5H9WA

Crystal structure of regnase pin domain, form ii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Ribonuclease ZC3H12A
total genus 50
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h9wA00
5H9WA 3V32A 5FT9A 4G24A 4G26A 4G25A 3V33A 5DIZA 5H9VA 4G23A 3V34A
chains in the Genus database with same CATH superfamily
4QQKA 1JH9A 4PYOA 2DG2A 5TY0A 4WY2A 2JLYA 1EM8A 4KQIA 2GB4A 3GEIA 1EK6A 5DYTA 2V3VA 5DM60 3A6DA 1A95A 3HYLA 5FHQA 3GLHB 5JSZB 3EWAA 1M73E 1E1YA 1HETA 1KI6A 1Q22A 2ZYDA 4ISCA 1N9KA 5DBHX 4UOZA 5HJ5A 1POXA 2O48X 2V65A 4UCWA 2V7BA 3A4MA 5DT2A 4EQZA 4F5EA 2IUSA 4Q7MB 3R5JA 2EP8A 3K0CA 2CNKA 4M9QA 3FZNA 2YXDA 3PENA 3M6UA 2PKRA 2Q1YA 1KP9A 3DPSA 4XUGB 3V1UA 4FWTA 4BGDA 1GA1A 2XF2A 4EFNA 3SQWA 1MB0A 1DBIA 1GQRA 2APJA 1PDVA 1C30A 4MGZR 3PKZA 1SB8A 3TF5A 3UV6A 3ZJVA 1Q44A 4QRHA 1FJGB 1J24A 3UUFA 5GVSA 3KETA 5CM2Z 3IMCA 4BN0A 2H08A 3LL7A 1RYZA 3D64A 4HDMA 4RWZA 3R76A 4RSRA 1KZ1A 1U1DA 3WR5A 2IPNA 2DHQA 3U7QA 2GBGA 4YJ3A 4BVAA 4G86A 4P5DA 2ZT5A 3O1LA 4N9QA 2KYRA 1OIXA 2QZSA 2YYYA 1OXVA 2WTXA 5JO9A 1YC2A 2YYZA 1C1DA 2BI7A 2UZ3A 5AHRA 4RVDA 4CL8A 1EM8B 3DNMA 1EU1A 1VL2A 1JR3E 5AW9A 4FHEA 1G20B 3LP8A 4XIIA 4H15A 4AG5A 1QC5B 2DXIA 3KEMA 3UPDA 4RKRA 5TJ9A 1W35A 3RSFA 5SY9A 3PNOA 1KRWA 2HXSA 1PJQA 4OQFA 1NXOA 3QG5A 5EIAA 3WHLA 1O6FA 3AEKB 2IITA 2QUZA 3OA0A 5JIBA 2HWXA 3LU1A 2EJWA 4HSEA 3NM6B 1X14A 1E2KA 3K9WA 1QOQB 3LPCA 3BA1A 3QXXA 5ESWA 2X1HA 3TLZA 4R9UC 5BXQC 3JSXA 3CVJA 3ZWXA 1CQIA 5AVUA 2H7XA 1W47A 4GYWA 2FJ0A 2CE7A 5F98A 1SOMA 1WB9A 2JANA 4IIEA 3HY4A 3H2HA 4O4IF 4I81A 4TTIA 1BXRB 1G0OA 1Z4QA 5K3FA 1F20A 3KKLA 5E6RB 4FDAA 4KFSA 4KQXA 4N0DA 4JI4B 2P2YA 3D3NA 4B48A 3EK2A 4BV2A 1ZNZA 4HWPA 4NV3A 1ZRSA 4RGVA 2A5GA 2OXEA 2GTIA 1VE1A 2JI6A 3EQZA 2Q3LA 3S1AA 1HQYE 1OW3B 1MB9A 3KKMA 4CFYA 1WXGA 2COEA 3NVMB 4CF3A 4OA5A 5ALFA 3K6KA 4HNGA 4EKNB 3V4LA 2PH7A 4FN5A 5DN6D 3T54A 4NIMA 1FZTA 1E98A 1O5IA 5FI1B 1W44A 4B9AA 3E18A 1FFGA 5L8VA 1XRRA 5LYJB 3DQZA 2XYQA 4EX6A 5LU9A 3T12A 2PUDA 5MF6A 3RF6A 4DYHA 4NQRA 1MGOA 4FUQA 5CJJA 2GEVA 1UQRA 1RM4A 5TS2A 2AOVA 4J94A 3HBJA 4NMWA 3V1YA 3HDJA 1XD8A 4FCVA 2UV8A 2PNJA 2QZPA 2X0JA 2GZ3A 4QGSA 1ZSNA 3Q3CA 2EF0A 3PGVA 5EGNA 1HDIA 2B7LA 4JP1A 3JATB 4M6WA 1OPXA 1ZIDA 2AC7A 3UUEA 1AC5A 2W8ZA 2FLKA 3WGNA 4H6VA 4ZT7A 5G1PA 2Z3WA 1V7PC 2W0MA 3ZV6A 4EI9A 4F3NA 1HFJA 4BFSA 2JHGA 2UU9B 3OCWA 4Q05A 4EHBA 3KSBC 1U3GA 3DZDA 3BE6A 1E9SA 2PZEA 3QX8A 1QP8A 5ICGA 1Q95A 3WRYA 3FGNA 2VNKA 1ETUA 2BEWA 2C94A 5E0KB 3GCXA 5BR4A 2HRRA 1B76A 4UHHA 3O26A 3WRXA 3JD4A 4QJ4A 1HYHA 2GNAA 2XZPA 2IYSA 4WL0A 4AN4A 3E53A 4O8ZA 3AR7A 4N49A 1YCHA 5HZMA 1R5NA 3ZGXA 4KOEC 4ND6A 2GPWA 3DDOA 3QBJA 3GK3A 2PSJA 1O8BA 3M2TA 1LW7A 1T0JB 2HIGA 3ABIA 2TYSB 3Q6NA 4UBKA 4WBNB 1LD3A 3UEOA 3ZU6A 4DV3B 3CFYA 4BHTA 1KDVA 4QKQA 3DO5A 1I2CA 2QMUA 4NU0A 2EC5A 1NNLA 3DAGA 3HNRA 3KXLA 2ZU6A 1Z73A 2G77B 3WGYA 4K9DA 5D5QA 4IWNA 4KXNA 4LRSB 3UOGA 1MV8A 3IUEA 3D3KA 1V96A 3T99A 1VHWA 1U2SA 1K5PA 3WLRA 2INGX 1AKNA 4BCCA 3RIXA 3AKEA 1KORA 3T1YB 5HA5A 1BX1A 1FXUA 4JVSB 3AJAA 4WKNA 2ID4A 1CUJA 2ISQA 4G67A 5L95A 1Z2CA 2OZLB 1RYDA 3QPCA 2YJ3A 2Y05A 3TSYA 3OQNA 3C6MA 4BMYA 4BPRA 3CR7A 1E1QD 1M2FA 2OCGA 2PV7A 5JJ5A 4JK3A 3OY2A 4IGFA 4KGVA 3IO5A 3I6YA 4WZBE 3DV0A 4EJMA 3I42A 3RWBA 4URYR 1UZAA 2B1RA 1UJCA 3E1SA 1XA4A 2G25A 1J8MF 4BZZA 5DLQC 4AKEA 1QFSA 4O33A 2LNDA 2AFHA 4DNQA 2Q41A 2GNOA 1LUAA 2J3IA 3N8KA 4C06A 4JHXA 2HCTA 5ICFA 3RSOA 1SOVA 3W5SA 3IHLA 4LOAA 1OY1A 1U80A 2FMHA 4Q4JB 3EGVA 4IAOA 1U9YA 4B83A 3K9NA 1BDIA 2BRUC 3OEYA 3RD5A 3W6NA 3KKEA 5F1YA 5AW1A 4KXUA 2DPLA 4Q02A 2BTQB 2O2IA 5AW5A 1NRWA 2J1LA 5K3FB 3ZG6A 2R11A 3QFFA 1HE8B 1W8IA 3UT5A 5BN1A 2WU8A 2DPGA 3Q7IA 4WEQA 4IWYA 5DGIA 5C8YF 2CT8A 2RDMA 5K0GA 2GFQA 1CUVA 1V35A 2KM1A 1C9EA 3A7EA 4GPAA 4JD5A 3KVYA 5B57C 4QOHA 1QH8B 1Z74A 1NBMD 3PQ4A 3HGMA 3LF1A 3BTSA 1KZ9A 2VP4A 2VH5R 2ZATA 3CJTA 2ZE5A 2FPWA 1U1GA 4ABYA 4MQEB 3CVUA 2O8FA 3BMOB 4DR2B 3W78A 2PBZA 1X1DA 5T6BA 2P90A 3ON5A 1TJNA 1VMEA 3DNPA 3DP9A 1A9XB 1O95D 3WLNA 1DG1G 4QUKA 3HUEA 2IYYA 3SS9X 3DCNA 2UVPB 1L5MA 3DOFA 5DNDA 2F1JA 1P0MA 3NGXA 3L5KA 4B3XA 2V1XA 1W52X 2C8JA 3AVWA 3U7QB 1NJ8A 4EZEA 1MXFA 2I9KA 2PLRA 2UZ1B 3K5WA 4MHTA 2PS0A 3FVVA 1UODA 4JKYA 3NQ41 4XIGS 2C00A 5D3ZA 2W2OA 4MS1A 2Y0EA 4EOGA 2XYVA 1CE8B 1K89A 2RHHA 3VH1A 3KWLA 3NV9A 1O9HA 4DQLA 3PIIA 5C80A 1WV1A 1I2DA 1GAQA 3TLXA 3KT0A 2FLWA 2QNRA 3UZUA 4AXXA 4TXLA 2FPPB 3P7MA 2GZDA 2R47A 1BYIA 3L0PA 5HMMA 3HCBA 3INNA 3WNCA 4F56A 4YT2A 5IT4A 3KC2A 1G3IA 2DQKA 4X45A 4B3TB 4DLVA 1OIWA 5FWXB 1V3VA 2QP9X 3MLAA 4J90A 2RAVA 2Q5JA 4O4IB 1RCTE 5FFNA 1U4SA 4RQBA 4TMWA 1CWUA 4TWZA 1CZLA 4CG0A 4DCCA 3F3KA 4PPGA 4MEBA 2UXCB 1ZOSA 1UBEA 2N0SA 3B3QA 4UUNA 4MUAA 5CH8A 3WIDA 2JFWA 2DFTA 4KOAA 2JARA 4Q9HA 2A0WA 1ZISA 2XUFA 5H3HA 1DAOA 3ND9A 4N5NA 3ZVRA 3KQPA 2HGZA 5AM4A 3L0SA 1WPXA 4S35A 4AZSA 2WV7A 5IF9A 1R6VA 1M7GA 1OREA 1EVJA 4IHJB 3CLSD 1UXGA 3LWNA 4XUEA 5DEOA 2AOTA 3D8RA 4FU0A 2ZOSA 1G8MA 1B8VA 3IUPA 3GD5A 1IOZA 4D43A 1SUCA 1S3SA 3EZXA 4RF5A 1QDUA 2R60A 4JYCA 5TVKA 2H5JA 1QPGA 4HFRA 3UN1A 4Q4HB 2H48A 1L5FA 3ZBUA 3AV0B 4I5DA 1ISFA 2YBEA 3GT4A 5DBGA 1Z4MA 1E94E 3VJMA 5BQ3A 5EP4A 5IK2D 2J0UA 5H4HA 5GIPE 2C3YA 3DHEA 1D4FA 5CP8A 5EXDA 4DLNA 4UTVA 4JCCA 4PYRA 5I4CA 4JP2A 1GAEO 4Y2TA 4UMEA 3VHQA 3LXXA 2QE7D 4ZCSA 3FR7A 2VWQA 1WF6A 2Z9CA 3CHYA 4HGYA 4NF2A 3EFOB 3K2EA 3D3WB 1C4OA 1RACA 2PGNA 3QUTA 5JYCA 1E3TA 3ZLVA 3IV9A 4QNNA 2PZKA 2XCLA 2XWPA 2Z5FA 4N54A 1ZVVA 2X7XA 4LDAA 3G49A 2IHYA 2BJHA 1T1RA 1UJMA 5JCJD 1PSDA 1Z8HA 3VHLB 1BCSA 3AR6A 3GUHA 1IC6A 3QEJA 4GL2A 4XWAA 2GI4A 1NYQA 3KLMX 4UFPA 4RA9B 4B3JA 5BP7A 3F2VA 4G81A 1U3DA 4KGZA 4NCNA 4O29A 5T8KA 4NU6A 5BY2A 3C3XA 2JGRA 1ECBA 2JATA 2B61A 1C50A 5FPTA 4PHTA 5FULA 4GNKA 5G0WA 3SK0A 4ZTZB 4LF4B 4LJ5A 4X6XA 4YH1A 4MVJG 2IKQA 3EBPA 4Q3OA 1XTZA 2DUWA 8OHMA 4NZ9A 3LQRA 1PNQA 5DBEX 4P3XA 2WJ4A 5EJ8A 1VE6A 2HD4A 2JHCA 4O2RA 2EF1A 1ZH0A 1II8B 1R6AA 1V8ZA 3TIXB 2B4TO 1DEKA 2J30A 3KELA 2CHGA 2HGSA 4YN3A 3CO0S 3AG5A 4ITRC 1C7JA 1TW3A 1X7XB 3BQMB 2A0UA 5NULA 3EB9A 4BVLA 2A8YA 4MUFA 2LIPA 1IB0A 2CVFA 3JQPA 5EMKA 1NTOA 2ZRQA 1WXXA 1GCAA 3FNGA 1ZICA 5IBRA 3SZLA 1U0RA 1RKQA 2R6HA 4YRTA 1NG1A 2PYIA 2AG1A 1FNNA 3FRJA 5EMLA 4NCAA 1PR0A 2BFEA 3MS4A 1JDJA 4GI7A 1L5HB 1CIPA 4JGGA 3DF9A 4JQCA 3O4VA 3H9JA 2JK1A 2NO1A 2BFBA 4MRNA 3OCYA 4CEJB 3GRFA 1R3DA 3RFUA 1E3DA 1YQGA 3FLMA 3IEPA 3G8BA 1ZWKA 3CUVA 4K05A 4CM8A 3FPCA 1CB0A 2H4WA 1TZJA 3K5HA 3K1TA 3R3SA 4YJGB 3N0TA 5DM4A 4JEIA 4TZ0A 4Z4IA 3N5CA 4M9UA 2ZITA 5EZ6B 3DTVB 3JU3A 3OFNA 4XI9A 1JR3D 3NC4A 5AVZA 5IKEA 2H17A 2JBAB 1JKFA 1YO6A 2GO1A 3JQ9A 3T3MB 5AWFC 4EW1A 3F73A 2HTFA 4J1SA 4NMXB 2Q1SA 3VRHA 4BFWA 3FKJA 3GUUA 4IGEA 5F52A 2X8WA 1SUBA 1MMFB 3I76A 4HNSA 4B9EA 3L49A 1JUDA 1X3SA 4MRRA 5EJ2A 3TTTA 3TTVA 3OFJA 3R5SA 3CX3A 2MDTA 4MYRA 3U7RA 4MA5A 5TQ2A 4JKIA 4IZOA 1UKZA 3VBCA 2GTHA 1J1UA 1U6KA 4XQGA 3SHWA 4B31A 1T26A 5K8CA 2QD4A 1RJFA 3G0CA 4MDYA 4JGIA 3NKLA 5TEVA 4ED9A 4AZ0A 5SYMA 2BKXA 2DHEA 5GTDA 3M5CA 4EX7A 2XXAA 1M34A 1NLFA 1GDDA 2V45A 3M4XA 4MW4A 2QLFA 2HF7A 1KEWA 1KO4A 4DE5A 4CLRB 2FEOA 3INRA 5C8VA 5EHGA 1SU7A 1IXSB 1VQ1A 5HS6A 4IFIA 2LD4A 3UXYA 1M7HA 3BKWA 1Y8RB 4J4BA 1HRKA 4HWGA 5COQA 1EFPA 3SVZA 1C1XB 1THGA 4CIXA 2NZXA 2UYYA 1CJBA 1LK7A 1E96A 2W2KB 4MUHA 5L9AA 4GDFA 1ECCA 1F4PA 1UAYA 1DTSA 4KQKA 3UC9A 4TL9A 1Y3BE 4JKOA 4E4TA 5B3LA 1UBHS 1L4EA 5LZ4A 2BDEA 1I30A 4YO7A 4PRYA 2BFCB 3GFOA 3L1JA 2I8LA 3GNSA 4JNCA 1LPOA 2H5EA 2WKWA 3TPZA 1NW7A 2QD5A 2R8EA 1PS8A 3OEEA 5E4TA 5CFRA 1LBIA 4J16C 5ESRA 1SHKA 4U4AA 5AJZA 1RXYA 2X8BA 3V2GA 2QDKA 5KPJA 3BXEA 3PV0A 3OIGA 4X61A 3CB4A 5MGBA 2WICA 3JQ7A 3ICOA 4BO1A 4D1YA 5ENDA 1X9HA 2JH3A 4FNGA 1KMHA 1JHXA 1BKSB 1SQGA 4E14A 1Z08A 2J33A 2W2PA 1ZH8A 2Q0SA 1PS9A 1R6UA 4FN4A 1M2EA 5A04A 2YXBA 5LZ5A 3UANA 4L72A 2Q49A 4AROA 4BKMA 2R751 4JUIA 4AT1A 1LRLA 1I7NA 4XUDA 1ZONA 1E0SA 3MMNA 3IXLA 3MMXA 3UMFA 2L82A 3OHSX 1M54A 2NYAA 5C1IA 3RNLA 4OD0A 1G98A 2AFHE 3I2YX 1CY8A 1I6KA 4O1HA 4PZ0A 1H3NA 3WB1A 3TFQA 1HG1A 1U0HC 2PUGA 4DB2A 2PFGA 4B80A 4ZYLA 1DIGA 3A4TA 4F5DA 2OZVA 1Z4OA 4HC4A 2BMWA 4ZC1A 1OZAA 3HDHA 4MLPA 5E3JA 3N39C 4LI0A 3GNTA 3T0GA 4C08A 3VKHA 1WLYA 2GNPA 3LVFO 3EXEB 1OU0A 2XYGA 3QU7A 4KNVA 3VNQA 3GGPA 4F93B 3PBKA 5EMHA 2F3RA 1W581 3PUXA 3WIVA 4PYNA 1NM5C 4BMDA 4R71A 1ZKMA 1L5OA 1W1IA 1K6IA 3GZTB 2OR3A 1TZMA 1VRVA 1Z16A 2P67A 1WJGA 2ZJ0A 3AY7A 1QHXA 2BEKA 3C7DB 1J9GA 1T3LA 2OK8A 3CC8A 1ZG3A 2PUWA 4JJKA 4KX3A 5U4XA 3W9YA 3PSAA 2ZRMA 3KAJA 3O8OA 5HCUA 3WDSA 4FFPA 1HL3A 4MCIA 4KLCA 1IJBA 3OOEA 5BSMA 4RU1A 4TT8A 5AW2A 1MC8A 4OHKA 1JHQA 3FAZA 1DAHA 4F12A 1BE1A 3R7LA 2X13A 5BQPA 5FOQA 5B4UA 4UAUA 1S4QA 1YULA 3G1UA 4ER3A 4R69A 4TQAA 4Q12A 2XQIA 1H2EA 2NVUA 2R6DA 2ZEJA 3M89A 4W99A 4KREA 1WBJB 1WDKA 1TU4A 2VDKB 4JX8A 2A0YA 4R3NA 5HIKA 3CGWA 3G8DA 3PA6A 2RHBA 2YVUA 2J3LA 5FUYA 4ZMBA 2I55A 2R8YA 2YZ7A 3ACCA 2I4IA 1P5HA 4F6RA 2QU8A 3IPCA 1C9MA 1Y1PA 4ND7A 5D6OA 5T8KC 3AVUA 4D4MA 2XLCA 1DARA 1MJHA 2NZVG 1XZBA 3EH1A 3M6LA 4DADA 3OKPA 4FEGA 3L18A 5ENVA 1WNTA 1X77A 4FIDA 2D1YA 1L4UA 4O4LB 3S2GA 1WLSA 4RXUA 5BYBA 3TQCA 3LI2A 5HS4A 1SKYB 2K2QB 1EYZA 3Q8MA 2F4NA 4WKOA 1TGYA 3BSYA 3WLOA 3ZIUA 3LX4A 1A71A 4GI1A 5G4KB 5B2EA 1FRZA 3GPIA 3LPAA 1KEUA 4LG1A 3GLFE 1IMJA 1SBZA 2QX9A 2BW0A 2OHXA 1LBEA 1PWZA 1P4HA 3P5SA 4L9SA 2SKEA 4R7GA 3WDKA 4FD2A 2IYQA 3AM3A 2FMXA 1W93A 3A04A 2PFKA 3IELA 3DE6X 4CMIA 3AUAA 4ZHQB 4RZUA 5KSOA 4U6QA 1YI8A 4K2HA 1E2FA 5LBTA 3OHPA 4TVBA 3OAAD 1Y48E 1GXSB 1BD3A 2UAGA 4I9NA 3P9SA 4PNPA 3RS0A 4Y2VA 3CEMA 4U6SA 1ONPA 4JFRA 4HGZA 4MA4A 4ROTA 5B58C 4DXHA 1KEZA 4CQMB 2P6PA 4KEAA 3ZUPA 5MN6A 1V5EA 1JJAA 1N32B 4LBZA 1SBTA 1YR6A 3IKLA 3USZA 2G0TA 5TR9A 1QNLA 5A5EA 3I9JA 5H9VA 1GG5A 1UANA 5KYUA 5H0IA 1P2FA 4X6UA 3B38A 5F23A 4Y2GA 4CTOA 2NTNA 4YRFA 4CM1A 3VKWA 5I7UA 3FZGA 3EDCA 3W5HA 4I3FA 1R0KA 3D8TA 4IBOA 1EFKA 1Z2DA 2WWIA 4WFJA 4RJTA 3MXTA 3NTLA 2PD3A 1KR5A 1TT5B 1OSNA 2YWDA 3HJTA 3COZA 2M6SA 2I6TA 2IEGA 4JYMA 4CL3A 4YUWA 2QA5A 1GM5A 4BNDB 5BYKA 4B44A 1EQ2A 8GPBA 1KI3A 3IE1A 4DMHA 1D04A 2XX3A 5FUXA 1MVOA 4ZEWA 4OB8A 5G1OA 5LWQA 2OUKA 3FSRA 1SD2A 3ZV5A 3R09A 4ZEVA 2C2ZA 2AE1A 2OXCA 4KAAA 5KYXB 4JI0B 5HIAA 3EXEA 3R1IA 4KMSA 1W9MA 3SF8A 1SVWA 3AU9A 1T5BA 1U02A 2EVWX 1T36A 1C1HA 3E3OA 4QVGA 4WSOA 4CTKA 4YMHA 4KDCA 3USCS 1Z4KA 4ZYZA 3KR9A 4LMPA 1IH8A 4HQ6A 4B7CA 4XGQA 2VI5A 2ZIWB 4MWBA 5L4LA 1MAVA 1EGVB 1FFCA 1DC3A 3ZDYB 1QRRA 3QOXA 2F1OA 3A1DA 5HK9A 3FGZA 4MARA 5BNWA 2PMCA 1I94B 3PPXA 3HB0A 3SVLA 1GNQA 1HLGA 5DSZA 2XBMA 5DGCA 1E92A 3EVEA 4IIUA 4BAUA 1W9HA 1T2EA 1JA0A 3MCUA 2D2IA 2HMUA 3M6AA 3M83A 1L4FA 3HKBB 4Z3OA 4A9AA 3OPQA 1RT9A 4RZSA 4I8XA 1P1IA 4UTOA 1ETHA 3DUWA 1EHIA 4QWMA 2MR6A 1I2MA 3B1YA 3I2KA 2IYOA 4B43A 4OQEA 3KBOA 4CVNA 2WD7A 2C82A 4CM3A 3I73A 1D2AA 2X0FA 4BIMA 2JVIA 4LJ8A 4OMUA 4OU4A 2WIJA 2W6CX 5HG0A 5IH3A 3CEHA 3T1OA 3VYTB 5HKKD 2OHIA 3IUBA 3PC8A 2GK3A 2DB3A 1X2BA 3L1HA 5I9MA 2IOHA 2VP6A 4KFCA 4DQDA 2D54A 3UJDA 2XEDA 2CNWA 3SJBA 1GSIA 2OGWA 1E8NA 4NZZA 2YS6A 5CVUA 3DNFA 2OV6A 4DSNA 2CLLB 3SEAA 3N58A 3HDTA 3GMTA 4QUJA 4ZVOA 4EYKA 1TW2A 5JJIA 3OIFA 3L6BA 2V58A 4G0QA 1P4SA 3L7BA 3JY6A 5FA5A 2EV9A 3M70A 1M1XB 3G2QA 1M2VA 4RE5A 4FKMA 4M99A 4B2PA 4GRAA 3SIWA 1Z62A 3A0UA 1MOZA 3GEMA 1C3JA 1SN7A 5K8TA 2F55A 4LYHA 2CK3D 2YW2A 2OV1A 3GDGA 4Z7NB 521PA 2YJNA 1LNSA 1O5TA 3FUVA 2N47A 1EE1A 2LRHA 2O2CA 4CMJA 1Z8DA 2H1VA 2VHTA 3UJNA 2R2AA 3FFXA 5F2KA 2LUOA 3QGMA 4H9GA 1QMGA 4PXYA 4ARBA 4XTCS 4EW3A 3JVEA 2NT3A 3B6KA 1SOWA 1TI7A 1T29A 3MOGA 1ZD1A 2GPTA 1XZPA 2ZWMA 1ZL2A 3V4PB 2QVYX 1REQA 1N5OX 1MLDA 3O0TA 1MB2A 2IDZA 3KALA 4MVJF 1WPQA 2XZOA 4FNMA 4ROSA 1U9IC 1WB6A 2GF0A 4KXYA 4Y6OA 5IAOA 5FWYA 4TTRA 3P1JA 1U0GA 4W5NA 1IULA 5FNVB 2AF3C 3NT4A 4BZXA 1R9MA 1T6NA 4NAVA 4XUCA 1RMYA 1LRJA 2XGGA 1V8PA 3LECA 5K03A 5IS2A 1UP7A 3OQMA 1EGQA 3DVLA 4K46A 1O6GA 3TINA 5T41A 3KZ1E 1VL5A 3KQWA 3UH1A 2NU8A 1UF9A 1ZL0A 4N7JA 1OX6A 1ZVJA 2CCJA 2PMFA 2ZS8A 4DARA 4DJJA 2B5WA 4NFYA 3L82B 2JEOA 1JLKA 4HX5A 1XCGB 2D1SA 2GESA 2R96A 2WTBA 2E4VA 1RCFA 1EXDA 1QDEA 1EWYA 1L8LA 1XEXA 2ZW9A 5M7EA 5E3IA 1KY2A 4POAA 1XGKA 1U28A 3BILA 4XWOA 4U7DA 3GBVA 4L16A 4M9SA 5I7VA 3QEOA 5LC1A 5HNKA 2V97A 4WBSA 3GAMA 2VK1A 2NUBA 4H27A 4WKBA 4CNQA 3O03A 2PEYA 5BOSA 4MI1A 4OHMA 3AR5A 4FOLA 4OI1A 4EA9A 4F45A 3VVLA 2EX0A 4MB0A 1JU9A 4NQZA 1ZRMA 2X9VA 2G67A 3BD9A 3PU6A 5F12A 4A16A 1M8PA 2RCNA 1GZ3A 4D02A 3U4AA 1OYVA 5EWMA 4M1MA 1ZXLA 2WPDD 3Q7QA 1A9SA 4UBMA 1A9RA 3C1AA 1IWPB 1R3UA 2N75A 3W2EA 4MW6A 3BRWA 3SJZA 2NU7A 2WUDA 3PDJA 4G84A 3S2EA 2HF8A 3E7FA 4IM7A 1HX7A 1T9DA 3BOSA 5CPFA 2ZIEA 2NQTA 1SCNE 2JD1A 4DV1B 1XROA 4CCYA 1T4DA 2AJBA 1WUIS 4ZWNA 2R6GA 4ZDIA 2VBGA 3AIMA 1XZJA 1AURA 4U00A 2VZLA 4W1PA 2ZYUX 3VSBA 4BX8A 4MWCA 2QR5A 3PNYA 3MT9A 4MVJH 5IUKC 3H9CA 1TECE 1E2BA 2E85A 3ZUGA 4JUDX 1PR9A 2A9FA 4Q7KA 4A82A 1GOTA 2E4XA 3KJIA 3NIBA 5ULLA 3HUDA 3ZOKA 4AKHA 3E22B 4PSDA 1KE2A 4EH1A 2AN5A 1DCKA 1A2OA 1Z28A 3C3DA 4CQLA 3SIXA 1CU1A 3ZHSA 4EA7A 4P36A 4JBWA 5LMCA 1YCGA 2GCGA 3GW8A 4RYDA 4DPLA 1ZCBA 2JF0A 2QAGC 4JJ7A 4X6LA 4ZCPA 5KVSA 3BH0A 3RYIA 1FTQA 3UK7A 4RVCA 1FOEB 1G9XA 2BKLA 4TX1A 2WTUA 2IUEA 2WSYB 3D1LA 1EX9A 1WSBA 1ZW6A 3B3GA 3IB3A 4P38A 3DBIA 4Q9DA 1ZK4A 2BBSA 1BNCA 4N3NA 4EB0A 2H7VA 1LTHR 1JXOA 2ZRHA 3EXAA 1EPUA 3IDFA 2VT3A 3ISVA 4C2BA 4CKYA 1IBLB 1PWHA 2LR0A 1A82A 1JTEA 3AKCA 4NK5A 1UBLS 4S1TA 3AETA 4EUHA 4ZEXA 9ATCA 5AM5A 5CTAA 5KDDA 3PQDA 2B98A 3QKIA 3RG8A 1KY3A 2OT3B 5KYWA 1F0KA 2P2GA 3ESRA 5BRJA 3AT1A 5INTA 1QVRA 3AINA 4IX1A 4F96A 1JIVA 2BI4A 1CFZA 3VAAA 1IN4A 3RQIA 2BN4A 1U94A 2CF5A 5ICMA 5DBFA 3TZCA 1TM5E 1T9AA 1HDRA 4OYHA 1YRAA 1CEQA 4MUNA 1E9DA 1I10A 5CM8B 5L6LB 2DPYA 3S70A 3R0IA 3PTZA 4L5YA 1UOQA 1A8QA 2NYVA 4GOLD 1MKYA 3T0IA 1GTSA 3GDHA 4X3OA 4RTLA 1QHHA 3M5DA 5AQEA 4RA6B 4HG2A 4EY3A 4CG3A 2PGAA 4B3MB 5LWHA 2EGHA 1ZM3A 2XVYA 3EFBA 1XD2A 3JZFA 4PC6A 5WRFA 3OZTA 3P26A 4CLDA 1P45A 3EZFA 1E1RA 5LL6P 2H9AA 4BNKA 5GONB 4ECAA 5C7YA 4GM4A 5LQCA 4DUZB 3T5PA 3KZMA 5K9ZA 2QYOA 3DBHA 3KK0A 3QRWA 2XRMA 1QIDA 4BECA 1YAJA 3QVJA 2O0MA 4AYWA 4YMLA 2E4ZA 5BMVA 2H2HA 3QVTA 1L2TA 4D3DA 1J4AA 4I1PA 3BQNB 3TW0A 5D86A 3QEAZ 2QN9A 4PM4A 2XDYA 3ED1A 4KCGA 1UMBB 2VTEA 1M1YE 1PZFA 2BGGA 1XEAA 5CB6A 2WT9A 2I3AA 3E3MA 4O4JF 3EGCA 3R9XA 1ODFA 1DAFA 1ULHA 4TSFD 1QH1A 4NMHA 4YDHB 2AVNA 3KHTA 5E7JA 3ZLJA 4D9CA 1KP2A 4OFZA 1GARA 4FYKA 2FNAA 1HZZA 2W6PA 3KHSA 2PL5A 3QWIA 2GZSA 4ZCIA 2GD0A 4ZDWA 2I4TA 3EG5A 2FQYA 4NAUA 3FOFC 4IDFA 2AT1A 4GX5A 3ZU2A 4KWCA 3WLQA 3E3NA 1ZIOA 3PE6A 4MQUA 1YR3A 4HTFA 5JH7B 5KVCA 3ROFA 4WADA 1V6CA 2YV2A 3JD0A 3TTUA 1EFLA 4MTLA 4BNIA 4C03A 1MFPA 4TVKA 4MAMA 4KPFC 5KNBA 5KOJB 4PZYA 1YDWA 8AT1A 1YVPA 5CXXA 4KFRA 4CKEB 3I72A 3QMWA 5FWXA 3EC2A 4Z0PA 3M5PA 2YNMD 1N8NA 4TTQA 2RGRA 1YVRA 3K8YA 5DK6A 1EK5A 3MSXA 1HURA 3K9FC 1GTZA 2R2GA 2PGIA 1LBSA 3EGXA 4HQ0A 1RMQA 4L7VA 4LC0A 2VUSA 3FTDA 3PR1A 1KZ4A 3OZWA 5T5QA 4C0XA 2EBHX 4UBNA 2YIJA 4MICA 4ABTA 3R0ZA 5HDQA 1GADO 1DE0A 4C43A 5DTMA 1DTWA 1BQ4A 3CW9A 3GFGA 5JNWA 2NO7A 3TD9A 1FDWA 1H0SA 2NWQA 3L2OB 5CGQB 3HXMA 2ZI6A 2I87A 3LVRE 3Q88A 1S02A 4WIAA 1L5NA 3UMMA 5IEBA 5F7XA 2IH5A 1KA9H 2AFHB 4WKCA 4EAQA 2QVXX 2XDQB 1F4LA 3JVUA 1JF8A 4R1PA 3LUBA 1CERA 2DVMA 2I4OA 3GPLA 2A9KA 2IQIA 4R8LA 3T7IA 2IXFA 2XYRA 3Q87B 1KDZA 3OZAA 2H4JA 5KDOA 2FE1A 4TWJA 3QEBZ 3PWTA 2FOIA 1AXEA 3S5UA 3R0VA 4L07A 4RVSA 5KTMA 3QPUA 4ZYUA 2PT6A 1RFLA 3CSUA 1UBOS 1PR4A 4DSOA 3EWIA 2ST1A 2NUAB 1SD5A 2AN4A 3L41A 1DPFA 4TLLB 3ER6A 2PEZA 2YICA 2GVDC 5EJ4A 1BU5A 1GY8A 1W29A 2WYOA 5FOXA 5JR3A 1XX6A 2ACWA 3OZXA 3PQ7A 5ITZA 5D3KA 2BEUA 3VU3A 1NR7A 2ZSJA 3T9AA 1JWBB 3IQXA 4DSUA 4HOYA 4PTZA 1ISIA 1G41A 1WVMA 2ASEA 1ONOA 1O2DA 1U5AA 3HFJA 3WISA 4QZVA 4M83A 4NMLA 3Q7SA 1I14A 2O06A 3RSLA 3VM6A 4DBVO 1NUQA 4EJSC 5JSQA 2RC6A 4MRVA 4R16A 3SHVA 4YRJA 3HKCA 5B7QA 1GZHB 5KREA 5ALSA 5E7QA 1N3BA 2WT8A 3HC7A 2V55B 1JAZA 1ODCA 2ZULA 4PSUA 4ZOAA 1ZIXA 3M3DA 4HDNB 1OC2A 4V0RA 3TAXA 2PAFA 16PKA 1ZLYA 2YXEA 3WL5A 4DB4A 2O8DB 3A10A 1E8MA 1NMSA 3OESA 4B6OA 3BHNA 3KYDA 1I4EB 1XNHA 2HA0A 4LHXA 4MHSA 5LA6F 4R9NA 1E4EB 3JWPA 4U0JA 3V42A 1CUAA 1SM4A 1Z4PX 1VKHA 2W6QA 4XR9A 3TZHA 1Y1TA 1ZD2P 4RHFA 3ZXIA 2GPSA 1ZXXA 3OG9A 5IU6A 2VJLA 3QY0A 2EIXA 2ZSKA 4HQFA 3BXZA 3S0JA 1FU7A 2ZIUB 1QZXA 5JVDA 4IEFB 4TN5A 1Z7GA 3ZE2B 4MPDA 5FWAA 4KWHA 1LDNA 4IP0A 3MQ2A 1J23A 2ZJ2A 4HYYA 5HILA 4J0KA 2JRCA 1A97A 4TYQA 1XTTA 2C99A 4KE8A 3W77A 3ZDXB 4TV8A 4G5SA 4N12A 5CBPB 3JQAD 1OVGA 2C77A 4HQRA 4MKGA 3SC2B 5AVRA 2BWJA 4GOMD 4GOND 4KVZA 4PHFA 3EGWA 1W85B 2AOUA 2I7XA 2II6A 4MWSA 5BO5A 3OZSA 4YK7A 5EQDA 4F5ZA 2EKQA 3LH5A 1SVSA 4L4YA 2ID9A 3EY9A 2IDJA 5E9AA 2X0NA 3AUXA 3IEKA 2XKKA 3GLHA 1JXAA 1CEEA 3JYHA 3QLUA 1B42A 4L1KA 1KMNA 1YL6A 2RG7A 4IL5A 3IV7A 2QP4A 5TGZA 5E4YA 2FV8A 3LBIA 4FFDA 2A84A 1U1CA 4CIVA 3BMNA 1OFUX 3IP8A 2C5LA 2DOKA 3OE7A 5FD8A 4E30A 1DTWB 3KQYA 3N59A 2WG0A 4RJIA 2OHVA 5K4AA 3VH2A 2JLZA 1QJCA 3ELUA 3MUNA 3NU1A 3PITA 1FDUA 3NHWA 4IRXA 4DBLC 1YRYE 2X0KA 4TRMA 3GARA 3D4OA 4BDSA 5CXQA 1T6ZA 1QAQA 3C0KA 2HI0A 3H75A 2RD2A 1O57A 4KMOA 3ADPA 3INGA 4IV0A 1WMEA 2CFOA 4KIWA 3MCTA 2YC4C 3IKMB 3MWJA 4FEAA 1NASA 4MQ4A 3THYA 1QCYA 2ZJZA 3D3EA 1SUAA 2X5JO 1GG8A 4KQEA 1F8XA 5EUCA 2A88A 1UJ2A 2GPJA 3H8WA 4ZEOA 5C3UA 5I3CA 1FJHA 1VMIA 4JMLA 2VJBA 1U8XX 1KI7A 3ILYA 5IDXA 3H6KA 2C7VA 3E3LA 4RL4A 3ZJTA 1HZZC 3ZGLA 3BN3A 4N7RA 3SLKA 1W4AA 5T4HA 1Z5OA 4FMCF 4F9EA 2BGRA 3GQBB 1FDTA 1VBNA 4J0FA 4HVLA 1VXOA 3LCMA 2H6EA 4I5EA 1QBGA 2O3UA 1Y6ZA 2Q4RA 4ZV4A 1UKAA 3OPXA 1N5KA 3LTEA 1JS1X 2C7BA 3GHHA 4HUQB 4OXQA 4W8GA 3W2TA 4ADSG 2H4YA 2YWRA 5C8YB 3P0RA 1I2AA 1CTQA 3BFXA 2X41A 4LTMA 5CIQA 1ZNWA 2OFXA 5ALUA 3L6EA 4YCAA 1XOIA 1UT6A 3F6CA 5EE5B 4L78A 5TF4A 3VSDA 4IV5A 4QJ3A 3A70A 3GAAA 3KIPA 4V03A 2G9NA 3QUAA 4PS0A 1YE3A 2ZUSA 2WUFA 2YQZA 1PG5A 3MWFA 1T0BA 3MWYW 2A7QA 3KEOA 1YFZA 1ZS9A 1P9LA 2E7ZA 4KXFB 4NH0A 4QOJA 2EJVA 4GPZA 1TYBE 1J0DA 2VZEA 1V43A 1IWBB 2H92A 2WNHA 3E9RA 5TRTA 2GM5A 1CULC 1NVVR 3EDOA 2ZXUA 1UFOA 4PLYA 4EBFA 3OWOA 3L4JA 4GKBA 1SCBA 4ZQCB 3N2KA 2CXSA 3GDFA 4MCHA 3ZHRA 3I5YA 2UZ1A 1HT1E 4F97A 3R7BA 1VIMA 3M1YA 3U7GA 1KHTA 4Y9DA 1OFHA 4AZVA 3DLHA 1VBFA 3L8EA 3ZJ5A 1BAPA 3M6WA 4B8YA 1CVLA 1HOXA 4LPKA 4WASA 2J6IA 1XB2A 3N8HA 3BXOA 2CBXA 3D8NA 3G2IA 3UY4A 5FPPA 1JLSA 4R9SA 2IZ0A 4G5FA 1VSBA 3LT5A 5FL7D 4KXMA 4IDEA 3IULA 4MZXA 5BSGA 2PKQP 3ICEA 3WJAA 1K7YA 2X76A 4QRIA 1UEXC 3KL4A 3K32A 3IIJA 1X1TA 4WCFB 1OZ0A 5ER9A 3RUCA 1RWVA 1PFUA 1DCTA 1LQUA 5CB4B 1KTIA 3MTAA 2I78A 2QZZA 3FPAA 3RROA 2I76A 3RBAA 1ZZEA 1SWVA 2OGSA 1IE3A 4NBVA 1P81A 1HTWA 3WGVA 1V7ZA 3G85A 2LPMA 4HMPA 3PUJA 1FSZA 1JQDA 3MT0A 3OU7A 5M3BA 3TAUA 4EG6A 4BVBA 3QNMA 5CDHA 3ENVA 3DBRB 4C6TA 1UBGA 2XOKA 1NG9A 2VP5A 4R6WA 3I6BA 2BLNA 4XYMA 3HLTA 1DJMA 3PD1A 1DEHA 4RD2A 4RIEA 3BWYA 3RS2A 1QUFA 4RAQA 1BJRE 1W5AA 4I1YA 3SJUA 2AOTB 1W5SA 4BDTA 3FPKA 1RR6A 3Q41A 3ONFA 3AI2A 3TQOA 1R0YA 3OU2A 4X1IB 1C7ZA 3ZIDA 4XVRA 3GUVA 3GFQA 5JAIA 1ULAA 4K7JA 4QEZA 2BEJA 1OV6A 1X7HA 2XUZA 5JI2E 3F0TA 1KFBB 2Q8PA 5GPBA 2P4EA 3UWKA 4AUNA 2Y6VA 4YAIA 4WK0B 2NOAA 4CM9D 4QL3A 4CT0A 2UZ4A 1U0LA 2I66A 3T5TA 2NSDA 3WV4A 3X0DA 1ABEA 2VZ9A 3S27A 3UKJA 4XM2A 4CDMA 4AF8A 1JIUA 3HP7A 2XNHA 3W1VA 1AQJA 3P0HA 1D6MA 2OBMA 3R75A 2EKZA 4WCDA 2VDPB 3KJFA 5HHTA 4IOKA 1GPMA 2Q3HA 5CVJA 4I36A 1VPWA 2Q29A 3TNLA 1GUDA 1K8ZB 4S3MA 1XV5A 4KUEA 5EZYA 3STTA 1NX9A 3HQ4O 3VI3B 3NOXA 1FUEA 3S4YA 5D00A 3I1FA 2VAVA 1W25A 1U7PA 2GSWA 4MA0A 3MPOA 4BRUA 1K3TA 4JT2A 1F06A 1PW5A 1Z2NX 3ULKA 4KZKA 3DLIA 1VJ1A 4DDMA 4DHEA 5BSKA 6REQA 1TEXA 3F5FA 3K8ZA 2M2IA 4RTMA 1T2UA 3B6JA 1SXGA 1EX6A 3CNEA 3L8CA 2QLBA 4NECA 5TJHA 1ND5A 5CD1A 1MEJA 1LVUA 4DZTA 4E32A 1A9QA 1CT9A 4L5BA 3EYAA 5J5CA 5BWNA 1T2FA 2ZYRA 3ABOB 2VHZA 2G7ZA 1CUDA 2DFLA 1CUCA 2PKEA 3WKAA 6NULA 4DY6A 2WU0A 1W4LA 5DNYB 4E4RA 4Z4EA 3KYDB 3SXPA 3D6VA 4A5OA 2WF8A 5IHXA 1RI2A 2OXRA 4GKJB 3ZWBA 3GVCA 4XYEA 3E9QA 1QYVA 3I45A 5FEUA 2J0SA 1OFTA 4WLUA 1RM5A 1N1EA 2ZXFA 4G6ZA 4WNCA 2X4LA 4TMYA 4MR7A 3WGZA 1DB3A 1VCIA 2ZBUA 4HAXA 3T9BA 3GIWA 1H9BA 2ZAYA 4FGKA 2PLAA 1WZNA 3WGJA 3ZD8A 4TVSA 3LDGA 2LIVA 4GR9A 4OHVA 5JD4A 3HMQA 1PV2A 1QS0A 4YJ3B 5A62A 5FQOA 3SZMA 3E48A 1TJPB 4Z9FA 3GJ4A 3DGEC 3NBXX 2PGXA 2H1SA 1FDOA 3NAMA 2JA2A 4HRVA 4WGFA 1KOLA 2R8ZA 3DFIA 3X1DA 1CJKC 3J81A 3PEVA 2EFDB 1MBZA 2OP0A 4F85A 4ZOCA 1Z0IA 9MHTA 2R1TB 3UJAA 3R8CA 4XD7D 4KQGA 4Z53A 2POCA 1H94A 2BELA 2ZIXA 3QJGA 2FRDA 1T5IA 2IELA 4I4TF 3SQXA 5CX1B 4XVQA 1HEUA 1AQLA 1ODLA 4MYHA 2IDKA 4UDNA 5H59A 2F2TA 4RIIA 1TPZA 4EY6A 4GI5A 4CMCA 1SUWA 1TLTA 1SHTX 2XDQA 3T1VA 3R41A 2ZIZA 5BV1A 4I1RA 1XXHA 3TVDA 1Z29A 3RW9A 4M1YA 3S2ZA 1Q84A 1VYHA 1WMDA 5FPYA 3TNJA 3QVLA 3COSA 3VV2A 3E15A 2G9VA 1C9JA 3GFSA 1QTIA 3TQQA 2FWNA 4QPZA 4KITB 2NSLA 2KLBA 4LY6A 1PLLA 3PFGA 5KX5B 2G0NA 2YOFA 4RHEA 1WB4A 2FOXA 1WCIB 2PA0A 3CN9A 3F9CA 1Q1GA 4R31A 3AXSA 2I1VB 2YJ5A 1RM0A 5IVHA 2J3DA 1XHEA 4X24A 2AEMA 1QIJA 2PM8A 5A3JA 4PC2A 5HRCA 2O0LA 3N5KA 1H4SA 1A4IA 2VAPA 1OZFA 2O7NA 2PSFA 3H1PA 3ZLBA 2WIBA 3IJ5A 3FOBA 3GT7A 2HHAA 1JSXA 2X3YA 1VSUA 1BS1A 4TRNA 2B78A 4BQOA 5BWLA 5CPBA 5DKFA 5FUQA 1E8DA 3WFIA 3VC1A 2LCIA 4OQLA 2R6JA 5B2FA 1FTNA 4A26A 3SP1A 4EPWA 1U0NA 5THXA 1M6NA 4W5WA 5EKXA 4PO3X 1NVTA 2RI0A 4ZT3A 4CE6A 4DA8A 1G20A 1EP2B 1V16B 3JQAA 3HBNA 2WU1A 2AIRA 4FYVA 4PLWA 2ERXA 2PY6A 3RJ5A 3NHBA 1Z6GA 2FQXA 2VJQA 3MVEA 4BWYA 2OV4A 2NPFA 3MHPA 3FDZA 5LN1A 3ZWCA 4H2DA 1XTSA 1GWNA 2HRZA 4BJ6A 4X94A 1P7ZA 4G1EB 3RUPA 4ZYYA 5F1OA 4DLKA 1VCMA 1K88A 4WOCA 3THOA 4AIRA 5FPKA 4L73A 5M34A 4J1TC 4LISA 3CE6A 2CGEA 4YWJA 3ESAA 3NFRA 5J58A 4HL6A 4JI3B 5F4BA 2GZ2A 1MJ5A 3GEHA 1JQBA 1NVVQ 3PZRA 5J2TF 3RJTA 3WAJA 3ER9A 3I05A 2PWAA 2Q3FA 3O4HA 1AKYA 1E79A 4MW2A 1PX0A 4FFWA 3G9UA 3G7UA 3B6ZA 4IHAA 5HGJA 2V6FA 3QEKA 1OQAA 4B3FX 4CDRA 1X1EA 3VA7A 3T94A 1T5HX 1UBMS 2DP4E 4LQ4A 1WOMA 1J90A 2ZZNA 1D1QA 2DULA 3BWVA 4GKAA 1GEEA 4RPGA 4LJ9A 5KSZA 4M60A 1JEYB 1H3FA 3LKZA 4OJMX 5IKXA 2QY9A 1Q19A 4Q16A 4PN3A 4J07A 3A9SA 2HCRA 4COOA 5D87A 1I4OA 2VCEA 3AZQA 5CYPA 3CSSA 5IEJA 2CEAA 5KIAA 4MINA 4ZK6A 3S40A 4GFDA 4K3VA 3QQ5A 4R41A 3FHTA 5H82A 2QM3A 1V8BA 2JBAA 1FVHA 4IMRA 1AB6A 1EAYA 1Y0BA 5B3AA 3UOAB 5AM3A 3HFSA 3PPVA 4IO0A 3ORHA 5LUAA 1S7CA 3HFRA 3QYFA 1XZ8A 2F7SA 2H16A 2PKXA 3RVJA 3MB5A 1X8JA 3CEJA 1N1GA 4CG1A 4N5MA 4PG6A 4EJ0A 4C7MA 3IUSA 2OSVA 1Q7GA 1FRVA 4BNFA 3SHFA 4C0AC 5K4HA 1IN1A 3TSAA 2VYCA 4F72A 1Z4JA 3LQQA 1Z2PX 2VZ0A 1XDSA 1JL3A 4D4JA 2HYDA 3MINA 4HYQA 1P73A 4O59O 4WMLA 3WS7A 4NENB 1YQXA 1SA0B 3ONVA 3RFTA 3FCCA 2DZDA 3WWPA 1FPMA 3A06A 5KAPA 4EG8A 5AHWA 4Q24A 1Z5VA 3G7SA 5TEWA 2C58A 3GF4A 4QOIA 4QPJC 2FMTA 1PYOA 3VSAA 3A9VA 3G3EA 4BUCA 4E2WA 1N1MA 2BLLA 4P92A 3ZWNA 4CKZA 4WA8A 3RJMA 3K0AB 3D8UA 3IQZA 2P5SA 1X1SA 5KVQA 2EHJA 2JH8A 2XMCA 3DF7A 3SJAA 1D2HA 3GPBA 3OEWA 1YBHA 4BBAA 2X4GA 1X7XA 1P5ZB 2JIZD 3G2PA 3IVCA 3QE3A 4GMGA 3T4XA 4QDOA 2X5XA 2E1PA 4YRMA 2VA8A 4ZI5A 3TLJA 1XMJA 2J5RA 3I5AA 2FN7A 1XJ5A 1AGYA 2I6FA 3NORA 3O92A 5AKGA 5DU2A 3R7FA 5H9WA 4PC7A 2QD1A 4BO3A 1ICEA 3OO0A 3HB7A 2CDRA 3UAOA 3PQ8A 4LCJA 3BL5A 1XZEA 1NGSA 3G68A 3UAGA 3IMFA 1P4GA 4Q03A 4QFDA 1SC1A 3N2NA 1XMQB 2PG3A 5AI6A 4EHNA 2XQKA 3O74A 5A5VA 3U3OA 4JI6B 2GO7A 3I6MA 4G24A 1QX4A 4NBKA 3M4NA 4QEKA 2HV9A 4MRSA 1JT2A 1YA8A 3OOWA 4P4UA 3OIYA 5KQGA 3IIIA 5ITVA 3VO8A 3D6TB 4K6MA 4URXR 3K94A 5BSWA 5CFNA 5EMJA 1QRSA 2F8SA 4H6XA 1OLSA 4X97A 2G7MC 1SIWA 2PNFA 2BHLA 4YIKA 3R8FA 3TZ6A 2SICE 2JK0A 3GI1A 1WVIA 2GJ4A 4AB1A 3LDUA 1YI1A 2QPAA 4GBGA 4ETMA 2FEKA 4L5IA 5B1IA 1T10A 2B83A 1EM6A 4YCDA 1E9RA 3KJZA 4MR9B 1PL6A 3N2ZB 5IYZF 1L7DA 4CIWA 2OO5A 1QFZA 2J9RA 1U7WA 1ZFNA 4EJ6A 2IGTA 1FTYA 8ADHA 1A5SB 2PRIA 2FP4A 2ZI9A 3WLIA 5BQXA 3GA5A 4LNUB 1X1CA 2BM0A 1WD7A 2SECE 2R6AA 4LHWA 3SX0A 1BW9B 4KN6A 4PCUA 4HKTA 3K0FA 3B5EA 4LQLA 1R16A 1KGDA 2CXHA 1ADGA 3DOOA 4B0OA 1C7FA 3ZXYA 4J0HA 4XQ9A 4BJ5A 1E1CB 3SEZA 1E3QA 4F4HA 3EPJA 2WU4A 4GOJA 1BQ3A 4HPWA 4WZAA 4G01B 1W4CA 2ORED 4AJ4A 4WOPA 1KARA 5I8WA 1MNAA 1U2QA 1G6HA 1U3TA 2CDBA 4D4IA 3GLGB 4DVGA 3RU9A 3JTMA 2P75A 2RK3A 4I50F 1T6XA 1CUSA 5IUJC 3SE7A 3VNAA 1I9CA 1SR8A 2VPXA 4FHCA 1P60A 4NOKA 4JC4A 5CVDA 4IQ4A 1BXGB 3DAFA 3QE4A 4QXRA 3PR2B 4YPFA 2QLJA 5I7WA 1EWTA 3KZKA 3ZC3A 4BB6A 4BE4A 3DOHA 1PUJA 3QW4B 4WV3A 2HA5A 2PZGA 1JTVA 1TAHA 3ADDA 2ZJ8A 4CWAA 3PXEA 5CGZA 3VO1A 3SC3A 3U49A 1U6IA 1G7TA 4MV3A 1MZPA 4C4AA 1YZ3A 5KQMA 1P2TA 1IN6A 1U9CA 3L0ZA 4MV5A 3DSRA 3UJBA 2BKEA 3ND8A 3D7MA 1FLNA 4QC2A 3FMVA 3WHKA 1U3CA 3EG9B 4Q4AB 3JWEA 3B9RA 2O2EA 3OJFA 1AV6A 2NMVA 4GYJA 2X9LA 3BSWA 1GGVA 1W88A 2NG1A 2R0QC 4ESOA 3RCBA 4Q9NA 4U5XA 4D2IA 3I9LA 4EBBA 2B99A 3TZKA 2PDAA 1FB5A 2FSVC 3RWMB 4OYYA 1MHPA 4B35A 4IGAA 3QF4B 5FADA 2DKNA 1DOAA 2XAAA 1OXUA 1HT3A 1R00A 3ZW9A 1RRFA 4RZIA 2F67A 4B2YA 3CW8X 3IKTA 4B6RA 2IS1A 2IY7A 4RADA 2QP3A 2ZJ4A 3UHOA 4Q3AA 2IV7A 2G07A 2P7IA 5DNWA 2V74B 2ZK7A 3E27A 1LLCA 1C8KA 1DAGA 4FOOA 1FU8A 3M1IA 3R20A 1I2BA 3NBAA 4ZQHA 2HM7A 4DIUA 4B3DA 3COYA 1Z25A 1J5EB 3ICPA 5DNEA 1OZGA 5K1ZA 3CLTD 4JODA 1EH5A 4YMSA 3UA4A 4J0EA 1VRWA 4ERNA 3RS9A 3TSOA 3ZBPA 3JTEA 5ELXA 3PX3A 4BMPB 4WD3A 4GYKA 5A4KA 5H80A 2WC1A 2A7XA 3PR3A 5AK6A 5I4IA 3JQQA 5TQ0A 1C3EA 4EITA 1E58A 5ERXA 1E5DA 2CMFA 1YB4A 3HJNA 5B3KA 1KO1A 5GV7A 1S2GA 2XAUA 2EWWA 2H0QA 4IG4A 3T8YA 4LSZA 1BGXT 1YB1A 1GG9A 3D4PA 1WR8A 3QYAA 4BMXA 3AWDA 3SZOA 5ITZB 4ZTUB 4N6OA 3CRW1 1I1NA 2DCUA 3OBIA 2EKDA 4DJEC 1KKMA 1XLTA 2I2BA 4UUAA 3R9KA 1P5FA 3TTSA 4CMGA 1ZC4A 3MILA 5FO1A 1KEEA 2G5CA 3LIPA 2ANBA 1ZVKA 1MJGM 2HBYA 4NCJA 4B5LA 1PT5A 1GA6A 2FSGA 5HVNA 4IF4A 4JUAA 1K9SA 4C76A 3Q12A 4RHYA 3WGHA 1XU4A 2VR1A 4UVDA 3UMSA 4L9WA 1HE4A 3WDLA 5AXAA 4LJ7A 1XD2B 2CHVA 2DBYA 1K8XB 1ODIA 4D80A 5EZQA 4DSZA 3BTOA 2GVZC 4C1BA 5I45A 4CEJA 2ZP1A 3D3QA 4XE5A 4OX9Y 1M0EA 3A1NA 2ZTSA 5DX0A 5EWLA 3ONWA 4GQBA 3CX6A 2VS1A 5B6IA 1FYVA 3KE9A 4CR8A 1HSOA 2XA9A 3GP3A 4XXHA 4QXMA 5BN3A 3WY9A 1U4NA 2WMYA 1XRQA 1JXQA 3G5AA 4GH5A 4Q4DA 1B74A 2VYQA 1LW6E 5BSTA 4UCXA 5DCLA 5TT1A 1R4MA 1O95C 3LGSA 3RFXA 1RIIA 3VTKA 2GM4A 1WM1A 2VPTA 4OK3A 2O5CA 4XFJA 2VLIA 2GLTA 1H5UA 4D45A 1K98A 3TECE 2CYAA 4NOMA 1HKHA 5ALLA 1MDFA 3GQVA 5E1MA 3CA8A 3PNMA 2TMGA 3NBKA 3IBGA 3NM4A 4RC9A 1L3BA 4LSGA 1V0JA 4N47A 4NEHB 3DFUA 1OLXA 2AW3A 2PH1A 5KNCH 5DCWA 3EZ7A 1XMOB 4E46A 1B8NA 1THTA 1HLFA 3QX7A 1O4VA 4QSMA 1PU2A 3MWKA 4W7IA 3TBHA 3W8NA 3IXMA 4R51A 4ESEA 4F46A 3KPYA 1LK0A 1TM2A 2F43B 1QTNA 3ZWAA 1N5DA 4LXQA 1HKUA 3NEYA 5GOZA 1JPUA 5SY4A 4BRZA 2O8DA 1Y6FA 4XEUA 5JH7F 4BX0A 1P6QA 1PL0A 3T9CA 3T4PA 5JC8A 4MKHA 4ZODA 3WKBA 4FDVA 4NICA 2JIDA 4Q82A 4BMSA 1F5NA 5C7OO 3GPDG 4W9MC 1ISMA 4AJOA 2P30A 4FC7A 2ZPAA 1NN3A 1QX3A 3COPA 1R0SA 4PX3A 1UZUA 2OAQ1 3MF4A 2R4TA 3VKVA 4FBLA 421PA 3JQ8B 3SWWA 4AAYA 3BGSA 2YN4A 1UXJA 2I2CA 1SXJA 3GP8A 4LA4A 1F3OA 3M7IA 3NUQA 1YU6A 3RASA 3RAFC 2PZLA 1U3VA 5SZHB 1DI0A 2Y1CA 4Q39A 5DZSA 5CEEA 2XODA 1UT5A 2FPMA 2PKQO 2QG4A 5B1HA 1T6YA 3AF3A 2Q4TA 3BRCA 3DOEA 1UXOA 1QE5A 3K2BA 4GPD1 2IY8A 1L7VC 4KO2S 4LF5B 1JDSA 4OKIA 2Y2UA 2P8SA 2RG1A 1OAAA 2AEFA 3BMCB 3D6JA 1KQFA 5AKHA 2V8OA 2EZ8A 4FQ5A 3NJ4A 3RC2A 4BNJA 2EJUA 3OUTA 4RFLA 5A0FA 3OJEA 1VL0A 4XDZA 2A9PA 3M5WA 4TL8A 2AC4A 5BT8A 3ZS8A 2P9ZA 2XKJE 1ENYA 3WTBA 1PYDA 3LSTA 1AN0A 2VO1A 7ADHA 2WUWE 1HWYA 2HA2A 3BZBA 1GNPA 1X15A 2C3PA 4RJKA 3L46A 3RT9A 4IMIB 5LJIA 3LF2A 3TIVA 1KJJA 3LQ4A 3AVXA 3VNVA 3BHIA 3SYLA 2SBTA 3S1AB 1UKCA 1Z2AA 1XWIA 2GX6A 3SJ7A 3HV0A 3N86A 5KS2A 1JB1A 3MTEA 3NIGB 1D8AA 1X38A 5B4VA 3NLLA 4HUJA 3R5HA 4NG4A 2WSLA 3ZK9A 3C3KA 5F35A 3RABA 4LFAB 4A0FA 4MKZA 3ESXA 1N4AA 3A9CA 2Q6KA 2PRJA 1N0UA 3KXDA 1U8CB 1DXOA 3FPGA 3E3AA 4NY1A 3NCTA 2B1IA 4FYPA 2IXTA 3FYDA 2ZJFA 1L8XA 221PA 5G0TA 4IHJF 4YJ3F 1VPEA 1XVUA 1C0IA 3CG4A 1OKKD 2FXVA 1CUYA 3GRVA 3H8VA 4UE3S 4Q48A 1V2HE 1TZCA 1ZEJA 1EWQA 3PUYA 1IM2A 3GLFB 3QP9A 3H9BA 3E4CA 4OXKA 4TYPA 3RUHA 4XYBA 3EZ2A 3L8FA 4KGDA 3TSCA 2A78A 4RK5A 4XPIA 5JAHA 2JIOA 2NN3C 3L7DA 2CL0X 4UEOA 4LTDA 2B21A 2D0IA 3ILSA 2HDHA 4P1ZA 1Q7TA 3W6PA 4RKWA 1ZD5A 2RGEA 2WWFA 3I2GA 4QYIA 3RHSA 2W6NA 5AW6A 1O08A 1KMHB 1OA0A 2FDRA 1ZCAA 2YC2C 4V02A 4PONA 2AZTA 3JARA 3JQAB 3RS5A 5BRAA 3HWRA 2QN3A 1H66A 2IYAA 2QG6A 4HTAA 1XZIA 1MOPA 4XWYA 7ABPA 3GRRA 3AMVA 3H16A 1N9GA 2P5TB 3LT0A 3V80A 4DR3B 3K4QA 1GL3A 2I5PO 1GUZA 2RFLA 1ZP6A 3BXPA 3LUHA 1JDZA 3PC7A 5JS8A 2HO4A 3MG9A 3G9ZA 4M49A 4F60A 3ZDDA 2WV9A 3PGLA 1BQEA 2JLXA 4MEJA 4ZQIA 5A05A 3COJA 1V11A 1Y80A 2BFPA 1N0HA 3T34A 3AVQA 2BGJA 1XXLA 3LWDA 3L5OA 4EB6A 1EDZA 1CQJB 1DZIA 4GM1A 2GXSA 1EIZA 4IIFA 5BVGB 1S2OA 2RHLA 1ST3A 3THSA 2KPOA 3TCKA 3EVBA 1SUSA 3LLUA 2C95A 3MGAA 3H84A 3PLNA 1HRDA 2BZSA 4EFMA 2EP5A 1O0CA 1HORA 2BTQA 1BFUA 3RK4A 4D9HA 2Q4EA 4YXFA 5KQRA 1NVMB 2PUJA 2FX3A 3GH1A 3G9QA 3D7RA 3H2ZA 3AV3A 3FI9A 3R6TA 3TVTA 1E1DA 3FBWA 1NMYA 3T7SA 2OCLA 3MGKA 2JLSA 2HREA 1RNLA 2HC9A 5LVAA 4CLXA 5M04A 4L74A 2PLFA 1JFFB 2DECA 4JJAA 1W5FA 5ALYA 3PJFA 4DOMA 3OSZA 1WZ2A 1ONNA 1N6LA 2ZJOA 3WIOA 3R3JA 1CR4A 1XZFA 3PHJA 3V34A 3HWX1 4KR7A 2R8PA 3N0XA 1E20A 2GHQA 4G4SO 2RONA 1RMTA 3NZEA 1J5PA 4JJFA 2XRZA 4IRMA 2QU7A 2WTMA 1N3LA 1ENZA 1TC1A 3MQ4A 1TKBA 3W4JA 4CI9A 4CV3A 5JVDF 3FNIA 2ZUBA 4RV5A 1T3GA 2JLUA 3PNLA 2IE0A 1JT9A 3IIEA 1RPAA 5AIBA 5JEDA 3CVYA 4O02B 2IPXA 3FBTA 4FYIA 2BCEA 3K09A 4N3BA 4ONEA 4LWOA 5J5AA 1MO4A 1Z5GA 2DLNA 2VK2A 3S44A 5EL0A 3VKUA 3PNSA 1VZ2A 3R3HA 4NABA 3OQOA 3CF6R 3HKDB 5GIOE 1VB3A 4P3PA 4CL0A 1WHTA 3CX7A 1U98A 2XD9A 1R15A 1HQKA 4AG6A 1I33A 4UHJA 1NNUA 4XYLA 1SXJC 5FEMA 1KNQA 1NBAA 3G6WA 4GE0A 1F8FA 1NXPA 2RGCA 3HA2A 2X0DA 4FLEA 5K0ZA 1FJXA 2AQHA 3PGJA 5GV8A 1E6LA 1RTTA 2O4CA 2VNHA 4G56A 2MSKA 3HRIA 3GCDA 1EFHA 2Q3BA 2Y1WA 4BKRA 5LXTB 2XGSA 3GNLA 2GUGA 3LBYA 4MW9A 1XFAA 3C70A 2Q8QA 4EEXA 1T9GR 3QPDA 4TLMB 4RH1A 5ECWA 1LI4A 3SYNA 2NZUG 3BWCA 3VJKA 4RD3A 4P7FA 3MIIA 5F2OA 5K3BA 1JDNA 3H0CA 3C74A 4RCYA 2HA7A 5LQJA 5EQJB 1HZJA 4XFKA 2HFJA 2CJYA 1O97C 2Z0MA 2ZVQX 1Z0UA 4CM6A 3KOYA 3OFND 3IP5A 4Z9BA 1GTRA 3B5JA 4FGJA 1TQ6A 2O8EA 3OFSA 5E2BA 3FNBA 2PUEA 4FFVA 2FZ5A 3BS4A 2CXOA 1H2WA 2R1VB 3F3YA 1CR0A 3F9IA 3G2JA 3INYA 3FDIA 3OZDA 1JHMA 4FR2A 1FFYA 1YZTA 1T8RA 2JJYA 3IOBA 3AZPA 1BXKA 3ORYA 4OIMA 1GXSA 3ESQA 2HWUA 2YIVX 3PCTA 4NZMA 5DCUA 2P4UA 5EXPA 5HJ7A 3O1IC 3KJEA 4EG0A 4UTRA 1N9GB 3I58A 3N7UA 3PGXA 5IULC 4O0LA 5AJYA 1H4QA 2WD7B 1E2NA 3B13B 4MP6A 1NW6A 1LPAB 1MENA 3KAPA 4R2LA 4LJLA 2MR5A 2DJ5A 4TTPA 4D4LA 4WN9A 3GJ7A 5EG5A 2JIQA 4JLAA 1TUEA 1Z33A 4YJKA 5J2UF 3CYFA 4R83A 5BSFA 2C2HA 3EQ7A 3HU5A 3DR5A 1KJIA 2DAPA 2FGJA 1OROA 3LVBA 4BVFA 2O57A 3BK1A 1YVDA 1L4LA 3ZVMA 1QIEA 5IXJA 3V4VB 1A9XA 1I0ZA 1K7XB 1M8GA 2QW8A 1DEXA 5BT9A 5CVEA 4DLRA 4D56A 1Y3IA 3EFOA 2FZCA 1RZ3A 5JFGA 1R88A 4IY1A 3FKSD 1NM5A 4FYWA 2JGAA 4X1IA 2HSWA 2MYPA 3PA8A 4G1UC 3L7OA 3HCRA 5K0CA 2V6IA 1XQXA 2GT1A 3BXHA 3JX9A 5ED0A 1Z13A 4ZCTA 2AFIA 2Y4NA 4NPHA 1HLDA 3F7TA 4JSTA 4XOIA 2BP7B 5EWJB 1IATA 1GKYA 2CE2X 3U4DA 4B84A 3GLGA 5F5NA 4M4SA 2Q62A 3SF8B 4B3SB 1EVYA 3KFVA 4XAQA 3C4QA 4RLHA 4RPLA 2BL4A 1XU9A 3G2OA 2FSFA 4AI6A 1BXZA 1ZY2A 3HWSA 3C7CB 1FC0A 3GEDA 2H4ZA 1EWVA 4EUFA 4DUPA 4V3BA 1A04A 3U3ZA 2R7NA 2UKDA 1ZN7A 2CVHA 2JAWA 1RXIA 4NTZA 4RPHA 5CA0B 5JQGF 1BX3A 1U7HA 5TQJA 1F2UA 3BREA 1HPLA 1W4ZA 2AGVA 3AJDA 2P5UA 4RD1A 3FTPA 4PGHA 2C29D 3N2GA 4YV0A 5ETJA 4FPXA 3ZKWB 1T4GA 4ZTBA 5JANA 4ZDJA 2GK4A 2GYVA 2IEYA 5FT9A 2CUKA 4LBVA 3DMFA 1DCFA 2AQ8A 2HSZA 3AW8A 2RI1A 4EG3A 1KO5A 1O58A 1UBUS 3Q40A 2O1SA 4KI7A 4LXTA 5HUQA 3RIEA 4R1SA 5G53C 4IIGA 1CF9A 3VR4A 2OXTA 1EFRD 5DGHA 1L5ZA 2I1LA 3A6ZA 3GOHA 4QELA 3U2QA 1BVUA 1NOKA 5LDHA 3UK1A 4B32A 1HDYA 3SVTA 4ZP1A 5CTJA 2P7HA 5L45A 4MV9A 1M76A 3T5BA 2G5GX 2JGKA 3OC0A 3EZLA 4GEKA 4M55A 4TS9A 4RTKA 4GEGA 5HFAA 4ZYXA 1CVRA 3K05A 1AQIA 2KQUA 3GMDA 3PDCA 4N0PA 5AI8A 3PQ2A 2DX7A 3V8QA 4BNNA 2FSVA 4AMYA 1T5TA 1E9AA 4AMGA 4P4LA 4C3ZA 4F4IA 1IN5A 4Z1MA 2CF6A 3U4QB 5CAEB 4ARAA 1NQVA 4DWOA 3H5AA 4H7EA 4X93A 1M2GA 2Q7OE 3C3BA 4HDAA 3J7AC 3I2IA 1P4RA 2ATVA 2FW7A 2I7DA 4W6ZA 1CY4A 1DIAA 1LBTA 3R9XB 1ICIA 1VB5A 1XYVA 2WY2D 2J46A 5I7SA 1KI2A 1YU9A 3EUEA 1I7LA 4JEHA 2CFIA 2PBRA 1A4RA 4Y2PA 3LBFA 1NBIA 1GUBA 1Y9JA 1CJUC 4FFOA 4ALLA 2V3WA 3LFHA 2ZGVA 3ZWYA 1JVBA 4MWOA 4Z7JA 4J76A 1K4KA 1X7GA 4RHCA 5E6SA 4Z4HA 4DDKA 4NCBA 1KGSA 3IAXA 1K86A 3UJPA 4TV9B 2RGGA 2ZRGA 1DUIA 3BZUA 4DAOA 1Z17A 3N6VA 1JEQA 1ESZA 4XCXA 5IG2A 1XTUA 1VJDA 4UCQA 5DW0A 5ARBA 4U2FA 2XOXA 4GPEA 5TMPA 4D0RA 1J0XO 3Q9LA 4HGQA 3PFWO 1EJ0A 3QA9A 3QOWA 1NQXA 1YAHA 2FEXA 5CHEA 4FD3A 5DWVA 5JCOA 1DMRA 2OYCA 5BMVB 2E4YA 4ZVNA 3PF9A 1WW2A 4RPIA 3WFZA 2EIHA 2F6RA 1GD1O 2F9LA 3CBQA 4UUOA 4RMJA 3EIUA 3KFXA 5FLXA 1ZA2A 1GGKA 3EISA 3HN6A 3N3BC 2H29A 3OE5A 4MO2A 5H8WA 1OYOA 5JDIA 1Z56C 1CXZA 2WVJA 1SAYA 2C59A 4V0NA 2OC4A 1SWWA 1VKNA 2RGWA 4PZCA 2HMVA 4W82A 1SBCA 1UAGA 1QHFA 1M2OA 2OTCA 2VQ3A 5REQA 3ZU4A 3ZLTA 3QOFA 4K26A 3VOBA 4XSGA 5IJWA 1JEYA 4G5HA 3FETA 4M1ZA 3VR5H 4CKXA 2H54A 1VDZA 5KYUB 4QXOA 1EQUA 5JCJA 3ABZA 4RNDB 3AETB 3V46A 4L4XA 1DV1A 3C15C 5D8DA 4D6PA 4AN1A 5A6SA 3IT2A 5KSYA 1CFJA 3Q5GA 3FOAA 2VJMA 1NR1A 2XCOA 1GU1A 1G8PA 5DX1A 3WA7A 2QGFA 2V9ZA 4DA0A 4GRIA 1YBVA 2I4LA 1EG7A 4EQ6A 4QDKA 1XVAA 2JJMA 1SEVA 4YJ2F 2FZLA 1UQTA 2QRHA 1TQ8A 3NEAA 3QSGA 2NSHA 5SZIA 1NNEA 4LN1A 2BKAA 5T57A 1NLZA 1B73A 2V7XA 4I50B 1E3SA 4DBZA 2QTHA 3WQQA 3DDCA 4KIJA 4RD4A 4N41A 4L28A 2GCEA 4PC3A 2WZBA 5JAPA 5MFPA 2LKCA 4OTZA 1AB5A 4GRDA 2XLBA 3OCUA 1R6DA 2HX1A 1AUVA 3KQVA 4N5HX 3HUUA 1JE0A 1B8OA 4M0LA 3FNRA 4PC1A 2HR1A 1YMUA 1K0UA 2BY4A 1H4VB 1AO0A 5AICA 4F4CA 5TARA 1VXRA 4GVPA 1KOGA 4WH0A 2YVQA 1DP4A 1RLTA 2ZB7A 4UHFA 2IBSA 3FYSA 2FFBA 4TXJA 2A0KA 3WO0A 2VPIA 3BF7A 3D2LA 5LB2A 1S1CA 3NH9A 4EVSA 2ZI3A 2C0CA 1WCV1 1Z7EA 3UENA 5EHXA 3ICQB 1NTRA 5F4ZA 2AX3A 1ORHA 1EZ4A 2DWPA 2EARA 1TU3A 4I2NA 5HF9A 3K71B 4WZAB 1GVHA 2VATA 3M1LA 4DGQA 3JZAA 2RAPA 4K9KA 2CHQA 1JIQA 1GFIA 4U7HA 1UAAA 4ZT2A 4G4IA 4DLLA 1QFJA 3UKOA 1N6KA 1PGPA 2V6MA 5KYTA 3OQ1A 3VX4A 4JQZA 3GAZA 2W71A 4RSGA 1IQ0A 3BK2A 3NRBA 3NVDA 4D8WA 5KOHB 4L5CA 3UFBA 2WTAA 1FQOA 4PFKA 4UVHA 1EJ2A 2C5FA 4KFTA 4M8IA 4ZCQA 5EIXA 3QKRB 2Q2OA 4XSHA 4Z1OA 5JASA 1D1SA 1Y1RA 3DKKA 1O1YA 3BWMA 2H8GA 4B6GA 3ORSA 1EA5A 2QTRA 2DERA 1J09A 2NXWA 1N8KA 2P3QA 2VJNA 4OQQA 3VYVA 1S2LA 1GLVA 3DHWC 3W34A 1YR2A 2YXPX 4J1NA 4DCUA 1KMMA 4I8IA 4JYZA 2XUIA 5FDFA 2V9PA 4I99A 4YCCA 3F8WA 3MWDA 3SFZA 1WABA 4PPFA 2VHJA 3UG6A 4H31A 4EHFA 4GI3A 1CZRA 1LVHA 1T2VA 2WVAA 3AHHA 5JY6A 3IEVA 2HQOA 1CLUA 2FN3A 4KR0A 1B1CA 3IJRA 5EXXA 4US2R 4E5DA 2Z3VA 1Y8ZA 3FPHA 1S3IA 3UW1A 4C4PA 2PQ0A 2Q3EA 3I6IA 3FMIA 2QMZA 5AKJA 4XD2A 1ECPA 1G4UR 3B6EA 2Z4TA 4JBGA 2AFIE 4YREA 2WJPA 1P4JA 4JOBA 4ASUD 5TPZD 2B3DA 2Q5QA 3P9YA 5JCPA 3FOZA 4HI0E 1NUPA 4CM8B 3I52A 4G5OA 2VLBA 4W8OA 3AHCA 3IVMA 1OWOA 3O4FA 4BQQA 2WF5A 2KB0A 3EVGA 2OHHA 3FA2A 3UATA 1FFAA 1USWA 3RKSA 4I6JA 4A3SA 2GASA 4KJZA 3IL2A 1W49A 2ZZMA 3DAYA 1ESMA 3VKGA 5SICE 3GGGA 2FQQA 4RV4A 3TAHA 3IV6A 4HB0A 4KYVA 2NACA 1OBVA 1E77A 4DG9A 2C54A 2W4IA 1OE0A 4S1PA 1T1JA 3CINA 2YQ4A 4NV0A 4HEHA 4OXRA 4WXEA 1G5FA 1JV2B 4EYEA 5C46F 5CDGA 4HAIA 2V7EA 5HQJA 3CF4A 1M5UA 1MAWA 2QNIA 4INOA 4R2WA 5EHQA 2ZWAA 1TAUA 3U19A 1CEYA 4W9RA 4M0FA 4MB2A 2HLDA 1UC5B 2YOGA 2BC9A 3LC7O 3QV2A 1PT8A 4XQEA 3TOZA 1SK8A 3HE3A 1KFEB 3R6DA 1YWGO 4I08A 1QIKA 1OX5A 1Q20A 3OCZA 1MEOA 4S1OA 4YT5A 4H1HA 3AFHA 2P27A 4CR7A 4P35A 1NVKA 2FEAA 1Y8RA 2WKPA 4GXNA 4QWWA 1CDEA 1X3LA 1PG2A 1TUGA 1ZVQA 2NZJA 5GJVC 5B1YA 1UBSB 3WYNA 1C2TA 2IYFA 2X8AA 4PLFA 1DIOB 2P2CA 3PKJA 1L5LA 1GHTA 3FAKA 2EW1A 3F8TA 4O0MA 4PZAA 5SV2A 3TLBA 3U0BA 1YS4A 1CLEA 4JB8A 4BFYA 1FJ2A 4J9VA 1Q83A 2X3FA 4F3TA 1QYRA 2CXRA 2OLKA 2QV7A 1KVRA 1ZMBA 5EPEA 2LCQA 4MUYA 4UTPA 2ZCJA 3K6JA 4HB2A 3Q3GE 4KODA 3MRSA 4LXYA 1Z22A 4NK4A 5CW2A 5BW8A 1OMOA 1GFWA 2OENG 3BE8A 1IG0A 3JCZA 2QZ4A 4MMYB 4OJYA 4B87A 3L7JA 3PDIB 1O54A 4ALNA 5LQNA 3Q10A 3VYUB 3CZ4A 2ERCA 1RC1A 4UNPA 3G8YA 1ZQ1A 1K6JA 4PIMA 4DMFA 1YQQA 4O3MA 3UW3A 4NENA 1SBYA 4U63A 2O5VA 3A7DA 3UWDA 1QORA 5GINE 1UOOA 1LNZA 1KJQA 2BP7A 2WNSA 3L6UA 3P94A 5EWJA 1O0BA 5CDUA 4HQKA 2QIOA 4PYMA 1FW6A 1ZINA 3MMZA 3CG0A 2P9BA 1MW8X 1SU6A 2IV2X 1NQAO 4YWHA 5JW6A 3DC2A 5CFQA 5CM9C 5BNFA 1GNSA 3STHA 5JALA 2BGTA 3WP0A 1EZ1A 3D2AA 1WXQA 3KOXA 4CU5A 5CA0F 3H4VA 1C0EA 3CKMA 5IJAA 4JT9A 3VVMA 4B8ZA 3B6IA 4BP1A 5JJCA 3KAQA 5BMVF 2C0PA 5JS1A 1X7DA 1RDFA 2QVGA 4DY4A 4L08A 2HJWA 4UEJA 1UPFA 1NUUA 3LY7A 5KTNA 3ZQKA 1BKYA 2PMBA 4HP8A 4ZJPA 4BFTA 2HF9A 2VHVA 4PQFA 3RYCB 3EWSA 4XVCA 3TW6A 1ZNQO 2QTZA 1B6GA 4JJIA 3ADBA 4NJEB 1RI4A 4G0OA 1LJUA 4UVEA 4FSHA 4QBKA 3IBTA 1UXHA 1H85A 3JALB 2FWRA 4B0PA 3PDIA 2HBZA 4OOFA 4M7RA 4GXRA 5K8JB 2OCYC 3GEPA 2VTVA 4UNIA 1N7JA 3A0RB 4CQMD 3M9XA 2YCBA 1JHVA 3Q8LA 1RZUA 1J8YF 2PMEA 5K6RA 3BUSA 2WMOB 3CNOA 3TDMA 1OF1A 1GN9A 1ZITA 5IN5A 1LLQA 2IYEA 3DLPX 3MTGA 1OGYA 1U1FA 3WRYC 2JLWA 3ZKAA 4C89A 3T3GA 4NR0A 5IANA 3HDVA 2JW5A 2A58A 4M0KA 2AZMA 1XAGA 1JQ5A 1H1LB 4FW9A 3HB4X 5EIHA 1CIVA 2LVBA 4KWTA 1Z4NA 3WLSA 3REQB 1RQGA 4B3BA 1G38A 2GDJA 4BTVA 5LP6F 2PZMA 4J3JA 1QP7A 1JR6A 3CTMA 4W1SA 3DLCA 2CV2A 2J85A 2JFXA 5A6VA 5KYNA 1L5KA 5FBRB 2ZQ5A 4DDVA 2C9CA 5K0JA 1G8FA 5GONF 1ZAYA 1J97A 4LWPA 4ID3A 4MCAA 4WI1A 4WXRA 5LP1A 1QO0D 1HA3A 1XCMA 1M1ZA 1Z0ZA 2V5UA 3FPFA 3FZYA 4UU1A 3TJZA 1HQCA 2QN8A 5CAEA 3LDHA 2BGUA 4OYLA 3WLAA 1G2PA 2R6CA 2A9QA 2O4UX 4IJQA 2E5WA 3WL4A 4QAQA 1N6OA 1TCBA 3RG2A 4BMZA 4DANA 3O6VA 1QRAA 1UMBA 1Z12A 3U7JA 3UB2A 2Q07A 1ZNYA 4KQFA 1AA9A 4Y2YA 4P83A 2DQ4A 4QFMA 1E2HA 3PNQA 1J8QA 2MSWA 3HCNA 2CDNA 1GSHA 2W6ID 3AI3A 1GZ5A 3HL4A 4S24A 1GRQA 1Y7LA 3L07A 3A6EA 3L7KA 5LXTF 3FZQA 1OXKB 4ND8A 2NU6B 4YP7A 1NW8A 2VPPA 1MV5A 5HKLA 4DG8A 3BWXA 2GTPA 4HPXB 1T4BA 5CG1A 2DHCA 3C14C 3WZMA 1WEHA 3T1HB 3L77A 2O2ZA 1HY3A 4L0MA 3UT5B 4ZN6A 2AHRA 3OT1A 3MJSA 1E6MA 4MXDA 5F2EA 3B1VA 3CPEA 4AJ1A 2N1MA 4XLZA 4YUZA 2YJ4A 3ZZ1A 1HUQA 1R4MB 2B2XA 3BQ9A 4X7RA 4FXPA 5IJXA 4UNQA 4BLSA 5A9SB 1R9GA 1ZH6A 3HXTA 3HSSA 3AR8A 5KHLB 2R5NA 4LBWA 1HF3A 4XZ3A 2NUTB 5MN5A 1IZ9A 1F1JA 4DR7B 3WL7A 3D6UA 3WAGA 1YJXA 2RCYA 4CEHB 1P39A 1PZGA 4HWKA 3ZD9A 1U8UA 1XCOA 3TOXA 2NP7A 2Z2YA 4MDEA 2JH9A 4Q1AA 2Q99A 1E63A 1ADBA 1Q5PA 1SVLA 4GBJA 5A9TA 1GU0A 3QE2A 3FYCA 5IK2A 2FUEA 3AUTA 1QZUA 1R50A 5IAKA 4UPEA 4HS9A 7MDHA 2C4TA 2ISSD 2PA3A 1A9PA 3KR2A 5D3MB 1AXGA 2DFPA 4IH1A 2EATA 1Q0LA 1FP4B 4L4UA 5AO9A 2GEJA 2XNCA 3LW8A 2FN8A 4HWRA 4U9IS 4FS8A 5D7BA 5JOQA 1CSEE 1DX9A 5JMTA 3ZJUA 1GNTA 3A2KA 3U9SA 2XQGA 4KB5A 1BX0A 3KQQA 1IEXA 3B1XA 1DO0A 2CLCX 3O0DA 3UT0A 4KQMA 3NDBB 5IARA 3BEOA 4QOSA 4Z54A 1KWKA 4I7EA 1JA1A 2LWIA 1F6WA 1CRPA 4XYGA 5D3QA 3IESA 4H3KB 1NWCA 5KAMA 2O3QA 4MS1B 1YHYA 3RC7A 2G40A 3LLVA 1UWVA 2WYWA 1QTQA 3DEHA 3VNSA 4OQ4A 1KBZA 1O9GA 3AFGA 3CZMA 5IWAB 3DYIA 2EQAA 4I1OA 4TUYB 3GFTA 5ADVA 1IY1A 1OH5A 4IV8A 5F3DA 5IZ4A 5EAIA 2F9MA 1R6BX 2VC2B 4I4CA 2P1DA 5AMXA 5IBPA 4YRIA 1CUZA 5ADHA 3GGCA 3PXBA 4P3KA 1KIFA 2XTMA 4J3NA 1H0KA 2IS6A 2OWDA 3T0FA 1VG0B 2AMLA 2G3YA 4L8FA 2X2EA 2BFDB 1C1DB 1HGXA 1I1HA 1ZCFA 2B30A 3T38A 4BQIA 3K70B 4MQEA 5ADWA 4RL6A 1U2GC 4BO0A 3PXCX 2ONYA 4JB2A 4JFAA 1LWOA 3EQ8A 1V9SA 1TCCA 1ZGZA 4TWBA 1JKMA 4DV2B 4FB5A 4MW1A 5LOVB 4FYXA 1CB7A 1INLA 5FFMA 4E09A 1UJBA 3GFBA 4F4DA 3BC1A 4HLDA 4MR8B 1G291 1RE0A 3QEMB 1OWMA 1Q1BA 1CY0A 3K16A 1P8AA 2DE0X 1M66A 2VSQA 3NW9A 2OPHA 3W05A 1AUPA 2H1LA 4G97A 1NPDA 4YHHB 1TK2A 1AKMA 3PIDA 5EKTA 2PPVA 3N70A 2JI9A 4M8SA 3WIEA 4WW0A 3RYTC 1ZMXA 1KYYA 5JQWA 1U65A 1YBMA 1YZNA 3IIMA 3T1NA 4DV7B 5ILOA 3OEHA 3GH3A 3J7TA 4FINA 4HNQA 1XVIA 1ABBA 1WKBA 2R6R1 4DIKA 2H9IA 1E0AA 5ES4B 3L40A 4NLLA 4V24A 1J1IA 2QXUA 3ZK7A 4MV1A 3MLBA 1G6Q1 1SHJA 2HA6A 2LDBA 4N5IX 3BGOS 4DJAA 1FSPA 5F3RA 4QUAA 4FR0A 2VHEA 2IGBA 2O2GA 2QRQA 4I1IA 2PT9A 5ANRB 4LF9B 2WJWA 1USVA 2AKYA 4HH3C 2IC5A 5FPQA 3ZEAA 1AJEA 1P3Y1 2ZIXB 1Q11A 1QV9A 2B25A 1XK7A 5GM2A 1CJVC 2ODEA 1NV8A 4OHWA 4X44A 3C24A 3E6AA 3HADA 4PAMA 2Z2XA 3WYDA 2YWBA 3U7IA 5CNIA 4MGKR 2P8JA 4OUKX 4RMGA 2FJPA 1CE8A 3DXXA 3UMYA 4HAWA 2Z30A 5JWOA 1RI3A 4HADA 1Y3AA 4MS4B 5KJFA 2HZBA 2YFYA 3KDPA 4E2YA 1ZO8A 1EEHA 3WLJA 3AUUA 1QLHA 3UFXB 1SBIA 5JD3A 2ZROA 1G8KA 3V97A 4UQOA 1PV4A 4CM5A 3ZH9B 621PA 1AG9A 5E7MA 1ULUA 4MGYR 2Q4OA 4EY7A 1UZLA 3CWZA 1X0VA 5BQFA 1YOVB 2VBIA 4KG7A 5ECDA 2WYHA 5CT9A 4KKVA 4RABA 4Y2JA 2FFRA 4NYJR 1OYYA 2ECOA 1A27A 4LZLA 3TX6A 3WYEA 2P35A 10MHA 3WSWA 2P6OA 5TPWB 4KK3A 4GOXA 4BCBA 3GFRA 4CMBA 2G63A 2Q28A 1K8YB 1LLFA 1YJQA 5J4LA 2H31A 2UXBB 2VTDA 3S2YA 5F76A 2GBFA 3IIKA 4N0QA 4X9XA 1KZGB 4UULA 4AX8A 5P21A 1GN8A 3CUUA 4QQFA 1Q0RA 1F5SA 2GWHA 4DLBA 3BE5A 1EFRA 1EB8A 1M8JA 1Y8QB 4H6PA 2QRLA 4HGNA 3R3WA 2H52A 5CDFA 1TU0A 3RTEA 3PC6A 5JRJA 3F6YA 4IS2A 2CJPA 4LV5B 3N8IA 4PBTA 3UJCA 3ZQ6A 3ZHUA 1H8HD