA 5BR1A 1ZDMA 1GUDA 2P9HA 3NHMA 4OATA 1ZESA 2GI4A 1LJUA 1ZITA 3RH0A 2GWRA 3H5TA 1M5TA 3ILYA 2V0NA 2PJUA 1DCMA 2GX6A 4Z4GA 3F73A 1YMUA 4RXUA 1NXWA 2FMIA 3MF4A 3MIZA 4JASB 4D6XA 4ZPJA 4TLMB 3RVKA 3CNBA 3CG4A 4IGAA 5HSGA 3SNKA 4XXHA 4YCSA 1EWKA 1YK1A 3O1JC 1UDRA 4YO7A 1E6KA 2JBAB 3GL9A 1QQBA 2QV0A 1DCFA 5EWMA 5TPZD 4KNYA 4N0PA 4MS1A 2OENG 3BBLA 1ZHHA 5C5EA 3VNBA 1DC8A 3HS3A 3Q9SA 5F64A 3CLKA 1FFWA 3I45A 2FEWB 1EWVA 4ZMSA 3C97A 4IRXA 1C0EA 3RVSA
chains in the Genus database with same CATH superfamily
4X92A 4BE9A 1G2QA 3BFKA 2DUMA 2VPZA 4TZKA 3WDKA 5A4AA 3BJEA 2VWQA 1WMFA 4I1OA 3A1FA 3AILA 4EY8A 1XHFA 3TKYA 2QT9A 3K9GA 2G4LA 3KLMX 3Q5EA 4P0TA 1A9XB 4QGFA 3ZZ1A 4EHNA 1W44A 1RPNA 2Q3HA 3NXSA 2O8EB 2H16A 3E53A 4QELA 3GDOA 1HNWB 1UAYA 1NF9A 3KVNA 4OCZA 3T4EA 3PDUA 4DZTA 2Q07A 3FF4A 1EDEA 2PLAA 2VBIA 5CDFE 5EWMB 4OQFA 2Z1MA 4MQ6A 5LQUA 3MT7A 1YI1A 4O0LA 4RXTA 3OE5A 5I7RA 3IPYA 1JVBA 3O9ZA 3H9EO 1C4XA 3Q7TA 5D7BA 1Q91A 5DPMA 2WHPB 3ZXIA 2CV2A 3RRJA 2HRZA 2J1LA 1JF8A 3NM5A 1Z7WA 3FPLA 2YOGA 2W58A 3I2KA 2VPTA 2ZYAA 4EA7A 3IIJA 2OFOA 2A5GA 5G3ZA 1T0PA 2ZB4A 4U7GA 5B3JC 3MGKA 3ZE6A 1GKYA 3GCWA 3Q7PA 4HDNA 2X5NA 3ETEA 1G1AA 1TEHA 2J9RA 3UJNA 3VHXB 1M8KA 3O2JA 5BRAA 1S8OA 2WKPA 5D6NA 1M7HA 3ZWDA 4CGZA 2N47A 2Z6UA 4FSHA 4QBTA 2HHAA 3PVCA 4FQ8A 4F9FA 3K9NA 3QJ5A 4OHXA 4YRQA 3HFSA 3N8DA 1GV0A 4RLQA 3QTBA 2HAEA 2NNLD 5F1YA 4H3HB 3TL3A 4H7PA 2ZE6A 5KYWB 5GIOE 4LJKA 3WLSA 3CH7A 1P6UA 1AQNA 1H42A 3RFCA 1N57A 1RTTA 3WGTA 5HX7A 2ZBEA 3SJBA 2G07A 2BGJA 4UTPA 2ACEA 4XIGS 5A03A 4BO9A 2W6JD 4DRYA 5P21A 1J2TA 1FRVA 2G4VA 1I3MA 1R5BA 2R8XA 1JX6A 3HXLA 4N3BA 4RHTA 1UBMS 2Q5QA 4L9SA 1FNDA 2AL7A 3E9EA 5LQMA 5EUQB 4OKIA 3GLTA 1TA9A 2VUUA 3A32A 2VJPA 4GIBA 3PGA1 4QE3A 3QHQA 1Y98A 1KDYA 1ZGHA 4O3MA 3ZIDA 1KAMA 3OM9A 2JGKA 4HNHA 1Z3IX 2YL2A 2AI3A 2JFNA 3EC1A 2II6A 5FV7A 5CB6A 5ARCA 3U4HA 2DHEA 1FOEB 5DX8A 3EFOB 4WGFA 1OI2A 3LGAA 5JU6A 1FFAA 1ISMA 4PNHA 2RONA 4ZQFA 2QZ9A 1VI6A 3DOCA 5ICFA 3QHPA 4EDHA 4JDPA 4B6PA 2NWQA 3DPSA 1YMVA 4GHWA 3I04M 4TQUS 4EKEA 3I1YA 2BZSA 1IY9A 2K87A 2ZYVX 4IOJA 4Z8YA 1H8HD 5IAKA 1VKOA 1CB0A 4R3UC 1Z7BA 3FPFA 4KRXA 1ZNWA 4QXMA 4FS8A 1BX0A 2X14A 1HSOA 1BTOA 1RM5A 5FL7D 4RVSA 5CXSA 1KC1A 4XB6B 4CMHA 2RH9B 1MIOA 1TQ6A 3A6ZA 1A96A 4LZLA 3G8AA 3LPLA 1U3DA 5IDQA 1PNRA 4BRZA 1T25A 3LP5A 1WCV1 4LGCA 3RIGA 1YDFA 2ODQA 4OMUA 3BMNB 5B4UA 2BKVA 4EDFA 1P7VA 1X3SA 3IUQA 3SX2A 3U56A 1DV1A 4K9RA 4F56A 1CUZA 1YFZA 1LNQA 3AL2A 3OPYI 4LXYA 1KSJA 3C16C 4U2EA 2WB2A 1R9GA 2GRUA 2HCBA 3BXHA 2D00A 4NKRA 1EWQA 1E66A 1MFPA 4Y1RA 4KYUA 4ZOEA 4EGFA 2NX2A 5FI1B 3TJZA 2FR8A 2J3LA 3QY0A 5ALIA 4GYWA 2XWJI 3GT7A 4L02A 3K9HA 4M0PA 4UMDA 4GI1A 4BWYA 3QLTA 3UXHA 4Y2PA 4E7PA 1I5RA 1NKVA 3FOWA 3AT1A 1Y6JA 2A4KA 5EFOA 1Q77A 2VVTA 5AUPB 2I6SA 1EP3B 1KDOA 2X4DA 3OLYA 3P4XA 2K5UA 4ITVA 2B7LA 4KGXA 4G1UC 2O0KA 4G0MA 5EP1A 3RGGA 4DMRA 5A9SB 5B3AA 1RKQA 1WZNA 4BQRA 2FE4A 2I1WA 5DHRA 3GLRA 5IAAA 5CAEA 2CMGA 2GBIA 1IHYA 2Z43A 4ZOLA 2P8SA 2D4AA 5T4EA 1YAHA 4Q4JB 4DLXA 2A1TS 1FX1A 4D0SA 2VQDA 4XM0A 2O54A 5CX4A 1OTXA 3FKSD 4XKJA 3WZMA 4RWEA 3UAOA 1W5SA 1EA7A 4CLRB 5BOSB 5CITA 5AK3A 1PHPA 2P9GA 4MUKA 4PY2A 1NTRA 4LSMA 1J56A 1VLVA 1YZYA 2B7BA 4OJKA 2Y71A 5IDWA 3Q15C 5EC8A 1N2EA 5LYJA 2OXFA 3NNSA 3DONA 4UEJA 3PDIB 1D09A 1ZW6A 5JV5A 3FZEA 1J09A 2B4TO 2WAOA 1RLOA 4JCOA 3DMDA 4ND7A 4Y1RB 2J3MA 3M5DA 2O23A 1QKIA 1RT9A 2R79A 2VT3A 1NW6A 3DO8A 3GW8A 2HXYA 2F4VB 3STTA 3KKNA 3VJRA 1L0BA 2N46A 4JA0A 1AB6A 2Z2XA 1Z5VA 3MW8A 5KINB 4J0FA 4FR5A 4A2CA 4YRNA 3WBKA 3OIGA 3G0BA 3N7TA 1CUHA 1KH1A 1IN6A 1U28A 2XZPA 4QXQA 1UJNA 1B7GO 4JGIA 4HV4A 2W2NA 3H4TA 2QZSA 2FW6A 2G71A 4ENVA 3ZY2A 1THGA 1FYWA 4M60A 3H18A 5ITWA 5KTOA 2FPPA 1G8YA 3HO8A 1EG2A 3E35A 3ET4A 5DM2A 4JBYA 4KUGA 1WMEA 3VH3A 1E5LA 2FWRA 2OQ2A 3EG5A 1JSXA 3FTCA 1RXYA 1MJHA 1GADO 3A0UA 4IJVA 3NOQA 4DRZA 4BO0A 4RMGA 1NUSA 3LIIA 1WP9A 2XA1A 4EQZA 3KLNA 2D54A 4ZQCB 1GCOA 1QGAA 1VYUA 4C4XA 5GIPE 5COAA 2BM1A 4LHXA 1ZRMA 2Q8QA 3EXAA 3ZLBA 2YKGA 2BGMA 2H2HA 4C07A 3ON5A 2PKEA 1UPAA 3E03A 3D7KA 4RAOA 3OY7A 3H87A 2NZXA 3PFKA 3QEJA 1SULA 4FYPA 3ZGYA 4HX2A 4LJRA 4YDRA 4EVRA 3CF6R 4U7JA 3VR5A 2H1SA 3VH2A 2O1SA 1XSEA 3DLAA 3QUCA 4P93A 4E3WA 1OZHA 3ICQB 3EEOA 1NWCA 1PFYA 4RL4A 3UC5A 4E5KA 3ZU3A 5JMWA 4BLSA 2O8BB 4R8MA 3UICA 3OZEA 4J3JA 4C0XA 3WLEA 1M10A 1AF4A 2YJGA 4I99A 1QHIA 5ADHA 1NW9B 4WLEA 4BTEA 1EU1A 3O90A 2FMHA 1QR6A 3H9UA 5IKMA 2BFBA 1Z8HA 1XWFA 4EWLA 1G3IA 3AKZA 3A05A 3AEUA 1S2IA 4PC3A 4HVLA 2I3GA 3O6VA 4A36A 1DKOA 1I14A 3G0IA 3Q6IA 5BW4A 5FI3A 3X44A 4D6YA 3ZUPA 4QQFA 4MK4A 3NC1C 2FPSA 3P2MA 1DAKA 5SZJA 1UPBA 2VSXA 4ZVSA 5BUQA 4GOKA 3EJ6A 1P3JA 1A97A 1YGYA 3ICEA 4MAAA 2X4GA 1X9HA 2HA3A 3CT4A 4HBZA 4O08A 4XPZA 4EY4A 5KX5A 3AF0A 1X74A 5CDUA 1HFEL 4FJ1A 3MLAA 1IB6A 3UN1A 3E05A 2HA4A 4HYTA 3LI2A 3WK7A 2X5OA 1KS2A 4B3JA 1O94A 2C2ZA 3A3PA 1WW8A 3L8GA 4FYMA 3NVMB 5E1MA 2VDOB 2Y9PB 2VYCA 1N92A 3A0RB 3QPBA 1KOLA 1NG9A 3DKPA 3W4KA 2HEGA 4DC0A 4DILA 3IKTA 1RRVA 2NXWA 1QYWA 2MWMA 1V26A 4I4TA 1NI4A 3JAKB 5J1SB 4GOMD 4M38A 3PTZA 2HCFA 3N6XA 4ZC8A 1Q16A 4TVBA 3U3DA 2OHXA 1SCAA 1T24A 3VC7A 4PX3A 3VPGA 2RGBA 3R2JA 1KP2A 1LCIA 2JCXA 2PZJA 4M53A 2RHBA 4IH1A 4MVJG 3ZV3A 4CIXA 4D0NA 2ZM5A 4ZRMA 2YWDA 3JPYA 4JKOA 3T4XA 2G1JA 1FLNA 2H1WA 1HLFA 4BP1A 1C9NA 1ZY2A 2NU6A 3OIYA 4B3MB 3G8CA 4ARAA 1DBSA 5G3YA 5AI6A 2KX7A 2FPIA 3ZWYA 4OGWA 4MYDA 2EQAA 3M6WA 1NATA 2C1ZA 1Z2OX 4WK6A 3UPUA 2Z2KA 1TJ4A 3CINA 2JJ8A 1EK2A 4ZYYA 7MHTA 3SOZA 1UJ4A 3EGEA 3G49A 3I2FA 4X20B 2CD7A 3KM0A 1T2UA 2ZWMA 4PS1A 3PI7A 5KX5B 1WCIA 2VF5X 1T9BA 3B1VA 4Z4CA 1RJGA 4MVJF 1FP2A 5DI3B 1R6XA 2IOQA 3CRZA 1GFSA 1NAHA 3KB6A 4PRLA 2IFTA 3PUWA 2ZR8A 4HLNA 5EQJB 1CY0A 3IAM1 3CKKA 2BFCA 2QZPA 4Z0PA 2VWHA 3R0XA 2EFCB 4OHKA 3TTTA 1KO1A 1W96A 5AW9A 3SZ3A 4QD3A 3SM9A 4WLOA 5JO0A 4RTRA 1F8YA 3S7ZA 2H06A 1NR1A 3FG9A 3MVEA 2L82A 2QLNA 2YZMA 1H5NA 3ZQKA 2WF7A 2ZYGA 1KR5A 1KFCB 2ZI7A 1LI4A 2PZMA 3JQ9C 4UHBA 2R4TA 3W9SA 4EY6A 2HSWA 3BWMA 3FYSA 4PLVA 4Q19A 3W6PA 3T9EA 5KVVA 4LHYA 1AURA 1GAWA 1EJ2A 3M5PA 2IEBA 2Y0PA 2J9FA 4U9UA 1MT0A 1H8ED 1VTKA 3O9VA 2YRWA 1ZKDA 5HQ3A 2PR7A 1QGZA 3KWLA 3S1AB 3U48A 4OHWA 1X8JA 2MHCA 1NDQA 1NVVR 1WD5A 3PCTA 1AGXA 3P9CA 3ZHSA 2YQZA 4XJXA 4F4IA 1YOBA 2AF4C 3ZQJA 4LJSA 1JBEA 4RMJA 2H2DA 3FBTA 1V1JA 4XUEA 5ALDA 3WK4A 4DDVA 4J29A 3PQEA 2ODEA 3BULA 2PGIA 4PQFA 4UTZA 3WR5A 5F9HA 1V16A 1QUFA 4HWPA 4P98A 2AQKA 4WY2A 3T1VA 3TSWA 1OASA 1OV4A 3FNHA 4X6XA 5ECDA 4ZVKA 3IIMA 2IW1A 1KK0A 2ON6A 1HDOA 1NZFA 4R3WA 2JASA 5AYVA 2X0DA 4NMXB 6REQB 2VAWA 4M86A 2ZPAA 1K4YA 4NFSA 3ROXA 1W2GA 3SN6A 5EERA 3ENQA 4DCCA 1Q17A 2IHVA 1QOPB 4DJJA 4F5ZA 3J81k 4XVRA 3CZMA 4E2ZA 3U0VA 4ZAWA 5HUHA 2HBZA 1IOZA 4AULA 1RRGA 3K09C 1SUDA 3VPHA 2C94A 5BN4A 5KTMA 1V9SA 2MSNA 3GN2A 2G5PA 1QLJA 3DEHA 2LTAA 2MMCA 3U19A 4HR7A 1P5ZB 4KO8A 5DN6D 5MHTA 1G66A 2GF0A 4D4GA 1N5IA 2OP0A 3MFYA 4KKXB 1JFLA 1MN6A 3TSCA 1MD9A 1PI3A 4N40A 1AVTA 3EC2A 3GYBA 2YUTA 3PJFA 4C78A 4E12A 3WFJA 4KTVE 5H3CA 4LGVA 3THYA 3HO1A 2O2ZA 3C6KA 4OB8A 4IDGA 4PPYA 3PTLA 4EUEA 5K0JA 2W6CX 3OJOA 4JT9A 4YWHA 1DIHA 3DHWC 2D7JA 1T4GA 2FLWA 4MWZA 1SBZA 5C3MA 3HB4X 1I7SB 4NOMA 3C4VA 4DV3B 3TVTA 1W4RA 2NTNA 1U7OA 5DYWA 3K6SB 4FI3C 2CWDA 1U6JA 5BV2P 1FNMA 2NTYC 2Q1UA 3DGEC 1WAMA 4GMHA 3KSRA 2YXLA 3NHMA 4CF6A 1DV2A 1NRIA 1JPNA 2R66A 1V71A 2CVPA 4UUOA 1HH4A 1OGIA 3UQZA 3PICA 4G37A 5JQWA 1RQLA 5K0NA 4RGBA 1T6YA 2VNAA 2I1QA 2VH2A 5KWEA 2WU0A 3HEMA 3V1MA 4LJAA 2KWIA 3Q3HA 5ED0A 5F2OA 5DM60 2IPOA 3WKBA 1CRLA 4C9BA 2PA0A 3IQIX 4AIRA 4Z7NB 4FIZA 4ZOBA 3LCVB 2V58A 3U13A 1R9JA 5C3UA 1LF5A 2IZ7A 3NP9A 3TL6A 1QGUA 1CZLA 2J6IA 4L16A 1T2CA 5J5CA 3TQTA 2ID4A 5KREA 1CHDA 2AZTA 2ODBA 3HKCA 1YZUA 2R8EA 5JBQA 4YN3A 1U1DA 4M8NE 4FGLA 4XXHA 5ANRB 3EMKA 3UF0A 5CEFA 1G7SA 1E96A 2PV0A 3FOBA 3QJYA 1L4NA 3L5OA 4PC6A 1DG1G 5DNYB 4AP5A 5BQPA 1FF9A 1R9NA 1DC8A 4WH0A 5DNAA 5G4LA 3T61A 4I9UA 5L3SB 3K71B 3HP7A 1NW4A 4O4JB 2D1YA 1PR3A 3MUEA 1O95A 4EQ6A 3JWEA 3DVQX 4FJ0A 4JBGA 2XYVA 3O4FA 4DDMA 1Z2AA 1JLLA 3RASA 3CVVA 1YR6A 4FMCB 2B30A 5DJ5A 1IWPB 3BEOA 1GNSA 5IARA 3WB1A 2J3KA 3LRPA 5TPWB 3NX4A 4BVEA 1LQ2A 3AV3A 3SQDA 4YAFA 4MCAA 1N78A 4TLEA 1XZIA 2D7CA 5IP5A 3UGJA 3D5TA 2NUAB 2IF2A 2EBWA 4EARA 1AGYA 2HK6A 2J7PA 3LNCA 5ALRA 3UJ3X 3VGJA 4N0DA 4EF6A 4MNTA 4HLUA 1OIVA 4TVOA 5DTQA 1Z34A 1J8VA 3C8HA 2O3UA 2YHAA 4GNRA 4M0CA 4B85A 4JK3A 3KEGA 1V7CA 1Z7YA 5F2KA 1QQTA 3DD5A 4AB1A 2GCOB 2IK8A 3LD9A 3NBXX 1AOXA 4C0BA 1A5BB 1U1EA 2VRCD 4OMFG 1XMXA 4HH1A 5K4AA 3QVMA 4HEA1 1WMDA 4F4JA 2ZJ1A 2ECOA 2VDWB 2YZGA 4V1CA 3DLHA 3L7MA 1D2AA 3O74A 3K0HA 4QODA 3U80A 1R6UA 3NVAA 4MEJA 1N9GB 1DBWA 2W6QA 2F67A 3BQMB 2C03A 4ZQEA 1G20E 4BLVA 4LBYA 5C1PA 5T7BA 1VBMA 2Q0HA 3S99A 5IJZA 3LBYA 4GRAA 1ECGA 1P1BA 1U1GA 1O4WA 5JECA 2R4UA 3DZFA 2YIDA 5E3IA 4BMVA 1B6RA 4B74A 1DRUA 4WACA 3WNDA 5KC8A 4R5HA 1OAKA 4ND8B 1N5DA 4R05A 3W5DA 2XIJA 3B5EA 3L3BA 5GV8A 1FFYA 2JHPA 2HL6A 1YO6A 3GFFA 4AKTA 1TTHA 2W2LA 5FBWB 5E1DA 2JLYA 1GP2A 3N74A 2NUAA 5L3VA 1LDYA 4J2HA 1C3VA 2C5HA 4QLAA 3KEQA 1H1LB 1QAQA 2ZETA 1LLUA 3M1LA 5GVSA 4P3KA 2ID9A 2GXSA 3DS8A 1H6DA 2QSZA 1VE5A 2V7XA 2ZBVA 3K35A 3KG2A 5EP2A 4C0HA 1WXIA 1M34A 3JQCA 5FOQA 3HWWA 2J0EA 4IO0A 4MINA 5CNIA 4ZVRA 4QYMA 3DC7A 1N6LA 2OFXA 1XQVA 2VCYA 3BILA 4C2AA 4JA2A 4TRNA 1P0FA 2OGUA 5AW8A 5JDIC 2F3PA 3N2YA 1RYZA 3L7BA 4LRXA 1ZNZA 2LDBA 1E32A 1F38A 3EDMA 3N0XA 4UBNA 2O1EA 5K8IA 3VHRA 4EABA 2A1UA 1E2QA 1BCSA 4YAJA 4EFMA 3RV3A 2QU7A 1U2GA 4F9EA 3NNNA 1MUUA 1SWWA 5CB4A 3DMTA 1NT2A 1EGAA 4I5DA 2O7NA 2ZXFA 3E7XA 5CJPA 4C4AA 1E2GA 2AGVA 3KBBA 3RCBA 4BVGA 5ITSA 2GTIA 5LNK6 1G3QA 1CY1A 5HKOA 3Q5DA 3UJAA 3HR4A 3LCUA 4P54A 4UEOA 2E4YA 3QH4A 5B2FA 1G5HA 3LE8A 4ENQA 4Z7OB 2Q1SA 4OHCA 4UEWA 1NHWA 2IL1A 1P0MA 3ITEA 5AK5A 5E9JA 5EZYA 4YCCA 4E4TA 4ZZ1A 3THYB 2D1SA 3PFNA 4Q48A 4WZAE 5EHIA 5EZ5A 1BCRB 4YJHB 4NYJQ 2QORA 5CGQB 3LUAA 1AGPA 2FPLA 2ACKA 5C1DA 4E2XA 1DX9A 1QYVA 2HI0A 1Z2DA 4WJZA 1S8NA 1W94A 3IT1A 4TXJA 5E4YA 3E8XA 2JRLA 3D5QA 5D86A 5FTNA 2UVPA 1BHJA 3SHFA 2GCIA 8ADHA 1ND6A 1TTTA 2GO7A 2GRJA 1ZCZA 3BHMA 3PE6A 4NARA 2B21A 4QIHA 5LOVB 4OBXA 3NPAA 3IEKA 3TECE 2H57A 5IZ4A 1SXJA 4PSUA 5IS2A 2KE5A 3I30X 1E94E 3W1VA 2OCYC 3A3YA 3OMLA 5CCDA 3T9CA 3LDAA 4ERNA 1YBFA 3ZLJA 3M70A 3B1JA 2XODA 3WWEA 4OYLA 5K05A 1OZFA 2RGNA 4RCZA 3EY4A 4QICA 1NNLA 2VYND 2WZQA 4GSLA 2CCKA 1B41A 5CVDA 4ZCIA 5LMUB 3JVVA 1KAOA 1WXFA 5JYDA 3ER8A 2OG2A 3IDQA 1P3DA 3FFTA 3ANLA 4CM9D 2WVGA 3KB2A 1P29A 4MWGA 1FFXB 2PD3A 2XMSA 1N6PA 3WO0A 4AQYB 1NT4A 4Y6PA 4TMYA 1Y3CE 4AYXA 3N05A 3Q0TA 2KI5A 2VNKA 3EXIA 1OROA 3W79A 1NRJB 2IIVA 3DMFA 4LZJA 1OAOC 1R9MA 2A5YB 2B0CA 3ORHA 4CMBA 4MS3A 2DOKA 4O63O 3SE0A 2XMQA 5IVIA 4D8WA 4ARBA 3HC7A 4I1RA 5LIPA 1W36C 5E4JA 3PF9A 1KDVA 2WPNA 2LE0A 3UMGA 4OGGA 2O6LA 3IVCA 3QRWA 2J3DA 4XFKA 5A06A 3KD2A 3RBVA 1LJLA 3CN7A 1JIJA 4MUAA 1USVA 2A88A 3C7CB 4QFBA 4RKWA 4DMFA 4RJJA 4YR7A 5LOVA 1EXMA 2DUWA 1XJWA 3DNMA 4XYEA 4B46A 2BPOA 3QPCA 4QBFA 2BKAA 4C14A 3ZHVA 3DJFA 4E2FA 1G18A 1WXGA 2BFEB 3U39A 2HNKA 5HOQA 4O1MA 4Z9BA 3FGPA 2V0CA 1KMNA 2AYYA 4GBJA 2WM8A 4KMSA 4PO1A 3FSGA 3GJXC 3B51X 4FFWA 5IAEA 4C88A 4NAVA 1O9BA 3V97A 4R0VA 4RE6A 3UANA 2Y76A 4JP1A 4UTNA 1T3SA 1Z28A 3RS2A 1RM0A 5IMSA 3G6WA 4BKQA 3QPUA 2FZVA 2JIOA 3U3ZA 6CHYA 2GKSA 3A1WA 3F6PA 2EJBA 3EYAA 4FOSA 4CCAA 3PNKA 1G19A 1H69A 5EMNA 4CMEC 4L73A 3ZDBA 1JYEA 2Y66A 3LUKA 1P61B 4OBEA 4S35A 1TZKA 5EJIA 3ZBPA 5KTRA 1D0SA 2ZIFA 4FYYA 5EEGA 4GOXA 4ECEA 3P2YA 4X60A 5ICGA 5DNUA 3KKZA 3QU2A 4IVNA 4BFXA 2AE2A 2F62A 4LX0A 4PG7A 2O8FA 1H5QA 2BSXA 3T3DA 4AMVA 3V7NA 3GLIB 1WB4A 1YQGA 1HO3A 1TK3A 2LXNA 4RA9A 4HP8A 4QDTA 1FRFS 221PA 1OVGA 1SBHA 3OJCA 4LQLA 4QVGA 4FYXA 4YI3A 5EJ2A 3RARA 5HGXA 4KFCA 1FFGA 3M6MD 1XXHA 3RK0A 1RRMA 4IDEA 4K5QA 1NPDA 1DC3A 4JJZA 4QXPA 2DHDA 3MS2A 2ZB8A 3PI6A 5JVDA 3SD7A 1JPJA 4YLYA 1JHXA 4HNQA 1XP8A 1H1LA 4NRDA 2VT6A 3NTUA 4XWYA 5LXTF 3SJAA 1KOGA 3AL0C 1NL3A 4KFUA 2D3WA 5HCUA 5B37A 1S02A 1YZGA 2H4HA 3B60A 3ITKA 4XB2A 1AMOA 2ZSEA 2CV1A 3LTNC 5MGBA 4CT4B 4PRYA 5EQDA 3MERA 1T9AA 4IO1A 1NBHA 3N2LA 4X1OA 4B4WA 5H1YA 2KBFA 1KIMA 4JT2A 3ZD7A 3HMKA 1SOMA 4N47A 4PINA 3AESB 3UGTA 4CEIA 1Q0SA 1CZOA 4WBXC 2MSEB 4ZARA 1L5SA 1WJGA 3BVPA 2VH5R 4RKRA 1SXQA 3ZWQA 2CYCA 4AJOA 3R6LA 3GAZA 4PIMA 5AH0A 4WASA 5IVDA 4ILEA 3C3JA 4QG7A 4YRCA 3GARA 4R7GA 2R5WA 1Z4KA 3OF2A 4I1PA 1RWPA 1B6SA 1HTBA 4MVJH 2Q5FA 1YE3A 3PBKA 3U62A 4U2KA 1IZYA 1IRXA 1DBRA 5HILA 1OFHA 3UHPA 2AG0A 2UXDB 2FLVA 4RA9B 4G9BA 2EWMA 3R23A 2ZRNA 4IMRA 4YJDA 3NWJA 3O8LA 5PGMA 4OHBA 4DSTA 2VDKB 4DJTA 4F5DA 1JSLA 4B4UA 1NQAO 5DF1A 2F6RA 5BN3A 3EGXB 3BEDA 3FZYA 3L2OB 4J6FA 3V4SA 3O95A 5D00A 4YJGA 3MMSA 1A76A 2XOKA 5K20A 4DR7B 3U26A 3P8ZA 2RHLA 3OTHA 1XJQA 4MW6A 3WYCA 2C5FA 4UQOA 1KPIA 2IYRA 1RQ7A 4G1FA 4YJ2F 4E07A 2ZUCA 4XGNA 3DD1A 5BORA 4JBIA 4QUJA 2L0XA 2XCRB 3KQLA 5C7LO 4X97A 5F3RA 3SJZA 2EKPA 5B1DA 3KYCA 2EJUA 4ASUA 5K4GA 2E48A 2QRNA 5GMOA 4H6WA 4N76A 2NZVG 3L5KA 3M49A 5DT2A 3IPRA 2SCUA 2WJHA 3H2BA 4RQAA 3AF1A 2FWIA 2G09A 5JYCA 5A9TA 3DWFA 4YJFB 3TW8A 3M9WA 1DXYA 1QG2A 1ZMOA 3OCUA 4MUYA 2HC9A 4JLWA 4ZAXA 3IJRA 3I6ZA 2ANBA 4MYCA 4HNSA 1IAVA 3AV0B 1CETA 3R74A 2Z6VA 2GCGA 4J7XA 2CCJA 2J4FA 4AJLA 1HOXA 1S5PA 4A8JC 3M82A 2B4QA 1KGDA 5DCUA 2Q4RA 1X7YB 2RAVA 2Q3FA 2VHWA 3I0MA 2VDWA 3Q7IA 4HAWA 4V1CB 1A3CA 2BF7A 4MWBA 4D9CA 1ZVVA 1Y81A 5FOSA 1M1NB 2AR7A 3C3WA 5LUBA 3KVRA 2EAUA 4QECA 3X2FA 5KTKA 1JTEA 3OE1A 1BOOA 4Q34A 1OUMA 4FBLA 1M72A 1ZNYA 4BBJA 1O96A 1EFCA 4DUYB 1QFSA 3AONB 1EVEA 3IP8A 4EKGA 2OHFA 2YRFA 4HC4A 1B14A 3VHQA 1QBKC 3R7AA 1MO4A 1V9CA 2C9DA 1YJAA 2DKFA 3P0IA 4UUNA 1AU9A 2JI4A 4HDOB 4U9IS 5J58A 3RYCB 1JA1A 3PNMA 4EYGA 2ERXA 4FHCA 3O8NA 4MW2A 3OP1A 3KCQA 5KYYB 1JG6A 1YU6A 3VR4H 2I91A 4C6TB 4FFDA 2V1UA 3AFNA 3TXYA 2OHOA 1XCLA 2DB3A 2AC4A 1PUIA 4Y1GA 1P1CA 4WBNA 1HDEA 3GJTA 1UQTA 1PEAA 4XWAA 4NDNE 4MJ7A 4RIFA 4C06A 1EGHA 3TLKA 5KB3A 4QM7A 2XDAA 3FH0A 2NZYA 4G9GA 3OCVA 3WADA 2O05A 1ZUIA 2QL9A 1QO7A 5ES3A 3T7EA 2G40A 5DM1A 4IRMA 4F11A 4QOFA 3T3EA 5EIBC 3QFSA 4M7WA 5H5JA 3KU1A 1KI2A 3MRSA 4N12A 4Q1VA 2JS7A 4DBLC 5KZMB 3UK6A 5KNCA 3VGPA 4FHGA 1XAIA 2Y1OA 1FNNA 3QMWA 1K4KA 4GKVA 2QMQA 4J1TC 2AEMA 5AVZA 4JEIA 3PQ7A 4QJ4A 5IJXA 4UUAA 4HB2A 2FEOA 4FT2A 2VATA 5ECGC 4V2IA 3ZV7A 2WMDA 2WKQA 2ES4A 1SZPA 2IX9A 3REQA 2QMYA 3ED5A 2GD1O 1VMAA 4ID3A 3SKXA 1WB5A 5HQJA 2YMQA 4M36A 1P2UA 4Z5XA 1QMGA 1CULC 3OM0A 4AN1A 3OPNA 4BZWA 1L8QA 2WICA 3OKAA 2AJDA 1GPH1 3FYUA 2ZRAA 4QU5A 5A6SB 4G86A 3A3KA 1FW6A 3UIEA 1NSYA 1WPXA 4M54A 1N6NA 4DVGA 5K9ZA 2Z95A 5IRCD 1VGRA 3LLCA 1E9CA 1SHKA 1Y3IA 2GJ8A 1D7AA 3MWJA 1LTKA 1RW4A 3CUSA 4EA8A 1RKXA 1MLDA 2C0PA 3BJMA 3QNWA 4X7RA 2EGHA 3DHEA 3DZKA 1FYFA 4OATA 5KVSA 3CLUD 1IXZA 3IA7A 2HSJA 2V4UA 2W0SA 1AKYA 3VSDA 4DB2A 2Q99A 5K3SA 2Q6KA 2RHOA 2XMGA 4TS9A 3TFWA 2OCGA 1MA3A 3ER6A 4RPIA 2IU0A 3V2UA 1P2VA 1L9KA 5CIYA 3M8KA 2P90A 3BGOS 2WNIA 3RFUA 1EM6A 2PKQO 5D01A 3MF4A 1KVQA 3MIZA 4BP8A 5LBTA 4AUKA 5KU1A 1IZ7A 3CNBA 3EYWA 1FDVA 4PTLA 4X24A 5FBZA 3VKFA 4BWGA 2AN9A 1R4NB 4C7VA 2Q8PA 3CH6A 2QNRA 1Z5GA 3A1EA 1OF1A 5LB4A 4CKYA 4CR8A 5C35A 3EGXA 4X1KA 4ZCMA 3EGOA 1QZTA 3GL9A 4IKEA 5KQSA 4XCQA 5CDHA 2WWRA 3GEIA 3PG5A 3KLPX 5LKRA 4HSEA 5BNIA 2DQKA 1RU3A 1WZEA 2F9MA 3L79A 3QU4A 3PRYA 4M1OA 4BNGA 2GF2A 1YS4A 5DHUA 2WHXA 3R4CA 2Z3ZA 2XVZA 4EA6A 4D3DA 4D9MA 3WGYA 2VSYA 4PR3A 3L06A 3R3ZA 3T3OA 2P78A 3LHKA 1JT9A 3SZUA 4E94A 4MGEA 1X1DA 1T35A 1YQUA 2YJ4A 4GE0A 2HK8A 4HCJA 1V48A 3G5UA 3ND7A 4LQ4A 1OT5A 2AFIE 3A2KA 4ZAZA 1P9NA 1KE2A 2Q3LA 2XUKA 3K05A 3N2KB 4YRAA 1S4MA 3RT7A 2DPLA 4FWIB 3TO5A 4YV7A 4ND1A 4RYDA 1LWNA 2JLRA 4MJXA 3E23A 3ZC3A 3OICA 4ZCRA 3BMCB 1FMLA 4B7AA 2VDPB 1RJWA 3PJDA 2VP0A 4L7QA 3I61A 1HT0A 5EHXA 1XQXA 1ZW1A 2IV2X 3EOBI 1GHTA 3HYTA 3U6KA 2CMFA 1RR6A 3KQVA 5CDYA 1STOA 5SZKB 3RT1A 5K0TA 1T8RA 1BDMA 2X8BA 1U7PA 3CX7A 3D1VA 3H2KA 3PPYA 1GR1A 3DV0A 4YUAA 4TROA 5C9ZA 3JWJA 4NHOA 1E9SA 5TQ2A 1T1EA 3QM1A 1PR5A 5B58T 5LC1A 3SQNA 3TLYA 1COWD 3UJBA 5CDSA 5DWDA 2A30A 3REFA 3GEPA 1Q1ZA 5HJ7A 3A9CA 1C7QA 2EGGA 3HB1A 3VOBA 4A8PA 2P9CA 4BP9A 3H9JA 4ZO4A 1LDBA 2DPYA 3FGZA 3GLIA 3G0HA 4URVR 5ICMA 1VFNA 2Y99A 3K20A 5J2UF 5HE8A 1C9JA 2EIXA 4LI3X 4LRYA 3UT0A 1V41E 2IPMA 1IXSB 3WRVA 3GBSA 2BBWA 3ASYA 3A9WA 3GDFA 1WUKS 4RVNA 3W77A 1L5HB 3Q7SA 4HRAA 5JNWA 1PBTA 1SKYB 1EINA 5F2EA 3KV3O 2CFCA 3ZCVA 1W1IA 1JLRA 3IDAA 1WS6A 1ZISA 2FR0A 4QUHA 2JI8A 3UAYA 1RDFA 4LXIA 5MFZA 2J45A 1B1CA 2XMZA 5IEBA 3GUHA 2A0WA 4B6OA 5K3AA 4DCSA 1PVDA 3QKRB 2BE9A 5E0KB 2VHQA 1KKLA 2QVXX 4BWVA 4R8KA 4YRTA 1DAGA 3CJQA 5TARA 2ZBRA 4YPFA 3KVOA 3SI7A 3MTDA 1ZM4A 3SS9X 2HDWA 4FFVA 4GPD1 5JT1A 1N8NA 1UF9A 5H81A 1WULS 2CHUA 4Y2JA 4U7HA 5T5QA 1IUKA 4CU5A 4EJSA 3IO5A 3AVYA 5BQ5A 4XLLA 1Z0AA 1Y42X 2Q1YA 4BE4A 1FMJA 3DWIA 2JJ1A 4MUBA 4DHEA 5I7OA 1DC4A 2JATA 1QAOA 4LDRA 3S3TA 1Y63A 4EMSA 3N7AA 3QP9A 4I1UA 2PE5A 2L2QA 3L4KA 1GR0A 3WMRA 1WPQA 1U9IC 2GBFA 3CISA 4WKCA 1OU0A 3H5RA 5JQGF 1L7NA 1NUAA 4L08A 3OX1A 4A6DA 5ERYA 2OGWA 3H99A 3THOA 3FNBA 1ADJA 2Z5LA 4PYKA 1P2TA 1SFRA 3QG5A 3RT9A 1QRUA 4C5BA 3RSQA 5IYZA 4FGJA 2GZ2A 2D0PB 3T41A 1JU3A 4AY6A 1M2OB 4KH1A 1GN9A 2YVUA 3FYUB 4IJKA 4J4TA 1KQ3A 4JI3B 1BDJA 1DO0A 2NO5A 2J6HA 2XJ4A 1JR3D 2XQVA 4PLPA 3IEIA 3SS8A 4BGEA 3G0CA 4AY2A 2HPAA 3T5BA 1IZ0A 4GSYA 4KAXA 3IAEA 4MQUA 4RC9A 2RAPA 5ESWA 1ONBA 3B9BA 4GPEA 4CQLB 1OC2A 1P19A 1C1HA 1GRCA 1P44A 3TQOA 1FUKA 3WHIA 5TR9A 3F9CA 3BSFA 3OE4A 3B20A 3K96A 1GTSA 2JVKA 2R6AA 4M99A 4AECA 4BQNA 2JAHA 5LU9A 4LF8B 4WZBE 4IJ5A 1JQ5A 3H6GA 3P27A 2DULA 4X95A 3K2BA 4AJNA 1XEXA 5HWSA 4MYUA 4NR0A 2Q49A 5DOVA 2BEJA 2HQ1A 3HI4A 2FMUA 4IWNA 4MV1A 3F6SA 1E2BA 1YBHA 1NVFA 5D87A 3EZ6A 3S29A 3W05A 4RJTA 4EHIA 4C4SA 1XDSA 3CF4G 2R25B 2RH4A 3IVGA 4LXUA 3RJMA 1YIOA 3EBPA 3WGQA 4QZVA 4L4RA 4Q4HA 4JXZA 4CIAA 1M2NA 3GHHA 4MWEA 1MDFA 1UBTS 2QXTA 1JWBB 2C82A 2JDIA 2JKYA 2OWEA 2C2KA 1X7DA 1JUDA 1XK6A 2RAFA 2VA8A 3D8HA 3O93A 4I81A 4NZZA 3G9ZA 4UHJA 3ZIAD 1E1NA 1E1CA 1Z36A 5FXMA 3GRCA 1GZ7A 3WL3A 1W25A 1P7YA 1CYEA 4HFRA 1WUYA 2H7YA 1A5AB 4TLCA 1CFJA 3RNLA 1PYOA 3FSEA 2VDQB 2HY7A 4BGUA 1NN5A 2J9GA 1F6WA 4MV8A 1ISRA 1PZXA 3RJ9A 4KLCA 1R88A 2B1RA 1QRTA 1U7TA 1X7XB 2RGGA 3B82A 3B1FA 3EAGA 1E2KA 2JH8A 3LPCA 5DCLA 3W2EA 4B3HA 4LHWA 4BX9A 3ILVA 1PJLA 1PVVA 5C4GB 4QT4A 1BZYA 5DFAA 4ZHQB 1ST3A 5JD5A 3MAAC 1VIDA 2JGDA 4BNLA 4EBBA 1OWNA 3ZZNA 2ZW9A 1F8UA 4L5AA 3PCXA 3RVBA 4QDOA 4JOSA 3OEED 2IXDA 4URZR 4ACBA 1WXHA 3FGOA 4PM4A 3PFGA 3LLUA 1W0CA 3HDQA 3G2PA 1DPFA 4AYTA 3LLMA 1KBZA 4LN1A 3UQYS 3B1WA 4DIUA 3FETA 3C5HA 4RZ2A 2XQKA 4KPUA 2EZTA 1NC1A 1FSGA 1JFRA 1TD1A 4RD1A 3ZI7A 4DDWA 2BGUA 1LBEA 4IZIA 4MRSA 4QXOA 5GJCA 2FUCA 4QU9A 3HDTA 3WMWA 3ZVRA 2P2ZA 4OP1A 1OFUX 4OP2A 3SF0A 5DN6A 1P9OA 4DSUA 2F17A 2PSJA 5HM6A 5TB5A 2Z8ZA 4WXHA 5DW3A 5BT9A 1Q0ZA 3CWZA 1E1CB 3LPMA 5DHTA 3WP1B 1N7GA 4AG6A 3D6NB 4MW1A 2PS3A 1IOWA 5IDVA 2ZJOA 3BX1A 3C6MA 2FRVA 1ZCJA 1GT91 3GXBA 3JAWA 4GP6A 3HRHA 4KQXA 4QTXA 2B8TA 1M2VA 5D85A 5EP4A 2FE1A 3LSTA 4J1SA 3AB7A 5ALWA 4DLPA 4ZTZB 2WIBA 3UXYA 4IOKA 1YZHA 2PLRA 1EUQA 1KSFX 1IPHA 2OT3B 3RRFA 5GQSA 4OKNA 3G5LA 1U9ZA 2Z2JA 1BWRA 2OV2A 4Q24A 2O5EA 4RVDA 2C84A 1E0JA 2P0EA 1R4MA 4LHZA 3O2SB 6NULA 3AKEA 1TUBB 1X7GA 3QVVA 2V5UA 1GL6A 1P5HA 4WFJA 2GYUA 5JMPA 4U63A 4D42A 1QKKA 1Q44A 1R8YA 2BJHA 4FW8A 5AO9A 4QGSA 4XUDA 4J75A 1QWSA 4WNCA 3TTSA 4I50A 2ORVA 5JXIA 4TRJA 2VJNA 5AW4A 1U8YA 1CZUA 2HK7A 4GSKA 4QWWA 4UCQA 1TYDE 5J63A 4ZI3A 2XMCA 2ZFUA 5JSZA 3BTVA 4HNAB 4XRRA 3WGOA 4MULA 6Q21A 2WF8A 3PEVA 2OVFA 4WOKA 2FWBA 4OTZA 4DLTA 1M2FA 1P33A 4KN8A 1J0DA 1M1XB 4P92A 4ZV7A 4S2EA 4EJSB 5A5FA 2GVDC 5LA6A 2D1TA 3H5IA 4GI3A 4UBJA 1I0ZA 4KWTA 3CY6A 1I1HA 4TQGA 3AR8A 4H08A 4Q9NA 4WI1A 2H6EA 1VYTA 2FK8A 3LT0A 1E5XA 1LLFA 4D57A 5DVZA 1OXVA 3ABZA 4Q9IA 1DNPA 1PF7E 1RAAA 5DWQA 2FN3A 3PT5A 3GEEA 3R0VA 1PW5A 4DG9A 4MRMB 5DIZA 1I51A 3TLGB 1GSIA 2BFAA 3T7DA 4PPQA 1QV9A 1QVAA 4I4TF 4G01B 4Z9FA 3NEYA 4IDQA 4RSHA 2XUAA 2UUPA 2C7PA 1F14A 4M2LA 4PE5B 1ND5A 2XR1A 3DLIA 3MJTA 3RSLA 1W4BA 4GO1A 1K06A 1MJGA 1KMQA 1XFDA 3L0PA 4OFWA 1AKUA 4GXNA 3M6AA 2D8MA 1V43A 3RO7A 3E7PA 1R16A 3EFEA 1PFWA 3QW2A 4O5OA 2CV0A 1YRAA 1CIVA 2I87A 3SC2B 1F0NA 3FPGA 4ND3A 1ZD1A 1RABA 2PYZA 3AXTA 3G5TA 3IAUA 1H05A 4RDIA 1F5SA 4K88A 4JUBA 1QFZA 3CV3A 1NNI1 3BWCA 4PSCA 3O9MA 3L1JA 3VTFA 4M7PA 4AWAA 3HUFA 3LNTA 4JJ7A 3AGPA 4ZDKA 2J0UB 1P2GA 4BATA 4TZ6A 3ET5A 3QXJA 3J7AC 3BC1A 3PDIA 1SQ5A 3R3XA 1IFXA 5FOTA 2YWBA 3R5HA 3E0QA 2G25A 3ZKWA 3H97A 5FUYA 4MVJA 3CNQS 3MS7A 3VNVA 4C0WA 4URXR 3QOYA 4BGDA 4KVZA 2YY5A 1JB9A 1T6XA 2O2EA 1I94B 2BBOA 4NXNB 2PRKA 3NHPA 1ACJA 3WK9A 4CM6A 5LYJF 2GCEA 1W93A 4O25A 5LZ5A 3UOWA 3EVZA 3NRBA 3PC2A 1VGQA 4GX1A 1Z6GA 3DL7A 2I4MA 4M55A 1NMEA 2BONA 4PGGA 3ZY5A 3JQ8B 1N0HA 4O02B 4D46A 3VKHA 3UAZA 3A37A 1KJYA 2E4ZA 3GFQA 2OFFA 3K6JA 4R2XA 3QGMA 4C76A 3IILA 2IE8A 4C2TA 4K9OA 3MCAA 3R3HA 4FC7A 4W1RA 4OJYA 4X9XA 3ZGVA 2F2TA 4W6QA 4IEIA 4LXQA 3CPEA 3HHPA 2EFEB 4BE7B 1N0WA 1NMZA 2QTWB 4JMLA 5F5LA 2HJRA 5KOHA 4K9SA 4IF6A 4RAQA 3RFTA 1Q7EA 4MYHA 3VA7A 4DV4B 2VT7A 2IPAB 4JY7A 5JSYA 1XWIA 5K0CA 2DC1A 3F49S 1HEIA 1S3FA 5JCJA 3L4EA 2WQZA 1NBEA 5LR6A 3EHEA 4YRBA 1LSUA 2O3RA 3O4HA 5TVGA 2NU7B 4MZDA 3PC4A 1NLZA 2A0UA 3PC8C 2VG8A 3L6BA 2CJWA 3C85A 3O4IA 3ZCXA 4QBGB 4RY8A 5GWXA 2GA8A 1GGVA 2JI7A 4CLRA 4Z9XA 1Q7GA 3WKEA 3S1SA 3DPUA 1KMMA 1RZVA 4HTAA 5FUVA 4P86A 1WDMA 2JIRA 4BB0A 1JIIA 3I6BA 3IUSA 4OQ4A 1RD4A 2H52A 5ESXA 3OQMA 4TLAA 1YC2A 4A0RA 3COZA 1MX9A 1KTVA 2C3YA 3IFSA 1OZAA 2O48X 3KEMA 3K5IA 1ZK4A 4TWZA 4HF7A 3ZYZA 1FXSA 4EW6A 4WJLA 5C80A 3ABRB 3EZGA 4REMA 4JI4B 1ZPDA 4WFKA 1WO8A 3PNVA 4RCVA 2WV9A 4KBFA 3FSRA 5THQA 1F48A 4LS3A 5CT9A 4JNCA 3OPMA 4MLDA 3F67A 4F7WA 3JQAA 1ISHA 3L8DA 4QPPA 5HZMA 1JH9A 3UK0A 3NVKI 2NV0A 2NSYA 2ZJ7A 1NWHA 4IUBS 2Z2IA 3LCJA 1XCJA 1AMNA 2VJMA 1TJYA 1TX4B 1MO3A 3HPQA 1EVKA 4F9TA 1G5FA 2BEKA 5BRJA 1XAJA 3NWPA 4MYRA 4UAGA 4R0MA 1UFRA 3NCTA 3C39A 4G4GA 3U7JA 5KVCA 3VO1A 1QM5A 1D2EA 1DEHA 3G3EA 3O03A 3PUXA 4P1ZA 1GILA 4ZKEA 4ANFA 2QTRA 2ZRCA 3DM5A 3EARA 3A3NA 4GZ5A 4NQZA 4BFUA 2F7SA 2JLCA 3AP2A 2Z3WA 4KFSA 4O4IB 3TSYA 4OHOA 5ENZA 5TDHA 5D3KA 3T0IA 1RAFA 1X0VA 4HQ0A 3ZNQA 1XZHA 2LZ0A 1ZD2P 1XVLA 4MOWA 5FBKA 4A91A 1YQEA 2WLSA 4JCCA 4D41A 4E4RA 1P2DA 4YUWA 1HQCA 3QUQA 2OKGA 3P2OA 2F9FA 2TS1A 3C3BA 4DA8A 1TU4A 3UA3A 2X6QA 2EJCA 2FP4A 3JXEA 4G5SA 1W36D 3P19A 3AUXA 1UKYA 5F7JA 1SCDA 3FWKA 2F64A 2WIDA 5I9BA 1KWKA 1IMOA 1FS6A 3G2IA 1Z4PX 2QRKA 2PWYA 2ZQZA 3DAYA 3QG1A 3WYGA 1U6KA 2D5IA 1YRLA 4JUDX 3ZIUA 1DXHA 1DMRA 2P62A 4WCFA 2OE2A 1QCCA 4BLQA 4BEJA 1E5QA 3LHFA 1P4JA 2QM0A 2WP0A 3VNRA 1N32B 3O84A 3K5PA 1TZCA 2FWMX 4CMGA 5CDGA 5CT5A 4ESVA 3UWMA 2FMIA 3HCNA 4B3TB 5DBFA 3ZD6A 5FPPA 4U0JA 4YAOA 3WIVA 4QPDA 3BKWA 2GEUA 1DHTA 1KY3A 4B3IA 1FCJA 3MD0A 5DHFA 2AFRA 3LW8A 1VCNA 3OZUA 3SHTA 4EHLA 1SKAA 2WUDA 4Q3NA 2BRUC 4YJGB 1QANA 2JFWA 3KDPA 4FONA 4GZ3A 3DZ8A 5EESA 4DIDA 1W73A 2P2NA 4PSAA 3X3HA 1G8PA 4IXNA 4BQSA 1U2DA 5EZSA 5K6AA 3S68A 1LV7A 4KEAA 1LC3A 1NR7A 1SC1A 5EWMA 2FI1A 2ZPUA 5MN6A 1C1XA 4LA4A 4I08A 5ICCA 3WHKA 1VA5A 1T5SA 1IJEA 2DHRA 1GUAA 2IXFA 3WQSB 1M6VB 1J20A 4RHCA 3PE4A 5K3FB 3IOYA 3FUCA 4DT1B 4PCVA 2WWIA 5REQB 3RE1A 3N87A 3WB0A 2G17A 4D2IA 1Q1AA 1SQ6A 2QY6A 2UZIR 4NBTA 4TV8A 4UHKA 4AIIA 4HS9A 3LUGA 1INLA 1D6SA 2F90A 4JB3A 2P3QA 2HJHA 3BL8A 1WCWA 3HKBA 5AR1A 2EEPA 4DEYA 1PVOA 1T3HA 2FSHA 2QL6A 2REQB 3QTTA 4XYMA 3VUFA 4G4IA 4GG1A 2YW2A 4Q82A 3L6DA 3UFXA 3HJFA 3D8BA 4CFZA 4PS0A 1A82A 3ILHA 4W5TA 2ERYA 1RI1A 5FPYA 3S7TA 4B4DA 1HYHA 2OV8A 2V6MA 1Y7IA 3A1NA 2NXJA 2PMKA 4IHAA 1APBA 3HG7A 3C3YA 3UKDA 3VYWA 2IS1A 1YDEA 1CUGA 2OORC 3DLCA 4YGYA 3UENA 1S89A 4ND8A 5IUJC 3G02A 4EI7A 5H8WA 4TSFA 2A3RA 4E88A 4LV5B 5WRFA 1P77A 4D26A 3CGGA 4B1FA 3UVEA 5F51A 3V2IA 1GDHA 1SM4A 3KZOA 5JJ5A 1I5EA 4ZVMA 4NCBA 3C15C 3QE0A 2WFLB 1M3SA 3V32A 4WEOA 5AW2A 1YJXA 4H3SA 4KLNA 1GYRA 2XZLA 3D4BA 4MEBA 4YALA 2G7ZA 3QX7A 5K01A 1C1XB 1J42A 1AO3A 3O8DA 4WY5A 3K9QO 3AIIA 4PGFA 1XXLA 2QRVA 1BU5A 2PH1A 3CZ5A 2V97A 3L0OA 4QYTA 1ADCA 3AKDA 2FHPA 2DSNA 4Y0NA 2D0OB 1X8LA 5LLSA 3OOEA 1I9CA 5AJXA 2PQ0A 3A1CA 5CBPA 4A0FA 2ZM6B 1N2ZA 5LMCA 3HCDA 1NQWA 3SZLA 3GA5A 4YWJA 5CT8A 1E2JA 3T9DA 2IHNA 3A14A 3M3PA 1K68A 4PZDA 5E4FA 4YCMA 2Y1EA 2IHYA 5DHQA 3JZAA 5JASA 5ILGA 4BY9E 1FRNA 4KCGA 3VTKA 2NSLA 4RV4A 5EIWA 3KEFA 2O8FB 1T5LA 4E4YA 1MPTA 1ZMXA 3B12A 2CUTA 2CW5A 2VHUA 1TD9A 4AWXA 4R2JA 2FDRA 2BLNA 4MVXA 3OFVA 4W1PA 2C31A 5H4HA 3VX4A 2OCLA 421PA 5E4TA 4NAUA 1ZEJA 1J9ZA 4DQVA 3AVWA 1T6BY 1A98A 1UPFA 2ZJ8A 4UBKA 4MVWA 1RYEA 2XKJE 3QVTA 2J59A 1BMQA 1TQDA 4HK4A 1SHUX 4MRMA 1DELA 3CW8X 1W5BA 3H04A 3PDWA 3RYHA 5DNCA 1L5RA 1USKA 4WOJA 4N5NA 4H0CA 1Y6ZA 3HKEB 3B85A 3GRAA 3JQ9A 4G26A 3NV9A 1RIFA 1NN1A 1HE8B 2P2DA 1BVYF 3JARB 4KV7A 4V0MA 3H5OA 3TBFA 2WG0A 4PFJA 2JANA 1YC5A 3HY3A 4BN4A 4K9MA 4PC7A 1M1YE 3D59A 2IP1A 1Y3HA 5JD6A 1TGYA 4NESA 1FZQA 1NBIA 2XF2A 3LYLA 2BH2A 1FP4A 4GC9A 1OH6A 3FM9A 3PQCA 4UVGA 1YNOA 3CPHA 5A9SA 4QDXA 5C52B 1WM1A 2Z57A 2AV6A 3BDVA 4OXKA 4PSKA 1NNEA 4QGBA 4DLRA 4EKYA 3GYGA 1QO0A 4B6RA 4L4ZA 2MTBA 1E3LA 1GKUB 2YYYA 3LVFO 3OMWA 5CEJA 2E37A 5ICSA 3BB3A 2FP4B 8MHTA 3JYLA 1Z07A 1SUIA 2YHUA 3KV1A 3D2LA 4V03A 3ZBUA 1J0EA 4G0PA 3SJ7A 3GDWA 4E30A 1MAWA 2OZLA 4EGSA 5GOZA 4HEA6 1BMTA 2DPXA 4KX5A 4XRGA 1YS7A 1AY0A 2X41A 3TQHA 1U5BB 4RKQA 4F3CA 1PE0A 5CYOA 1NHGA 2QD1A 2ZSBA 3U40A 2G5CA 3SE7A 1S2OA 4UCWA 1CEXA 1HOTA 4FDTA 1HUQA 3GQBB 5ALFA 5HS4A 1JEQB 3K09A 4GYJA 3HU1A 3GJYA 5GM2A 4KN9S 4Y30A 4WZAB 3QOFA 1QTIA 3H8JA 3L84A 3FTDA 3HV0A 1L5YA 4JT4A 2LPMA 3OQIA 3SF8B 5KSPA 2ONZA 2QHXA 2PCJA 3E22A 2CUKA 4BIMA 2CL7X 1F8GA 1W9HA 1UOEA 3QBEA 1TC1A 1AHIA 1JEJA 1VRVA 1MOPA 2EFJA 1OWLA 2RGXA 5EI5A 3PHLA 1PSWA 3B13B 4IM7A 2ZTLA 1PZNA 2KLHA 3C3PA 1EIWA 1ADGA 4ILKA 4QEKA 4BCCA 2L42A 2PKXA 1I4DD 3FBGA 4KLRA 4L6IA 5EJGA 3PHBE 3LUBA 1ESNA 1JSRA 2DR0A 4B4KA 2WQ7A 2CFTA 4XX1A 2H2AA 1ZOLA 3NT5A 4EGAA 3D02A 1ODCA 1X7YA 3PYLA 1CHNA 1G3MA 1II8B 4D9KA 3ESBA 1QIJA 3ITDA 1GM5A 4L5JA 4CM5A 2PZGA 2MYNA 3JALA 2EZ8A 3ZWCA 4K9LA 1Y37A 3GZNA 3AEZA 2IYWA 3I72A 2DTDA 3DXXA 4W82A 3UKJA 1LZLA 2ZBUA 1VI5A 5E7IA 1P1JA 5ALYA 2VQ6A 1MNQA 2D2IA 3CRRA 4YRGA 3CNHA 3I52A 5KJFA 3SHQA 3MOSA 4ZT7A 2PPLA 4Y0AA 5J2UB 2ZREA 5DCYA 4M1QA 3FR7A 4XR4A 3JQ7A 4P7KA 1Q21A 1EM8A 1FQWA 2VYNA 5IX8A 3KYDA 3WB2A 1U0NA 1SRRA 3IV6A 5LBIA 2AJ8A 4IINA 4DQDA 3K70C 2HM7A 3DB1A 5D5PA 1BS1A 3QV1A 3UJ8A 1KI6B 4PRZA 4XYGA 4XD7D 4CDNA 4Z4HA 2G9VA 1E79D 2YV5A 4INJA 1C81A 4FYWA 1BCSB 3O26A 2VK1A 1Q3TA 3VNAA 4OGKA 3OIFA 4MUJA 5JOQA 5CB4B 4QUAA 3W06A 4QVIA 2ZUSA 1NI3A 3QFCA 4Z4QA 2OCIA 2YCBA 3V8EA 1V8PA 3HA2A 4GPTA 1GGNA 1RI2A 4P33A 3PXXA 4QTZA 2ZSAA 2XB8A 3P9XA 2ODPA 1FMFA 4UQLA 1AUPA 3WAKA 3IMEA 1X80B 4LZZA 4MLPA 3HGTA 3I42A 4Y6LA 5I7HA 1QIDA 1U1FA 4U6NA 4PNEA 1XEXB 3ICVA 3T34A 5JQGB 2WJZB 3H9CA 1E1QA 2F3QA 2ZR0A 2DLCX 3C74A 2OAP1 1Y7LA 2GCPA 2V54A 3SG0A 5C1BA 1MJ5A 5I3ZA 4ZOCA 2YHIA 3CB4A 4ZTBA 4V3CA 4EFNA 1ATZA 1PU2A 1J21A 1XZQA 2BJWA 1X92A 3HA7A 3ISJA 4K28A 3JQEA 2X9QA 4Q37A 3VBCA 2O8EA 3JAKA 2AS0A 1HMPA 3P4UA 4DRXA 4FUTA 4QEDA 3LUDA 1XN1A 3F7MA 2OMKA 3QLUA 4GP9A 1NUHA 3LL7A 3DJYA 4KQ2A 3HJRA 3NHRA 4L74A 4ZALA 3T4PA 5H70A 5IH7A 4MIYA 4XVQA 4YMSA 1HEUA 2GAJA 4E5NA 2BHRA 3GY0A 3DLPX 5J4LA 2J0VA 1RJEA 3W2FA 1Y5RA 4IY1A 2BV3A 1U4OA 1R3DA 5F4ZA 2V45A 4HGNA 1W88B 1NJ1A 4KR0A 3AUUA 4XSHA 4AMUA 1PQWA 3QMMA 3F5SA 3TKAA 1IJKA 3X1JA 2OV3A 4R1LA 1M6YA 2BM8A 3IAM6 1VMDA 1ZO8A 2E87A 3JYHA 4GOND 5D5HA 4EB0A 4OI0A 2J5BA 3S28A 5BV8A 2QKYA 3TOCA 3OIDA 4O5AA 3N1UA 1V11A 2KHZA 5FF9A 4JHXA 3ZK8A 3FOZA 1QLWA 3DYVA 3PF8A 3VJLA 3D7MA 4P4NA 1DE0A 4LY9A 3M2TA 2N75A 4DADA 1HQYE 2P67A 1QOZA 5FNVA 2C9CA 1YF3A 3BGIA 1CJKC 3A1UA 2YN4A 3ZD9A 1GGMA 2YHIB 2ZRQA 2W2MA 4P6VF 1W87A 3ZWAA 3CPJB 4CMCA 4RULA 3N8GA 4FOLA 1Y9JA 3ROFA 1SXPA 3V1TC 4K81B 3ABQB 1IJBA 2ZBFA 4RXMA 3WK5A 3ESXA 3AC0A 3IMFA 1L5MA 3E5NA 4OLHA 1JDVA 1GU1A 3KQUA 3QXHA 1Q19A 5EJ7A 4FB4A 4HLQB 1IUOA 1UKAA 2Y0BA 4WN9B 3UG7A 4EYOA 3ORQA 4C4TA 1E9FA 2FKAA 1N2IA 3HFGA 4DLSA 2RHHA 3DE2X 3MCVA 3D0RA 4CKXA 4FK8A 2VHYA 1SOAA 1IATA 1CSEE 4DAOA 3DGFC 3CRMA 4CQMA 1XCPA 1A2QA 3NBZC 3ZDDA 5LQJA 5CVJA 1LB1B 3C3DA 2C2HA 1CR1A 4NBVA 4MWDA 1Y5LA 3LP8A 1Z4QA 2C1XA 1GTJ1 1E69A 1XVVA 2FXVA 2WJ3A 1DIRA 3EQZA 3VJMA 5FUWA 2E4AA 2GM3A 2EX0A 4MP3A 5AVOA 2GPTA 4DNQA 2IHKA 3LZDA 2C2XA 3DMHA 1VMKA 4DV5B 4IOLA 2IZ1A 1VA4A 2GS9A 1MZVA 2O14A 2GN8A 2ZRFA 3HCRA 4FNOA 4LVNA 3HADA 4QAQA 4JEUA 4YC7A 1GO2A 3PQ8A 2IPLA 3JY6A 3VR6H 3WWZA 1CRWG 2BMJA 5TSDA 3T15A 4UOZA 4ZICA 5KYNA 2J5QA 3ODGA 2GEBA 1LPMA 1HFJA 1NV9A 3NBYC 3URKA 5I9IA 5CW1A 2PMEA 4WBNF 5IJ0A 3EIQA 2CNWA 4NECA 3KUDA 4U8HA 5FWXA 1EWRA 3EEYA 2ZZNA 3ZHTA 4C43A 3BL5A 3WKDA 2SKDA 1A95A 1EVLA 2HJGA 2RDMA 3Q3GE 4YV2A 4DMUB 1QLHA 2JLUA 1PIWA 1R74A 1WY7A 3OQPA 3VU3A 2M1ZA 1DWOA 2H4XA 4JITA 2UZ3A 3TAXA 2QXYA 1SVKA 4NDZA 1WE2A 1PR0A 2BFFB 3G82C 3EQ8A 3K31A 4LYHA 4CLOA 3OU6A 4BQFA 4K2HA 3ZHCA 1CP2A 2GBLC 3DBIA 1V1MB 3DCYA 3FPHA 4IJ6A 4DC9A 2VYQA 1HDZA 3B6ZA 5B2ZA 2GD2A 4RHUA 4IKOA 4WINA 4ZVOA 1PEYA 3JQGB 4M4SA 1GOTA 3BT7A 3EF1A 4H6PA 4ZU6X 2NIPA 1C3JA 1Z7GA 2XGOA 1YR2A 4CF7A 5JI2E 1FBTA 1PK7A 2FVYA 3FFBA 4J8PA 4MQMA 4F72A 5JSFA 2FZ5A 3PXUA 5DSXA 3V2HA 5EIHA 2QP3A 2EP5A 5LZ8A 5CA0A 3ICOA 1M2VB 1SHLA 4EG8A 4F38A 1B42A 1FPQA 1BO6A 1D0VA 3GJRA 2BZGA 3GFOA 4MQFA 5LD2C 2AOTB 1RVV1 4MVJE 1RNLA 1JG1A 3SBOA 2A0XA 3BXPA 3V6LA 1I30A 1GNLA 3CRNA 3SFZA 4LHSA 5KOJB 4J0DA 1GZUA 3D5EA 1KOFA 1LRKA 5KVAA 3LDFA 2HV9A 1JJVA 1JWLA 2GEKA 3Q2OA 1ZEMA 3K0BA 1E0SA 1EESA 2J31A 1K9SA 3O7MA 2W2XA 3BORA 3K4HA 1J8QA 2R60A 1O08A 2FFBA 1MPXA 3E1SA 4V0NA 1Z56C 1HDIA 1JPUA 3WDMA 4IGKA 2JGNA 2QX7A 4BX0A 3I5XA 4LW8A 1Y1SA 1XHEA 2Q5OA 1XZPA 3D6AA 1E7QA 4DMKA 3ZHBA 4G9EA 2G9RA 3OKPA 2KSQA 4RZSA 3TYXA 4C08A 2R1VB 3ANMA 3AL3A 5HDBB 3V8QA 2HXSA 3I2HA 1OHHA 1TLTA 4PYQA 4CN8A 5JMOA 1YB6A 3IL2A 2GJ9A 4LKOA 3FYDA 2YYZA 1ZESA 2HNBA 2AR0A 2N42A 3N0VA 3UAWA 2VXYA 5DNWA 3ZJYA 1H2ZA 1WV0A 2FCRA 2SICE 4WNAA 1CIPA 2VHXA 5F1OA 2MIIA 3KELA 2Z9CA 4QREA 4IIJA 1XD2B 1V8OA 1JEYA 4OL9A 1KR2A 4WA8A 4MPPA 1VPLA 4KZPA 2LWIA 1AKTA 2IGBA 4MO2A 5BYKA 3ZUGA 2ZYTX 1J24A 5I6DA 5K6RA 4UBMA 2QR5A 3QVLA 2BGWA 3KWMA 3SXUB 5LZ2A 1N8TA 2R11A 2VXBA 2NU7A 1SUAA 4LPSA 4CR6A 3PVZA 4R31A 1Z39A 1DSSG 3NHUA 5B53A 2PDAA 1DCFA 1ZIXA 4JP3A 4B81A 2FFHA 1EHYA 4MS1A 1FFEA 4UBLA 4F4FA 1PQ4A 1KJNA 3QI2A 1NF3A 3B53X 3HS3A 3I73A 1NFQA 3T35A 2VRBA 2QTCA 5KNBH 1A4IA 4YLGA 2QUBA 3E8MA 2CDRA 1CERA 3HRKA 3LX5A 1O96B 4M8SA 3MZ0A 5AVWA 4NAHA 4CKCB 3NJRA 2V55B 1D1TA 1YXMA 3TNJA 2R1UA 1VKRA 2ZU0C 1BFDA 1ZN2A 4DA9A 4KPFC 5EJ6A 2I4OA 4WJKB 1QHHA 5DBIA 5LQAA 1NGSA 1SKQA 4B2IA 2NP7A 1R0RE 4ISBA 1QR2A 4NWIA 4PN7A 4MB6A 4F5WA 2W2PA 2NXCA 3A28A 4YXWA 3VDQA 3ZCUA 4C2UA 4GF5A 4TV8F 3LA6A 2GDZA 2J9ZB 4UCXA 3GJZA 2ZS8A 3KSAC 1DLIA 2BEUA 2P68A 2PS9A 4NYIQ 2GKOA 3MJDA 3DZHA 3OQHA 4B3DA 2O8DB 3IQHX 2BGLA 2R1TA 3EDCA 1ZVMA 1DEOA 2IQ5A 4NVRA 4U7WA 4YH1A 2XT6A 3W1WA 4HJXA 4OPMA 1M8FA 1WUIS 3STHA 1XO1A 3W0LB 4PAGA 1Y80A 1Y8ZA 4JV5B 4UAJA 3CEAA 3O8OA 3DEKA 3RVQA 2P2YA 1V5WA 5EVCA 4DJFC 4GEGA 5FWYB 4R1UA 4EFDA 3TZ6A 3HY4A 5CYFA 2XWBF 5FJJA 4B6SA 2ICAA 4MB0A 3E7DA 5ALTA 3UUEA 1G5PA 2WMNB 2IYOA 3LBAA 5BW8A 1HYBA 3V55A 5FAKA 2XMBA 3ERCA 3H0EA 1VHDA 1QQ6A 2X15A 1E6EA 4FGSA 1AIPA 4EI2A 4OP3A 4HMPA 1POXA 3BH6A 4JJ6A 4MUMA 1SU8A 1N3BA 1TO1E 1L7OA 4I66A 4JUFA 4D0GA 5IAOA 5ECWA 3ZNNA 4XWOA 2X0RA 4MUFA 3HJCA 5TGZA 3SLGA 4P3PA 2WD9A 3X0DA 4B75A 2JEZA 4X93A 3CUUA 1QJCA 2PGLA 3EVGA 1N2HA 1RWNA 1VPDA 3C87A 4R54A 1ATIA 3E8SA 2YJNA 4UD2A 5CB4F 4I5FA 2JLWA 5F3WB 2TRSB 2WJ6A 4NBKA 2RI6A 3MMNA 2JGRA 4H9GA 2F9LA 4NG5A 5BV7A 3LKDA 5F3DA 1X3LA 5K51A 4OO3A 3CEMA 1Y34E 4O4JF 1YKSA 2R6ZA 4KSBA 4U2BA 2RAUA 3VR1A 1FP7A 1Z4LA 4YIHA 1NPYA 1L4FA 3AEQB 2Z83A 4HGYA 3LQRA 5CPFA 1CE8A 5KHLB 3AXSA 1KDZA 4HRXA 4Y9RA 4D25A 2IOYA 2V96A 2WJGA 1N2CA 2GPNA 3HZOA 4YCDA 4F9GA 5E6SA 1P9WA 3NB0A 3IMCA 1RACA 5KYUA 3TRHA 5JAQA 2QZZA 3EBLA 2XAAA 4XIYA 1ONNA 3L49A 5CH5A 5JTTA 2IYLD 2HBQA 1HA3A 3CE9A 1G16A 2QQEA 4G65A 4RZUA 5DOZA 4YQEA 4GMXA 2ACWA 1R27A 3RVJA 1MG5A 2GWHA 4YDQA 5C8VA 1BMDA 4BO4A 1GPUA 4QDJA 2RCYA 1TFRA 5C8DA 3O8QA 4CIDA 5F77A 3JPWA 8AT1A 2GEFA 4FHFA 3ORSA 1HPLA 2K4MA 2W8BA 2Z98A 2UZ4A 3A4VA 5DLDA 3QFTA 4WHMA 3R7DA 2C8LA 5EXDA 1ZK1A 2WOOA 3O2NA 1WMBA 4P31A 1JIXA 5CLFA 4G09A 3L6CA 2TMYA 2JGEA 3KSZO 2QD4A 5CLGA 2BGGA 3GQBA 2HK9A 5ALHA 1JLLB 1MOSA 1Z5PA 1RC1A 3KFVA 1O6CA 3ZWBA 2FAXA 5TMEA 1SU7A 3CQ9A 3FW1A 3IJ5A 2P4SA 4F45A 3Q8XB 4Q4HB 4ZU3A 1OA1A 3IBCA 3KYBA 3C6ZA 4IDBA 4MKIA 1WBDA 2NVBA 4RVFA 3VKWA 3L8ZA 1K6EA 5C8YB 2ZSJA 5CFMA 2R48A 3T7RA 5L8VA 1YQQA 1XTUA 1PR1A 1V6SA 2PUHA 4HH3C 1XNGA 4XD7A 4XFJA 5K0ZA 3FCSB 3IUYA 5BNTA 3O8RA 2BBSA 3GF4A 4BN0A 3R8FA 5LM3A 3B1YA 3ONDA 3QOWA 4P4TA 4QJ5A 1W4CA 1G5IA 2O2GA 3KU4A 4BVKA 4XR9A 2Y1KA 1O94C 3VSBA 1YBVA 4R6WA 1XPJA 1KH2A 4WZBA 4AX8A 4JXKA 3LDUA 3DDOA 1PX2A 3OOSA 1IN8A 4DXDA 3NHKA 2AD5A 2BDTA 3KZXA 4QYSA 3IJEB 4ZU1X 2G0NA 3MLEA 2QBYB 2QTZA 4AP6A 3QVUA 5GOTA 3K94A 5JFGA 1QU2A 3BRSA 4J0JA 2PA3A 3OC6A 1V6CA 4WLVA 5KBYA 3G0OA 7REQA 4PGHA 3HDJA 2J07A 2R96A 1FQJA 1UCFA 3K1YA 1P2FA 4FIDA 1GUYA 1SK8A 3V80A 1KYZA 5JZOA 1H9BA 4R1TA 4BB5A 2ST1A 2QIPA 4PFQA 1KHTA 3WIBA 2F1JA 3L7YA 4YCBA 4FN4A 3WZ2A 3L0YA 4HKTA 1NU6A 1T4CB 1JXMA 1GNQA 2EERA 3BKXA 4H6VA 4ZKDA 5CFNA 1D2HA 4WCDA 3RJTA 1Y0BA 4KQ9A 1N77A 4FGZA 2ZRDA 2WF5A 3U3MA 4R5MA 1XTIA 3I92A 3LVBA 4KXQA 1DINA 1EE1A 4J0HA 4OOFA 5I7WA 4KRFA 1X13A 2MMGA 1I1OA 1KK1A 3P9PA 4PBRA 2JCYA 5IW8A 3G2QA 1GU7A 3RC8A 3VNSA 3FKSA 3OT1A 2ZAIA 3GNSA 5CM8B 4YHBA 5EL0A 4BCBA 1F8FA 3BK1A 1E1DA 1NUQA 4ZVVA 1JS1X 5ES4B 1NVVQ 3R40A 5EKUA 1XU9A 2A0KA 2B4AA 3EOAI 3H5LA 4E5MA 4LYAA 1BS9A 5JYBA 4PAQA 1L5ZA 4QT0A 2WWWA 3H65A 4JB8A 3DKVA 4RFSB 3WRYA 1RXIA 2W8ZA 3HABA 1B26A 4Q3DA 2H5JA 1E58A 2Y4OA 5JYEA 4Q16A 5EMMA 4TXHA 1V7ZA 4HTFA 3U09A 1IVSA 4WESA 3AR2A 3V7YA 4ZI7F 5IWAB 3K0AA 3QMVA 1VPVA 4ZOAA 4UUBA 3OFND 5K09A 1GPMA 3DT6A 1SZCA 3K6RA 5JXGA 2VTBB 1AE1A 1JR2A 1XZLA 1K7CA 1UUFA 1YR7A 2VRCA 4EX6A 5LZ9A 3KWJA 2I4RA 3G0GA 1BRTA 2JGMA 1M2HA 2QJFA 3KQSA 4HQ6A 4JLMA 5FA6A 4UNIA 3RM3A 1U7HA 4DIFA 4MJLA 3TFOA 1CX9B 5EUMA 1H23A 4JVLA 4GQBA 3W04A 3OF3A 1RJDA 4RJLA 1CY4A 3UJHA 1A8PA 4IX9A 4PAMA 3V48A 4XTRA 4COKA 1Q14A 3C5WP 4KXXA 3FLEA 1VPTA 5EOVA 1AQJA 3QE9Y 3K70B 1YONA 3QVXA 2IT1A 2Z0MA 4MR8A 4QUIA 3GFVA 1RRPA 4AY3A 1W19A 1FUUA 4EKIA 3O1HB 2PFKA 1PN3A 1WXWA 2WSYB 4R98A 2GM5A 2XBLA 5K8JB 2GXAA 3X1ZA 2ZQYA 1FDUA 1PRYA 3MBIA 5LA6F 1CB7A 3HN7A 1EFVB 3CNOA 4MS4B 5A2QA 3LT5A 4K7JA 3CF2A 2QRQA 4FVTA 2FUKA 4XA8A 3WXBA 4HDKA 1A9RA 1JKMA 4F6RB 2CE7A 4YRIA 4FMCF 1PL8A 5CVVA 1O95C 5CCBA 4NG4A 3TBKA 2BP7A 4QJ3A 1W88A 5I5EA 3OQOA 5K3BA 2QTHA 4X1YA 4HRYA 4AKIA 4XYLA 1AUVA 1XVAA 2VAXA 1ZJ4A 2DRIA 3K2EA 4HH4A 5EPEA 3PYMA 3MYYA 1LLCA 4BZZA 1F7VA 1YS2X 2A35A 2EYUA 1W46A 5AI5A 4OJMX 5C5DA 4D74A 4PX2A 1ZRSA 3GEBA 2JCVA 2JJMA 5B1EA 3DVSX 4Y6GB 3S70A 2CVHA 4CM4A 3A6HA 4G89A 3V33A 3AWIA 5AKIA 4BLRA 4R81A 4ESHA 5BVGB 2RBEA 4BMCA 2JZCA 5DASA 1EFHA 3UHJA 3SQXA