5H9WA

Crystal structure of regnase pin domain, form ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h9wA00
4G24A 5H9VA 4G25A 5FT9A 4G23A 4G26A 3V33A 3V32A 3V34A 5H9WA 5DIZA
chains in the Genus database with same CATH superfamily
4HR7A 3Q40A 3PEUA 4GICA 3S8MA 5KNDA 3F47A 3PC7A 4DC9A 4JP2A 4Z8YA 3LXRA 4M22A 4ZCQA 3M4YA 4AYWA 5DNAA 4XX1A 1Y4DE 2AE2A 3M6UA 3AYZB 4EI2A 4C4TA 2RGBA 2D3TA 4TL8A 1X6VA 2L69A 1YL5A 1L6RA 3CF4G 1ULZA 4GYYA 4LJ4A 1EA5A 1UJ6A 2XB4A 1GY8A 1XD9A 3MB5A 5ECYA 4AP6A 1JJVA 4E5DA 2ZBVA 5HZMA 1TM1E 3WX0A 3DZBA 1XEWY 3KVRA 1E64A 2Q4BA 3ADKA 2VHQA 4I14A 3Q11A 1T0PA 3NM6B 1QHHA 3H1TA 1P2TA 4WLEA 5DGDA 2OQ2A 5JXWA 2W2KB 3OICA 5CEFA 3IUYA 4HP8A 4DEVA 2J9YB 4YJ3A 4C2BA 2DFKB 2WF9A 1E99A 3VC3A 3L0BA 1UDAA 5HJ5A 4FWTA 3R5TA 2WTAA 2FCAA 3OJOA 1EVJA 2IX9A 7REQA 2D7CA 2VF4X 1WL8A 1BXKA 3UTDA 4PZ9A 3ZU2A 2IPOA 1Q2UA 2H07A 4QO7A 3QF4A 1T8PA 1RQ2A 2FOLA 3AF4A 1KE2A 4EMTA 2AF4C 3MUNA 4NOKA 1JLMA 3PNBA 4HNTA 1TTHA 4ETIA 5BR7A 1Q1NA 1N2GA 4ND8A 3LV8A 4RNCA 5F2KA 1WJGA 2CMGA 3HCCA 5LIPA 2EATA 1GUZA 2OGUA 1C1DB 4P35A 3OE1A 4GD3Q 1JJFA 3DOJA 5IPFA 3HPQA 2BAGA 3T52A 2ZJAA 3F2IA 5T8KC 4W9RA 2IBMA 2ZSUA 3C8UA 2QA5A 5LFAA 2XE6A 3CKMA 3T4UA 1Y8CA 1UINA 1SZJG 2Q5QA 2WA1A 4XIYA 4AJKA 3O8DA 4N4AA 4LGMA 3IALA 3NTUA 3MJFA 4Q1CA 1DQNA 4X95A 1L7EA 4CIXA 3AEUB 4IDGA 3W9BA 2P91A 1MTOA 1P3DA 2XLCA 3L04A 1JNXX 4HVAA 4OHOA 2P9HA 4HWPA 1M5UA 3NYWA 1E2BA 4GOND 4L3VA 4TV8F 4OLBA 5IJ9A 3U7QA 3LO8A 1WU7A 2QNBA 3U0BA 4NV1A 2Z4SA 1RAIA 4OQYA 2DULA 1KDZA 3GUVA 1THMA 2IIVA 1NKSA 2J9ZB 3E9MA 3KT0A 2JHGA 4M4SA 3QLJA 4A5SA 4B0PA 4CTMA 1F5NA 4FYHA 1E3IA 1KZ9A 1V8BA 3UXHA 4OXQA 4PWYA 4EYKA 2RGAA 3SC6A 1XWIA 1R6UA 3OPMA 1YB5A 2ZB3A 4E70A 3ONWA 4JI3B 2O8CA 5CNKA 2J7KA 4I55A 5FV7A 5IYZB 1NBMD 4LVCA 3URMA 4H18A 2R85A 4LI3X 3T5PA 5JFTA 2E89A 4WCFB 1FDSA 3RLIA 3VR3D 1OH5A 2FDRA 2O2XA 1TLTA 1U7WA 4MAAA 3T35A 5GOZA 5FTKA 4OL9A 2OXRA 4ZZ1A 4CKWB 2A88A 2B7CA 2DH5A 3FTPA 4K9SA 2ON6A 5CEEA 5KTYA 4DUGA 2UZIR 4RESA 5HVNA 3NGXA 4KNVA 2ZFUA 3BMXA 4NNPA 4JX8A 4O5OA 5F1KA 2Y0EA 3ZW8A 4CM6A 5EEHA 1R66A 2C5FA 2FPLA 3ROPA 1Q7CA 1KAMA 3RUAA 4AK9A 4DLWA 4F60A 4RC9A 2CLKB 1YJ8A 1DDIA 3FCYA 1VBNA 2CUZA 2ZE6A 1L3IA 3JYOA 3UV7A 3N0WA 4CLRB 2F8LA 1Z0UA 1SG0A 3I64A 2B21A 4UC0A 3UHPA 4ACAA 2IITA 2NPIA 1QRTA 3ES9A 2VRBA 1YMVA 3F8TA 2OFFA 1NJ2A 4D9CA 1Z4KA 3BX1A 1FVHA 3AONB 2CUKA 2XRFA 4HB4A 4MX8A 4NEHB 4QUJA 3VTZA 3K6RA 1N4DA 2R47A 4PNPA 4D80A 4D8XA 1P1KA 4I81A 4RJJA 5H4GA 3RFXA 2AI2A 4JLVA 2IIBA 1RZRA 4GOKA 5EIWA 1P7ZA 1M2OA 1VLZA 1RRKA 1U0GA 3GNSA 3LVQE 4CDRA 4PO3X 5L7WA 2JJ8A 4P58A 4NQRA 3GT0A 3FFAA 2AN5A 1UIMA 3UBMA 3CRW1 2VQ3A 4WT7A 2IYAA 1GGEA 3GDGA 2PPLA 2HPZA 2KBEA 3E48A 1AGRA 5J2UF 3UPTA 1E9BA 2BMDA 4ZV7A 1QDEA 5LBTA 3PUHA 5KJEA 4AZVA 2OG2A 1FW8A 2ZYWX 1D5WA 1YMQA 3TX6A 4OA5A 3PC8A 2X8JB 2YIJA 2AQIA 2HA5A 3ZHUA 4JR2A 4P08A 2H4ZA 5A5DA 3BDIA 3F2VA 4QU9A 4R2LA 4DSTA 1W4BA 2ZI3A 3AFIA 5G2OA 5B58C 5FI3A 4HRAA 5JH7A 1ESDA 1P80A 4MYRA 1Y81A 2DLNA 4TL6A 1XAJA 2A33A 4Q02A 4MVJF 4N8SA 1JPJA 2XCOA 2FSVC 4JEMA 3VR2A 5A5FA 1G17A 1MUUA 3N6RA 4DMCA 3KYDA 1QUEA 3ND9A 4RVGA 2QBYB 5AI4A 4K7JA 1XG5A 3K0FA 2C2XA 2PZKA 3ECCA 2JFYA 5I48A 2Z5LA 2RGRA 1U63A 3H2GA 1NBAA 2ZSAA 4BEJA 2P40A 3I39X 3LUJA 3SXPA 2BI4A 2E0IA 4IMJB 2QRUA 1L5KA 4RTQA 2Y1XA 2B4KA 3V8NA 1RM5A 2WP8J 2LWIA 1EWQA 1IJFA 3F6SA 3ZR4B 2CCGA 1L4BA 1UBJS 3N8DA 2MIIA 1S9HA 2QENA 4Q3NA 3UJ8A 1VGQA 3MVEA 3V8RA 1U65A 2ZRAA 1U0EA 2AZ4A 3FHOA 2NVOA 3GLUA 3HI6A 4HUQA 1SUIA 3AV3A 5E95A 3UANA 3Q7SA 1T4MA 1WW3A 3D59A 4D4HA 5LP6A 3BH7A 1LU9A 3VX3A 5K6TA 1NW4A 4LXTA 1YKGA 1FFSA 5I5EA 3K6KA 3WYGA 2XT9A 4GPAA 2WJZB 2X2OA 1HRDA 1HE8B 1D1QA 4B3BA 1OU4A 1Q7GA 1RLMA 5AJHA 1XA4A 3PIDA 3N2NA 5ALEA 3OT5A 4KQWA 3HWSA 4JBYA 2O2YA 2DXIA 1P0IA 2X13A 4EYSA 2DTEA 4L6IA 4FU0A 1ZJ4A 4ZOCA 1QHGA 2IGTA 2MT9A 4RD4A 4YN3A 3UB2A 2IXGA 3UJ9A 4I9FA 1I01A 5I9MA 3V1YA 2HT6A 1IXSB 1E2KA 4M9SA 4IRXA 2FA9A 1Q74A 3QHPA 4RF2A 2WAYA 5BQ5A 1A7UA 3H42B 1VZ2A 2PZAA 3CJQA 5CCDA 3NAGA 4U3JA 2O1WA 3ICVA 1YU9A 4U39A 3RTEA 1N3YA 4IJKA 3QJYA 3AUAA 1HK7A 1DKNA 2JF0A 2C9YA 1TQ8A 3WHIA 3T3NA 5LVAA 3EGWA 4HXYA 4U7WA 5CA0F 1N6KA 2JGDB 4QBFA 3KAKA 3D8NA 3OBIA 3OWXA 4P5EA 4YR7A 3T1YB 4L73A 3MJCA 5B12A 1W85B 2A59A 2B0CA 1RZVA 3B60A 3G0DA 2HK6A 4HX9A 1H8HA 4B0OA 1R37A 5CD9A 3NBYC 4CM9A 1NFRA 3G6WA 2W2MA 3KR1A 1B8NA 4O2AB 1ZUHA 3AIIA 1OPRA 3K1JA 3OJ0A 3OPYI 4B4VA 5FPKA 4NY1A 3I01M 1PJSA 4ITUA 2ZBQA 4KVGA 4GE3A 1E9AA 2PSEA 1ZONA 1IPHA 4YXWA 3V48A 4B2YA 2PXAA 4GP9A 2GASA 4ZU3A 4LF5B 1AKTA 2YV2A 5ALHA 2ORED 2P1RA 3PHCA 4JKYA 1IDOA 1YV9A 5JMOA 3OQHA 4DT1A 1ORIA 5JCOA 3GO4A 2NVWA 4U2EA 3H5AA 4X85A 5BQPA 2HSJA 1EQUA 2VKQA 4MVJH 5JAPA 3EULA 3SQOA 4A4DA 1T5HX 3UBTA 2XGOA 1U28C 1NJFA 1ZPDA 1WNTA 2TS1A 5FR2A 2Z3WA 2GPSA 4OMCA 5HEKA 5LDGA 2X7HA 3IQHX 4R9UC 5AI5A 4I5EA 4IEFB 3IDFA 1U2GA 2JNWA 2ZUWA 4LOJA 4ARIA 5AW2A 1ZUIA 121PA 4PO8A 3FPFA 2C9OA 1NZDA 1SCJA 2C4VA 4A23A 4YV1A 3I1YA 1PHPA 1O97C 1R5BA 5YASA 3D3KA 5AI8A 5D7NA 4MRMB 2RGWA 4RF5A 3JWHA 1SD2A 4XX0B 3RAEC 1NVKA 4I50F 1V96A 2VJDA 1PS9A 4I36A 1B42A 5JR3A 1DTWB 1I9GA 3AF1A 5DF1A 2FUKA 4R68A 3B1WA 1KJZA 4F3YA 2DZDA 3EPPA 1ACJA 1GZ7A 5EVJA 2WILA 3H0KA 4IIJF 1YRBA 3TQHA 1U8TA 1TMOA 2WFZA 5K0BA 4L3OA 4QRDA 5AK5A 5E2AA 1NLYA 1IIRA 5SYAA 1OBOA 5CJ2A 2R751 5AJTA 2PTHA 4FYWA 4ZAZA 3RS9A 2NZ8A 1UPAA 1L7NA 2ZSFA 1U80A 5KKNB 5F7XA 3K9WA 1T1EA 4Y6PA 1IG0A 1PWYE 1TCBA 3VSBA 3DKVA 3O7MA 1AKYA 3RPEA 4K9LA 2CNDA 1ORWA 1IEWA 4P33A 2AEFA 3P0RA 3C3EA 4KYVA 4EPXA 4GR5A 2ZTMA 4A0FA 1OV6A 5EE1A 5A4AA 3C7KA 3F5DA 1L3BA 1MG0A 4LQCA 5FBQB 2HN9A 4FE4A 3VYUB 1TTQB 1YI0A 4I1YA 1I7PA 2EKQA 2P2ZA 1AG9A 3DMGA 2H63A 1XCOA 3CPJB 4RMNA 3EXG2 2GBCA 2HPAA 2PSJA 4RGYA 4I4TF 3JD1A 1JA1A 1H22A 1EP1B 1RE0A 1XDSA 3OMXA 5HFJA 4US1R 5TMEA 4A2WA 1L4MA 3AKCA 1DO0A 1GGKA 4LHWA 4YJHB 5MDHA 1A0OA 1YJQA 2WYWA 3JQAD 3H2KA 4PZPA 3L7LA 1SRRA 3R7NA 3F90A 2HH9A 3ZC3A 2IHNA 4IMPA 3RG8A 3AUYA 3W2IA 4X5OA 4H3KB 4IJWA 3KYCA 4RY0A 4E7PA 1QYIA 2WHPA 2W6NA 3D7SA 3EK2A 3W2EA 4GXRA 2ICAA 4FBMA 3ZD8A 2JLQA 3KKNA 4YJFB 2E5LB 5BVHA 4NFHA 2ODWA 5TMPA 2ZBUA 1SOAA 1FLAA 2WTXA 5I7VA 3PCXA 2PLAA 4GFDA 1HMYA 3FMGA 3LT5A 4JKOA 2B4TO 1QSGA 4TMXA 1T2AA 5KYYB 2VTBB 3AF5A 2WKSA 3CZ9A 2SNIE 1S3FA 3CSSA 3VM6A 1H2ZA 1RHJA 2JEYA 1Y8QA 3PHHA 1CB7A 2GXSA 2OZLA 1FFEA 3DDHA 3W4JA 5IXJA 1QTNA 1JHYA 4QEKA 4CUZA 4J43A 3ZZ1A 2GKOA 3FBGA 1R0KA 1JHZA 3M81A 3REQB 5KO2A 3JQ7B 1RVDA 3H1EA 4NS4A 4OY3A 5KVVA 4OCZA 2RH4A 5CT4A 2OD2A 2WMDA 4DGSA 3T9FA 1VSUA 1BHQ1 2E3JA 3EXIA 2NU7B 4KWHA 5EG5A 1SD5A 1SC3A 2PUBA 3OE7D 4QYXA 3MOIA 5EXEA 1ZESA 5CDHA 2YQZA 1FNSA 2WAOA 1V4NA 2VA8A 4W7HA 3GP8A 2O19A 2F9LA 4J16C 3ZKWB 1GSOA 1R0LA 3GHHA 1LY1A 3ZJYA 1IZ8A 1K8XB 2Y1DA 3U7FB 4BAZA 3T3PB 4KN6A 2UVQA 4N18A 1U4SA 4Q5IA 4BJ6A 1W5TA 3JQDA 3MTQA 3QKRA 3EXFA 3SQNA 1RMTA 4ARSA 1N3LA 4G1VA 1TUBB 5K3FB 5JAHA 5IH7A 3I4CA 4MSUA 1ZGBA 2WVJA 5IN4A 4YALA 4A8JC 2C84A 3G8BA 4A0QA 4EA9A 4OSPA 2DETA 1JJ7A 1X8KA 3OZEA 4RSMA 4B6QA 3AR5A 3BGDA 4O63O 3QEMB 4IRMA 2C4WA 1K8ZB 4RVFA 5CBPB 4YLEA 2O57A 3IIEA 1OWLA 2H11A 4LRQA 1DUSA 4YUVA 2VF2A 5AXDA 1K4KA 1CW2B 3RT9A 3S3TA 4BFUA 1WY7A 2C1EA 2CDRA 3FNQA 2GCOA 4CQMD 1T4CA 1FDRA 4GX0A 2H8GA 3V7NA 5KTSA 3FXAA 2XOKD 3CZAA 2I80A 1XQVA 4IFTA 3WISA 5C7OO 2HZ7A 2KB0A 3R9XB 2PT6A 2XYVA 3CEPB 3G9QA 3O8NA 2BTOA 2D06A 1KIFA 3ORFA 4JU9A 4CN9A 1E1QA 4GMFA 5ESXA 5KTMA 1M8PA 1CQIA 4HQRA 1JT2A 5F1PA 4HHEA 1T2UA 1OT5A 4O4JA 1ZSNA 2YNMA 3T4EA 1YVUA 5D1HA 4C2TA 4MW1A 4CCWA 4DLUA 3S4YA 1SY7A 4GP7A 1M72A 3CUKA 1KPGA 1M83A 1EEHA 3QPVA 3IJPA 1KS2A 4RLHA 4UBKA 1QHEA 4AECA 4G09A 4YUZA 1CHDA 3OSUA 1XCGB 4KX5A 3HYTA 1A9ZA 4JDUA 1CUSA 3U13A 3R6DA 4PN3A 1GQYA 1JKIA 3GAMA 3H9GA 2I34A 1GQ2A 3D6TB 1L7AA 4DQ0A 3JR7A 2G77B 3ABIA 3AG5A 5BW6B 4CODB 3EC7A 1FNDA 4WN9B 3KM0A 4ZGBA 1FTNA 5FBLB 3K4QA 4WNAA 2QN3A 5AH0A 3I3OA 4DR7B 4LW8A 4D46A 2JFBA 2EHDA 4MRPA 2J07A 4CIWA 1GTL1 2D74A 1P2UA 1Y1TA 2JAWA 5AJWA 4LI0A 3DVAB 4Z7JA 5EQFA 3K70D 3LO5A 4G6ZA 4KQEA 1RM3A 1FCJA 3DZHA 3VR5A 1E2HA 1K0FA 1GCGA 1KL7A 1V11B 3DTVD 2O48X 3EQZA 1P1JA 4G3XA 2YXBA 4HDAA 4P7FA 5TDHA 2P5TB 4ARBA 1YAJA 4C7BA 3CLVA 2JFPA 1ZRNA 4HKTA 4DIFA 1Z4IA 1WF3A 2QS9A 2Z2IA 4FFOA 1KORA 1O03A 2V9ZA 4PZLA 2AWOA 5T3YA 3VX4A 1KY2A 2KSQA 4G4IA 4GKBA 3NHFA 1SBTA 2ISCA 1RWXA 3HCNA 3R7BA 5AVQA 1TOAA 1YONA 1TADA 4NJMA 2O8EB 3H17A 2RGYA 1COWD 1DG3A 4R2WA 5HM6A 4F2HA 4KNYA 2HRDA 1Z47A 2PYDA 3VISA 4FB5A 1WB6A 1XXLA 1P1IA 2IU3A 2O20A 2LR0A 3AP3A 4Q39A 2Q7DA 5HQ3A 1QWSA 2IYOA 3KJXA 4HDSA 2ZIXB 3ZWOA 1P62B 1LC0A 3EVZA 1PWEA 4BCBA 3LW8A 3M49A 4RA6A 2H5IA 1C50A 2OD7A 4G97A 3R3HA 2P9EA 4PR3A 4QBGB 4R9SA 3KVNA 5CUQA 4XR9A 1K68A 3UH1A 1NVFA 2BGKA 2E4AA 3E9YA 2GSDA 1N2SA 4FHZA 2I22A 1VMDA 1XALA 1XJWA 3ND8A 1E2DA 5FA6A 1EU1A 2TRSB 5DX1A 1H1LB 2C03A 4YAGA 4DV3B 1JDTA 1ZL0A 2QTAA 3IO5A 2WQZA 4TWRA 4J03A 3EXEA 3KTFA 1NXPA 1G2PA 1J2YA 3DMYA 3W9YA 3R5KA 4GKVA 1PR4A 2QNIA 3P7MA 1DKUA 2DT8A 2IW1A 3W3AA 2BM8A 5BRJA 4IKOA 4L95C 4HNQA 2F59A 1QYCA 1E9FA 4IHQA 1MZPA 1Y9ZA 2WRZA 3N07A 4H35A 4MLCA 4O2BF 5CGZA 2ODBA 3V4OA 1QIMA 3RBAA 1IRIA 4D0LB 3O2QB 3VR4H 1K5HA 2ZK7A 2H1CA 3NV9A 2PCJA 1DBSA 3KNZA 4BGVA 4DRXA 4XDZA 3F97A 2V3WA 4BO7A 3O7WA 2FWRA 1B3RA 2HYDA 2NXJA 2YOFA 3AILA 3DEAA 4P53A 3GJ3A 4Q4AB 1L5SA 5ESRA 5AW3A 5HPYB 5HZGA 4UJ5A 1UQUA 1XNJA 3EIFA 2DM6A 4GGMX 4GI2A 4JY7A 4GRDA 4KQ1A 4QXQA 1USGA 1I32A 1JR4A 3LPCA 1M2GA 2C3UA 5CAEA 1E6CA 3FSRA 4RFLA 3V7YA 1EUQA 5MFZA 4UHFA 1M1ZA 1NMXA 1KE1A 5KPDA 1E2QA 4XUDA 5AKIA 5GM1A 2C99A 3WGMA 2OBMA 1QLWA 1G20B 2XD9A 3L5KA 1YRWA 3CLKA 4KQ9A 3GW8A 1K7XB 4R3UC 5AKEA 1SIBE 1D4OA 1VYUA 3GJSA 1QDUA 2DQKA 1FQJA 1N2XA 4ER6A 1UKBA 5K0TA 4GPIB 5CJJA 4DVJA 1K2WA 1KR5A 1JQLB 1SCNE 1PR9A 1CWUA 1SQ6A 1NJ6A 1H3NA 4B44A 4BMVA 4MAMA 3B5JA 3KUKA 3EMVA 1F2UB 2ZWMA 1UM8A 4IOKA 4UJ3A 3HK2A 4GPEA 4XB1A 3TI7A 3EOAI 5LUBA 4H4EA 3TF5A 1JS1X 4M1TA 2NSLA 3ESDA 4XLTA 4EHNA 3VO2A 5AM5A 4C6TA 5F5NA 1UT8A 3MS7A 3QVVA 4JBLA 3NPMA 4QQRA 4BASA 1E60A 2A92A 5KNBH 2H51A 5K45A 2EP8A 2V6GA 4MKRA 1OIVA 5ICGA 1Z2PX 2MCFA 4PY2A 1NQ5A 1N25A 2QN6A 2L19A 4TTRA 4MUGA 1J0DA 2XVYA 2AQHA 2MYTA 4GH5A 4LJ7A 3K72B 4RVUA 1LUAA 1N5IA 1ULBA 3HE3A 4MICA 1MOZA 1Z06A 3HQ4O 2NU8A 3WQQA 4EEZA 1DJLA 5MFPA 1NU6A 1S2IA 2YJNA 3DFIA 2FUG6 3IVGA 5FNZA 3WADA 2FSFA 5B58T 2QYTA 3O2JA 2CF6A 4ZTBA 3GMIA 4TQAA 2V5UA 5L40A 1EE9A 1US8B 4HRYA 4DNXA 3AUJB 4JLAA 3CRQA 2XIJA 3OG9A 4CE6A 1OI7A 5HKKA 4MR8A 3NBMA 3T0IA 1Z5NA 1BU8A 3ZI0A 4G36A 4MMZB 3I92A 3T06B 4DR4B 2ODQA 1SB8A 2XQGA 1R8XA 2IIQA 2JDID 1Z6QA 2G76A 2Q2QA 3D4LA 4HGOA 5DDIP 5H9VA 3U44B 3HP7A 1D2EA 4ER5A 3KZ1E 1DRWA 5LDDC 3GPBA 3R0VA 3ENVA 1VG0B 2HCJB 4KPGA 4IHAA 2W48A 5G53C 2ZJ8A 2C2ZA 1AD2A 4O4LB 1U0NA 3MWJA 1NVVR 5T41A 4LRXA 3L6CA 1QMGA 3Q2KA 1E1KA 3OCUA 5EWMB 2VK2A 2FW8A 3IESA 4MPJA 3R41A 3JQAB 5U9CA 4DM7A 3ZZMA 1GRVA 3HB0A 1P2VA 4KAXA 4A6EA 1ODFA 2FUNB 4CT4B 1R9GA 2FMTA 2QY6A 2OPBA 3HVKA 3ABSB 3DWIA 4M0FA 4RORA 2MSDB 1VP9A 4BPBA 2O8DA 1H2AS 1QFMA 2IZ5A 3NTXA 3AESA 3E7PA 2XB9A 2QTTA 4N40A 2EJUA 4OQXA 5HKLA 3ROFA 1NXWA 2P65A 1NJSA 1NX6A 1U31A 2H85A 1U3WA 1VMEA 1EE2A 2WHXA 1G5RA 1GSHA 4JUDX 4G67A 1AKWA 3X1KA 3EGCA 4FHGA 5CVUA 5J4KA 1VG1A 2PR2A 1L7PA 2ZGVA 3HFGA 5E4TA 3AEQB 4DBLC 4PLGA 5K03A 5KYXB 2ZJZA 4X1YB 2C8LA 3H1GA 3O8QB 3R6TA 3BL6A 4CMHA 3FHLA 4K9DA 3WA7A 2C07A 1MH1A 3EFBA 2ZAIA 1MRNA 4B81A 1LI4A 3CIOA 1RYFA 2FE4A 3FUTA 3SDSA 2QR3A 5KVQA 3TEMA 2HQSA 2QVLA 5FOWA 5IXYA 2XMRA 5L8VA 2VP2A 1HETA 2UXCB 4YREA 3FLEA 5FTLA 2WJ6A 4OQNA 1KP3A 1U8AA 3GJ6A 1U7OA 1L5QA 4EHKA 1ESMA 1EQAA 5DM60 2WU3A 3KWFA 4YCJA 4F5ZA 3EPLA 1HNWB 2H6EA 1TPYA 1YZFA 4Q9LA 2GRJA 4Q12A 5TEVA 1JSRA 5JNSA 3DHWC 2HJ9A 1VSTA 4A91A 5JUWA 4Z5XA 5K6AC 2UUBB 3ISJA 3K16A 5DTRA 1MXFA 1IZ0A 2XYRA 5B3AA 4LJLA 1FVXA 3KD2A 2A9PA 4H0CA 1EFAA 3E2IA 4M0CA 1JTFA 2VXOA 1RXUA 4EI9A 5JLJA 1UKCA 5M5BA 1EXDA 3B9RA 1ATIA 3C3XA 2VZ8A 2KYRA 1ZKMA 3NT5A 1TB4A 1XZLA 1HL7A 4HYQA 4LZPA 1QE0A 2A0KA 2C4HA 3DL0A 4KVFA 5EMLA 3ZVNA 2DOKA 4MB0A 4OQLA 5KSOA 1B23P 2ECOA 3R0QA 2JGLA 2OCPA 2PVSA 3G2MA 2HIAA 4KTTE 4WOKA 3D1LA 4YPOA 4GLFA 5AYVA 4EARA 4R2JA 2DJIA 1GPJA 3HJBA 1CS0B 2D2FA 2ZBRA 4CQMB 1I4OA 3O8OA 3FCAA 4IP0A 1CUEA 4YONB 3WGJA 4DR6B 1H5UA 2B5VA 5C31A 5CPBA 4E51A 3BC1A 1NRIA 2Q62A 2VN8A 4FGUA 4DUYB 3BJIC 3S2ZA 1KJ8A 3TECE 2X0FA 1ZX1A 3QWBA 3T38A 1CIPA 2EKDA 5EMHA 4LDJA 3U7HB 1YGPA 2N75A 2NADA 2P0EA 2IH4A 1CIVA 1UMDB 4IXDA 1T26A 2ZR8A 5G3YA 3WYCA 2WTBA 1A77A 3ISVA 3D3WB 4LOAA 1C14A 3CRVA 3FRJA 3FE2A 3JTEA 4ZAYA 3X2SA 3QXXA 4NU0A 2Y93A 3ESBA 3P20A 2P2NA 3HJCA 3I2IA 3VH2A 1LI7A 1EGQA 2JFGA 3QX9A 3TKLA 4IX1A 1U5AA 4KDFA 2WICA 3OPQA 5FAXA 1ZMOA 3S29A 2DHEA 1KMNA 2D00A 5BWMA 1OLUB 3SKXA 1MEEA 3CA8A 3SSNA 4RXUA 3ZBQA 4TL9A 3R09A 1JEQB 4TTAA 3JWGA 1HQKA 1VKHA 4PYQA 1XNHA 3LT2A 2QNRA 1JR6A 3WLSA 1FRNA 4GIBA 1KNXA 1ISJA 2ZJ6A 3CO5A 3A2MA 4H0FA 4RQAA 2VC2B 1NIPA 2XVAA 3P4XA 3LDUA 4WJLA 4H16A 1XF9A 2IU4A 4HLUA 2WM3A 3A3PA 4RADA 3R6LA 4CDGA 5TT1A 4HYEA 2PVCA 5H9WA 2VO1A 4GZMA 3DHEA 4IILA 3K70B 4R7ZA 2JFNA 5LOVB 2F90A 4C1BA 2O2CA 1I5EA 2QAIA 1XTSA 1QORA 3L4BA 4PCAA 4Z4EA 1Y48E 3L92A 4Y2QA 4YJ3F 2WIBA 3SIXA 5AVUA 4E14A 5EJ7A 1NPTO 4D41A 3ZG6A 5GVSA 3OEWA 4C7KA 1I2CA 2OESA 3CN9A 4K81B 3L2OB 4LJ9A 3TOVA 2PZLA 2V7XA 1CQPA 2YASA 2HUNA 3EFEA 4L5JA 3M82A 3ID6C 5ARCA 1RWNA 2DUJA 3QM1A 4OLJA 1NI4A 3BUSA 1SXJD 2V7PA 4TT3A 4U00A 2QVXX 3KRTA 4DTCA 2BV3A 4QTTB 5LL6P 1XT6A 1Z5OA 2GAAA 1C3JA 4X97A 5AK4A 4NECA 5LSAA 3Q7EA 4W63A 3VOSA 1LPPA 3OA0A 4E5UA 2NNWB 2WJPA 1Z6YA 5KQPA 5DXAA 2FVYA 3AEZA 3BERA 3AP2A 3R5SA 4GRIA 2R8BA 2PIAA 4YDSA 1UPUA 1ZIPA 3FIUA 3DL7A 1ST3A 1X1EA 4URHA 4WVFA 2B1QA 3RK0A 4IICA 4YRPA 1ZLYA 2OBYA 1XKQA 4PSUA 1WUHS 3I45A 2Z95A 1KNQA 3NXKA 4C0LA 3QEOA 2XUJA 2QI9C 2QTFA 1KPHA 2ONCA 1XTJA 1IWPB 1WB4A 2D1YA 1EDBA 3FW1A 1YC2A 2PJUA 3CINA 1XTKA 1GG5A 2XX3A 3F7TA 4NJEB 3VPDA 4DIKA 4E4RA 2I1LA 3O1JC 1WDWB 3PEVA 3VU1A 4NPHA 1JB1A 4CV0A 1DWUA 1HYEA 4D5GA 3UK6A 3SBEA 5A2GA 2MTBA 1V2HE 1L5FA 4PYLA 4UBNA 1TUGA 3NWJA 1YBAA 3BQNB 3OURA 1CETA 2IYZA 2P35A 4KK3A 4B9EA 4DABA 3DQZA 4EHAA 2FW6A 2Y3IA 1WOMA 4P4SA 4EKGA 1NY6A 221PA 3TTVA 5LQRA 1CQZA 4JEIA 3WYNA 1CKEA 4P0TA 5DRYA 4I55F 2CFSA 2NIPA 3ANXA 4C4RA 1IEQA 3GCDA 3GROA 1NY5A 2CT8A 2A9FA 3EYAA 3DOOA 3LC2O 2GM5A 4OEHA 5B7QA 1CDDA 1BTOA 2ID8A 3AW9A 4HVCA 2F64A 3TZQA 1OFHA 3I83A 2CNNA 5DTJA 4Y9DA 1OD6A 2Y1OA 3B5EA 2JAOA 4HATA 4RJIA 5JCJA 5K0SA 3TQOA 5EZYB 1T5OA 2BCGY 3C3JA 1QRAA 6Q21A 2CE2X 2Q46A 3PDCA 4YCLA 1JR2A 2GARA 2OFWA 1HEIA 2FFRA 3QY0A 4YRNA 1ZDMA 3O8CA 4K0KB 3IQZA 4WGGA 4DILA 1CY2A 4C4YA 1V3QE 1W0KD 3OCCA 4KEAA 5LZ8A 4DIUA 5D5QA 2J6HA 1K4MA 1TVKB 1VDMA 4MWCA 5H02A 4CUKA 2FEMA 3FZEA 3P9RA 2QW0X 3Q3JB 4IGFA 1EVQA 4MQEB 2HLDD 2Z30A 4KE9A 1HPLA 2BEVA 4Q7EA 4YFVA 2IZ7A 3VDNB 3R7DA 2WIDA 1H4QA 4D3XA 4XSGA 4L8LA 3VYTB 3ML1A 1G21E 1WXEA 3NB0A 2ZDHA 4US2R 1N1DA 4DTIA 4KR6A 3U4CA 4QG3A 1AV6A 2Q5EA 5JPCA 2CE7A 1E1LA 4IEEA 5DCYA 4CG3A 5CEJA 3ABRB 3DZFA 3CSUA 5F21A 3VU9A 3WZMA 1GG2A 2WF7A 2I2BA 4FEAA 2XXAA 4KHZA 2L42A 3PPIA 5IJ0B 3WLQA 3NONA 2B82A 2I7TA 3CEAA 2E5WA 3ENWA 1JVSA 3I0NA 3PHIA 3OOJA 3BIJA 1QU3A 5BYKA 4JBNA 4CVNA 4QVKA 4YAOA 1WUJS 1XDWA 4QT0A 1Z5ZA 1FUIA 1ZCZA 4A0RA 1AO0A 5JH7F 3A4NA 3UEOA 3D2AA 2ZUCA 3B1XA 5EKXA 5CW1A 3WE7A 2ZU0C 2OMEA 2H8KA 4KVAA 5GP1A 4C21A 3ND6A 1H2FA 4DQKA 2FJ0A 2QTHA 3O93A 3E7FA 4FR2A 1II9A 3R5XA 3ZV7A 2I4TA 1YD7A 3H8VA 1N57A 4MVJM 1N9GA 1IZYA 4RIEA 4DNQA 4GLJA 1GRCA 5DK6A 2NP6A 5ETJA 1FMLA 2X8BA 2VFAA 4L4UA 1C9YA 4WKPA 2FUG1 5KCZA 4WZZA 2O8VA 3PK0A 5KHLB 1XMOB 3D0RA 4G0VA 1D03A 3MC1A 3H7IA 5C1PA 1QHNA 4CWAA 4MYUA 3LQRA 4RTOA 1NBOA 2RI1A 1E5DA 3D6MA 3KCNA 4P3NA 3FM9A 2B36A 1XCPA 3PDIA 4V0OA 4BO8A 1JHRA 3WDMA 2REQA 4TLAA 1KVQA 1TRKA 2H0QA 3QVGA 3K0SA 3L0SA 3JD2A 1NA5A 4EBFA 1KO1A 5ISMA 4RDHA 1HKUA 1ST2A 1UBUS 5LP6F 3R3SA 3WGQA 2CN1A 4B3RB 1HZZC 4C0AC 1AK2A 1Z68A 3I9JA 1HNZB 5IUNC 2HMWA 4YAJA 5MN4A 4ND6A 4F84A 1PG5A 4E46A 1T0UA 1RXWA 2OYCA 1NYRA 3INNA 3HYNA 4N3CA 2MYNA 3SX0A 1GL9B 1X19A 3D4BA 1LPBB 1UH5A 1HDGO 2RCNA 3KQUA 3K31A 1CXZA 1ESZA 1TXGA 3A6EA 1USUA 4OHFA 4QPPA 5GMOA 4G5RA 4V0SA 1NRWA 3GV0A 1EFVA 3V4ZA 3DEIA 4W4TA 1JDBB 3RWBA 3ZBUA 2RONA 3ZXUB 2WZDA 4ALKA 4EPRA 5JXGA 1TU0A 2QN1A 4L3WA 1YZQA 2CDAA 5FWYA 4Z99A 3UPDA 4IXWA 2XNJA 1FDUA 3RVKA 4AZ0A 2BMEA 2Y1WA 1RPJA 3NHYA 4FHFA 2NMVA 1OHHD 2BL4A 4LWPA 3QQPA 4PANA 1DBRA 4AX4A 1IDN1 3Q9SA 4EVSA 1SC4A 2A1TS 1UC8A 4Q66C 2AFVA 4XGNA 5KTTA 5L3VA 3E4DA 3FWZA 1ICEA 4NZYA 4AJEA 3H3JA 3K0CC 3HB7A 4Z0TA 4FYJA 1WZCA 1P7VA 3O21A 4YA6A 4ZAWA 2PLRA 3G7NA 3JD0A 1CZOA 4OJYA 5TLSA 3OZIA 1I51A 3KSDO 4J3JA 2P78A 2PT7A 5CLHA 5DPMA 1TJ5A 4JMLA 1QF7A 1I6WA 2EFDB 3V7UA 1WG8A 2WG1A 3K9BA 3HO6A 2ZJ1A 2XDAA 4QUBA 3DWGA 2V7QA 2PJRA 3FWKA 4HDCA 2NO5A 2D1QA 4MARA 5ADUS 3U4GA 2XWPA 4IFIA 4IR7A 3MJTA 1CZNA 4Q9KA 3SSOA 3TMAA 4HPJB 4FJ2A 5E7IA 2DHCA 4L5IA 5CDFE 1TK2A 1X80A 4KXLA 4DBVO 3LDFA 1QCCA 3WLIA 2FSGA 4NFYA 5EXSA 3MF4A 4ZVRA 4J7AA 3ZCSA 1VGRA 2WD8A 3E1KA 3IHLA 2GZSA 4IYRA 4PC7A 4BBPA 1K4YA 3MA0A 1SQ5A 5HJ7A 1KRHA 3OJWA 4PHHA 4RTJA 3J80A 4B46A 4BATA 5HA5A 1QH1A 3LQYA 1TEVA 1RPAA 2AK3A 3DAFA 3EIWA 4HTAA 4JASB 2HSGA 2O3JA 4IJQA 4NZ9A 1XZFA 4UUQA 1JX6A 4IMRA 2GM9A 3UMMA 3AIKA 2C20A 1VZ3A 2H1SA 2P4HX 1JAIA 2X7XA 3K1YA 4XPZA 2B69A 4KR9A 1H1TA 1G18A 3KELA 2JZNA 2ZRKA 4CM8B 4D92A 2I1WA 2ZRJA 4OJQA 4MLZA 3NP7A 3MYRA 3A14A 2F4NA 2QX7A 4IVRA 4E3ZA 3HFSA 1KI7A 1BGVA 4DDUA 2B30A 1ULAA 3M6LA 4KN5A 3BXEA 5GONB 3HCAA 4EB0A 1Z63A 2Z58A 3KEQA 4LCJA 3LOQA 3LJKA 1CJVC 3L7IA 3PG5A 1OBVA 2OL4A 4AG3A 4KSCA 3W77A 4B71A 1PX2A 3O9VA 4BWYA 4TLEA 3IUEA 4QG7A 4I19A 2XGGA 2Q99A 3CV3A 3DXYA 4YRIA 2WWYA 1U7ZA 2LKDA 1L5NA 1R8JA 3WGVA 3WIUA 4CL8A 1PK7A 4YJGA 2AG6A 1O54A 2JCGA 3H9EO 1NN3A 3EODA 4FM9A 2PY6A 3IODA 2H52A 1POWA 5KS2A 3FFBA 2C59A 2FOIA 4R9RA 4R54A 5EE0A 2TSYB 3K2BA 2H1WA 5ECGC 1FJGB 4Q1EA 4TL7A 5I7EA 1XPRA 2VJOA 1L4NA 3BD8A 3INYA 2O4UX 4WKNA 9ABPA 3C2QA 3QUSA 1UKEA 3EHEA 4S04A 1SK8A 4O4IF 1W49A 4JD5A 5DYGA 4X20A 2VP3A 1RU3A 1UPFA 5IUKC 3S0JA 1RC8A 2WZBA 3EZ2A 3FPKA 4NYJR 1ZJZA 4II2A 2FEXA 2FPIA 5CDFA 1XP8A 4H1VA 3OBBA 3W5IA 2YKGA 4WKGA 2BFPA 3R3ZA 4RS3A 5JSQA 5FLYA 4M37A 2GX6A 3GLHE 2ZJBA 1G16A 5ALGA 4F71A 2AW3A 1DIHA 2ATCA 1GSAA 4JJEA 3WLMA 4FMBB 1KI9A 2YV5A 3IO3A 4ONEA 3SXUB 2OBBA 3HBMA 1ZBDA 2OUIA 3NJRA 3FOBA 3L1JA 5CGQB 3V1LA 5IKMA 4NCBA 1U0LA 2NTNA 2VH1A 2QMUA 2VDLB 1JLKA 2QRVB 4PPQA 5REQA 1E89A 3GRCA 2R5WA 2WVHA 3JVVA 3H5IA 2NGRA 4E6EA 3E0QA 3RRJA 1PFKA 2XEDA 4JMPA 2Y05A 4L0CA 3VO1A 2VPQA 1Z25A 3H9JA 5GTDA 4W5RA 1BFDA 1ZXXA 3TTUA 4EUSA 1TF5A 2XJ4A 5B30A 4S1TA 5HXAA 1AUXA 4IO0A 1UBMS 2EERA 5J4YA 2H2DA 4YRFA 3AOGA 1N75A 4I1RA 3N74A 4RZQA 4NFLA 4TMVA 4QSMA 4KR2A 1ISRA 4NICA 4S1PA 1ZD1A 5JBIA 5KYNA 2HW8A 4CEIA 1E2UA 4ZI7B 5JALA 1FX0B 1P17A 2ANCA 3OHPA 1BHSA 4JI8B 1ZAYA 1UDWA 1C3EA 2FFQA 5CVTA 1PUIA 1CJMA 4HC4A 1R00A 2K7FA 3PDUA 3P2IA 3JZMA 3WGZA 1XXHB 1XMJA 1XRRA 4IJVA 4IIFA 3EJ6A 3KV1A 3GFGA 4FHEA 1YFLA 4OXYA 1G2OA 1E3EA 2EYUA 3KEFA 3EMBA 4O0LA 4F2PA 1FVFA 1Z0JA 2L0XA 4HFMA 3EF1A 5T4EA 4DCGA 1KHHA 2H16A 4JA0A 2VPZA 5DBIA 4C4PA 2OHGA 1E7QA 1C30B 3T6KA 5JQGF 2ZJ3A 3ORRA 5D85A 1JG6A 3ITEA 2ZXFA 2GN2A 2HL6A 1HKHA 2QLFA 2E1RA 1NC1A 1VXRA 1ZG3A 3BWDD 1D09A 3GGJA 5K3DA 3PFKA 2ZVQX 3TIGA 1HT1E 2IOHA 4JSYA 2GDZA 1XNQB 5E4JA 3D7MA 3EYWA 3DUWA 1CEYA 4LVNA 3L7BA 4OHWA 3G49A 2AOTB 3GLHA 4PBSA 4XXHA 4B80A 3C24A 3KIPA 3U3KA 5DM1A 5G3ZA 3JWIA 4JI0B 1YR6A 3G79A 5A04A 5LZ7A 3OIGA 3Q0EA 4JITA 2C2YA 4UASA 2HSWA 1JDSA 1RR6A 1DBVO 1W19A 4AS3A 5A4JA 3OAAA 4PLTA 1ECFA 2O7SA 1KEZA 2Q9BA 4M2LA 1Z82A 2CBXA 1IM5A 5J2UB 2C8JA 1H8ED 4Y67A 4HQNA 3NRCA 3WL6A 1FP6A 1X1CA 5HYVA 3W34A 2VHEA 1DWOA 2D8MA 2HU2A 3ESZA 4IQ8A 4LBYA 3RRNA 2JI4A 5EJ9A 3OTWA 1WE2A 2ACKA 3BWEA 3HNRA 4OLFA 2WB2A 4XWYA 4PHTA 1U2RA 3KZCA 4G4GA 1POXA 4MP6A 3LYAA 3SKVA 4UBIA 4C29A 4F3KA 1BC5A 1TZJA 1LQTA 5AXAA 3OCWA 2QMEA 2WM9B 5I3ZA 5IU6A 4KHPB 2FZGA 3R1IA 4UVGA 3OFSA 3CBQA 4G5QA 3SS7X 2RHCA 2HKIA 4BKUA 4ID3A 4O4JF 1ZAKA 2D1RA 3DEHA 3RS2A 1KDRA 2JHPA 1TYBE 2O4CA 3BFVA 4DJTA 4JXKA 2YS6A 3TQCA 4KMOA 5J3JA 4K9PA 1BXZA 1F6WA 4WFJA 1EPUA 5BV1A 3CLSC 5P21A 1ABFA 4MYDA 5BV2P 2QL7A 1U3VA 4JOCA 5ALQA 4MB2A 4GM4A 3LPDA 3W9UA 1PGQA 2QZPA 1KEEB 1IPEA 2AJ8A 3N9IA 5JS2A 1I2BA 1YQXA 4UPEA 4P3YA 2IS6A 2X2EA 3CNEA 2H57A 1MT3A 2DR0A 4OJNA 3KQQA 4IV5A 4ZC1A 2D2EA 4KQKA 5H81A 5BSFA 1SHUX 1VE9A 4DKXA 4E03A 5A5VA 1S2NA 3TBHA 1YS7A 1WQ1R 3ETEA 3RJ5A 4BLWA 4M86A 1VKZA 4C0HA 3K8ZA 2XUFA 4L8YA 3R6GA 4YXFA 3KVVA 4BQPA 1QC5B 2R25B 4UBJA 5DK4A 4ZYXA 5K1ZA 1YOBA 2KI5A 2RGDA 3PWKA 4IIEA 1VJDA 4DRZA 4XZ3A 1J1IA 4IOJA 3BN3A 4I6GA 4PCLA 1QHFA 2VP6A 3R24A 4PLWA 3NHKA 1SU8A 2AJBA 1GNVA 4UDNA 4XJXA 4E33A 3A1UA 4F9GA 1ANKA 3T54A 1G4UR 3O26A 2Y0DA 5FJJA 6NULA 2PUWA 2ZWOA 3QTBA 4ZWNA 5HBRA 5EWJA 3RQSA 2B7LA 1Q21A 3ZCPA 5EWLA 2G9VA 1SCUA 1C7IA 2HNBA 5MGNA 2BRUA 4B4WA 3D3NA 2VYCA 1T5TA 1EWTA 2ZJOA 3SICE 1KQGA 2GHQA 1TM4E 1V7QA 3VR0A 4Y1GA 2DUNA 3GZ4A 5HBGA 4C3OB 2HCFA 4I46A 2XW6A 1AQIA 3KKLA 1GPDG 1Q0ZA 2W6PA 2YH2A 3EAFA 3KPJA 4L76A 4QE3A 4UNPA 5E6SA 2FPMA 5LM3A 4GP6A 3A06A 4HJRA 3COPA 1H3FA 3NHAA 2P30A 4Z0HO 3LQ1A 2CLCX 2H4YA 1EVLA 2FMUA 3SCZA 3AUFA 4EYGA 4UDOA 5AVWA 2M1XA 1W0JA 3DZIA 3UYKA 3T41A 2GYYA 4I1VA 1N5OX 1LVGA 4I4LA 2A9VA 4ISCA 1BG6A 4HTFA 1IEVA 1F48A 4LHEA 2JCXA 4XARA 1VL8A 3VBCA 2XRZA 4W6ZA 1ABBA 2G5PA 2W2LD 3UT6A 4IGIA 2VUIB 5DMHA 1IY8A 2UAGA 2WSMA 4PICA 5JY6A 2FP3A 4LF9B 4D82A 2AN9A 4JJGA 1UBOS 1B7GO 2V3VA 1RWBA 3RYHA 2BFCA 4M99A 1NUQA 3DFKA 3KB2A 3WA6A 4A82A 1GPAA 4LYDA 2YJ5A 3CPSA 3PRYA 4H4DA 4B43A 4H1HA 4L72A 1PUJA 1JYEA 1NV8A 1OXBB 3HU5A 1NP7A 1WV1A 2ROQA 1ZA2A 3ANMA 4RLFA 4XSVA 3EQ8A 5AK0A 3T94A 1PO7A 1R74A 3BXXA 4I3GA 1L4UA 3BRQA 1QZZA 3KDSE 3QG5A 4IRUB 3TI9A 1NXVA 3UWMA 4F0JA 5I4BA 4LKOA 4ZRMA 2ATVA 4KAFA 4BNUA 2UYHA 4ZEXA 4OJMX 4ND3A 4BKMA 1THTA 1GCAA 4B2IA 4CTKA 1X86B 3EPJA 3NHRA 4FE3A 3IOYA 1RJ9B 4B82A 4CQLA 1Z75A 1BX3A 4S1WA 3H9CA 3ZHQA 2MYUA 3ZHRA 3DA8A 4WEOA 3DDNA 5I45A 2RAPA 3IJRA 3OD5A 4KXXA 3F73A 5TS2A 1D3AA 1DLJA 5JWRA 5DCUA 1QCZA 3ZHOA 5IS2A 3UMSA 3ZJ5A 3TE6A 1QJ4A 4D2IA 4M1ZA 3FR8A 2GI4A 3QBEA 5F12A 4IIJB 4FFNA 4KV9A 3AJRA 2AXNA 4PPFA 2W2KA 4UHEA 4AN4A 3IQFA 3VR5H 1BOFA 1AQ6A 3LUDA 3LVFO 3LY9A 4TM7A 2QGFA 2WAMA 3A6GA 3D4NA 4UUNA 3ZGOA 1XKLA 1QVWA 1VB5A 1YT5A 1AS2A 4P1ZA 2F4VB 1UPTA 3RADC 3NO4A 4BPRA 1PTJC 3QY9A 2H18A 3EVBA 3D7RA 4D44A 4ZJPA 5LIRA 4HLQB 2WF5A 2XMZA 3DV2A 5J5CA 4ZZIA 1NJGA 3O4RA 2PMWB 1D7AA 1JYFA 2EYQA 2YR0A 3M4XA 4BLRA 1WB5A 4OX9B 2I5PO 3L6DA 1X8JA 3DZJA 3RC2A 1N5JA 1CULC 2NV0A 2R2GA 3QUTA 4IDDA 4AFNA 4MPRA 3FNRA 4JUIA 1UOOA 4LHVA 3LLMA 4MNTA 3SHVA 4D8WA 4DLLA 1XMPA 3GLFE 1XJ5A 3THRA 1XV5A 3BRWA 3K4PA 4MH0R 3V4VB 3SEFA 3T9AA 1ESNA 3GAZA 5ALRA 1O97D 1U5CA 1J70A 3P2MA 2OQRA 3O92A 1JAHA 2ECPA 4WE3A 2NU9A 5BT8A 4MKFA 1C1DA 3B5IA 1AGNA 3DR3A 2B2NA 2Q8QA 1B00A 4IO1A 5GWXA 2QD4A 3ZWYA 4AO6A 1E3JA 1E1RD 1F1BA 1EGMB 3PC4A 4EMSA 2IPMA 1KH2A 3SF0A 3CX8A 3IAXA 3JQ9C 4D8TA 4F9FA 4G24A 2A67A 1VJRA 3IT2A 3RS3A 1YFKA 4Y0VA 2NXEA 3BSSA 1I5RA 2DUWA 2V6BA 3AEUA 1ITZA 1KA9H 3BBLA 4W7IA 2GWRA 5H4HA 3REGA 3TTYA 4BLTA 1ZR4A 2UV8A 4GSLA 1AKRA 3E9CA 3PGXA 1C80A 2PX8A 1EFDN 4OFBA 4Q9DA 1W0CA 3KKQA 3TCNA 3A0UA 5E7QA 3OJFA 3TSAA 1SCBA 2QMQA 4URWR 1MAWA 4JLMA 4K0RA 3W3AH 2YWJA 3TZHA 2C9MA 5DHTA 3TXYA 5BNTA 5KX5A 1N8KA 3H2IA 4MUEA 3RK1A 3ZE2B 2ZITA 3TDNA 1SXQA 1NG1A 2H92A 4GXNA 1TL7C 5JI2E 4JJ4A 1VIYA 3HUDA 1TIBA 1FU4A 1VE1A 3GEGA 2EFCB 4KJXA 4CM1A 5JT1A 4TZTA 4R7GA 1NSFA 1D6SA 2W6ZA 5AKZA 3LRPA 4GX1A 3QX3A 4MR7B 3ZH9B 5M7EA 2QQ0A 1ULUA 4NYMQ 5SZIA 2QRPA 3CNLA 4WCFA 4A7PA 2FMKA 2GXUA 3OZDA 2EBUA 4RYDA 4X91A 3AVXA 5DLPA 4PSAA 3UAYA 5IW8A 1EVKA 3BJZA 3JAKB 5AKHA 4CKWA 1YR9A 2F3TA 4N7MA 3KDAA 3Q4GA 4DLYA 3PX2A 4IW3B 3PXEA 1GU0A 1ZISA 4C7MA 1FSSA 4C4ZA 2BMFA 1VCMA 1VMKA 2BD0A 3PYMA 4DMHA 1IUPA 1F8XA 3U37A 6CHYA 2BKAA 1T6XA 1JIJA 1M1XB 4Q01A 1GQFA 1ONNA 2OK7A 4EYEA 3DHVA 3HWRA 3GJ4A 5IZ4A 4UQOA 1D07A 1U3DA 2YUTA 4JYZA 6PFKA 5KPJA 4PAOA 2GCGA 3TRIA 4CLRA 1HDRA 4ISBA 4R1QA 3GLFA 3QKTA 1L1EA 2JJ1A 1CE8B 2CLIB 4IUYA 2QRLA 3RTDA 2QVZX 3G2LA 5ADHA 3M5WA 4LX8A 4PYMA 3WWYA 2XMSA 4TMTA 3A4MA 3ZLJA 3AFHA 4WUTA 4ZCTA 2ETXA 1VC2A 1KQPA 1V1MB 4LBWA 1ZZGA 2QRJA 5T4FA 1O95A 1R5JA 4V24A 3ZS9A 4LSZA 1YIDA 1XVTA 3GJ0A 3HLYA 3WNQA 1Y33E 1KFKB 4G41A 1BQEA 2CXHA 2RBEA 4URUR 2WF6A 3UATA 2OQVA 4AJHA 5BUCA 2NZVG 3SU8A 4AKTA 2BEKA 1T91A 3K73O 3BMOB 4I8XA 1U0OC 3CUTA 3C6YA 2ISSD 4X93A 1BN6A 2DFLA 3GVXA 4QX6A 1MFZA 1BJKA 3JV7A 3S2IA 3X1WA 1AA6A 3LYHA 2QTGA 5HM8A 1Q7RA 3G5LA 1PWXA 2R84A 1MB0A 2ZUSA 4HN4B 2GEUA 4XDHA 4Z9XA 1P19A 3VHRA 5CDSA 4OYLA 1JG2A 1HI9A 5I4CA 4WBXC 5B55A 5K7SA 3NOQA 3OM1A 5JNRA 3L18A 4C4OA 4L4XA 2IEBA 1Y5MA 4OATA 3OZWA 1HO3A 4PYKA 4DEYA 4X7PA 4X8MA 2BGTA 3RAJA 4X60A 9GPBA 1LWOA 3A9UA 2ZRDA 1HZJA 2BE7A 2XA2A 3ELDA 3ZJ4A 4AMUA 1OFUA 2ZB4A 4UVHA 4L74A 2HFKA 2HU5A 4NV3A 5I9BA 2Q28A 4UBLA 1HLFA 3RCBA 1H93A 1B0AA 5BWBA 1PJ2A 4BX2A 4PFSA 3B1VA 1SBIA 2REBA 2PHZA 3LHDA 4JT9A 2PV0A 3EF3A 4X7BA 4EMBA 5JE8A 1DC6A 1EWVA 4BO5A 4EX6A 1VIAA 1RCFA 4Y6OA 3R0XA 4WNCA 3HACA 3HCEA 4AKEA 4ZVSA 1QFZA 1YH3A 4H3SA 1E2GA 1UZNA 1U9JA 5ALZA 4YHHB 3EWIA 3T34A 2PXCA 3LHKA 3GXOA 5HP4A 1HDXA 3RIYA 4WNYA 5FWAA 2X40A 4JT8A 2HM7A 1G38A 4GECA 2PKCA 1PWHA 3DPIA 3NCHA 3D0OA 4PQEA 2UUCB 1XK7A 4JXZA 4JYMA 4QPDA 4ZA2A 1L4LA 1Q1GA 2OV3A 2PM8A 2PBRA 1NULA 2C1ZA 2X76A 3CB2A 4HNUA 1M1YE 5A4MS 1R64A 3PKJA 4YP9A 1WPQA 3GG9A 1QRUA 3IB6A 3AHDA 4ECAA 4ENPA 1UFKA 4FEYA 1LTKA 4KLAA 5IABA 2ZIGA 1O3YA 3LFHA 1NW7A 2KHZA 4WJZA 2CF5A 4IGEA 2ENUA 4W82A 4ZVNA 3RBZA 2V9PA 4Y8VA 3W1VA 3K0BA 4AWBA 3KSAC 5JMWA 2BE9A 3WBJA 3NHWA 4U1RA 5FQNA 1J2JA 1OGIA 3ICWA 1RWOA 3FGNA 5BSEA 2X86A 3C43A 4F1WA 1WXDA 3RSZA 3UK1A 3WYFA 5EHGA 2FWBA 1V43A 2JGDA 2ZRLA 2F2TA 1O0SA 3OETA 4P7JA 1HOTA 1JEEA 2WWFA 1VE6A 4ED9A 1UC9A 1U2SA 2EEZA 3A9RA 1UJ4A 3CUYA 3ME5A 3DBRB 1IAQA 1KJ9A 1RD4A 5A4FS 3PUJA 3J81k 2D7DA 2GHRA 5KQGA 2HC9A 3HZHA 3MRXA 3RSGA 4O2AA 1LX7A 5H3LA 4C03A 5JSUA 3RJ9A 2J9GA 2ZUTA 1H2HA 2ZBGA 4COOA 3TRJA 4W8GA 2VDOB 2VAXA 3ET4A 4FNAA 3QNUA 4FR0A 4EGJA 5K2OA 1W5SA 1AQYA 4UUMA 3JYHA 3QI2A 3AR2A 1JMVA 2JVJA 2CKDA 2R6R1 2XVMA 3QTTA 4LZNA 2KBFA 2G1KA 2YHSA 4UNSA 3SSMA 1CT9A 1G64A 2ZRGA 3G13A 2RH9B 3HKDB 4UD6A 2GJAA 5C4IA 5CDGA 1E2NA 3PFCA 4ERXA 3E7DA 1T2NA 4UM9B 4HBZA 1CJKC 1BD4A 1SWWA 2NTVA 5I9IA 3FVRA 2J4DA 3VDQA 1TJNA 1ZH0A 5IC5A 2J0UB 2VNHA 4EJSB 2VATA 4P0PB 4M9QA 1C8LA 4QHTA 3WLAA 1U9CA 4PC2A 4XJSA 1DAOA 1BNCA 1DCFA 5CB6A 3C3CA 4R1LA 4JB3A 1I7QB 1Q3TA 1CUAA 5FD8A 3LCCA 5BSHA 1ZH8A 3LQFA 2J9RA 1EXNA 5DNWA 2GF0A 2H4FA 4RK7A 3STTA 5EHZA 3ZD7A 2PWYA 4LOIA 5C32A 3A25A 4H4CA 2GPBA 4HT3B 3LWNA 5F23A 4IDOA 4ZYUA 2FRDA 5KUTA 3K0AB 1EDOA 3NDRA 2I62A 4G86A 1M1YA 5B53A 2V65A 1RZ3A 3N2ZB 1K63A 4W1SA 3JWEA 5DHFA 3I42A 4WEQA 3DZ8A 3MAGA 4MV9A 4XX0A 3UN1A 1YE3A 3GCXA 3U4QB 1B26A 2W6JD 4RKYA 2BJWA 2YJ4A 2NVUA 1O4WA 4MV4A 3UFXB 2MU1A 2XVZA 3ETDA 3RW9A 1OBHA 4IUDS 3SJBA 1QPZA 2XUPA 1M2EA 4KQJA 1Q1BA 1ZHHA 3DXZA 1D7OA 2PA0A 5HFAA 1NNI1 3ZVKA 4Y9RA 2LDXA 5BSUA 3PGLA 4XVRA 1QZ3A 3TIVA 4NCIA 5IXSA 4BO3A 5LQUA 1OYVA 2NV2B 3PNQA 1JXMA 4NE2A 4CDNA 3H0EA 2IY7A 1XRQA 4QAQA 5DV9A 1LPOA 3U3DA 2IKSA 4JNCA 3IP9A 4H77A 4F2DA 4JBXA 1Z7EA 2JAPA 4ATNA 4OLAA 4MEBA 1YDFA 3NCTA 3GJRA 2R96A 1N2CB 3KBOA 4I8IA 3M3DA 2XZPA 3AR8A 1NF8A 1RIIA 3MMXA 2AOUA 5JPDA 4RQUA 5IT9A 3NHMA 1BYIA 3KTAB 2H2WA 4FYYA 4M1EA 5J4LA 3WV4A 3JQBA 1CZUA 1GT6A 2B8WA 2XZOA 5DHRA 1DOHA 1J8VA 3A0RB 5EZSA 3C6XA 3I53A 2WD7A 5E8RA 1LNSA 3EGOA 1XTPA 3R3VA 2OGZA 2ZUBA 4IVQA 3QWAA 3VPHA 2H1FA 3P0IA 3DYIA 1X2BA 4NPCA 3ROQA 2F8TA 2ZUVA 4EY6A 3NEPX 1NQWA 1NBME 1CJCA 1QVRA 1T1SA 1YJXA 2Y67A 3UOGA 4YT8A 2IFTA 1PYDA 1WX1A 4CTOA 5TIIA 5FUBA 2CJXA 3DO6A 3DGEC 4GOLD 3TSYA 1SPXA 4ROSA 1FIUA 1V8OA 1QHIA 3JX9A 1W46A 4EAQA 3ODGA 2P77A 1JG3A 4Z3KA 3ONEA 1XZJA 5KNCA 3NM4A 1Z0IA 2C2GA 3WSVA 4M9RA 4UQLA 3A4TA 5K8VA 2G72A 1JIKA 4MPDA 4QPNA 5M04A 1VPDA 2B2XA 3RC7A 4YQFA 3MLAA 4BJ1A 1BYUA 2BHLA 3GMDA 4EPWA 4QOHA 1MU0A 1Y9AA 3G68A 1H5NA 4DCVA 3TIXB 3VHQA 4JUFA 1O7JA 1DFHA 4EBBA 2C57A 1NHGA 1SBNE 3GOQA 1MJFA 5JCXA 1G6OA 3DMTA 2YVLA 3ROZA 3KXIA 4LSWA 2OFOA 2WT4A 1M8KA 5ALXA 3ABQB 1M6HA 3DAPA 5DBGA 5FBRB 3VPSA 5KYYA 1D2RA 1TU3A 1EXVA 2A2ZA 2Q7OE 2VTBA 1OFVA 2BFDA 2OXEA 3OQIB 3UW3A 1XRJA 3I0MA 3V4FA 2O3UA 4BNIA 5K3BA 2NZUG 1X70A 1J00A 4HAIA 4W9NA 3WK5A 3BWXA 2GVNA 1F0YA 5LQCA 3JQ7A 1VQ1A 2NO6A 1NONA 4Y7DA 1FPQA 3GUYA 2VPYA 5KQLA 4ER7A 3L0ZA 4EIWA 2OENG 4F5EA 2NU7A 2JGAA 3P9KA 1ZCBA 3OFJA 4X6UA 2XUZA 5EESA 3ZY3A 3NAZA 4TWIA 4WFKA 4M0PA 5JNUA 5FP0A 4RIIA 2JIPA 1L7BA 4OGLA 4CHTA 5KOIA 4W99A 2ET6A 4GI3A 2PH3A 1G19A 3H5WA 2QZJA 4RDCA 1XZAA 4K88A 2QZZA 5K0NA 1O1YA 5TE9A 3ZCRA 4EDFA 1C7FA 4NMWA 3P45A 2QMHA 4GX2A 3KE8A 1NBMA 3MQ4A 3U7IA 3AM5A 1OU0A 1QOPB 1TUBA 1XRNA 2G0AA 2GO1A 2ZREA 3LS2A 4MMYB 1R4ZA 4PONA 4GLBA 3SC3A 4Z7QB 5CDTA 2M32A 1JE1A 3DEKA 3PNLA 3UCFA 3V34A 3B89A 1NLZA 1L1RA 4HB2A 3RVPA 4BEBA 1J7KA 3QEMA 2Y2VA 3COWA 1RXSA 2B35A 5CBPA 5BOVA 5IULC 4CEHB 2GJ4A 2IPNA 2PGJA 3BHNA 4POAA 1A5SB 3VC1A 1GNRA 1RI4A 3KYJB 3VSCA 2Q5JA 1U6KA 3BRSA 4QVGA 1KY4A 3CX7A 2R6DA 1QGYA 1C4WA 4F8EA 4PM4A 4HLCA 2H5JA 4MUIA 4UKDA 3ZH2A 2P41A 2VJLA 3FPSA 5FL3A 5TMBA 1BDJA 1E1CB 3TRKA 3I30X 4E12A 5T67A 4LG1A 3S70A 2DWPA 1WDTA 1ZO8A 2W2PA 2ENWA 2X8AA 1RI3A 1G98A 3SOPA 1PT7A 3R9XA 2ZT5A 3TINA 3PXAA 4IS3A 1UMBA 4DLSA 5COAA 4NOMA 5FPQA 1DKMA 1THGA 1W2GA 1WDLA 3WKEA 4BFCA 4XVCA 2QU7A 2VCHA 3E8SA 1ZUD1 3GT3A 1AV7A 2Y76A 4UE3S 1JG1A 2XNSA 3B12A 1XVIA 3UV3A 3UWDA 4F5DA 4G0UA 4LZOA 4UHJA 3SKYA 1CJBA 2JJQA 4ZKEA 3PUKA 4FWIB 1C1YA 2PUVA 4IAOA 2Q9CA 1OZ0A 4MITA 4P4NA 4WADA 3QH4A 2XODA 3GFVA 4JB2A 1Q44A 1W1IA 2NXWA 5BN3B 3I3SR 3SVTA 1WXIA 1Y9DA 1GDHA 3GPCA 1EM8B 1ZM2A 3LCRA 3OCZA 5B1HA 1ZOIA 4RZ3A 4Y2SA 2FGJA 4RELA 3WIDA 2JASA 4PG8A 2QN2A 4JK3A 2OO5A 3PFFA 4GLLA 3WLKX 1D2AA 4EG6A 2FTKE 1ECJA 4RA9B 3CVJA 1ISGA 4FNMA 2VNAA 3CN7A 3PC8C 2C9BA 4WKOA 4WN9A 3CRZA 4ICIA 4PYNA 3WBFA 3VPXA 4G0QA 2QG6A 2XUKA 2AHOA 1P31A 2A1TR 3M1LA 2RBGA 3GXBA 1JV2B 3E5NA 3OQJA 1Z0FA 2BKUA 3NHBA 1Q17A 1QRRA 3SQXA 5TF4A 4EW2A 2N47A 3DVAA 2OOSA 4EPVA 5KWVA 4FK8A 5HCIA 3WL3A 4DG9A 1QKIA 1FNMA 4TYMA 4O3MA 1Z33A 4PHFA 2VH2A 3EISA 1V11A 3WMRA 5CHYA 1NRJB 4ZANA 3SG0A 3BD6A 1ZITA 3W2HA 4KK4A 4WH0A 3OZ7A 1XAIA 2Z9CA 3UM9A 1N1GA 5EPUA 1A2OA 3FBTA 2G67A 3HR4A 5DLQC 2PUEA 4B6EA 2O8EA 1T8SA 4PSDA 2WJAA 1U2DA 3VH3A 1G0NA 2XTZA 3EUWA 4G0XA 2XD4A 4RTRA 2O06A 2W90A 4IL5A 4N5HX 5B2ZA 4AUKA 1R5NA 2F17A 1G20E 1XL1A 1A9SA 3QJ5A 3ELBA 4YI3A 5LD2C 1T6NA 4MW0A 1NTRA 5LP6C 1XHLA 1NMQA 2HCTA 2ZIXA 1Y3HA 2B1IA 1C0IA 3W5VA 3MYYA 1X7GA 4YJKA 3NQ41 3LLUA 4B4KA 3LQ2A 3M3HA 2OLKA 2X22A 5EXXA 3OESA 4YJ3B 1WNFA 3DBVO 4NJOA 3OQNA 2YCBA 5H8WA 1JTVA 4JFAA 1Z26A 4P34A 5DYNA 1NUPA 2NQ8A 2QPTA 4IBOA 3UMRA 5LWQA 4C3VA 5D1NA 7REQB 1QB8A 2QTWB 2WNHA 2RHJA 3HFJA 4GOMD 4N3GA 4URXR 1G3UA 4UBMA 1DJMA 3THSA 1O5TA 3L05A 3PHBE 3GJ5A 4FZVA 4PQGA 1CV2A 4A73A 4C6SA 2AC4A 3BWCA 1UWLA 3QF4B 3HA3A 1ZK3A 4Y1RA 2JCSA 3DNFA 4UAGA 5EFZA 2FPKA 1UBTS 3HGQA 1NXSA 1T4GA 3JARB 1BKYA 2CNWD 3C4VA 3H8WA 4C0SA 3C6MA 3JZFA 4QYSA 4UUPA 2ZUEA 4ND8B 1DDOA 2GN9A 2YIMA 2X4GA 2ZT6A 4X94A 1QV6A 5FORA 1G3QA 4YLGA 1YVRA 4G0NA 3BHJA 4XVHA 1SEVA 2C1XA 3ZBPA 5U4XA 4YMHA 4J4HA 2F8MA 3R8XA 2NO0A 1SNYA 4TLDA 5LQSA 4BLOA 5KYWA 4LRWA 4L0MA 1LQUA 2I6FA 3Q8WA 4C0QC 4MWTA 2WU1A 1EB8A 1VKJA 2BELA 1ONPA 2COUA 3ROKA 5IAAA 4JAVC 3K9NA 2J0EA 2J3QA 4Q4AA 4RLSA 5DCLA 1J0AA 2JIOA 3ECAA 2ZIWB 1WBJB 4INZA 3A6FA 5G4LA 4JVLA 1ZCJA 3NOXA 3IKLA 4OK6A 5A4DA 1TEXA 5DHAA 1KVUA 1DEKA 3E9QA 2FSIA 5KWJA 2G1PA 2QM8A 2X5NA 3G5MA 4XI9A 1PR1A 5LYJB 1UL1X 2C5LA 4OA8A 4WI1A 1LW6E 3PNPA 4LRSB 3ZIAD 5JCOC 2GK3A 2RHDA 4KGVA 1G20A 1MJ5A 1NPDA 3UGTA 1SOMA 3IIMA 1XQ1A 4LTMA 3RO7A 4B32A 2F1KA 2ZYSA 5AHOA 5BW5A 4X7RA 1OFTA 4LWOA 1IY2A 4EWLA 5BPHA 2H4JA 2PGOA 3K2EA 2HBYA 1D0VA 2OCGA 4QARA 4YCMA 4BB9A 3KFLA 3LX5A 1DCMA 2NM0A 1OCEA 1U2GC 1L4HA 1CCWA 1Z5WA 3QPUA 3SAJA 2IV7A 1X15A 3CPHA 3CW9A 5B6IA 5FR1A 4A2QA 3H18A 4JODA 4EG8A 4NYJQ 1DADA 2ES4A 2O3QA 3EFHA 1C3OB 3PT9A 3FTEA 4W9MC 3HG7A 3L9XA 3TJMA 2MDTA 5KU7A 2P9TA 4DA4A 3RIHA 1EM6A 3VNVA 1WHSA 5EP4A 1WSBA 2Z4RA 5F98A 2ZYIA 4ZT6A 4ZV9A 2YBEA 1N36B 4WIAA 1BGXT 1S3SA 4Q3BA 1HRKA 5CT6A 5DIFA 5AWFC 1VL0A 4INPA 4JR0A 5SY9A 3WQBA 1DKRA 4DKJA 1V71A 4RU1A 3RT7A 4MDFA 4XVQA 3HKBA 4C01A 2VDUE 1M2OB 4DZZA 3E82A 3HJHA 1NVXQ 3IEKA 4JLUA 4YRTA 3RYIB 4MHTA 1SVLA 1HNXB 2QG4A 2A9JA 2Z6QA 3OY2A 2R1TA 5KYGA 4AKGA 2R48A 2YMLA 3I04M 3OZVA 1US8A 1QTQA 3FRIA 2H9AA 1U8EA 3TD6A 4W1RA 4ZAGA 1GGMA 3AHEA 3HDGA 4O25A 3M0EA 3SHTA 2R60A 2E4WA 2Y0CA 1SG6A 5CK5A 1QFJA 4ALNA 3NVDA 5AVZA 3LX8A 2IYLD 4EK9A 3UGJA 3U44A 2I6UA 3BA6A 4Z51A 1QIFA 3N0RA 4JP8A 3Q8KA 1FK8A 3BF7A 1IBLB 4C76A 4ZPJA 3B6JA 3TL3A 4M8NE 2DPLA 4KO4S 5LJIA 4XQCA 1TLFA 2Z09A 3EXHB 1RT9A 4O4LA 4II3A 4KLNA 3FCXA 3SZ3A 3N2GB 3K0FB 4V39A 3THXB 2JLVA 5AVTA 1EX9A 3DVSX 3JQAA 3KZOA 4HDKB 3HUTA 3ZY6A 2EVWX 4G81A 1AMOA 1MAAA 1N1MA 3KLBA 4UNIA 3KSBC 2GBFA 3FTCA 2XCUA 3NDJA 4LIPD 1T9GS 2NZXA 2QKYA 4X92A 5SZKB 2JAQA 3D3QA 1ABEA 3IV9A 4CT0A 1DBIA 1GEGA 3E70C 4G1MB 3SFTA 1HEUA 2HGZA 3U6BA 1C8BA 2IYQA 2JFHA 3G82C 3KBBA 4CV3A 3EOBI 3DLIA 4PSCA 2DUMA 1PHRA 2BGMA 1VL5A 1MT0A 2H08A 2OT3B 2W43A 1Z29A 3A31A 3HDYA 5AO9A 2OUKA 5FA5A 4R84A 5LD2B 4R1SA 5E0OA 3RVLA 1K7YA 2R8PA 4A6PA 2C2MA 1B0UA 3AEQA 2PX6A 4ZQEA 3SJ7A 5KYXA 1AK9A 1SELA 3ELYA 4X1YA 4WZAB 3O8QA 3OC6A 4XUCA 3WAJA 3HVJA 5JU6A 2F8SA 1DBPA 1W47A 4BNXA 2GGSA 1XZHA 1AS0A 3PRHA 5CW2A 1I2AA 4R2IA 5FPHA 1C4OA 2QTLA 4UHHA 4V02A 4MW9A 3LC1O 1F38A 1WO8A 2GPAA 4QBKA 3ZYZA 2MSKA 1BFUA 4OVKA 4JUAA 3KHKA 3UHJA 3D54D 3MMZA 3MELA 1PR6A 1OVGA 4ZALA 1R5OA 3E61A 3WL7A 1Y7IA 3QU7A 5KTRA 3DLPX 3ANLA 3H2YA 3K5HA 3OX2A 1Z37A 1C4KA 3C3PA 3UA4A 4AMGA 4ZMRA 2ZLBA 3B3FA 2CL0X 1NP3A 3GY0A 1QANA 3L49A 4XQGA 3TB4A 3TZLA 2VP4A 4D6YA 3FAZA 2FRVA 2POCA 4FGWA 4FUTA 3AUTA 3V4LA 5J63A 1QG4A 2D59A 2P5SA 3QF7A 3LTEA 4A0GA 2XZTA 3F8SA 4LGVA 2FQ1A 10MHA 4Z1OA 2XNDD 2C83A 1GGVA 3H75A 2WLSA 2C5HA 4U5QA 3G2NA 2IY8A 1I2ZA 3IRUA 4BMCA 5KJ6A 3VKGA 1J2EA 4PIVA 3PKIA 1U1FA 2Y9PB 3AGQA 4BTLA 5A06A 2QHXA 3RSOA 2Z08A 3F1KA 2VSQA 3EG5A 2NPFA 3AVWA 3FSJX 1Z15A 4AO8A 3DDWA 1PL7A 1A1SA 4QZVA 3KJFA 1O0CA 1VE5A 3O82A 1TZ2A 1J1UA 2EARA 1DGQA 1WMFA 4YECA 2K7ZA 4CQMA 3PHJA 1OXSC 3RS4A 1PNOA 1MC5A 1YTLA 2CHGA 2ZSBA 3BZWA 2DY0A 1A8UA 2R97A 1GRQA 1UK7A 2XOKA 3I1FA 1Z2EA 1WCXA 2QGZA 3DEYX 1IOLA 4J0KA 1EHYA 3T5TA 3GX1A 4OAPA 1RQGA 2C7RA 1E59A 4KO2S 3IUJA 4YB8A 4BY9E 4TZ6A 3SX4A 4PRKA 5SY6A 2ZRFA 1TGVA 1G291 3NHLA 3AVVA 3I9MA 2JEZA 3N59A 4ENVA 1UMDA 3A32A 2ZBFA 4TVSA 3ZJUA 2XQVA 1RXIA 3GWZA 3NDIA 4LGYA 1XROA 1YQQA 2OV8A 1NIJA 2B34A 1MV5A 2JLSA 3D3WA 3NUGA 1HE1C 4BMYA 4DCMA 5C5DA 5LMUB 1LW7A 1X1AA 2SKCA 2YNMC 3PEFA 1OPXA 4H6XA 1L5GB 3H19A 4TN5A 2WWTA 2D1FA 2Y1CA 4PX5A 5LQKA 2P79A 1DZ3A 2EQ5A 1M34E 2B2CA 4M1OA 1RKBA 1OLUA 2N3ZA 1GPH1 1C81A 3B1YA 2QN8A 4M55A 1GN9A 2KMLA 1V6AA 4KXQA 4MQUA 1H23A 3A9WA 3I2YX 3N0XA 5IEBA 2EBFX 1RTTA 2VDRB 4GI7A 4JB8A 2RGUA 2CUTA 4KBFA 4ESEA 4QJIA 2DQYA 1H2WA 3MGCA 5GQSA 1WMDA 1XQ6A 1R6BX 4MS3B 4EFKA 3IB3A 1ZFNA 1ZGCA 4EJMA 2DPGA 3Q5EA 3EIUA 4UMDA 2IHBA 1OIXA 1Y3IA 2Y1LA 1D6JA 1Z4NA 1RYYA 4PPNA 4LECA 3SQLA 3SZUA 3AFMA 4DDTA 3QMWA 3DFZA 5HK9A 2FUEA 4LZLA 1RJFA 1Z12A 1U0FA 1ZQ9A 3FKSA 2IDJA 4OG2A 4O1HA 1P1HA 4PHCA 4PLYA 5DBOA 1UXOA 1E96A 4P22A 1J20A 1YASA 3JQFA 2FE1A 3L01A 1CU1A 3T3HA 4XH9B 1LDMA 3K2QA 4ABTA 4QTYA 4F5YA 4LNUA 1ZVVA 1M6VB 1N6NA 4I08A 4OKIA 1PZGA 4MVJD 4UM5A 2AB0A 3G2KA 5LU9A 2AE1A 3ESRA 1BEZA 4ZAVA 1COWA 2FZLA 5G0UA 4H59A 1GKYA 4O4IB 3N6VA 1YTUA 4JHXA 1K06A 3V32A 2R62A 1UBRS 4JXXA 1PNTA 2RB4A 4DIMA 2BN4A 1FYWA 2ZJ5A 3AF2A 4BO6A 5K20A 3HKEB 3JSXA 1CYDA 5KCMA 1NVGA 3LX6A 2BFBA 3DZDA 3QKSA 3T3GA 3DJFA 5B1IA 5EPOA 3THYA 2YJGA 4Y2RA 1FTQA 1VA4A 1J0BA 4KRGA 2I3GA 3VDXA 5EKUA 2GFHA 4S3MA 4NU6A 4V2IA 4LDRA 1MAHA 1EK1A 3BTSA 1JWBB 2XKAA 3KCQA 4HGQA 2A1UA 1TA4A 13PKA 2J3DA 1IWBB 5BSGA 4MUKA 2A5FA 3B9PA 3CE9A 4NJEA 3TVDA 1C9DB 1II8B 2GZ3A 4G0ZA 3ZV3A 4UHBA 1XLVA 3AEKB 2AV6A 5TARA 2ZRCA 1SUEA 2WHPB 4ZVVA 3A6LA 4L9AA 4V0KA 5KX5F 2QDKA 2RK3A 1Q0RA 1CLEA 1XTUA 2ILVA 2Q1YA 3AZQA 4HAWA 8MHTA 1COZA 5BVHB 2E7ZA 1PG2A 3EX7C 1ZJ5A 2IKQA 3RUHA 4G5XA 2EWMA 1EHIA 4UNQA 3SR4A 4LOKA 2J0SA 3IAS6 3L46A 4XRRA 2ZRQA 1WMBA 2W93A 3C45A 2QX9A 3EHDA 1YDWA 3KQHA 3KB6A 1QZTA 4EVQA 2Q9AA 1PZXA 2OP0A 4HRXA 4PPGA 2JAUA 1MO6A 2C8VA 1QP8A 3AVQA 1Y8QB 1T2FA 2AI3A 1FSGA 2EFYA 3BIFA 2VDWA 2JFOA 1H65A 3AKYA 3DB1A 1G9TA 2GD2A 2WDZA 4NYIQ 4OGWA 2CVHA 3T1VA 3KHUA 2OGTA 5KI6A 3ZU3A 2C3PA 2HDOA 2YYAA 1YDMA 5FHRA 4E1AA 3AY3A 4FX2A 5EZYA 4CQNA 4F7DA 5BQXA 3NAMA 4WW0A 3HO1A 2ZSKA 4K6KA 4KV7A 1TO6A 1USVA 1SN7A 4QWMA 5DASA 4Z7NB 1W88B 5JQGB 1ADGA 4HWRA 1I3LA 3HN2A 4XM0A 5HGXA 3GA5A 2C58A 2PUFA 3BCRA 5FO0A 1JWAB 3LFTA 2YWHA 3UK2A 1GZ3A 2VWGA 4I2NA 4CUJA 3EXFB 2HU7A 1T5IA 4JSTA 4GSKA 3BYZA 1U9IA 1XVAA 3NI2A 5E1OA 2BYTA 2VOEA 3CMCO 3E0XA 2Z5FA 4MWSA 1UF9A 2M6RA 2VJAA 4U9IS 5B3JA 3ZCTA 2ZIZA 4EUEA 3ESAA 3CH5A 2RC6A 5H1YA 4NBWA 1HT0A 1Q15A 4HYYA 4LJ6A 1KSHA 4S2EA 3OZUA 5JPIA 5K99A 3V8QA 3PQ2A 4HSEA 4X61A 4JQZA 3SYNA 3JASA 3NJ8A 3P9SA 4L9SA 4ESOA 3GLGB 4UNRA 4U5XA 1CUYA 2X8WA 3MJ4A 3NWBA 2WINI 5IC4A 421PA 1GKLA 1YA4A 2J5RA 1R3DA 1RI5A 4YVFA 2RAVA 2PMBA 3VA7A 3GT7A 4MV5A 4UAVA 3RV4A 1T4CB 5BSMA 3TQRA 4NS1A 3HI4A 3HBJA 3MCTA 4D6XA 3WR5A 4L7VA 2X15A 2YW9A 2YWEA 3W7VA 5BN4B 2NUPB 1I33A 2IU6A 4URFA 3RHZA 3PD7A 2WFLB 4MYHA 2I3BA 2COEA 1XTIA 1CQIB 1XEFA 2BEUB 2R66A 5DSTA 2PBZA 3I4LA 3ZDEA 1CY6A 1DFGA 1DMRA 1FRFS 4O4JB 1ZN8A 3MMNA 3SY8A 4YGYA 4PNHA 1A8QA 4NCNA 4TSFD 1VSBA 3D81A 1TFUA 3Q3IA 3UMBA 4BVEA 1M0WA 5INTA 4MXDA 2QM7A 3PENA 1Y1SA 3H8JA 4CFZA 1J5XA 1E8DA 3WO1A 1YF3A 2JFVA 3LSYA 1GIAA 1E6MA 2I2CA 1K75A 4GMXA 3OOSA 2E4YA 2GUWA 4R2XA 5K0GA 3DR5A 4PV7A 3LF1A 3LOPA 4BVKA 3D4PA 3AQ4A 4PO1A 2JDIA 2CYAA 2QM3A 1T9CA 5JJ5A 3KUCA 2C2WA 1IC6A 4MTCA 1JI3A 1SUCA 3RU7A 4BV9A 3UJDA 2Q3HA 1U04A 4QQKA 5EIBC 1BS1A 3U09A 1JWLA 4YRSA 3G2OA 5TEWA 1A95A 3UMGA 2PH1A 2PX2A 4QDOA 5E2IA 1YCDA 1E2LA 4U4AA 3ZHYA 4GM1A 4US0R 1QG0A 3WFJA 3VNQA 2RH8A 3IT1A 2A0FA 2MSEB 2WJWA 4OKSA 1UJCA 2L2QA 2ZTSA 2I8LA 1JIUA 4H2DA 4H0NA 3VNBA 1QDLB 3HJRA 4OMFG 4ENTA 4ZVTA 1N0UA 3KSUA 3TL2A 1OI4A 2ZIVB 3H13A 3QXSA 3FSGA 4RZUA 1B0ZA 4ZO4A 3LF2A 3HADA 3DTYA 4N5MA 4D9HA 4Q1AA 4PYJA 2AC7A 3IKTA 2HLHA 1Q91A 2PUTA 2IGBA 3OEED 1SBZA 4Q3CA 3ZZUA 4BB6A 2HA0A 1T2CA 3PQ6A 4JU8A 3QHQA 3ZK9A 4B48A 1QHYA 2FPGB 4PQFA 5IWCA 4Z0PA 3CJRA 5A9RA 3TEJA 5HQ3B 5KVSA 1YJ5A 2J45A 2HAEA 5HMLA 4DEXA 2VDNB 4NAHA 3CLSD 2FUCA 4BMNA 1KRWA 3Q0TA 1GNSA 1ZP6A 3I1JA 3WL4A 1L4YA 3AKEA 3M8KA 4N5IX 2OZVA 3WHKA 5CH8A 2OGSA 1L5YA 2A78A 2ASEA 4QUDA 4RA6B 3E1GA 5HILA 5JXJA 3C1AA 5JEDA 2QJRA 2CDCA 1T3HA 4BRUA 2YXPX 1Y3AA 1Q83A 3KKZA 5F1YA 3ZDXB 3GBVA 1IUKA 3K15A 4O2AF 5ILQA 3VVCA 4I1UA 2WY2D 2QV7A 1HL3A 3GPLA 4HEHA 4XQEA 1ODKA 2YHUA 2WNSA 4QULA 4MJ3A 2IJGX 2OWDA 5AJZA 1KP2A 4LYGA 2Q41A 2C95A 1MO5A 3EXEB 4HLNA 5GJBA 1NI5A 2VP5A 4F8JA 1CRPA 2VBCA 1PCXA 1K97A 4ZYLA 5H68A 2Z8ZA 1YHYA 5ITVA 1JMYA 4LWQA 3SHOA 1CB0A 1PJ3A 1E2PA 3HJNA 5AVKA 3PFGA 5AXBA 4BVGA 1DTSA 5T4HA 2XMQA 4EAAA 4JOSA 1X0VA 4TRRA 3BGVA 5AM0A 1BMDA 3FUWA 4HUJA 1G8SA 3ZHTA 1Z07A 2W83A 2BGIA 4MRSA 1XTRA 5DI9A 3FOEC 2ZCJA 5IRCD 4BO9A 3T61A 4OQQA 4DVGA 4DRXB 4W6QA 4ARCA 2X0KA 4Q9AA 1G5QA 3QTLA 5F7ZA 4ENQA 3UPUA 1GN8A 2GM4A 4IY1A 5LLSA 3WMWA 2C0QA 1RRGA 4GPZA 1XN1A 4C87A 4LDPA 3SFZA 4PAWA 1SWVA 2IS4A 1CR2A 4QWWA 2VQFB 3JY6A 3H97A 4U7FA 5IN5A 4CJXA 5ALPA 4CM8A 7GPBA 1I4WA 5CAEB 2JLWA 2XQIA 5DHPA 2ONZA 4NHEA 4Z86A 5TX7A 1IQRA 5ARBA 3ZW7A 3HYLA 1CRLA 1PZMA 3KT6A 4L27A 2APJA 1Y7PA 5JADA 4TKUB 5GONA 3VQTA 1G63A 3ORYA 4PYIA 2DPHA 2Q4TA 3KV3O 1FRVA 3FJYA 4R1PA 2CCKA 4L4RA 2CKMA 3MJSA 5DSZA 4BQQA 1O0BA 3RSSA 1ZU5A 4AL4A 1JEJA 3FZQA 5GVRA 2ERXA 2P9FA 3CPEA 1XQWA 3VPBA 4ZU6X 1N6OA 2OC9A 5KTKA 1ZZEA 4B7ZA 1M6NA 1U5BB 3WWZA 1AE1A 2IC5A 4C4SA 2XB2A 1Q1ZA 2D5AA 2B4QA 4KH1A 4GDMA 2GHTA 2XCIA 3CWQA 3QXJA 1CF4A 5C46F 4GMKA 3LUBA 4I1IA 5HIJA 1M1NB 1E3MA 2B3TA 1UK6A 1ZI6A 3C4QA 4AAYA 4MWDA 4ZGWA 2GMWA 1R0RE 1K6IA 3LPAA 3N05A 4CMEA 3TUZC 3E15A 5CVDA 4Z9YA 3DMFA 3TLYA 4LGCA 1AVTA 2O3SA 3G89A 4LTNA 1T3TA 4HLUC 4DC1A 1QRSA 4OQZA 2UZ4A 1TM2A 3HHEA 2PLFA 4R4JA 3DEFA 5DB4A 4AZ3B 4HFJA 3AI7A 4HN2A 4N0MA 3VZPA 4MIOA 2IP4A 4ZDIA 2PUHA 5F5LA 5IK2A 4D4LA 4UU8A 3S1AB 3NDPA 1DU4A 2QVCA 5K3EA 2PL3A 2WWRA 1C8VB 2ZYRA 3KT3A 3L4BC 3SEAA 3SXUA 5JG7A 3B20A 2EWVA 2FFHA 4HAYA 3C41J 3N8NA </