3SAJA

Crystal structure of glutamate receptor glua1 amino terminal domain
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
375
structure length
369
Chain Sequence
GAMPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor 1
publication title Crystal structure of the glutamate receptor GluA1 N-terminal domain.
pubmed doi rcsb
total genus 115
structure length 369
sequence length 375
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sajA01
1ZVVA 4KNYA 2IPLA 5FWYB 1R8JA 5GOTA 3BILA 3KCNA 3KKEA 1QP4A 4QICA 1D4ZA 3H6HA 4FE4A 5BQ3A 3H75A 1NTRA 3C97A 3EDCA 5C5CA 2FTKE 2QU7A 4PYRA 2JCGA 5PNTA 1Z2EA 2GX6A 1YS6A 4IF4A 2PMCA 3CU5A 3LUCA 1QQAA 1NATA 3N75A 4JAVC 1Z15A 3LUJA 5DLEA 2B4AA 2MSWA 4RXTA 4KQCA 4Q6WA 3OMXA 4G0YA 3SM9A 1ZITA 4H3KB 2RGYA 1KGSA 2MYNA 3FFXA 5KQGA 2GI4A 2M1ZA 2I6FA 4TLLB 3QLUA 4Z4EA 3H1FA 1H9CA 6CHYA 2MSKA 4LE0A 4Z4IA 2E4YA 2WY2D 2FQWA 5IEBA 4L4UA 1BDHA 5B3JA 1VPWA 4N47A 1K68A 5ED4A 1JHZA 3K4HA 5BRAA 3CG0A 4KV7A 5IUJC 2JVJA 3OLWA 1F4VA 1Z13A 1DBWA 3EODA 3LKVA 5C5EA 4RKRA 4S04A 4MS3A 3A3KA 3MIZA 1JX6A 2GKGA 1LJUA 4O1HA 4RDCA 4P1ZA 5CHYA 2FMKA 3B2NA 3RVMA 2P9HA 1JYEA 3I5AA 3OLXA 4D6YA 4NCAA 1MVOA 3N53A 3QX9A 1M2EA 2LBPA 3QK7A 1I3CA 1P2FA 2FLWA 1RNLA 4XFKA 3GYBA 3ROTA 1PEAA 1ZDMA 4L85A 2MYTA 4MLCA 3M9XA 2FN9A 3HEBA 3ROFA 2QR3A 5TPWB 5EWMA 5EWJA 1QQBA 1RXEA 2MYUA 1TVMA 1QMPA 2NZVG 4RK5A 3T8YA 3P9YA 2QVCA 1YK1A 2FXIA 3LKBA 1IIBA 3KYIB 1MAVA 1SXGA 5I4CA 4JP1A 3ILHA 4W5TA 4F3TA 2ID9A 2QZJA 4Z99A 3QLUC 4WXEA 1ZHHA 1BAPA 5TPZA 3KTOA 1YS7A 3HK2A 2A9RA 2FMFA 5B3JC 3OQOA 3C3WA 4Z4CA 2P4UA 2QW1A 1E6LA 1MIHA 1SXIA 4GNRA 4MPTA 3UK0A 5JNSA 1NXVA 3GL9A 3JS5A 1MB3A 2TMYA 3OO1A 3F7NA 5GQSA 3MMNA 1GLGA 4YV7A 4G97A 4HNRA 1NXOA 5EWLB 3EQ2A 2PKXA 5IEJA 4W5OA 1JFTA 4FB4A 2R48A 5JNVA 3FDFA 1MB0A 3GA5A 5HKOA 3CNBA 3TD9A 3GRCA 2ID7A 3RQIA 1JLKA 1YTUA 2QSJA 2WMYA 3OM0A 4YLEA 4YO7A 2RJNA 1VLZA 2WRZA 4MS4B 4N76A 1YMVA 4NQRA 2L18A 3H5OA 2PJUA 3H5IA 1ISRA 3Q41A 1CHNA 1F51E 1A04A 3ILYA 3O1JC 1A2OA 5IUKC 3RVLA 4ZMSA 1L5YA 4WZZA 4W5NA 1EAYA 3E61A 4YR7A 2RJOA 4KZKA 3RH0A 1ZAYA 5JS1A 1CEYA 7ABPA 1PNRA 4MR9A 4H3HB 4MQFB 3FFTA 3KLNA 2HQOA 3MQ4A 1EFAA 5JNRA 5TQ0A 1JBEA 2JBAA 4KQ9A 1P6QA 2FEWB 3JY6A 4S05A 3DGFC 2JVKA 1DCKA 4QPJC 4F06A 4ETNA 3H6GA 1KRWA 3KG2A 5DGCA 4RSMA 3EULA 4RXMA 5TPZD 5ABPA 3SNKA 4LDAA 4LX8A 1JWLA 1DRJA 1TM2A 1NXSA 1AB6A 4O1IA 4ZJPA 3EAFA 3KSMA 2HSGA 2PL1A 4UHKA 2LPMA 3T6KA 5KQMA 2JRLA 3CTPA 4F12A 1P8AA 3CZCA 1UDRA 1D1PA 1DC7A 1SRRA 3RVJA 1TMYA 3HCWA 3CRNA 3I09A 4JB2A 1QNLA 2IKSA 3IPCA 4IILA 3HV2A 4MAAA 4MQEA 3VNAA 3QEMA 1JH9A 2L2QA 4EVRA 3HVRA 3KYJB 1NY5A 2ZWMA 4MS3B 4EYOA 2FMIA 3HUTA 4HNQA 4MRMA 3KLOA 3CLKA 3QELA 4RXUA 4RU1A 4LE1A 4FE7A 2VK2A 4MYRA 5KWSA 4N0PA 4YWHA 1TLFA 2FEPA 2WJWA 1E6MA 4YGXB 2W42A 2NT4A 1Z12A 3CKMA 2L19A 4JASB 2KYRA 1JDPA 2PE5A 1SD5A 3LUKA 5EWJB 4Z0NA 1E2BA 3OLZA 5BR1A 3NHMA 3SG0A 3HUUA 2JVIA 2H3HA 4KREA 1ZY2A 2ZAYA 1ZH4A 1VRVA 4XASA 1DG9A 1DZ3A 2GBPA 1M2FA 3D8UA 1A0OA 1U8TA 1USIA 2HQBA 3HJFA 3OLYA 3QX8A 2FEKA 1RZRA 3CZ5A 6ABPA 3KHTA 2VUIB 1EHCA 2HJ9A 4G0MA 4QYMA 1EWKA 1EWTA 5FWXA 3DGEC 2NT3A 4TLMB 4PE5B 4RKQA 1YIOA 4ZMRA 5FWYA 3UUGA 1Z2DA 2M98A 3C6QA 3FMVA 3N0WA 4ETMA 5CNJA 1DBPA 4F8JA 4B09A 5DCLA 1EWVA 5IX8A 1U04A 2E4WA 4KK4A 1KRXA 1PHRA 4E7OA 5DTEA 3JPWA 4G0XA 5CNIA 4NICA 1M5TA 2FMHA 3R0JA 4RY0A 3RVPA 4WUTA 5IBQA 5KQLA 1ABFA 1QPZA 1JYFA 2JK1A 3O75A 3NNSA 3GWGA 2HPHA 5T3YA 3QLTA 4MS1A 4QYWA 5JS2A 4ETIA 3H5VA 4N03A 5HSGA 2PUCA 4D6XA 3N0RA 4O5AA 4WXMA 4IGAA 5IULC 3N6VA 3CS3A 1BVHA 3OQNA 1DC8A 3K9CA 4ZPJA 1P6UA 1QO0A 5BRJA 2F8SA 1JL3A 1QP0A 3CFYA 2IDMA 4IMIB 4MR8B 1NXXA 4Q6BA 1DCMA 1DP4A 2E4XA 3FFWA 2PUEA 2PUFA 5TQ2B 1W9HA 5CNKA 1CYEA 1ZESA 2VUHB 4Q7EA 3HO1A 3Q7TA 3IP7A 4TMYA 4KFCA 4Z4GA 3DZDA 2JBAB 2LUOA 3BBLA 1QP7A 3A0RB 4LE2A 4LZLA 4XAQA 1T34A 3I45A 2L17A 4F11A 1BDIA 3GBPA 1BA2A 3QEKA 2CHEA 4MLDA 2PUAA 3IP5A 2V0NA 3QLVA 1RZRD 4G86A 5T7BA 1Z18A 3Q7SA 3N8IA 3IP9A 5TPWA 3IPAA 4EVSA 3O2JA 4HNSA 1PUXA 4KVFA 2CHFA 4DQDA 3O1HB 4M88A 2E4VA 3DBIA 2FSPA 3HS3A 2NUBA 1SXHA 2MYPA 3RVKA 4EGSA 3O2SB 3QEMB 4G0ZA 4W5RA 2PUGA 4EVQA 5JNUA 4ZYLA 1Z25A 5KQPA 3O21A 4MR7A 1ABEA 1DCFA 3QELB 1U0SY 2YHBA 4TN5A 1GUDA 3OM1A 5D2CA 4KRFA 2OENG 4N41A 2QVGA 3JTEA 4GPAA 1JFSA 4YRZA 2AYXA 3H1GA 5KC8A 4Z4HA 3GT7A 2E4ZA 1QO0D 3JVIA 1FQWA 1ISSA 3HSYA 5EWLA 4DADA 4WWHA 3T95A 4H60A 4G0QA 4LDZA 4UHJA 3QLVC 3NHZA 4EYQA 4RK1A 3LFTA 4P98A 3F6PA 2IPNA 1D2AA 1M5UA 1RXIA 1W25A 1FSPA 4XARA 2FLKA 2R25B 3IP6A 2RDMA 1JDNA 1ZH2A 4Z4FA 3SY8A 3O74A 2PUBA 1OXBB 1GCGA 3C3MA 3Q9SA 4OLBA 1FFGA 3F6CA 3KJXA 2QV0A 4YP9A 4PEVA 1PEYA 2B1JA 5E3JA 1USKA 3RVOA 4KMRA 1D5WA 4YS6A 3M6MD 4EYKA 5EWMB 1Y1LA 1L5ZA 4RK7A 1XHFA 4MQFA 4YCSA 2R4QA 1ZN2A 4XLTA 1C4WA 5DKFA 3SQNA 3IDOA 3LUFA 1GCAA 2A9PA 4OATA 4RK6A 2PUDA 3MYYA 1C0EA 4Z9AA 2O20A 1DRKA 3BRQA 3BRSA 2PAFA 4OBBA 4MS1B 1LJLA 3RVQA 5KC9A 2QXYA 5HQJA 3T38A 2VYCA 3HZHA 1K66A 5CNMA 3OQMA 2XDYA 4RK0A 4PICA 5JNWA 3A0UA 3N0XA 4JOQA 5FBHA 5TE9A 9ABPA 1GUBA 2FQXA 1U2PA 2LIVA 1WETA 1DBQA 4W5QA 2PLNA 3S99A 2A9QA 3M9WA 4RWEA 3I42A 3KS9A 2CD7A 4OG2A 2E4UA 4OTZA 1JF8A 3NBMA 1AB5A 2IYNA 2J48A 4G0PA 3LMKA 2N9UA 4RK4A 3C3KA 3GV0A 4IRXA 1RPJA 3BREA 4RZSA 5JNTA 4D74A 4EY3A 4OLAA 4N0QA 2HQRA 3A10A 1D1QA 3LTEA 4KPYA 1VKRA 4Z9BA 8ABPA 2WJAA 1ZGZA 1S8NA 3O2QB 1Z17A 3O1IC 2PL9A 3H5TA 3VNBA 1YVUA 4MR9B 4RS3A 2OQRA 3EGCA 3HXMA 3CHYA 3L6UA 4PZ0A 4Y9TA 5TQ0B 3DLHA 2F8TA 3JPYA 3LUAA 3W9SA 2IOYA 4ML3A 1USGA 1U2QA 3LUDA 3SAJA 3H5WA 1OXKB 4MR7B 1NXPA 1YMUA 4JB0A 3NNNA 3OO0A 1Z16A 1KMIY 5HM6A 1QKKA 2A9OA 2AYZA 4XXHA 2WWVD 3FGZA 3HM9A 1FFSA 3EQZA 3RVSA 1J56A 2LP4Y 3G1WA 3MF4A 1APBA 1ZGGA 4JA2A 1JFVA 1NXTA 2NZUG 4EUKA 3F73A 3JVDA 3Q15C 1DJMA 3H5LA 2JB9A 3LOPA 1NXWA 4E7PA 4IMJB 2WB4A 1LK0A 4RV5A 1XHEA 1URPA 3Q7RA 2FVYA 4RY9A 3L49A 4MQEB 4DN6A 1Z26A 3DLBA 4EYGA 3OLVA 3G85A 4NCBA 3EJWA 1HEYA 3TB6A 2DRIA 3NNDA 2MSLA 4MRMB 2GWRA 1E6KA 3TO5A 3LUHA 2H0AA 5TQJA 1XWWA 3HDGA 3LUGA 1PNTA 4G0OA 4KK3A 3TMYA 5IUNC 3H1EA 2FKAA 3HDVA 1LBHA 3E3MA 4MR8A 2IPAB 2IPMA 5TQ2A 4WT7A 3CG4A 3GBVA 3RVRA 5KI6A 3RVNA 2FQYA 2Q5CA 1LBIA 2FN8A 2X7XA 1BDJA 5FBKA 5F64A 5IC5A 1YK0A 4MGEA 2FW0A 1B00A 3OMWA 4MS4A 3MM4A 4LRQA 2R47A 3TX6A 2BGGA 3MA0A 3URMA 4CBVA 1FFWA 4NV3A 2YHAA 1TJYA 3D02A 4HYEA 2CWDA 3UKJA 5FWXB 4RY8A
chains in the Genus database with same CATH superfamily
1F8GA 3NT5A 3CLUC 4W7IA 3G7UA 1ZRNA 2JFFA 1EP9A 5FWYB 1C14A 1R8JA 3ZUPA 2DMRA 3JYNA 2I34A 4BB6A 3CR8A 2I3AA 4A26A 4E6PA 5TX7A 2WG1A 4MUHA 4F2HA 1F1JA 4BAGA 3OESA 2HAEA 3H75A 4GKVA 2GD6A 4IR7A 3VNRA 3FIUA 3DKKA 2O2JA 3IUBA 2JJMA 5BYAA 3H2YA 5LNK6 2CHQA 2DQZA 4Q3DA 2GM9A 1SHZA 1DC3A 2QMQA 5LQUA 2PMCA 4HZUB 2G09A 2IGTA 4MUJA 2G1UA 1NURA 3ZWBA 4E5KA 5CH8A 4YUAA 4TPKA 5CK4A 2G9NA 3G8AA 3LDAA 3HEMA 3MTDA 4NVRA 1L7AA 4Q7KA 1O0SA 2AI1A 4MCJA 1V1RA 2RGYA 1H6DA 3ZCTA 3LQKA 3RBAA 1IPEA 3WA7A 4L5YA 3NBYC 3FFBA 1M76A 3I9LA 4UU7A 2OFPA 1JB1A 3ZY5A 1UJ2A 4TMZA 1QIDA 3F5SA 3H4TA 1HLPA 3NTRA 4UAVA 4Z4IA 2G7MC 5I9IA 4Y6SA 1C30B 3MMZA 1GG9A 1DDIA 1Y7HA 5ECWA 4EHDA 4KV7A 3TUIC 3KJFA 1Y7TA 3AIOA 3D3WA 4LFAB 1PTKA 1KFEB 1PZFA 1Z13A 4M22A 4BV3A 2PFGA 4CFSA 3KHUA 3DOJA 4CV1A 4BNLA 3RS2A 1CE8B 4RZQA 3CVWA 1EUDA 2CMGA 5E1DA 2F1OA 4QGAA 5IARA 2JI6A 3OLXA 3PPVA 2AFHA 4A91A 2ZIXB 2YV1A 4XGRA 4XWKA 5ALHA 3L7AA 3HFRA 3QFSA 4ESOA 5ESWA 2PHZA 4ZFNA 5JJ5A 1V16B 4WK2B 2W70A 4BOYA 3P2YA 4RBNA 1CU1A 3BMXA 2EFEB 4Q1EA 5TPWB 2VWPA 2JARA 2B6NA 4ZAGA 2WFLA 2X3YA 2EARA 3PJGA 3IQZA 2J5QA 4LYEA 1TW2A 4A82A 2WP0A 3DE3X 3NWBA 4PGHA 1QMPA 2VT7A 2H7CA 1K7SN 1SK9A 1WVGA 2CN1A 2BMEA 2SBTA 3E84A 4B84A 1JSRA 4YVFA 3GLGB 3DONA 2L0XA 1Q1GA 3AUSA 1DKUA 1MMFB 2PMFA 2QDXA 2W22A 4BAUA 1EDOA 2X0KA 4LS3A 1ZHHA 3I8SA 1GIAA 1ULZA 3EXIA 1EVEA 1RXCA 1YS7A 2PSEA 4DDKA 3KZ1E 4L8WB 3OA2A 3TUZC 1FXWF 2QRVA 1IOVA 2RG7A 3AJRA 1X1BA 3JSAA 3OC0A 4GBED 4JIMA 4KG7A 4WZAB 3TNJA 5B3KA 3FPKA 1JKFA 1CFJA 1NXVA 1XEAA 1O2DA 3GLFE 4BN5A 1UC5B 2F1RA 1NXQA 1UBGA 1EVYA 1US8A 3JZFA 3TMAA 1L8XA 1NRJB 2XB6A 4R9RA 3ILXA 4TSRA 3L7LA 4HQ6A 2WSYB 2ZIVB 2CBXA 2VPPA 4EO7A 1Q1BA 4MUXA 3FWPA 4W8HA 2RHDA 3CNBA 2CXSA 2C4TA 2WG2A 2V45A 3W2IA 2NZWA 1S02A 4ZYVA 3THYB 4BRUA 3E05A 3MWEA 3KKOA 4MDFA 1YTUA 4NR0A 4IDNA 4BE9A 3HYLA 3EJ6A 2PFSA 5IBRA 3P9XA 3ZHBA 4YASA 4MRAA 3U2QA 3ZGVA 3ZOZA 3T3GA 1A2OA 1MLDA 1T9ZA 2QN6A 5IWCA 5BQFA 3H9GA 5G4KA 2RAVA 4H6WA 4XDHA 2QX9A 4RIFA 2QBYA 3TX2A 2FSUA 4BE7B 2IOQA 3KALA 1GPYA 1UEJA 3QMWA 3CUTA 3SBDA 4HDNB 4A8JC 4KLZA 2SICE 2ZCVA 4YT8A 1T9KA 1CEEA 3V7FA 2EU8A 4BDTA 5AW5A 5C0OE 3U4AA 4N5IX 4CM8A 4WFIA 1HA3A 2X2FA 1THTA 4YLYA 3W3AH 4B3HA 2Y93A 1QCZA 3ROQA 4E21A 5FL3A 3WYGA 1DAKA 4Q48A 2BD0A 3LC0A 2AH5A 1W5TA 2OZEA 4RAQA 4R1PA 3AB8A 1YJQA 1R4MA 1RHUA 3UOWA 1QWSA 1HYQA 1M73E 1XQYA 1P5JA 1RMYA 2IXEA 3SEQA 3GPLA 4L5JA 1DX9A 4R7ZA 4WDQA 4BNDA 1HR0B 2YW9A 1HX7A 1UUFA 1AKUA 3S28A 2FW1A 3GLHE 1IK4A 1V37A 5DM4A 2GPNA 3GLFB 1BX3A 5HDBB 2YWJA 2JIZD 4KR3A 1N2IA 1PT7A 1JFFA 2ZCJA 3IV9A 1UBSB 2BYTA 4S1OA 5ECGC 5LIPA 2OM6A 4PPYA 3KZVA 3CZQA 2C3OA 1L5HB 1NI4B 2YFKA 3FSJX 4NHOA 5DGDA 2LCFA 4V39A 1B3RA 4OHKA 2XZDA 4GMXA 4PGAA 5F33A 4CF3A 3HWSA 1SUBA 4N0PA 3NRJA 5TMBA 3V6LA 3TEJA 4CHGA 1XK6A 3TGPA 1XTQA 2B6HA 5CLQA 1VPEA 4OJYA 3HZOA 4P2BA 5IDXA 5AD1A 2EERA 3OHPA 1YDEA 1MX1A 4HN2A 3TVDA 4QXRA 2W6QA 3N2GA 2CE2X 2JA1A 1S1CA 2OECA 4J6FA 3RHTA 1JPJA 3V8RA 1FDUA 1A88A 2BMJA 2YV2A 1R3UA 4DIFA 5KHAA 4CT5A 4YRQA 1E5QA 3KSDO 2O48X 6ABPA 1L9KA 5I48A 4GBJA 1MGOA 3IYLW 3K8ZA 4UFOA 4CCYA 1EHCA 2AVNA 2VLBA 4AAYA 3LX8A 1PDOA 1L7OA 3ACCA 1C2YA 4HUJA 1MX9A 1PV4A 1OVMA 5H70A 3IIEA 1JG6A 1VG8A 3AF1A 1WBDA 2OR3A 1TYEB 1R0CA 2HF2A 5LL6P 4N6GA 4ETMA 4H6PA 4MYHA 3M5DA 1FXWA 4LC1A 5DCLA 1U11A 4D8XA 2IPXA 5H82A 5LP6F 3LKDA 2DERA 1QK3A 3SD7A 1U2DA 1DJOA 2IHTA 3GLHB 4G0XA 3NIBA 1GGKA 1GR0A 4JVLA 3NDIA 4QOIA 1XTUA 2VJDA 1IOWA 1N0VC 3WZMA 1C9YA 4P32A 4DLSA 1SG0A 2VSNA 2A14A 1VLVA 2YY5A 3E5NA 2HPHA 1NVFA 4PLGA 1NIPA 3O38A 3H5VA 2PSFA 4NE9A 4YP6A 4B3IA 1A7UA 2D1TA 3GRZA 3WO0A 2YOHA 4MAFA 1IQ0A 1YU6A 3T9FA 1N6OA 1RAGA 2RMKA 2WD7B 1TF7A 1H0KA 1KOFA 3KJZA 1GZ6A 5BRJA 4GNKA 1J49A 1JIKA 1JALA 3RK4A 3WBBA 4NBWA 1TCCA 1L6IA 2OAP1 4QGGA 3BL6A 2YUIA 3A3PA 2PUEA 2XH8A 2BGWA 5CEFA 3BK1A 3R5KA 4WVLA 1ORTA 2W43A 4HNAA 3ZWWA 4M0KA 3W6ZA 4HJXA 2EJCA 4FYVA 1SK8A 2YASA 3C6MA 4LZLA 2MMCA 4M89A 4C3UA 9GPBA 4W9RA 1J0CA 3D2AA 1CUIA 1JKXA 3QEKA 1IWOA 1E8MA 1KR2A 3IV7A 3CIOA 2I4OA 1GFIA 4Q7MB 4ZCRA 3UEOA 2QSYA 4QUGA 5EZ5A 2OO3A 4G86A 1LNZA 1T0HB 1T4MA 1G4AE 1FW8A 2HMTA 4J8PA 1O5OA 3DDUA 5EUCA 2NU9B 1G55A 4WH0A 2WT4A 2ZZKA 5HA5A 3D0OA 4DNFA 2O1WA 3ZI0A 1F0YA 1PSDA 4NY1A 3UMBA 1U0GA 1QRSA 4A9AA 1ID8A 4EITA 1KXJA 2CT8A 3ROGA 1F12A 3ZYZA 3G2QA 2XE7A 1WSBA 2EKZA 2HRDA 3O0DA 4ACBA 5LQKA 1P4JA 3U3DA 1EBFA 2FK7A 3GMIA 4C87A 3ET5A 4XDZA 3BXZA 1ZN8A 4GE0A 4GYYA 4L6IA 2ZJ5A 3IEIA 3A6DA 5BPHA 5JNUA 4IDCA 5JMPA 1QAQA 3VC2A 3IAS1 2JPDA 2VJBA 5EZSA 3ZU4A 4AT1A 2IX3A 4JKYA 3ISVA 4ES6A 4UVEA 5JSUA 4QDZA 3KEQA 3E9QA 4ZVVA 5JV5A 1PU2A 2XB9A 4P7KA 2GXAA 5HKBA 5KC8A 1UZLA 1YDGA 2E85A 4P3KA 1DUIA 3FETA 1ISSA 3JVIA 5G3ZA 3HSYA 1KEPA 1EVLA 4DV1B 1HT3A 3UV6A 4GLLA 4DM3A 1ODJA 2IY8A 4MQ4A 4MO9A 5TJ9A 3TQIA 3P4YA 2VZEA 1X70A 3LXUX 4DCCA 1D2AA 1U8ZA 5F3DA 3C45A 2ODTX 3BL8A 3DF9A 5FXMA 1K27A 4MDEA 4BC1A 1ZXLA 3ZVKA 1TYAE 2VKTA 3IPXA 2VHQA 3L4BA 3SHTA 3WNVA 3J7AC 1NULA 1GTVA 3OOJA 3H2JA 3F6CA 2XCLA 3KJXA 3L0PA 3LPLA 2MR6A 3PEEA 1CZKA 3FCCA 4YP9A 3WIEA 3UB4A 3OEEA 4JEUA 1KF0A 2RAPA 5LMCA 3PZBA 5K0JA 3O95A 5EWMB 1Y1LA 4X0EA 1ZRSA 3MOGA 4COOA 5EMKA 2C4KA 3F1KA 4B3RB 1ZN2A 3OU2A 1J7JA 3SQNA 1W96A 3HU2A 3SP1A 2K87A 1H6BA 3AHGA 5DHRA 5LP6A 4O2LA 1BXRB 3IO3A 1HNNA 3MGBA 3DEFA 1DDOA 1QHGA 2IW1A 3JYLA 4IQGA 3U56A 2OZPA 2C82A 1QFYA 4DMRA 3B38A 5HQJA 2IEBA 2NPIA 2Q5EA 3WWPA 2O57A 1EVJA 4BQRA 1C3XA 1FP1D 4CV2A 4BEJA 2XYHA 2W2TA 3C98A 3FWYA 4QTUB 5BSEA 3HL4A 4B1FA 3N8GA 9ABPA 4MUIA 1X1RA 2CNWA 2HMYB 2YMMA 3IBTA 2ISCA 1P19A 2AJBA 1OREA 1ZIPA 3JRXA 3PXCX 1KQOA 3DZIA 3RK0A 3SC4A 1GQSA 1WIWA 3L4BC 3A1EA 4B87A 3UJ9A 1U1FA 2TMKA 3Q3JB 2QS9A 3CRQA 4N9WA 1Z5GA 2PZMA 2IZ0A 4M1EA 3WQRA 4GSYA 4E3ZA 5LR6A 4RK4A 2YHSA 2I1VB 1UKAA 2NXCA 3C3KA 3F9IA 1DJNA 1A72A 3GD5A 3PXXA 2J5RA 2V5UA 2XMGA 4IRXA 7MDHA 2AW5A 4I19A 1JXQA 4BGIA 2O4UX 1SBYA 2QPAA 3ROKA 1LQ2A 1VLQA 1GTG1 5LOVB 4OLAA 1SVKA 1N32B 4A2CA 3TG8A 2V7XA 5U4QA 3RHSA 1J2EA 3FKSA 4BEVA 3GEDA 5BSHA 3WSVA 2EX0A 1H0HA 4AN4A 1Q1QA 5HS4A 5LP6C 1F5NA 4PX9A 3ZWKA 2RE8A 1V8OA 4AKIA 3L0OA 4PC6A 3U13A 1H8ED 1KPHA 3SDBA 2D54A 4ZEWA 4C43A 1P7YA 4US0R 1GQRA 3B6EA 1K7EB 4ARAA 3V48A 4M0MA 1XTPA 3PI6A 4OB7A 2JHCA 3RROA 3IKJA 1QIEA 1RQPA 5DLPA 3RSFA 4DC9A 5LKRA 5DTIA 3KPUA 5ALOA 1NXPA 4K6KA 4UM5A 4HB4A 3F47A 2FP4B 4GZ5A 4MW7A 1CUGA 1QKKA 1XT6A 3A2NA 2FJUA 5DIFA 4PNEA 1MIOB 2F1IA 1ID1A 3KQYA 5BSTA 1YQXA 1KJIA 3H4VA 3WG9A 3OEYA 2OBNA 1VE7A 2HH9A 2QMHA 4Q3CA 1JFVA 1K4YA 1VQ1A 4RFVA 4I9HA 1FPMA 3TECE 3PRJA 3KOZA 1AY0A 1A8IA 5ALWA 1M1YA 3HMQA 1KEVA 3RI3A 1H22A 2JB9A 2WIGA 5CFOA 3HR4A 1E5DA 3ZE2B 1B8UA 1ZUD1 3WL5A 1E7QA 3O9ZA 3W04A 3K9FC 5EUMA 1R6VA 3ZEAA 4HVLA 2YZGA 2IXBA 4XM0A 4H7DA 4MQEB 1T24A 1Z26A 3RUIA 3LXRA 2GEVA 4LZNA 2FZ5A 2B8JA 2DUNA 4R84A 3ZUGA 4CKEB 1DC5A 3ZK9A 2FF5A 2QQ0A 5DCWA 3VJKA 4EG0A 1II8A 3TO5A 2H2WA 2H9IA 4DUYB 2QK4A 3RD5A 3LC7O 1QHHA 1H2FA 3DEAA 5IUNC 2AC4A 1A9XB 4Q1DA 3NAQA 1DGQA 3N8DA 5E3IA 2YXLA 3P9KA 2X1HA 1L4NA 1PLLA 3A9VA 1IVYA 3ISTA 4DCMA 3OZUA 4Q4JB 2MR5A 2NYVA 4F5WA 1T36B 1E3LA 2D2VA 4TXLA 1FRZA 4D43A 1FSSA 2HK6A 2Q5CA 1RYNA 3C7CB 1CVIA 4JX8A 3ADDA 4R81A 4KSCA 3AU8A 3R7DA 2P2NA 4KXMA 3GMSA 3UCFA 1YK0A 3WYAA 4CM1A 3FDIA 4MGEA 2JIBA 2I65A 2BGGA 3BXGA 4EJSB 3GZNA 3GJ8A 4MGIR 5FEUA 2VCEA 4LOAA 1NE2A 4RIIA 3E1GA 4RIGA 3HB0A 5B2FA 1ZMTA 1SOUA 4DL9A 4RY8A 5FYQA 1U8XX 4MGYR 2O2IA 4I1OA 4RPGA 3G0HA 4QFBA 4GMFA 3BILA 1T5SA 4J4BA 2I7DA 1ZI8A 4PONA 4GX0A 2QXTA 3HY3A 3UUFA 5C8DA 4CODB 2NTEA 3BIXA 1UEIA 1QAOA 2Q0QA 1N2EA 3KQSA 3B1WA 1IVSA 4MP8A 3EBOA 4PSUA 3VDXA 4B81A 1E1LA 3LUJA 4G3XA 5DLEA 5DRTA 5IP5A 3WNBA 1KI6A 3V97A 3A6LA 2O1EA 4P7FA 2H4XA 4LBZA 3ZV3A 1M2KA 2WAYA 4LNAA 2Q3MA 2R85A 3EWNA 4JT2A 1NYTA 4X1YA 4ZVRA 3EW7A 3O8NA 2Q49A 1N5JA 1IEQA 3FI9A 1FTGA 4I3HA 1JWAB 1JT2A 2A33A 1AUQA 4L4UA 1U0TA 4M9QA 1DV2A 4QPDA 5ED4A 1RM3A 4NBNA 1GVHA 4PWYA 1EP2B 3EVAA 5IAEA 4D81A 1RAFA 5CT8A 1VRCA 2J9YB 4G2NA 1B8PA 3S55A 3JQAD 1EDDA 4RGVA 1E7WA 1KZ6A 4J0QA 3VZPA 2Z8XA 3PPYA 3MIZA 4FZ3A 5CHYA 3HDHA 1REQA 3I5AA 1Z0JA 3ZCRA 4JSYA 4NCAA 3JQBA 1NQVA 3QK7A 4MOWA 5ALLA 2BM0A 4JT9A 1RNLA 4CV0A 2AZMA 3LW8A 4Q4HA 4ZU1X 1RYYA 3HEBA 3NIWA 4K6FA 1L5RA 1P7VA 1UXOA 2C4HA 2MINB 3TLKA 2CKDA 1Y4SA 4CLRA 4NXMB 2ATXA 1TYDE 3P4UA 3JAKB 4DIOA 1AZLA 2WK1A 2Y66A 1ZK2A 5U4XA 1XC7A 3CYFA 1UIRA 1FDVA 2RG1A 3ZWCA 1HLDA 2J31A 4OM7A 1XAGA 2G28A 5KYGA 3LZCA 3ZVNA 1YZUA 2X2OA 4LVCA 2GJ9A 2QHXA 2XJ4A 2QAGA 1UJ6A 1TZ2A 4L4RA 4DIEA 3STWA 1GSOA 5EIEA 4XUEA 4QOGA 3PVZA 1AOXA 1J8DA 1UT8A 2H1WA 2GHQA 4GRDA 1PX2A 1WDLA 1ZCAA 2H1CA 4OKIA 1EX9A 3C3WA 3F8WA 3ZLVA 2XA9A 1SQ6A 5BN1A 4C7OB 1E6LA 1TF5A 3DDNA 2BH9A 4OHMA 3SVLA 4KPEC 3CURA 4NMXB 3WGQA 1QDLB 2XRYA 1NBMD 3EG9A 4JN6B 4KCGA 5I7AA 3JQ7A 1F60A 4I1IA 5ESRA 3ZVMA 3WVNA 4PS1A 4UPDA 4WLEA 4X90A 5AM5A 1NNEA 3JD1A 3N39C 1PGPA 1H2XA 1XMIA 2B0JA 2IF0A 3M5CA 3WLOA 4K3UA 2C57A 2G88A 4QRIA 3C3PA 2Y77A 1IXZA 3D64A 4U2KA 1PKEA 1H94A 2WFMA 3GJZA 4QOFA 3HVJA 1TMKA 3TZKA 3VR5D 1L5GB 3QKSB 1HDGO 1OC2A 1EGAA 2FF7A 4ZC8A 3I4LA 3LLCA 5F2NA 3KZXA 1NVVQ 3UCEA 3EIWA 2HPAA 3HNOA 4GLOA 3OIYA 4M8IA 3RJZA 3K96A 4HLUA 3E61A 4LXYA 4N0DA 4YR7A 3BSSA 5CA0F 5KNDA 1IXYA 5JS1A 3WGZA 2IDJA 1YRHA 3GY0A 3CT4A 2QNIA 3PPWA 4RD6A 2CNKA 2HLDD 4MJXA 4R5MA 4YHBA 4K8OA 3WKCA 4QQFA 5AM3A 2RGRA 3FYUB 1W36D 5J58A 1QCCA 3G5TA 3DD1A 4BU1A 2QX7A 1VLJA 1ZLXA 4B43A 3FWNA 5L3SA 3HNPA 3JSXA 5EPUA 1MBZA 1N92A 1S2OA 2I33A 2JL1A 4JMLA 4WOPA 3O8RA 1MNQA 2VJQA 5H5JA 3O4RA 2QX6A 4R2KA 3EULA 3I6QA 2A92A 4NBKA 4LDAA 2UXBB 5B1SA 5LCXA 1Y3CE 4OHOA 3F4LA 1TM2A 2VZLA 4KN6A 1J2TA 4IDHA 2ZE8A 4E1AA 2GZ3A 2RONA 1UBLS 4QHYA 4UTXA 4F92B 4MJ7A 5L3QB 3LT2A 3AETB 4H4CA 4UQPA 1SA0A 3PI7A 3VU9B 4BQOA 3QVJA 1VGQA 3UXHA 2WABA 2H2DA 4P0PB 3ESZA 4M99A 1II0A 4OQXA 4X7MA 1RI4A 4A6EA 3LPDA 2QM0A 1HDXA 1XDSA 3CRNA 4EY7A 1P91A 2PZLA 4QU5A 1JH9A 2J08A 3CV3A 3RRBA 3AKZA 5KYWB 2V96A 3PT5A 3RARA 4G63A 1NE7A 1SIOA 1NVGA 4HB0A 3KYCB 4J3NA 2JLUA 3TCNA 2Y27A 3PUXA 4HLUC 3ADCA 1AX9A 1WPQA 4Y2XA 5DYYA 1EFPB 4KVAA 4BKUA 1CEQA 3GVHA 2JKZA 3R5FA 2BEVA 4E13A 1AHIA 2G3YA 3G8DA 2EFGA 3WNCA 1HDIA 3AEYA 4EG8A 4RWZA 3RAEC 3HCAA 3NUQA 4UZEA 4CR6A 5LQSA 2RH5A 3UKDA 4CL2A 3MCWA 1DJPA 4WXPA 3UT0A 2GVDC 4F3KA 1D1SA 3CEAA 2WR8A 4ZVUA 4CM3A 3COSA 3SG0A 1JU9A 1KBZA 2H3HA 2VJKA 4HX5A 5DMHA 4WV3A 3FGOA 1HI9A 1HNZB 4P4TA 2VDLB 3D8SA 2CHGA 4BFYA 2GLUA 4F86A 4NL4H 3ECCA 4B6PA 3D81A 2QTRA 1INLA 2AOTB 2JGJA 2ZJFA 3CUWA 1HZZA 2CJWA 1NV9A 4A0GA 2HJ9A 3K09A 4QYMA 3I5MA 3M7IA 3D7NA 5AHOA 3EK2A 1W88B 1NU6A 1ULTA 1OT3A 5AKIA 4Z54A 1QV6A 1FK8A 1DO0A 3AHJA 3U3JA 1VG0B 1KERA 4W7HA 3E48A 3K31A 1AF4A 2DSNA 3GDOA 2WYHA 5ER6A 4F46A 1I1OA 1A96A 3IVGA 3N74A 4ZHQA 5I51A 1U7UA 5CIQA 2REXB 1LA2A 1TJPB 4Z8YA 2ECQA 5FI1B 4URZR 1QPZA 3PC4A 5DNVA 2HF7A 3ZGXA 3GA7A 3GU3A 4ITUA 4LPSA 1E3WA 5FUQA 2YS6A 4YI3A 2XUIA 2PX3A 3QF7A 5LBIA 3LBNA 4KN8A 4EHKA 3ADPA 3K94A 4IGAA 4Q18A 2HKIA 3RASA 4I3FA 4QFDA 1DFHA 3G0GA 4NPHA 1T8YA 3B52X 4PYOA 1QGUA 1STOA 2BDUA 4J2HA 1JQAA 1LC0A 1EFRA 1WHSB 2NV6A 2XDQB 4IMIB 4IFBA 5T8KA 2JLWA 1FPQA 5FLKA 3UAXA 4B32A 3B5JA 4YRMA 3IDSA 2C3MA 3H86A 3IVRA 1KIAA 5A4JA 1ZMRA 3IAEA 3EGXB 1AQ6A 4YACA 5CA0A 1D2GA 2DGDA 4B3MB 1ESEA 3KKQA 1M8FA 3PDJA 5FO1A 3W90A 1D09A 4HTFA 1LQTA 2A30A 3ZCXA 2Y1CA 1LDGA 1E9SA 2JI8A 1N6HA 3RFVA 4DLTA 1Y5RA 2A0YA 2QRPA 3VV3A 2I9KA 4A92A 4EPWA 5JQWA 1Q1AA 4X8MA 3KOMA 3VO8A 2SECE 4NG5A 3MWJA 1E6UA 3EFOB 2JD2A 1PUXA 1FX0A 3AWIA 4BKRA 1TQ8A 4LRWA 1H4VB 3RJ9A 4DBZA 5GZ3A 1VJ1A 1WEKA 4JUAA 1SCQA 5CR9A 3O1HB 5IM5A 1BW9B 1XMSA 2C2MA 1QRDA 4FUTA 3ZDBA 2ISQA 3P52A 1B6RA 5F4ZA 5EJ9A 2R6ZA 1B0ZA 1MG5A 3JQ9C 4EZEA 3E7WA 3HXOA 1XZCA 3DBLB 3U3XA 2YIJA 4JUDX 4IIHA 2P67A 4IOJA 1ANKA 2C8JA 4JSTA 2OCXA 1N5LA 3B53X 3EGIA 3IULA 3G6WA 3IVMA 4FWBA 3WZLA 5IBCA 4XQ9A 2BSQA 4UE2A 3TIFA 4NMHA 1J2JA 2A86A 2PVCA 2GCPA 1NVKA 3G2JA 2JBWA 2VT2A 3PHHA 5BN5B 4DHWA 2XJ9A 5BV0A 2C96A 2E9SA 2XMRA 4LHXA 4PG6A 2DBQA 3EZLA 3FDZA 2OO7A 3OKCA 1TQDA 3VYWA 1NSFA 4CNBA 4G9BA 4H1VA 4MVJG 2GPBA 9LDTA 2HPZA 2Y1GA 2E7ZA 3PFGA 2JJ2A 2Q29A 3GP5A 5E6SA 4LNUB 2GPYA 3LPCA 1T2EA 2XVYA 1L7BA 3KP1A 3EG5A 4ZQBA 5KCZA 2QKYA 4GE3A 4KU4A 4G89A 4ND1A 4Q4DA 3EQ7A 4UHHA 3LPAA 4QAJA 4U00A 1AN9A 3E3LA 3IJPA 4XWGA 2QYHA 1Z36A 4U6SA 3AOEA 4KN9S 2VYNA 3IP6A 3FLAA 1JDNA 1C7FA 4WESA 3L4JA 1WMSA 2QD3A 2OBYA 4Q16A 5DDIP 3UT5B 1GCGA 1O97C 1X19A 3CEMA 5I7RA 4H3VA 4WNAB 3O84A 5BW4A 1H23A 3O4VA 3IDFA 3I9MA 3WYEA 2JZCA 5B7NA 5M2QA 1PEYA 2VDMB 4KW7A 4C6RA 1USKA 1S2LA 1UBMS 2E18A 4N3CA 2P1ZA 4LDQA 5AJUA 1XRNA 3FHCB 3B60A 1RLOA 5ICFA 3WGGA 2R1ZA 1XBTA 4OBEA 4UBJA 5KKAA 3Q8KA 4KMMA 4D98A 1KFJB 2I3BA 4CG1A 3NETA 1LDYA 1C0EA 3QFFA 1QIIA 1JAYA 3IQGX 4O0MA 1WTCA 3HL0A 5HM8A 1GDTA 1OTXA 2Y9MB 4K9DA 1TKRA 4V24A 3T38A 4HT3B 4ESVA 1Q14A 4YRSA 3VKUA 2A2ZA 2EZ9A 3BMOB 2CXRA 3IEXA 4JFAA 4PPQA 3AESA 3A36A 1TRKA 4IKEA 1L1QA 3TLGA 3U9SA 4IDFA 1ZC4A 5LZ8A 5K8IA 2GK3A 5DSTA 2HIGA 4B0OA 4HEA6 1WM1A 1QC5A 2W6MA 2O5VA 2PBFA 3E22A 3ECAA 5EN4A 3WKEA 1S4QA 3R7LA 1AKMA 3V2IA 3SF8A 1WDTA 1E59A 1Z0KA 1NOIA 1N6KA 2CD7A 3AOEC 5IF9A 2O3RA 4CQMD 3NONA 2VSFA 1PK8A 2NUPA 3PFFA 5I3CA 3U5TA 4G8BA 1NQAO 1OZAA 1WW2A 2Y1FA 3QYJA 4IWXA 5HIIA 1E1CA 3C3EA 2H54A 4HPXB 3NVDA 5I5EA 5JNTA 4MKFA 4QA9A 3WLJA 4IDQA 3CNHA 5GTDA 3THWA 4WXRA 1P7WA 2Q28A 4O4LB 4PZPA 1Y82A 4FMDF 1JSCA 3SSAA 1OGIA 5JAOA 3LGAA 4C0LA 3DZGA 2OQ2A 4NFLA 1IPFA 4KPYA 1E4YA 3ROMA 4OQZA 4QLOA 4Z9BA 3ZHXA 4ZV9A 4O8ZA 3UJDA 1TM3E 1WF3A 3R8CA 1F48A 1LSJA 1M74A 4HLNA 2IYWA 2QN7A 3GEBA 3VNBA 5FDFA 1JV2B 2ZWIA 3NBUA 4LAFA 1P4RA 2XCQA 2QUIA 1RKQA 1YL7A 2MTBA 4F6LA 1U1EA 3QVWA 5L95A 1PSWA 1WZNA 4GZLA 4NS1A 5K8LA 2B61A 3HGTA 2AX3A 4RVHA 1T6YA 4D0SA 1JEOA 4PLZA 1CUFA 3SAJA 1FVFA 2DVMA 2OZKA 1O4WA 1WE2A 2A94A 2QMZA 2X76A 4HF7A 4OHXA 1BCSA 1OU4A 1ULHA 2WI8A 4JGIA 5EIWA 1FXSA 5HM6A 3H9BA 3W8EA 1ZOPA 3LSYA 1XEWX 4XIGS 1PR3A 2D7CA 2GEUA 5BO5A 2VAXA 3ICVA 4FEGA 5LSAA 4BMZA 3ILSA 2ONYA 1GZ7A 1BMFD 3AC0A 3IALA 5K7SA 4D79A 2HR1A 4AO8A 1EHYA 3DT8A 3KQWA 3DMDA 4MO2A 1VHWA 2RCYA 3B1JA 2WB4A 2X9GA 4TYQA 1YFLA 1MRNA 3P9SA 3LK6A 3OLVA 4AZ0A 5AHKA 2UYYA 5KSYA 721PA 2ZRAA 3EPPA 5AVRA 5TMEA 3U7IA 1RQ2A 1IM5A 1D2RA 2MSLA 5FUMA 5KNCA 1FMLA 2GWHA 5KZMB 1C0IA 1K5GA 2VSOA 4HNGA 4OJTA 1XWWA 3ZZNA 1DELA 1KZ7B 3L1IA 4R0MA 3CINA 4DIUA 5L3ZA 3MUOA 3TPCA 4X61A 2FKAA 1MP0A 1PDVA 3HDVA 3HHEA 1XTVA 4JYCA 2PXHA 2PZGA 3HU3A 2QMOA 1SXJA 1T5HX 1UFOA 5E4YA 1UPAA 1KJYA 1CDDA 2TRSB 3NM4A 4P5PA 1I7QB 2QVLA 1LBIA 3DVSX 1JHXA 4H7JA 2CHUA 1T13A 2WHQA 2VRBA 1IN1A 3BWDD 1UQTA 3R3UA 1L8OA 4K9QA 5F64A 1LX6A 2GF2A 4CN9A 4ZEVA 4JC4A 2GETA 3ZX5A 1WX1A 4FK8A 2PJDA 4I4TB 1YQUA 3CY6A 1PJ3A 3PDCA 5DNDA 3HLYA 1H2YA 4F4IA 1PYGA 2IA5A 4RESA 4RHFA 4ZI3A 3B78A 4FR5A 1TJYA 3D02A 3DWGA 3NDPA 3L0YA 5FD8A 4ZALA 3WLFA 5CYOA 3IOBA 5K4HA 3PJRA 1FMJA 2X13A 1NP3A 1GSHA 3O90A 3Q7EA 1LD3A 3V8BA 1UOEA 3KCNA 3LQFA 2Y1DA 3QKWA 2VYVD 4LHVA 1SHUX 1D4ZA 4ZVSA 4AUNA 3ZNOA 1N7HA 1K98A 3OZBA 1DTSA 1R88A 2N75A 3D6VA 5EFOA 4V2UA 2FPMA 1J33A 1DAPA 1EGVB 1KSHA 2FUG1 2PWZA 3GFBA 3PGJA 4KAAA 4K0RA 4DCPA 4GVXA 2XVAA 1O4VA 2Z2JA 3AY6A 3VRHA 5JEEA 4MVWA 3QFTA 1KMHB 4JYBA 2VTVA 2PH7A 3BK7A 3PGMA 3REOA 1ZP6A 3GRYA 2XR1A 1FBTA 2H52A 3ETNA 1IXRC 1SXJC 5REQA 3T7RA 1NPDA 1DAHA 3KZMA 1O87A 4DMKA 1QS0B 1F06A 1QTQA 3QVGB 1X7WA 5FNVB 4ZZ0A 4JI5B 3ZWYA 3BGSA 1OQAA 5BSVA 5EERA 3FUVA 5ESDA 4INJA 2XT9A 4OQ4A 4MV9A 4Z6KA 1RSZA 1N57A 3VH4A 3DDOA 2OAQ1 4DMGA 4BFXA 1NFRA 3U4MA 3CVVA 4H1TA 4E6EA 5K0EA 1ZEMA 3VOBA 5AW9A 4MWBA 5L7TA 2O5CA 1GYQA 2Y4OA 5C5EA 4QD3A 1MC8A 1IYZA 3KSAC 3T3EA 4Q1AA 1UF9A 3GNLA 5KTOA 1SQSA 3FUUA 2GNPA 4LCBA 4CLXA 4XWOA 1E1QD 4ZT3A 1H6CA 3V4FA 5HOQA 1B8NA 4Y98A 5IVPA 4MLCA 1Q0SA 3WBJA 2BFFB 1BIFA 2POQX 2NWQA 3CPSA 1FS5A 3BB3A 2QL6A 1CQJB 1RLTA 5EWJA 3P94A 3BXHA 1Z7BA 4K46A 5TEWA 4UARA 3MMSA 3ZH9B 4JLNA 1ZKDA 1SAYA 4XTCS 1R9MA 4KN5A 4CR8A 1IIBA 4OHPA 1JQ5A 3EXG2 3NBXX 2PPLA 1DEAA 2OHJA 1RLIA 3CPHA 3MEQA 2VHVA 1OYVA 3R40A 1FNSA 5F4BA 2DKFA 4EHHA 1WBJB 3UMMA 3ZNQA 1N8SA 1ZUNA 5FUYA 1XZQA 4HXEB 2ZRLA 2NUAA 1KYZA 3N59A 3UATA 5DNCA 1WD7A 2PUWA 2X23A 3AEQA 3UPTA 2XOXA 1ODTC 1Z33A 3AX6A 1YZVA 2PZJA 2C7GA 2YVUA 4X20B 5AR1A 3RSHA 4BJHB 5CDYA 1D8TA 5JH7B 1QZUA 2JA2A 3T5DA 5I8WA 2F9FA 2WYVA 2YINC 1L5LA 3DBVO 1ESCA 1VI6A 2X4LA 1DKOA 5GQSA 3T9EA 3ZJ4A 2IH5A 4G5GA 4DLPA 4MPPA 3EX7C 3ANLA 4P81A 2PKXA 1K3UB 1HEUA 1JFTA 2G06A 3VR3D 1IWBB 1N9KA 5JNVA 3PR2B 3AB7A 1M6EX 3U44A 4GLBA 2O8CB 4D0NA 4YBZA 3OP4A 1BGXT 3FDJA 3PEUA 4NTZA 4QU0A 5D85A 1HFJA 1E7RA 2NVBA 1WNFA 4HC4A 3RQIA 1CP3A 3STYA 4Z7NB 2DG2A 4UVDA 3IAHA 2YV3A 5J9FA 3IO5A 3UHFA 3CRW1 5IXJA 3S6JA 1CRWG 1DXHA 1LRLA 5J23A 2JAUA 1D4FA 4I36A 5C53B 1KAHA 2WAOA 4HY3A 5HTKA 2HI0A 6GPBA 4P82A 1CNMA 4X6LA 4QUJA 1V1JA 5E6RB 5J2UB 3C15C 1YE8A 4QLAA 5BNWA 4QEZA 4MYCA 4IXNA 4LJYA 3LWZA 5DX1A 3TR6A 3QTLA 1FQOA 4MQFB 2QUHA 4YMIA 4DDHA 2F62A 1QX3A 1RT9A 5JNRA 3UM9A 1NJSA 3S1LA 1R27A 4IQ4A 2JBAA 4ZANA 4RENA 4HWRA 2JVKA 2VOJA 1L4MA 3C3JA 1Y6FA 4B83A 4G8DA 1N6NA 2OMEA 5LA6F 1E6CA 2XUOA 5TPZD 4OHWA 5ABPA 1FRFS 3N05A 2P79A 3G8BA 4UDNA 4BX9A 2UZ4A 4NK5A 3EZGA 1NVVR 4LK3A 1FP2A 1E3IA 2RKOA 1K7XB 1W34A 3ZCPA 4AWXA 3UQZA 4YCNA 1XP5A 3I05A 3Q3VA 5IH3A 3EPRA 2IHJA 1J24A 4MK4A 4L3WA 4AMBA 5LD2B 1TU4A 3EAGA 3RC3A 3VUFA 4HNUA 4F9EA 1GAWA 3M89A 3T54A 4JB2A 1XF1A 2AZDA 5DHPA 3D3WB 5E7IA 4IILA 4GIBA 2C9BA 2IELA 3DLIA 3FWHA 3W3ZB 1QRTA 2L2QA 2I78A 2JGRA 2VT6A 4AP9A 4E2FA 4WN9A 1OAOC 5L7WA 3FAKA 4MRMA 4YCJA 1MABA 3CLKA 3QELA 1JU3A 5BY2A 2BFBA 2PKYX 2EG9A 4BMNA 4GOXA 3L8CA 1FQJA 1GLNA 1UPCA 2QGFA 4YJFA 3TQOA 3TZQA 1E2QA 3RO7A 3X3HA 3ZXUB 1B23P 2OK7A 3CVOA 3LC2O 3KYDB 3HSSA 1AVTA 1R5OA 4W6ZA 2W42A 3DAYA 2P2CA 4NABA 4ZT5A 3ZCQA 1D0IA 5CBKA 3AUXA 4UAJA 4WKGA 3C14C 1SD5A 1EJ6A 1HV8A 2V6FA 1ONOA 3HBFA 4PNHA 1SZJG 4MSUA 4Z0NA 5FT9A 3SIWA 4RTRA 3HXQA 4WERA 5AKLA 3SN6A 3ZDDA 4GVPA 1DKNA 3CF6R 2DHCA 1IHYA 4H3SA 5D87A 5H16A 4DSZA 1DZ3A 1GZVA 3F7TA 3S4YA 3IBSA 5CB4F 4CEIA 2BPOA 3FI0A 1FQKA 1OFUX 2CD9A 3PNPA 4CM7A 5E4TA 3ZBPA 3TTSA 3NYRA 4M7WA 1YE3A 1O94D 3EXIB 3WNDA 4B40A 2MSDB 3DMGA 2G77B 1ZR2A 4NAHA 1TCAA 4PFQA 4E5MA 4QRHA 2WSIA 3A6GA 2QRVB 2WP8J 4REMA 4WFKA 5GM1A 5CBPB 2DETA 4A8PA 5G1OA 4TLMB 3NUZA 2AI2A 3F5MA 5LM3A 3M6LA 2M98A 1VLMA 4ZPXA 1TXGA 1DBPA 4MMYB 4B09A 1RWQA 3FE2A 1US8B 1H8HA 5FR1A 3GOQA 3WIVA 4DV5B 2OCKA 1Z9BA 2JIMA 4YTEA 4Z3DA 2IL1A 1Z75A 2FVXA 4E22A 4KWEA 5EIOA 4B0PA 3MWEB 3UCXA 2GYUA 2UZAA 4HNTA 1LWNA 2GPSA 4IGFA 5B3AA 1WB5A 4LCJA 1H0RA 4JQSA 3T1YB 2BFPA 5K8VA 2WSSD 1VCMA 3TIGA 2W2LD 2B7BA 1U5AA 5TMPA 4HZIA 3N6VA 5DRYA 3AP3A 4RJJA 1X39A 2JGIA 4G09A 4YO8A 1UBKS 3U6KA 3D7RA 3DKPA 3NOQA 5I45A 1M0SA 3F3MA 2E6UX 4Y2YA 3I2HA 4BNHA 4CMEA 2J9ZB 1NW8A 3QPDA 2I5PO 4M0DA 5G4KB 3WP1B 4IS3A 5A04A 3PHBE 4HRAA 2VXCA 3E2IA 4JLKA 2IZOA 4UDOA 1ZSYA 1WDMA 1IEVA 4UATA 4IV0A 2HJWA 3AVVA 1V96A 2KI5A 4HV4A 1N2XA 3E9CA 4EMSA 4Q7EA 4KFCA 1UADA 2AMFA 4FCCA 3DZDA 4L08A 2O07A 3B12A 3BBLA 1UZNA 2A9VA 3Q7IA 2BV3A 3DNMA 1OASA 4UPVA 4BEBA 4IY1A 4ZI7F 5IKPA 3ZHVA 1BDIA 4JI8B 2FX5A 4B2YA 3UJ7A 4EHIA 2JZOA 1DKLA 2XOKA 3O8QA 2V0NA 3CB2A 3DZCA 3ORQA 2IODA 3EC2A 4QTXA 3SQLA 3WGLA 4REOA 4RPHA 4US1R 1UP6A 2EW1A 5LA6A 3RANA 4AMYA 2XMCA 1R4MB 4LJSA 2GN4A 3WLQA 1SUEA 4FR0A 3P9ZA 2XNHA 1P2GA 4L8GA 4F60A 4BNDB 4GP6A 3LX5A 5EKDA 5D3QA 2HDHA 5TR9A 1UJ4A 3U4HA 5KYYB 1DAOA 1H0SA 3L43A 3DBIA 4LYAA 4P7GA 3HCBA 4XIYA 5C2JB 1Y4ZA 2BTQB 4Q9AA 3H9EO 3NWJA 4FLEA 2A6PA 2IQ5A 3NEYA 4JYPA 2ZUTA 1NI3A 1OGJA 3K0CC 4IHAA 4AXXA 4FFNA 1PJ4A 4LC9A 4OV6B 4TMKA 4CMEC 1LVGA 4W8OA 3IQFA 1U6IA 2Z6AA 1C8KA 1G8FA 3DR5A 3OM1A 4KQIA 2CXTA 1HM5A 3H5NA 1U0NA 3CXUA 1U2GC 4ETWA 5K51A 3AL2A 5FA6A 4D92A 3IPLA 2A5FA 4OGGA 5CH5A 5J47A 5LQJA 5AVQA 4HH0A 4AICA 2NVUA 3H6KA 5LQMA 5AW4A 4PO8A 4E2YA 5LMUB 4RGYA 4LDZA 3KC2A 3BRWA 1JAHA 3MUNA 3N2GB 5AOVA 3SF0A 1DS6A 1G7SA 3HACA 1P9WA 4RK1A 4FOOA 1N8KA 3RC8A 3FMFA 2GUGA 3K2IA 1M5UA 4LJLA 1W25A 1Y8AA 4JP3A 1O54A 4H17A 4J3JA 1DADA 3R5SA 1XZ8A 2XY4A 3IAM6 3OX4A 1HXHA 1TM4E 5CB4A 4CM6A 1W46A 3HB7A 1RVV1 3SOZA 1J21A 2P5UA 2YJ5A 3O73A 2DUJA 5HKAA 1L5FA 2EFCB 3NR2A 3PDUA 4JQYA 5I7SA 4CR7A 3IIJA 5K09A 2VTKA 2VH2A 3OCVA 1IMOA 1D2NA 4YT4A 1QYXA 2QTGA 2O14A 4BLTA 1ZD3A 1SWVA 1CUZA 1D5WA 5D6NA 4MKXA 3I92A 3QEAZ 3GMTA 2WLSA 2O9JA 3TYXA 2JGAA 4ARZB 4FOSA 4OYHA 2NTJA 3SC6A 3DC2A 2OKCA 1AGRA 3ZDQA 3BFVA 1FIUA 1DC6A 1RXUA 3KXKA 2JGNA 4EA9A 2XT6A 1U99A 2YFQA 4JJIA 5T4HA 1VBKA 5FV7A 1CRQA 4E2XA 1ZD8A 4ZCMA 3GW8A 1RABA 2X8AA 1J09A 3AERA 4ZRDA 5KAPA 2J67A 4B4WA 3OX3A 3UMSA 2F1JA 2R8PA 2Q9AA 2ADOA 1Q6ZA 2QXYA 3BZUA 1QHIA 2I3DA 4KVGA 1OWNA 2G4VA 3QWBA 2JASA 4UNIA 3MAJA 1HKHA 2YICA 5K3FB 4CKBB 4YUZA 3EZXA 1RJ9A 1C7RA 2WYIA 3SJBA 4D4JA 1KNXA 5KJ6A 2QQGA 2ZUDA 3BH0A 2QTBA 1O6ZA 4PYLA 1Z22A 3ETCA 1X7XA 4GMDA 4OHCA 3EXHB 5AI8A 2XYQA 4FC7A 1M1NA 1BXZA 2RGBA 4HNAB 3ISJA 1RWMA 4ZK6A 4QZVA 4BKMA 3GPBA 4KBGA 5DNEA 4B45A 3RTDA 3BREA 4DPLA 2GCOA 3FCOA 1RQGA 1GUYA 5DHFA 2HHHB 1SEPA 3EGEA 4ZI7A 2I22A 2QP4A 2CDCA 3A10A 1DI0A 4OQPA 2PX8A 3R7BA 3DE5X 1NUHA 2ZOSA 3QPUA 1ZD9A 3DWIA 4RQAA 3NWPA 5ICEA 4JVMA 5AI0A 1YR7A 2IYQA 2H59A 1Z17A 4Z8XA 1ZI6A 2HADA 1DC4A 1U7XA 1SH7A 3KDPA 3EGOA 4FOPA 2BDEA 4CMKA 4E07A 2ZB8A 1FY2A 2Z6VA 3V1YA 4ILKA 2WTNA 1QVZA 3DS8A 3PT9A 2YZ7A 2FPLA 3IQHX 4KGVA 4MGKR 4TL7A 3QG5A 4Q9JA 4B7CA 2V6MA 3GB9A 4JB0A 5F51A 3EYWA 1KMIY 1UOOA 4L5IA 2AXNA 4KXLA 4O8CA 4BCDA 3JR3A 3FGZA 4M7OA 1FFSA 1EXMA 2DPMA 4RIEA 1XTZA 5J5CA 1AJEA 2PU5A 2ORVA 2O50A 2ZTVA 1RBMA 4LOJA 2DYKA 5CU7A 4BNUA 1YR6A 3JVDA 3N3BC 2A0WA 3Q15C 4DDWA 2HREA 4WBNF 1V1MA 4O25A 3TRKA 1ZW6A 4MA5A 5C4IA 2HWWA 2PANA 3ITNA 5EHGA 3ZV6A 1ACJA 4IMJB 2VDKB 5K4AA 4UOQA 4YAUA 1HE1C 1PZGA 2I80A 2AFVA 1S7GA 3ZXIA 4S35A 1CUAA 2EEZA 1Z63A 2FSSA 3ZR4B 4XJXA 1HKUA 3VU8A 2VNSA 1Q7RA 2R8RA 4LZZA 4XUGB 4BY9E 1VHTA 3NMUF 4H0FA 1L1EA 4S1NA 4AS3A 3D54D 4B6EA 2XCUA 2ENWA 1P18A 1PT9A 2X2EA 3D0QA 3NHBA 4ZYZA 3QJGA 1W2GA 2GASA 1IDOA 2J3IA 3H1EA 3BJZA 4BZQA 1V43A 5CA1B 1H2RS 2XMBA 4H7HA 4PZEA 2GCGA 3WE7A 1PRYA 2ZIEA 5JALA 3RT9A 2UDPA 2Q3HA 1Y5MA 4LRSB 5JNLA 4YQYA 5LU9A 4RF4A 2GM3A 1M1XB 2CUNA 3HWWA 1AXEA 2F67A 5HFJA 2KBFA 4D99A 2W2KA 4BN0A 5HQTA 4XPIA 1LU9A 1B2RA 1XEXA 1XVLA 1V0JA 3DE7X 3QUBA 4MUMA 3MLEA 1B43A 5ELLA 1J5PA 4BJ6A 3M2PA 3WFIA 1K0FA 1EVQA 4GPEA 1LQUA 1BO6A 1FU8A 1YC5A 2XDWA 2YWCA 4P3OA 2VNIA 4MI6A 1DJLA 1FRNA 2QLBA 4NYJR 4EUHA 3FBTA 4F3RA 1VJCA 1Y1SA 2CWDA 3TQRA 4DA9A 2XI4A 5FWXB 4PAOA 1VSBA 2J5XA 1GXSA 3R3WA 4M87A 4CE6A 3QFRA 2Y1KA 3IODA 2DULA 3NTVA 3EF0A 4R6WA 3ULKA 4XGQA 4C6HA 1XI2A 5TMDA 3IT1A 2ZRGA 4CEJB 2R44A 3CMCO 4FE4A 3REFA 3G2IA 1P44A 4A73A 4NAUA 3G9XA 4G07A 4NOMA 3SZMA 4D1YA 1O97D 2O0LA 3S2ZA 1MHTA 1UFKA 2HXYA 2A1IA 4BZPA 4UHEA 4URVR 3PSAA 4EENA 5ED0A 1H2WA 3WLPA 1T4CA 4RORA 1X80B 2AJTA 3MRVA 5JO0A 2AKEA 2D0IA 2ODNA 4HRVA 2IYZA 5C5IA 1V4VA 2AQHA 3OE7D 5FL7A 4C4XA 421PA 3K0EA 3M5WA 2I29A 1EQ2A 4QNNA 5KTSA 4JI0B 3VR4A 3KE9A 4C3OB 4FX5A 3GX1A 4JUCA 4XTRA 1GEGA 2E4YA 1E20A 2HA6A 4DIBA 5LBUA 1FDTA 4U7GA 3L4SO 1ODSA 2G72A 2R6JA 3AJ8A 2FR8C 1CUJA 5DHQA 1XYYA 1C2TA 4TWIA 1AKEA 4J0GA 5FOTA 1IQUA 1PK7A 2FUG6 2R86A 2DWCA 4NCIA 1P29A 3SHQA 5F1YA 2WICA 4QYIA 3DLCA 4RDCA 2K7FA 1YI0A 2FMKA 4OA5A 4D6YA 3Q3HA 2BF4A 2YXNA 1IAQA 4LJ6A 4U7HA 1MVOA 3DMYA 4MUYA 4TTVA 2LBPA 1G3IA 5DNWA 3S1SA 3QEOA 3ROTA 3TCXB 2GCIA 1HSZA 3ONWA 3DVAA 1P3DA 4MW9A 4DCTA 1J0XO 1JJVA 5F5LA 3VAYA 1W8IA 1XK7A 1RWPA 4A1OA 2FPRA 4QXAA 1QQBA 5KMGB 1NVWQ 3LGXA 2ECPA 3W8DA 2IEGA 1DMRA 3SHVA 1VBMA 1KMNA 5LMNB 1NG9A 1ZGAA 3O8LA 3KWJA 4IGEA 1SM4A 4NU6A 4P31A 3SFZA 4KXVA 1J07A 3H3JA 4WBNA 2RGNA 4M9RA 1X8LA 1YNOA 4INOA 1YBAA 4KQKA 3DCYA 1UPUA 1Y5LA 3F6BX 1VIYA 3RUPA 1N4DA 3DV2A 1ISPA 4BP9A 1VXRA 1II8B 2XKJE 3QX3A 3P1JA 2FH5B 1OFIA 5HF9A 1I7NA 5KTNA 2PSJA 1F14A 8ATCA 2BGKA 3L7OA 4H1UA 1R4NA 5LN1A 4G41A 2EG5A 3WJ1A 1CR0A 4E14A 4XJTA 4ID9A 1RC1A 2BSAA 4N3GA 4BBZA 3LWBA 1UK6A 3RS0A 3PUYA 2E6KA 1H9BA 4B3BA 2E82A 3EQ2A 3EF1A 5IEJA 1TLLA 2OT3B 3K71B 3U7RA 4Q1BA 3NOXA 3TM5A 3ZPXA 4C7VA 1VMIA 4KVZA 1R9NA 3ZLUA 2AN4A 2BZSA 2ZJ7A 8MHTA 3A4NA 3WB1A 5GMOA 4LWOA 1EUCB 1LK5A 2CNBA 4IDOA 4B47A 2Y3IA 2WMYA 1LPNA 1OJ7A 2RHMA 1UKVY 4XB1A 4W7SA 1KE1A 2WKPA 3PQEA 4DG8A 3L0IB 4YYZA 3N8KA 4MDYA 2Q5LA 3EA0A 2L18A 1YJCA 3GFQA 4OHUA 1E2FA 1V5GA 3N2YA 4LSWA 4RIHA 2C7RA 5FOUA 4B3JA 5DTQA 3OE4A 2VP4A 2CMFA 5EESA 4RQUA 3UH0A 3N9IA 4XX1A 2WIAA 3IBCA 3F6EX 4J1NA 1RHRA 2ADMA 1Z5OA 3OFJA 3TFOA 3RU2A 2ZYAA 8OHMA 3PNYA 1AMOA 3UAOA 2V59A 3ORYA 1OA0A 2W6JA 5ALDA 2RH9B 3OP1A 4UM9B 1EVKA 2CW5A 2G6BA 1JB9A 3E7XA 1JG2A 8ADHA 2W4MA 4YCBA 1T2UA 1ZOLA 2W7TA 1X74A 4PGGA 1NF2A 1P0CA 3MT0A 2W00A 1N2BA 3LVRE 3R6WA 4C30A 4YPFA 1P0MA 1QBGA 1TYZA 3NX4A 4HGNA 1S8OA 2WT8A 2Z30A 2NP7A 2AYYA 2AUMA 2IIBA 2XA2A 3M8KA 4RV9A 3OF5A 3ZIDA 1DTEA 1YZGA 2E49A 4B7UA 5JJCA 1I2BA 4AQDA 2CFRA 3D5TA 3KLMX 3T7KA 2JRLA 1WUYA 2ENUA 3DTNA 3DZJA 3H7IA 1BA3A 3N87A 3RIXA 3ZWDA 4AMVA 2WIBA 2O2DA 1ICIA 1XRRA 2JLBA 2PU7A 2WA2A 3D6AA 2P2GA 3CMMA 4HQ0A 4L2IB 4M36A 4BO7A 4DJEC 4HADA 2FMTA 2I6TA 1R0WA 3IV6A 2R4TA 5HGXA 4GKKB 3E8XA 2GO7A 4B5KA 2PBZA 1F2UA 1JPVA 2HO5A 2PS0A 5DMXA 2X0FA 1ADJA 1GN8A 5AVVA 4A15A 2A1TR 3U3KA 1LVHA 1S1MA 1DQPA 3PNKA 2VK2A 4ZT6A 1ULAA 5IRCD 3CM0A 4U5XA 1ZCBA 4XQCA 4CLRB 4ADSG 3TLXA 4JASB 2UXCB 1AKYA 4R2XA 3QMVA 2WJZB 3JZAA 4BTLA 3I0NA 1I13A 4JR2A 1IN7A 3FOWA 4UTVA 5JZBA 4KREA 4AN0A 2ZAYA 2ZYGA 3W6OA 5ADVA 3RTCA 3ZKWA 2H16A 2O59A 2QAGB 4X1IA 4OLHA 1JQEA 4KGZA 1WMBA 3AEKA 3ZY6A 3M4ZA 2CY0A 4JJEA 3UJHA 1J42A 1EWYA 4DQLA 2BDTA 3HO8A 3AIMA 5H81A 2ZYTX 5CM2Z 4HDRB 5CDUA 3UJCA 1MO5A 1ONNA 4LF7B 1I6LA 1VE5A 1AQLA 1EX6A 3SIRA 3SU8A 3KB1A 1C9DB 3EG9B 4WL0A 2HCTA 3IL2A 5GVRA 3SI7A 1B1AA 4DBLC 3KZKA 1SBQA 1ZXBA 2ZJ4A 1RAAA 5AK3A 1XCJA 4WN3A 5EIHA 4C4OA 2BRUA 3PJDA 4QFCA 3CCBA 4ANFA 3SC2B 4B2PA 5KQLA 1SVIA 4P5DA 4QXOA 4MQMA 4ER7A 3WL3A 2O5EA 4PRYA 1DSSG 3CB4A 3WHPA 1QGZA 4ABTA 1WJGA 5MN6A 2P5YA 1Z4OA 2Q1WA 4PG4A 5F52A 4FNGA 3SDSA 3GLIE 3A4MA 1AQYA 3HN2A 4TT3D 2HQ1A 5EXEA 3SYTA 4BO2A 4IHJA 4I08A 2NO0A 1UWVA 1YZFA 2ZIWB 3JAWA 4KE8A 3JX9A 4BXOA 2HNKA 1FTWA 1G8SA 1W581 2OD7A 3DAHA 3L77A 1J5EB 3ITDA 3KX2A 1Q5PA 1BSVA 4EFMA 2RKBA 4YFVA 2IW3A 3ADOA 4ZVOA 5CLFA 3OZWA 2V4ZA 2BEJA 1E79D 4PV7A 2QTAA 1D6SA 2GAIA 3LOUA 4Z4GA 3VPDA 1YFJA 5L3SB 1MDBA 4QULA 1QP7A 1UKEA 1XYGA 2G7ZA 1KDZA 5KOHA 4AY2A 1T34A 3KZCA 1WCXA 4LY6A 1H65A 4L02A 4LHZA 3V4OA 1BFKA 1PJLA 3ABSB 1KSJA 4LBWA 3O92A 1MUUA 5JPIA 1ZVMA 4ZRNA 1UMCB 4OSOA 3BQ9A 1YONA 5GZ1A 3VJMA 1KOJA 1V9LA 3MW8A 2BRUC 3I2IA 3EVFA 1AKWA 3MBKA 2M2IA 4MIOA 1XJWA 3DJYA 5B1HA 5E9QA 4WZBA 1L5VA 3Q85A 2V58A 4YROA 4A3SA 3V8NA 2UV8A 2WWFA 1NQOA 1P81A 2PUJA 1X6VA 3FB4A 1JDBB 4MIKA 4BVJA 1HO3A 4JHXA 4IO0A 5EJ5A 2FGJA 4PCUA 3O2SB 1PJ8A 2AK3A 3LT1A 4NKRA 1QBKC 4AECA 2O6HA 1E69A 3SQOA 1Z25A 2HSZA 3R7FA 5KQPA 3EMBA 2FSVA 3IILA 1U0SY 1Z62A 4W5JA 1J90A 2P7IA 3Q2IA 4DLUA 1C7QA 5HF6A 5D2CA 3RIMA 2YCBA 3ZDZB 2BEVB 3AI3A 1C8VB 1Q3TA 2YZNA 3GLIB 4K1LA 2Z56A 3WWOA 1IE3A 2W2PA 4DUGA 2J85A 1XFDA 2C5GA 3FPJA 3QIVA 3RT1A 1GPNA 1X9HA 4IINA 4X44A 1SCUA 1QFJA 2RI0A 3W3AA 2OHXA 1VJ0A 1XZEA 1SQFA 1DKPA 1U9IA 1FYFA 1XTIA 1TU3A 2IP2A 3FX2A 3JQ8A 4KPGA 2G07A 5A03A 1RAEA 1Y9ZA 1N36B 2BSXA 4XVQA 1VIAA 3S0JA 3EXAA 4G1BA 4UNSA 9MHTA 1DMSA 1CZOA 3CNQS 5LWQA 3AHCA 3GIDA 3HBNA 2FLKA 3I64A 2D2XA 4QM6A 2PRSA 3OCYA 1MV8A 3E5MA 2CJWB 3BOSA 4Z9YA 1B93A 3ESXA 4M3NA 2IUSA 4BNKA 3C3MA 4RTQA 5L51A 3NHAA 1C1XA 5IN5A 1DIOB 1HMPA 3OTHA 3V9PA 2O19A 3PD1A 1BKYA 1K75A 5IJ9B 3Q8LA 1NLFA 2LVBA 4G4GA 3BWXA 3L79A 3EVBA 3EWIA 1WUTA 1U90A 4MMZB 1DX4A 2ZZMA 3TOSA 4ZHQB 1COWD 1KAMA 3QPVA 2XEXA 3ZX4A 4X54A 3BFJA 4BDSA 1P2DA 2FSVC 3M4YA 4UHCA 2P91A 5LXTB 5C8XA 2IIQA 2C2ZA 3TNDA 3G1TA 4N6NA 4O1MA 5FTMA 1LSSA 3OBIA 3BDIA 1ITZA 1DRKA 1XRLA 2ZT8A 3AP2A 3GRRA 4AJIA 1UM9A 2G04A 3B9PA 4EFLA 2GAFA 2DTXA 4BASA 2PCLA 2ZS8A 1VXOA 2GDJA 3TJZA 1KK1A 4QLBA 2JFVA 1UK9A 5IAJA 1IN8A 2FQQA 1U9IC 1BYIA 2IS6A 3B20A 1VJDA 1H9AA 1QG2A 3C48A 3Q3IA 1M9NA 4HAZA 4JOQA 4WJKB 3WMWA 4AZWA 1DBQA 3IHKA 3EPHA 5JYDA 4W5QA 4B3GA 5JDIA 3KZOA 1S01A 3EGVA 2ECOA 1U1DA 1WSAA 3BWVA 3M9WA 4JI1B 3BZWA 3BMCB 3RF7A 1UJBA 2OM2A 4AZSA 2Q4EA 4B4VA 3Q6MA 2XIJA 4EVIA 3K1AA 1KDOA 1K86A 1HLGA 2N9UA 1KZ1A 1NVUQ 2XZPA 2BGNA 2QRQA 1RPJA 3NVMB 4RD2A 2CYAA 5BN4B 1W4ZA 1KZHA 3DNPA 1NMSA 4FMCB 4Y6LA 3VPHA 3HH8A 4HQLA 2EQ5A 4RF2A 2WC1A 2NACA 3QY0A 4N39A 1FNBA 4Q9IA 5B4TA 1E3JA 3CSDA 5U9CA 3V4RA 1A8PA 2HQRA 3FKJA 3MERA 5D7BA 4FYWA 3RB8A 3TJRA 3W78A 2ZRKA 2B25A 2MDTA 4G9GA 3G2PA 5E1BA 4I1UA 1FX0B 4BV9A 2G4LA 4DY4A 4MPRA 4DFDA 3FXAA 1J8YF 4P8RA 2XXAB 3RRXA 5EG5A 2CLKB 4MV4A 4PNZA 4OBXA 4DCUA 5KSOA 3C3XA 4LX0A 5K3AA 2OQRA 1XOIA 1K6JA 3EEQA 1A9YA 2FUKA 4A4DA 5TQ0B 2ZWAA 3K92A 5K5EA 5F76A 1ZA2A 2HU5A 2PH1A 1TPZA 2VF7A 4Q7JB 5CW2A 1NJ6A 1FLDA 4JJAA 1BQEA 2ZM5A 1U5BA 1O95D 4TL8A 1YJ5A 4GECA 4HB3A 1H85A 4ONEA 4ZAFA 1JSLA 1R9JA 2HWUA 1F0NA 4BUCA 2ZIZA 2V9CA 4AO7A 2OHOA 1IJKA 4G56A 2CVQA 2YQ5A 4YJGA 4O3FA 4DCOA 4K88A 2FQ1A 4PY2A 1K88A 1R8QA 1GZ5A 4CCWA 4MZXA 5E6SB 1YI8A 4ROSA 3I3SR 3TI9A 1E9FA 2V6IA 1J70A 4DKXA 3L49A 3L02A 2EGHA 4I0WB 3S44A 1SKUA 4LUCA 1QH8B 3ZI7A 2YC4C 3NHLA 1G5FA 3L92A 1J2RA 4FYPA 4D8TA 2V7QA 4NOLA 4KYVA 4QPNA 4WESB 3UXMA 3V3KA 2ZDGA 4D3ZA 2WYOA 5AM2A 4P22A 4G36A 5BXYA 5KUTA 4F1KA 1Y8CA 2PGDA 2C9DA 2NYAA 2ABWA 2RI6A 1KP3A 1VPTA 2P68A 3HVUA 3WL4A 3PEFA 4CDGA 1FE8A 1M2NA 1M8PA 3I04M 3EVNA 3WHLA 1JEJA 4Y0VA 3LX4A 1EA7A 1L7VC 1W85A 2BN4A 2MT9A 4LV6A 4MR8A 4Z2AA 5JC1A 1UBEA 2IPAB 4FVTA 1N3YA 5IT4A 3A28A 5AW7A 4KWHA 4LRYA 4EI7A 3FCUB 3GJQA 4DEYA 2OESA 3NHRA 2PR7A 4II7A 2AL7A 3LKZA 3ZE0B 2I4MA 3C3CA 3WLAA 1C5KA 4HSGA 4WKCA 4GC5A 4BWVA 1R37A 1NF9A 2HRRA 3LT4A 4FFVA 1EI9A 1YUNA 3NEAA 1HG0A 4G4IA 1HE5A 1JHPA 2NLOA 4IJQA 4IM7A 5DXFA 3UK1A 3BB4A 4G84A 3H11A 3OWXA 1O9BA 5HZHA 4Q01A 1FFWA 2ZYHA 5J2UA 4GYJA 2OLKA 1E3TA 1WY5A 2QQFA 3MRXA 2A84A 1ZU5A 3V7YA 3W2FA 3R3SA 2X4IA 3WLRA 1AGXA 1JVBA 4BWGA 4XVUA 3BXFA 3DQQA 1T5OA 3H97A 3OAAD 3RSGA 4KBYA 4AUKA 3CNLA 2UYOA 1CD5A 2Q4DA 3RAJA 3TOCA 2UYCA 2EJBA 3SF8B 3VKWA 4BMVA 4KI7A 5BQ3A 4K6OA 3K1YA 4QBIA 2QU8A 5JR3A 5KIAA 3PXUA 4JUFA 4OQFA 4PIVA 1CY8A 2NUPB 3DTVA 1Z2EA 2GYYA 1Y3AA 1ZM7A 4HAIA 4IF4A 4CMCA 2F17A 3D3KA 4XSHA 4DDMA 5JRJA 1IZ9A 1HMYA 5BW5A 4D4HA 2ET6A 2WB2A 1I2AA 2LIPA 3JQGA 1CZLA 2F3QA 4RXTA 1Q92A 3IMGA 5F7ZA 5DK4A 3D8NA 4DCVA 3SM9A 5A6SA 4NPCA 2E21A 4PIPA 4B7AA 3VSBA 1DQYA 1T5IA 3RRFA 1YVEI 2NZYA 1LDMA 1V3VA 2JRCA 1E1KA 3OQVA 4QAQA 2R1UA 4QQ8A 1CUVA 5I4BA 2NGRA 1HBJA 3FF4A 2DQSA 4LE0A 3FKQA 3ZG6A 2JJ1A 2FGKA 5BSRA 3LO8A 5CAEA 3BJEA 4CMIA 4HUTA 1B6SA 3CPJB 4YREA 2J09A 4GQAA 1DNPA 3FSGA 2Q1TA 3NG1A 2D2IA 5IUJC 1G60A 2WAXA 2FW9A 3DL4A 5BOVA 4ZD6A 4BVBA 1DBWA 1MJGA 1ECPA 4EZBA 1XIVA 3ANYB 1LF5A 4MS3A 4LF6B 2GKGA 3H2SA 1U3WA 3WS7A 1ZCJA 3LF1A 2R4UA 5BYKA 4Y1FA 1LS1A 4GDMA 1SN7A 1OAAA 4TZKA 1OX4A 3BYZA 2BR3A 5EXPA 2WJIA 1CY1A 3TTYA 4CT4B 4G2TA 4XB6B 3VX4A 4RCVA 4E5NA 2YYSA 3K9WA 2I87A 2P0AA 3H3FA 4LRXA 1SBIA 4DSOA 4QQRA 2YW2A 3NAZA 1ULUA 5EZYB 4R40A 3TSOA 2IV2X 3U26A 2K7ZA 3P9YA 1GGEA 2XGOA 5EIBC 5A3SA 3ET4A 2VWHA 4MYDA 3FM9A 2I2WA 3KYIB 1CLEA 5JHGB 3HKBA 2OYSA 3WYCA 3PV0A 3QNWA 5GONF 4QSMA 2NOAA 3DFKA 3IB6A 3PFBA 4J91A 3DM9B 4U6QA 4C4SA 3KTOA 2WDPA 4OO3A 4BCCA 4BNGA 4JLBA 5BWBA 3U7EB 3JU3A 5C3UA 1JR4A 3ZU5A 4JX9A 1Q77A 2ZBEA 5AQ1A 1KQPA 1ZK0A 2VDNB 4FPXA 5IF3A 4Z7OB 1O58A 1U28A 2OQVA 3STVA 3U80A 2G80A 1MB3A 4QIHA 3B2EA 4LJ7A 1EM8A 2V03A 2EYQA 4QODA 4W4TA 2WIDA 4OMUA 1Z88A 2W2QA 1H5UA 3IQIX 3PBKA 4ER6A 2IDKA 3PC3A 4UE6A 4UUMA 4DSNA 1FFCA 3U9LA 2BAGA 1VE1A 4FNOA 3WGVA 1RU3A 3ZW9A 1JR3A 3IP8A 3EWSA 4C2TA 3BIOA 1L5SA 5TSDA 2BMFA 3MVEA 3DVQX 4ZKEA 3ZDYB 1VLZA 4HAWA 3G89A 4FZVA 3VTAA 1JEYB 4X7BA 3BCSA 4NQRA 3T15A 1M72A 1U2EA 2AC7A 4YQFA 1SD1A 1HZJA 4ARVA 2RH4A 5JY1A 1POXA 1CHNA 4W6QA 1F51E 1NJFA 5FB3A 3F6SA 3L7CA 4A5OA 4BFZA 3U7HB 1W87A 3CPEA 1KOLA 1E64A 1Z0UA 3I0MA 4PHHA 2EDAA 4A16A 4M6WA 1OI7A 1P4AA 2ZJ0A 3DMTA 4FHFA 3PD0A 4MR9A 3BKWA 3FTFA 5HG0A 1RPAA 4E11A 3J81A 3PJFA 3S8EA 5H4GA 3LU1A 4CTNA 2WDZA 1MAUA 3WQHA 4BFUA 2GEFA 1E94E 3DGFC 3RLFA 2PV0A 1UM8A 4QNRA 2VKQA 3K16A 1YBMA 3PQ6A 1VBFA 4QXQA 2GPWA 1O6FA 2ILTA 3T7AA 4J94A 1S7CA 4XD2A 4JVNA 2H06A 3LBAA 4RH3A 3SJ7A 4CGZA 3ZGYA 4YI5A 3AL3A 1OXXK 1XUOA 3G9TA 4C7BA 2HSGA 3CH5A 4G5HA 5IXSA 2VRCD 3DL2A 2F00A 2O2EA 2ZBRA 3LGSA 3CVUA 1QG6A 1JIJA 2AJDA 3R7WA 3RVJA 3HYSA 1XZFA 3CZAA 5A9RA 2X86A 3EC1A 3M4XA 2YIVX 4MZDA 5CD1A 2J7PA 3PFKA 5EHNA 1KI2A 4UMFA 2I7TA 1JS1X 2C2GA 2C95A 3R8XA 2W6ZA 3MTGA 3TE6A 4DYHA 4BMYA 5IHPA 1MEOA 4HHEA 1P1RA 2VXYA 3HKEA 3KT0A 5COQA 3NC4A 2AJ8A 1V5FA 3ADKA 4XCXA 1PDWA 4V3CA 5B55A 5KWSA 2FEPA 2ZPUA 3DV0B 3IRUA 3VVBA 4JLDA 1CS0A 3PPXA 4YGXB 1ZJ5A 4F9FA 5ALRA 4BNNA 4BCBA 1AS3A 4GI5A 3K9LA 1GGFA 5EWJB 4N8EA 4PHTA 2IYPA 3FVWA 2QY6A 4FJ0A 2JVIA 5F78A 4AWBA 4B6JA 4D5GA 4Q3AA 3DYIA 1FNNA 3D8UA 1SVUA 1ZNXA 2PMKA 2JIPA 4WLFA 3R8FA 1YHYA 3DMNA 1FFHA 3H8WA 5DV9A 2D0OB 3FGPA 4ND7A 1OI2A 3O9VA 5D3MA 3WQSB 2C1EA 4IQ8A 1MOQA 2QTLA 4F93B 5FOQA 3GGSA 1CVRA 2ZBFA 4JGBA 5GONA 2WM2A 3I8OA 1DLIA 4CYMA 1OUMA 1BE6A 2J33A 3RC1A 5FWYA 1ESNA 3EVZA 5J4YA 3W9UA 1YDHA 1EK5A 1E2JA 4EJ2A 5A4MS 5DGIA 3RWOA 5IX8A 4WADA 3X44A 4HDCA 2JFUA 4RJ2A 4ZZ3A 4UQOA 4JEHA 4HL6A 4GL4A 1M1UA 3BL5A 4O59O 4YJ2B 3TR5A 5CNIA 3NCHA 2M6LA 5A3RA 5IXYA 2XHZA 4RD3A 4IG4A 4YDQA 2PVSA 1FDRA 2MSNA 3EBLA 3PPIA 4NZMA 4S2EA 3FCYA 5IMBA 1M6WA 1C9JA 4EFKA 2GXUA 2YDYA 2ZKIA 1CF9A 3S8MA 1XZAA 1ZU4A 3KJHA 1QE0A 4PFKA 2ZRBA 1E8NA 3A9UA 4ZAYA 2QE6A 2R0QC 3KDSE 1PJ2A 2A67A 3A1SA 2QZ9A 1FMFA 2Z9DA 2J30A 2ZJYA 4OQMA 3SZRA 4ALKA 3K9CA 4RMHA 5ICCA 1K8YB 1QIKA 3D2CA 2H7YA 1ODIA 1QRAA 2Q6IA 3AMVA 3OSUA 4N48A 5BNTA 2PA0A 3Q4GA 2GS9A 4LV5B 1GZ4A 1MTZA 2GZ1A 2J7KA 4JOSA 1C30A 2Q1SA 1L6RA 1SQGA 2E4XA 3GNSA 4DQVA 3IE0A 1T9GR 3C43A 4FEEA 2P9ZA 4RVFA 1U9ZA 2H7XA 5EVCA 5FLEX 3U4IA 5FTNA 2JBAB 3WWEA 4BYMA 4F71A 2JGKA 3A0RB 4UBIA 4G0WA 2GDZA 4N12A 4KFTA 1CE8A 4YAKA 1QB8A 2I71A 1TRHA 3BWBA 1JP7A 2P3SA 3R75A 1PFQA 1V95A 2C99A 2WHPA 1WXHA 2ZIXA 4OXNA 3G9UA 1ZI9A 1ZSVA 3ONEA 1DX6A 2I7VA 3PC7A 2P5TB 2XD9A 4JJFA 4ZU3A 4EDFA 1H3NA 3Q7SA 4P3XA 1IATA 1IVNA 1WU7A 4K40A 3T5TA 5KSZA 3EXG1 3OZCA 5TPWA 1OKKD 2A35A 2VNAA 4OPMA 1NBAA 1I7DA 2R6CA 3A9SA 3SZ3A 1EFVA 4ZODA 4LIPD 1A2QA 1OBOA 5DYWA 1ECLA 1YFKA 4Y9UA 3RBVA 1TKBA 2JD0A 4FZRA 3FZNA 4QKQA 4BVEA 2QG9A 4WI1A 3GLGA 4EOGA 3RIHA 4BNTA 3U3OA 5ITZB 5KNDH 4MA4A 2HK8A 4Y2HA 3P9CA 3ZU2A 1I14A 3FRJA 4RHEA 4YDRA 4TZTA 1U1IA 5CXXA 1MABB 4JLPA 1XZMA 3QELB 3RRJA