4IJQA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with [(2-((guanine-9h-yl)methyl)propane-1,3-diyl)bis(oxy)]bis(methylene))diphosphonic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
198
Chain Sequence
b'SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Acyclic nucleoside phosphonates containing a second phosphonate group are potent inhibitors of 6-oxopurine phosphoribosyltransferases and have antimalarial activity
pubmed doi rcsb
total genus 68
structure length 198
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ijqA00
3EFHA 4TWBA 1OPRA 3N2LA 1A95A 1A96A 4RQBA 4P86A 4RHUA 1DQNA 4LYGA 4P3KA 4F8EA 1GPH1 1A4XA 4FYMA 4LZNA 4X44A 4QYIB 1VDMA 5KAPA 5IAOA 1AO0A 3GGJA 1I0LA 2H08A 1DBRA 2H06A 2VFAA 1QCCA 2YZKA 1BZYA 5BQOA 5EUCA 1BD4A 1STOA 5ESXA 1P19A 1I13A 4M0KA 1G9TA 1TC1A 1WD5A 2DY0A 3NAGA 4KN6A 4QRIA 2JI4A 4RHTA 1GRVA 3DEZA 4M0UA 1UFRA 4LZAA 4PFQA 5HKLA 1J7JA 2E55A 3MBIA 4RADA 1A98A 1A3CA 1HGXA 1UPUA 4IJQA 5JSQA 3HVUA 3QW4B 3O7MA 1DKUA 2GEBA 2AEEA 1Z7GA 1ECGA 2PRYA 1L1QA 1I14A 3GEPA 2P1ZA 5BSKA 1G9SA 4ZFNA 2EHJA 1DQPA 4RABA 3M3HA 1O57A 3OHPA 3ACBA 4Z1OA 3DMPA 3G6WA 3LPNA 3ACCA 1PZMA 1Y0BA 1U9YA 2PS1A 1XTVA 4RAOA 2IGBA 4MB6A 5KAMA 2WNSA 3DAHA 4RANA 1QB8A 4LZOA 1ECCA 1QK5A 3S5JA 1V9SA 3KB8A 4QYIA 1VSTA 4P82A 4JLSA 1D6NA 4RAQA 5BQPA 3OZGA 1ZN8A 4RQAA 1XTTA 1ZN7A 1QK4A 1MZVA 2JKZA 4PAWA 1P18A 4OHCA 2H07A 1DKRA 4P80A 4RACA 1ECJA 4RHYA 1CJBA 1XZ8A 4P81A 4X45A 1QCDA 1I5EA 3LRTA 4WN3A 1L1RA 3MJDA 1HMPA 1G2PA 4M0PA 1TC2A 3H83A 1O5OA 2FXVA 3ACDA 2XBUA 5E38A 3OZFA 4S2UA 1NULA 5IPFA 2C4KA 1U9ZA 1BD3A 4P84A 4RHXA 1P4AA 1QB7A 4RV4A 2HCRA 5HIAA 1FSGA 1A97A 1ECFA 1W30A 2JKYA 1ECBA 4JITA 1IBSA 5ESWA 1YFZA 4LYYA 2PRZA 1XZNA 1JLSA 1QK3A 1VCHA 4WMLA 4P83A 5K51A 5BRNA 1JLRA 1R3UA 1UPFA 1P17A 1NONA 1LH0A 1G2QA 1OROA 2JBHA 3GGCA 1XTUA 1ZN9A 5JV5A 1OREA 1I0IA
chains in the Genus database with same CATH superfamily
4TWBA 5JAOA 2YJ3A 4LBYA 1I1NA 4O5OA 4GOKA 2Z4RA 1Q7CA 2OM2A 2EW1A 4YPFA 1F60A 2WUDA 4O2BB 4KXYA 1SU7A 1H42A 4QQFA 3HCBA 5KJ1A 5IG2A 1UH5A 3UJDA 2QQFA 3GP8A 3GJQA 3KJQA 1L2TA 4BQQA 4Y3UA 2EDAA 2GYWA 1MABB 2WHQA 4KQ1A 5DTMA 1J42A 1ZUNB 5ELLA 1RAEA 2A3RA 2Q3MA 4HQ0A 1B42A 4G0UA 2V7QA 5DNVA 2XGOA 2YIJA 4MMXB 4NBWA 2J3KA 3ED1A 5IWCA 2PJDA 2JK0A 3A3PA 4HDOB 1G98A 4MA5A 3DZJA 3VDNB 4JKOA 5AQEA 2A14A 1COZA 1NOJA 3R24A 2V4ZA 1D2CA 3REQB 4G0ZA 3IPXA 3QX7A 3HJCA 5JMPA 5JQGF 2QUBA 2Y99A 2YJ5A 3UYKA 4DQXA 5A06A 1JBQA 5EZ5A 3FLMA 4B2LA 2PD4A 3CO0S 3LRXA 2R1TA 1DBPA 1N5OX 2D4HA 3IYLW 3KZMA 1DKUA 2FSHA 5I48A 4GC5A 1BH6A 3H2YA 4ZO9A 4ZC8A 4A91A 4C0KA 3L0BA 2Z2XA 4L02A 4AO7A 2Z8YA 3HL0A 2HLDA 2B3TA 2XE4A 3K6RA 3LC1O 4IH9A 5F2KA 3UFBA 3F46A 1W76A 2FPXA 2ACEA 4LC9A 1QG4A 4CHTA 5LQRA 1KO1A 3VH3A 4Z4FA 3FSGA 3TRHA 4YGXB 1MX1A 4HZUB 4KODA 2SHKA 3AJDA 4Q4DA 3ROZA 1E2UA 4MYDA 3N6RA 4IJ6A 1V7PC 1RR6A 1TUBA 1EFRA 1V39A 2JGLA 4EY8A 1KVUA 4YXFA 5KU1A 1IEWA 1U3CA 4CL0A 1CS4C 5CDHA 4QVIA 1OZHA 3ZNPA 1JHMA 4HDQB 1P91A 3R1IA 3U13A 5A62A 3D3JA 2GEJA 3FXAA 3GFOA 2OEPA 3ZWPA 1GT6A 2PPVA 5AW0A 4U3JB 4AG3A 3R44A 5JATA 3TEMA 2XEXA 1BAPA 4HDSB 2A9RA 4JLKA 5DMXA 3X1KA 3B52X 1AZLA 4FHCA 4KMSA 4GMDA 2IDZA 1I80A 2XMCA 1NP3A 4ZRMA 2G82A 3L77A 4PPQA 4K3VA 1Z38A 1HE2A 1I8TA 5E4JA 1ZSVA 4H08A 2OGUA 3OIFA 2YVQA 4B82A 1EA5A 2C54A 3FA2A 3SR4A 1XLUA 3K0BA 4XVQA 5DK6A 1ZO8A 5LLSA 3DWIA 3NDPA 4QUGA 5TR9A 4RPHA 4CFSA 4FM9A 2LCIA 3PI7A 4DM7A 1HYGA 4WX2B 2J5RA 4RY2A 4AK9A 4FGZA 1TTTA 2GCEA 2V54A 1BYUA 1NYTA 1UOEA 3MHPA 3MERA 1XZNA 3AEXA 2C7PA 2JB9A 3IPRA 1N8NA 4KGDA 4YMSA 4FYWA 1S0UA 2I2WA 1P5HA 1VI6A 5JNRA 1IPHA 1D2EA 2Z4SA 3QF4A 4G4IA 2R84A 4MDYA 2C61A 3NJ8A 4EG5A 3OLCX 2LGJA 4MIYA 1AO3A 1S2DA 2CBZA 2FWPA 2XLBA 3GEIA 4H17A 5E9QA 2IZ7A 4PSKA 4ZCRA 2K2QB 3IIJA 4BE9A 4RFVA 4FP9A 3EFHA 3ZE9A 1C8BA 3K2EA 4BMYA 1KBZA 2EJWA 1T1JA 1YR8A 2PD3A 5TPZA 4TQ9A 1YC2A 1FX0B 5JJ5A 2QZSA 4X97A 2FUG6 1GIAA 4BFSA 1APBA 2O19A 2A9KA 1AXEA 1JIQA 2FW8A 1KQOA 1IM8A 2B6HA 2M9MA 4JVLA 2H06A 3VV3A 3EZ6A 1ZOLA 3SR0A 1H0SA 4ZKEA 5KOIA 3MJEA 3CX6A 4RGYA 4PSAA 3SBDA 1BD4A 2IPAB 4PLZA 5AHRA 4K0KB 4LV6A 4Z7QB 1Y9JA 1WD5A 4AJ9A 2AZTA 3NAGA 4BWYA 4C5AA 2QYSA 5LXTA 4E7PA 1E4EB 3ROQA 5B6PA 5FPPA 3GRVA 3ER8A 4KPUB 1A88A 2JVJA 821PA 5IW8A 5LR6A 2ZIWB 4YMLA 1PSWA 1U2DA 3BRWD 3GBPA 1L6RA 2GHRA 3JQQA 4Y1FA 4G5SA 3V8PA 3KPUA 1E8MA 3ZWAA 4AKTA 5CAEB 3HRIA 4PIMA 1LFDB 1U0EA 1YDEA 4G0XA 4GEKA 4IR7A 4JU9A 3MWGA 1XYYA 4IWNA 2BFEA 1ZIOA 4UD2A 4EZEA 2JFHA 3ETNA 4MQLA 2ZSFA 4CV1A 1WF3A 2EL9A 2ZCVA 4QU0A 3VR3A 1JHOA 1EDBA 4LQCA 1Q1AA 4U1RA 3SP1A 3ZWQA 4E3WA 2B2XA 4IQ8A 4LJ9A 1P2GA 2BEKA 1GKUB 2QN6A 3I3OA 3FHOA 1JG3A 1BJRE 4Y2HA 1ZY2A 4LW8A 5DM4A 2I6GA 3DEKA 2RARA 3M9WA 3TOXA 4OI0A 1GPLA 3ZC3A 4OL9A 2P11A 5E3IA 3ANXA 2PXXA 1T3GA 1YRWA 3FYUA 3P2MA 4JLSA 4RAQA 4WNAB 2BI8A 4YAJA 2DWQA 2HNBA 2Z9DA 3E27A 3QRWA 2C98A 1JVSA 2YS6A 3CFYA 3G3EA 4ARCA 4MQBA 2C0CA 4DILA 3HVHA 4QYWA 2K87A 2QRUA 5C37A 2QTGA 3HU5A 3OPYI 5E8RA 3M89A 2C5AA 4DPMA 1E7YA 1O5IA 1AKNA 3UM9A 5KNBD 4CL2A 4PYJA 1I33A 3AZOA 3KQTA 1GCIA 1KJQA 3KKQA 3VZSA 4RZSA 5AW9A 4DYDA 3GU3A 4E13A 2QVBA 2TYSB 3JS5A 4PQYA 4TYMA 3PRKE 1P4JA 2LBPA 4W5JA 2Z30A 1Y9DA 3CIFA 4YX9A 3QMVA 3AJ9A 2Y1WA 5BW8A 2GPWA 1PQPA 3JQAA 1PU2A 1LDEA 3EB9A 4DQDA 4QDZA 3GT3A 2VHCA 3F74A 1IN8A 3QVUA 1GGMA 3MD0A 3C0KA 4WD3A 1K66A 1AG9A 2PKCA 4DG5A 1OE0A 4B3GA 1NVTA 2XQKA 1TAHA 5K51A 2W4QA 1XTRA 4I6GA 4EHKA 3I4CA 1TF7A 2O6HA 5DWDA 1YJBA 4H1VA 2FX3A 2PN1A 1AUPA 3LUDA 5AK6A 1U8FO 3MUFA 3UXEA 2OHXA 1JH8A 2YXBA 3R3UA 4J07A 4E5KA 3V00A 4BMDA 2VSNA 1D7AA 2C9CA 2BM9A 4NLLA 5EJGA 4I14A 4EO4A 3FPCA 3TJRA 2ID9A 2YY7A 2LIVA 4L3VA 4N4AA 3E58A 2GEUA 1EHYA 2C2OA 4P3XA 3SHFA 2F3TA 4GPEA 1CV2A 1Q83A 3LWZA 4MEAA 1DQZA 1TQDA 1FDVA 1O4WA 1PFVA 2B6NA 2N0SA 3BMXA 3MPOA 4LDRA 1QFXA 1XMIA 1Z68A 1CEQA 2DHQA 3EOAI 3IQWA 3K6KA 4HGPA 4DVJA 3LU1A 2HUPA 3LVQE 1C3OA 2JGEA 1FE8A 1MENA 1E1RD 2XNJA 3BRSA 4GFDA 2PBZA 1PTJC 1YIOA 1IZZA 1T2UA 4XVCA 1FVOA 4E6EA 1Z2AA 1DUVG 2QGFA 1AF4A 1TW2A 5DYGA 2TSYB 1KVTA 5M04A 4ND8A 4MVJD 1GQOA 1X8KA 4L78A 4UUMA 3SFVA 3H18A 2FGJA 3N2KB 2Y4OA 1TA4A 2VCHA 1L5VA 1WZEA 3FJYA 5CCEA 2P2LA 3ETDA 2IGTA 1P9LA 3VFDA 4JLNA 5BW6B 4EGFA 5BMVB 3N2GB 1LI4A 1E79D 3T5TA 1H5NA 1NN1A 3QVGB 1ZH6A 4B1FA 3CM0A 1KDOA 1SA0A 5HKKA 2YKGA 2PUFA 1DFGA 2IOFK 1E6CA 4BKQA 4RDCA 5DULA 3FMVA 4JP8A 4B3XA 5CNIA 3TDKA 5BSRA 3PDIA 4PFJA 2GFIA 4B6FA 1HR0B 4NOKA 1H9BA 1SKAA 4KPGA 1YVDA 2NV0A 3KP1A 4AO8A 2WU4A 1KI6B 3JQEA 3E9NA 1JDBC 4H7KA 1UWKA 2ATXA 4L6AA 3IAXA 4XDHA 3EH2A 3LZ6A 2ZI5A 4BUCA 4R6XA 4F1WA 1JMVA 1ACMA 5L3RA 3D5EA 3NIFB 1K88A 2Y76A 3ZVKA 2JH8A 5C8XA 1TJ4A 2F9LA 3U5ZB 4LKRA 1U0HC 2QRPA 1SKYE 1VL0A 4KPUA 1T91A 1XCGB 4BCBA 5KSOA 3E3LA 2A9OA 1KBOA 5HEKA 3VHXA 2OB2A 1T2DA 1EFPB 4RPIA 1ZOPA 5P21A 5JY1A 2WTUA 5GQSA 4ZYTA 5EKXA 1QH0A 4MV7A 1RBYA 3EZLA 1N92A 1ZJYA 5GJVC 1FTWA 4G85A 7REQB 4Q21A 3ZU6A 3FHCB 5K3OA 1E6EA 1JU9A 4OGGA 4TKVB 3UB2A 1G5TA 4K2HA 1Q0SA 4GM0A 3EVCA 5LNK1 1PV4A 2RHBA 1UQRA 4WOJA 3BDIA 4KQGA 1AT1A 2R68A 4KH1A 2WA1A 4F2HA 4O4HA 1NDHA 4YCJA 3LP5A 4X84A 1ZNWA 3TG2A 4M6WB 4H0NA 4F85A 3TSWA 4FONA 1V37A 3RG2A 1GNPA 2HLHA 2XCOA 4MHSA 3PXUA 1ECFA 3UWDA 2A0UA 2ZR8A 3FPSA 4HUQB 4DNOA 2ISCA 4FGLA 3A11A 4JKYA 4NL4H 3OF2A 1FJ2A 4MVJF 5EGNA 3C15C 5BNTA 3PTZA 4RLSA 4B4KA 4KIFA 4FKZA 2VS1A 3ZGZA 4BLRA 2JFXA 1EZZA 1RFGE 2PV7A 3MTEA 3I52A 2ECQA 2JAOA 2BIFA 4K6GA 4M21A 4PYQA 1NUHA 4RYLA 4NP6A 1G16A 5SY4A 3PX2A 2D13A 2NVUA 2YV3A 3OC6A 4HD8A 2DCUA 3I32A 1A2QA 4FZVA 1NVFA 1UQTA 5GZ6A 4D42A 1MB3A 1AKVA 3ZD7A 1Z4MA 3F98A 3IAM6 5DLPA 4Q1CA 1R88A 1GNTA 4S0XA 5T4BA 4FFNA 5JAPA 1GM5A 2ILTA 1KBQA 5H5JA 4GOJA 5LQAA 4MRMB 3IQFA 3MQFA 3Q8KA 1QVAA 2GAFA 2QL9A 3V1KA 3L84A 5FD8A 2YHUA 1U2DC 3DJFA 1A4IA 2GTPA 2P9TA 2RI6A 3GN2A 3JYLA 1M67A 3R5TA 2C3OA 5EESA 5LU9A 4CIVA 4DHWA 1HWYA 1AK1A 1LPBB 3UWPA 3M6UA 3KK0A 1IHYA 1KI6A 1ZIXA 3WLAA 1RQPA 2BE7A 3WRWA 1R8XA 4HRYA 5CFMA 4MR9A 4CODB 3I45A 5C7OO 3IV9A 3CVJA 2B4RO 1FMFA 1RYYA 3BFPA 4FYKA 1U9CA 1J8DA 4LZAA 2IU4A 3F5QA 1ZVKA 3OQ6A 3STYA 1QE3A 3EPPA 1KOLA 2J9GA 1ZL0A 4HGZA 4BNZA 1A3CA 1VRWA 5HIMA 3PDHA 3VAZA 3PC7A 1BYIA 4PZZA 3RRNA 3DF7A 3L7LA 3AKEA 3DNFA 3UIEA 3EAGA 3CX7A 5H0IA 4C30A 1E3LA 3EFEA 1TYBE 1U4SA 3SJUA 4A6EA 1XWIA 5C5DA 1HDCA 4EH1A 1I7DA 2PRSA 2W2NA 5KX5A 1P31A 3FBTA 1HLDA 1CE8A 2FKAA 2PGLA 2MIIA 2RK6A 4K9RA 1CUBA 4K6CA 4KMMA 1QGUA 3T5DA 3AR8A 1JEQB 1NW5A 3HJUA 2AXQA 2R6DA 5AK5A 1RWOA 4KXVA 1OX4A 5F35A 4UUBA 1B16A 3GJTA 1N3LA 2AFIA 2X86A 2G6BA 3AIKA 4G5YA 1KAQA 3EGEA 1J5XA 1TK2A 1M2WA 3BZBA 3A6GA 2WVAA 1PAUA 1LRLA 4UTOA 4YDSA 2NUAB 3TSZA 4RTSA 3P2EA 3OQBA 1E62A 5ULLA 3VPDA 1JGTA 3MB8A 2KBEA 1EXWA 1GA4A 4BB6A 3OZGA 3DFFA 1XRNA 4MUMA 3WWEA 3KR0A 1WV0A 2RCNA 2D4AA 2TS1A 2IYNA 3EXG1 2FDRA 3LL4A 1JSXA 1NM5A 1TEXA 2HF9A 2I78A 2IYZA 2R44A 4FE4A 1HYEA 1YR1A 4JJIA 3FAKA 2ERYA 3HFSA 1Z39A 2B8EA 4FFBB 4MWCA 1AK9A 3EXHB 3K4QA 3C6MA 3KCNA 2VCEA 3F9IA 3OZXA 3PGLA 4BUJA 1PN3A 4H3VA 4UHDA 5IH3A 4DMFA 1UMBA 1LGYA 2W71A 3HO6A 1DC6A 2FEAA 2RFLA 3F5MA 4NICA 2ZRCA 5EKUA 4MP6A 5TGZA 1TK9A 1VG1A 3D7SA 3OKFA 4NCBA 4WZAE 2LVBA 2GJ4A 4KPYA 2BGGA 4ZVUA 5L40A 5CU7A 4GUAA 1R66A 1RACA 2C77A 2PSDA 4LJLA 1NX9A 2BFFA 1PVDA 4XIJA 5TEWA 3FKJA 5TQ0B 1L7RA 3KB6A 4UU1A 1A97A 2N1MA 3MG9A 4M1KA 1YNSA 5EMHA 1KJIA 1MQSA 3CRNA 1AB5A 3ETLA 4UHKA 5IAJA 4XD7D 1PJBA 3VPBA 1CZNA 1F4VA 1FOEB 3BBLA 1GSIA 4IJKA 3OZRA 4OSPA 1CR2A 4TT8A 1FDTA 3QUSA 3RSQA 3W9UA 2QTLA 4MUNA 3L8GA 5KMGA 2I29A 3OQMA 2SNIE 1N2CE 3WGKA 5DX8A 5AOBA 4HV4A 2ZI4A 5FWNA 5D86A 2AXPA 3MJSA 2RGGA 3LCCA 3K5HA 4FDTA 3FCEA 3Q0IA 1PTJA 3R3HA 1H5UA 1A82A 1ZM7A 3NALA 3ILHA 1YACA 2A4KA 2GXAA 3EFOB 1D2GA 1Z33A 3PENA 2O14A 4BXOB 2QUZA 3LYHA 4W8OA 1T2EA 2PO5A 3KZVA 5I51A 4HZIA 5CVCA 3A1TA 4DMCA 5ITWA 1Y3IA 4GYWA 5A2QA 4IXNA 3EIQA 1CF9A 4CMCA 1R1DA 1RM0A 3QMPA 4OA5A 3Q8LA 2J9FB 4LJ7A 1PFKA 1E5DA 2MWMA 4PG7A 4BKUA 3BK7A 4OEHA 3RYFB 1TQ6A 2IF0A 5CFNA 2FHSA 2FW1A 1DBRA 2NUPB 2WIGA 3K0CA 2FFAA 2Q0SA 5IT0A 3UJCA 2YWFA 3WQRA 4FB5A 2C5GA 3DE1X 1BN7A 1UBLS 3LT5A 4ZZ0A 1GAQA 4WN9B 5G1PA 2WJZB 1OX4B 2EFDB 2XE6A 3DEFA 5BVGB 1K97A 4NEHB 4GPZA 5T41A 1CRZA 4YAIA 3G9ZA 2P9ZA 4EB6A 4DUGD 3HZRA 1R6UA 2X9QA 9GPBA 4HDCA 2DAPA 5C53B 1JG2A 1UPUA 4NU5A 2NVUB 3DWGA 3SC6A 2PA3A 5IAEA 3M6LA 3P9RA 2OXRA 4UTVA 5HW0A 3L4EA 5JSUA 1SBQA 3PNKA 4W82A 4OKNA 4TKZA 2RSLA 1SXJC 1R5BA 1NMYA 3DOFA 2IKQA 3VKUA 3C74A 2C2XA 1GILA 3WA6A 4F0JA 3VVCA 1US8A 4AIRA 5F3DA 1TXGA 3ORQA 4I08A 2H9YA 1JAXA 4Q03A 4HZUA 4HNHA 3UMVA 1T8WA 4BQEA 4HNRA 4EVRA 4PYNA 2LCQA 2HMUA 3KFVA 4D0NA 4YAUA 1YCGA 3IR6A 3PWZA 2H11A 3EJ6A 3ZE7A 5K99A 1M10A 1X1CA 2B69A 2WWFA 3LVBA 3HNOA 3WYGA 3ZDCA 3VPAA 2UYQA 4JL8A 2WIBA 3QWFA 4RPCA 5ALDA 1JB9A 1JKJA 3KXLA 3K6SA 4LNUA 4RQAA 5KOJB 1ZCJA 1NQTA 1MZPA 4NV0A 2RHOA 3FWNA 4W5OA 3HDYA 4IOMA 2HQSA 4WBNA 3CEAA 1DI0A 2ZB2A 1V41E 4RSMA 5I9TA 3V4VB 4G1VA 3WGQA 1QCDA 5AYVA 4OFBA 1Z0UA 1UJ2A 1LKZA 4TKMA 4BGUA 3T7RA 2A92A 4OM7A 4ZPXA 3DTVA 3GCZA 1JT9A 2QIPA 5JASA 2GZHA 2G04A 3X1YA 3BM5A 4D9FA 3DP7A 1XEWX 5E3JA 5DBOA 4TXLA 4X60A 3R75A 4LN1A 1KA9H 3IGFA 3EDYA 5I7SA 4AZ0B 1VB3A 5ADHA 5KSWB 5G0UA 4Z9FA 3RIEA 2AFIB 5JROA 1P5RA 2XMPA 4ZDIA 2FR8A 1FSGA 4FX5A 2P4QA 3A58B 5FORA 3KV1A 2AKYA 4N0QA 2IIPA 3S1AA 2B4QA 3LGAA 4C88A 1FEZA 4MA0A 1Z0ZA 5SYNA 5C35A 3UJ7A 3TUZC 5TSDA 3ORHA 1TEHA 1ZC4A 4MO2A 3MIIA 3MRXA 8LDHA 1ZLYA 3DOJA 2EC5A 4PXYA 4TN1A 5LSAA 3AF4A 1DU4A 4YV7A 3JCZA 3I76A 5H1YA 3PUHA 2O3JA 1ZN9A 5AKJA 1SC1A 1Y33E 1IQPA 2K2WA 5HJ5A 2H29A 3WZ2A 2ZAOA 5AXAA 4YPOA 3HH8A 5LJIA 3GW8A 3P4XA 4NYIR 1PNOA 5KC8A 2W6CX 3T9BA 3WNQA 2ADMA 4NATA 4X44A 4EI7A 1JR3D 3EZFA 2N75A 3Q8WA 3PFKA 5TJ9A 1RKUA 2XJ4A 3PDJA 3VO1A 1YS4A 2CFCA 2QRKA 1KP3A 2K4MA 3AX6A 1T5LA 4OQ4A 3A1DA 3CR7A 4MQ5A 1Z22A 5FV7A 4QJ3A 4BX3A 5K6RA 4QQRA 4FYJA 2RBEA 4G25A 5TMPA 1NLFA 3D7LA 1DTWB 3PSHA 1ND6A 2MR5A 1N8TA 4W9NC 3ET5A 4MHOA 2WYVA 4RHTA 1UZAA 1ABFA 3TNLA 5IABA 4KE9A 1GKIA 1VJTA 1NVGA 4MRSA 1W581 3IPCA 1MOZA 2C96A 2JDIA 2QTWB 3BWBA 1GZDA 1Z15A 3CNHA 4MUAA 4DLRA 3COJA 1KYXA 1UADA 2B34A 2OBLA 3MAGA 1YL6A 3LV8A 4MCAA 1PL0A 3FGNA 2AOTB 4TL7A 4W4TA 3T1HB 1DKMA 1QTNA 1Z6QA 1NVUQ 2CE2X 1GNVA 4WJZA 1GKYA 3ZDXB 1REQB 3BWVA 4KYVA 1FTGA 3AIMA 4TXMA 3M3PA 5DN6D 1ZUNA 2BFWA 1DAGA 1RXYA 3QVMA 4NAUA 1FSFA 4KWHA 5CLQA 3GAFA 4RK0A 4OMDA 5FHQA 1T4CB 1GITA 5EHIA 4AXBA 4MKRA 2AC2A 4IFTA 2Y27A 3BMNB 3ADBA 2V7GA 1O77A 5FA8A 5A4JA 5A7FA 1KERA 3F1KA 4DCSA 1WQ1R 3L3BA 4YC7A 1FUUA 3K8OE 1DCFA 5REQA 5HCIA 1YAHA 2E7ZA 1A9XB 2X1VA 4D2IA 4RJTA 1JTVA 2ZQ5A 4DSOA 3HB0A 3P26A 3QF4B 3FUXA 3OE7A 1T4DA 3C45A 1K89A 2XWPA 4J0GA 5JAMA 3DUFB 2DH5A 2XXAB 2B0CA 3DOUA 3WIEA 3RV4A 2EJCA 1Y5RA 2H1FA 4FMDF 5IZCC 3WAJA 4L07A 1UBMS 1PKEA 1Q7RA 5CCXA 4BV3A 3UUEA 2A9JA 4DMGA 3QQPA 2PUHA 5CW2A 4BNNA 5LQUA 2W2VA 3Q8XB 2OHVA 1EDOA 1PJRA 4PYMA 4P8RA 2PDAA 5CX4A 1TD9A 2DR3A 5AJZA 2HWUA 2GESA 3UGTA 1E6LA 4NG4A 1NUUA 2ZE8A 4RNDB 1HQCA 3WP0A 4QEZA 1E18A 5K8LA 5JJKA 2K5UA 4AULA 5I9IA 2H31A 3A6LA 3KSBC 1DC4A 1E2JA 4PYKA 3FPHA 4MX8A 5ALPA 1VXOA 4P4SA 4XZ3A 5C5EA 4C7KA 3E3OA 1XSEA 3OQIB 2CUTA 5FEUA 3UHFA 1M9NA 3SBXA 4HB4A 4LVUA 1TJPB 2I1WA 5AI8A 1CDDA 2WF8A 2VPYA 4MYCA 3K8ZA 1H6AA 3KB1A 2HU7A 1YVRA 2JAXA 1J24A 4HLUA 2XODA 3LSYA 4PN7A 1U02A 1IFXA 1G3MA 1JV2B 4O4LB 1KIMA 1H93A 4D81A 1B8PA 4DDKA 5IHXA 3QVKA 4WNAA 5AKKA 3W77A 5IAOA 3P71T 1EUDB 2C03A 5CA1F 1A71A 2BGRA 3G7SA 4II2A 3TIFA 3L79A 5JADA 1K3FA 2OCPA 2IDJA 4ZAFA 2H57A 1JDJA 1RAHA 3E9ZA 3KT8A 3O3MB 4HX2A 1M6HA 1N5RA 3C87A 3KWFA 2QUAA 5IBCA 5FLYA 1VB5A 5AJVB 1G3UA 2BVNA 2K6GA 4R3UC 3FWZA 4L57A 4BNVA 2GZ1A 2E2WA 4GYJA 3RNOA 7ABPA 2PUGA 1EBFA 3N2GA 1WULS 2OAGA 1TM5E 1QVWA 3IBFA 2H2FA 4D3FA 1RS0A 5A03A 2GWRA 1LBHA 2PUBA 4MJLA 3ONDA 3QFCA 1F4PA 1XEAA 2P9YA 3C6XA 4Q9HA 4ASUA 4QODA 3DL4A 2FWAA 4LRSB 1BU5A 1PUXA 2V6GA 1GAWA 4JBYA 2XUOA 5FUBA 5AFSA 1IHUA 2SCUB 3E7DA 3IUMA 2GDZA 1KMIY 1MIOB 4WCFB 3VM6A 3DUFA 2B2NA 2ZULA 4OA8A 3CW8X 5L95A 2BSQA 2FOXA 1F2DA 1XDDA 2JZOA 4KDCA 4Y6QA 4YRLA 1ZSYA 5A9TA 3GLGB 2P78A 4JODA 1EK5A 1SEPA 5G4KA 2DHCA 3GA0A 3OX2A 4KITB 1EPUA 3I2JA 3JQAB 1Q1ZA 5CYFA 4ZO8A 3M7IA 1NUAA 3NBXX 3HE3A 4GZ5A 3V4SA 4F3YA 1LI7A 1YI8A 4GT1A 4ENSA 4MGEA 4S1WA 2XCLA 4CMIA 3QKIA 2G0TA 3QM1A 1JYSA 4S04A 3PFIA 1S2NA 1X2BA 4NKRA 1Q2UA 1YAJA 3QTLA 3UUFA 1PWXA 2QT9A 1QFSA 2TMDA 2VRCD 4D41A 2FR8C 2ZWMA 2V5UA 3FF4A 1OZGA 3NV9A 2HCFA 1YBFA 4LYHA 3RTEA 2C8VA 5BURA 3ZHCA 1C3OB 3EGXA 2JJMA 2XIQA 4ARVA 2VWPA 1OT5A 3L1JA 4C4ZA 7YASA 3T61A 4XUEA 4IJWA 4Q82A 1IZ7A 1JEEA 5JU6A 2IDKA 3QUTA 2V3WA 4BN0A 3AIOA 5FPQA 5KNLA 2HBYA 1NHWA 1R9MA 3W6UA 5A2GA 4OHYA 3U3JA 4GPIB 2OORC 3AOGA 4MIOA 3TJZA 5KNDD 1XTJA 4DR7B 1FS4A 5ECGC 3A1FA 3INTA 2X42A 1OB5A 1QQ7A 2A33A 1KSGA 3ROXA 4ZN6A 4LXUA 1QMPA 4DIBA 1VI2A 3WLKX 4UXJA 3ZNOA 2BGWA 1G4AE 4J3JA 5CUQA 3SJBA 1KZ6A 1R12A 1G8JA 1TD1A 1HC7A 4NCKA 1A77A 5L53A 5ARDA 1NDQA 1SBTA 3PJFA 4MAAA 1GHTA 3ZE2B 4EG8A 5KKCA 2D0OB 2O8DA 4XQGA 2R8OA 3AO0B 4MV1A 1D1PA 1KDPA 1W5EA 2ZSJA 3CG4A 1IQ0A 1BS9A 1ZKMA 1GVNB 2GF2A 2NZYA 1WKCA 3A4TA 3AY7A 3FDZB 4RZQA 2W70A 4QPCA 4JBNA 4W5RA 5ILGA 3VU8A 1OFUX 2HDHA 1OPRA 1Y9ZA 4IFEA 5BNIA 1FBNA 1U7PA 2XQJA 3RC9A 2NP7A 2HGZA 1W94A 2PANA 2H8KA 2C8KA 3A9TA 3WGOA 4YT8A 4Z86A 621PA 4F8EA 5K3AA 4B3TB 1VE9A 1UBJS 2RGUA 3T7CA 2WPDA 1QO0D 3DM5A 4QNMA 4AYXA 1EX1A 1TK3A 1M34A 4D02A 2OGSA 1N3YA 5JMOA 4CVNA 4BB9A 1DT5A 7AT1A 2FN3A 3Q5DA 4M46A 5ALGA 1CQJA 4AY3A 1QE5A 2X0IA 3L7OA 1M54A 4L5JA 2HF8A 1TEZA 4MWSA 1YOVB 4MZXA 2PH7A 1BROA 4AECA 1RQLA 3KEFA 4E0BA 4NBSA 4M0KA 3O8OB 1YO6A 2O2SA 5D85A 3L0PA 3WS7A 2F8TA 1EZ4A 2CXTA 4B7XA 3JWIA 3GFQA 3TW4A 4M0UA 4LTDA 4MKFA 5GTDA 3NM4A 3QY0A 2EV9A 3DM9B 4UM5A 5SV2A 4EHLA 2QYHA 4EW6A 4MS1B 4X62B 1QIJA 3EVBA 3HC7A 3M49A 5DV9A 3V1MA 4CJXA 5FJJA 3U44B 1JQKA 1E1QD 1V1RB 2ZRDA 3IPYA 1GUAA 4DQUA 4Z5XA 5A71A 4X20B 3THRA 1BMDA 3EF1A 3I23A 4DTCA 2ID4A 4CL3A 1YQWA 5KCMA 1CS0A 3GELA 4BVFA 3GAZA 1CIJA 4RTRA 1QE0A 2PSEA 3VNRA 4BNLA 4O4HB 2D6FA 1EUDA 4XJTA 2B30A 3FNGA 2H59A 4RZHA 4B7ZA 1ZICA 4EA6A 1RRFA 1XPUA 1U0SY 1L9KA 1FXUA 2NO5A 3V3KA 1XA4A 2QMYA 4MB6A 4M83A 3TINA 1VJCA 4HDKA 4D4KA 3SIXA 3DV2A 1WVGA 3ITKA 2YUTA 3FSJX 4KR6A 4RORA 3DZCA 4FDUA 1M74A 1X3SA 4PLCA 3UWKA 2HYIC 4BP9A 1GEEA 2ACVA 4CXMA 1FCJA 2WAYA 2NT4A 5KBYA 2C5HA 4OGKA 1QRRA 1SC9A 3BKXA 1ZD4A 4M7OA 4LMAA 5DVZA 5BWOA 1X7YB 3LIIA 1KFCB 2J5QA 1I3OA 2C3MA 4TRMA 1N2ZA 3FSRA 4BFYA 1DEXA 2P5UA 1KEUA 5HNKA 4FFLA 4CEJA 3TWOA 4HCJA 1IXRC 1DRUA 1S7CA 1YH3A 2R8EA 2V4UA 3E22A 3PNOA 3PQDA 1KDTA 1JAYA 2QQGA 1L4MA 5JRDS 1QHIA 3KXIA 1MX9A 4BHTA 5JSKA 4O02B 5CDSA 5ALZA 3WQHA 5AI9A 1B76A 3IVRA 2DECA 1DBSA 2BLNA 2VOEA 4KVAA 4W8GA 3UYLA 2WWIA 5CEFA 3COVA 2VHVA 1SHTX 4MPTA 3KVVA 1DHTA 3U9TA 5IWAB 1HDGO 4AMUA 4BNFA 1TB4A 1Z74A 2PPLA 2D00A 4LWPA 1J70A 1KU0A 3LT2A 3SKXA 1P33A 2OFXA 4BNDB 2IYXA 4UREA 1RXUA 1P7YA 1SPBS 3AGPA 3F97A 4TV9B 4DV1B 3G2MA 1IDN1 4C0BA 1YR3A 1YRBA 1MR3F 1O9HA 4Y1EA 3LC2O 3NYQA 3UQYS 3URMA 3SYKA 2PR7A 3R3WA 3N8HA 4MINA 3W8DA 3VJKA 4ZOCA 1DDIA 3DDNA 5LZ4A 1CRPA 4HN9A 4AZTA 4JVMA 3NNDA 5HVNA 1KI4A 5IC4A 3CSDA 3UMJA 3CINA 2YQ4A 1MA0A 5ICEA 4GZ6A 4CU2A 2FLVA 4XJVA 2PVCA 2IXDA 2I2CA 1H6BA 2I71A 3G9TA 1K7SN 5TDHA 5CFOA 4UDOA 1QGUB 2HA6A 3MN1A 3IERA 3ZBQA 3OF5A 4MLZA 4H6XA 1O54A 1SZJG 3ZV5A 4DIUA 3BXFA 1FB5A 4US1R 4DR3B 5TQ2B 2HU2A 1RLMA 1KWGA 3SFZA 2CK3A 2P68A 3DDWA 4A73A 2ZXFA 1FDOA 3M9LA 3NHBA 2YZMA 4J3NA 4LDAA 2FF5A 3CW9A 1Q74A 2JIRA 4INOA 3SE0A 2VQFB 4A8TA 1U0OC 2GRJA 1E94E 1MCZA 3KHKA 3RAGA 2HIAA 2J6IA 2HRRA 3H0KA 4DE5A 2IXGA 1V7CA 3WB9A 4FZ5A 1FK8A 1U4NA 4TM8A 1CQXA 3A4LA 4I9FA 3L8DA 3RBAA 5CD1A 3SYLA 2H0QA 1DQPA 1KFBB 2HV8A 3NYIA 1Q44A 2AXEA 4PSUA 5DNEA 3MVEA 3WIBA 2IUTA 5I9MA 5DI3A 3TW8A 3ZD8A 1JWLA 5ER9A 3PWSA 2LWIA 2VKQA 2Z9BA 1GQRA 3CHYA 4JBWA 4JEUA 4PG6A 1QLWA 1DCMA 3TH5A 2FSGA 2ISSD 3B7GA 4G0YA 1PG0A 3CRW1 5ELXA 3EFOA 4INPA 2E5WA 5D6OA 2ERXA 4O2BA 3A14A 2RGCA 2OVBA 2OORA 3K7EA 4NCHA 1UKEA 4MS1A 2IYYA 1ODCA 2UAGA 3VKVA 4WCDA 5CBKA 3W5BA 4R9SA 2H07A 2PUTA 4GLBA 2X7JA 3M4XA 2I6TA 4WV3A 2PFKA 3ZKWB 4YR7A 2NUPA 2IIVA 3COWA 1IJBA 2AK3A 2C3PA 2QL5A 3GFFA 4KGVA 2XA2A 3AERA 3OEEA 4FCVA 2XUFA 2HPVA 4EHIA 4PZDA 2A67A 3CRVA 3R3SA 3HWWA 4GLJA 4MV9A 4O2LA 3GRKA 2EBHX 1RDFA 1Y7LA 4HVAA 2EATA 4OREX 2FRDC 3THOA 3U3KA 1U7ZA 4D9MA 1N6IA 2I7TA 1C3EA 2CLIB 4O1MA 4U6SA 3GLHB 5CK5A 4L7VA 4OYRA 4C03A 3WNBA 4ZCQA 1J07A 2DLDA 3L8FA 3PKZA 5EWLB 3SC2A 4EJSA 5KYYA 1CLUA 2RGXA 4WN9A 4YCAA 1L5RA 1X8JA 1Z28A 1V4NA 1JJFA 1U1CA 2A0XA 1PR1A 4B87A 4NWIA 3IAFA 2WY2D 3OFNA 3L1UA 4DUZB 1NI5A 2VDPB 3FPAA 3G7UA 5LMNB 5JZSA 4D0RA 1Y1TA 2Q5JA 2D7JA 4EPTA 3K32A 1QVZA 4XPZA 2VP9A 1P73A 2PUAA 1J56A 1NJSA 4QPNA 1EFLA 1LBEA 2DY1A 2F8LA 2AIRA 4CCYA 4IDAA 5KJFA 5TIIA 2XB2A 1HETA 2HSGA 3RH0A 1E2GA 3ZCQA 4F9GA 4XD7A 4NZPA 4YRSA 1G6HA 1T8YA 2YRWA 3GK3A 4KQ6A 5KVQA 5BMOA 3D81A 5AKYA 1M6WA 2RB5A 5ISMA 1JKJB 4E51A 2HDNB 4DCPA 1RAIA 4KIJA 2A86A 3OCXA 1XOIA 3VJMA 1HT2E 2YWGA 1Y34E 1H65A 2WD8A 4FBGA 1B8NA 2QORA 3E8SA 1GNSA 1A9ZA 2QUKA 5DYWA 5EP2A 4RULA 3O0DA 3G02A 3E4DA 3F6PA 3M5DA 3OI7A 3RC3A 1AQLA 2JCXA 3KJHA 1OR8A 4LBZA 1U04A 3N07A 3E9RA 2UZ0A 3PJGA 1SOWA 1E2MA 1JU4A 4NNPA 4F8JA 1NQWA 2AG8A 1IQUA 3D4BA 3K16A 4A1FA 1GSOA 1CLEA 1JHVA 5HQ3A 3WL8A 3OTGA 1SCNE 3EEIA 3QOYA 9ABPA 5JR3A 1LNSA 5M29A 3THYA 1Z5PA 3FH0A 4UBIA 4DLSA 1R6TA 1G2OA 2GILA 1Q22A 3EGWA 3TR5A 3VNAA 3BMCA 3QG5A 4HLUC 3DMNA 3BL5A 3H4VA 1HKUA 2VT7A 2C1EA 1CK4A 4BEBA 4KYTA 2VDRB 4DSTA 1WB4A 1FRQA 1X42A 2CVPA 2HCTA 2IYSA 3UPTA 3VR4A 2JA1A 3NOVA 1E2EA 1JZSA 3FFTA 4YCMA 1B8OA 3OZUA 5FWXA 2FPOA 1IPFA 3T3MB 4FD2A 2GQ0A 3MOSA 4GXTA 4QDXA 1N32B 5TQ2A 1CSEE 2CDCA 1HDZA 1OWLA 2CLDX 3H2BA 4J2TA 3SQDA 3R7BA 1NG1A 2WFMA 2OCYC 1EVQA 4QOJA 3ZIAA 5EE5B 1DKNA 2EZTA 3ILYA 5FWAA 3RV3A 1TW3A 4N0PA 1EHIA 4MP8A 1WVMA 2RAVA 4FFVA 2ST1A 3QENA 1QIMA 1ZN7A 3WJ2A 1M8FA 2FU5C 2VYNA 4W5HA 5H7XA 2GN0A 2WT8A 2JI8A 3QBTA 3GCDA 2BTQB 3L01A 2OHGA 1C9DB 2GNOA 4BJ6A 3I3SR 5CCBA 3PX3A 1Z7YA 5BT9A 3HCOA 2WD7A 3TTYA 4E15A 5EIEA 4YPVA 3NTVA 4CFZA 3OO1A 2ZM6B 1BE6A 2FWIA 1XI2A 2PVPA 3P94A 4P33A 5DF1A 5EHZA 2V3CC 2A88A 1XR3A 2OGZA 4G8CA 2XZDA 2M1XA 4IY1A 2ZYDA 4RVSA 5ARCA 3M6VA 1EG7A 3RGGA 3TPZA 4IIVA 1JLMA 3A8TA 3BDAA 3NI2A 1DKLA 3NRCA 1UZNA 3MT7A 3ORFA 1XHEA 2JBAB 4XLZA 5ALWA 3O8CA 3D6VA 5LYYA 2Y67A 3VTZA 4BVHA 4KREA 5B2EA 4N40A 3D3QA 4KH0A 4OHFA 5DYYA 2G1PA 2HT6A 1YD7A 3H97A 4ICIA 2IPMA 2PRZA 3G49A 1JLSA 3G1WA 2PZJA 2YVKA 3LNCA 3HFGA 3QP9A 2TMYA 2XD4A 2GOYA 3N2ZB 4IIJA 4INZA 4IDBA 4IJMA 4JGGA 5EXXA 9LDTA 3X1JA 2O2ZA 3SI7A 2GZAA 3DLIA 4GBGA 4X90A 5B37A 3T41A 4ITRC 1T9AA 3WQBA 1M8PA 3JV7A 3N5CA 1ZLXA 5E3HA 3R4VA 3V8VA 3BTUA 3M6WA 4QXAA 5C5CA 4Z1MA 4HX5A 5F9FA 3PQCA 4PONA 4FWBA 5LA6F 5M7EA 1FPQA 5CYOA 1AC5A 2G4LA 1UIRA 1W2GA 3VV2A 2NV6A 4LMBA 2CVHA 1UPAA 1USVA 1K9SA 2AQHA 2BFDB 4DCOA 1AO0A 2YICA 3SE7A 2P2SA 2V8OA 1E1QA 1QTRA 1X1EA 2QAGB 2C92A 5TMBA 3VBCA 2ZWAA 4UDXX 2PZFA 4D3DA 3KC2A 1HH4A 2QJTA 3LKDA 5BSEA 1EG2A 3OCUA 4F5ZA 1BDMA 1ONBA 3BMNA 4KO8A 4GNKA 1NJ6A 2CXOA 2UZ1B 1EQAA 3CZCA 3EGDA 3HV0A 5IKEA 3PEYA 2XUAA 4PQRA 3PPWA 5E9JA 1LW7A 2VPTA 3AEQB 1XHLA 1QVVA 2GO7A 5FAKA 1W75A 1ZJZA 2AB0A 1J25A 3NBQA 4KQKA 5LU8A 2GBLC 1FMLA 4TYWA 4DV3B 4DR6B 1QPZA 3M70A 3N1UA 2WHXA 4FTWA 5H81A 4ZCIA 3TRDA 1ZH0A 4QDTA 3TXYA 2R60A 2VJPA 4GECA 3AU8A 3A1UA 4MULA 2JAPA 3T34A 1XLVA 2D5IA 16PKA 3BJMA 4DMRA 4P4NA 4OH1A 4C1NA 1A1SA 3GLGA 1C9NA 2KLBA 2Y1FA 4AN4A 2D5CA 1H0RA 1QKKA 3UMCA 4NHOA 2MSKA 3QU9A 1ZUD1 3KQSA 1LDMA 2Z1NA 4PTZA 5LWQA 1MPTA 5EFOA 4ZQIA 5U9CA 1FP2A 4F2WA 4W1PA 4POOA 3F6EX 2HRDA 2Q7OE 4DKJA 4GWGA 1QIIA 4FS3A 1VA5A 3Q3VA 1E0AA 2IYUA 4HHEA 1G3IA 4HQLA 5HX7A 2A1UB 3UUGA 5IU6A 2V0CA 1JDZA 4P4SB 2GHQA 1SOUA 2VTVA 3V97A 3HA7A 1U1GA 4WFIA 2I22A 1CY6A 3TIIA 2WT9A 3ANTA 1R16A 2G7MC 5CH8A 4LIPD 5JDIA 2BHTA 5IC5A 4P80A 3WK4A 2CE7A 3B12A 4R81A 1ECJA 5TY0A 4YMIA 3ZQ6A 4E46A 2AS0A 1FFYA 5FPHA 4MH0R 3HFJA 3THXA 1XNJA 4A10A 1UWCA 2O48X 3EEYA 2VP2A 3ITDA 2HRCA 2L69A 2N9UA 3DL2A 3IT3A 3OZDA 4QUJA 1TZMA 3W4KA 4LZZA 2VYQA 2YN2A 1R4ZA 2RBKA 4O4LA 3WC4A 2NZVG 1FFHA 1CUGA 4M49A 2Q27A 1M6VB 3UVEA 4D74A 3NIWA 2YJGA 5FIUA 2D7DA 1XAJA 2BE9A 3GOQA 2VRCA 1L9XA 1PFWA 3QPAA 5TB5A 4XSVA 4EECA 5CLFA 4QGHA 4TTPA 3L7BA 3DSRA 4KCGA 4M99A 2AEFA 3QVOA 4HNAA 4G67A 4KAJA 2I91A 5EWJB 3DKKA 1SQ6A 1JG1A 1Q1GA 2SCUA 3BXHA 4QBKA 4WCFA 1FNDA 4E31A 2HK8A 4QVGA 2DMRA 3FN4A 1IVNA 2HTFA 5I9BA 4A8JA 1KXJA 1UMCB 3B36A 4YRFA 4U5XA 4ZJZA 1QF9A 4BO9A 1CNEA 3HCEA 3BB3A 4E30A 1RJFA 2JGJA 2NW6A 2WD7B 2Z1DA 1X87A 1HT0A 1VMDA 4R2LA 8OHMA 5CIYA 4YTEA 3GGOA 3F6CA 3WOHA 4F9TA 1W1IA 3KSUA 4JYBA 1MIOA 3IP7A 4IBOA 5H02A 4HP8A 1RABA 4FGJA 3ZG6A 4DCVA 2Q5IA 3KKOA 3REFA 2YMPA 3E5NA 2IV7A 2MMGA 4RHCA 5CT4A 3FWHA 4FFWA 4C0XA 4BQFA 4EZBA 3EAFA 3I0ZA 5CYPA 2RHCA 4NDNE 4GKBA 4EY5A 3KAKA 1OLUA 5JZVA 4P0TA 3FFBA 3FRIA 4EARA 9ATCA 2O8BB 1ZMOA 2DHEA 2HD4A 2JGDB 3PKJA 2Z58A 3W06A 3KR2A 3NZEA 4IEFB 2ZIGA 4FHFA 3PXBA 5IDVA 3VJRA 1TFUA 1RMYA 2C82A 3W2IA 3K0SA 3WO1A 1D1QA 3ANSA 3DE4X 3QE3A 4H2DA 5CAEA 2CDRA 1NVXQ 4UKDA 4DNFA 1A4UA 1DJPA 4ZO6A 5FOVA 3CNQS 3K2BA 1PD0A 3OZCA 4AJHA 2E3JA 3KJFA 3WLOA 3D4NA 2UVQA 4RFLA 2F17A 2RKOA 3GVPA 2NXNA 4K6KA 2FSSA 2QAGA 3KPWA 1H2YA 1XJ5A 3HB4X 4PWZA 2P77A 4UTNA 3D3WA 3CZ5A 2ZEJA 3L82B 4I0WB 4Q4LA 3R0JA 4F5EA 4UEOA 5TRTA 4MWBA 4GEGA 2EYQA 3NATA 2IQIA 5B3JA 5IVDA 3WAKA 2G70A 3PQ6A 1P60A 4OXIA 1CDOA 2ZVPX 3CTMA 1XDZA 1KZHA 3L0SA 3U9SA 3VU1A 5JZMA 5KO2A 1J2RA 4UNIA 3CLKA 2HIGA 3EXHC 3OKPA 3AEQA 4I5IA 1NXSA 4QQKA 3LY8A 4Z4HA 1ICIA 5DM0A 3LK6A 4DGQA 2R3SA 3IC5A 5TX7A 3C5CA 4WFKA 1YR9A 1LNQA 1Z47A 3FNBA 3NR2A 5LDDC 1RHRA 2PWBA 2VDVE 1Y82A 2RHGB 2ZANA 3IKLA 3N28A 4F6LA 2AI3A 5CFLA 4EHHA 3KTAA 3K09C 4NRDA 2WIAA 1QO0A 2F2TA 1NBAA 3RS5A 4F86A 2FP3A 2IZ5A 2CGEA 2WF5A 1X3LA 2LDBA 4KVGA 3MGBA 3OU2A 4PZ0A 3V7WA 4YMUA 1W4LA 3E1SA 4HK4A 3UO8B 4S2EA 2BDEA 3TQHA 3U1VA 1OILA 4HDMA 3RSSA 1UK9A 2FUG1 3HCDA 2I6QA 5AKGA 1UC9A 4JB2A 4M9CA 4Q1DA 3ZEIA 1M34B 1S89A 1GG2A 3DXFA 3LUAA 1J09A 1XELA 1UUFA 3O2JA 1MJHA 2GVZC 3QEMA 5DFAA 3WZLA 4FMCF 2MSCB 1GYQA 1JIUA 4CT5A 1QG2A 2Z95A 1EMDA 5DGDA 5FP0A 4G23A 3TQCA 1KTVA 3BA1A 5FPSA 5L6LB 1VCHA 2P6NA 2D1RA 2BZ0A 1IUOA 3V46A 2IHJA 3DAFA 3DBOB 2F3QA 4ZCMA 2Z08A 2DLCX 3C7DB 4XIGS 3L8YA 2E4WA 2XGSA 4I4TB 3HMKA 2NTEA 3COYA 3DO8A 3GDWA 3OE4A 4RMIA 4UAJA 1BE1A 1D4ZA 1QO7A 3SXPA 3WX0A 4CKBA 4D4GA 2WWRA 4UOZA 3P0IA 4U9HS 2ZRKA 5IJWA 3M1IA 1JR2A 1DWPA 1NW4A 4WADA 2IK8A 2VHYA 5EXEA 5JNUA 3KAQA 4RXMA 5EXSA 4NFSA 1BS1A 1M2KA 2PRJA 3E0XA 3ZLTA 1FFBA 3EFBA 1IN1A 5I7AA 2E89A 2GT1A 3BX1A 5T8KA 3TLAA 3UG7A 4E09A 1V1MB 2Q4RA 3OPXA 4S0ZA 3YASA 1K0FA 4QQ8A 4I2VA 4ZCLA 1XTSA 4DL9A 2HQ1A 2HQRA 4QYMA 4MJ7A 4DZRA 3ORSA 4EUHA 3ZCVA 1RVV1 4M8KA 2HC9A 4BMNA 5JWRA 4LUCA 2FMTA 4V2IA 2A5JA 1KARA 2IL1A 2JI4A 4OB6A 2CF6A 5D7BA 2VJYA 3OCZA 3WP1B 4F5WA 4W9RA 5D1HA 4Y2XA 3HN6A 2EX4A 3EIFA 1I4EB 4WERA 2VNSA 1E5QA 2OZPA 1KJNA 2PK3A 3A32A 3FNEA 1J8FA 2Y1GA 2Z0MA 3UWMA 2FRVA 3WL4A 3O1HB 4N5IX 4IKOA 4MJXA 1ODFA 1QG6A 3CH5A 2OTCA 2PMFA 3I61A 1LX7A 3MJTA 1Z5OA 3TRIA 2JD1A 1VI5A 2EP5A 4R8MA 3VH4A 4DDMA 1ULSA 4W7HA 4B2YA 4DWWA 1F12A 2VL7A 4CF5A 5CVTA 5JDIC 1O9GA 1GGNA 3MINB 1JDTA 4K1XA 4ND2A 2V3VA 3UV7A 1X8XA 2QBYB 4EJ6A 2ZZKA 1OH8A 3JATA 2WA2A 4GOLD 4D9HA 2IUSA 1S02A 2BY4A 3TD6A 1T36A 1CIVA 4LZOA 1C7JA 4Y9TA 3LWDA 4YRPA 2AL7A 5FKJA 1G7SA 1I3MA 2BMEA 3A6FA 4P82A 2JFZA 3DZKA 1ZKDA 4CNQA 4DJEC 4EI8A 1XFAA 4KN8A 3ZIAD 4Y1GA 1B73A 2G1JA 1RLJA 2VRBA 4YN3A 5C1BA 5MGBA 2D3TA 2IH5A 1YDWA 2DWUA 2ZG6A 1OPXA 1U3DA 2NXWA 1QNLA 2FA9A 1TMKA 2GXQA 1E2KA 4WVLA 2C2HA 3RB8A 2CMGA 4QTUB 1PS9A 2FFRA 5JMWA 2B4TO 1JB1A 1N6OA 3ELYA 4E7OA 2A9PA 4D96A 2X1HA 1R0RE 1XU7A 1MV8A 4M6WA 1M2GA 4JLOA 4XUDA 2OD2A 4YV1A 4LRQA 1JDBB 3PP8A 4LK3A 1XTZA 4YJFA 2C4KA 1IHOA 1RFLA 4CDGA 3PHBE 5IJXA 2J87A 1OU0A 1SHZA 4CPDA 4ZYZA 3T1OA 5IDYA 3HUFA 3JSAA 5AW4A 3PUYA 4MPPA 3ZDDA 2XD9A 3DYBA 1CF2O 4R2WA 1GO2A 4CR8A 1WAMA 3ETJA 4K40A 2P6UA 3DNPA 2WU0A 3EN0A 3NBFA 4EA9A 3QKUA 4GR9A 3CVYA 2BSAA 5G40A 3TQSA 1NRXA 4UNRA 2FX2A 1VLMA 2EKBA 3F3MA 3PHCA 1NQOA 1XPJA 2RJNA 3AKYA 1NRIA 4R83A 2WAAA 2QTRA 2QG6A 2ZIUB 2FOLA 4FPXA 4MRNA 4K9LA 1MD9A 1XDGA 2HMYB 2VLBA 4LHWA 5COBA 3BL8A 1YB6A 4HDMB 4F71A 5LIPA 1BHSA 1R27A 3LS2A 1V96A 4I4LA 4OXRA 4D3XA 1Z8FA 1XDWA 2KS6A 3OJFA 2AOUA 2WSBA 3PRHA 4WSOA 4BUZA 4F1JA 5AVVA 3LZCA 2AN9A 3ZWNA 2F3SA 3H75A 4EYQA 3KQUA 4X93A 4BX2A 3KAJA 3K53A 3N87A 1SBCA 3SFTA 3UJNA 1RC0A 3PTAA 3RASA 4J6EA 5ED0A 2CCJA 4FFSA 1E61A 2VNIA 1Z5UA 4PZCA 4QUDA 2Q6OA 3VDXA 5ADWA 4IIBA 1RE0A 2ZUEA 3QXGA 4HH3C 5AP9A 1BH2A 2FN9A 4CMAA 5AJTA 4DCGA 5M5BA 1SUIA 1O95D 1SM4A 4LPSA 1IQRA 1WIWA 3DE2X 1RWVA 1LZLA 4C0LA 3EIWA 3DAOA 2O50A 3OHMA 1KI7A 3H5LA 2RB4A 5CM2Z 3TVTA 1X8LA 2CJXA 5KIAA 1C1YA 1EINA 1OI4A 4QAJA 1MRNA 3Q0EA 3VR6A 1N7HA 1W29A 1ZJJA 5KTTA 1A9TA 1W5TA 1BGXT 3MILA 1GR0A 1HRKA 1AUOA 3H3JA 4MS3A 1ZG3A 5L3SB 5EGSA 1CETA 4Q02A 4RD2A 3AFNA 3THWB 2ZSKA 3GC6A 1Q3TA 3NDRA 1IHXA 1D04A 1N9ZA 2JFFA 2DPMA 4DR5B 3A27A 2AEMA 4MTLA 2VQ3A 3GJ6A 4OHMA 1YGPA 4V1CB 2FPMA 5IJ9B 1P9NA 1XA3A 2GN2A 5F33A 3NMUF 5JXGA 1BXGA 4J8PA 5IKMA 3RRZA 1KS2A 2XYPA 1GAEO 2W2KB 4HDNB 3Q85A 3P8ZA 3A37A 3T99A 2ZS7A 5FOXA 3WIVA 2DHDA 1ODKA 4LDZA 5GONA 1XDUA 4UNQA 4J90A 2VNKA 4ARIA 4ZOEA 4D5EA 1YV9A 2ZE5A 4P0PB 4L5CA 1CCWA 4HYYA 4P81A 3D7NA 4PZ9A 4DA7A 1K4MA 2G8NA 3CISA 2OOSA 2FMUA 3O92A 3C1OA 2D2VA 2JIMA 1LWOA 2NSYA 4TKLA 2O8VA 1HDEA 1D8AA 2XYGA 2AOVA 2QM3A 3ZBUA 2G72A 3H83A 5HKOA 5HSGA 3Q2KA 3EGOA 4LQDA 1TU0A 2FZ4A 1WSBA 3HSSA 3NKVA 3W34A 4ZICA 3ND8A 4LYJA 4RHXA 3F6SA 1A5SB 1EGVB 1P4RA 4QTZA 1RYNA 3KQHA 2R62A 2CFIA 3V2GA 3KSMA 3T94A 3HLKA 3ZHXA 1XJ0A 4L28A 4X3PA 1KRXA 2IHZA 3LOPA 4CM7A 4J0FA 3LLCA 2Q7XA 4BFXA 1W5BA 3PNBA 1D2NA 1O0BA 3AUKA 2G0NA 5HIIA 2CYAA 1N77A 1YQ9A 3EH1A 4QBHA 1WW2A 3ESQA 2A0YA 2PNJA 2R1ZA 1PD1A 1UPFA 5JH7A 3T3OA 2D8AA 1F17A 1JUDA 3LTEA 3TNFA 1AQJA 3MWFA 5KDDA 1NW7A 2PX0A 3H2SA 1H6DA 3QE2A 3FYTA 2GXUA 5A7GA 1PT5A 4P92A 4CT4B 1R74A 2P9HA 5CG2A 2ZI9A 5EI5A 3FIUA 4YQFA 4OP1A 1FU4A 2VP0A 5F9HA 1LLCA 6YASA 1TKCA 2YBEA 4FOPA 4MO9A 1Q77A 4DN6A 2IUYA 2XTMA 4MKHA 2OYRA 3WTCA 4B74A 1EX9A 1NVVQ 5EIXA 3T1TA 4IIYA 4JI0B 4FR2A 3RYFA 1HEIA 1A9XA 4DC9A 4QUIA 1HPLA 3OMLA 1ZK2A 3OPYA 1XPOA 1SVIA 1I0LA 4II3A 4R84A 1SU6A 3ZZ1A 5K8IA 4MR7A 5EPUA 4QPPA 3ZX5A 1GGHA 2AG0A 1MAWA 5JYCA 1NT2A 1ISFA 2G9RA 4RESA 2IFTA 4B75A 5CB4A 3S2GA 4MS3B 2QY6A 1NPTO 4QPDA 5DNCA 1E6WA 2KPOA 2Y6VA 3PXDA 1GRVA 4MGKR 1OXVA 2ZWVA 3C41J 4JIMA 3MT8A 1K7FB 3DLCA 5AJXA 1NGSA 2X2OA 2W6JD 3AESB 1MA3A 1RKQA 4XFJA 5EMLA 1BCSB 2NTNA 2TMGA 5EUQB 1CC1S 2Y9MB 1JEJA 2R8PA 3G17A 4E6PA 1HM5A 4Z0TA 1E6MA 2JKVA 3OZAA 4PE5B 5F3WB 1SELA 2O8CB 4JB8A 1AY0A 3DZDA 1Y3BE 3JAKB 4DV4B 4JH0A 3TMKA 3NP7A 3AHDA 5FNZA 4NS4A 3SS8A 5LFAA 4YACA 4D6PA 4OHZA 1YJQA 2GD1O 3JQ8A 3HEAA 5FFNA 1EUYA 3FTQA 3ZCXA 1RC8A 1ZNZA 1KAOA 4LBWA 1VA4A 4D3ZA 4I3FA 1RWWA 4QDOA 4ZVRA 1U6KA 2J45A 2C0PA 3ADPA 4NBLA 2FPWA 3HU3A 2DFVA 2ES4A 1TVMA 1ZXXA 2IX9A 2OCAA 3EUFA 3LPAA 3V9AA 5K0ZA 1E1KA 5D8DA 1MT0A 5K8VA 5EIWA 1FZQA 3WOVA 2IS2A 2C8JA 2CLSA 4KRYA 4M53A 3OOYA 4OYLA 4OCZA 5HBGA 3DFIA 2W2XA 3H99A 1YC5A 2AJ8A 2IV2X 3TLBA 2BUCA 1TA9A 4IDGA 2VF4X 2WIJA 2JPDA 3OMWA 4EABA 5JI3E 1S01A 3AV0B 1TRKA 4JYPA 1JYEA 2HR1A 1PO7A 4O08A 2EP7A 5KPJA 5B1SA 3EGDB 2WSSA 3EMBA 4MVJG 4MVJI 4N3NA 4PPFA 4R9UC 5AK3A 5E6RA 1FFGA 2AMJA 4OB8A 4RDIA 4ITUA 1FVFA 3AIIA 2G4VA 3P0FA 3THWA 3WGTA 4RBNA 2ZPAA 1TZJA 4H77A 1OIWA 1ZI9A 3HCPA 1OFGA 4WKPA 3SDZA 3UAVA 4R5HA 3OPYB 1ZIDA 1E96A 4H1WA 2AFHA 2DULA 2ODBA 2V97A 4G2TA 3WFIA 2H1RA 2D1YA 5JY6A 2VT6A 3NEYA 3NXSA 4K8OA 2H1IA 2CDBA 4E2WA 1DPGA 2ATCA 4UTPA 3R0IA 4GP9A 1XZIA 1E7SA 4TROA 4TSRA 1JU3A 4YO8A 2BGTA 4LECA 1R0SA 1NONA 1SU8A 4NFHA 1KZGB 4P08A 1XYGA 4A9AA 1MV5A 4KR3A 3ZCUA 5GIOE 4ZVNA 1H3EA 3CEMA 2NYUA 1XZPA 3IJPA 5F2OA 2AG5A 3KHTA 2D2FA 1K92A 5F1OA 4DNQA 3QIVA 1MB0A 3AUAA 4K9KA 1ML4A 2FE4A 2X5KO 4PAMA 5JVDB 2DKNA 1WUJS 1A8HA 1EB9A 2J9ZB 1UPBA 1EK1A 3M33A 2G5GX 3U3OA 5BN3A 2B1JA 5C2JB 2WWYA 1QFYA 1XZCA 1PL8A 2VUTA 2WYIA 3BHNA 1FYFA 4XOUA 3VU0A 4JA0A 2VHEA 3MBKA 4AKEA 3VR5D 2PBFA 1W9HA 2QIOA 3G79A 1VRVA 4WKCA 5ESDA 5THKA 5BYBA 5DHTA 1O6ZA 2YWBA 3OWXA 5BQOA 4K2AA 2Z6UA 3FUTA 3A1CA 3ZGNA 2V7XA 4P32A 2BGKA 1HNWB 1JIJA 4NFYA 2OO5C 1SUDA 2B1IA 2DFNA 2WDZA 2XDQB 3DEZA 2HJGA 1VHWA 3P19A 4RS3A 2IS1A 4V03A 4YRDA 4D3YA 5LXTF 4YT5A 5K03A 3VZQA 1ANKA 1HSZA 2ZFUA 1CKEA 1DTSA 3I64A 3D3KA 2X2PA 3HVUA 2L82A 3TOVA 1NJ2A 3O0TA 1NKSA 4B81A 3S1SA 1YB5A 4OJNA 2C97A 1NNUA 3A70A 3W2TA 4XM2A 3KBOA 3ROTA 3BMQB 2OQVA 1EWTA 1OXUA 2C4WA 1WB5A 3IEUA 4M1YA 4DREA 1G8MA 4CM5A 2Q0HA 3WNZA 3G2NA 5CLIA 5AVJA 3TW6A 1ULUA 2B9EA 2BISA 2QLNA 3E4CA 1UPCA 3HA2A 3LP6A 3SBEA 4ZA2A 3UNXA 4GMHA 1PE0A 1EFAA 4RCVA 5HUHA 3FWPA 2OC4A 3GDHA 3PYMA 2CW5A 5MGNA 2Q2WA 1H8ED 1T6ZA 2VR1A 4PXAA 5FPTA 1GKLA 2PX4A 5THQA 1DAIA 3WHPA 2O20A 1CIPA 4QYIA 4RVOA 1AF7A 4Y0VA 3H5AA 5H9VA 4E3ZA 1GUBA 4KC0A 4C6TA 5MDHA 1RMQA 2BM0A 3GVXA 2OXFA 3TBHA 1F2UB 1QK4A 2JZCA 4KAFA 1ID8A 1MQAA 4OJQA 3NDBB 2ZRGA 2VRNA 3ISJA 4QYXA 1SWVA 5HG0A 4K86A 2IYAA 5LOVF 5JS6A 3AHCA 4WT7A 3D54D 3MCAA 4XIFA 4HAXA 2AZDA 3GJ8A 1PL6A 1U65A 2CLHB 5LC1A 4GGMX 3GFPA 5J2TA 4ETMA 3EXFB 3LKVA 4R7ZA 4W7SA 1GA6A 4GXRA 2L42A 3OKCA 1OF1A 1L1RA 1PW5A 4MP3A 3FPKA 4RK4A 2A0KA 3QLVC 1O6GA 3ZGOA 3EGVA 3CF0A 4YQEA 2G36A 3RFTA 5ADVA 2BHRA 2Q3EA 1MAAA 1RWBA 2XBUA 1VMAA 3MGKA 5E38A 1EE9A 3TL6A 4ADSG 5AICA 2JIZD 3ELDA 1E1LA 4KYUA 1VG9B 1XRLA 3WRXC 1SPXA 2EX1A 1AIPA 4BY9E 3GXOA 3C5EA 2C5BA 1RLOA 1V7QA 2CMKA 5JJLA 3MFYA 3OJEA 1T24A 1E6UA 4FLEA 5LDGA 1H23A 4BB5A 2B94A 3F5SA 1GDDA 4JEIA 2Z3WA 3LIPA 5IVPA 4TWAA 1UK7A 1D3AA 3NHRA 4I4TA 1Q17A 3SG0A 2GM5A 2V4MA 3HADA 4U7DA 2GERA 3Q6NA 5FI3A 1U6IA 2MDTA 1XQYA 1ZUWA 5TJHA 4BRUA 1JE1A 3GO4A 4RIEA 4TSFD 3T7SA 3D0RA 2WIKA 1E64A 3MTIA 4HBZA 2WWTA 5IDXA 3LY7A 1F9EA 4LF5B 5E95A 2B1RA 2X8AA 1XN1A 3VPXA 3CT4A 3ISTA 2Y2VA 3LCUA 1S3GA 3K20A 2XI4A 1KVQA 4QYTA 4O8ZA 4OI4A 4WNIA 1Y4AE 1ZPDA 4OM8A 1Q1QA 3H6KA 2NN3C 2PQ0A 4BO1A 5A5EA 3HM9A 4Y2QA 3R5SA 1Y7TA 5F78A 2CV2A 4QGBA 2QD1A 3MS2A 2M2IA 4DABA 3WK8A 3KQWA 4YRZA 3GRYA 3IKMB 2L17A 1U3UA 5JW6A 3VKHA 3R6TA 3ICQB 4ZHQF 2PL3A 4DJTA 3WXMA 2PSSA 3AJ8A 3MMSA 3UB4A 1OYWA 3KB2A 3PL5A 4EKDA 1E5VA 1OAKA 2AEJA 1I4WA 1TPYA 3DCYA 4RD3A 4CCWA 3L8ZA 4J1QA 4XDZA 3P45A 4H18A 4CEHB 4G07A 5A1JA 3HUDA 2DG2A 4GNRA 1M83A 1YS7A 3B9BA 3PC8A 3QHPA 2IEDA 1NLUA 1OLXB 3RVRA 3O9MA 1ZVMA 4P3PA 1F3LA 2WTXA 4BO8A 5ALHA 4QT4A 3JTMA 3DKIA 1UP7A 4YAKA 1KAHA 2XSZA 4J1SA 2IT1A 2WTAA 3CPHA 4UULA 3C8ZA 3SBOA 4RU1A 4PY2A 3WIUA 1F8YA 4L4XA 3WYDA 1D2RA 1WSAA 4URHA 4HWOA 5JQGB 2AE1A 4UNSA 3E3MA 3N76A 4LOIA 4TZTA 2Q9CA 1BMTA 1I2BA 2IZOA 1M2VA 3U7JA 1ORVA 2VF2A 5DDIP 3AY6A 2C7OA 4XASA 1T5IA 1SCJA 1DX6A 5K2OA 2P2GA 3M5PA 1C3VA 3RSHA 1E1MA 2ERCA 5FA6A 5ER6A 4E07A 3GLKA 3K5PA 2BR5A 3GRFA 3QU5A 4J9UE 3ZY4A 3TAUA 5BSFA 3LD9A 4WBXC 1P1IA 2LTAA 5AT1A 2YIVX 5I7OA 2IGBA 4EFMA 1TX4B 1Z8HA 3UHPA 1G60A 4PWYA 4Q9DA 2ZRHA 4R40A 4EKYA 3GG9A 4CKBB 2ZT7A 4LE0A 2ID7A 1FYWA 3K70B 2Y0PA 3CZRA 4MZDA 4TZ6A 5C8YA 4K6MA 1ZD9A 1HFWA 1ARZA 1JEQA 4A0FA 2COKA 1TO1E 1KHHA 1XRSB 2B21A 4ZOLB 1RXSA 1SCUA 1U2TA 2JGAA 4JOCA 4AO6A 5DPMA 2CNOA 3OD5A 4ANFA 2ZQYA 1W52X 3H1GA 5DWQA 3TI7A 3WBFA 3BMQA 3S2EA 1YZHA 5HYVA 3M4NA 5BT8A 2PWAA 1BMFD 1EVYA 5HCNA 1KVRA 3VI4B 5KYTA 5EZYA 4FHZA 4I1RA 1NBME 2IELA 5WRFA 1L7PA 1U1FA 3LMKA 4ZT2A 5GMOA 1ZK1A 4OQPA 2P3SA 3HTXA 4QDJA 4HXYA 5H3HA 4XWTA 2BEVA 2ZJ1A 2BR4A 3KT6A 4A0QA 5C4MA 2N47A 2PTHA 2PM8A 3NGXA 5CRIA 4BLTA 3KSAC 3I5AA 1AKMA 4W7IA 2VIIA 2J7PD 3DLPX 3S7TA 4NMXB 4TZKA 4BLWA 2WTMA 4DM4A 5AVWA 4LYEA 4NF2A 1ZK0A 2NU8B 5JJCA 1WV1A 3PQ2A 1DBVO 2VHXA 4BPBA 4DCNA 2OSBA 4G0OA 4HEQA 4KTTE 3ZE6A 5ITSA 2BMFA 4E5VA 3KTAB 3LO5A 3O2SB 4KDFA 1LPAB 4A2WA 3HA3A 1KO5A 3D6JA 5CB8A 3OJXA 5CLGA 3G9QA 3G59A 4KGZA 3MINA 3PNVA 5DBEX 2QTCA 1CZRA 1NXOA 5EMMA 1OLXA 5TQ0A 3T6KA 2VRWA 3IXMA 1R4MA 3QXXA 1ZHFA 5FOWA 1XVVA 4DV7B 2P4UA 2WM9B 4J6FA 4I8XA 4DSZA 4B6JA 3F9CA 1RIIA 4HBGA 3IAM1 4Z3KA 3JZMA 2PSHA 3ICWA 4KQFA 3S2IA 5JBNA 3CGWA 2XR1A 3JVIA 4HEJA 4FOTA 1H85A 4RW0A 1U8ZA 1CQJB 4CE6A 1VE6A 3K8YA 1DTEA 2P6PA 1WMFA 1M1UA 4JI3B 3GHYA 1SEVA 1R00A 1EEXB 2CCKA 3MMXA 4YMGA 2QE7D 3L0YA 5HIKA 1P61B 2ATEA 4KV7A 2C4VA 4E21A 1ZGGA 5AIBA 5HMMA 2HIHA 5CNMA 2PT9A 1QZUA 4RDHA 1X19A 3CIOA 4X95A 3EPHA 4Y30A 1VSQA 1UFRA 1DC5A 5CJJA 2Q0QA 3HPQA 1DCKA 1IC6A 1R37A 1RSZA 4NS1A 4EBFA 4UQLA 3F2VA 4UBNA 3ZWDA 2C4UA 3CKMA 3HNPA 3AC0A 2R2AA 2QOEA 1W47A 1JX6A 1UM9B 2W93A 4FI3C 2GAJA 1KY3A 2ON6A 4KUGA 1QGYA 1VLQA 2ONKA 2OCDA 2WYHA 3F9RA 3B3JA 4RM3A 1TJYA 4CG1A 5G0TA 2J5BA 2TRSB 2PXCA 2WR8A 3I58A 4H7JA 4JNKA 2DQYA 2HQOA 3VPFA 1U2GC 1MJ5A 4Q1AA 4UQOA 4Z0NA 3TOSA 2C0QA 4OJYA 1L8XA 1AZWA 1ZVQA 2FWMX 3ENVA 5D51S 3VR2A 3AM1A 1X7HA 1SC4A 1JKXA 3TFQA 2AX3A 2WYWA 5F64A 5DRTA 5FOQA 2YH2A 1UBTS 4BQOA 1KYWA 2O8DB 4TTTS 4AQ7A 2JS7A 5DN9A 3EQ2A 4ZVKA 3SX0A 3TQOA 1M8GA 2HXGA 4A7PA 4ZXFA 4OOEA 1ZK4A 4LXGA 1T0BA 3RVPA 2HMWA 3RRYA 2FKNA 2HADA 4RX1A 2NO7A 4OUDB 1ORWA 4CEHA 4MRMA 3D7RA 3U9LA 3DHNA 1P44A 1VYUA 3AETB 2E1RA 3PF8A 1HDYA 3HZOA 2VOJA 2XWBF 1UP6A 2NO0A 1P5ZB 4AFNA 1QP0A 2W00A 5I3ZA 2GN4A 1YSCA 3EVNA 1U2RA 2BOVA 3WGLA 1RVDA 2ECKA 1GZ5A 4ND3A 1HQYE 4PRZA 5ECWA 3WHLA 4BBAA 4TOIA 4HRAA 4AWXA 2X2EA 1RBZA 1YJ8A 1KTIA 4E5YA 1LK0A 1W49A 2C2BA 5LBTA 2PFSA 4JJFA 1AGNA 4MKGA 5C51B 3DULA 1ZH2A 1YMUA 1L5YA 5U1PA 4RFSB 4CM6A 2ZR9A 4R5MA 4ARAA 1YA8A 5ICCA 4NNOA 4X8MA 4EELA 5GJCA 1TKRA 4XM0A 1XTPA 1K6JA 2A78A 1R0WA 3S68A 3AM4A 2ONYA 4CIDA 4L08A 2R8ZA 4C7OB 3BCHA 4CQLA 4BNKA 8ATCA 5DNAA 5KYKA 1JN0A 4U2CA 3R20A 4QPJC 5B1YA 3HCNA 3JPYA 3V1TC 1Y6GA 5KX5B 2X7HA 3OT4A 1GUDA 2ZRJA 4ZDWA 1ZNXA 3IBTA 4HQNA 4JBGA 1DSSG 4UM9D 3T35A 1P3Y1 1WZUA 2CY0A 3G0CA 4KAAA 1G2QA 2VK4A 3VUEA 2ZM5A 2VSYA 3WLTA 5KWVA 3FPFA 1D8TA 1PI3A 4JP3A 4OBWA 3OPVA 1CERA 4JENA 4U7PB 2VP5A 3AVQA 1M6NA 2EIHA 4B4OA 4D44A 2NU9B 4E1VA 4YRGA 3PC2A 1I0IA 4H4EA 3I5XA 1PFQA 2E6KA 2P30A 4D4JA 3AF1A 4DJDC 2LCFA 5FR1A 4BCDA 4EI2A 1OHHA 4N18A 3PC8C 1WEKA 3S2YA 3TOZA 3ZBPA 3C8UA 3KRTA 3OT5A 4IHJB 2NXEA 4OQQA 3U7RA 4PX3A 1DX4A 5HKAA 2ZIAA 3AGQA 4WLFA 1UXIA 4IVRA 1SCQA 1TYCA 5F5NA 3RC2A 5LUAA 3S2UA 1TJ5A 2HSDA 1C9JA 2DTXA 3STXA 3FUCA 5GONB 1XTBA 4I50B 1Y37A 2G1AA 3UTCA 2C9OA 2YMLA 1HF3A 1UWLA 3LUCA 4NEGA 4C3VA 4B85A 1QO9A 3ZH2A 2GN1A 3FNHA 4EUEA 5K4HA 3DMDA 3AR6A 4B31A 3O8QA 1BCSA 1PK8A 4IZOA 2OV6A 1LPMA 5K3FA 1CUJA 4DG8A 4KR7A 3HZZA 2R25B 1Q12A 3CSUA 3V1YA 3KKEA 4LVOA 5CPBA 4ER7A 2JFPA 2W2KA 4HDNA 3UBMA 2XMSA 3ONFA 1M33A 1PBNA 2YFKA 2PZBA 2Z83A 3IV6A 3OA2A 1ZONA 3OPQA 1ZMBA 2BONA 3NXKA 4DA0A 3J80A 1WEHA 1ZOIA 3A6JA 1AA6A 1C8LA 2HBQA 2ZAYA 1GDHA 1ECGA 1SU4A 2NO9A 2CHFA 1WUKS 1EHCA 3IP1A 1YL7A 3KE8A 3QBEA 1FP1D 3COSA 4YREA 5KWJA 1V16B 1FNCA 1QG0A 3GRUA 4FGUA 5JCOA 4AUKA 4ZFNA 3FKSA 1ISJA 1O58A 1T9CA 2DZDA 2FWRA 4G81A 5CIQA 3NHZA 3T0FA 3V7UA 3CF6R 4C08A 5B3JC 2BI7A 3NORA 4JUDX 4LZWA 2YTZA 4O2AA 1F7UA 1D0VA 3LPNA 2VK8A 4H9GA 3I04M 4N6OA 5T6BA 4CDRA 4DQLA 4DR1B 4DRXA 3DMTA 3GBVA 2W42A 3R3XA 4U7WA 5FYDA 1P5JA 1ULHA 4EB0A 2OZVA 5H4GA 4R8KA 3RHSA 1P0FA 2VSQA 4HAIA 1SCKA 3GMSA 2DETA 2PSJA 4QREA 1NATA 1AJEA 1QYCA 2VT2A 1BKSB 3OLXA 1K8YB 5KI6A 2VDNB 3P2OA 4Q4CA 5AJYA 3ZS9A 3JALA 1FQWA 3NWJA 3K09A 3TQRA 3VSBA 5JH7B 1MXFA 4KK3A 3ZKWA 3IP8A 1SIWA 2QNBA 2V96A 5E0KB 3SM3A 4Y9RA 2UXCB 5HUQA 4N8DA 3AINA 3ICEA 4TL6A 1WHTB 4CQMA 1I2ZA 3I9LA 3WLQA 5C1OA 3DGEC 3FLEA 4MR7B 4MWEA 3CRQA 3RRBA 4HNTA 2PBRA 3AP1A 3GLSA 4WZ6A 5L7TA 5TPWB 5CB4B 4F91B 1H66A 4L74A 1MTZA 5DISB 4BMZA 1MAHA 1OC4A 4HC4A 4LHXA 4B7UA 1NVKA 2V0GA 5ALLA 1FP7A 1BW9B 1ST3A 4MPDA 5C34B 4MHTA 2ZBDA 4RVCA 3ZV3A 3ZWKA 1I4DD 4DQKA 5LDHA 1RD4A 1N7JA 3B8HA 3F7OA 2FLKA 4YAEA 1FTNA 1PRYA 3HKDB 1JLHA 2BGLA 1ZZEA 3AR9A 4ALNA 2W6PA 3WGMA 2ODNA 4MW2A 3H9QA 3PS9A 4OHRA 1K7CA 2R6ZA 4C04A 3NTOA 1QYDA 1DRJA 2O06A 3NNSA 4X61A 4Y2PA 5TC4A 5M34A 1Z2EA 2F3PA 1Z82A 3LT1A 1M1YA 3JVDA 1Y4UA 4RGVA 3AVWA 3GAMA 5BN1A 3ZGXA 3GMTA 4F93B 3TLXA 5KKNB 3L7JA 1RYHA 1GZ6A 4HH0A 4NJMB 3LC0A 1ADJA 3B13B 1NIJA 4URUR 5KYVA 3K5IA 3VRHA 3TCKA 2PGIA 3HJTA 4XM1A 3PLAE 2VHQA 3ROMA 3DLTA 4FC6A 3ZY5A 1JKMA 2GR9A 1P2FA 2JFVA 5KSPA 3DONA 4LE1A 3ESZA 5CPFA 3RO7A 5KVAA 4BNMA 1A4XA 1JE0A 1X92A 2DBYA 2OLJA 3OQIA 2QW8A 3MAAC 1MQ8B 1PYGA 4K05A 1PYDA 3ZY3A 4I36A 5FLEX 3IAAA 4DMKA 3RK0A 4XFKA 5HZHA 1MNQA 2YWXA 1F8UA 5A6SB 2FJ0A 2QD2A 3KT0A 2C4HA 3R7NA 3RS3A 1CEEA 3P20A 1R0LA 1E3JA 4KN5A 2CKMA 4RVGA 4LXIA 2QLTA 4QXPA 1ORHA 5KYWA 2PUEA 2YYSA 1K8QA 2BCJQ 4RADA 1OIVA 1RI2A 1EB8A 4OFWA 1E3MA 4NBNA 3QY9A 5JSQA 2QL7A 1E2LA 2WTBA 1T5TA 4V3CA 1KDYA 5HJ7A 1D5WA 1UJNA 2J9RA 1PQWA 1Q92A 2Q9UA 1BVYF 2XDAA 3BD8A 3LDAA 2QX8A 5C18A 5EWLA 4ZWNA 5JSYA 4O25A 1FFWA 1JIIA 1G7CA 4EYGA 1ESMA 1TEVA 1YCFA 1E32A 1I7LA 1KMQA 3PPIA 4N65A 2M6KA 2VSFA 2FSVA 2OFOA 2R79A 3CEHA 2B8NA 1O57A 3FNFA 3KQYA 1Z7WA 2O57A 3CXUA 4NC9A 4G97A 1Q0UA 5INTA 3ZDEA 1RZVA 1M75A 2XXBA 1P7VA 4EHFA 5ES4B 5FL7A 2KM1A 1Y9AA 1ZD3A 1Y1RA 2CXQA 2W9XA 3C24A 2G76A 3QEJA 3PHHA 3DHWC 1H5QA 4RS4A 4WECA 5HK9A 3WKAA 1IM2A 4U5QA 2B7BA 2VHWA 1W87A 2DSNA 2WI8A 2P9JA 2HUNA 4L3OA 2Q21A 1AOXA 3NVMB 3RFCA 5AW8A 5F5LA 5SYMA 3W3ZB 3IEMA 1NVEA 2VZ9A 2X19A 1IUPA 3JQPA 1N6HA 3MNFA 3EEFA 5JFTA 1YI1A 2LIPA 2I1QA 2ZAMA 3ZWMA 4K6OA 1L5GB 3M6XA 2VF7A 4FILA 4KW7A 1PX0A 2BKUA 2X1MA 2O2EA 2ZJ8A 3JWEA 3ZV6A 5IFKA 5HE8A 3DLBA 2PAAA 1XJQA 3O83A 2CMFA 5A7HA 3DW1X 5HJEA 1YZLA 3LX5A 2I4TA 5FNVA 2IZ0A 1GN8A 2HL6A 4GP6A 2REQA 4XWYA 4Z8YA 3Q3CA 3TNYA 1Y3HA 1XVIA 5KKAA 3VOBA 2AN4A 3CWZA 3QKRA 4FLMA 5F7OA 1U7XA 2W90A 1RPTA 3GMIA 3TE6A 4PR0A 1ZUIA 4IDDA 3DCIA 1G21B 1K8RA 4BX0A 4BIMA 4DADA 2AKEA 2DX7A 2F8MA 1AUXA 2ODQA 4PG4A 1J6UA 5A02A 3LY5A 1I10A 1DRKA 4OHWA 2B5WA 4XEHA 4YJ2B 2XA1A 1VE7A 3EGXB 1II9A 1FDIA 2PWZA 3ZZMA 4LYYA 4NULA 1QK3A 2O2CA 4JJAA 4P83A 5JDCA 1T4GA 1YE8A 1LU9A 2Q6IA 5LD2B 3U60B 3FW1A 4FFRA 3LFHA 2AMLA 1E1RA 4RD4A 5EE9A 1P9RA 1ZCAA 5FWXB 1R6DA 1QANA 4L95C 3RAEC 1EKXA 1UMDB 1E3IA 4EQ6A 3IP3A 3REQA 5GAJA 1GRRA 1CUEA 4Y2GA 4F8YA 2H1SA 4IFIA 4R2KA 4TRNA 1CW2B 4FKBA 2NACA 2XECA 4ND1A 3K6JA 4M0MA 4JI4B 4MPRA 1BDBA 1NVMB 4IICA 3RS9A 2OV4A 3WLSA 2CXNA 1VDMA 1EP1B 2QLLA 1BW9A 2YIMA 4PHGA 4XVHA 2D59A 1QR2A 2OV1A 3ON5A 4KFTA 4RKRA 1Z2NX 3TVDA 3RTCA 4BVJA 2WM2A 2VSXA 2C2GA 2FH5B 1ISGA 4B17A 4RK6A 1GU1A 2BTQA 2XWSA 2YZKA 3EOBI 3PCXA 1DAOA 3D43A 2BUBA 4HWTA 1CBUA 5A6VA 2H2GA 4HB2A 2AHRA 1KDRA 1YRAA 2Y9PB 1NPYA 2P2ZA 4LSWA 4M38A 4Q3KA 5GY7A 3EXFA 5EHQA 3OOHA 5J2TB 2J3QA 3TLGA 5B58C 3T3NA 3IEVA 2EGGA 4DM3A 1K9VF 1XALA 4OBBA 3GJ7A 4PFQA 2R86A 1VIMA 1Z18A 3D64A 4GRIA 1TUBB 4RL6A 4GI7A 1DINA 2BELA 1P3DA 4Z7OB 2PMEA 3LJKA 3G23A 4NYJR 1YZ3A 1ABBA 3DAPA 1RCFA 2DCMA 1RJDA 2CK3D 3EIHA 3KDPA 1A27A 5EIFA 1E3QA 5CXSA 3UMFA 3UMBA 2ONZA 2WP0A 5LNK6 1XMQB 1YR6A 2FCRA 2OAQ1 1I3LA 2OG2A 3DAYA 3HP7A 4CLDA 3OE7D 5G3YA 4RIHA 1DO8A 5LYJA 5KNBA 1ESCA 4ZP1A 4JT2A 3PJEA 2OR3A 3IULA 4YR9A 4JLAA 2C88A 1V1RA 4EW3A 1BMFA 1FSSA 5K09A 1RHKA 1RQXA 4M0LA 3MC1A