5H9WA

Crystal structure of regnase pin domain, form ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
b'DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
molecule tags Hydrolase
source organism Mus musculus
publication title Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions
pubmed doi rcsb
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h9wA00
4G23A 4G26A 3V32A 5DIZA 3V34A 4G25A 5H9WA 3V33A 4G24A 5FT9A 5H9VA
chains in the Genus database with same CATH superfamily
4NBKA 4MVJI 5AW7A 1NT4A 3IA7A 4D2IA 3V4ZA 5GM2A 5DZSA 4GX2A 1E2IA 4HQ0A 1YQ9A 3WIOA 3SM3A 1E9BA 3ETNA 4R2WA 4QOSA 1BX3A 2BFDB 5FUBA 3O4RA 1DXYA 1Y0BA 2GF2A 2C98A 1OTYA 1N36B 1U99A 4WUTA 5JTTA 2Z95A 4YMUA 4P58A 2BE9A 4KI0A 4DT1A 3RFXA 3O91A 5KJCA 4C7OB 3PFKA 2AR9A 1OZAA 2SHKA 1I2MA 1NQ5A 4DRYA 1NUSA 1SKAA 2LKDA 5HK9A 4NBTA 3NANA 3ZDAA 4MUEA 4CM5A 1RLOA 2BI4A 2J32A 2QMEA 4LRXA 1A1VA 3KEGA 4PVCA 4XPIA 3E7WA 2CMHA 4HPXB 5E9AA 5J1TB 2WJYA 5AXDA 3ZCVA 1PNRA 2YWCA 5L9AA 2GM3A 4MP3A 2OFFA 4DF3A 3ECAA 1HZJA 3R5TA 2CXQA 1BXKA 4I4TB 3FTPA 1ZKDA 4IVRA 1KXJA 1CY1A 1AZLA 1OMOA 1YCDA 3T7SA 1E1QA 1G1MA 5C4MA 1GP2A 1SCKA 3DDCA 4M0UA 2QMYA 1CJUC 4ARVA 4DV7B 3LXMA 3NIFB 2MR5A 1FYVA 5D7NA 3B53X 4EY6A 4NU5A 3U09A 2C2KA 1FTWA 2VHEA 1GYQA 3GZNB 2Q2QA 4LYFA 2GEBA 1YJQA 3SQXA 1RYDA 3ZQJA 3AR9A 2GESA 5FPPA 2PMCA 3BMOA 3U60B 2OO3A 1M2VB 4JH0A 5ITZB 4RULA 1NZJA 3ZY3A 3WWYA 3JQAD 3HNRA 1EVIA 5AIBA 2YWXA 4YRKA 2P30A 4UU8A 2EXXA 3OY2A 3L7JA 2ACKA 2VO1A 4LXTA 3RKSA 5K4HA 1NWHA 3KJZA 3SIPA 1ETHA 5I8WA 3OQOA 1LF0A 1L0BA 4TTVA 1V1MA 2HSZA 4JLBA 3LK7A 2PMEA 2CL5A 4IVPA 3V80A 2C4UA 3L6RA 4FFBA 5IVIA 1YASA 4MYTA 4BL5A 3RYFB 5BPFA 5ICEA 1K7XB 4BVKA 3IH5A 3SOZA 1V4NA 1SNYA 1SVNA 4K2HA 3TTVA 4KW7A 4FEYA 3B13B 5K09A 1YE5A 2GWHA 3ZIDA 4CMIB 1E3EA 3VUEA 3ZDYB 4WACA 4BP9A 1IN5A 4L5YA 5HF9A 2CV2A 4TSFA 4L8YA 5F76A 3OZRA 1EAYA 1ST2A 2GYYA 3PEVA 3WL3A 2ZRNA 4AJPA 4EWLA 4PQRA 2RJNA 4R0NA 5IANA 2PR7A 2OGZA 1YJ5A 1ZI6A 2W2TA 1RRCA 4PC2A 4QGFA 4CG1A 3AVVA 4C7BA 4ZVOA 4YDRA 1S0UA 1QX3A 4MYCA 1GKYA 4OK5A 2CLIB 3H18A 3KPWA 4MV1A 4ZDKA 2R1TA 3FOBA 3QOWA 1N0HA 4B6FA 2FP4A 1EUYA 3UJDA 2FH5B 4PLVA 1KC1A 1W30A 2AVDA 2D2EA 2N9UA 3CKMA 3AF6A 2KX7A 2FAXA 1AVTA 5T4EA 2X1MA 3ORHA 2PA3A 3KQTA 2OHGA 2Z1DA 1E58A 4FHEA 2N75A 2X2PA 4WA8A 4J3NA 3WG9A 5I7OA 2XKAA 1G20A 3PC8A 3NWEA 4NYMQ 2VUUA 4ECEA 3R09A 4DSZA 4DCTA 4TLCA 4ALJA 5TE9A 4PIVA 4W7IA 1TXGA 4BO0A 1O4VA 4XPIB 3BGWA 1U1FA 1O97C 5BORA 2W70A 2ZDGA 5KO2A 4RV5A 4UAJA 1FBTA 1CF9A 1JLSA 1LEHA 1LBQA 3KEFA 4P34A 4RD0A 5E1MA 1K9SA 1X7YB 5BNIA 2JFFA 1USIA 2IUEA 4CNQA 5L7TA 1DBVO 2XZDA 1H2ZA 1XLTC 4YCJA 3KKQA 4B45A 2Q3BA 2YBDA 1UT5A 3VOAA 1F8GA 1G3IA 4IDOA 4ZTUB 1A69A 3D5QA 2WEKA 4MS4B 2ZS7A 3ILVA 1ISPA 3OZDA 2DPXA 4QDJA 4GU5A 1RWWA 3MTBA 1QQ6A 3PFCA 4A8JB 4NG5A 1OYWA 4ARZA 1MJHA 3ZNPA 2QB5A 4PC3A 3KQOA 5CH3A 1FFAA 1JDPA 1KC3A 4LVCA 3THOA 1LY1A 1FMJA 4HFNA 3AP3A 4QQNA 4BJHB 3LOPA 1CJKC 1BJTA 1QTIA 2HF2A 1YHZA 3GIWA 5DM60 2XOKA 4BZPA 1VG8A 3RUHA 3B3FA 5HYVA 1DB3A 1A9TA 4WZAE 4ZT7A 1ZCJA 2O2HA 4E3ZA 3WP0A 5JAHA 2MR6A 1LTHR 4RZ2A 4ZK6A 1TFRA 3L4EA 3O74A 1QH1A 5JVDF 4AG3A 4J7CA 3AIMA 2EFHB 4A5OA 3KT3A 2H85A 3Q11A 1IY9A 3DL2A 3NTRA 5AVJA 1I2BA 4O0LA 3IIIA 2C7PA 1DIHA 3AJAA 4II2A 5BWMA 3ZUPA 1NW7A 5E1BA 1N2CE 2NQ8A 3ELYA 3H5NA 4MUAA 1VE1A 2HF9A 3A9SA 3G5LA 5DHTA 1WSBA 4YCBA 4GKBA 1YR9A 3U4QA 2WWIA 3L6UA 2RAUA 4RESA 4EMUA 4PX9A 4PZ9A 3E0XA 4URUR 3I2GA 3C43A 3PITA 3QTBA 4MRSA 3DMNA 3HV2A 4JI2B 5BUSA 4CG0A 4PFKA 4RVSA 3THXA 1VE7A 3FJ1A 5GV7A 5PNTA 4GIBA 5CB6A 4HWPA 5E6RA 3VRHA 4I1VA 2BEVA 2DLNA 3QUBA 2WF6A 4ZT5A 3WMFA 2D5AA 4R01A 2PKQP 5J59A 1DFHA 1JDJA 4XWWA 4ZVPA 5ICSA 1X14A 3G3EA 1T2FA 3GLGE 3K2IA 1M8JA 1R0WA 1WF6A 2OQIA 3F96A 4Y2XA 3STYA 4P4NA 3PEUA 1W5BA 3AZOA 3DBRB 4J0EA 4N5IX 4HLCA 2XMPA 4N65A 4QAQA 1NLZA 5CVJA 4DV3B 2ILTA 2Z9BA 1UMDA 1ZXLA 3KQUA 3HDVA 3T94A 3K0CA 1K8ZB 4AQ7A 5D1HA 1NOIA 5IYZF 2WU1A 4DDHA 1KPHA 1LSUA 4YJ3F 4C20A 3GPDG 1VBNA 2MJLA 4Q4AA 5K0NA 2Q7OE 3SEAA 1QYIA 1PP4A 1N0UA 5BQOA 1U4OA 4DM7A 4XVUA 3IDFA 4QGGA 2O8CA 1M6VB 3H2KA 3T9CA 1S5PA 4XB1A 2HEIA 1SHKA 4RA9A 2H06A 3MTIA 2W6JA 1ZY2A 2PUTA 2B0CA 3UQZA 3CTPA 3SZ3A 4MMYB 4BCDA 2IUTA 1WCV1 1EHCA 1CUGA 1T9CA 2XQFA 4BVLA 4E94A 5KWVA 5AWFC 1QF6A 2FFAA 5HDBB 3LQFA 1N9GB 3KXLA 3ZWVA 5F3WB 2WIBA 1Q1AA 1NZFA 1JHVA 3MXTA 2JAPA 8GPBA 4MVYA 1ZN8A 3TH5A 2OCAA 5G4LA 2SKEA 3KX2A 4C6TB 2VSQA 3FI9A 4WOKA 4JBYA 1MC8A 1H66A 1OREA 1WQ3A 2Q4TA 3CMMA 3MLEA 5HF8A 5BN4B 3RFUA 4I9FA 1AD2A 2FXIA 5L3VA 4MKIA 3GLGA 4OB7A 4GKJB 2ZPUA 4R8LA 3JATA 4LY9A 2PIAA 4D0NA 1HO3A 4LJYA 5LJIA 1GPH1 1EJ0A 1IC6A 1RMTA 2JIZA 2WE7A 3MOSA 3OFND 3QELA 1WCIA 1G42A 1V39A 2JDIA 1UWLA 2VT3A 1L8AA 4JLPA 3WSWA 1US8B 4M7PA 1QLJA 1LRKA 3UJ8A 3WRXA 2HXYA 4R9RA 2XD9A 3ND5A 3N7UA 2ZTLA 2O3JA 3EF0A 3FCCA 3AR8A 5E1DA 4B3SB 3T5AA 1I80A 4GR4A 4BNGA 3KVNA 4IIHA 5JBQA 4MUXA 1PJQA 5FRDA 1P5HA 1OPRA 5EXEA 4TTPA 1JG2A 4DMHA 1ZR2A 3EA4A 1EE1A 1WE2A 2XQGA 1G2OA 3NKFA 1EUCA 1Y8CA 3ILYA 1FNCA 1AKMA 3MRXA 3OPNA 5I9TA 3V4VB 5LDDC 1Z8HA 3SXUA 5D00A 5IJWA 3EUEA 2EQBA 1ZNXA 2YJ4A 4IJ5A 3Q3CA 1U31A 2F9MA 4CFSA 3CX6A 1TMGE 1GZUA 1S9DA 2G40A 4TTIA 4JT4A 1OJ7A 4DVJA 1UR5A 2DP4E 4JLDA 4QYSA 4HN2A 3RW9A 3QTLA 5JG7A 5KNCD 2R4QA 4CCAA 1MNQA 3S68A 2RGXA 2BGRA 4D0LB 3KZXA 4UPEA 1X9HA 2AW3A 2YY6A 1QC5A 4G24A 4LZNA 1GYRA 4B1FA 2IEDA 2DQZA 1UM8A 3PC6A 3IQGX 2FVXA 2QRNA 4PCVA 3RSSA 2XNJA 4B4WA 2O52A 2SNIE 3WAKA 1AS2A 3PEYA 1SQFA 4UM9D 1EX9A 1H2XA 1UZMA 4ZPXA 5TGZA 1HURA 1UJMA 1BQ3A 4CQNA 4ZOCA 3RC9A 1X8KA 4FHFA 2HQRA 4TLEA 4ZCMA 1EWYA 2FG7C 1N2XA 1W0JD 5I4KA 2AJDA 5KWJA 1KQFA 3ZVLA 1G9XA 4YH1A 4JFAA 3JXEA 1R88A 1B0UA 4G3XA 4P7JA 1SXIA 1IL0A 1T6ZA 2PRIA 2J3IA 4LCJA 1DELA 5DTEA 2Q2WA 1B8UA 1H1LB 3OT4A 4JT8A 2BFNA 4V1CB 1Y7LA 1O89A 1P39A 2WTEA 4RWEA 2XGSA 4MW0A 2QG6A 4NP6A 2X0JA 1T5OA 3F6BX 3MBIA 2QVBA 4CCWA 3ADDA 3PNYA 3B3QA 5DSXA 1E79A 2EP5A 2FMKA 3ONNA 1ESCA 5E6SA 4J0CA 3MWJA 4ESEA 3I5XA 3GMIA 1GCAA 3KOOA 4M3NA 3BRWA 3CZPA 2FSIA 4FC6A 4XQCA 4KBFA 1A9PA 3I2IA 1M8KA 3S2FA 4OY3A 4PLWA 2PD6A 2XVXA 2H1VA 4JAVC 2D5BA 4P53A 3TR6A 3H5TA 1O94C 4D99A 3DGEC 3KR1A 1YZHA 1Y6QA 3KVYA 1QYRA 2R1VA 2PUAA 1E9EA 1NHWA 1H8EA 1CUZA 3DE7X 3I01A 3O73A 3PJEA 3V6MA 4B2YA 2WT9A 3KAKA 3MWLA 2HGZA 4NOMA 4LJ8A 4DRXB 5DE3A 5DB4A 2CLLB 2ENWA 3JQ9C 5JFTA 3B70A 4XX1A 2BEKA 4R54A 2IWRA 3K0SA 1TQ2A 2ZYUX 4MINA 4WE3A 5JSYA 5DNUA 1UAAA 1SD5A 4JLSA 4BGVA 1VDMA 1ORWA 2XIQA 1H2WA 2HSJA 3PICA 3R5SA 4BVAA 2ENUA 2NO1A 2HWWA 2R87A 1K5HA 1W0KD 2YQZA 1LVHA 4KQWA 3F6CA 3RV4A 4AY4A 2F8SA 3C6MA 4RJTA 4RKRA 5DFAA 4BCBA 4EW2A 3IPRA 5EJ6A 1Z34A 3OM1A 5KYGA 5B55A 1CF2O 5F3DA 3GUYA 3D4IA 3NYIA 1MVOA 3VR5H 2C8VA 2GPTA 3AILA 8OHMA 2X0KA 3GIDA 1YJAA 2R751 2W43A 4PYMA 3B5IA 2VEDA 4KH1A 4Y1FA 5DHQA 3KKEA 4HOYA 4WXRA 3C5EA 2XZTA 2H1CA 1K89A 4IP0A 4KO1S 1WS6A 4OYYA 5EMJA 2B3TA 2J30A 3QKSB 3WC4A 1FP1D 3LRPA 1VCIA 1XV5A 2H0AA 1TPZA 4NKRA 5L51A 3LUBA 4MEBA 4JI1B 5CDUA 1GTRA 3AEXA 3N2LA 5B3KA 1R74A 1V6CA 3DW1X 4HNRA 2F3RA 1CP2A 5BSEA 2BFPA 1XJCA 1CYDA 1GPKA 1VG9B 2RH4A 3F8SA 4EGFA 4XVCA 4J7UA 3AKEA 4CRWB 4DR6B 1RMQA 3QWHA 4G0MA 4HAXA 3I8OA 3VJLA 3MTJA 4HDNB 2BRUA 1VKRA 4Z3OA 2NXCA 3VPBA 1KAGA 1A8UA 2G6BA 4RD1A 3IB6A 2GI4A 1WV0A 3WAGA 1K7YA 1AKTA 5B36A 4IDPA 3DMTC 3ZU2A 2RHWA 1NX6A 3X1ZA 3VYUB 1HDRA 1WHTA 2MYUA 2HMVA 3V7YA 1AS0A 2AD5A 1R12A 1WDKA 3QIAA 4NCNA 4BN0A 5ADVA 2GERA 3Q7SA 4D57A 1VE6A 2QDXA 3BXPA 2W6CX 2EDAA 1I1OA 3M89A 5LQNA 4QULA 4RVNA 4CKBA 2Z5GA 3T1HB 3G9UA 3WNQA 4Q05A 4E12A 1E0AA 1L5RA 3TINA 3K9FC 5A6SB 1U81A 1VLZA 3LWZA 2JARA 4ROSA 4Y2HA 1C0KA 2J4DA 2ZDHA 4ME6A 3FPGA 2HBZA 4MRVA 1EUQA 4XYEA 1RCFA 3VYRB 4D42A 4CTKA 3GT4A 1E2UA 3P94A 1PQWA 2Q07A 3D7NA 1C7IA 1F06A 3BREA 5JSFA 2ZJ2A 2MOKA 1L5GB 1JG3A 4NXNB 2FU5C 3L4KA 5CA1B 2C4WA 5F7XA 2HQSA 2D1QA 1SC4A 2ONKA 1Q3HA 1U8AA 2QGFA 4FQ7A 5LP6C 2WB2A 1OXMA 1VE9A 1TQDA 2GFIA 4QDXA 3RTAA 3SD7A 4UOEA 3ITDA 2VNKA 4JP2A 1QNFA 5DXJA 3BGOS 3KTFA 3HUDA 4HZUA 2DPHA 2DQSA 2LZ0A 2ZI7A 3TGWA 2FA9A 1G8GA 1ZUWA 2GA9A 2FGKA 4U2FA 4H4DA 4UEWA 5J4LA 1AUQA 3N2KA 3QPCA 4WGGA 1Q21A 1J70A 4W99A 1TCCA 3H1AA 1ORIA 2IYRA 4RFSA 4XM1A 4MR7A 1X7WB 5EXPA 1R37A 2R1TB 2J1LA 2MSNA 1LQ2A 3D4OA 3UO8B 4H18A 1AV6A 1PWYE 5C9ZA 2Y77A 2OLJA 1KDYA 1HR0B 1N3IA 3UUWA 3RJMA 3K5WA 2CLSA 3TTYA 4KPFC 4QPCA 1W44A 1CBUA 1GU7A 2XCLA 2OUIA 4F85A 4ZYVA 4G84A 1A76A 1ISFA 4V2IA 4DM4A 3GLIA 5AVOA 3ADKA 4ENQA 1KVQA 3RJ5A 4F5EA 5IXYA 1MUUA 2HA0A 3KKLA 1DT3A 3H4IA 1YDGA 4L57A 4D9FA 1T4DA 1J2TA 1YBMA 1CZLA 2CGEA 4PF1A 3S2UA 4DL9A 3T3OA 4QNMA 1I7LA 1VMAA 4OBEA 4MV3A 3MQ2A 4FP9A 1T5TA 1PX0A 1W49A 4YMIA 5DP1A 1RKQA 2GEVA 3KWMA 5TQJA 3OCXA 1P75A 4RMIA 5A5VA 2R8YA 3AJEA 1CJSA 3C5VA 5F4ZA 1J5PA 5DLPA 2ZXUA 1OBFO 1PEYA 2GQ0A 3DMHA 4UAGA 1F9AA 1UEJA 3A1CA 1WAMA 2QP3A 3NAGA 3VC1A 1V1MB 2QRGA 1LNQA 5A7HA 4YRBA 5K8IA 2W2MA 4ZYYA 5DBIA 1AKYA 2HT6A 5HG0A 4UVDA 2XNKA 3T4PA 4RWZA 4BTLA 2F3TA 4K1LA 2FN7A 3KOUA 4C4SA 1JXOA 4PYJA 5F52A 3TZKA 1U9CA 1RADA 4NMXB 3S1AA 4WQMA 4BIIA 3B6KA 4LMAA 2C4VA 4JNCA 5KCMA 4DNFA 4KR2A 3GAFA 3F73A 1U3VA 2ZVDA 4DMMA 2EARA 2YXNA 1ZD2P 4E5DA 1MQAA 4DEYA 4LJRA 1FUUA 3ADOA 3R3ZA 5EVCA 4C6HA 1JHYA 1CUFA 4U3JB 2QJOA 4Z0HO 3VR1A 3HLKA 3SE0A 1IUPA 4U00A 2ZW9A 1RTTA 1B8OA 5H4GA 2RAFA 4MCJA 4RADA 1PFKA 1J23A 1JQ3A 4H7HA 4P3XA 4DHWA 3DV9A 1ZUNB 4BKMA 2DG2A 4OD0A 2LCQA 1IDN1 2EW2A 2J4FA 1NIJA 3WK7A 1AKQA 1ELOA 5EJ2A 5I47A 1ODSA 1UT6A 5FOXA 3JRXA 1CQIA 3VDRA 3GFQA 2QBYA 5G40A 2YVQA 3FZNA 3NJRA 2BMJA 2F3UA 2I4RA 4PWZA 4TKMA 4YRTA 5F2EA 5HWSA 1IXYA 5IM5A 4AQDA 2JFQA 5AOAA 5TX7A 1XWWA 5EP4A 2FPUA 1TU0A 4R8VA 4BBPA 3C15C 1IZ7A 2D0PB 3TEMA 1DLJA 5EESA 4HUQA 4O2RA 3DP9A 3T35A 1OLUB 3ASYA 2E4WA 1AO3A 4OXQA 4X63A 1JTEA 1PDWA 3ACBA 2HWXA 1AKUA 3VPGA 3ZI4A 2E48A 3OF2A 1DX6A 1R4ZA 1FVOA 2W6QA 2WWGA 1L7XA 3A2MA 3ROEA 1Z25A 4OXYA 5JI2E 2WQ6A 3TLGA 3UVEA 1TRHA 2DBRA 1N3LA 2CXXA 2HADA 1WXWA 3WYBA 5MGNA 1CUAA 2WWRA 3QMPA 3K0AA 4ISCA 2FFRA 2XJ9A 1JNYA 5ALQA 3HJCA 3RSHA 1OVGA 1NKVA 1TZMA 5LLTA 4FN5A 4I6GA 1JYEA 2HTEA 2FUKA 3QIVA 3G2QA 3PE4A 1ZD3A 2MWMA 3BH6A 2ZM5A 4JB0A 1KZHA 1QZZA 1AX9A 1LC3A 4LGVA 4RD3A 1CUWA 1XYGA 2BMAA 3VNUA 1VFPA 3SEQA 3PGMA 4R3UC 5D84A 3LI2A 5KNCA 2V1UA 4NEHB 1VCMA 3NLLA 1KOLA 4LOJA 5AHOA 5BRNA 4B3GA 2IIVA 3E82A 3PQ6A 4EAAA 1C4OA 2GJ9A 5JSUA 1UMBA 1FY2A 1LBSA 5B1IA 3T7DA 4ZI5A 3NWBA 5HZKA 1A7UA 3W8DA 4P3PA 5ECWA 3ERCA 1O4WA 3CRQA 4PZCA 4REOA 4XX0A 5DTQA 2D6FA 3HXPA 4CHGA 3A9VA 1CNEA 1RLIA 4D6YA 3HDTA 3A4YA 2JCVA 3OZWA 3ZGYA 4CIAA 2WP0A 5T4BA 4YVFA 2QF7A 6Q21A 1T2VA 3S4YA 4WGFA 3IQFA 2ZI3A 4X92A 3T7TA 3KR2A 1U3CA 5CT8A 1L3BA 4CUZA 2H63A 4EGJA 3BWEA 1GZ4A 2I4OA 3FPFA 1DOHA 1T43A 4MRAA 1JG6A 3WL5A 1D8AA 1B4DA 1WU8A 1ADYA 4PSVA 3PF9A 4M6WB 3NORA 4BX3A 2OO5C 3CLUC 2B4YA 2J9FB 2DWCA 5COQA 2H48A 3H2GA 3OJCA 3NP9A 3U49A 3WYGA 3MWGA 1ZG3A 1GUFA 1GY8A 4L8GA 3JARA 4IRMA 2ORWA 2VJLA 3HZZA 4PS0A 1AB6A 3PVSA 1P2TA 5D6OA 2P67A 1KMNA 4F3YA 4Z1MD 2RHBA 1V6SA 4DCPA 5L3SA 5FUYA 1BWPA 5JAUA 2ZXEA 2HCJB 1PUJA 1Z88A 1EDOA 3DFKA 2NT4A 1QU2A 2OZPA 5KYXA 1UC9A 4X00A 4D74A 2OBLA 2OZEA 3E8XA 1VJDA 1ZWLA 3BMQB 4GQIA 3WBJA 1G291 1BS1A 1OR8A 2P9JA 1NU8A 1XD8A 5JJ5A 3SBDA 1MJGA 2X1VA 4GXQA 4MUJA 4MV7A 5PGMA 3REOA 4F7DA 2YY7A 5JECA 3EJWA 1A1SA 3SBOA 2IOFK 4JV5B 2NSLA 4HHEA 4HQFA 2G8NA 4KG7A 1UMCB 4OJYA 4HSGA 1SKBA 3B9QA 3W3AH 1XZEA 1SU7A 1GUAA 2F9LA 2LRHA 1Z4OA 1SCDA 2W6IA 1A04A 3D64A 3R7BA 7ADHA 2GXSA 1H5NA 3GU3A 5D3MB 1ISHA 2GAIA 2H0RA 3BWXA 3TNFA 3UMVA 4M7RA 5JASA 1R6TA 2QY6A 2R79A 1OLOA 3KWJA 5DCWA 4CV3A 1R8XA 1WTCA 4HJXA 4QUKA 5EMNA 1JH9A 5FUQA 5IHPA 4G8CA 2P0YA 2FRXA 4DMRA 2A0YA 1CQZA 1E60A 3I3SR 4MVJP 5JRJA 3QVLA 3HNOA 4XJXA 4UFPA 4MJXA 2RGNA 3CT6A 2NU8A 2QE7D 2V6FA 2CCKA 2WSIA 4P4SB 1I51A 3HO1A 1GPNA 1H8ED 4BB9A 1G8SA 2ZTVA 3B3JA 4NOJA 5GMOA 2W8BB 2C2MA 2CVOA 1YI0A 4GMGA 3TSWA 1Y9JA 3PPVA 1GG2A 1E3TA 2C8JA 2P2LA 3V3KA 4ZZ3A 4CTOA 4L0MA 3NGMA 1NN5A 4GL2A 2R8ZA 5ED4A 5AESA 2C3UA 4V3CA 4QA9A 4BV8A 1NVDA 4WNAB 5IAOA 4LZPA 4WKGA 5TDHA 3SVLA 3R5JA 4PXAA 4JN6B 2RHHA 2JCSA 2OCPA 4G9EA 4X5OA 4XQ9A 1DMSA 2I1WA 1VRVA 3BMCB 1HRDA 4Y0NA 1WR8A 3CRMA 3ZJYA 2HBQA 2C29D 3I01M 3L84A 1FW8A 2X14A 4QLAA 4MQUA 3U48A 2L17A 3R6GA 5BURA 1V45E 4V0RA 1W5EA 2O2XA 1GCOA 1L8OA 4F12A 4X9XA 3P9KA 1CZOA 1JJFA 4OFWA 3W3AD 3WHIA 2VNJA 2H51A 4YHBA 2QTFA 5DRYA 4YLGA 3W90A 2EIHA 2GNOA 3K9GA 1P29A 2XUJA 3NASA 4TRJA 3TLAA 3D31A 4LYJA 4LZLA 4QBHA 4ZVQA 4YV2A 3JASB 3TXYA 4BFVA 4MJ3A 4GXRA 3DBVO 3WYAA 5JC8A 2WKWA 4S12A 4INOA 3GJ4A 1XMPA 1VE3A 1MJNA 4EIWA 1U8TA 1G19A 5JIBA 2WUGA 3AB3A 3MHTA 1RZRA 2CT8A 3G5TA 3QU2A 5A3RA 1K3FA 1J0XO 1V9LA 1PNOA 3ABZA 2VP9A 3K1JA 5FL7D 1CDOA 4HQKA 3SSAA 4H7IA 4YQFA 3JR7A 2XCUA 4U2EA 3DOIA 4E5KA 3G23A 1KDZA 2ZR7A 3DLTA 4ZQEA 3STUA 5LMCA 1DCFA 1G2PA 1N5OX 3CX7A 4IHQA 1DS6A 3UWKA 1N8NA 3NHMA 4V1CI 1HX7A 4CMEC 3NDBB 4MUYA 1AUVA 2REXB 3G2HA 5JALA 4YMGA 2OOSA 2IWHA 2HJHA 2QL9A 1XLUA 2ZSDA 4OL0A 3LDFA 3ETJA 2M2IA 3IUBA 4G4GA 3EODA 4WUVA 4BV9A 1KJ8A 1X9IA 2P1ZA 4PM4A 3OPVA 4JC4A 3BTUA 5J40A 4CIVA 5F12A 3E7PA 3I1JA 4UTVA 4GGOA 3ABOB 3HCAA 3ESZA 1VIMA 5K3FA 3ENNA 3OPYB 3I39X 1GCIA 2PGAA 1DCKA 1ESNA 3GCWA 3U7FB 1UC5B 3OICA 4URFA 3E4DA 4CLHA 4DCUA 4DSNA 1U0GA 2OB2A 2GSWA 1S8AA 5ALNA 2XBUA 2PBZA 2YJZA 2A0XA 4JI3B 1JBQA 5F5NA 2XW6A 4R69A 1LDEA 2A88A 3HDYA 2Y2UA 1DC8A 3NUZA 2D59A 5AUQA 4ANFA 4QJ3A 3FTEA 3K05A 4BTVA 5K8TA 4N48A 5NLLA 3ZWMA 3LQ4A 2IXFA 4G23A 4Q03A 3PF8A 3UGKA 4RSGA 2OA0A 3PYXA 2QLFA 1AZSC 3SYTA 4LWOA 4KYTA 3UY4A 3DKRA 2R25B 4FCCA 1BKDR 4NZYA 4PNZA 3WTCA 3DOHA 1IY0A 4RMJA 2XMCA 1G4HA 1Y5RA 3HKEA 1J07A 1Y1SA 3N0TA 3WI7A 4AYWA 5CR9A 3UGTA 1OXXK 4DIBA 4I1YA 4OU4A 4FLEA 5HGXA 2DHCA 4GOOD 4RXMA 2GN8A 3HXLA 2UZ1A 1AKVA 5EPUA 5LD2C 1DIBA 1CEYA 2PFSA 4FFLA 5AKXA 2XT6A 5KNDH 2DLDA 1XQ9A 4N9WA 2F43A 3CEAA 1KHTA 3HNPA 3S8YA 2TECE 4X93A 2NV6A 1E69A 2QN2A 1UPUA 1INLA 1TLFA 2AI3A 1QGZA 2AL7A 3P8ZA 5BV0A 1NBMA 1L7NA 1XZ8A 2Y9MB 1CZNA 4TKZA 4WFQA 1P4SA 4O4IB 1T0BA 2CXOA 4D9JA 2QORA 1TUIA 1LLQA 1JEEA 2A7QA 1TYDE 4V1CA 4UHEA 1UM9A 2ODNA 1OI7A 3BXHA 1XCLA 3CUVA 3MERA 2H2AA 3LSYA 4TTJA 2F1HA 2YNMA 3O7WA 5EPOA 1SZDA 4DSOA 2ZUEA 3JARB 1VXRA 4KHPB 3O84A 3PXUA 2JA1A 9ABPA 2A86A 3HEBA 2I54A 3N8KA 1PFVA 4Z9YA 3DOUA 5FKJA 2P90A 1GARA 4KYVA 3P9RA 5LA6F 1QHEA 1TPYA 1Y89A 4JYPA 4MQEA 2W2VA 3T5BA 3UJAA 3VR6H 1IIRA 5FHQA 1P2DA 4E5YA 2B5WA 5LQCA 3U56A 3VOSA 3CX8A 1L5QA 1W87A 2JK1A 3EQ2A 5HKLA 3WKBA 3ZWWA 1TA0A 4KJZA 3RAFC 4RK4A 4EA7A 1EGMB 4JXXA 4K0KB 1ZO8A 2R5FA 2XGOA 4I1SA 4XUCA 5LQRA 1E4EA 2VAXA 1GVHA 4JEIA 3TFQA 1SR8A 1F3LA 3G0OA 4NATA 2HJVA 4GMFA 3KFXA 2XB4A 4IIUA 3WXBA 2YW2A 3F7TA 4EDHA 2ZB3A 4K1XA 1ZMBA 2OD7A 2YRFA 4OUDB 4KQFA 1EVYA 1QGDA 3KWLA 2PUDA 1XALA 2OV8A 1NV8A 1R2QA 5CBPB 1E1QD 2K4MA 2TMGA 2UYGA 2GEUA 4JXJA 4BU0A 3KZVA 1SUAA 3COWA 3MGKA 4GKAA 2C99A 3I52A 3GELA 1KY5A 1KEZA 3IBGA 4BJ5A 4EA6A 4EO4A 1HNWB 2QYOA 3C16C 5IF3A 1XZQA 1CF4A 1J5XA 2IUYA 3HPQA 4IH9A 1A8IA 2I2WA 4AD8A 1QOQB 3KBOA 2BSXA 4UXJA 4XWTA 5AVQA 2XRYA 1M6HA 2ECFA 1DE0A 1KR5A 3B20A 1JKFA 1YRAA 1DTEA 5D5HA 3L8DA 3NHPA 4R16A 4ZGBA 3U4CA 1DJLA 1XEWY 4Q47A 5T6BA 1ZX1A 4L8LA 5A0FA 4IOLA 1S2NA 2P5UA 3QNMA 1I14A 4GLLA 2EV9A 1MN6A 1SRRA 3E1SA 4ITRC 2RGWA 1UKEA 3DE2X 3EBPA 1XCMA 3ZQKA 4EJ0A 5IDXA 1I13A 5P8WA 1VKNA 1QIKA 2J3KA 2G9UA 2Q5JA 2VPYA 2WTBA 4N82A 2C0CA 3E9DA 3FB4A 3ICOA 2FQXA 3LUCA 1L4GA 2IHYA 4MB2A 3G5AA 3S55A 5KJ1A 3ZY2A 4GDMA 1Y34E 1P2VA 2C5AA 2WTNA 3MK31 4C78A 1HUQA 4IIXA 1NIPA 1TVCA 2EGGA 4AS1A 3OHMA 4LYGA 4OA8A 1NQOA 2WA2A 4II3A 4EY8A 4IQ8A 4GZMA 4DQ0A 2H9AA 3EY4A 3FBWA 3NV7A 2I1LA 2JGDA 3BL8A 1JVNA 1L3CA 4X1KB 2VZLA 2X2FA 4WOBA 5CDFE 2I3DA 3RAEC 4KQ9A 3OJEA 3Q8WA 5FPKA 5CDSA 3HFGA 2WJAA 2PUEA 221PA 1L1QA 2ZT5A 3ND6A 2A4MA 4H60A 1DINA 2O5EA 2QE6A 1I1QB 2GCNA 3HBLA 1N6LA 2PVCA 1R27A 1ULBA 2DPGA 1KPIA 1Z36A 2JD1A 2VSXA 4IGAA 4MW1A 3EIFA 4KIGA 3TVYA 4PN7A 1NW5A 3CISA 5G41A 3CZ5A 1FMTA 1KMIY 2GAOA 3HJHA 2BHNA 3INGA 1QB7A 5IH7A 3SBXA 1HDXA 1Z0DA 1KZ4A 2CDBA 2H5LA 4IUDS 4WCFA 4NBVA 2IOHA 3AFMA 4L0DA 1NVXQ 3K9WA 5B7PA 2C9OA 5I01A 3VDXA 3N39C 2ZYHA 1SH7A 3EXEB 2EKQA 3I5UA 1Q1NA 4XIGS 5BN4A 2FTKE 1JXAA 4XVRA 1MO3A 2PWYA 3PQ2A 2OD9A 5CM2Z 1R0BA 4QOIA 1XLTA 2P3QA 2G5CA 1O8BA 4I7EA 3E9QA 3IJPA 4OK6A 3DQZA 3RG2A 1Q0PA 3PUJA 1P7CA 2FB9A 2RGYA 4UDYX 2YV4A 4I4CA 1WU7A 2GPAA 1AH2A 1C0EA 1CQJA 1TJ3A 4MVJG 1N25A 1ZM3A 5FOTA 3EY9A 4YT8A 5EOVA 3PHHA 4IRXA 2LBPA 1G21B 1XYVA 3NVMB 2Z5FA 4WBXC 5C4IA 2PBRA 1GU0A 2IF0A 2B8WA 3OM8A 2JD2A 4RL6A 1X80B 1W88A 1FFWA 4H3VA 4OLFA 2DEUA 2C97A 3GRAA 4P1ZA 2CHEA 4Q4LA 1QZ3A 3DEKA 2NPFA 3DHEA 3CNOA 4OQNA 5JYCA 4JOBA 2HHJA 2PKYX 1DBSA 2WF5A 3ZD6A 1SUCA 3IXMA 5EMLA 4MV4A 4FYPA 3NTLA 1H42A 1I9GA 5AJHA 5EUQB 2X41A 5ALMA 3FOAA 3N0WA 1MB2A 2QM3A 3OEHD 2BVNA 1TQ4A 4I9NA 1LBIA 3STHA 3ZX5A 3FSJX 4BBJA 1PR3A 1E6CA 3HCRA 3PNLA 2O3RA 4QARA 4FGLA 2RE8A 1W9HA 5K3OA 1UXJA 3OCWA 1NATA 3I64A 3VTFA 3H0KA 4EF6A 3VVCA 2C4TA 1TTPB 2FSPA 2HV9A 3WLKX 5F9FA 1M8GA 4QFCA 1C9JA 3A27A 1BKSB 4JVMA 4NMHA 1HFWA 2ZB7A 4GPIB 3OHSX 4J2OA 4DQLA 3I2FA 1TQ6A 4R2MA 1WDTA 2PSDA 4OM7A 4XARA 1NW4A 3VDMA 5CG2A 4ZVMA 5DM1A 1XB2A 4FE4A 3TBKA 3WLIA 3F1KA 4P35A 1PUXA 4KQEA 5REQA 1YGYA 2C42A 2FOLA 3KT6A 1TJYA 4YY3B 3IIMA 4JBGA 2CFTA 2R7NA 3CF0A 2YRXA 1CHDA 3E5NA 1E0JA 1DEAA 3R6DA 3TQQA 3EPKA 4DA4A 2IEZA 2W37A 4HATA 4GOKA 4I6EA 4WK0B 5JYEA 5CA0A 2QZPA 1Z6GA 3KT8A 4LQLA 5F2OA 4IJVA 1GT6A 5K05A 5I6DA 2E0IA 3LFTA 5BWLA 4Z4IA 2OAP1 1XK6A 3O4HA 2WYHA 4UVGA 3D8TA 2CSXA 1V4VA 4L08A 3AUSA 3DA8A 1JVSA 1U6KA 5EQTA 1M6YA 1BKYA 1IHYA 4R9SA 4LY3A 1F3OA 2QT1A 4O4LF 5LCXA 4GWLA 2BTQA 4H59A 2O6LA 3HYNA 1Q74A 3T99A 2CXTA 1QPGA 2PY6A 3FPKA 4C0AC 3LL4A 4HYYA 1IULA 1GO2A 1V47A 4D0GA 1B26A 4G6ZA 3DMFA 3S99A 4CM9A 3PR2B 2OFXA 1EWKA 3HEMA 6GPBA 1ZCZA 3EQ8A 2OYCA 2HMTA 4MTCA 2A3RA 4B6JA 1SHUX 1Y9AA 4HNAB 1WD5A 4U1RA 2Y05A 2QRUA 3LZDA 1BGWA 1U04A 5IN5A 1WDLA 3EXFB 1NUTA 5TQ2B 5C8YF 2NYRA 2RCYA 4IUCS 4L4YA 3RI3A 3E9EA 5KDDA 3KR0A 2UDPA 1E3QA 4M8LA 4RLSA 1DC3A 1NFRA 1TYZA 2XUIA 4O2LA 4EG3A 2EQ5A 4R1SA 1JDBB 1Y82A 3GGDA 3OIDA 3HSYA 2E4XA 1DVRA 3LQ1A 4OB6A 2C88A 3D7SA 3UZUA 4FDUA 5A2QA 4RLHA 4TYYA 1DOAA 2RKBA 3MT9A 3CNHA 4JHXA 5GIPE 1PJZA 1SVIA 1J06A 3QYJA 4HQNA 4WY5A 1USVA 4YXFA 1CUHA 2QD3A 1UDRA 3CIFA 3E9MA 3NAZA 4NR0A 2JA2A 5ALZA 2WU4A 1LPMA 3A28A 4C2AA 5CXUA 4FBGA 3FYHA 4YPOA 1XKQA 1PHRA 2M32A 1GGVA 2TRSB 4DG9A 5LOVA 4WCVA 1FPQA 1TO1E 1DOZA 5C51B 3EK2A 4R2KA 1EZZA 2O5VA 2UYOA 2XITA 5FAXA 2PLWA 4QGSA 1T5DX 4KVGA 2GR9A 4KGZA 1BU5A 1RJ9B 2JBHA 3HB1A 4W8OA 1UM9B 3BJMA 1NF3A 2PQ6A 3BB1A 3T3IA 5ALJA 2A9KA 4EBBA 5LYYA 4A6PA 4CDNA 2YWGA 2L69A 5C7IO 1IJFA 4W4TA 3F47A 4MI1A 5LYJA 2NZ2A 2IP1A 2O3UA 4X8OA 4K6OA 1QKIA 1U8EA 4A2CA 5A1TA 5J2UB 3H99A 1MGOA 4U6NA 3EQ9A 2AKAB 4Q00A 1F9EA 1BVRA 4PSDA 1QAMA 3E9CA 3T61A 4AKSA 5IPFA 3L1IA 3K94A 1B14A 1Q91A 2PU5A 2VYCA 3W6ZA 3K71B 1CRPA 4F4UA 4P7FA 3WLTA 4NYMR 3TZBA 4IOMA 3UAOA 3JPWA 1OT5A 3W5SA 4G0YA 3AF3A 1KY2A 3NONA 3C41J 3L79A 4WY8A 4WFIA 3WV4A 3JQAB 1NY6A 1FXSA 5BOSA 2HU7A 1DUIA 2ORIA 3AETB 4FMCF 3H5LA 4OHBA 2BCJQ 3L0BA 4EH1A 2EJCA 2JH8A 2VQ6A 2WIKA 4LGMA 4XIYA 5FWYB 2MSWA 2XECA 1RYMA 3L1HA 1IXZA 1QG4A 1X8XA 2QD4A 1Q3KA 2VJCA 3ICWA 3Q9SA 4JQZA 2DQKA 4TV9B 1UUFA 1VJ1A 4WKPA 1NLMA 1TLTA 2HCRA 5I7EA 4R3NA 3AV3A 2FPOA 3HJAA 1OXTA 5C8YA 3G2MA 3U1BA 1KKLA 2B2NA 3I83A 3Q15C 1V5FA 1YQWA 2DRIA 2ILVA 3OC0A 1I2DA 1JNXX 1L4UA 3QXSA 5ITWA 5DCUA 3R3SA 4K86A 3EIXA 4EARA 3NHFA 1OKKD 3H87A 1GFWA 4PPNA 4ZP1A 3ROKA 3JQBC 3I37X 4QUAA 2FJUA 3MJSA 3RE1A 3ZXYA 2QU7A 3JY6A 1QGAA 2BEJA 3ODPA 4CF6A 2AE2A 3HY6A 4ND6A 2J85A 4NFSA 4LF5B 2O2IA 1L7RA 3OTIA 4XYLA 5KQMA 3NBYC 5H81A 3IDOA 2PX8A 4L8WB 1MIOA 1JLLB 3KSDO 4L7VA 3KE9A 4REMA 5DW3A 5FBZA 3U2QA 4B3DA 1PJCA 3I42A 1S2MA 5DU2A 3LKDA 1RP1A 4G5HA 3QPDA 4RAOA 5AK6A 1FA9A 3DE4X 5CA1F 2WUFA 1QQ5A 1YUBA 2RHGB 4G1BA 3QLVC 4KLNA 3D6UA 4B73A 1IIBA 2H1IA 1BN6A 3HLTA 1PNQA 3ONEA 4ED9A 1OZFA 3V4OA 1IOWA 4B8ZA 5JRDS 2ZTHA 4G1EB 3ZE6A 1YJBA 3LKZA 5KOJB 3OLWA 5HVNA 4ZO7A 1FRFS 1XRSB 3IXLA 3I0ZA 5CB8A 3MWDA 4DQDA 3C97A 4PGHA 4DBLE 5LIPA 4R6XA 1C8VB 1UQTA 1QORA 2AX3A 4X3PA 3ROTA 1R64A 3TW0A 4R7ZA 1GGMA 1ZMTA 3EMKA 4LVUA 4DLNA 4GWGA 2RGBA 4GI3A 3SWWA 1GG9A 1Y9ZA 1B8NA 2PUHA 2O20A 3QKIA 4BNLA 3D8HA 1D2CA 3IVMA 5HTOA 2P9EA 2AHOA 3FCYA 3FDZB 5FJJA 3TM5A 2ZAGA 1DL5A 2VNIA 1RYZA 3LC7O 3ZTYA 1II0A 1CUCA 3ZVKA 1R5OA 2G72A 4QDTA 5HKKD 2BCGY 4AO6A 3LCVB 4X24A 1OA0A 5HF6A 2QVLA 2IHBA 2IIPA 2V7QA 4FI3C 3C8ZA 4BQRA 3SMVA 2ZRAA 3TL3A 1P81A 1CJCA 5LR6A 5JT1A 2PG3A 3DT6A 4PCUA 2ZRJA 5LL6P 4HWSA 2I3AA 5F9HA 5ILOA 4TLMB 4MNTA 4O4JA 1KEEA 3NEYA 4JHLA 3DAFA 3Q9LA 1P4GA 2JAHA 2O1SA 4Q18A 2Y0DA 3LGAA 1QUFA 2PEYA 1ODFA 3I30X 3LX5A 5K51A 1JHZA 1M2NA 2PANA 3HUFA 1VPDA 2XSZD 3IIJA 4RDCA 2WHEA 1JAHA 4Q9JA 4C01A 4DDTA 3G2PA 3W5HA 1I7NA 2IODA 1SKUA 3Q4GA 5JXIA 3C6XA 3DTVA 3D59A 2PS0A 4ISBA 5T3YA 4E15A 2WG2A 4K9RA 1QV7A 1X2BA 2OGTA 5ECDA 3IHWA 4UTRA 4I1PA 2A0WA 3JQGA 5DM4A 4U3JA 2VPIA 4CU5A 5JJKA 2I3GA 1EK6A 1VIVA 3BJZA 4KXUA 4RA9B 1WKCA 1Y4UA 2BFAA 3IQEA 1I4EB 3OIGA 4X3CA 5G02A 4MEAA 2G28A 2XMGA 3RBAA 3H84A 5LP6A 3KPVA 1G3RA 4CIXA 4JBLA 4LVNA 4AUEA 4I5FA 4ENVA 3KLOA 2NLOA 1T4CA 4MPRA 2XCRB 1SVLA 3E03A 3O9ZA 4MKGA 3GDHA 1QH8A 4ND2A 3TUJC 1JJ7A 2I2XB 3HDGA 3FVQA 4R8RA 1K9VF 2O2DA 3KJXA 1R9GA 3IUMA 2XA1A 4UMDA 3WB2A 3BS4A 1LW7A 4KX3A 4YDSA 4QHYA 3EUAA 2ODWA 4CLOA 3JQFC 2HK7A 3LXRA 3HBMA 3Q3VA 2J7PA 4LDZA 5EINA 2W6OA 3IPAA 1D6JA 4JQCA 3S7TA 4DW8A 3A36A 2R7KA 2OHFA 3HWWA 4M83A 4Q34A 1DC7A 1SCUA 1J2JA 3JQ8B 3R1IA 3SLRA 1HTWA 2DCUA 1W0CA 4FZJA 2VCEA 4PQFA 5KX5A 3EDRA 4LC0A 2DXIA 2Q9UA 2HJGA 3KOYA 3B6EA 4NONA 4ETWA 1NSTA 3PNQA 2WLSA 4NQZA 5A3QA 4RQBA 1MB4A 5JPIA 3LBIA 3U3XA 4EHNA 3C3XA 2AN4A 4F2HA 3KYBA 1BMTA 3HRIA 3IT3A 2FUEA 4FZ5A 1JL3A 1V7PC 5DI3B 1CCWA 1GGFA 4KN8A 3CJTA 1ZJZA 1I30A 2CLDX 4OBBA 5F73A 2QXYA 5DYGA 2ZRPA 2WAYA 4FDMA 5GONB 5C5DA 2ZTMA 5B6PA 3FSGA 2WOOA 1WKVA 2ERYA 3RSCA 2PIDA 3OCZA 4A2WA 3DXFA 4GI7A 3UQYS 4I4IA 4NRDA 4WECA 2HK6A 4PPGA 1CWUA 3ODGA 2GZMA 1WUHS 3UJCA 2QW0X 3ZG6A 1KFCB 2C58A 4O29A 4J0FA 2VP4A 3MS4A 3QY0A 4U7GA 4QWWA 3S2SA 1UH5A 1Z4LA 4Q4HA 3UG7A 1NN1A 2XHEA 3GRUA 4UEKA 3ZLJA 5HCUA 3K70C 1MPXA 1PTJA 4LW8A 1E8MA 1GU1A 4OXIA 2PMBA 3DONA 4M46A 4RZQA 4NIMA 1DBRA 4C1BA 1NGSA 2OCKA 1Q92A 1KQPA 2CF6A 3LWDA 1MX1A 4JEUA 4PQYA 4HB3A 4EITA 1FVFA 1X86B 3HBAA 5KYYA 1UZAA 3SJZA 4ND4A 2W4MA 3VNSA 3GP5A 4YROA 2C4HA 1E3IA 2QD5A 4R83A 1FQOA 5ESDA 3RPEA 1XTZA 4N54A 5IAAA 2VDRB 4Z0NA 4EW6A 1IHOA 3FNHA 1ZP6A 1IEQA 2VJPA 1GTG1 1YUNA 2GASA 4HUJA 4NMMA 4TS1A 4WK6A 1RU3A 3VMMA 1SXQA 2XUAA 4LFBB 1Y4AE 1E3LA 2XQJA 3AQIA 3AUJB 5KREA 2BFEA 3WLPA 7MHTA 3GT7A 3CVJA 3MWEB 2G04A 3DLCA 3LVQE 3MFYA 4DWVA 4JI0B 3MGGA 4MDHA 2RGUA 4H6WA 4DIFA 1BCSA 3FOFC 2QDKA 1YZQA 1ACLA 3FCUB 3Q98A 3ZPXA 4F6CA 5CLJA 3IRVA 3HDQA 5H59A 6CHYA 3A2KA 1YD7A 2A92A 2YXPX 1JFTA 2BKLA 3MVEA 1FBNA 2MDTA 1I1HA 2OAQ1 3IBTA 4YR9A 3MB5A 3W2IA 2UXDB 4DLZA 1RJ9A 1PX2A 3B7PA 3NM4A 4KPEC 1NWCA 5JISA 5JDCC 4L4UA 1CB7A 4V0KA 4H6PA 4Z0TA 4DLBA 2UUAB 2VT7A 2WTAA 1T91A 2W93A 5DMHA 4BX2A 4HTFB 1E6EA 1IEVA 1U2PA 3NFRA 4RIFA 2QPTA 4LJSA 2QXUA 1J20A 3BGDA 3O75A 4S2EA 5TR9A 3ZLBA 1VLMA 2JJQA 1WMEA 3B3GA 4NCHA 4NCIA 3ZWYA 1TCBA 3FUWA 3CBQA 3CLSD 4JS0A 3Q6MA 1UKYA 5B4VA 4E5UA 1FZQA 2YFHA 3ZE0B 5D85A 1YZVA 3FOWA 4K5QA 4EY3A 2HLDD 4LI0A 3AY7A 3NB0A 1Z7EA 2C7GA 4YS6A 5CITA 3L8CA 2GO7A 3ULKA 1XTIA 2RC6A 2BJVA 1A9XB 4M0EA 1K2WA 5HOQA 5C46F 2PX2A 2PRZA 2Q8QA 3H9UA 4YFVA 4PNEA 3ESRA 3V1MA 5BOVA 3L2OB 3M81A 3TKLA 1E1CA 4E13A 4F1JA 2X15A 1QHHB 1SB8A 2HY7A 3LLVA 2CB0A 1ZMXA 2MMGA 5C5IA 1ZKMA 4BGUA 5I5EA 2G07A 2V7XA 2BN4A 5L4NA 4L5JA 1T8UA 1P19A 1GHTA 3NOXA 1IG3A 5B53A 5KU7A 5KMGB 4OHYA 3H4TA 4ER7A 2UUCB 3TL6A 1UZLA 3QPBA 3KV1A 4DDKA 5J2TA 3IYLW 4GP6A 1QGYA 4WBNB 3A2NA 1OVMA 4TLLB 3N2GB 3EWSA 4KPUB 4PSAA 4CMJA 2ASVA 5GAJA 3DYBA 2Z8YA 2ZRLA 4MS4A 4YAKA 1EA5A 1G9TA 2UVQA 4BMOB 1G20E 3GPIA 3VR0A 4URVR 5KVAA 4NH0A 3NC4A 2IIQA 3CLTC 2ONZA 2Y1WA 3ROPA 4XSGA 1GNPA 3PKJA 3MYRA 3UWMA 4EOGA 2GDZA 4XIJA 3W4KA 1EB8A 2O7QA 3LNTA 2QX6A 1MVNA 5TEVA 2YXBA 1CRLA 4PGGA 5BV8A 4I6JA 3L0IB 4EBFA 3EMBA 2QLJA 1U7HA 2VWGA 3PXAA 1BX0A 5AVUA 1FJXA 1JFFB 4D3DA 4Q16A 3ZZTA 1T9AA 3BQMB 1ONPA 1NF9A 3N2KB 1BVHA 1Z8NA 1IFXA 1EWQA 2OFWA 3AVOA 3E23A 4JKIA 1USUA 3ZBUA 5EIHA 3DWIA 1KVRA 3ZY4A 1LV7A 5U4QA 2BFWA 2NPOA 2GXUA 1NUHA 4L22A 2PT9A 1ZINA 4OLJA 4DR5B 3MELA 4PIPA 4RMGA 1RHMA 3IXQA 5DP2A 5I3ZA 5KX5F 3KM0A 1IM8A 3NPAA 1I7PA 5D5QA 3C3EA 2BFCA 4IKEA 4ZOAA 3AUTA 1PZGA 5A5GA 5FHRA 3AVUA 2F3SA 1RKXA 1PYDA 1T9BA 3Q41A 3A4IA 1MO4A 3WLMA 2Y4NA 5EFZA 1ZC3A 1L4LA 3M33A 1AV7A 1Q2UA 2DU8A 2VEOA 3O4IA 5I48A 3QSYA 2QU8A 3PHJA 1PGJA 4TT3D 4AF8A 5BV7A 4N6GA 1QHHA 2NO9A 3AKCA 4R68A 4BO6A 4G81A 1O94D 4XW2A 1F0NA 2XMDA 3ORRA 4S1PA 5A62A 3BVPA 5ABPA 5BYJA 3QK7A 2FEWB 3G7UA 5CH5A 3CF6R 4YCDA 4ZYLA 3N74A 13PKA 3A0RB 2EBHX 2FPGB 1IY1A 2FMHA 3L3BA 5A6SA 4DQUA 4FEAA 1B0ZA 1FDSA 1NFQA 1VKZA 2X6QA 3HJRA 4NBSA 4R1TA 1V5GA 4YJFA 2R1UA 2Y1XA 3I9OA 5F9MA 4Y1GA 1BROA 1OWLA 1XZHA 3VJRA 3WQRA 5BQFA 4K6HA 5JCJA 1PRYA 3HN7A 4DKXA 1W5SA 4H16A 5L4LA 2PTHA 1HT2E 3BD8A 3EG9A 3DDZX 2MSLA 1RAAA 2C2BA 1N2GA 2QUAA 2VJQA 4KP7A 4PAQA 3U4HA 1IK6A 3A9TA 1Z4MA 4MR9B 3IPLA 1BHQ1 4NX2A 5DWVA 4G0WA 3BBLA 5HA5A 1XRLA 2PS9A 3IAM1 1H2AS 4G5FA 4IKOA 4W9NC 1RXIA 5B3JC 3HP4A 4B2IA 3ZJTA 3TSZA 2XTZA 3L7NA 1RCTE 5J4YA 1GNRA 1GCUA 3GJ0A 4QC2A 5G0WA 4EA9A 4O02B 4GWKA 3NVDA 1X74A 4MICA 2GTHA 1LJUA 2F8LA 4NBWA 1WJGA 4TMXA 1OGIA 1EXDA 1Z75A 2AFHB 3QEOA 3P0RA 4O4IF 2G09A 4HAWA 4LPSA 3LIIA 4DIUA 2VHXA 4PO8A 1N2JA 3RYHA 3D2CA 2AXNA 3B48A 4MV9A 4ZPJA 5E7QA 2PUWA 5E9WA 1HEIA 1VL2A 5TNXA 3TBFA 1FMCA 1K4YA 2ZBFA 1J99A 3ZUGA 5LXTF 1K5DA 3QVGA 5EERA 5K4AA 4GX1A 3L6DA 3OUZA 2V59A 3DZDA 4HTFA 2GD1O 2P2GA 3UTDA 5CDHA 2HNBA 1DU4A 1G7SA 1JXMA 2D13A 2QSUA 4LYEA 4NK4A 4CVNA 2R6FA 3JYLA 4HLUC 1GYPA 3EAGA 4Y0AA 4F4FA 2RBEA 1II9A 4C0HA 1WNFA 1WUIS 3CLVA 3DUWA 2ZSEA 1M6VA 3MIZA 2CHUA 2J0UA 1U8FO 8ADHA 2O2YA 3Q2KA 3CPJB 1KYTA 1JT2A 2FPLA 3OJXA 2GMWA 2WINI 2BP7B 4PGFA 4B0OA 4DSUA 3H4MA 1DQNA 1GWNA 4FSHA 4KWEA 3VX3A 1SK8A 2OGWA 1HMYA 2JEYA 1QV6A 1CW2B 3QEBZ 2GDJA 4K26A 4D44A 1YIOA 4ENPA 1G3UA 4EZBA 4PHGA 3JD4A 1Y1TA 5DHFA 3VUFA 3C45A 3M1YA 2ZPAA 5F35A 3OPYI 4WY2A 5TT0A 3TPCA 9GPBA 2WHRA 3K96A 2JL1A 2XAUA 4F96A 2BFCB 3T7EA 3PYLA 2JCBA 3EXHA 4D9EA 2I2DA 4LXYA 4TSRA 2BV3A 5CPBA 5B37A 2B4KA 2XKKA 3FPCA 4KO4S 3W8RA 2GTPA 3IJ5A 1E2BA 4P3YA 1OU4A 3GRRA 3DMYA 3P0EA 3DUFB 3JS5A 5K0JA 2XCIA 2FPMA 4KE9A 5JDIA 5IAKA 4B3MB 4FD3A 3GA7A 3HABA 1VB5A 4EGAA 1G64A 4KAAA 3QYFA 5K01A 2YTZA 3B51X 4TZ0A 3VPCA 2GD6A 2F59A 3D1JA 3BHJA 3R8CA 4KNVA 1SJ9A 3LF2A 5IT4A 1J97A 3KU1A 3M6UA 1OROA 1RJGA 4I2NA 4P36A 1SQ5A 3UMBA 3VR3D 1CQPA 1EE9A 2JGAA 4H0NA 3HKDA 1JG1A 1JAXA 4JXKA 1D2EA 2E6UX 3WL6A 5HOEA 3WA7A 4UEOA 3RLIA 3S5UA 1UBNA 2VDWA 2C2HA 2VDPB 5E8JA 5FADA 5HFAA 3UK2A 2NMVA 4B40A 2X2EA 1HL3A 1LZLA 2AWOA 2WJIA 2QEQA 2ZT6A 3F5SA 3PYMA 3BXOA 1T9DA 2ZKLA 2XZLA 2VAWA 1UJBA 2W6MA 1KIAA 4IDGA 3TE6A 3FUUA 3QW4B 4C03A 3FCSB 5KOJA 3KL4A 2J41A 1ZOSA 3EGCA 1WXIA 5I9BA 1FDTA 1F51E 4W9MC 4FGWA 2UXCB 2PSEA 1TJNA 1I7SB 4MW7A 4KWCA 2ONJA 1UT8A 2HJRA 3D2BA 3N59A 4EEKA 3T5TA 1HQCA 2AI2A 2W2OA 1V96A 4DEVA 5C52B 2FX2A 5KSWB 5BQ3A 3L41A 3TGLA 1QIHA 5LP1A 3IVGA 3V2HA 4TKVA 3C85A 1QRTA 4GICA 4HEJA 1YHYA 2OXTA 5C8XA 3NHJA 2GO1A 3FAKA 4EGQA 3ZD7A 1J90A 3DOJA 4PN3A 2QQ5A 3RC1A 3GD7A 4P93A 3CEHA 3VPHA 2C3OA 4BN5A 4E4TA 1COWD 2HPHA 1Y8QB 3P1JA 1YC5A 5CGZA 4YUXA 4LXQA 3BRWD 1ORTA 2ZUWA 1XDGA 2P9ZA 2WMDA 2UUPA 2WLTA 2R8RA 3H4VA 4V02A 2X2OA 1EFVB 4L9WA 3UA4A 2Z6AA 1MLDA 2UAGA 4CV1A 5EIOA 2Q3JA 3FVRA 3GVIA 4CM4B 4N3AA 1XRMA 4CKWA 5LKAA 5H8WA 4IV8A 1Z7BA 4JR1A 2BMWA 1KEEB 1RYYA 2GKOA 1VPVA 2VI5A 2WV9A 3AGPA 4O33A 5D6NA 1XCGB 1M7GA 4IDFA 2NU8B 4AT1A 4BMNA 4DABA 2X19A 2PPVA 1CUDA 1XTJA 1RXVA 1YH3A 2FK7A 3CIOA 3IR7A 5AM5A 2Y1CA 4KO3S 3L6BA 1YB7A 1SIOA 4FGJA 2JLVA 1K4KA 5HIMA 3AM4A 1TLLA 3MJEA 5GINE 3AERA 3IAUA 4UU0A 3N70A 1TU3A 1YKGA 2A94A 3FOZA 4JROA 1SG9A 1Y8RA 2VC2B 3INNA 5JPDA 2VHVA 1EP3B 4XIIA 1KU0A 1NJ2A 2COUA 4XASA 2JCYA 3MJDA 4HJRA 2JJ8A 1RXSA 4MVXA 1I9CA 1L5MA 4F1WA 4LSGA 3VO9A 3WNBA 4BKQA 1AUPA 1H0HA 3SVZA 4DIMA 3M34A 1IAQA 1HF3A 2I1QA 2JHFA 1HE4A 4KR6A 4GI2A 3S2IA 3FZQA 2JANA 1N5MA 4FFVA 2FP3A 2RHJA 3TD2A 2Q5CA 4Y1RB 3VC3A 3YASA 4RKEA 3OQMA 4KNYA 1A4UA 3QWIA 1UMDB 2WW8A 3RB8A 1HE8B 1GL9B 4OQEA 1L1FA 1DADA 1C3LA 3RROA 5JAZA 5SY4A 1FP6A 1OX5A 1PWZA 4PYIA 4TKUB 5FOVA 1C7RA 1QVZA 4XLLA 1WUYA 4EECA 3ZTWA 3V8VA 4YT2A 4BKUA 3FNIA 4BNDB 4EG7A 3JSAA 3QLVA 2QLMA 3QWAA 2IXDA 3K0HA 1U5BA 1QYWA 3TQIA 1DBWA 1YAHA 1YTUA 1LW6E 4NE9A 1WXHA 1JSCA 3DF9A 4I46A 4C7MA 3Q72A 1RFLA 3B5JA 4Y2GA 2P1DA 5FBHA 3RODA 5I4IA 4FFOA 1JHPA 1F20A 4WLNA 3WLAA 2C00A 1UWCA 1E6WA 1UDAA 2XGMA 1ZBQA 2HMWA 3KBBA 4MS1B 3QU7A 1B0AA 5EP1A 3UPUA 1NG9A 1P5JA 1F6WA 2WNIA 3QFCA 3MT7A 3KOMA 4EY5A 3M2PA 2B92A 1I32A 3KJGA 3K9HA 1Q0HA 5YASA 3X1DA 2VLBA 1F0PA 2QGNA 4MI9A 4HNHA 2RD2A 1J39A 2IBMA 4P0QB 1NMZA 4A82A 4L4RA 3MILA 3TR0A 4Z53A 3KQNA 4CW7A 3TW4A 3V48A 1J0BA 4CKYA 4B8WA 3B89A 1Z62A 2I6SA 1VJGA 3N28A 2Z2YA 3ZWDA 3FR7A 1YQEA 4XQGA 1Y1PA 3SYLA 3WK9A 3OLQA 3IDAA 4ALMA 2PXXA 2PPLA 3NVAA 3UFXB 1H0KA 3C1UA 3DVAA 1D8TA 2EZ4A 5FJIA 2H8GA 2OK7A 4OQDA 3WJ1A 3OURA 4Z4HA 1Y6FA 2PBFA 3VX4A 4YN3A 1HG0A 5ED0A 2RGGA 3BWMA 3TUIC 2HUPA 4LDPA 2EVWX 4QYTA 1QQBA 2Q7XA 2MYPA 4NU6A 3W5IA 3QJYA 3GJSA 3NCTA 1GL6A 3KRTA 2VP2A 1OTXA 2ZIUB 2V55B 3GFTA 3T52A 4YRGA 1CERA 4A0FA 1ETUA 8ATCA 3LA6A 4EO9A 3VNQA 4F6RB 1LLCA 3MLAA 1U90A 1UXIA 1Y7PA 2ZJ6A 3L5OA 1JLHA 1TIPA 1KETA 2Q6OA 1H6BA 2GARA 2I5PO 1BEEA 2PSFA 2EL7A 2W2QA 3EYAA 3PQ4A 4NEQA 1RZ3A 4Q3OA 2VLIA 3RRYA 5IKXA 4HH1A 4UFNA 4PINA 5JXWA 3PFWO 4GPTA 1PLJA 1ZVJA 2H7XA 2I29A 3RYTC 4GZ3A 5KNBD 1HDIA 1XZLA 2BMFA 3DTVD 1M2GA 4AUNA 3ED5A 3KB1A 1NULA 2VN8A 3BK1A 3U3RA 4RK0A 3OQIA 1A96A 1FFBA 4JJAA 4QDUA 3DPSA 4JUCA 4XM0A 3THRA 5CLLA 3WLSA 2H59A 3FWZA 4BBAA 4Z7JA 2OCIA 1QO9A 4QUDA 3QVXA 5E3IA 2OUKA 2V3WA 4QOFA 2DCMA 5A3VA 4C0XA 1IAVA 2FP4B 3M4ZA 1P1KA 2FX5A 1EVEA 3DLIA 3A1FA 4R2IA 3U44A 2XRZA 3EBOA 1CETA 2RIPA 3G6WA 3I58A 4GLFA 3FM9A 4JZYA 4S1OA 2YYSA 3L6CA 2C96A 5J47A 1SKYB 3EIHA 5B58C 2CYCA 4R7TA 4QBIA 3QVGB 3CPHA 4PX3A 2P2DA 3H2BA 4IX9A 5KOHA 1XA4A 2VUTA 2VSFA 3EFOA 3CG0A 3H2JA 4QPJC 3X1YA 2BJWA 3O26A 3FPEA 1BHSA 1EK2A 1QR6A 3DXZA 3E53A 3QQPA 2C78A 3DTTA 1KZ6A 4FYKA 5FB3A 4IM7A 2B2XA 3CE9A 3K30A 1H2EA 3QJ5A 3P26A 2Y99A 1M34A 2COKA 1E0KA 2CNWA 4KDRA 4YRMA 4NS1A 5SY9A 2QJWA 1XC7A 4V0OA 4RGVA 3D4LA 5AM4A 2C7RA 2AOUA 3W5UA 3BZBA 2X8JB 4CLXA 1IATA 3WDMA 3ZDCA 2C5EA 1XAGA 2X1HA 4K0RA 4Q7LA 1Z18A 3ZWAA 4E22A 2Y0BA 1ISMA 2IP2A 4QICA 4LQDA 4G2TA 4QUHA 1FYWA 1RZRD 3T9FA 3HRKA 5CFQA 2BEVB 4M37A 2HWKA 3ZE2B 1T2DA 2WAXA 3Q2OA 4FX5A 4L9RA 4QTYA 1V3QE 2AXEA 1OX4B 1TQHA 2SCUB 4L72A 1CUXA 1LNZA 2Z4SA 4MVCA 1X7ZA 4DRXA 4G5SA 3TR5A 4UFOA 2X22A 5D3KA 4CM8A 2AKEA 1RTKA 5DI9A 1N75A 1ZD4A 2WOJA 2XRFA 3UMGA 3SJBA 1CYEA 5A4KA 1K6JA 3WBFA 1YBFA 4O8CA 5CXXA 3AOEA 3RQSA 3QE2A 3BJRA 2R2AA 4FIDA 3W7AA 1R7RA 4XJSA 4EYKA 1LPAB 3V1TC 3TK1A 2VK1A 2EKPA 1SB9A 1FLVA 1KBZA 1BTOA 3O1JC 1DQSA 1SVMA 1TU4A 4H0CA 1MC1A 1TTTA 2PJRA 4QJIA 4D9NA 2IU4A 4N49A 4OP1A 3FIUA 4TX1A 4X8HA 1T36A 1TEHA 2GAAA 2BTOA 3AR6A 3MRTA 4F2DA 1AK1A 2PRJA 3WB9A 4LJ4A 2I7DA 1KE2A 3GZ4A 3ND7A 3U31A 1MENA 4CF4A 1Y1LA 2HK9A 4FILA 4XDYA 3KSAC 2ZE8A 2WB4A 3E05A 3MAGA 2E5FA 3BD9A 4WZBA 3HVKA 4HNGA 4Z9FA 1MT3A 2ZR0A 3WYEA 3ZS9A 1LSJA 1AOXA 3D02A 4MAMA 3SBEA 2Z4TA 3BMNB 1NV9A 3OQHA 2E21A 2I4MA 4TQUS 5AQ1A 2XB9A 3KTAA 4RVUA 5EJEA 1R3UA 4FQ8A 4D56A 4HZIA 5CVEA 3M6IA 4YJFB 2IV3A 2CHQA 1L5NA 4BUCA 1X7XB 1WX1A 2C04A 2EJVA 3WYDA 4L51A 4P7KA 1F1BA 1FUYB 2ACVA 2PWPA 1Y8AA 1TQ8A 3BA1A 5AW5A 4CT4B 3ZJUA 1IK4A 3SHVA 3ROQA 2FMXA 3H3JA 1KSJA 2VDJA 4CN9A 3G02A 1P4AA 4G4SO 4L07A 1YI1A 4TXNA 4FHDA 2DBYA 4Z54A 3OF3A 2BM0A 1N2BA 2F1OA 1QUEA 4X66B 2G5PA 3FSGD 3UV6A 4TGLA 1JDBC 1RHKA 3KXDA 1IXKA 4GZ6A 5BWNA 3ILXA 2OORC 1TTQB 1KFEB 2D1RA 2H1HA 2WG1A 2VA8A 4XFJA 3DKKA 3BPSA 3EVBA 4LOAA 4Y2QA 1OLXB 4DZRA 4C0SA 5C2JB 3BQ9A 4DC1A 4GECA 3RANA 2ZI5A 3TZLA 1O6GA 4OCZA 3AG6A 3RCBA 4HVCA 3MCZA 3RDPA 4W5QA 2IVZA 3FB1A 4WESB 1Y6GA 2C31A 2WD9A 1D1QA 3T0GA 1V5IA 3NHWA 3PA8A 4FFWA 1KH3A 4JLUA 4PHHA 4PRLA 3T7AA 1XO1A 4CBVA 1XQ6A 2NXJA 4A92A 2X4GA 2QMZA 1GQRA 1KFBB 1UMKA 1Z5UA 4MGEA 3ENZA 3L18A 1D4OA 4FMCB 3V4RA 1OASA 3ZGXA 2ZBGA 5CLFA 1X7HA 1WDMA 5LB4A 4PYQA 1NLYA 1DWQA 4AXXA 3TQRA 4L3OA 2GZHA 1AK9A 1X1TA 4O3MA 4YJ2B 1OQAA 3AKYA 4KQIA 4P8RA 3M6LA 4OK3A 5HDQA 3T34A 2PL3A 3HXQA 2GM5A 3QI2A 5EUBA 4URHA 2Q62A 3ZU5A 5AMXA 2QLNA 2VP0A 2G76A 3SFZA 1GT91 2GYVA 3PDJA 5HQTA 1N2HA 3QBEA 4IUBS 4ABTA 1KDVA 2C7QA 2OPBA 3PFHA 4XYMA 1EFTA 1KPGA 3AKDA 1EX6A 4U4AA 1IZYA 2ISQA 2D0OB 5JSZB 1QE5A 1V1JA 4RY8A 5LU9A 1FRZA 1PWHA 1UOPA 2FE1A 2NQTA 3E9ZA 3Q6NA 4HNQA 4K2AA 2NTYC 3DB2A 1YRQA 2VVTA 1KSFX 4O08A 4OMDA 2O4CA 4BX0A 2KSQA 5IUNC 1MJFA 3U5TA 1O5OA 4MLDA 2XB6A 2AOUB 2JFBA 4JELA 2VUHB 2X7JA 2EWVA 1NUUA 2XVMA 3NZEA 4YMSA 1H0RA 3SQWA 4DCMA 1GQFA 3LTEA 3IERA 3LQRA 4KEAA 3PC4A 4EI9A 2W2NA 3WYFA 2INGX 3OETA 3B1XA 1P1BA 2CFCA 4QXAA 3W5JA 1H2FA 3LZCA 3VHQA 1GM5A 1IJBA 3ZCPA 3UXMA 3CINA 4M55A 3AI3A 3LT4A 3P96A 5ADWA 4JA0A 4B75A 1YVDA 2C7BA 2I4NA 1R6BX 3QMVA 4L3VA 3UWOA 4ZN6A 3K31A 1ZD8A 2KLHA 4GBJA 1XD9A 4RHXA 3HUTA 2Q0HA 5EIWA 2CJWB 2I2CA 2RGEA 3U3DA 1KIMA 4IO0A 1RXYA 1VYVA 3DWFA 2MINB 3G9TA 1PCXA 2HHLA 1LGYA 3PGXA 5CVCA 2ID9A 5LJLA 4GFDA 3CWCA 5TLSA 1H2HA 1I36A 4V03A 4KUEA 2BPOA 3RVPA 3UH1A 5KNDA 2UXBB 3RV3A 2CMKA 4QQRA 1GAQA 3W8FA 2V7GA 3CLSC 5DHUA 2PKRA 4BU1A 1N6IA 2N42A 2BLNA 4O4JB 3WYCA 2ZVJA 4YIKA 1P33A 5E95A 3SC3A 2GHQA 4O1MA 4O2BF 4OYHA 3SOPA 4H27A 4CIYA 1Y33E 5I7VA 1M5UA 3PR1A 2IBSA 4IPTA 1YO6A 2QUIA 2VBIA 3DZJA 3H75A 3IKLA 3LOQA 3IOCA 4P54A 2IS6A 3UKDA 3OIUA 2DBVO 2VSOA 1L7DA 3MF4A 4E46A 1M8FA 3ENKA 3NEJA 4OJQA 4S05A 1Z9BA 2RHRA 3UW1A 3ZVRA 1JALA 1NBHA 1W19A 4A8JA 1G6HA 3KAQA 4BOYA 5F7OA 1EJ6A 2H4HA 1FX1A 3MMPA 3A26A 3RJTA 4NJMB 5JCPA 3GFRA 5COBA 3SHQA 1XN1A 5HZGA 2PO5A 2Q27A 4F38A 4R41A 4BO8A 3GVHA 3ACCA 1F8YA 2FRDC 1UOOA 4CKBB 1RM5A 1WXXA 3KKZA 1FS5A 2G7MC 2OXFA 3IT0A 4FN4A 2CXSA 3VYSB 2Q21A 1GCGA 3SZLA 5TQ0B 1IJKA 4EQZA 2JCGA 1O94A 3MQ4A 4R5HA 2QI9F 3U16A 2PGDA 1RAHA 5J63A 4J29A 3EH1A 3ZXSA 1W2HA 4Q4CA 2R85A 2VF7A 5EMKA 3VGPA 3VHXA 4DQVA 1UBKS 1WV1A 4D41A 2ADOA 3T3DA 4Z49A 5THKA 1UEIA 2NX2A 4ARZB 1YJXA 3L92A 3IAAA 5SY6A 2FKAA 3TEJA 1E59A 2BDUA 3IVXA 1DWPA 1NRIA 5ALOA 121PA 3IE1A 4Z3KA 4PAGA 4IJUA 3MMSA 3GAAA 2DBZA 3TQTA 4AKHA 3TB6A 3F9CA 1CJMA 1JZTA 1I0IA 2ZRIA 2YFYA 3G88A 2ZJFA 4C07A 2Q3CA 5JTUA 4RIIA 4K88A 1TZKA 2BT4A 1ACJA 1XZGA 2V45A 4QYWA 1L1RA 2QNIA 3Q3JB 4AW9A 1AF4A 4V0ME 3QEMA 2RI0A 4DLVA 4ZZ0A 1M74A 4BO1A 5LB2A 3AK4A 2AJ8A 2Z3WA 4IKPA 3GC6A 4X1YB 2IDMA 5M3BA 3TZEA 3GEHA 1LX6A 1XQWA 2BONA 2E4VA 3M8KA 2VYVA 4JWTA 3EXG2 2AOVA 1G7RA 2XE8A 1K66A 3FUTA 4RDHA 2R47A 3K1TA 1LK5A 2Q1YA 5DNCA 4L6AA 5EXSA 4CXMA 2A6PA 5CLGA 4RPCA 2JK0A 3DAYA 2WHQA 4FJ2A 5HFNA 1N4DA 4YT4A 1O87A 3ZVNA 2MINA 2P3SA 1RRGA 3QHQA 2A5FA 1JWAB 1NQAO 1U3WA 5TVGA 1W4AA 3U7QA 4DLRA 3RSOA 4ZJPA 1M34B 1SHLA 3BE4A 4G5QA 1PWXA 1NVFA 1RQ2A 3BKWA 3FDJA 3TNLA 1MC5A 1CRWG 2BBSA 2LCIA 4J0KA 1YRHA 3NHLA 3BFKA 5AD1A 3FPSA 3X1WA 1ZJJA 3K0FA 4BLVA 1Z8FA 5BN5A 3E6AA 4EUNA 4IJQA 4CL2A 4ZXPA 1IRXA 2CDNA 5K0EA 4RSHA 2F00A 2ZBRA 2ZQZA 4OUKX 1U94A 3T4XA 1GZ3A 3O2NA 4KIUA 4KK4A 5LN1A 2IY8A 5E6SB 3N2YA 5BRJA 4JDPA 4J9UE 1AKNA 3IUEA 2BZSA 4XLTA 1N5IA 2Y1KA 5IJZA 5LWHA 1KKMA 2X40A 3IPXA 1Z0AA 4MX8A 2D7DA 4OBWA 4ZMBA 4EHJA 4TM8A 1OD6A 3TLEA 5H9WA 3R20A 1DP4A 2PZ8A 3HXTA 5TS3A 3F49S 3CLKA 3MTEA 6ADHA 1Q84A 1WPGA 2HK8A 4YUVA 4XYGA 2BM8A 4MCAA 2WUVA 3KG2A 1LLUA 3O8NA 1RAIA 3TOVA 1MT0A 3T8YA 1GEGA 2GKSA 1W47A 3DSRA 5D3QA 4YP9A 3CLUD 4EJSA 1UBUS 4E5VA 4ZYTA 2ID8A 3HV0A 4J1TC 3AC0A 4JJZA 1E63A 4RZXA 5DWDA 2VTDA 2EEZA 1CVLA 4KAJA 5JO0A 5F78A 1YRWA 2POCA 5TPZD 2J6IA 1A4XA 3W4JA 1YQXA 4BEWA 4EJ6A 4Y9SA 2CEAA 4WEQA 5BNZA 1YOVB 2C82A 3KQHA 1QC5B 3LV8A 2ZYTX 1Z0KA 2WMOB 5LUBA 4NY1A 4YCCA 2D4AA 1GNSA 4DMLA 1WETA 2V0GA 3DE0X 1PL0A 2ZRHA 1Z2CA 2QRVA 2AEMA 3KD3A 3F2VA 3AM1A 5A5DA 5BXYA 1TMYA 1AB5A 3O21A 5IM4A 1S2DA 4XD7D 1H85A 4R31A 1HKHA 4D4HA 1ADFA 1T3TA 2DC1A 1LF5A 5TV2A 1OBCA 2C0QA 4BWVA 1JWLA 4JSYA 4CV2A 4D3XA 1G8FA 1UPAA 2AB0A 1Q2XA 2VFAA 1CY6A 1QRUA 4HH0A 3W2EA 1VYTA 3D3WB 4EPVA 1MAUA 1SCBA 1CUIA 3EZYA 4F9TA 5BPHA 3DDUA 4OFBA 1YQTA 1K08A 1MA3A 4DIOA 3ANLA 4D8YA 1ID1A 2FWIA 2VP3A 3A3KA 4HFJA 1MFZA 4PQEA 3NTVA 3ORFA 5DLYA 2LIPA 3FCOA 1R4NA 4OLBA 3ZDDA 4KK3A 4AJ2A 1EBUA 3UUGA 3MJVA 1OH5A 2SBTA 3K09C 1JQLB 3UKOA 2QX7A 1YQQA 2HUNA 2W90A 3VR6D 1PHPA 1L7VC 3JTMA 5DBOA 1UWKA 1DCTA 1MFPA 1EP1B 3VFDA 4AYXA 2JHAA 2IV2X 1AN0A 2OENG 3HR8A 4OJMX 4EVQA 1SUDA 3CYFA 5EQJB 5K0LA 2V7WA 4AKTA 2UZ4A 3MD9A 5EWJA 1ISIA 3TX6A 4CTNA 2CLKB 1EI9A 4UNRA 1H6DA 2FEMA 1JT9A 2GTIA 2WM9B 4NBUA 4G09A 1HSOA 4G67A 4UARA 1V8OA 1VIDA 2A0FA 2MT9A 1NVWQ 4R9UC 4TMZA 2F48A 1DV1A 5AP9A 1KI2A 5ULLA 5EZ6B 1ODJA 3S40A 4QPPA 5BQXA 2IS1A 3L7IA 4MW9A 4WNAA 4RTKA 3FWKA 2MMCA 3A1NA 5AXCA 1P0PA 2DB3A 4GQBA 4JEMA 4LZWA 1PJAA 1ORDA 1JFFA 1IJEA 3TDNA 4FX2A 4ZCRA 1Q20A 1ZK2A 2JGMA 3MCUA 1QGUA 4BZZA 4AYTA 1CC1S 1SXJE 4G8DA 3W5BA 2HQBA 1IQUA 1II8A 2FOXA 1B6SA 3EASA 4BFLA 3WIDA 3RYIA 3U7IA 1D5CA 1H3EA 1P9RA 1L5KA 1E7SA 2O2JA 1E4OA 1TK9A 1GITA 5JCZA 3P0HA 2XE4A 3B60A 4ZTBA 2E1RA 1P0CA 1YS6A 3K9LA 1LTKA 3G9ZA 2KYRA 1GLVA 3CPEA 521PA 4C05A 2Z6UA 2EFEB 2YJ3A 3D8UA 3GI1A 4KXMA 4C43A 4BFZA 2WBLC 1T4CB 1C3OA 3S8MA 1BWRA 1GKUB 1NE7A 1W5TA 2O1EA 1KGDA 1UBTS 2QP9X 4QFMA 4WA7A 4ZT4A 3RVRA 5EJGA 3TPFA 3V7UA 2DETA 4CEIA 1FFXB 3H6GA 3GRPA 3JQQA 5H68A 1F4PA 1R1DA 3P27A 1E1RD 2FFQA 2VBFA 3IQIX 5KWEA 5A06A 1LBEA 2BDTA 2IUUA 1L5SA 1KTVA 2IP4A 2YS6A 4GX5A 4K40A 1QG6A 4OF4A 3UJHA 3LKVA 1L5ZA 3ZGOA 2VJOA 1MH9A 3K4HA 4X1YA 1L4NA 1X1QA 3AKZA 1IB6A 2PZGA 1Z17A 4KV9A 1NN3A 4MKFA 2HA4A 5DIZA 3MSXA 5EWJB 2HN9A 3ZHSA 4MITA 3TRIA 1W4ZA 3HUEA 1KJZA 2QTAA 4EYOA 5J23A 2V4UA 4B87A 4DIKA 3GEMA 5DISB 3QOYA 4QOHA 1J8FA 3ANSA 4GYYA 4L2IA 9ATCA 3EXIB 3PGKA 2DFKB 4KXFB 3PWKA 5ESXA 3DS8A 1QTRA 2IY9A 5HTKA 4CDGA 1AGXA 1B16A 1T8RA 3GGPA 5A04A 5CLQA 4O4JF 1EDEA 2QROA 4CKXA 1TYCA 3N2ZB 4RPIA 3USZA 4DAEA 4F6LA 3D1LA 1E64A 1DO0A 3OA2A 4L4XA 5JD3A 1NJ1A 4Q7MB 2F8TA 1RAGA 1BSVA 3LP6A 4HADA 1XTSA 1Q7EA 4KSYA 2VPXA 1PJSA 1JHDA 1G55A 1CY4A 2WM3A 3PFFA 4TWZA 4CKEA 3RAPR 1UADA 2WVJA 2YUIA 3QVSA 2I2AA 1KY3A 3WLLA 4BTEA 1D1SA 3GUCA 1Q16A 5AJZA 2F55A 5JHHB 4RHUA 1SO8A 1WPXA 4DVGA 4RAQA 5AH0A 4QTZA 3ZQ4A 4DJAA 2IKQA 1SOVA 1YL6A 5E4TA 5FLYA 2I2BA 1N7GA 3CNEA 4DCJA 4E14A 3WGIA 4BNKA 2ZSFA 2QRVB 3I9KA 1SBZA 4IO1A 4Q6BA 5JD4A 3TECE 5MN4A 1AHNA 3QPWA 2YVLA 3MMZA 3PSAA 4Q15A 3DZKA 3DT8A 4V0LA 4JI7B 1P18A 3DFMA 2XXAB 3HYCA 4HXGA 2NGRA 5IEJA 4QUEA 2I87A 2AZ4A 1WDWB 1L7MA 4QXQA 1XE3A 2DFDA 3EG5A 4BNVA 2VTBA 2W7TA 3O1HB 4I5DA 3EGDB 5AKKA 1XQ1A 3ST7A 2ZYIA 4J7XA 5LQDA 3GL9A 2QR5A 4XGNA 1AUOA 1JDUA 2R1ZA 2BUAA 4BP3A 2GZ3A 2IU0A 4O63O 2QTHA 2DHRA 2ATXA 2Y4OA 2HI0A 4JR0A 4US0R 4Z99A 2CK3A 4DGSA 2Z08A 2BL4A 3F3SA 3P52A 4KR0A 1J0EA 4MUMA 4JJ4A 3EWNA 1QAOA 4LWZA 1DKMA 3V8NA 5LC1A 2W2KB 1AG9A 3CLRC 4YFYA 4AY2A 4KGDA 3AHIA 4AMYA 1TMOA 1Y3HA 2HJWA 1QFJA 4G4SP 1XZCA 4B4DA 4F84A 3NNNA 4JBIA 1M9NA 3GRZA 4XUDA 2FJPA 3LLCA 3T5MA 2P0EA 2PQ2A 3WRXC 3ZE1B 4NZPA 1DKOA 5TQVA 1DKLA 3V8BA 5ALYA 5B1HA 1D04A 1G8AA 4FPXA 4B3IA 1LDGA 2GVDC 5ENVA 3PV0A 3VVBA 4D9MA 2HEGA 3T15A 4CUJA 1ESDA 2OESA 1T6YA 4RTJA 2BMEA 3H3FA 2P1RA 2BKEA 4PG4A 2RGNC 4ZI2A 3DBHA 3CX3A 2F4NA 2VYVD 3HJGA 5FORA 5HIIA 3KQMA 4D80A 1SC1A 5BQPA 1B1CA 3N5CA 1LPBB 2ZLBA 3TUZC 1M1UA 2AOXA 3TYXA 4XZ3A 1V5WA 4EFNA 2YXEA 2FHPA 3COZA 3MGAA 3N5KA 5IAGA 4YRIA 1A2KC 3NATA 4RVHA 4EK9A 2CYAA 3OE7D 5JYDA 3HSSA 5EYPB 1H05A 2HQOA 3FSRA 4GP7A 3RARA 1TEZA 3AVQA 1JQKA 1FSFA 1BFKA 1JHRA 1GAWA 1UXHA 2H1SA 4KLAA 3PC8C 4RQAA 1JFSA 1YQGA 4A27A 1EMDA 1W5AA 3BAZA 3F97A 4HL6A 4LHYA 1EK5A 1ZVVA 1UJCA 1XZFA 5BVHA 2YZGA 3NQ41 4FMDB 2FPIB 3KUKA 4R6WA 5JJBA 2ISSD 4EMBA 2Y1FA 1FTGA 2HSGA 1S1MA 1WCWA 4CTJA 4L3WA 4DANA 3HGTA 4C7KA 1O96B 2H5JA 5EP2A 5J58A 4LF7B 1T5IA 1MHPA 5SV2A 1W73A 2PD4A 2HFKA 1KAEA 4QPNA 4R1OA 1S3SA 4QBKA 5GZ6A 5J1SB 3H9QA 4G89A 3OKCA 3PUVA 2YIDA 3OSZA 1ZCAA 2FNAA 2GCOB 5DGXA 5CFNA 4BQPA 3GMSA 1ZSNA 5HRUA 2Z9CA 1Z45A 4QU0A 4QECA 3JZDA 4TS3A 2Q4BA 3SEZA 3MCTA 5FOUA 3V6LA 1Y8QA 2VHWA 1THTA 5MHTA 4R8KA 1Q19A 4HFRA 3L46A 1N6NA 2HW8A 4EFMA 2QZZA 3A6EA 3UOAB 5A71A 1KMHB 4CM7A 4N4AA 4DY6A 4B2LA 5J9FA 4RORA 2VF8A 4OI2A 4B32A 1HOXA 2PL1A 4DUGA 5LQJA 5FD8A 3TKAA 5FA8A 2IIBA 4DG8A 4HXEB 1L4FA 1KVUA 4TRMA 5CYFA 3IODA 5F1PA 3G5UA 1C0IA 1HLPA 2RDMA 3EIUA 2XCSB 4EG4A 4HDSA 3FFXA 4RZUA 3KQQA 5IDYA 1YC2A 2IUSA 3RU7A 1IG0A 1R9NA 3W06A 4REQA 4X7MA 4DDMA 4RBNA