3SAJA

Crystal structure of glutamate receptor glua1 amino terminal domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
375
structure length
369
Chain Sequence
GAMPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the glutamate receptor GluA1 N-terminal domain.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Glutamate receptor 1
total genus 115
structure length 369
sequence length 375
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA01
4OLBA 2HPHA 3GWGA 3HJFA 4MQFA 2JB9A 1W25A 3JVIA 2E4VA 3OLWA 3FFXA 4FE7A 5ED4A 1XWWA 5BRJA 5HKOA 2PL1A 4LRQA 3N0WA 4G0XA 4RDCA 1P2FA 2FKAA 1AB5A 3H5WA 4KNYA 3O1JC 4TMYA 3HEBA 1RZRA 2PLNA 4HNRA 2NT4A 4Z99A 3OLVA 5IUKC 4EYKA 1JLKA 1YTUA 3L49A 4TLLB 1LK0A 1EAYA 4MQEB 4OBBA 1Y1LA 3QELB 1AB6A 3QEKA 1Z2EA 4TN5A 4WUTA 1DRKA 3QK7A 1DZ3A 2B4AA 3RQIA 5BR1A 5I4CA 5TE9A 3A0UA 3O1IC 2ZAYA 2QSJA 4Z4GA 4WT7A 4KQCA 3C6QA 3QEMA 3HXMA 4YV7A 1T34A 3N53A 4XASA 4Y9TA 1BA2A 3N6VA 5JNTA 1RXEA 4G0YA 3CZCA 3RVNA 4PE5B 3RH0A 3QX9A 4N03A 1QMPA 2Q5CA 3MF4A 3I09A 1A2OA 1D5WA 2HQBA 1NXWA 3MQ4A 2FQWA 1YVUA 1BVHA 4LE2A 5PNTA 1BAPA 3I42A 2L19A 1ZAYA 4Z4FA 1DCMA 1JX6A 4PZ0A 4D74A 2FEKA 1TM2A 3H1GA 3QLUC 1HEYA 2QVCA 1E6MA 2RJOA 4F11A 1E6KA 2VYCA 4UHJA 3KTOA 4DQDA 4H3KB 1GLGA 1U8TA 4XFKA 1Z15A 5FBHA 4MR9B 1L5ZA 4N76A 5JS2A 1NATA 4MR7A 2GX6A 3GT7A 3LMKA 3FGZA 4IRXA 1GUBA 3OM1A 1JYFA 2L17A 3LTEA 4RK6A 4F12A 1DJMA 3KYIB 4HYEA 3QX8A 5JNRA 4HNQA 3LUFA 4EYOA 3MYYA 1KGSA 1F4VA 3A0RB 1YIOA 4H3HB 2TMYA 4IMIB 2CHEA 2A9QA 3I5AA 3TD9A 4E7OA 1Z26A 1YS7A 3H6GA 1RPJA 5IUNC 4W5NA 1Z2DA 3N0XA 2QXYA 1SRRA 1RXIA 5TQ2A 1EFAA 4F3TA 1YMUA 3O2SB 1JFTA 1PNRA 3EQ2A 5CNKA 1D4ZA 4JB0A 3M9XA 3Q7TA 3NHZA 5TQ0A 1PHRA 2E4YA 3JPYA 3H5OA 1JFSA 4MQEA 2NT3A 3NBMA 4DN6A 3H5LA 5IUJC 2O20A 2XDYA 3D8UA 3NNSA 5C5CA 1JF8A 1MIHA 2CD7A 4Q6BA 3O75A 3QLTA 4MRMB 4Z4HA 5EWJA 3CZ5A 3JY6A 1JFVA 3LUKA 2FTKE 4F8JA 4IF4A 3QELA 4G0OA 5BQ3A 3SM9A 2VK2A 3HDVA 2WJAA 1DBPA 4MS4A 8ABPA 3DLHA 2V0NA 3NNDA 4OATA 1ZGZA 2GKGA 2E4ZA 3KLOA 3TMYA 4EVRA 5FBKA 2LUOA 4Z0NA 1A0OA 5B3JC 5TQ0B 4LDZA 3VNAA 5BRAA 1FFSA 3IDOA 3O2JA 3OO1A 3HO1A 1QQAA 3GL9A 2CHFA 2FLWA 3CG4A 2LIVA 1SXHA 3KCNA 1EWTA 1QP4A 5IX8A 1D2AA 3BILA 5KQLA 4ZPJA 5TPZD 4ZMRA 3F6CA 3O2QB 5JNUA 3CRNA 5KC9A 4KQ9A 3IP7A 4RK1A 3HK2A 1EWVA 2MYUA 2E4UA 4MR8A 4WWHA 2WB4A 1B00A 2RDMA 4NCBA 3FMVA 4KK3A 1R8JA 3T8YA 9ABPA 4MPTA 4O5AA 6CHYA 3EAFA 5DGCA 3RVLA 3C3WA 3EGCA 2ID9A 2LPMA 4F06A 2P4UA 3C97A 5CNIA 2FXIA 3GBPA 3HV2A 3HZHA 1DP4A 2JVIA 3G85A 5DTEA 1PNTA 4RY8A 3RVOA 2AYXA 2MSKA 2R4QA 1VKRA 1M5UA 3UKJA 6ABPA 1RZRD 2HSGA 4OLAA 4MQFB 3DZDA 2DRIA 3UK0A 5KQPA 2YHBA 4RXUA 2FEPA 4IMJB 1NXTA 1YK0A 1NXSA 3KG2A 3LFTA 4UHKA 1ISSA 3EQZA 2PKXA 3Q41A 5F64A 5B3JA 3LUDA 4L85A 4YRZA 3OMXA 5DCLA 1M2FA 3IP9A 4ETMA 3SNKA 4RY0A 1U2QA 1ZY2A 1LJUA 5EWLA 2FN9A 4MS3B 4PEVA 4MAAA 4QICA 4RV5A 1S8NA 4YGXB 1NTRA 1ABFA 3I45A 4LDAA 3ILYA 4GNRA 4MS1A 5EWMA 5C5EA 1VLZA 1DG9A 4N0QA 2GWRA 3LUCA 4YO7A 2FVYA 4LE0A 3E61A 2NZVG 4RU1A 3F73A 3SQNA 2IDMA 3LUAA 1UDRA 2NUBA 2RJNA 3GBVA 3URMA 5DKFA 1QKKA 2RGYA 3CFYA 1GCAA 3H5IA 4G0PA 5IC5A 1JH9A 1ISRA 3TO5A 2JVKA 1ZESA 1QPZA 1XHFA 2P9HA 2M1ZA 4EVSA 3M6MD 3Q9SA 5E3JA 1U04A 4O1HA 3RVRA 2JK1A 1ZH4A 3O21A 4Q6WA 1P6UA 1Z17A 3N8IA 4KVFA 3T95A 3OLYA 3EDCA 1D1PA 4Z4EA 1H9CA 5CHYA 1NXOA 3O1HB 4WXEA 4JA2A 4MS1B 3F6PA 3BBLA 3LKBA 3RVQA 2LP4Y 3SG0A 4S04A 3S99A 5TQ2B 1VRVA 2L18A 4JASB 1ZH2A 2QU7A 4MGEA 1M2EA 1PEAA 1URPA 3MMNA 4P1ZA 2IOYA 4G0QA 4XARA 1GCGA 4RK7A 3RVKA 3LUJA 2H0AA 2QV0A 2HQOA 3IP6A 4ZJPA 5T3YA 5KWSA 5TPWA 4G86A 3NNNA 3UUGA 2HJ9A 4N41A 2F8SA 2JCGA 4D6YA 2GBPA 3IP5A 1SXGA 3HSYA 3JPWA 1OXKB 3JTEA 3Q7RA 4M88A 2F8TA 4KRFA 3OO0A 4G97A 4QPJC 4NICA 4TLMB 4YR7A 4W5QA 2R47A 5FWXB 3R0JA 1DBQA 4W5TA 1JDPA 5JNVA 1USIA 1JWLA 3JVDA 1K68A 3G1WA 2AYZA 2JVJA 4KZKA 2PUAA 1FFGA 1YS6A 2PL9A 1NXXA 3H75A 2OENG 4RXMA 1LBIA 4YS6A 4XLTA 5JS1A 4ZYLA 4YCSA 1BDIA 2PUGA 2PUCA 2JRLA 4MLDA 1MAVA 3DLBA 1JHZA 1JYEA 4LZLA 4KMRA 2MYTA 5TQJA 1ZN2A 4KFCA 2PUBA 4N47A 3E3MA 2W42A 4RK4A 1U0SY 1YMVA 2PUEA 3K4HA 2E4WA 4WZZA 3GRCA 2IPNA 4G0MA 4Z9AA 3IPAA 1FFWA 5HSGA 4D6XA 4EUKA 1OXBB 3SY8A 4ZMSA 3CU5A 3O74A 4QYWA 1L5YA 4MR8B 3Q7SA 1ZVVA 3K9CA 3LUHA 3RVJA 3QLUA 1ZITA 3F7NA 3ROTA 2FLKA 2VUIB 4GPAA 5JNWA 2ZWMA 1EWKA 3P9YA 2FQXA 3RVSA 5FWYA 3KS9A 5EWLB 3BRQA 3OLZA 5TPZA 2N9UA 1C0EA 3CS3A 3HUTA 4N0PA 2B1JA 2FQYA 3CTPA 4MYRA 1VPWA 2BGGA 4EYGA 1W9HA 2VUHB 5ABPA 2L2QA 1RNLA 1SD5A 5CNMA 2M98A 2JBAB 4OG2A 5IEJA 7ABPA 3VNBA 1E6LA 3GA5A 4IGAA 3HS3A 1PUXA 4ML3A 2PMCA 3JS5A 4KK4A 2QW1A 4YLEA 3A10A 3HVRA 3LOPA 2LBPA 4LX8A 1ZDMA 5KQGA 4Z9BA 3OMWA 3TB6A 3MIZA 4JB2A 1JL3A 1BDHA 1FQWA 2FSPA 1LJLA 4FE4A 1ABEA 3CG0A 2PUDA 5TPWB 3H5TA 1JDNA 2FMFA 4MRMA 4B09A 5JNSA 2FEWB 3T38A 1YK1A 1Z16A 2J48A 3D02A 4EGSA 1QQBA 2WWVD 4HNSA 4RSMA 2WRZA 1Z18A 3M9WA 3HDGA 5D2CA 4LE1A 4MR9A 5IBQA 2R48A 3RVPA 2KYRA 1TLFA 1LBHA 1KRXA 1USGA 3C3KA 1EHCA 3HCWA 4G0ZA 3W9SA 5KC8A 5IEBA 2A9PA 2QZJA 1QP0A 4NCAA 1SXIA 1PEYA 3TX6A 4EVQA 1DC8A 3OQNA 1QNLA 3GYBA 3RVMA 3A3KA 3EODA 1D1QA 3KLNA 4RS3A 4RXTA 3T6KA 2IPMA 2MSLA 4RK5A 3SAJA 4DADA 4RZSA 5FWYB 1TJYA 3Q15C 3CLKA 1E2BA 4Z4CA 1TMYA 4JP1A 1DC7A 4EYQA 3KKEA 2JBAA 4NQRA 3OLXA 1FSPA 1TVMA 5HQJA 1NXPA 2HQRA 1F51E 2FMIA 3OM0A 5DLEA 3QLVA 2PJUA 3KSMA 1P6QA 4Q7EA 4CBVA 4S05A 3H1FA 4XXHA 4MS4B 1DBWA 4W5OA 3MM4A 2WMYA 3IPCA 4QYMA 3H6HA 4PICA 4RY9A 1QP7A 2ID7A 5KI6A 2FW0A 2FMKA 1A04A 2I6FA 2PAFA 3FFWA 2IPAB 3FFTA 3GV0A 3L6UA 5HM6A 3CKMA 3DGFC 2YHAA 3HUUA 4IILA 3CNBA 2PE5A 2PUFA 1U2PA 3HM9A 1QO0D 2H3HA 3LUGA 4JAVC 4O1IA 4Z4IA 4EY3A 1C4WA 2IKSA 4YWHA 4RKQA 1M5TA 3NHMA 1IIBA 1JBEA 3EJWA 3EULA 1ZHHA 3OQMA 1GUDA 2QR3A 2IYNA 2QVGA 4E7PA 1DCKA 2X7XA 4XAQA 3QEMB 4KPYA 2E4XA 2MYPA 5KQMA 1K66A 3N75A 4KV7A 5FWXA 4H60A 4MR7B 2FN8A 4RK0A 4PYRA 4WXMA 1P8AA 3DGEC 5CNJA 3C3MA 1Z12A 1KRWA 1J56A 3QLVC 1KMIY 3MA0A 3N0RA 1QO0A 2OQRA 4RWEA 1Z25A 3KHTA 4MS3A 3OQOA 4FB4A 4P98A 3KJXA 1DRJA 2FMHA 1MVOA 3ILHA 5EWJB 4MLCA 1XHEA 3BREA 4OTZA 4JOQA 2A9RA 1WETA 4L4UA 2IPLA 1MB0A 1Z13A 3BRSA 5GOTA 5GQSA 1NY5A 3H5VA 1CYEA 3FDFA 2R25B 3H1EA 2WJWA 3B2NA 1CHNA 2WY2D 4NV3A 5EWMB 4KREA 4ETIA 1USKA 1ZGGA 3DBIA 1BDJA 2MSWA 2NZUG 1I3CA 2MYNA 5IULC 2CWDA 3ROFA 3CHYA 4ETNA 3LKVA 2GI4A 1APBA 2A9OA 3KYJB 4RKRA 1MB3A 1NXVA 1DCFA 1CEYA 4W5RA 4YP9A 5T7BA
chains in the Genus database with same CATH superfamily
2CGEA 1HNZB 2PH5A 4NEGA 5KVQA 3HJFA 1QIGA 2J7PA 5DH9A 1NQOA 1VIMA 2JB9A 3VH4A 3Q0IA 5TMEA 2PBFA 4JVMA 3Q87B 2EATA 1RBMA 2PWYA 2EGHA 1NW5A 1RAAA 1PJ8A 1Z4LA 2FKAA 4NBNA 3OKPA 3LHSA 1CJBA 2V7XA 2PRYA 3D5TA 2CLHB 2ETVA 2J3HA 3F1KA 5BV2P 4F93B 1ZN7A 1KMQA 3FYSA 3QU2A 4JC4A 1JQDA 2PLNA 4DOMA 1YZNA 1OZFA 1SUSA 4AYWA 5F9HA 3IEMA 2XMQA 2P1DA 2DTXA 4US1R 4H6VA 3N8GA 1BNCA 2FPGA 1YUBA 3BL6A 4C6TB 5FNZA 1V41E 1IK6A 2QN9A 1SBTA 2EG9A 3D6VA 1KZYC 2IYEA 3WJAA 4IIXA 4AFNA 1B8VA 2CJYA 4EGCB 1BOOA 2V7VA 1Y1LA 4L6IA 5JAQA 1D0VA 5ECGC 1UAAA 1QRAA 5CYFA 4Q15A 4AJ9A 2PZLA 1RI1A 1N1EA 2O3SA 2WP8J 4PYKA 4PQYA 3WLKX 1Y81A 3CW9A 3C70A 4W5WA 3VR4H 2B7LA 4OB7A 4UMEA 3NHJA 4XASA 3TSYA 1HX7A 3DWEX 1IY8A 5L3SA 4BKUA 3DC2A 1VRCA 1XJCA 1CDDA 5IZ4A 2GD2A 1MXFA 1QWOA 3MIIA 2QPOA 3I64A 1D2MA 5AJHA 5IN4A 5JADA 3O03A 2HV8A 4HAWA 2WP0A 2VQSA 1Q0SA 3PDIB 4V0RA 2H11A 3NHBA 2O48X 3BWVA 5DO9A 1SVWA 3DQPA 3JQFC 2YY6A 4M76B 4OHFA 5FA5A 1GZSA 3N58A 4IQ8A 4Q9AA 3W2TA 1NF8A 2R79A 4FZVA 1E6KA 4C2BA 4ZVLA 2NVUB 1Z47A 4Y6SA 4Q4HA 1HFKA 1J5PA 4YJ2A 4XFKA 1SURA 2IOQA 1S8AA 3PRJA 1W85B 4N01A 4KFRA 4DRZA 1JJIA 2HUPA 4MR9B 2I6QA 3WRXC 4BYGA 3WVNA 1QE0A 3UGQA 1P2BA 3CVOA 3QWHA 2BUAA 1YRWA 4QQRA 3ZK7A 3G5UA 4D3DA 2YKGA 4MGYR 3HDQA 1QHSA 1GUBA 2O6HA 4RVDA 4UBNA 4P4LA 3ANMA 2CL0X 5H0IA 3ZJ5A 2ZYSA 1E8MA 4CU5A 1DJMA 3Q5EA 3EN0A 1ZLYA 4OQEA 3T0FA 4D0NA 4D92A 1QGAA 2HMYB 2P9FA 1HDZA 4LXGA 3HYLA 4BY9E 4KR9A 1NBEA 1YCHA 4U5QA 3WHKA 4ALNA 2BC9A 2AKYA 2IHZA 1QPGA 2BJHA 2P11A 3EDRA 3KEMA 3FKQA 4JLSA 5ADUS 3GG2A 2IDKA 4Q01A 3U19A 1GFZA 2H2WA 5SICE 3DVQX 3EXG2 3LX8A 2GPBA 3T9BA 1OC2A 3V33A 3CKLA 4D1YA 3RJZA 1RWVA 5DOZA 1NG1A 1RXYA 1UJ2A 3FAKA 4M7PA 4RAQA 3V1LA 4OIFA 2XQGA 1OSNA 4YJ3F 4ZD6A 2X23A 4MQEA 1KI3A 1E0KA 2IUUA 1HYGA 5JAOA 2WU4A 4MDHA 1NT2A 2RGCA 4WEQA 4MOWA 1R4NB 1CLUA 4KLCA 4TZTA 5LYJF 4BZWA 5BW4A 4BC0A 3K0BA 1UDAA 2AG8A 4BASA 3D7KA 1FNCA 1RQGA 3SC2B 4IWNA 2ES4A 1VL5A 5HR5A 1CJCA 4I9GA 1DAEA 3JQRA 2VFAA 1TEXA 2DKNA 2EGGA 4UJ5A 1TK2A 1FBTA 4FC6A 2P4QA 4HDRB 2F6RA 1HT1E 4FYWA 3RRXA 5BVGB 2X40A 3Q8WA 3ZV5A 1IN5A 1A95A 1GTJ1 3RARA 4H3SA 4JY7A 2YVAA 4LXTA 3SS7X 3QYAA 1XZJA 5FBKA 1AUVA 4GF5A 1Q0RA 2IV2X 3VV2A 1GLVA 2G71A 1Q74A 1BWRA 1ZK3A 4NZYA 4U7DA 2UYCA 1EI9A 3AEQB 4UUPA 2JS7A 1KMCA 1S5PA 4XX1A 2CT8A 4E5KA 2F62A 2WSSD 2FY8A 2ZATA 1WOMA 1N77A 4EFDA 1NDQA 4MVJH 4ZMRA 3STWA 3KVOA 3V8EA 3ZHVA 1HFWA 3HBAA 2RB4A 2R8XA 5KC9A 1BIFA 2G76A 3EIOA 3O3MB 5IJWA 3U31A 3SKVA 4AZSA 5HZMA 3FLBA 4DDHA 3SHFA 1CFJA 1I7PA 4N5IX 3OQ6A 2RAPA 2XRFA 3QVJA 4JGBA 5KTKA 6CHYA 2XUJA 4L73A 5BQ5A 3RVLA 4Q4LA 3VUEA 2JZOA 4CLHA 5L6LB 2D4AA 1G59A 1FMTA 3HLTA 1MIOB 2BEKA 2CFRA 2ID9A 1BGXT 4FBGA 2JJ2A 2XWBF 3SR0A 4CN9A 3IBYA 3Q8LA 1E9EA 4KKXB 2V97A 3DKRA 2X14A 3B7PA 3BVPA 1HYQA 3ES9A 1V3TA 4UEOA 3R7SA 3P96A 4H6WA 5L53A 4B6FA 2JVIA 5FP0A 4G07A 3OCWA 2GWHA 1EP9A 3R7NA 4JC8A 1E2NA 1G20A 3ZCQA 1VKRA 1M5UA 4TVSA 2P5YA 2ZYHA 3ZD6A 1WM1A 1H2YA 3QUQA 2IPOA 3CN7A 4WFQA 3FMOB 1DSSG 2HV9A 1XXHA 2WKWA 2VA8A 5GZ6A 3OMLA 3VJMA 1EVIA 1YONA 3R9XB 3B1XA 3ELWA 5CPBA 4DAOA 1NXSA 2EKBA 2YHIB 5EAIA 3WIVA 2DT5A 1E99A 2JFOA 3EOAI 3HJUA 5J2UF 1HE1C 3HRKA 1TD9A 3CZ4A 1BCSB 3KTAB 3PB3A 3WGOA 3CUSA 2AHOA 3EHEA 2V6MA 3LGXA 2GXAA 1QONA 3VKWA 1X9GA 4K5QA 3LP8A 4QBTA 3ZCSA 4M9SA 4DBLE 1W4ZA 2AN3A 2HEGA 3L40A 1NWCA 4BVAA 4OM7A 2WTUA 3W8FA 1CSEE 1YA4A 1EK0A 5ALNA 3ZQUA 2ARKA 4CLOA 1EMDA 4RV5A 2OO7A 4RHFA 4EB6B 2PBLA 3BXPA 1A8HA 1U31A 1NFQA 5E6UB 4DHWA 4BO4A 5KVAA 4G23A 4LE0A 3QIAA 4D0LB 2NZVG 3HBNA 1G63A 2PKRA 2ZE6A 4HADA 4JQOA 4QOJA 2NUBA 4IOLA 1YDEA 4ITVA 1Z7WA 1KIFA 5AUOB 1PVVA 2JGEA 3H5IA 1CDZA 1OWNA 1SXJA 1ISRA 2BR4A 1G5RA 2C2YA 3TO5A 5GZ3A 2VDNB 3ZD8A 3W3AH 2G77B 2GFQA 3N07A 1V1RB 5E3JA 3H5AA 2IXGA 2WSMA 1PW7A 3HDTA 3QE3A 5IJZA 1AK1A 1T9BA 3HYNA 3O8OB 3OTWA 3PR2B 5HF8A 4FYJA 2J3EA 2Q1UA 3QU9A 3ETEA 4GC9A 1VI2A 4WKOA 5IAJA 4UM7A 3X1YA 1LSSA 3GELA 1JKXA 1BDBA 1J2YA 4FYHA 5DBEX 1ZVMA 4NJMB 1T36B 5KNBD 3S99A 1L7AA 5DBFA 5TQ2B 5E6UA 3WS7A 3L7AA 5LQJA 5HDQA 1ZH2A 4ZTUB 1JFFB 1K0FA 1R8QA 2GXSA 3NBQA 1URPA 1C0IA 4ZODA 1UT6A 3SF0A 4D25A 5G40A 2CYAA 3WE7A 3JR7A 2FGJA 4RCVA 3DZBA 3VGPA 4A6PA 2FEXA 3EC1A 3DO5A 1RAEA 3FNQA 1H05A 2XUZA 1QFJA 2ZVQX 3LPAA 3DOEA 1XEWY 3M2PA 2V58A 3SXPA 1FY2A 3HO8A 1V5WA 4FDVA 1PSDA 4EO7A 3IAEA 1A2QA 1TUIA 2REQB 4PV7A 3ND6A 2ZDHA 1GL6A 3LD9A 1Y5IA 3JPWA 1EXVA 1Z4NA 4Z7NB 4FS8A 1IN6A 1TTHA 2XB9A 4YQYA 2QRQA 3KEGA 3GJSA 2Y0CA 4HLDA 1FUYB 3UA3A 1X1QA 4IZIA 2EXXA 2VCEA 1BSVA 3SHVA 2AJBA 3WMGA 3UWOA 2Y0PA 1UBMS 2WIGA 1P61B 3ND7A 2XMPA 3URKA 2I3ZA 1PGNA 5DHSA 4WOBA 3WYNA 3KUDA 1G1AA 3SXUA 3Q2KA 4IX1A 5EKDA 2I67A 4D3ZA 4MRRA 1TEHA 4FFMA 4A91A 1SVMA 3RS5A 3PFBA 4KIWA 4PRYA 3ZZ0A 2CDBA 5J4HA 3K4HA 1HDOA 3NR2A 3VPAA 2WIDA 2Q07A 3C3YA 2WTEA 4IJQA 4M9QA 2OD7A 2UYOA 3PFGA 4NENB 4WZZA 3R7WA 4B84A 3GRCA 3BPSA 4Z9AA 3ZNQA 4R6XA 3OF3A 4L50A 4LSZA 2D74A 4RPGA 1EUZA 2RAUA 1RJEA 3R8FA 1YB1A 3HFGA 3Q7SA 1C29B 1ZRHA 1COZA 2D1FA 3AESA 1T8PA 2QRLA 2W98A 2HT1A 1UC4B 2CE2X 3D8NA 2CK3A 1FUEA 2XGOA 2P27A 1S2MA 3HLKA 1WBJB 3NO4A 5DSXA 5EGNA 5EP1A 3ZKWA 4RTQA 3D8TA 1RPNA 4BEBA 1WSWA 1WULS 2HFJA 5AKLA 1K5HA 1HDIA 5B1YA 2HN9A 4EJSA 4U7HA 4DW8A 2PTHA 3W04A 2QZ4A 1OX4A 4P22A 2RHDA 3OE1A 4FOLA 3L1JA 2NTJA 3TX2A 3ZQJA 5JXHA 1MZPA 1SWVA 1B8PA 4U3JA 3Q3IA 1JXOA 2WKPA 4N1AA 2L2QA 4ZARA 1BQ4A 4J94A 1W4LA 3JQ8A 1P60A 1NJ5A 1IQPA 2AC7A 2FLVA 4QQ8A 5JU6A 2O14A 2PZFA 3F5FA 4HQOA 1CUZA 3A6HA 3K2BA 3OKCA 4OEHA 4NNJA 1U5BA 4UVDA 3ZQKA 4FFOA 3RYTC 2RFLA 3LOPA 5DYGA 1J0DA 4LNUA 3WNZA 4EI2A 4R71A 1EIWA 1DUIA 4C4OA 1FE8A 3BQMB 2GXQA 2WHRA 3CG0A 3EWSA 4PWYA 1K27A 4J7XA 3CZRA 5K6TA 1OX5A 5DWQA 2IE8A 1VSUA 4R4JA 4PIPA 5EXPA 1Y9DA 4QQKA 2YYZA 2FPGB 5ARCA 5ALPA 3BMCB 3C43A 1SU6A 4P7FA 4EM6A 5DYTA 2BFOA 3LQFA 2R2AA 4LYJA 5E1OA 3P5SA 3R5HA 3LDAA 1XNQB 1SZDA 1U3VA 2XYPA 1W48A 2A9PA 3ZV7A 3BQ9A 1NNEA 3ZEAA 1QG4A 4DR1B 1R9NA 4BHTA 2P4EA 4LJYA 1R5JA 1QNLA 4ZQCB 4YMGA 2J9FB 1VKOA 1ZFNA 4IW3B 4JQYA 4LJ7A 4QGAA 5I8ZA 3WQBA 3DEJA 1D4OA 1X7ZB 2BFEB 2HJVA 3H8WA 4ND6A 2GARA 1LWOA 4JJ8A 4NU6A 3SXJA 3LRXA 821PA 3PDJA 4B4KA 4UEWA 4BMDA 4LRXA 5J4YA 2W2LD 3GEIA 1BQ3A 4INAA 3SJBA 1WUHS 3LPDA 1JHAA 3D4BA 3T7KA 3Q85A 5SYNA 3I3SR 4QTXA 1GM5A 3WRYC 3H9JA 2G17A 3OLXA 3OSZA 4DYDA 4MP3A 1IIRA 2DPGA 3ZJ4A 1YHNA 4DIDA 5J40A 1KPIA 1W85A 3DW3X 3PXUA 4QREA 4CIBA 2BBWA 5KVSA 3MM4A 3OPNA 1SKMA 4KCGA 2CBZA 2XNHA 4Q4HB 3O4IA 3IDFA 2DPLA 2YCBA 1IRXA 2PQ2A 3UWKA 3ELYA 2ZB2A 3KBBA 3SMQA 4MXDA 4OB8A 4QU0A 4TZ6A 4GD3Q 2PE5A 2PKEA 2V0CA 2BE7A 2YY5A 3MGKA 4Y2PA 2G8LA 5D86A 2I3AA 3IKVA 3QHQA 4M1EA 1LWNA 1ENYA 2ZAMA 4XIJA 4YH1A 4BRWA 2P9GA 2P2DA 1JBEA 2MMGA 2JAOA 1WV0A 3COZA 3PR3A 4FYMA 4EKYA 4MUNA 4QM7A 3DAOA 1OLUA 2B78A 3BDAA 1O97C 1FVHA 3PK0A 2C96A 3QEMB 5JQGF 3KEQA 1A71A 2HCJB 2Q5LA 1KDRA 2BDTA 2ECPA 1XEWX 2BFBB 2HIHA 5JO0A 3BE5A 1JT2A 1XD9A 3PFHA 4B47A 4LWOA 3TBFA 5AJZA 3MMSA 2ZRCA 1GOTA 5LZ7A 2HWUA 3WQRA 3EH2A 1PJRA 3S0JA 3ZWAA 4Y6PA 2Y3IA 5AKHA 2R60A 2RD2A 2QTGA 1W19A 4R8MA 3ZDRA 2C2BA 1FNBA 1MVOA 2JI6A 4HNAA 1FFXA 2OT3B 2P35A 2FK7A 1WEHA 3QXJA 2CVPA 1T3GA 2OGWA 4HGNA 2V74B 3C1OA 1Y7IA 3N9IA 3NBAA 1LF5A 3GJ5A 4I4NA 1CYEA 4PNHA 3DKIA 3SIPA 4OQPA 4BPBA 3H1EA 1D0IA 5KJ6A 4FT4A 2JAPA 1C7RA 4DMMA 3EMKA 4NR0A 1H8ED 1M34E 1MGPA 1SY7A 1Z22A 2BKVA 2HIMA 5T67A 4RF2A 1UBOS 2BSAA 2R6DA 3HEMA 3ZDAA 5AVWA 4D43A 3S29A 4WFKA 3OESA 4PXYA 3HDYA 2H1VA 3A58B 1FYEA 2M6RA 3GRPA 4UNQA 5KWIA 4CI9A 2VQDA 3H7IA 4DCPA 2WWYA 2JFYA 2VL7A 3N2KA 4OJKA 5EYPB 2QAGB 3U81A 1SCIA 2HRQA 4F4CA 2PEYA 2YRWA 4JOBA 4MUHA 1DEHA 4BQQA 3P2KA 5LXTF 3OLWA 3PX3A 4CR7A 3TLGB 2NU9B 2WSIA 4MH0R 5H5JA 4CHTA 4WXPA 1CJSA 4XEHA 5HBRA 1TYEB 5FOWA 5EJ6A 3LIPA 1T2NA 1BRTA 5K8TA 3HPRA 1V9LA 1W36C 2C0CA 1J4AA 3E8SA 3G2OA 5LQDA 2W43A 4Y1RA 1F5NA 3D5EA 2QOEA 2SCUB 1USUA 1VOTA 1JPJA 1SCAA 4FFBA 3PF8A 1YVEI 2GZ1A 4LYDA 1WL8A 5JDCC 1JZSA 5CM2Z 2DBYA 2EL9A 4AY3A 4RHCA 4ARAA 5JJLA 1UT8A 4ABYA 3IVCA 4RENA 4CMBA 1CV2A 1AZSC 3IQZA 3MMXA 4RIGA 2GHQA 1UXKA 3CRVA 4TN5A 2G1JA 3PR1A 4QDUA 5F78A 1UFRA 3VISA 5A6SB 3HXQA 1HL7A 3CW8X 1JLLB 5FO1A 2O1WA 2VZ0A 4EABA 5B3AA 3JQ9A 1XCLA 1KR2A 5LB4A 1FJHA 1N3IA 5AESA 4QEDA 2GCIA 4MV8A 1BCRA 3SC2A 1FSZA 2KBEA 2QSZA 4J1TA 4J1NA 2HRDA 4JELA 2RH8A 4L4XA 3EPPA 3RH0A 4J75A 2HO5A 2DWQA 1PLKA 1Q1QA 2OKGA 5FI5A 3V3TA 4ZVUA 3ZGLA 4LHYA 2B9EA 1EZZA 5EOVA 2HQBA 1PTJA 1GG9A 1OCEA 2ONKA 4FXPA 3HP1A 4QO8A 1YULA 4UDOA 2D5IA 2O8CB 3F97A 4R98A 4CMAA 2H51A 3V7WA 3QLJA 2CXOA 2LCFA 1HE3A 2ZJ6A 5EPEA 5CDTA 1IXRC 4AY2A 3SJCA 1N6RA 4X7BA 2QEQA 1ESNA 4UBIA 1GRVA 3FRIA 5GV7A 3RYFA 2J46A 4EQ6B 5I7SA 2B25A 4KX3A 2JHFA 1BD4A 4F85A 3QXHA 5JJBA 5GP1A 1LVHA 1VIAA 4EHKA 1K8RA 1EFHA 2D8AA 3WP1B 3MWKA 4BGVA 2SKCA 4XSHA 4BNDA 1X19A 1Q20A 5CBKA 2CNLA 1PVDA 3FLEA 4EY5A 1CRWG 1QZZA 3B70A 4XUCA 1XJ0A 2QMUA 3LVBA 4HAUA 5B5SA 3ZLJA 1Y1RA 2ZRQA 2IXDA 5EL0A 4AP6A 1VFNA 1OWOA 2J9XB 3D7NA 3THXB 4IEFB 2QY9A 4HRVA 5EJ7A 5DW0A 3K8QA 1GA4A 1ZOOA 3HJHA 1DXHA 4GE0A 2V7PA 3LTEA 3NVMB 4O33A 1VG0B 1OI7A 1SPXA 4TOIA 3EZ2A 4M9ZA 3SBDA 4K03A 4OJNA 1FLDA 3VXKA 2I78A 1QZXA 4DWJA 4F4HA 1E98A 1T3SA 2RGEA 2LE0A 2VF8A 4AJ2A 2H4YA 3CO0S 1BJKA 1RAIA 2O52A 1W52X 1UIRA 5MN6A 1LSOA 1XRNA 4LOLA 4RGYA 3E9NA 1DAMA 1PWEA 3RTGA 5DJ5A 3KAJA 3B60A 3I4LA 4MGZR 1J25A 2FX2A 2C98A 2JGMA 4C5CA 3BFVA 5JC1A 4OF4A 5TQVA 1I3MA 2GO1A 3U09A 3RUAA 2X58A 1P75A 4QFMA 3ZDFA 4KQXA 3C6YA 2UV8A 4TKUB 1OA1A 5A9SB 4XJXA 4YAIA 4WIAA 4BFUA 1DAPA 3ZYZA 2CBGA 5ULLA 1KXZA 3KSBC 1MIHA 2J5XA 4TPKA 5EQTA 1UBLS 4EHLA 5KDOA 2O8NA 1Z5OA 1OH8A 3UA4A 2R85A 2BSQA 3IHWA 4XX0B 4YCBA 2CFIA 1X7WB 4AP9A 1WHSB 1I2BA 2HGZA 2VPPA 2FN7A 3O3OB 4GLBA 5CX1A 3G9QA 2QORA 3B9QA 5ALJA 5JMWA 1GTRA 4K28A 1G9XA 2ODNA 3GIDA 1AKQA 3IKLA 5ES3A 5J5VA 1B0UA 2YNMC 3ZHOA 4G84A 3RR2A 3FDJA 2Q29A 1A9XA 2YZ7A 5B1IA 4UHBA 3HWSA 3ZE7A 5D1NA 5F7XA 2VBGA 4OFBA 2QM3A 3O93A 4E2XA 1NRWA 2CHFA 3E9CA 1Q0UA 1SIUA 3AF0A 3HO6A 4P82A 4R1UA 2VYVD 4RZXA 1D2AA 2GN8A 3DL4A 5AD1A 3OFND 1P91A 4KBYA 3ZTTA 1WJGA 5FADA 3DEYX 1THGA 4M21A 3HJGA 3GH1A 1BYUA 3GUZA 1QVAA 1X7YB 3TSWA 2VJNA 1XRLA 3VVBA 3WX0A 2GJAA 3HJBA 4OA5A 2WB4A 4WWHA 2LDXA 3HZZA 4H9GA 5DXFA 3GLGA 4C6SA 4Z8YA 1ZAYA 1MZVA 1XLTC 5CT5A 3RT1A 5DGCA 1CULC 5AM4A 2ZJ1A 1E4YA 1LRKA 4OHBA 2ISSD 1OYOA 2RC6A 2R1TA 1XPRA 1RHJA 2GO7A 1DBVO 1FS5A 4YJDA 2I4OA 3IUBA 3VV3A 4ESEA 3UB2A 1C3EA 3A4IA 4FUQA 4UAVA 3BK1A 3R4CA 4NXMB 4U63A 3V42A 4YV0A 1O6ZA 4PBTA 1N5IA 1TTQB 1RRMA 1XN1A 2ZDGA 4EARA 1T8YA 2MSKA 1EGAA 1UBSB 2GB4A 3NDIA 1PGQA 1XTZA 5LZ9A 1IDOA 2DWOA 1NN3A 4PAOA 3FB1A 4FX5A 3LE8A 5FYQA 4AKEA 1NVDA 4IDCA 1GPYA 4PZAA 4ZQGA 1YK0A 4N6NA 4WLEA 4U7FA 4A16A 4YGYA 3ZWNA 2W6NA 1JA9A 1M33A 1NJ8A 3CISA 5TGDA 1AD2A 3UHOA 5DGHA 4DG8A 4ZK2A 4FOSA 1AKVA 4W8OA 1Z5ZA 3FDXA 4IZ6A 3AVTA 4UFPA 4Z1OA 3LDUA 3F47A 2GPNA 2XYHA 2AN9A 3CW2A 4BO2A 4AP5A 4D99A 4B9EA 5CB0A 3BE8A 1SH7A 4MUAA 3CNEA 2VJPA 2XA9A 3OTGA 1KRHA 1ETHA 4B74A 1DZIA 4ZV7A 2M9MA 3JTMA 4HPJB 2UXCB 1N8SA 1LBQA 5AIAA 5EZSA 2ERXA 4PYLA 4DMLA 5FBLB 1W581 2E49A 3UC5A 3ICEA 2QTNA 3QBVA 4LF9B 1ZL2A 3INNA 2PZEA 2QTWB 1OLSA 3LUAA 2H06A 3OFJA 1YR8A 1VCIA 5BN3B 3SZGA 2WJPA 4ZICA 1FP2A 2I3DA 2J30A 3BK2A 3URMA 3M49A 4DWOA 2ZIEA 1QKKA 2IZ0A 4I9NA 3WKBA 1E2EA 1J5XA 2Y1LA 4KU4A 4XQEA 2DM6A 3S8MA 4UU0A 2CNOA 5JMOA 1KSFX 3IBSA 3BXGA 1IMOA 2C3PA 2B0CA 3G79A 2LV8A 5LDGA 3PCRB 3CWZA 4LRYA 3WBFA 2DFPA 4RTPA 1FLVA 1MXHA 1VPVA 1ZH4A 5I7EA 1YZYA 3MCVA 1G8GA 3N8IA 3O9ZA 3QA3E 3R6DA 4W1PA 4W63A 1PR3A 2HF8A 4ZAZA 5FORA 5FQNA 3ILSA 1OBVA 2PKCA 2V7EA 5FBRB 1UBRS 4H7PA 5B64A 1P81A 3E9DA 3I1IA 3LVFO 4MYHA 4PSUA 4PWZA 4Q21A 4ENSA 1MB4A 5C81A 2FWNA 3O4JA 2H17A 3FNIA 4JH0A 4MUIA 4CKEB 4S04A 3IVMA 4YRQA 3FNGA 3NIGB 4BDTA 1OFUX 4AJEA 3L7LA 4MQ5A 3TLKA 4RFVA 4C76A 2C1ZA 2VCYA 3MWLA 4I4LA 4P4UA 1BCSA 3L05A 4XARA 3RVKA 3GU3A 3WDKA 3NAQA 3EBOA 3WOVA 5IBRA 4QGBA 4U7GA 2A7QA 2CVQA 4TKMA 4W9MC 4S2EA 1BW9A 3S8YA 1NVVR 1KI6A 4YCCA 1L4YA 2YJZA 2JCGA 1K8XB 4DC0A 4RQAA 3T4EA 5MFPA 2JRCA 2EIXA 1OXKB 1UPFA 2JEYA 2JAHA 1B7GO 2AI1A 2PGDA 1E32A 2VKQA 2YWBA 4CQMB 5KVVA 4G5FA 4Q3DA 4XWWA 1LJ8A 4W5QA 3VH3A 4KE6A 2B35A 4W5TA 4URUR 4OB6A 4Q48A 4RMNA 1YNSA 3OZSA 4IIDA 4WBSA 1J2UA 1ZGAA 3IPYA 1FDIA 4XLTA 1KJIA 2O2EA 4MLDA 4CEHB 3RYIB 4YT2A 4Y1GA 2FWBA 3LK6A 4LFCB 1JMKC 1N7HA 3SJUA 4XD2A 1GPUA 1KF0A 3I23A 5EP3A 3L0IB 4J07A 1K6IA 3K0SA 2VTDA 3DH0A 2XSZA 3KJQA 1A88A 2O8FB 5CA1F 4M7WA 2G1PA 5EVJA 4L8WB 2GAJA 3A37A 3JYQA 1BA3A 2ZSIA 3O9VA 4X1YA 5L8VA 4JV5B 3OQBA 4GQBA 2F1IA 3JRXA 4NV0A 5I7OA 2E1RA 3ETGA 4OL9A 2PZKA 4BFVA 1WSAA 4TX1A 1ENPA 1DIGA 1N3BA 4BFSA 2WVJA 4P5EA 2NU8B 1YZTA 4CM4A 1ZMRA 1JALA 4G9GA 4M1YA 4RMJA 3WGLA 4D8VA 4XYGA 3N2NA 3O8QA 4TTSA 5CVDA 3HVIA 4CMCA 1NBMA 2EERA 2I2FA 2NQ2C 4HDSA 1NYQA 2GILA 5K0LA 3THXA 4GPD1 5KUTA 2ODBA 3FIJA 3UMRA 3OTQA 5E7JA 4GGPA 4MHOA 2JGDA 2ZM5A 3RAJA 1N9KA 3FSRA 3OJFA 5D7NA 2PGJA 4WK4B 4B7XA 5CA1A 2HUNA 4PYQA 1F8FA 2H00A 4JBLA 4RLSA 1SCDA 2A67A 3BWMA 4C4SA 3UT5A 5A4JA 3UHFA 2ONJA 5CFRA 5KYXB 2ENUA 4F8EA 1DAGA 5JH7F 3JAWB 2XJ9A 4TRNA 2ZI9A 4R0MA 3WQHA 5ITSA 3QTBA 4L8YA 2HDNB 2YQ5A 2WPDA 4OFWA 2GVDC 2I5PO 3WISA 4MYUA 4X1IB 1XAIA 3MJVA 1KDTA 1H6CA 5E9AA 1UMCA 3UXYA 5IMSA 4GRIA 1RE0A 2WE7A 3D7LA 4LXUA 1SOWA 3T38A 3DO6A 2DR0A 3Q3GE 5COAA 5AI4A 5C1IA 4HH3C 3D02A 3OE5A 3W78A 2IEYA 1DXYA 4BQOA 1DL5A 1Q16A 3H11A 3NB0A 1ECPA 3P9PA 1WW2A 1JEOA 1V2GA 3VDRA 4ZQFA 4Y6RA 3KWFA 5IBQA 3KVYA 5FJIA 1WUKS 3GLKA 3E35A 4UU7A 1V7CA 3ITEA 1VPTA 4XUEA 3AVYA 1KYYA 2XTNA 3JASA 2QM0A 1KZ1A 3CEJA 1TCBA 2VUSA 3K7EA 3P2IA 2R6JA 1SEPA 2VBFA 4GOXA 5CVCA 3ASYA 3WLMA 2OWEA 2HM7A 2ZJ2A 1I1HA 1Q7RA 4RH1A 5K3AA 4L76A 4C43A 5MGBA 5DBOA 1QAMA 2B36A 3AEKA 3GC6A 2P6UA 4W6ZA 5EIBD 1P33A 4C20A 3IHKA 4M0EA 1TJYA 1XU7A 2WWWA 1M2JA 3U49A 5B6PA 3V8NA 5BSKA 2ICAA 1OX4B 1XVAA 3NKLA 3UAZA 5JBQA 1E2IA 2HSDA 4X24A 4MI9A 3OWHA 2XMDA 4BN0A 1H4VB 2Z57A 4MQBA 1D6MA 1PR4A 1XMSA 1ZCZA 4M0MA 4GOKA 2P7IA 4IDQA 1VXOA 2HX1A 4E33A 2PJUA 3M4NA 3UHPA 1F14A 1ZK1A 3HBMA 5EMMA 2ODEA 3JW8A 3VDMA 2O7NA 4TSKA 1DO2A 2VHEA 4LYAA 4DC9A 3FCSB 4AXXA 3B38A 1WZEA 5LPNA 2FMKA 4C7VA 2C9YA 3GV0A 4WY2A 2OBNA 4P0QB 2WM9B 1L5VA 2AT1A 4EG4A 1O08A 1OU4A 2IYSA 4Y6OA 1YFZA 2PR2A 1DKPA 4Z3KA 3STTA 3G68A 5K9ZA 3U4IA 5CCBA 4R81A 4OXIA 3RPEA 1GNPA 2OZLA 4LCBA 2AR7A 3PWTA 4HEJA 5F23A 4LWQA 1CEQA 3OEEA 1YQXA 1W1IA 1Z35A 3A3PA 3EGOA 4J0FA 2LCIA 3UXMA 5AYVA 3FMFA 3KFLA 3W3AA 2DSNA 2QTFA 1Z12A 5I6DA 1KRWA 3INYA 4UCQA 3CNOA 1FTYA 3A06A 3M6FA 4UUQA 4XTRA 3P9RA 3SDBA 2IV3A 3TYXA 3NDJA 4AKHA 3KHUA 3NBFA 3DLCA 4F96A 1F7VA 2YWCA 4G5HA 2D6FA 3A1FA 4M38A 2G67A 1C9NA 1TCVA 3H6KA 3BREA 4BKRA 3KXKA 3EDMA 4O4HB 4OYHA 1ULBA 4EHBA 3OOHA 5GOTA 1JHVA 2VVTA 4F2GA 3I58A 2XUDA 2NZJA 3M5PA 1EAMA 1XRMA 2I65A 1NF2A 2RBGA 3U9LA 4IIHA 1H9BA 1GNTA 1YASA 1Z56C 3MELA 1XFAA 2HU7A 3DFKA 3OQIA 4TTPA 1FL9A 3RU3A 3IKTA 1R8YA 4IJ6A 3BDVA 2NZUG 3GCWA 4K3UA 4CKCB 2CWDA 4TYMA 2WD7A 3P4UA 3KQWA 4RKEA 5AK6A 5AM1A 1Y7TA 5B4UA 3P2JA 3KK0A 3NG1A 4JMPA 2A9OA 3SC3A 4XYMA 1T5DX 3M6WA 4YRRA 2QNIA 3PUKA 4MPDA 4OFZA 4TUYB 4YP9A 3SX0A 2P9ZA 1M8GA 5DVZA 2J0UB 3ZTYA 4D5EA 5L95A 3KV1A 4MB2A 6PFKA 4LNAA 2PQ6A 3B1YA 2ZUVA 4J0JA 3VTKA 3MT7A 5A7GA 3WQSB 3MTBA 1GRQA 3PI6A 5CXUA 4W1RA 2BM8A 2PL1A 3P45A 4G4SP 1HDRA 4PTLA 3CZMA 5DTMA 4CG0A 1FFBA 1RWMA 2XQFA 1J7KA 1QIDA 1NDUA 2R7AA 3R3JA 1WXWA 3M0EA 1VYVA 4AZVA 4BMNA 2OORA 2CJWA 2FP3A 3H2HA 1E0AA 3L18A 1RZRA 4NZ9A 3ZU3A 4DY6A 3NIFB 3UEOA 4LISA 1UL1X 3G5LA 2X1LA 4UZFA 3SFTA 3CCCA 3FG9A 4KN6A 2ZS9A 1CQJA 1XZNA 2IITA 4C22A 1LRJA 1KVSA 4EYEA 1Q3KA 1JLKA 1IWBB 2B8EA 4G5XA 4CW7A 3AIMA 2IYOA 3I2KA 3GZTB 3VVMA 2YFQA 2QQGA 1CTQA 2VP2A 4QHYA 5BW6B 1KWKA 3KVRA 4F3RA 3WGQA 1RRVA 4M1OA 1E5TA 2J0QA 1BX3A 1OI2A 1PQPA 4GG1A 2ZAYA 5KBYA 6NULA 4Z4GA 4CM8A 2AEEA 5A1TA 1MO5A 4HUQA 4Q7MB 3TNFA 5JQGA 2B1IA 4KN5A 4ARCA 3WGKA 2V98A 1BA2A 4OHXA 4RPKA 4YRIA 5B6JA 5JCZA 4QAJA 1Z0SA 5GONF 1PZEA 1FFCA 3NHUA 1NQUA 1VMEA 2X2OA 1E79A 1B43A 3PITA 1HC7A 1G8PA 4FMDF 1JDBC 1G7RA 4KPFC 4N03A 5CA1B 3AI3A 5LDDC 3G9ZA 4WBNA 4UUOA 1XTIA 5BUZA 1DKOA 1R00A 2XOKD 3CMMA 3AFHA 1ESCA 4KYVA 5ADVA 4MWGA 4CCSA 3BAZA 3SLRA 3U1VA 5GVSA 1BVHA 5C3MA 2GDJA 1BAPA 4QM6A 4EEZA 4Z4FA 1UIMA 3MHPA 4GVLA 4UHFA 3QLUC 4GDFA 2QVCA 4NECA 3ASUA 2ZETA 3HY3A 2FFRA 3T7IA 5A5FA 7AT1A 1S3IA 3L4SO 5LUAA 1YI1A 3ASZA 2PYIA 4EJFA 3CV3A 4GWKA 3WSTA 4JLBA 1DAFA 1J70A 1Y89A 3HFJA 4MRPA 5EUQB 2XYGA 1XKLA 3UCXA 4WKGA 3QE4A 5A4IS 4OHZA 1EUCA 1WD5A 5CP8A 4HNTA 4AY6A 1QH9A 4MR7A 1ZPDA 3P52A 2REBA 1U3WA 4IJ5A 4IOJA 1GZUA 3II6X 1D03A 1G3QA 3IEXA 2H2HA 1QK4A 3GRRA 3PBKA 3PUYA 4YRJA 4D8XA 3GNSA 3U16A 5K6AC 5C5IA 3BSSA 1TTPB 5BV1A 2Y68A 4U02A 2RHCA 2PZAA 3ANTA 1ZQ1A 2NYRA 3RBZA 3KQMA 4O2AB 3UUWA 4UUNA 5I7VA 3MLEA 3KETA 5FX2A 2FRVA 1FP6A 4LF8B 3LVRE 1RMYA 3EX7C 2NTVA 3PWSA 3F96A 3RE1A 2FPXA 2YASA 2ZAGA 3CO5A 3WLJA 3GX1A 4ALLA 4CF7A 4ZYYA 1YMUA 3UWSA 2G1UA 1ZBDA 2ZE7A 3AL3A 1YOVB 1BS2A 1QCDA 3C7DB 1E2GA 3CRRA 2G5GX 1N0VC 1ZXXA 3HH8A 4JB0A 4QGHA 3JXEA 3GLGE 4JJ4A 4E22A 2QJWA 2V4UA 1JFSA 2SHKA 2ZIXB 4ZGBA 4QDOA 1ULZA 3PLAE 3AY6A 5KNDH 3G0HA 1C80A 3W6UA 4IRUB 4IIGA 4MA4A 2AOTB 5EMLA 5AM3A 1C7EA 4ND7A 1H2BA 1W5EA 3C8MA 2YN0A 4JL5A 3NW9A 3NRJA 3PGA1 2W48A 3L8HA 3P8ZA 3JY6A 1CEEA 1QZUA 3NM4A 1BX0A 4TS1A 3TDMA 5T5QA 3ZHYA 3KOMA 4RFLA 4MEJA 3E9MA 2Z5GA 3COJA 5AKIA 1HKHA 1W8DA 1M67A 2IXTA 3H9UA 5IK2D 2MHCA 3NNDA 1O54A 3NIWA 4EPYA 1JVBA 1YTLA 1YL5A 3VR4A 1MR3F 1QGZA 3KLOA 4HPWA 4I7EA 4LECA 2LUOA 3C3EA 1RRKA 4Y0VA 4AULA 1J2JA 5KSOA 2ZBUA 3PWKA 4N7RA 4YJKA 5KNCH 2FOIA 2YV2A 4IH4A 3BQNB 4FSHA 2LNDA 1Z6TA 3JD3A 1P1CA 2YNMA 1Z5UA 3HVJA 3KJGA 4M53A 5ENZA 3FPLA 3T94A 3M83A 2KSQA 4YCLA 1CRPA 1T9KA 3I52A 5FPTA 3CVVA 1JHOA 2CFCA 5G0VA 1AQLA 2H1IA 4JEHA 3BTSA 3NEAA 4MW9A 4QHSA 4CTOA 1N5JA 1P7PA 4B4VA 1OT3A 3G0BA 3O0TA 4FNMA 4PCAA 1ZKDA 3O8BA 2BGMA 2GLTA 2QIOA 2ZSHA 1A76A 3BFPA 3R6GA 4WECA 5AHOA 2R7LA 4M1QA 2P62A 4LDRA 2UVDA 3E7WA 2N1MA 4XPZA 1IY2A 4XYEA 3M3DA 1RM5A 3T3MB 2PO5A 4RKYA 1ZJWA 1SVOA 1E3EA 2ONCA 2CJPA 4BQRA 3ID6C 1SIWA 4KXFB 2IWHA 4HN9A 3K16A 2K5UA 3C97A 4JBHA 4P54A 2Z5FA 1XSEA 1KSGA 1R4MA 4BB0A 1QK3A 4BNIA 2BFFA 2DFTA 2G9QA 4AT1A 5I7FA 5KSZA 3RF6A 1DCTA 3THOA 3HZHA 5E6SB 3N74A 4PC7A 5DTEA 1Q1ZA 3VKGA 3VI3B 3PGMA 5JAHA 5K3EA 5KJ1A 1JU3A 3MLAA 1WTAA 3OWXA 2QJOA 1FSSA 3IAAA 2X0FA 2QVXX 4DNQA 1E9FA 1CY2A 1EX1A 2XIJA 4LJ9A 4PANA 3PX7A 3ST7A 1ZD4A 1VI6A 4A2CA 4R9VA 5JY6A 2HCRA 2E5FA 1C4OA 2IX9A 4Y2SA 1SQFA 3TCXB 3AQ4A 4JNCA 1VPDA 3W2GA 4D26A 5AVQA 1YZQA 1Q91A 2H85A 2V1XA 3OMXA 3NZEA 2DFKB 3LU1A 2X4GA 4Q1BA 3AUAA 2Z1DA 2PUJA 1R9JA 3ETDA 3CINA 1IXSB 2N75A 2P5UA 4YXWD 5JZSA 4X91A 1RJDA 3IELA 4E5UA 2CXUA 2QAGA 1ABFA 1Z08A 1Z33A 4D8WA 4E5DA 5EXXA 2CSXA 3NV7A 5EIFA 4ZCLA 1M3SA 5GIPE 5A3SA 2Z95A 2IU6A 1VP9A 1U8ZA 2IDMA 4MQ6A 3NT2A 2JI8A 3ETHA 1YJQA 4G56A 1CQWA 4IDPA 1VTKA 4G0PA 4QNMA 3T5CA 3GT0A 1JH9A 2B4QA 3L0BA 5A4FS 3U4AA 1Q0PA 3DB2A 3VYUB 1PV1A 5FJJA 5F7JA 1ENOA 1PL7A 1VLLA 1AS3A 3LIIA 2JFVA 1JTFA 4PG8A 1RPTA 2OWDA 3R5KA 4MP8A 3MJRA 1N5DA 5JMTA 1G4UR 4GBED 3UY4A 2W11A 1GRRA 1PJ2A 2VT2A 2G04A 3NRBA 4KVFA 3OPVA 4MW6A 4OQYA 1NMEA 3PDCA 4QELA 3VC3A 4OAQA 3WWPA 4URWR 3TRKA 1MAAA 5DK6A 2XKKA 4GXQA 2DHEA 1T8TA 3DUFB 3ANSA 3VQTA 3G82C 2F1RA 3UGJA 5IASA 2ZM6B 4CEIB 2WSLA 2DU8A 5BN4B 2NACA 4Q03A 2WFLB 1KYVA 1HSZA 3DOUA 2XVXA 3ISTA 3AEQA 2AEJA 4ACAA 4G25A 1GG2A 1G8YA 1SZJG 3L6OO 1KY4A 4H7JA 4YPOA 1GCGA 1RAGA 3LQ2A 1RWOA 3IEUA 3LUJA 4K87A 3ERCA 1H1TA 5EINA 4ZOQI 3VNRA 3C5EA 4Z7OB 4DLLA 3YASA 4LBZA 2G3YA 1UT5A 5A2QA 3WWEA 2QS9A 3ORRA 2WWXA 5KOJB 1UFKA 5G4KB 5DN6A 2IZ1A 5I47A 3CVYA 1W93A 1THMA 1K1EA 1XEXA 1P39A 4HDNB 5FTKA 3DOJA 3UANA 2IEAA 4YUAA 3MTAA 3DZ8A 2A3RA 4UFOA 4YCDA 3ZGVA 5J58A 4TLMB 5ALVA 3AGQA 3W6ZA 4UMFA 3VGJA 2REXB 5BOVA 1U0EA 2KS6A 3ZI4A 2OD2A 3NONA 3PJEA 4PHHA 4EEKA 2OENG 4JB3A 6GPBA 4GP7A 1TKRA 2PUGA 3B9RA 4DDTA 4B6EA 3GCGA 4JJGA 3MOIA 4OXQA 1LDMA 1ZJ5A 2AF3C 3D1JA 2VDQB 3AEKB 1GZ5A 3ELBA 3WL6A 5LM3A 1T2FA 4D44A 1ZD9A 5D3ZA 2DZDA 1FUKA 2G6TA 1FX0A 2QTVB 3P9KA 4BZPA 3NDBB 1MHPA 2ZJAA 4BNKA 2D2FA 1R0LA 4KXVA 2QT9A 3R6WA 1HY3A 3LXRA 1EUYA 3JASB 4R2LA 4JDUA 2W2PA 3SY8A 3TS1A 1ULTA 4JU8A 2CMKA 3ZXSA 1KSJA 2XWQA 4INJA 2O0MA 3DMFA 3KBOA 3DM5A 4U00A 5AKZA 3DW1X 2EF0A 3PEUA 4R1SA 4TTAA 1M2VA 2OCYC 3EDYA 1E6UA 5KTMA 1VE6A 3RVSA 3T4PA 4WZ6A 4CMIB 5D01A 1G4HA 2HA4A 3BRQA 4I2NA 3COSA 3KPWA 5HCUA 1YE3A 4IJVA 3KB6A 4PGHA 5BSUA 3UAOA 3ZS8A 3SICE 5EUMA 3Q3EA 1WAMA 1G1MA 1P31A 4DPLA 5FTLA 3MILA 4G89A 2W7TA 3RFCA 2ZUCA 1P18A 4QBFA 3V3KA 4NDZA 3B5JA 4HO1X 3QJGA 2WJ3A 4C3OB 3H86A 1IMJA 4OM8A 2OGSA 2I34A 3CXUA 4I1IA 3H2IA 4PAQA 4MGKR 1JR3A 1B6GA 2XVAA 4HDQB 4LMBA 4LX8A 5F5XA 1M6VA 3OMWA 2HMWA 2K7FA 2CMDA 4G1MB 1GRCA 1LJLA 2WWTA 3AJAA 3DNPA 3GQBA 3DP7A 4IJMA 2FR1A 2PGLA 1R7RA 1I13A 2XUIA 3DVAA 4LVOA 4EENA 2YYSA 3LZ6A 1UDWA 1VBFA 2OHXA 2FEWB 1FFEA 1MORA 1RZ3A 2WU0A 5HG0A 1Z16A 3PXGA 5ARBA 5K3SA 1ZBQA 2F8LA 4ALIA 3WA6A 5D3QA 2PJRA 2WRZA 1T5SA 3PQ6A 1ARZA 4A73A 4J9VA 1E2UA 1U8UA 3LA8A 1FNMA 3U6KA 2R3SA 2BHTA 3ZKAA 1E9SA 4YBZA 5IDWA 1TM5E 3C3AA 3C85A 5IEBA 4BGDA 1CRZA 1ZSYA 3LFHA 1ZVJA 4WASA 3C48A 2ZTSA 4ZT2A 1E2PA 1SQGA 4O63O 4QNNA 3X44A 2CXTA 3TGLA 4PHCA 3LLMA 1H2FA 2V7BA 1H1LA 4NK4A 4QYXA 2G1AA 5FLXA 3U7GA 3UZUA 1P4SA 4X92A 3OJWA 5ER6A 2JASA 5JAUA 3AY3A 5J2TA 2B34A 2YVUA 3FNBA 1ZP6A 4JLKA 4D9NA 2J41A 1F6WA 2IEDA 4RHUA 1PJAA 1ZGHA 1U3UA 1Q57A 4MVWA 3AL2A 5LD2B 3TI9A 3G2LA 1U0GA 2XH8A 3PT9A 3C1TA 1YJBA 3NTQA 1C9JA 3L1VA 4MO2A 2E37A 3IAFA 2P4SA 1GQRA 2G1KA 1Y1QA 1OYYA 2VP4A 3KVVA 1IUKA 3DDCA 3KE8A 4XVRA 2AFHE 4JI4B 1SQ0A 2R6ZA 2WF7A 1WHTA 4XYBA 3W7AA 2EG5A 2L69A 5HBGA 2W6IA 3G23A 4KVZA 1YS2X 1I3KA 2Z3VA 1M83A 3UKOA 1P0MA 4US2R 1LY1A 1JSRA 3LL4A 2V3VA 4KIGA 1AXEA 4O2BB 1A5BB 4O4JB 4ZOLB 4REMA 4FNAA 3WL3A 1YS9A 1OH5A 5A4KA 3IRVA 1VJDA 2HNBA 2UUOA 4CM9D 4C05A 2VHYA 3T4UA 4RKQA 2YIVX 1SM4A 5A06A 3WZLA 1QFXA 4BQFA 2QAGC 4E07A 1QE5A 3GRZA 3ILXA 1FQOA 2W0MA 1MH9A 3AHFA 3HR4A 2HBRA 4ZQIA 4WNAB 3P7MA 4CDGA 1P72A 3SKXA 5A03A 1I10A 2BM1A 2FSFA 3UAYA 1F2VA 4Q9NA 4TRRA 3BGOS 1M2VB 2HIGA 3N75A 4KV7A 4PZLA 3TUJC 4ZGGA 1VYUA 5TMPA 1YAHA 3D81A 1P8AA 2XE4A 2COKA 2EW1A 1Y5LA 2C5BA 3QFSA 4LNHA 1AUPA 1C1XA 1S6YA 5B37A 1W6UA 1DKUA 4JLVA 4ZHQA 3FHLA 2ABWA 4RHYA 3P4YA 1T1IA 5F2NA 5LLTA 4R2KA 4IX9A 1U9CA 2I22A 4PPYA 4NYMR 2YWJA 4C78A 2E3JA 1UXJA 4O08A 1PAUA 2GYWA 4FT2A 1XLTA 5EIEA 3IXMA 3EASA 2HHLA 2EHDA 4MUBA 3ZX4A 5I7RA 1GTMA 3T5DA 4HDKA 5K8JB 3IQDB 1Y48E 1JILA 5GZ1A 2ZYRA 4R9SA 5JWOA 1CIPA 1Z13A 2BHNA 3IP3A 3NU1A 3OX1A 2V7WA 1LVUA 1NUQA 1Z0UA 4IHJA 1OQAA 5ERGB 3S27A 3TOVA 3ADDA 2Q7XA 3JWPA 1UC5B 5K03A 1DJOA 3B2NA 4ZCTA 5F9FA 1U7TA 1I0LA 2QYTA 2ZCUA 4YJ2B 5ERYA 5I9SA 1BDJA 5DN9A 2ZUDA 3WHPA 2CMHA 3PI7A 3B85A 4AUNA 3L7BA 4QQNA 4B3FX 3BFKA 4BLWA 5EHZA 4BFYA 1X38A 3LKVA 3STHA 3IO5A 1FLAA 1H2RS 4PU0A 5AVKA 2CEAA 3HXPA 1J42A 3GJRA 3IQWA 3OIWA 2OL4A 3PXEA 4OXXA 1TAHA 2JIPA 2ZJFA 4DPKA 3KAQA 3WBBA 3ZI0A 3DV0B 4NK5A 3ZUGA 2E4VA 5ED4A 1ESDA 4V0QA 5KDLA 3PS9A 4H31A 2MU1A 2C04A 3JD2A 2H2FA 1DADA 3A4MA 3BJRA 4G0XA 4HEA6 4JROA 3AVOA 1LPNA 3GT4A 4BB5A 1RRCA 4OHYA 4IHJF 1MD9A 2CLKB 1RQPA 3ZU6A 1Z39A 4Z5XA 3GDFA 1QIKA 2WSYB 1TE2A 3HM2A 4OHPA 5M2QA 1BH2A 1CIVA 2CFOA 2ZIXA 1IN1A 5A5EA 1KEKA 4G01B 3O92A 3PLNA 3D31A 2GTHA 2AFHA 2YMPA 3CF4G 3G9UA 3KKMA 4O2LA 2Z56A 2AB0A 1UFQA 5I4CA 3DE0X 1T10A 1X77A 3NBKA 2HXGA 3CQ9A 5TARA 2HF7A 4X1KB 3HXMA 2EDCA 2MSDB 5I8PA 1ZM2A 2TSYB 4DLAA 2C9OA 4D46A 4P86A 2I0FA 4EH1A 2D0IA 1J23A 3BXXA 3CMCO 3FMGA 4MYSA 3O8CA 5LMUB 1A7JA 5B53A 5G0SA 2PXCA 2VSOA 3ENWA 3NPMA 5CG1A 4WTOA 3ZC3A 4P08A 5MF6A 5FAXA 2NX2A 2P6PA 1ML4A 1IUPA 3CLVA 4XWGA 4RY2A 2AFIB 2GAOA 1MQ9A 5A9TA 2ONYA 4BO1A 3M82A 3OZDA 3UMMA 4HDNA 4E5PA 3I9JA 4K81B 1Y8QA 4B8WA 2F00A 2IY7A 4NCIA 3V4VB 4PZ0A 2C9CA 1Z4JA 4HQNA 3B6JA 3O38A 1GKLA 4RA9A 4RD0A 1QZTA 4WE3A 1M1YE 1XK7A 3ZGOA 3KB8A 4X95A 1W0JA 3RAPR 1E6MA 4BBAA 5ITWA 3H9GA 1WCIB 1E4EB 3V46A 3KUCA 1QPBA 5A4MS 2RE8A 2WG0A 1OPRA 4K9DA 4KXUA 2ZS7A 4XGQA 2DUWA 1HQDA 3FMIA 1ZW1A 2BLNA 2W00A 3A9CA 4YREA 1NATA 4IV0A 5LWQA 1SOMA 2G83A 4AUMA 1CUGA 1WBDA 4BMVA 1ZXLA 1LI7A 1MW9X 2IKQA 3MW8A 4QU8A 1BGVA 2DCUA 3NAGA 3MXTA 3MSXA 4Q3OA 5F3WB 4EOGA 3PPXA 2VTBB 3FCCA 4HYEA 4R01A 3VTFA 3N6XA 3HUDA 4MJ7A 4D9JA 4M2LA 4FP9A 1CEXA 2XZPA 3A0RB 4QFBA 5JFOA 2VYQA 3W8DA 5TDHA 2QL5A 1YUNA 3UXHA 1OFGA 3CSSA 4JIGA 5ED0A 5KIAA 1B16A 4FJ2A 2A9QA 1O03A 1UEJA 4C7OA 4P8RA 5FOTA 1RPJA 3W34A 3OOEA 1R6VA 3N0XA 1V4BA 2QXYA 2Y66A 3CH5A 3F4KA 3VPHA 4CF6A 1OI3A 4LBYA 1RAHA 2BM9A 1NONA 1XCPA 3ESCA 2QLNA 3I9OA 4P36A 2ZJ0A 5KYTA 1E7RA 1N36B 2Z08A 3QVLA 1PFUA 3RK0A 1J24A 4BNJA 3SQLA 3H87A 4CGYA 2VDVE 1G9TA 4X6UA 721PA 4ZO9A 4RETA 3F0TA 3WTBA 3WTCA 5JD5A 1QHFA 2IEBA 3DMPA 3QVUA 4NY1A 5KJFA 2DY1A 3VO9A 1WVIA 2E2WA 4AMYA 3SX2A 1G4AE 4F1JA 3NJ4A 1N8KA 3LBYA 4BO5A 5BN3A 3SM9A 2JLUA 4HDSB 1ONNA 4NOLA 8ABPA 1C8BA 3KFVA 4QYIA 1H2AS 3LO8A 4OXKA 2NVWA 2JFZA 4X63A 5L4NA 2Q5QA 1T1EA 2XUHA 2J0UA 2F17A 2PS9A 2NPOA 3O2JA 4FC7A 3WGJA 1RVDA 2I71A 3ADOA 3PNBA 1GFIA 1U0OC 3KKZA 3SYKA 1K4MA 3KQVA 3L1UA 1W5FA 2O7SA 4C6RA 3KU4A 4EKIA 3TUZC 4U7WA 4GQIA 1W4CA 4ARVA 1UJ5A 1YB7A 4DLTA 4WADA 3DTVA 2O5CA 4GZ3A 4YJHB 2JZNA 3FWHA 4ZT3A 3VC1A 1R64A 5HRUA 1ORIA 4D97A 2YV5A 2QVZX 5C46F 1V3QE 5JOQA 3L07A 1OIVA 3HMQA 4QDZA 2UXDB 3DFIA 5CEFA 2V6JA 1N6KA 3A9SA 4D3YA 1QHNA 5LP6F 1XNJA 4FEGA 1RYHA 2I6GA 1Y3FE 5JASA 3T5AA 3U9TA 3CZAA 5T4HA 1O95C 1NP3A 1YRLA 1CX9B 1RJFA 4DR6B 1AS2A 4MW7A 4HLQB 2VXCA 5B36A 2ZK7A 4Q34A 2JFWA 4YRPA 4CQMA 1KI1A 1RW4A 1YBMA 4UM5A 4YUYA 4DCSA 3NBZC 1P2GA 2HXYA 1V5IA 2ACWA 2QQ0A 1QP8A 1EDDA 4A2PA 4X6LA 3ZK8A 3K20A 4ZAFA 3STYA 4IKPA 4XGRA 2NU9A 2WJJA 3IJ5A 3IMCA 1AGYA 5FOSA 1YVDA 3K2EA 3IR7A 2G0TA 3NORA 5F9MA 4JYMA 2B4RO 3RFVA 2CVZA 4M9UA 2PMWB 1XPJA 4QOIA 4TV9A 5K7SA 2J3IA 2WW8A 1QDLB 4LYHA 2CXSA 2XQKA 3GGGA 4S1WA 2C84A 3AQIA 4DA9A 4EVIA 1V8FA 5JQWA 4D79A 3QV1A 2IHBA 2NO4A 4HCJA 2V3CC 1ZK4A 1AO0A 4BJ5A 3DKVA 1IZ7A 3A1DA 1T9GR 4KPUB 1HTTA 3E7PA 4Q0MA 3W9YA 1ONPA 4UE2A 2OSVA 1FXSA 3ZWMA 4ETMA 2YUIA 3R40A 5G3YA 4BBPA 4DDWA 2ALJA 4J49A 4V39A 3MTJA 5EWLA 1KFJB 1XMIA 5DI3B 4L8GA 3UOAB 3EFOB 2PS3A 4PQRA 1TPYA 2GDZA 3WRYA 3RWOA 4LS3A 2J3KA 4MW1A 2G0NA 1EA5A 5LC1A 2R66A 1PQUA 4N39A 4YO7A 3EPHA 1QOPB 4YMSA 4ZC1A 5AHXA 1RXUA 1G3MA 4XB1A 2C5AA 1UDRA 2QK4A 4PX2A 4O1MA 4X7PA 1LV7A 2E89A 3PHGA 3BUSA 1ZMXA 2CNDA 2YN2A 3JR3A 4FYXA 4YUZA 5EPUA 4LMPA 4WH0A 1A5AB 2JVKA 3IERA 4NBUA 1D2GA 3CE6A 3OEED 3WL4A 4DLRA 2P91A 1U8EA 2QI9C 3ROEA 4BJ1A 5FWDA 1DQZA 1MC5A 4R05A 1FF9A 1O94C 1NGSA 2XNDD 1L5WA 4GZLA 4Q6WA 3AP2A 4HDKB 2JDID 5C4MA 3RUCA 4JNKA 2HWWA 2X6TA 2BGWA 3OX3A 5DE3A 1DGQA 3ESRA 4R84A 1DKQA 1FNNA 1KHTA 2GM5A 2VT7A 4YMTA 3L2OB 4DF3A 3MCWA 1C4XA 2GQ0A 3BBLA 5INTA 2C4MA 2XE7A 1D6JA 1CRQA 2ZRFA 2HB6A 1SUFA 3ILVA 3OZ7A 4CVNA 1KAEA 4KQKA 4YIHA 1MRSA 2PM8A 1CWUA 1XRJA 4LI0A 3R7LA 3MG9A 3I28A 3ZCPA 2ZJ7A 2M1XA 4L8VA 2V8BA 4U2FA 3AWIA 4UD6A 4Y6LA 5AW5A 4BS9A 2R751 4UXHA 3DZGA 3UICA 4ATNA 3OSUA 2QX6A 5KOJA 1JQ3A 3V2GA 5TPWA 1SHLA 3CRZA 2CUZA 1UQTA 1AGRA 2PAAA 1FB5A 3IS3A 3NNNA 3QPUA 4LEIA 4NC9A 5EUBA 1YRHA 4AM8A 3JSXA 3NHYA 4HSGA 1EVLA 5DLQC 2DQZA 5EJ2A 3CLSC 2QGFA 2GN1A 4B7CA 5K0TA 4QG7A 3C74A 4AO8A 4BAUA 3M1AA 4FFBB 3DEIA 2DP4E 4JI8B 3M4JA 3NT4A 3OO0A 3QVGB 1KTVA 1PG2A 1R0ZA 2BFPA 1V95A 4NICA 4B17A 4C0SA 3FSEA 4YR7A 5I51A 5BYAA 4DB4A 1RJ9B 3KEFA 1JWLA 1K68A 1SBCA 4KZKA 4TSFD 4BB9A 3ETJA 1Z0FA 4DDKA 3O1LA 1KZ4A 3QPVA 4PW0A 5J43A 1X7DA 5LP6A 1UFVA 1SXJE 2PUCA 4GX5A 2FHSA 1VE3A 3DXZA 5G02A 2GR9A 3DZHA 4L9AA 4ZTBA 4QARA 3L7IA 4I50F 1I1QB 4QEKA 2BGTA 1W5BA 4RZ2A 4M99A 4TTJA 3HEAA 3LY7A 4DM7A 3G49A 1V9CA 1K08A 3RIMA 2FHPA 2D00A 1U0SY 1HNWB 2EHJA 4HVAA 1UJNA 1MA3A 3K9BA 4H17A 4TROA 1SUCA 2I4IA 3ZWBA 1DMSA 4J2HA 2HA3A 5LXTB 2QENA 4ZJYA 3EGDA 3PHHA 1H85A 2O0HA 4JVLA 3WYCA 5E38A 5DSTA 4F45A 2HADA 3EIUA 4G0MA 3O3NB 3AOGA 3OJOA 4BMSA 1DG3A 1SBYA 3HKDA 3IEIA 3D6UA 2NTNA 2FRXA 2ZE8A 3HA5A 3K5HA 4ACBA 3ISVA 4JT8A 4LDPA 4BGUA 5BN5A 4P4TA 3I9LA 2QE7D 2MOKA 3VOSA 4KODA 4TV9B 4L7QA 4CLXA 1FDTA 1J21A 1XA0A 3L7KA 5FA8A 1LPOA 1TQDA 4ISCA 4Q47A 4A1OA 4F04A 3H2YA 1Z5WA 3KS9A 4JBNA 1PCXA 4N5HX 1YOVA 2RK4A 1NV8A 3H4TA 2A5FA 3FVQA 3OQVA 5H1YA 1B8NA 2FZVA 4XVQA 2AJCA 3CT6A 4RPCA 4IVPA 3RYIA 3S2YA 1UPUA 2BMJA 1QIMA 5EE3A 5EERA 2PRZA 3UHJA 3K09C 2B1GA 4XIIA 5KYGA 1SWWA 1SHUX 1E6LA 3GA5A 1I1OA 2X2FA 1SKUA 4PZPA 3K9HA 3HKBA 4RD4A 5TGTA 1MA0A 1Q7BA 4HBZA 1MDBA 4RNDB 4Z9BA 1O94A 4JB2A 1JL3A 1RYDA 1NKTA 2COUA 3NIDB 4QUDA 4ZRMA 4D9CA 4ZAWA 4W9NA 4YAEA 5BNWA 3H5RA 1YF3A 2CV2A 1AF7A 3W5SA 1ZC3A 4DSOA 5LNK1 2HSZA 2WM3A 4IQFA 1S01A 2FF7A 1K63A 1M8KA 1ID8A 2A58A 2AMVA 1D8AA 4JBXA 4KE9A 1P3DA 5DXJA 2QE6A 2FAXA 5DX8A 4JVSB 1PK7A 4BMYA 5HYVA 4P83A 2XSZD 4M7RA 1C81A 1GA6A 2Q5HA 4Q4DA 4DIBA 1UBEA 3GY0A 4NENA 4Y8VA 2P0YA 3H4IA 4OUDA 4BFTA 2XB8A 3IJPA 3PCXA 1NC3A 4JZYA 1OTHA 4RIEA 3IUEA 3FYHA 2G5TA 4H27A 4JVNA 1L4LA 1KVTA 2OCGA 3QVKA 4R3NA 2O3JA 3OQNA 5A0VA 5IVHA 3HCEA 1UC8A 1YHYA 5KWVA 1Y1SA 2R7NA 3LGAA 3NVDA 4DBZA 1O95A 2BONA 2F9FA 3HKEA 4LSWA 5J2TF 4DADA 1H42A 4WKBA 4YJGB 3GPLA 3ABZA 2KLBA 3NHWA 4P4NA 3RG8A 2UXBB 2RHBA 2ZR0A 4GP9A 1U0FA 4FGUA 5U4QA 3PUHA 1YI0A 1E1YA 3PNVA 3ZVRA 5A62A 5LP6B 1HOXA 2CDRA 2CLCX 2ACKA 1U2SA 4IM7A 4HUQB 5JQGB 2IBMA 4X8OA 2YH2A 4ECEA 3BXHA 1QOZA 2JBAA 1RJ9A 2PSHA 1N5KA 4IKEA 1NXPA 2DY0A 2YBEA 4Z9YA 2IK8A 1V26A 1Q5PA 1TJ5A 2NV2B 4C4TA 1TU4A 3ZH9B 1RU3A 4EFLA 4CM8B 1R0KA 3A1WA 1ZNQO 1BXRB 1G8AA 4QYMA 2NADA 1ZRNA 4RY9A 4EL0A 5IN5A 4NP6A 1GNVA 3FJ1A 3UGKA 3RG2A 2PAFA 3U6BA 2J85A 3E23A 4WGFA 3FFTA 5A3VA 3TZBA 3ZDBA 1RKQA 1X14A 3QUCA 4WX2B 1NUTA 3UH0A 1NJFA 2PK3A 1U2PA 4BP9A 1KOJA 4EY3A 5IF9A 3H8VA 9MHTA 3F46A 1UINA 1RLTA 5BO5A 3TQIA 3UQYS 4HLUC 3OJCA 2QBYB 3RSFA 1LNQA 2WFZA 3UAXA 1DXQA 3QQPA 5DX0A 4MUKA 1LGYA 1TF2A 4QRIA 2FEAA 1TAQA 2IYNA 2FCRA 2IIPA 2PKWA 5HW0A 5KSWB 2FZCA 1ZRMA 2WNHA 1IHDA 1O94D 4GMKA 4GPTA 3U4DA 2BFCA 2MYPA 3A2LA 5CTAA 5KYWA 1W36D 2XZOA 4MCJA 4TYNA 4GUDA 4RK0A 2NM0A 1CY0A 3TAXA 1LDBA 4HP8A 4HEQA 3U3JA 4WN3A 5IT0A 2IP2A 4DSUA 1GPMA 4B45A 5GJWC 3N3AC 1PFWA 4JYCA 1IJKA 5EZ6B 4Q24A 2Q41A 5LVAA 4JXZA 4IJUA 1TYAE 2OLKA 3I30X 3QVVA 1EXNA 3D6MA 3KJZA 1RADA 4P98A 3KZXA 2C7PA 3E53A 1TMGE 1HMPA 4EI8A 1T4CB 1NY5A 1JIUA 4PX3A 3PFKA 1P6XA 1HYHA 1JDUA 4KSBA 4CEHA 1IHUA 1PUIA 3TM5A 3L8GA 1R8SA 1YR7A 3T1OA 1ZGGA 1UJMA 2GYYA 1OXUA 2H18A 3LYLA 3X0DA 3U61B 2PWBA 1FQKA 1NUPA 3V1NA 1WX1A 5CB4F 1Z88A 1Y9AA 5F7ZA 2HTFA 3EVNA 1I51A 3UIEA 4QBIA 3CM0A 4P53A 4X54A 4DB2A 2A9JA 2EBHX 3GWGA 4JYPA 1O0CA 2PX6A 2VHZA 1M0WA 2B6NA 3QBDA 1HT3A 3U4MA 2JGAA 5BRJA 2PWAA 2WAMA 4AIRA 2FOXA 1XB2A 3LQQA 1AB5A 1NX9A 2WD9A 3IV7A 4LNUB 2P4HX 4RJ2A 4C30A 5BSEA 4QWMA 3HEBA 1PX2A 4INOA 3ZG6A 3ZWDA 2WIAA 1YZ3A 5H82A 2H5JA 2BFBA 2EX1A 3M1LA 4J90A 5BW5A 1E3TA 3DFUA 4XSGA 2O54A 5DM4A 5PGMA 1D07A 2JEZA 5EMKA 2DVMA 3QEAZ 4K9SA 4FD2A 2HHJA 3HGTA 4D9GA 2A88A 5CB6A 4ZZ1A 5B55A 1WTCA 3QEKA 4F6CA 3IR6A 1MQAA 4DMUB 5GGXA 3DF7A 4AMZA 2VT3A 1DZ3A 4MW0A 4ES6A 2CV1A 4GDMA 3RQIA 2FDCA 4KR3A 3KQNA 4PHTA 3VNSA 1DIAA 1G5HA 1XAJA 2R68A 3E9QA 1EDBA 1FSGA 3GRYA 3JQGB 3N53A 3QYJA 4G3XA 4MK4A 5JNTA 1RXEA 3S2FA 3WRWA 2XKAA 3EDOA 2YXLA 4YXWA 4OFXA 4GBJA 4D41A 4DR5B 1P2DA 3PHJA 4WNYA 3TQFA 2HXSA 4U9IS 2HWKA 3K9FC 3H1AA 3FPHA 2Q5CA 1MJNA 3GW8A 1K6EA 3I09A 5CM8B 5FIUA 4XA8A 1WUYA 1ESZA 5HIAA 3EPKA 4H3VA 3ZD7A 3M4XA 1A5SB 1FPMA 2ODAA 3GIWA 2PLFA 1H3FA 1FTGA 3K0EA 2H0RA 1LA2A 2KLHA 5A02A 1FFHA 4FYKA 1DCMA 3KSDO 3A6DA 3TW8B 4EL5A 2V7UA 1KA9H 4HTAA 5IJAA 2WT8A 3GHYA 5LA6A 2GZ3A 1SC6A 4GR5A 1K5GA 4D74A 2XNJA 4IDHA 3JSAA 4LJRA 1WSDA 1WW3A 5IT9A 2SKDA 2Y05A 3O4FA 4UHJA 1XHLA 3IPLA 5I48A 5M04A 4MJXA 3M3PA 5DMHA 4DCNA 4LJLA 1PEKE 3G89A 4ZT5A 1A97A 2VNJA 4YA6A 3IODA 2QX4A 1IJFA 3QVTA 1H0SA 1C50A 3NH6A 1ONBA 2EJBA 3E9ZA 3HA3A 3P9XA 1XU9A 2OHOA 2QVLA 3M9LA 4M49A 1MQ8B 2PL3A 1U8FO 3MEQA 4FQ8A 4BAGA 3ZZUA 1QC5A 2Q2WA 3NWJA 1CS0B 2ASVA 1A4XA 1VBKA 1NVMB 1HTWA 2EFDB 2E21A 2YX1A 4OCZA 1A1SA 5HMMA 3WFZA 2QT0A 5F7OA 2C7RA 4EB3A 5KZMB 3BZBA 1TJ4A 4RC9A 1Z75A 3PA8A 3HBJA 4OUKX 1A7UA 1K2WA 2ZIWB 4Q1EA 2OCXA 4RSHA 5IFKA 1FMLA 1TW2A 2NQ8A 2O50A 1IPFA 4HDMB 4I3GA 4K6HA 4LV6A 4AURA 3M5WA 1IZYA 2Y4NA 1KO5A 1X9IA 3DXFA 2IOHA 4KO1S 2R6CA 2VTKA 3ORYA 3PPVA 3RHFA 4C0HA 2X0DA 4E7OA 3SBEA 4W5NA 2PGXA 3K9QO 4BO7A 4C7XA 3CGGA 1UPCA 3F3YA 1EQ2A 5KNCA 2VOEA 3O2SB 4CDRA 1H93A 3ZNPA 2QUZA 3WDMA 3L77A 1D1SA 2J07A 1H4TA 2ZT7A 4BUZA 2LVBA 1PSZA 2E4YA 1WMEA 3SE0A 2NSYA 5CB4A 1CZOA 4ER6A 4TL9A 4FFLA 5EE9A 2FQ1A 2CW5A 3AUSA 5THQA 3F8TA 1CUBA 4Q12A 1YJAA 1GDHA 2H31A 2GRUA 2WPNA 3DVRX 2OZVA 3C15C 2NU7B 2PMDA 3VZRA 1R0RE 3W2EA 3LUKA 3FOAA 3EXIB 4F8JA 5J2TB 4JC0A 3QELA 4G0OA 2X4DA 3U48A 4A15A 1E8DA 1PBNA 1O6GA 2P2SA 3OEYA 3CA8A 4EY7A 1GQQA 3TL6A 5K99A 1C0KA 1A9XB 4NF2A 3TRHA 4OATA 1XYGA 1ZSNA 1KJYA 3IBCA 5CDUA 4WESB 2ZZKA 1R3DA 3EF1A 3F6SA 5TQ0B 4EUSA 1Y42X 2FZLA 2D7JA 3L84A 4EUFA 3MRTA 2Y1GA 4Y2TA 4A2QA 1ETUA 4QODA 4MYDA 3RRMA 1B2LA 4GMHA 2E87A 4JP8A 1WNFA 2UZ0A 4EFNA 4N3NA 4UBLA 5H59A 3DCIA 3I8XA 1TKAA 2D2VA 3CRNA 1JH8A 1OMOA 4KQ9A 5L3SB 2G6BA 2I6TA 2R4UA 3D3EA 4RZHA 2XECA 3X2FA 1JGTA 2MYUA 3A6FA 2IVFA 4KIUA 4AN4A 1SQ6A 2CLMB 1HDXA 1YCDA 2GCEA 2IZ6A 5CLQA 1QUFA 1X70A 2GZRA 5LB2A 4DWWA 2DJ5A 5LR6A 2UVPA 4XM2A 3C4JA 3X1MA 1K75A 1JHPA 1WG8A 1GHTA 2A1IA 4NMHA 1JSXA 4MMZB 5JCXA 4BNHA 3HHEA 4MV5A 2AV6A 2CN1A 1TEZA 1V6CA 1E1KA 2RCNA 3L0DA 3RSHA 4DUGA 2I80A 1LC0A 2NO5A 3TKLA 4LF5B 4OQDA 2GPJA 1KY2A 1S8OA 3AJRA 3GBPA 4HWPA 4NZOA 3UT0A 1VGQA 2WDPA 1CR6A 3CB2A 1T3TA 3ZW9A 1HZZC 4IQ0A 4P3KA 1VKJA 4Q18A 4O4LA 3AHJA 5HIKA 4OVKA 4CEJB 1OZHA 3HNRA 4PQGA 1TM4E 2BI4A 2WWGA 1CF9A 3NFRA 1UXHA 2VWHA 1DX4A 1JDZA 1U3CA 2W4MA 3UKJA 4C3ZA 4KYTA 4R5HA 7REQB 1A9YA 2O8VA 1J33A 1IHXA 4KGXA 4ZI5A 3X1KA 1SBNE 4G65A 1V5EA 4MCAA 4XVCA 1M34A 3KCQA 4L3VA 3VVCA 1TXGA 4BBJA 4C0JA 3LFTA 1W8IA 2FWMX 2ZRMA 2QAIA 1EA7A 2GEUA 3OZXA 2XQIA 4KAXA 4RADA 2CJWB 3LT1A 3Q41A 4JMLA 2JD0A 1IULA 1PFVA 2ZR7A 3CTMA 1W46A 4TQGA 5CLLA 1PFKA 1DHRA 1DQPA 2EF1A 1ISIA 4ZRDA 3KKPA 3LV8A 5AVYA 4PYIA 5JCOA 3UOGA 2WKSA 2A78A 3O8OA 2B4YA 5FL3A 2OG2A 1MCZA 3JU3A 4EGFA 2PVSA 3TRIA 2CNWD 4HVTA 4RZQA 3VH2A 2HMUA 1M9NA 4K8OA 4EHHA 4WUVA 3K1ZA 3RSSA 4F86A 1MG5A 2NUPA 4GNRA 4E5SA 3GOHA 3MMPA 2F1OA 5CR9A 5H9WA 4JOSA 3A6ZA 2XZLA 5JZOA 1DFHA 5F2EA 4CYMA 4F0JA 4GKBA 4JKIA 1XJ5A 5DK4A 2DETA 2RJNA 2B7CA 2HREA 5TRTA 1U0NA 1TAUA 3TLZA 4YONB 1IVSA 3DKKA 3IEKA 2D7DA 3QKTA 1RAFA 1Z8NA 1DDIA 1GQOA 4PZDA 3NXSA 1Z5NA 2X0NA 3Q9SA 3DM9B 3JARB 4RLFA 4YACA