4IJQA

Human hypoxanthine-guanine phosphoribosyltransferase in complex with [(2-((guanine-9h-yl)methyl)propane-1,3-diyl)bis(oxy)]bis(methylene))diphosphonic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
198
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Acyclic nucleoside phosphonates containing a second phosphonate group are potent inhibitors of 6-oxopurine phosphoribosyltransferases and have antimalarial activity
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 198
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ijqA00
1VSTA 1O57A 2FXVA 1BD3A 1DQNA 4RQBA 1ECCA 3OHPA 4IJQA 4M0KA 4PFQA 4RHYA 1ECFA 5BRNA 1YFZA 3ACDA 1DQPA 4FYMA 2PRZA 3S5JA 1G2QA 3LRTA 4QYIA 1I5EA 2XBUA 1LH0A 5IPFA 4QRIA 2E55A 4RAOA 4RHXA 1A4XA 3MJDA 5IAOA 2EHJA 1A3CA 1OROA 4LYYA 4P84A 4P86A 1HGXA 1A96A 1ZN7A 2JKZA 1XTVA 3GEPA 1XTTA 3H83A 2H07A 4RACA 4X45A 1UPFA 1QK5A 1NONA 4OHCA 1QCCA 1CJBA 5BQPA 5EUCA 4MB6A 1QK4A 4F8EA 3MBIA 4WMLA 1UPUA 1TC1A 2H06A 5BSKA 1W30A 4PAWA 3NAGA 4JLSA 5JSQA 4M0PA 5KAPA 1BZYA 4RHUA 2P1ZA 3EFHA 1JLSA 4KN6A 1XZNA 3KB8A 1I0LA 1STOA 4RV4A 4TWBA 1OREA 1I13A 4RADA 1G9TA 4LZAA 2HCRA 1UFRA 4P3KA 4RANA 3QW4B 2YZKA 3G6WA 1L1QA 1P18A 3LPNA 4P82A 1D6NA 1R3UA 4S2UA 1ZN9A 1U9YA 5JV5A 1VDMA 2DY0A 4LYGA 5E38A 1ECGA 4P83A 1OPRA 1ECBA 2JBHA 1P19A 4RAQA 2VFAA 4JITA 4P81A 4Z1OA 1NULA 1Z7GA 1QB8A 2PS1A 1J7JA 1DKRA 1GPH1 1Y0BA 3HVUA 1DBRA 1O5OA 2GEBA 2JI4A 5ESXA 3DMPA 4X44A 5ESWA 1QK3A 1WD5A 2AEEA 1JLRA 5K51A 4ZFNA 2C4KA 4RABA 1ZN8A 3GGCA 1XZ8A 2WNSA 1GRVA 2PRYA 1IBSA 1DKUA 2H08A 3OZFA 5HIAA 4RQAA 1XTUA 1I0IA 1ECJA 1I14A 3GGJA 1MZVA 4QYIB 3M3HA 3ACBA 3N2LA 1A97A 1A95A 1G9SA 1PZMA 1QCDA 3OZGA 4LZNA 1VCHA 4P80A 4RHTA 2JKYA 1QB7A 3ACCA 4LZOA 5HKLA 3DEZA 1P17A 1G2PA 1L1RA 5KAMA 1P4AA 1TC2A 2IGBA 3DAHA 4WN3A 1HMPA 1U9ZA 1BD4A 3O7MA 4M0UA 1A98A 1V9SA 1FSGA 1AO0A 5BQOA
chains in the Genus database with same CATH superfamily
2HWKA 4ISCA 4E33A 4RQBA 1Z0ZA 2C9CA 2FJUA 3QKIA 4UM9B 1HEUA 3NYWA 3HL4A 1XAJA 4GKJB 4M0KA 2O8FA 3GRPA 3FMOB 3I1IA 3O3NB 2D1QA 3HKCB 3L92A 1KSFX 5EGSA 2AD5A 2O0HA 3LH5A 1U7WA 5BN5A 2V4MA 2XQGA 4RD3A 5AKYA 2GEDA 3JPWA 2VDMB 4EG7A 1E4EB 4CF3A 4YUAA 4ZJUA 2QMOA 3LNCA 4GICA 1Q6ZA 3P0HA 2X8LA 4MXDA 1IZ8A 3IXQA 4HB0A 3F9RA 4ZOLB 4DYHA 1WEHA 2HRZA 3P7MA 3QNWA 4V0ME 1QJCA 2ZOSA 3C7TA 5K0NA 1A4RA 4QECA 4R9UC 3UV7A 1VBNA 1G55A 5IUKC 4AMVA 3TUJC 3RUIA 2VRWA 1WX1A 3N0RA 3EG9B 4RW0A 5COAA 3PQDA 5EP2A 4MKZA 2YNMC 3PK0A 4O33A 1KEVA 2PJUA 2SICE 5BQPA 4L2IA 1YRYE 4JI6B 2C7VA 5LBUA 3RQIA 5IVPA 1RZ3A 4B3TB 1ZDMA 5ALPA 3RROA 1KVTA 2NNLD 5J9FA 3WICA 4DCMA 3DKKA 5A6VA 3RPEA 3QXXA 3AK4A 3NTLA 4KQ2A 1RI2A 4EP1A 1VIYA 4E15A 2C77A 1L5KA 5I8WA 2GJKA 1UJNA 4FB4A 3M6IA 1SG6A 4Z8YA 3GCGA 3UUGA 4B45A 1DBVO 2VP3A 2VTKA 1N4DA 2PWBA 1VLVA 3GUYA 3HSSA 4MPPA 3FUXA 2A94A 3B1YA 5E0OA 1PR1A 1PDOA 2WPNA 4UNSA 1VC2A 5C1IA 4URHA 1R4NB 3QG1A 2LV8A 1Q1AA 4TS1A 2W2KA 2H5EA 4BVAA 4B3JA 1CUWA 4IS2A 1ULSA 1XVLA 2RONA 1TM5E 3A14A 3DOHA 1PFQA 1YKSA 2W43A 3N1UA 3QU5A 3AKZA 1C3OA 2E4WA 3IIKA 2XWSA 4P83A 1IEQA 3KV3O 4DV2B 5SZJA 4ID3A 2AN9A 1K63A 2HUPA 2W2VA 3CMMA 3QWBA 5ER9A 1OAAA 1PK9A 4FU0A 1P6QA 4MQMA 4RS4A 1NX9A 1VPDA 3OP1A 1PG2A 3IHWA 2FE1A 2X3FA 3HWSA 2P3QA 2QVXX 3HBJA 3KC2A 4RSMA 3VYWA 1QAMA 3LK7A 3BPSA 4KVFA 1I6LA 4MHSA 5CRIA 4Q3LA 2H00A 2IX9A 2YXPX 2OORA 1XTSA 1ZQ1A 3C6ZA 1EWVA 4LGYA 1V8ZA 4Y2HA 3GEIA 4GE0A 3ZEIA 1K3TA 2PQ0A 4BMNA 4OREX 4DLNA 4JXXA 1IJKA 4RZQA 1T35A 4MWTA 3PPIA 4KZPA 3N6RA 3TMKA 2OD9A 2XMGA 3MYRA 1T8TA 2WAYA 2OXCA 4B6JA 3KLPX 5ALHA 3KTDA 2HMUA 2LBPA 3PTZA 1T5TA 2K6GA 4JUCA 2RHHA 4FIDA 3TQRA 5CA1B 2X6RA 5E2IA 3C74A 4X5OA 3WK5A 4Z7NB 4AJ1A 5HTOA 1EXNA 4Q3NA 1N8TA 2BTOA 5AVQA 3PJRA 3T4XA 2R60A 1FNCA 2P0AA 2BKEA 1ZK2A 1WW8A 2O3JA 3ZHRA 3OH8A 1ENZA 4ZIRB 1E5QA 3OEHD 3PZBA 4YI5A 2FF7A 3CF0A 4H7IA 4D4GA 3OQPA 2FW7A 2HC9A 2P40A 2TMDA 1G21B 1SD2A 2B92A 2XB6A 5DCUA 1GCUA 5EERA 3D8HA 3E8MA 5EYPB 4FDVA 3ZBQA 4B48A 5LFAA 1GGJA 2RK6A 4CL3A 1TMKA 4HY3A 1Z16A 3L9XA 3LY7A 8ADHA 4EZIA 4HQOA 4AN0A 4CV2A 2Z6AA 3NH6A 4GKAA 4WW0A 5LCXA 3TX6A 3W6UA 4ACBA 4BLVA 5IK2A 2J3DA 5BMVF 2JLCA 3QTLA 3CPSA 3VNBA 2FZ4A 5TQ0B 2BMWA 4G1EB 2Z08A 3ADDA 1NFQA 4RJLA 1Y1LA 2DLNA 5A1JA 1DBPA 4JN6B 4MCIA 1JWLA 1PWXA 2EHDA 3FMPB 3JYOA 3GY0A 4NBSA 5ITWA 1YVDA 2CLIB 4IMJB 5DHRA 1KARA 2AFVA 2GBFA 3HA7A 5IU6A 1WHSA 5KYTA 1XTTA 1PT8A 2EJVA 1W5AA 4ND3A 4TVKA 2G1PA 3WLSA 1E1NA 4ESHA 4JSTA 4GXNA 3OKPA 4TMXA 2JARA 3OC0A 3WYNA 3MBIA 2DERA 1WJGA 5JFGA 1VJCA 3P52A 1OB2A 1KPHA 1RSZA 2XWJI 4DC0A 4RULA 2JHPA 4J2TA 3EVEA 1P8AA 3EXEA 3RS3A 3ZS8A 5KTPA 2B1JA 2YJGA 4U6QA 3W6NA 4YYZA 4MWGA 1DSSG 5FI0B 2J0UA 3E2IA 3TUIC 2P9BA 2WTMA 3QQ5A 2FN9A 1OZ0A 3DKIA 2X1LA 3BH6A 1J0DA 3LI2A 4X90A 1C1DB 4JU9A 5DASA 1T8RA 5FA8A 1LGYA 1QQ7A 1FUEA 1UKEA 5EMHA 2VF5X 2VQSA 3LPMA 5T3UA 2ZIAA 2EFEB 2GXAA 3BF8A 3OLCX 1P0FA 4FZ3A 2VCHA 1GHTA 5EWJB 2NZXA 3NHYA 1T2AA 1AN9A 3AC0A 2QMUA 2ARKA 1AB5A 3K0EA 2PV0A 4LDZA 4RIFA 4AUKA 3W9SA 4LDRA 1L5FA 2P5YA 3E18A 3JQAA 1EX1A 4IKOA 4J1TA 2OOSA 2W11A 3KQMA 4XI9A 2Z3WA 1WUHS 4GPD1 3EOBI 4M9ZA 3TOVA 1H1TA 3JZAA 3M6UA 4I8XA 3ORYA 4BQPA 3ANNA 3IDAA 3Q10A 1GCGA 1YJBA 1SXHA 4P33A 1ZCFA 4NCAA 5HFAA 2TMKA 2PX3A 4JQCA 4LBVA 4Q4AB 4MW7A 1WD5A 4PEVA 1PKEA 2AQHA 3LFHA 4BLPA 3BE5A 3C24A 4DLAA 3Q8MA 2CXTA 1FJHA 3LT2A 1GFIA 4PICA 5EQTA 4CMJA 3M5DA 1Q0QA 3E15A 1BU5A 1KQOA 1N2BA 2KS6A 2OLKA 1BWQA 2XJ4A 3SHTA 3UKOA 3W8RA 1C81A 2WPDA 2IXTA 3ROKA 3BB1A 4L0QA 1NUTA 2C2YA 5AOVA 4JI8B 5GP1A 1SA0B 1ABEA 5FBRB 2AOTA 3TVDA 2X1HA 2WVGA 3R77A 1JAHA 2JAUA 1F2UA 1GL6A 2RI6A 3GMTA 4IG9A 2VNIA 3OD5A 1IEXA 3A6HA 4YJFB 5D1NA 5JSFA 4FE4A 1IU9A 3ETGA 2GHRA 4K9RA 4YT8A 3ETLA 3VSCA 3QJGA 4GOMD 4DAEA 3KB2A 3B5JA 5EXPA 1VCMA 4DMMA 2N0SA 1VHDA 3B60A 4Z7QB 1ZXLA 1KYVA 4M7OA 1IBCA 2AHOA 4O4LA 4XD2A 4CETA 2OP1A 2XTMA 3CNOA 3MMPA 4OHRA 4JL5A 3S44A 4EPWA 2C2WA 2NV0A 1BWRA 2P6UA 5F76A 5EJ6A 2L2QA 4PZLA 5C9ZA 1FRQA 3AONB 4DREA 3L4SO 3RWMB 5CA0B 1F4PA 1FBTA 2MHCA 3PGXA 4PC1A 4TUYF 3M1AA 5HBRA 4AQDA 3P71T 1KXZA 4TPKA 4DJFC 4HB2A 2Z8XA 1X7GA 1U7PA 1OASA 4MQEA 2E1RA 2VWHA 5GPBA 1LBQA 1O3YA 4X95A 1YJ8A 4OKIA 4EO7A 1J8FA 2C8JA 1F2DA 2BEVB 4UHDA 1E0KA 2IH2A 1BGWA 3L0OA 3QEJA 2X0IA 1JEAA 4TTRA 3CONA 1O94C 2Y71A 3QMMA 4UPVA 4ESEA 5JWOA 4P86A 1ZN7A 1DI0A 3DOFA 4JLBA 1H2HA 3EWNA 2AN4A 5ENZA 4FOSA 1QV6A 3NPMA 1USGA 4UEWA 5E1OA 3RSHA 2UUOA 2J7PA 1T9CA 1TVKB 1ETUA 2M98A 4CPDA 1B41A 2G8NA 2VHYA 3RYFA 4A0FA 2QS9A 2QKYA 3TAUA 4DA7A 4EHFA 4HWTA 2IP2A 2X4DA 1EX9A 2AFHE 3GI1A 1P5ZB 2I55A 3TRDA 4AJ4A 5CXXA 3L7OA 1HNZB 2ZYSA 5EE9A 2BSQA 4LF6B 5JJLA 4F4CA 3KKPA 2V6FA 3SJBA 4J16A 1FP4B 4CKWB 6NULA 3KIPA 4YVFA 1TQDA 1OBHA 4UFPA 5K5EA 1Y3FE 1LI5A 2R00A 3EIQA 1TF5A 1VLHA 2H1CA 3H9EO 3GPBA 3MG9A 1B16A 3MJ4A 3ZI4A 5BN4A 1J2EA 3LLSA 4QM6A 5AK3A 4B79A 2XMPA 1TMGE 1I0ZA 3QYAA 3BTOA 1RNLA 2XHZA 3LT0A 1FOEB 3DBVO 5K0TA 3VX4A 1LDMA 4DPMA 1UP6A 1XQXA 4MINA 2GF0A 2Y66A 1VIAA 4WERA 2OBYA 1JAXA 3QQPA 4G97A 4OYLA 1UQUA 4HBGA 4XUGB 1QB8A 1FSFA 1IAVA 3GLVA 4MGIR 3NKFA 4X1IB 2G70A 3MHPA 5LP6A 1DCFA 1J7JA 2HM7A 2MYNA 2W6MA 2WKWA 3HCNA 1RBZA 3ISVA 3NW9A 3ENZA 4NYJQ 4A15A 1KYWA 1TQ2A 1WUJS 2P9ZA 1JHOA 2OE2A 4FBGA 4DV6B 5F78A 2H65A 3C5WP 3G0BA 2B9VA 3KWMA 4EGFA 4L57A 1HKHA 4C7VA 2PR7A 4TKZA 2CL5A 4UKDA 2JAQA 3OA2A 1P2DA 1ZISA 1RXIA 2F8MA 2CL7X 3IP1A 4FGJA 2SCUA 4AROA 1R0BA 4ZHQB 2J3HA 1H2FA 2EVWX 3FB4A 2H0RA 1EYZA 1Y3HA 2QG9A 3I32A 4RQAA 4X8MA 4BO7A 5G3YA 1L5NA 2AB0A 1AHPA 1CY6A 2D62A 2BR3A 4JP2A 2WT4A 4PVDA 1YZUA 4J4BA 2C96A 3QLUA 4YRQA 2QM7A 4PFSA 5FI3A 4IDPA 1IUKA 2BM9A 2X9VA 3AOEA 3H9UA 1FFBA 3R6WA 4PYQA 1BNCA 5CFLA 4OI0A 1ADCA 3AZOA 4J94A 4NCNA 2ODPA 2X0JA 4ZQFA 2GKGA 3D81A 2NXJA 4Y6PA 3FZYA 2AF4C 1VKRA 4JEUA 4I5EA 1V9SA 1E3LA 1IUPA 2BSAA 2GJAA 1NAHA 1CNEA 1J2RA 5KOJA 3DEIA 3PGKA 2C4TA 1Q7CA 2D7JA 3T7SA 3WDLA 3FMVA 4HVAA 3M5PA 4L4SA 4MTLA 4GLJA 1Y8ZA 3R3XA 3ED5A 3B85A 3ND7A 3OM8A 2QT1A 2V1XA 3B78A 4CCWA 4GP9A 4P9NA 4QOHA 5LDHA 2IITA 1A9RA 4RZXA 3EXIB 4N0MA 1X8LA 3R7WA 1AMUA 2I80A 1ZMRA 3DOJA 3PWZA 1WAMA 2FN7A 2NZ8A 3JQ9A 4K9LA 3UHPA 2OQVA 4OIMA 5HMLA 3UB4A 1MMFB 1CUJA 3H1EA 3I0ZA 5D6OA 3VPDA 4R3UC 1QOZA 1CRZA 3E7DA 3HRKA 2VDWB 1NW4A 4B8WA 4FGZA 2XQJA 3IEXA 2HN9A 5C7IO 3TZEA 4ONEA 4AN4A 2ZRAA 4ZA2A 1KHTA 3TSWA 3GB9A 1Y3BE 5K0CA 3Q6MA 4BU0A 1RWBA 3ZI0A 2VNJA 5ECYA 4R01A 3KQKA 4I5IA 1T5HX 1D1QA 3E03A 1OJLA 3BFPA 3LX6A 3QXJA 4PX3A 4TM7A 3HXTA 1AIPA 1QCCA 2YJZA 1NOIA 2B7CA 1XA4A 1O6BA 2CMKA 2CXXA 1UBTS 3OO1A 4FGSA 3F6CA 1P61B 5NLLA 3ZG6A 3U56A 2AVNA 4B4UA 1OI4A 1TC1A 1A72A 1FRVA 1TM3E 2QVZX 3ZCRA 2PA3A 4AKTA 3CF4A 1S1CA 4J3FA 4BMCA 4MJXA 4EX7A 1OLSA 1OW3B 4PAQA 5FPSA 1QYRA 2Z5FA 4KREA 3LKDA 3LTEA 4MA5A 1KR5A 4V0OA 3LX5A 5K3CA 2ASEA 1FXWA 2R6AA 1YCFA 3BD8A 3KOWA 4KIGA 2AE1A 2MIIA 2OESA 2R1VB 3QLJA 5KHOC 3G6WA 4HZUB 2FCAA 4HG2A 3RLFA 5DRTA 3OFSA 2ZRKA 1R3UA 3WDMA 1VPWA 3L7YA 2JZCA 2F7SA 4YROA 1KIAA 4N65A 2IUFA 4NTZA 6PFKA 2FPPA 1YR1A 3WMRA 1NJ6A 3LP8A 1OLXB 3L07A 1PFGA 5DNWA 5F7OA 2R6GA 2QQ0A 3VXKA 2ZJFA 4NZZA 1ZD9A 4MRPA 3H2JA 5GONB 3O2JA 4NCJA 2C7QA 1MRNA 4CT0A 1A7KA 1EE2A 2X0FA 1OFGA 3C45A 1Z9BA 3QX7A 4MR9B 5K4HA 4O5AA 1DTWB 4G67A 5ALLA 3FYUC 4JUBA 3MQ4A 2I29A 4RZSA 5ESWA 2F4VB 4GG1A 3G02A 4DB2A 2AEEA 3C8UA 3P9CA 2D5IA 4JGIA 4OBBA 4OXKA 4DLVA 2MT9A 2GSDA 5JNVA 4BCDA 3FPHA 3KQSA 2QYOA 1GPMA 4RXMA 3AILA 2W9XA 5HIAA 3SCZA 4FCWA 4AZ3A 4LVNA 2Y68A 3HCRA 3R44A 4LA4A 1QWOA 3U9LA 4YV2A 1VBMA 1R64A 1YZKA 5MGBA 1UBMS 4OEHA 1PF7E 1HZZA 1A9OA 1JFLA 1G8SA 2KSQA 3IELA 4YRGA 1RRCA 1UBGA 3CXUA 4FHCA 2A1TR 3QHQA 4KW7A 2QGNA 3CF4G 3PGVA 4MGEA 1EAYA 2NZVG 3SM9A 2VYVA 4IPTA 3UXHA 2VHUA 2RHGB 4BEBA 2HK8A 3UM9A 1U8CB 2B7BA 3FNBA 4M1QA 3B6EA 4QGFA 3TZCA 4C1NA 4NYMQ 4NZPA 2M6KA 3T06B 1ORIA 3QFHA 3JVIA 4ZZ0A 4HAVA 3QY9A 5GOZA 1IVNA 2B21A 1HZJA 3WE7A 1SIWA 5I45A 1ADYA 1R0SA 2QN3A 4LI3X 2H8GA 3S28A 4MKFA 3W8FA 4DA8A 1PD1A 1YS4A 3ADPA 2QR2A 3OAAA 4JMLA 2X0KA 4IICA 3LUAA 4IIEA 2B0CA 3NH9A 4CZ2A 3L6UA 5EZYB 1GARA 1C8KA 2HQBA 1PT9A 4CRWB 2PJDA 4F4FA 2I22A 3DMYA 2I71A 3HU2A 4Q1VA 3QVGB 4TTAA 4BWGA 3RH0A 3PITA 3FI0A 4D4KA 4QBKA 2YHUA 5D1HA 3A4IA 3NWOA 3PXCX 1PUJA 4UU1A 2XD4A 3N8KA 3AW9A 4FYVA 1RIFA 4LDJA 1SC3A 1HDZA 2I2CA 5KQPA 4CKWA 1NBMD 3D5EA 1HURA 4M0DA 1HGXA 3ELBA 1E59A 1XL1A 1ISSA 1CUUA 3VKHA 3NVDA 2GRJA 4A6EA 2OFXA 4PX2A 1N5DA 3QM1A 1KMIY 2V55B 1TJYA 3CQ9A 3K1ZA 3P9YA 4YFVA 2OENG 3UA4A 1FS5A 1NMYA 2QQFA 4DCPA 3ND9A 4N5DA 4WD3A 4NC9A 1RTKA 5HZKA 3GH1A 1CQWA 1JYEA 1C9NA 4KYVA 2FFHA 5K1ZA 1EGAA 1PTJA 2JJQA 1DKOA 2ZIUB 2PMDA 3R6GA 4I2NA 4W7IA 5CNKA 2HRQA 5KAPA 4E70A 1FTWA 1JEQA 4YP7A 4GI7A 2BWJA 1OWOA 3D1LA 1UPBA 4N8DA 3T5BA 4FGWA 5DLYA 2NU7B 5EHXA 3QVTA 4FFLA 1XJCA 1Z29A 3KDAA 4ER7A 1A71A 3NDRA 4XVHA 1RYDA 3CH7A 1XMVA 1UC4B 4OXQA 4ZOLA 2H5LA 1ZMOA 4ND8A 4Z0TA 3H5WA 1ZIYA 2HHLA 1YGYA 2ZI3A 2EF1A 3E2MA 4RUKA 4UQPA 2M32A 1P91A 1VPTA 4IEFB 3ZDXB 2RGWA 2QJFA 5BR7A 1QHNA 5BW8A 2H1FA 5K0SA 1RHJA 4WOPA 1FFGA 5DHSA 4TL6A 3OT5A 1D3AA 4EVIA 1GDTA 4KMMA 4AJOA 1QKKA 2OC9A 1T1SA 4DV1B 4DEXA 3IRUA 1I33A 3SHVA 4TQGA 2FWAA 5C8DA 3ZR4B 4PYJA 4DR4B 1EDZA 5KYUB 3KQHA 2QE7D 4DS3A 2VSOA 1EFTA 5IUJC 2ZJAA 1JAZA 3LLCA 3ICWA 1SBCA 2PVSA 1LRLA 3I2HA 2QRPA 3HR4A 4MCHA 4KYTA 1RCUA 5DBIA 1JFFA 4K1XA 3JRXA 4CXMA 4NLLA 1SC1A 2Q29A 3F1KA 1I7DA 2B4TO 1HA3A 3EOAI 2AFHB 5B3AA 5A7FA 9LDBA 3TG2A 4Q21A 1Y9ZA 2ZJOA 3JQEA 1HFJA 3NWEA 4JGGA 4P0TA 5JAMA 3FTEA 4Q9HA 3S8EA 4Y2GA 3NJ4A 3LBYA 5FOXA 1VI6A 1XTRA 1ZOLA 1OYWA 4DMKA 1CVIA 3P9PA 4KR2A 1OHHA 2ZBGA 1GOTA 1M1NA 3TSOA 3ZCTA 1JX6A 3AYXB 1U7HA 3UVEA 1MW8X 2LPMA 1NPYA 3SOPA 1Z47A 1PNTA 2INGX 2JFFA 4ECEA 2HPVA 4X00A 2A9RA 3M81A 4G85A 4YCBA 3B12A 1ZRNA 1CRWG 4LGMA 1ZHOA 2OUIA 2Q4TA 4MO2A 1DAMA 1WPQA 2AC4A 2GEJA 4UNQA 2ZWOA 8OHMA 4CM8A 1BMDA 2OV2A 3LT1A 5AKGA 2YDYA 1TIBA 1S7CA 4C4SA 1T0IA 1YC2A 2XXAA 5JAZA 1DJOA 2APJA 2FGJA 1QAQA 2ZTSA 2ZTUA 3SK0A 5F1YA 4ZDJA 3L79A 4WX2B 1UJBA 3EHDA 1ZD1A 4FMDF 4RFSA 3T54A 4BZWA 2ZS8A 3N70A 5ELLA 3SQDA 3IP3A 5AW0A 3A9UA 5COQA 1D2HA 3KZCA 1B73A 2DUWA 3CRRA 1UXKA 2Q1XA 2WEKA 1J39A 3H65A 3G2OA 5ALMA 1XALA 3LCMA 1A7JA 2FZWA 2CV2A 1ZMXA 3P9SA 5ARCA 1OZFA 2PPLA 4KFTA 1Y3DE 3VPSA 4KWCA 3KTOA 2R8RA 1XZJA 1CNMA 3O8CA 1X42A 1ZK0A 2QD5A 2DUNA 5J47A 2VCEA 2C9OA 1CY4A 1FDUA 4WEOA 3UA3A 2CJXA 3QPBA 3B2EA 1UXJA 4MVJP 4DSNA 2NP6A 4Z4CA 2I5PO 2VH2A 3DO6A 1DEHA 3EGOA 2X3UA 3J7TA 4NV0A 1Y7PA 4P3NA 5DWVA 3THWB 5CBKA 4XM0A 2Y2VA 1JLKA 4KN6A 4E5UA 4MUAA 1UMCA 4LXQA 5DO9A 4WLUA 4ZK2A 3KO8A 3ODPA 1E2DA 3JATA 4HYQA 2HK7A 1I01A 4OGGA 2PWZA 1TZCA 3RK4A 1BS9A 2C7RA 1C2TA 2A7QA 2AG6A 2XNDA 2F3UA 3QX8A 3E82A 4MMZB 1MFZA 1UINA 1Z2CA 2CSUA 2Q1SA 1WUKS 2XSZD 3AR4A 3HDHA 1U90A 2QG4A 2PYIA 4II3A 5IWCA 2D7DA 4AURA 2I1LA 5JDIC 1MAUA 1CW2B 4EYQA 1XXHE 3QSGA 5AM3A 1VZ3A 3A1UA 3AEQA 2CFOA 4M4SA 3WAJA 2JGIA 3U81A 3A6PC 2BDTA 3HJHA 4N3GA 4GRDA 4R1NA 5DM60 5KVVA 2O4CA 3OJLA 4MUEA 3W2HA 1L7OA 2IOFA 4YQEA 3RT1A 4LF8B 3HP4A 4DUGA 5JYEA 5K8LA 3Q15C 3IL2A 2W2NA 3QKSA 5TRTA 1IWPB 4IFEA 4QQFA 4FT2A 2CNWD 4EJSA 5FUMA 3QJ5A 2PSFA 2A9PA 1B43A 2V7BA 1LLDA 2H17A 1Z39A 5T67A 4DPKA 5JS6A 4ZAYA 5BWCA 3TW8B 1ZGJA 2P5UA 1LF5A 2XYQA 2QLFA 1XK7A 3AUJB 2V7TA 3ILVA 3O93A 1C14A 4HYEA 5DGHA 3ZBTA 5M7EA 1PFWA 3FI9A 3HN7A 4LVUA 3MD9A 4MQLA 1DAPA 1RXEA 1USWA 2BZ1A 2RCNA 3NB0A 3JALA 5K7SA 2IHTA 3NMUF 1UJCA 2IKQA 3KT8A 2LD4A 4FCVA 3OKFA 3RREA 1DG3A 1JHMA 4E2WA 3KLNA 3R4CA 4X24A 4TXLA 5CT4A 5I9TA 3VV3A 1JXQA 2AEFA 2A1IA 3E9EA 1BAPA 4QLBA 5IFKA 1L4MA 4WWHA 1GTL1 1YQQA 3H0EA 1RWMA 2VJKA 3L04A 5HKLA 1IUOA 1Z36A 1Q7GA 4EB3A 3D2LA 1XKLA 1KF0A 4GMXA 4RK7A 4KQFA 3V6MA 3WMXA 4RTLA 2BFNA 1QU2A 4DGQA 3ICPA 5BSTA 3VVLA 2ZYGA 1E9CA 4HLUC 4IF6A 3G1TA 2FW0A 1JTVA 2PMBA 2RBGA 1IXKA 2HJVA 1NVUQ 3HDTA 3UJPA 2XUIA 3H2IA 4KG7A 2FXVA 3OIVA 4UHFA 1KFBB 4FHZA 4JYAB 2QAIA 1W88B 3C85A 4CKBB 3O9ZA 3ZH2A 1BW9B 1NQOA 2NLOA 3GLGE 3COSA 1NVBA 1BEEA 3PR2B 3X1ZA 2PRJA 3LFTA 3MSXA 4IKEA 2Z9CA 2JJMA 4HQNA 2EFCB 5JQGA 4UBJA 4GKKB 3T7IA 1KEKA 1NSFA 4ETMA 2GILA 5EZSA 2H4HA 3ZYCA 2JIBA 2HNBA 3PIDA 2AR9A 3KVRA 4LBYA 3HHPA 4KFSA 4KN8A 4PGGA 4MROA 3LU1A 4UU8A 2QQEA 3GFQA 3O90A 4UQLA 1EDOA 4MDYA 2Z2XA 5CTJA 2PZAA 3AM3A 1X1DA 2JVIA 2EBUA 4XUCA 1II9A 4V39A 3VTFA 4FJ1A 5TX7A 3GJ8A 1NMZA 1AKRA 1ISRA 2Z9DA 4M9RA 3OIWA 3ZXIA 4B4KA 5LZ2A 1Z45A 3D8NA 4FUQA 4BLWA 1AXRA 1PDWA 3OHMA 5BYAA 4DR3B 4JZYA 2VRCD 1VTKA 2W71A 4IZIA 4W63A 1YQ9A 5C31A 1ZH2A 3TEJA 2Z2JA 1QBKC 2AXEA 1OI3A 2AYZA 3G0OA 2Z57A 1SBTA 5CH5A 2ZJ6A 1V4BA 3GUHA 5LKRA 2TSYB 2FZ5A 1RI3A 1Y9EA 1BCSB 2A33A 4G5GA 4NBLA 4BXOA 2R97A 4C88A 3PQ2A 4CGZA 2YCBA 3TRKA 3TXXA 2XYGA 1IRIA 2D4AA 4G4SP 2QV7A 1MJHA 2PUGA 4ZDIA 1OVGA 2ATIA 1KYYA 3EGXB 4H4DA 4EB6A 3EXG1 3C3EA 2WJ3A 3SR3A 2HSEA 3H87A 4YV0A 4BO1A 4LY0A 1GWNA 3EB9A 4LYAA 5KIAA 2RGRA 1PVVA 1TCUA 2I1VB 4O4JF 1HMYA 4QBFA 4WRRA 2V7UA 3W5HA 2JH9A 3OZTA 1GM5A 1K5DA 4O2AF 1N5IA 2ZYUX 1QQ6A 2BMEA 3PUIA 2QRGA 4F12A 5AQ1A 2XZLA 3SXUB 5K8IA 1FDOA 1B3BA 3I58A 2FK7A 3RUHA 3AQ4A 3DNFA 5SZIA 1NE7A 2V3WA 3RLIA 3W5AA 1ENOA 2ADOA 3CM0A 4ZVUA 4DRXB 3LLUA 4UASA 3WNDA 3MLAA 3O21A 4JDPA 3ZE6A 4TKVA 2P2DA 1BXRB 1NF2A 3R74A 4G4SO 4EKIA 2N9UA 5U1PA 2UZ3A 4ETWA 3CLUD 3S0JA 1BG6A 4E5VA 4HCJA 5EIXA 1RYHA 5H83A 2XIQA 3PDIB 3QVKA 2VBGA 4ZVNA 2BFDA 3M4ZA 1I14A 2YWDA 3HA5A 4QYIB 4DGSA 4HQRA 4XOUA 4KBFA 1H1DA 1WKVA 3ZDBA 1HE4A 4G0XA 5DEIA 4ZVSA 3CS3A 3KKMA 1H6DA 3EIXA 2HO5A 2O0JA 3U7HB 3K1TA 4TXNA 3C6MA 1FTGA 2V5AA 4HB3A 2FP4A 2XGJA 4Y6GB 1TM4E 1KEEB 3EK2A 5JCOA 1OUMA 1GPUA 4I4TA 5A2QA 4QXAA 3KYDA 3SR4A 2UUAB 5MN6A 4G0WA 3Q7SA 1GYQA 4CM9A 4C7XA 5HEKA 1KQ3A 2PYDA 1W0JD 3ILHA 3H99A 1UFKA 5G0WA 1BRTA 1SUSA 4MYHA 5ITZA 4H3SA 1YFZA 2B8EA 2WHEA 4ANFA 3WLOA 2B98A 3GDGA 4RLSA 5D3KA 1KA9H 3W90A 3FN4A 3WYDA 4KAAA 2GZHA 1JQ5A 2DX7A 3H5VA 4JS0A 4REQB 3NIWA 3RRZA 2GPTA 3A3NA 2AMLA 2ZT5A 4XSGA 3U40A 4DQVA 1QM5A 2ZUTA 1AG9A 2XVYA 3UAXA 4ZI7A 5F7XA 4B71A 1UADA 3BSSA 4DVGA 4JI4B 3C14C 2C84A 2Q5CA 2VQDA 1B0UA 1X87A 2C2BA 4LXUA 2QSZA 4KH1A 5DBHX 4R98A 1P73A 3LDFA 3AYZB 3ANSA 1LEHA 1I2DA 1LBIA 2V8OA 2OCGA 2YV5A 2R6ZA 3F5SA 3R5XA 1UC9A 1YHZA 2HXSA 1SXJE 4M86A 5GMOA 1OF1A 4L8FA 2QMYA 4FFRA 2D8AA 1HLPA 4AMUA 4DJJA 5KQMA 4XRRA 2QN6A 2X2PA 3UN1A 5JNLA 3FOZA 1R6VA 5IVKA 4NH0A 4XJXA 4DLTA 3H4IA 3BUSA 2CVPA 1X0XA 2WA2A 2REBA 4QM7A 1FMLA 1N6IA 1J06A 2XVXA 5F3DA 1L6IA 5KQRA 3PTAA 5JNRA 1SQ6A 3BORA 2XITA 2PH5A 1QGOA 3DG9A 2P65A 2R8EA 1EESA 4H1VA 1EDBA 1E9EA 1AHIA 1T8YA 2BEUB 1R6UA 2HU2A 2VJNA 3HG7A 3ONEA 4OQXA 4QASA 2CLOB 1T13A 4MVJF 5TJHA 1YU9A 4QUDA 4ZYVA 1AK9A 2PGIA 2N1BA 4U2KA 4DNQA 3VAZA 2BFEB 3F6RA 1PT5A 2HLHA 1L7NA 3JVEA 2AKYA 4WCFA 2HSDA 2QXYA 4WKCA 3KJFA 2DVMA 1N1GA 2RB4A 4LECA 5ENDA 1DRKA 4I4IA 1F3OA 4IGFA 3OEED 4NZNA 4V02A 1VBFA 1W85B 1HG0A 4LRXA 4YN3A 1HE8B 3NBQA 3G6KA 1WU7A 1CDDA 1BS2A 3FHJA 2J9GA 2GNOA 1A82A 4H1UA 4L3VA 1RC8A 3LVFO 2Y1CA 2PGJA 5E6RA 4ZVLA 2YWEA 1VKJA 4FT4A 4XVQA 2CXQA 5DWQA 1ODJA 2XUGA 4M9UA 5KYKA 4XDYA 2KLHA 1F6BA 4G9BA 4RHEA 4Z4IA 5AICA 1ZVVA 3LC2O 3R9WA 3IJPA 4KPYA 1R6AA 2HRCA 1XMSA 3ELYA 3T7JA 4C0BA 4JLNA 1GYRA 4PHGA 3F67A 3CC8A 1J8DA 1AMNA 3K9FC 2PZKA 5EJ8A 5IDVA 4XXHA 1NN5A 1QO7A 1Y8RA 3KSDO 3ZJUA 2ZJ5A 3PFFA 4AYWA 3WBFA 3O8OA 2PSHA 3AFNA 2AQIA 2QVYX 3WRWA 4MDEA 2WABA 2B1IA 5JOQA 1E0AA 1K5HA 4KOAA 4L85A 4N3NA 4DG8A 5MFPA 2E1PA 3E9NA 3EODA 2WF7A 3ISJA 4KPUA 1JBKA 2CHVA 5EKDA 4JLJA 1EX6A 3LQKA 3R3ZA 4OXNA 4W5NA 1K86A 4EFMA 1O9BA 2QL6A 1RPTA 2ZG6A 1RWPA 1A8QA 1XCOA 2V9PA 2GF9A 1XXHB 4QUEA 4ZQEA 5AQEA 2BLLA 4C08A 1Q0HA 4TSKA 2YZNA 2N42A 2BGUA 2XDQA 2YJNA 1I3OA 2ZJ7A 2BGJA 4P7JA 4PYIA 3ROFA 4EMUA 5KU1A 1KE2A 2VJPA 4IOKA 4B4WA 4BBJA 2VP0A 3DZ8A 4RA9B 3T4EA 4DJ5X 3NGXA 4FOTA 4N5LA 1LPAB 3INTA 3KXPA 4ZP1A 1V48A 2YYAA 4WLVA 5DM0A 2PEZA 2X5XA 3HGTA 5JJKA 2ZS9A 4C87A 2D74A 3UMBA 5IPFA 1DL5A 4C5CA 1X7WA 1GPNA 1Q57A 4CW7A 4B3SB 2I91A 3B6KA 2ZB3A 4IIJF 3DTVA 3WO1A 3PI6A 5T4BA 4WXEA 3RU7A 1F9EA 3EH2A 3IUYA 2GYWA 2QXUA 3RKUA 3ZHOA 4BNXA 2IE0A 2IYYA 3A6JA 4Q66C 4JMPA 2HHAA 4YWHA 3OJXA 3M7IA 3G49A 3AFHA 3KT3A 5G0UA 3UCXA 4DYDA 3KLMX 4M0LA 1DEAA 3UMCA 4UHBA 2PUBA 2SBTA 2YUIA 3S2YA 4E0BA 5AKXA 1Z37A 2VIIA 5ER6A 2IZZA 4FFVA 5I4CA 3II6X 4RGQA 2FSPA 3MTQA 3DW3X 4ER6A 4CIBA 5IANA 3NEPX 3D4IA 4F9EA 221PA 3AHDA 1LRJA 3L6EA 4XYMA 5IT9A 2EGGA 4JJ6A 2YYSA 4FPXA 2BHNA 3C1TA 1NU8A 5D3QA 5BMVA 4BFVA 4Z53A 2Y1FA 2L82A 4O4HB 4ITUA 4EL0A 1C2YA 2XCSB 1XRPA 2OD2A 2JH8A 4XPIA 3GLGB 3K70C 1N9GB 2X58A 3F7OA 2A0YA 3PFBA 5L3QA 1Z5PA 1K0FA 2HA4A 4WUVA 1CUXA 2VG8A 3WJ1A 4C78A 4R0VA 4O59O 4GEGA 1GT91 2HD4A 4Q3DA 4D9HA 1LD3A 4UTNA 2OSBA 1IG0A 3DFUA 4X6YA 2QTTA 1D4FA 1QUEA 2RI1A 2YC2C 2JCVA 4XR4A 3WMEA 1SC6A 2CHFA 2YICA 3AJRA 2V54A 4R7ZA 3OICA 1K8XB 1CWUA 5D51S 5AJXA 5EUMA 2NXWA 1U1GA 2IHUA 1LC0A 3WK7A 3VDNB 4ENVA 2IX3A 3BERA 2GNAA 4HADA 1XHEA 2QZSA 3VM6A 1VHTA 1M72A 3A4TA 1IQ0A 3GA0A 3F3SA 1GZVA 5CW2A 1RXVA 1JDUA 1POWA 1LPMA 1SUDA 1RBMA 2J0VA 4QGBA 4A8JB 4CMGA 2Q1YA 4CG1A 1EEHA 3D3WB 4RSGA 1G3UA 1P0QA 2GA9A 2KBEA 1FJ2A 1B0AA 2QNBA 1TGYA 2CFTA 2XECA 3OZWA 3PQFA 4LZJA 3UKJA 1LWOA 2WMNB 1R6XA 1ODFA 2G9ZA 2CB9A 1P1FA 5AO9A 2ZVJA 5EN4A 4FJ2A 2FN4A 5TS2A 4N47A 4BNYA 5BV0A 2C2ZA 5KYUA 1J20A 1F14A 1RJ9B 3Q0TA 1Z6GA 5JMWA 5DM1A 1F2VA 4TLEA 3IOEA 5REQB 1U2GC 3SS8A 5JMTA 2RARA 4IO0A 1LQTA 1MGOA 1TLTA 4D8UA 2Z04A 4QUJA 5GGYA 1MX3A 4KXVA 1IHPA 1CQZA 1CVRA 2NUTB 3HRIA 4LC1A 1ZUWA 3CUTA 2RJ3A 4WNCA 1Z68A 3HKEA 5JZSA 5BN3B 1PD0A 4OQNA 4UNIA 1ZEJA 1BDJA 4RL4A 1ICEA 4C89A 5EMNA 1USIA 3FVQA 3UMSA 2WQ7A 1I24A 3LQ2A 1PUIA 2R5FA 4PIPA 4OJYA 1U8UA 4LAFA 2UXCB 3WHPA 3IBSA 4BO8A 5FPPA 2BCGY 1NUQA 4N0QA 1Q1NA 1RRVA 3T5MA 5E8JA 2Z3ZA 3LX8A 3NUGA 5DLPA 1KMNA 3LCRA 4HMQA 3HB1A 3MWJA 1Q1ZA 4RV5A 5ALJA 2Z58A 4NECA 5LZ7A 2J3IA 1WMAA 4YFYA 4A0QA 3ZXUB 1P1RA 4TLMB 3D6MA 4RFLA 3STVA 4L5IA 4WBXC 1KAMA 1AK2A 1PZNA 1ZK3A 3KXLA 1KZ6A 2WUWE 4LJ6A 3WISA 4E5DA 4QYXA 1DWUA 4H9GA 5JSQA 1EK6A 3A7EA 3CTMA 3SZ3A 1M9NA 3K0BA 5DVZA 2VJAA 2H4WA 3V1TC 2WUFA 4M76B 2I3ZA 3BHMA 3FAKA 3BGVA 3TL3A 3E8XA 4QUKA 4W1QA 2AG5A 3UAZA 4D99A 3UATA 3RAFC 3N2IA 4EG4A 3QW4B 3G2QA 4IRXA 5H68A 5FOUA 2R8XA 2ZZMA 2BMVA 1DX4A 3VVMA 2E82A 4L02A 1KH1A 4TV8F 2NUAA 1J2TA 2YBDA 3VBEA 1OAKA 4D9NA 4B6OA 4DTIA 4UHJA 1U2DC 3QW2A 1FP2A 3ZE9A 1E4YA 2HWWA 2ZB8A 1E3TA 1O8BA 1TYDE 2AKAB 2HMVA 2CXRA 3GFSA 3GJSA 3NNDA 5DP1A 1JE0A 1FU8A 2BE9A 3G7UA 2GN8A 3MINB 4D9GA 1PR5A 3Q3CA 2Z2ZA 1P0MA 4WK2B 1XHLA 1J9ZA 4C03A 3Q0EA 4IP0A 1F06A 1SXJB 1U0NA 3OCUA 721PA 3I2FA 3V4PB 3R7BA 4EY8A 4Y8VA 1CY7A 1PNOA 4FONA 4MPTA 1NUHA 3OD1A 1EIWA 2Q0SA 2OFPA 3FA2A 3GDHA 1OXMA 3U7FB 3OQIA 1YR7A 5F98A 4OH7A 3S68A 4DJEC 4DYVA 5CX1A 5FNZA 3VSEA 3VVBA 2JDIA 3WGIA 4DLZA 3K9NA 3ANXA 1GNVA 1XJ0A 3N05A 2YNMA 4UTPA 1RLMA 4HX2A 1Y1KE 3GLUA 2YYZA 1Q3TA 3P5SA 5ERYA 5J5VA 2P8SA 3T7KA 4FNMA 3THXA 4PLCA 1GG5A 1M6HA 4Z4QA 2ZREA 3FNEA 3GBSA 1XX6A 2WTXA 1IJBA 4GI5A 3HYTA 1WY7A 3JAWB 3L8DA 2NTNA 2ZBRA 4JB0A 2PLRA 2ID9A 2HBRA 4PO3X 4DJDC 4Y2QA 1J07A 1PZFA 1NYLA 2IV3A 2AC7A 1TAHA 3KL4A 1RZUA 4A3SA 4L72A 4PHCA 8LDHA 5HS6A 3MA0A 1TGVA 3OY7A 1I2MA 1AQ6A 2NV2B 5H59A 2HQ1A 2KJQA 1TK9A 2XTNA 3QUTA 1S2DA 5BRNA 2OQRA 4E5PA 3U39A 3TNDA 3NT4A 2FK8A 2REXB 3GRVA 2K7ZA 4B1FA 4YMIA 1ULHA 3W6OA 5MF6A 5J5CA 3RIGA 3NHFA 3TGWA 4G1FA 4MNTA 3C43A 2QTBA 1NZFA 5ALNA 1Q2XA 1PTKA 2MINB 1MAAA 4DT1B 4CEHB 4XLTA 2IHBA 3W5DA 1TKBA 2OL4A 4KQEA 2VDPB 1QRSA 1WHTB 2ODQA 3GVIA 4BWFB 2Q9AA 4HDMB 2DULA 4BBAA 3B7WA 2OLEA 1DDOA 4N40A 2QEQA 3GEPA 2HCBA 4DDWA 5JRZA 3MAGA 2JVJA 4QO8A 1L8QA 3GROA 4HP8A 1ZHHA 1FMJA 3AG5A 1TKCA 4U9IS 3CKMA 1MCZA 4XVRA 2IEGA 3HH8A 2WLSA 1I51A 3DVRX 3OX1A 4WV3A 4BQOA 4BIMA 1M2HA 4FDAA 2ZR9A 5B3JC 1C5KA 4GL2A 1PL0A 3EFOB 4MQ6A 4DY6A 5EXEA 3EPRA 1RI4A 2P91A 2ZRFA 3ESBA 3FMFA 1ZKMA 3CNLA 1D09A 1QVVA 3ENWA 4LDAA 2GPWA 5AM0A 2XNJA 1WZUA 2XCOA 1KC1A 3T12A 2ONZA 4DXHA 1FUIA 1V8PA 4RH1A 2CLCX 3T0IA 7ABPA 1NVVR 1A2KC 2REQA 2Z09A 3OF2A 4HGYA 3LHSA 4JJ7A 1GPYA 4FHEA 4NMLA 3UWKA 2JEOA 3DMRA 5DN6D 5HKAA 2C4HA 1JIXA 4W6ZA 3KCQA 4XYEA 1WZ2A 5KDOA 4EG0A 1C7JA 4AY3A 5IC6A 2P0EA 1T9KA 3MTEA 1MPTA 1PCXA 2Q99A 3GPCA 3SXJA 3TQTA 1YGPA 4BPRA 5ALFA 3DV0B 3FOWA 1YIAA 3UAYA 3VR5D 3C3XA 1DLJA 4TV9F 1ZH8A 2B8JA 4QKQA 5BR1A 5HZGA 3NFYA 1XEXB 4NRDA 4QU9A 5B6IA 3VZCA 4C6HA 5FL7A 1NOJA 1PJAA 5SYNA 3NORA 5TGTA 1K5PA 1L3CA 2PSDA 1UR5A 1U4NA 2F1HA 5D3MA 3IQGX 3WSWA 4F45A 1FSZA 3EXFA 1W8DA 4G1BA 5AW9A 3W2GA 4DBLE 4ZQGA 1Y5NA 4LXTA 4IDEA 1BCSA 3H3JA 4GF5A 4IFIA 1C0LA 2D5AA 1V7PC 4D79A 2ZANA 5F73A 1II8A 1AT1A 3FTPA 1ZFNA 3NP9A 2XRFA 4R0NA 4KXQA 3BQNB 3PFNA 2C31A 2JGDA 3FIJA 2ZUSA 1Z5GA 5CUQA 5DLEA 2A0XA 2CUKA 2GX6A 5IJXA 2Y1WA 4F6RA 2F43B 1LF0A 3QVWA 3KHUA 1F7UA 3RAEC 4EO4A 1QVWA 4MITA 4NOJA 1BWPA 5L4LA 4JIMA 2J9FB 4RM3A 3AUYA 4OPMA 1I5RA 3L7CA 4ZMRA 2P8JA 1KY4A 1F0KA 1W9HA 3IAS6 3OZGA 3RSZA 5HJ7A 3LQFA 5I8PA 1A5BB 3U09A 3N3AC 3I6IA 4HDSB 1E61A 3RS4A 2JAOA 2WD7A 3NC1C 3R3UA 4I3FA 1Z4IA 2WG0A 4XCVA 2FUCA 1JHUA 1Q92A 3LUJA 4BNFA 4KJZA 1I2BA 3MJHA 4O0LA 1SOMA 3ICQB 2YL2A 3DKVA 4AKEA 1I30A 4QO7A 4PZPA 4LHWA 4D56A 1CQJB 3ZE0B 3O1IC 2OHIA 4KKXB 3TMAA 3GGDA 3E9QA 1J97A 1PNVA 2FSGA 2MJLA 3VYVA 2UYQA 3D8TA 1X3SA 2XMSA 4KXXA 5IW8A 4BRUA 1Q15A 3QFRA 1C3VA 3G9ZA 5ALGA 4MZXA 4NBUA 1JL3A 3LY9A 1Z8HA 3UT5A 5BSFA 4BFSA 1R10A 1VB5A 2RKWA 1G2QA 4NJEB 4QYIA 5EAIA 3TE6A 1IPFA 2P1DA 3WADA 3H2BA 2IXEA 3V1UA 4QL3A 3K09A 5AJTA 2J5QA 2JHGA 3ZDZB 3F96A 4PYKA 2GKSA 2SKCA 3AH8A 1MTZA 1E8DA 1JIJA 2X0NA 2YVLA 4U1RA 4OAOA 3O38A 4E31A 4JP1A 4KLCA 2P75A 4RMIA 3LY8A 2VJDA 3RGGA 3VC1A 3OZ7A 2FEXA 4HUQB 4N5HX 4WXYB 1S4MA 3PNMA 4NOMA 4PSUA 2ECKA 1YL5A 2BFBA 1W5SA 2CHGA 2HBYA 2VPZA 4FR5A 4LMPA 4LW8A 5KO2A 1CJCA 2AK2A 4J75A 4EHNA 3A10A 2D1RA 2VI5A 3K1JA 3GJ6A 4KVGA 2BMJA 1DADA 2IPAB 1GKYA 2WJ4A 5TMDA 5JCXA 2H9IA 3RYCB 2XGGA 4DV5B 3NTVA 4PCUA 1ZA1A 1NASA 1O9GA 2XE8A 4RL6A 3TSCA 4HSGA 5TQVA 5DSTA 5F2OA 5FBVB 1TVCA 2P1ZA 2GM5A 3IV9A 2E18A 1EBFA 4HNGA 3SP1A 1JJVA 3RS5A 5JW6A 1G9TA 1R9NA 4L8VA 1AE1A 4MVCA 3GHYA 3DS8A 1U1FA 2QZJA 3WZMA 5DTJA 2HRRA 4RZ2A 2JLZA 4LQ4A 3DDCA 3M8KA 3EDOA 3ZLUA 2PBRA 5HFNA 1P18A 2ZDGA 3KU4A 1CJVC 2AZDA 5A02A 3JQBC 1M2VA 5EE1A 3WGJA 1BFDA 3CLSD 2J4FA 1BE1A 3FBTA 5FDFA 4Y9UA 1P19A 4N7BA 2CEKA 2CCGA 2NVUA 2FG7C 3B7GA 3AZQA 4P2BA 5D01A 4KR9A 3PI7A 5SY4A 1N0WA 1QHHB 2B1QA 4ZO4A 4FB5A 4GMKA 3KSMA 5DTMA 4X8LA 4JSRA 4EGQA 1NUAA 2I2FA 5A4AA 2D0DA 1CR4A 2W42A 4C4PA 1VFNA 3QPAA 1R0ZA 2FSFA 1VM6A 1Z4MA 5K8TA 2W4IA 4DZRA 3TTXA 2JD2A 4MQFA 3SBEA 1Q91A 2E6UX 1O94A 3R5KA 1G3MA 1I2ZA 2BL4A 2XB9A 3ITDA 2YFHA 4QBTA 5ERXA 1ABFA 5KDLA 1XVAA 1Z0KA 4MIYA 2ZUBA 3IIIA 3TSAA 4WT7A 4LOKA 5CT9A 5AK4A 1S8OA 2J09A 2R84A 2DWQA 1HTTA 2HNKA 2I4NA 3OIDA 4H3VA 3H97A 5FPHA 4AJHA 4KE7A 1SH7A 3RAJA 4ZAFA 1NLUA 3I8XA 5EIEA 2XI4A 4BZPA 3STHA 3TNLA 5BQ5A 5LDGA 3NCHA 1J1UA 4GM0A 1W44A 2MSNA 3BHJA 2YCLA 1M1XB 1MT0A 3E5MA 4MW6A 4UJ3A 3G2PA 3RRJA 5B12A 2X5NA 2GLXA 2XYRA 3DNPA 4MWEA 4ROSA 5HG0A 4ER5A 3WAGA 2G0NA 1P0CA 1EVKA 3LXMA 5CIQA 5IBRA 3JVVA 4GEKA 3L8YA 3R9KA 4Z7JA 2PT5A 2XKBA 5LQSA 2PMEA 3INYA 2AN3A 2IPOA 3SC6A 1XA3A 1RRPA 2BFPA 5KYWA 1T4DA 4W9MC 3F9CA 4IS3A 2ZWMA 4Q1CA 1WMBA 5CJPA 2NYRA 3DEAA 5T5QA 3OQMA 4LJ5A 3A6LA 4ZRDA 5AM2A 1A9ZA 3C3MA 1XG5A 3IP5A 3Q3JB 1N2JA 4TM8A 5UKDA 4ND2A 4G36A 3GPLA 1Y1TA 4UOQA 2FUG6 2QGZA 4ZZ2A 3ZQKA 3JQ8B 4D96A 3LXXA 3HTXA 3DM5A 1T5DX 5E7JA 2PQ2A 5SZHB 4E88A 3LAWA 1WBBA 2XXBA 2JFWA 5KKAA 1PHPA 5HF9A 4YJ3A 5C18A 1OROA 4F60A 2B2NA 3NHKA 2PUAA 4J9VA 3CO0S 1FRNA 2Y76A 4UOEA 2H1HA 1B8UA 2F3SA 1FNSA 4F8JA 1YS7A 5JDCC 2BGWA 3VHLB 3H83A 1ND5A 3FPBA 4BNNA 4KUEA 4U2DA 1G66A 4LF4B 4J0GA 4B4OA 3PEWA 2VL7A 5CW1A 4IRMA 4IUDS 2JEYA 2Q6IA 3Q12A 1YB1A 1ZUD1 3CZMA 4OIFA 5H16A 5JPDA 1DTEA 2ZZKA 1CQIB 1CVLA 1DAFA 3IKJA 4MKIA 1MO4A 4NQZA 4LCBA 5E1BA 3LHDA 5AR1A 3IP9A 1A50B 4ZANA 8ATCA 3GP8A 1XD8A 1RMYA 4L8LA 3ZV6A 2D8MA 1E1QA 2GARA 2PXCA 4RKWA 3AY0A 4RVGA 1VMKA 4C2BA 2VJYA 3HDGA 4Z86A 3F4LA 3D02A 4DW8A 1A9SA 1VYHA 3B2NA 3KBOA 4RK6A 5BUCA 3WL3A 3MELA 4HWKA 3BGDA 3C0KA 2QP4A 1O87A 4X60A 4XWWA 4RCZA 2RFLA 1AKNA 1XMXA 1NV9A 4MLPA 4RMNA 4K3UA 5GZ3A 2I3GA 1Z7EA 4S2UA 3ZCVA 4NS4A 3PXGA 3R8CA 1C1XB 1UJMA 4KN9S 2XNSA 1PU2A 5E38A 3RYHA 3L02A 3ZK8A 4B47A 3DEHA 3KZ1E 1P1KA 4TQAA 2NZWA 1KE1A 3RV3A 4AO7A 5LIPA 4D45A 2CZCA 1J00A 3KUXA 3NGMA 2I3BA 2Z30A 1JFVA 1XDDA 4HWPA 1KMCA 3QOYA 2Y8EA 2P68A 3VOSA 3HKBA 2F8SA 4M1SA 1FFSA 1XEWY 3H17A 2EQBA 3MBOA 2XKJE 4L8YA 5IULC 1MW9X 2GAOA 2HX1A 5E7QA 2M1ZA 3BDAA 1I8TA 4PQYA 4J1SA 4X1YA 2X76A 3NTQA 1AF4A 1OGJA 3PDCA 5EMKA 5E9AA 1E4VA 3PV0A 2WD9A 2JIQA 4RNDB 5E3JA 5EZ5A 1H94A 1N0UA 1YRQA 2IE8A 1MHTA 1JFRA 2P2YA 1IVYA 1GADO 3AU9A 2WWYA 1W48A 2GPAA 5EJMA 4UUBA 4ZRNA 4C4AA 3OZVA 3QVVA 1FTNA 1CXZA 2BW0A 3H8VA 3UYLA 4C0SA 2EX4A 2YMLA 3RC8A 1HNNA 4LJ9A 5C34B 1E6LA 3NWJA 2R8BA 2PZBA 4GL4A 4PRYA 3V2GA 1V71A 1MO6A 1YONA 3VR2D 1E8MA 3NALA 4QT0A 4WZ6A 3AF6A 4C2TA 1ZVKA 1NXXA 2QTVA 5I48A 3I2YX 1UKVY 4IWNA 3RG8A 4YJ2B 4OQDA 1M1YE 4AWBA 3MWDB 1GQFA 5EZQA 3HFGA 3SY8A 4ARAA 3FLEA 4BLUA 1ENYA 4CTKA 3IULA 3AFIA 4ZKEA 1FX1A 3ZXYA 1KORA 4QQNA 4BE9A 3NHLA 4Z99A 5FWYB 4DIUA 4ZICA 3F97A 2AWOA 3IALA 2WMYA 4E4TA 2EG9A 3G0GA 2FU5C 4Q1DA 5F4BA 4BGDA 3HV0A 4CEJA 2WKPA 4WA8A 4QUIA 1BGXT 4HK4A 3W7VA 4ESVA 1IY1A 1V37A 1MHPA 1Z88A 3FTNA 5DW3A 2G71A 2XTAA 2NNWB 2HMYB 4GU5A 4RBNA 3CE9A 3MCAA 1XXLA 1P6UA 1Z83A 1WZIA 2PSJA 3T9BA 5ILGA 1RQ7A 4CIDA 1EEXB 4V1CI 4KXMA 1XA0A 1EP2B 2QTMA 2ZRJA 1KOJA 2VF2A 2BE7A 3PEYA 1OWLA 3FYUA 5LQMA 4JOBA 3A2NA 1H22A 3KCNA 2WU3A 4RVDA 2NSLA 4RQTA 1CIPA 1XN1A 4WBNF 1E1CB 2GZDA 5DU2A 4JASB 5JO0A 3GCDA 3WSTA 1FFEA 1X1RA 2KMLA 4FYYA 1TAGA 1GPLA 4YDHB 1DO0A 5IXSA 3MCTA 2HGSA 1MC1A 3BCSA 4BDTA 2QJTA 2W2LD 2ZBQA 3AI1A 1PT6A 1DO8A 3LIIA 4DLRA 3QGMA 1QRRA 3TQSA 3WWOA 4BVLA 3AERB 3TN7A 2AOUB 1XZNA 5DEOA 1HWYA 5AVOA 3QG5A 4Q3EA 4PM4A 4KRXA 5TMBA 4OSEA 2HZBA 3DOOA 3K6RA 4D26A 4R5HA 2B30A 1FFHA 4HDOB 2OHJA 5A4DA 3TSZA 2KW5A 1REQA 4CQMD 1Y5RA 3I2KA 2ZAYA 4MS3A 1R8XA 3ZPXA 1EGQA 3BSYA 1GQRA 2FLKA 2YV1A 4GXTA 4HWRA 1Z8DA 3DL4A 4J0KA 5AK5A 2ZWPA 1JEDA 2FX2A 2G83A 4K3VA 4CEIB 1A9YA 3P2MA 3RJ5A 5TMPA 3GLIE 2BCEA 4N3CA 5BNWA 1LI4A 1YCHA 2CK3A 2VHJA 2OR3A 3PT5A 3V1KA 1KWKA 2CCKA 3I62A 3JRNA 2G40A 3S2UA 4LDPA 4Q4CA 1QFXA 2LDXA 4WK4B 2XYVA 2DAPA 3UW1A 4QTUB 1BVYF 2F9FA 5CB6A 4I55A 5FOSA 1NZJA 3HZHA 4FQ7A 4ZVKA 1C0IA 4GLLA 3WGLA 4N1AA 4M38A 2GEBA 2NU9A 4F06A 4K6HA 4KFRA 3TLBA 4JJAA 4OD0A 3GEMA 5KVSA 2ECOA 2I1QA 2IZ7A 2JD0A 3SIWA 3ZU5A 4RA6B 5EIWA 2J9RA 1U8AA 3KJGA 3CO5A 2NVBA 1R12A 3RHZA 3GP5A 4F3RA 1YNOA 4UBKA 2C5EA 4JLVA 4DLUA 2RE8A 1NN1A 1Z0SA 2DU8A 3QBEA 3EWIA 3NDJA 4KQWA 4QFDA 1W47A 2IVFA 2OFFA 3EZXA 1RBYA 2V7QD 2FDCA 4NV3A 2OHGA 3EG5A 1XQ9A 4MV4A 2AE2A 1UMBA 3ACBA 1Y37A 1T9BA 2JFHA 3AVPA 1QS0A 3P0IA 4KN5A 2MYTA 5ALUA 2LUOA 4YP1A 3DULA 4OXXA 1JR3A 2ZIXB 2ERXA 3WIUA 4BMOB 6ABPA 3EGEA 3DFMA 4GR9A 3GJ4A 16PKA 3KG2A 1I94B 2D59A 1RHUA 3KKNA 4LV5B 1I4OA 3KKQA 2FR0A 3WGGA 1WOYA 1RPAA 4FFBB 1UDRA 1ZP6A 1NG9A 2ZE7A 2PGDA 1ZZGA 1ZC4A 1ECPA 3CIOA 3NGLA 3ZBUA 3SKXA 1DBIA 1H0SA 1MEJA 3RNLA 1TQ4A 3REQB 1IWOA 5BNFA 1C7IA 1MOZA 3M82A 2RHCA 1XZKA 3BXEA 4DIMA 2Q4OA 3Q98A 1Z4PX 1IWBB 1DNPA 2I6QA 4ZDKA 2CY0A 2O9JA 3KDPA 1BJRE 4JCOA 3HCWA 1G9XA 2XT0A 3ZGZA 1A4XA 1I7PA 3OQ1A 2FPLA 4BO2A 1XELA 2O2SA 3FJYA 2CMGA 1A3CA 2ZCVA 2R6HA 2Z8YM 2JLSA 4EA8A 2YWCA 3UIEA 2WYUA 3TGPA 1T1EA 1U0FA 3A31A 4I1OA 3R1IA 4L5YA 3ORHA 1Z18A 2IUSA 4OFZA 4U02A 2C3MA 4AIRA 4L9WA 2C8VA 3BHNA 2YV2A 2ZJZA 3Q41A 1QVRA 2TYSB 4NJMA 3KX2A 3W79A 5J40A 1P4JA 4OHXA 2G3YA 2V5VA 5D5HA 1GPKA 2Z8YA 4OGLA 1EVLA 3BMQB 4UBLA 2RGGA 4U2BA 4KV9A 5H9WA 3NNNA 3QMWA 2O7SA 4G0OA 1TADA 3ZE1B 1HORA 2O23A 2GPYA 1MKYA 5JZ9A 4MS1B 1IOVA 2E48A 2VAVA 4IHAA 4RHUA 2ODWA 3SJUA 4JBXA 5HGJA 3H0KA 1MX9A 3VNRA 4RADA 1G63A 2WWFA 4L4RA 4TMVA 5A9TA 5A6SA 1Q7EA 2V5UA 3UAVA 1GRQA 4YT5A 4X64B 2YRWA 4P98A 3OF5A 5FTNA 3AW8A 5K8CA 3PB3A 3JR3A 1U99A 1GGHA 4K86A 1HRDA 1YHNA 3VISA 2GO1A 4HDMA 4OFXA 4YDRA 3VPHA 5D6NA 1YJCA 1TMYA 1CKEA 2EBWA 1YVPA 1YI8A 3D4NA 2SKDA 4FQ5A 4J0EA 5L4SA 3RASA 1S2GA 1T2FA 5EXXA 4RPKA 4JKIA 1XNJA 1WDTA 4I5GA 3G9UA 1KI1A 3V2HA 2DWCA 3U37A 4Z1OA 1VJ5A 3KQNA 5C46F 4UC0A 3FDZB 3MGKA 4X1KB 3VV2A 4C4OA 5C37A 3LZCA 3T6KA 1EK5A 3BJZA 3PE4A 3PLAE 3EZLA 1W6UA 1J33A 1QFYA 4D6XA 2QROA 4KO1S 2XE7A 3RE1A 4AKIA 3HVJA 3GT0A 1EB9A 1RYFA 1XZEA 2VZLA 1WB4A 4UM8B 4L22A 5L4NA 4Y0VA 2FSUA 1NR1A 3HCCA 4MVJM 3AVYA 3FGPA 1DRJA 2DBQA 1UDCA 3TW6A 3ZU3A 5M5BA 2MCFA 3BZWA 1E79A 3VZSA 5AJHA 4YRLA 3FPLA 3KD2A 2FPKA 4TVOA 3UMVA 1ESMA 5EMLA 1R0XA 2O1EA 1U1IA 3AFMA 3PKZA 4MVJA 5EKXA 1FL9A 2A67A 3KEOA 1G9SA 1HK7A 3OZXA 1ACJA 3ECSA 1VCHA 2BJHA 3MC1A 1T1JA 1O0CA 2FPSA 1G1MA 1N2CE 3K32A 2B4KA 4H0FA 3WB9A 1XDGA 3FPEA 2XB8A 3AWDA 5HUQA 1G8GA 3KAJA 1J1ZA 5JBIA 1QTQA 1V5EA 3DR5A 1E98A 2DZDA 3JSXA 1SOWA 2ZPUA 3SKVA 1B0ZA 3ZWBA 1J5EB 3HB9A 1AO0A 1NZDA 4TSFD 5FLKA 3X1YA 4QGAA 3CT4A 3T3NA 5JDIA 3HO1A 5DOVA 4D4HA 1ZBQA 2ZRMA 2C2KA 3RRYA 3I01A 3IUNA 1N2XA 3AFGA 3MLBA 3NASA 2ZAOA 3ESCA 4GOLD 2F43A 1DIAA 3FOAA 4PLWA 2DFPA 2EWVA 5CVEA 4DEVA 4O63O 5A1TA 3RHFA 3GFFA 3H6HA 5F21A 3EF0A 3F73A 1E96A 1UAYA 3DBHA 3DM9B 1P2GA 3LCCA 2ZJ2A 3SF0A 1UT5A 1NBME 3JCZA 4UVGA 4NG4A 2VHXA 5GJWC 3W2IA 2EFDB 2CNDA 3KEGA 1ML4A 1YDGA 4M1YA 4HDSA 1RC0A 2BEWA 5LZ9A 2UVQA 4I1IA 3BXHA 3RODA 3UJ6A 3SKYA 4FR0A 4DLSA 4NCXA 1Z3CA 3CKKA 4ZZIA 2JJ8A 3A1DA 3PWKA 3BL5A 3R23A 1SCJA 1F6WA 2LVBA 3QENA 4PG7A 3K2BA 1PQWA 4S12A 4HTFA 5EC8A 4EKDA 3QEKA 4Y7CA 5K3FB 3LPDA 5EWMB 1Z8NA 1HE5A 4MVJG 3VSDA 1WEKA 3E3LA 2OB2A 2MR6A 2QT9A 1QG2A 4D92A 3LXRA 2WVHA 1BXGB 4G3XA 2R5NA 1CUIA 4LS3A 2H63A 3ZZUA 1T2DA 2JNWA 4DDMA 3UJ3X 1WBJB 1P2VA 3PX2A 1L5MA 3AV0B 4RY9A 5NULA 4YP0A 4BWYA 5LQRA 2CVOA 5DGCA 1WLSA 3IYLW 4JA2A 4P4UA 1RAFA 1T5OA 1XMPA 2G76A 1NIPA 2WFLB 3SR0A 4G89A 4CKEB 2PZFA 4RANA 1VJTA 2BUAA 2AMVA 3BD6A 4QDOA 5DPMA 3UMRA 3X43A 3USZA 2DQYA 4HLUA 4ISBA 2I4OA 3WQQA 5A5FA 1U2RA 2DSNA 4IDAA 4RTKA 3P94A 1N6LA 2FHSA 1BC5A 3IAEA 2QX4A 3KVOA 3OZIA 5CP8A 4ARSA 4ER0A 1D1TA 3G9XA 4BKOA 3QJYA 4DDVA 3TCKA 5G4KA 4NZOA 2HWYA 3F8TA 1A2OA 3LWNA 4OGKA 4RK0A 4ESOA 2C3OA 5FT9A 4TS3A 3T61A 3L1JA 3RS7A 1JU9A 3FSJX 3BE4A 4H6WA 2UVDA 4RD2A 3LYAA 4MO9A 2NUBA 3UCEA 1AS2A 3JV7A 3P32A 4UVIA 4JJFA 4MQ5A 4TUYB 1J0XO 5T4HA 3BKWA 1JIIA 4NDZA 1GVNB 1ZM9A 1Z7BA 5HRUA 1RMQA 3B1JA 4QJIA 4CI0B 2XMBA 3A25A 1WR8A 2VAPA 3TLGA 2WAOA 5JCPA 1XCBA 2COKA 1PG5A 2JBWA 4AZ0B 1FVOA 4RC9A 1R4ZA 1J70A 1ZD2P 3H42B 2NSDA 2ONYA 1KZHA 2BZGA 3UKDA 5KPDA 3WKCA 5IJ0B 2DY1A 4NEGA 3I4FA 3F6YA 1EFPB 3C5CA 4CMEC 3WIVA 1UWLA 1I4LD 4XB1A 1RPJA 5C53B 2Q3CA 3C39A 4CL0A 4KTVE 4KP7A 1QNFA 1HOTA 2F3TA 4A91A 4O4IA 4BCCA 4EG1A 3B3GA 3LQRA 2H48A 3FFXA 1T34A 4P3YA 3ZJTA 3K5WA 1TC2A 3IBYA 2FEAA 2YHBA 1ZSVA 3BICA 4A03A 4AS2A 4X85A 2HDOA 1LW7A 1EIZA 2V96A 2VPPA 3KR2A 5LYJA 2Y2UA 4NK4A 3GZ4A 2ODTX 5KTSA 4EJ0A 1PVDA 4D0NA 5K3EA 2O8BB 9MHTA 1KIFA 4M60A 3UXYA 3FRHA 3EF3A 3R0XA 1M2JA 1T1RA 4BMYA 4X91A 2EIHA 3FSGD 5B1EA 3L0BA 3B52X 3VPXA 2FWPA 2ZGVA 3HEAA 1E5DA 5AW4A 1DWOA 2DFKB 2AV6A 3BAZA 4YCJA 4A2WA 2GN6A 5JECA 2GHQA 2QYTA 4XA8A 1SUIA 5C3UA 1CE8B 13PKA 1CPYA 3D7MA 3LF1A 2HIMA 1JHZA 5BUZA 4XTRA 1Z6QA 1WB5A 4UE6A 1LQUA 2FVYA 3BOSA 1GUDA 4YHHB 1VJRA 1DZIA 2GESA 4TQUS 2X2EA 3TQQA 3JQQA 4QGGA 3UMGA 3M34A 3L18A 2J4DA 3PD1A 2IUTA 1NONA 2W58A 4ENQA 3S81A 2E49A 1FUKA 1P1CA 3O8DA 4JCCA 3W3ZB 1YA8A 5EUCA 3OWHA 2DR0A 1RJFA 2WJ6A 4L4UA 3O0TA 1JZQA 3X1WA 1CJTC 2IZ6A 1DXOA 2V7EA 1KMHA 2CV1A 3RS2A 4C4XA 4RJJA 2R5WA 2PUCA 3EWAA 2FG5A 2LKDA 5ELMA 1HYGA 1XRNA 1P80A 3EGDA 1Q14A 4IJWA 1I13A 3CUWA 1P62B 1EDDA 5DYWA 3ME5A 5LOVB 3NAZA 4O2BB 4IH9A 4K6GA 4DJAA 4U7GA 1LLFA 1OA0A 1XIVA 4BO6A 5BVGB 4A0GA 2YUTA 3WK9A 4PTLA 1M1ZA 1JBQA 4NCBA 2FZEA 1WKBA 4BTVA 2GBGA 2XGMA 2Z4RA 4EY5A 2G07A 4IIVA 2QV0A 2WD8A 3C7DB 1Q16A 3JQPA 4QNRA 1M2EA 3C97A 3JRWA 4EIWA 2VTDA 4CLOB 4FCTA 2V98A 5HOEA 4MW1A 3WK8A 1CERA 1JV2B 1TRKA 1OBOA 3AF4A 3E0XA 4QPZA 3ESRA 4ZALA 5A0FA 2YQ4A 1SZDA 1FNNA 2B4AA 4UEKA 5T4FA 2DBRA 1E0DA 3CX8A 4BC0A 1EZ4A 3DKRA 3BWDD 1XZBA 3FPSA 3O4JA 2EKBA 4GYYA 4RNCA 2HXYA 4N9QA 4A73A 2WAAA 3DBLB 2B20A 2P6OA 2VP6A 4Q93A 5JJ5A 2PU7A 1L3BA 2CJFA 3TDMA 4YRSA 4HPXB 3ZY3A 4CTJA 4LQCA 3V34A 4D46A 1TIKA 5CFMA 5EL0A 2PSSA 3LQ4A 4Y9DA 4DF3A 2WU1A 1FQWA 1XZIA 4JB3A 4C1BA 3SSNA 1P7CA 1RCFA 1RI5A 2IDJA 3GFPA 4U9HS 1RQGA 2ZBEA 2M2IA 3ZVRA 1ZMTA 1KAEA 4HO1X 4X61A 3SVZA 1PR9A 4MKHA 4Q01A 5KJFA 1GNSA 3GRUA 2RG1A 3MWEA 1GU0A 2P9EA 1N8SA 3NTXA 4OQPA 3REOA 3VNAA 5ADHA 2WYVA 1G59A 2QRKA 3ZIUA 2P5SA 3IESA 3G5UA 1ZJWA 4ZVMA 4AQYB 4YRNA 3TQOA 4IJUA 2WTEA 1JAIA 2RHBA 3AJ9A 3BXOA 3UY4A 1N92A 1KZ4A 1TUBA 4QDJA 2YWHA 4JJ4A 4NFHA 4FKMA 3G0HA 3MCUA 5TF0A 3LWZA 2HT1A 2G4LA 3F5MA 3LT5A 4M8IA 6Q21A 3C3AA 3U0BA 4BFZA 1UKCA 1P5RA 1QHFA 5HM8A 3RFXA 1UK9A 2CZQA 3Q6IA 3FE2A 3GIDA 4EG8A 1Z13A 3DFZA 3GXOA 1KAHA 4DV4B 2PAAA 4B40A 4QEDA 5BUSA 2QORA 1U5BA 3R3YA 2X2OA 4IDCA 1A5SB 4V2IA 3TTYA 2PQ6A 1IM5A 2IYWA 3ET5A 3SEAA 1XJWA 3L01A 1NI5A 3W3AA 2PYZA 1E1YA 1FVFA 1KO5A 3LRTA 5I3CA 1AQUA 1FYDA 4KQ6A 1A8HA 1JMKC 2WU0A 2V58A 2YFYA 1JLHA 3OE1A 3BTVA 1NNI1 3UC9A 1XQ6A 3EEFA 2D5CA 3TM5A 4UHKA 3A2MA 1DKQA 1G6KA 1PSZA 1TQHA 1W4LA 3A6KA 1WZCA 1NQWA 2FMXA 1WMDA 2IYFA 3E5RA 1I6WA 3GOHA 5CDTA 2PAFA 2ES4A 2VXYA 4I7EA 3SIPA 4UM5A 2R7NA 4KGDA 1TVEA 1QQAA 4NENB 4DSOA 1Z08A 3IB3A 1M0EA 1JMYA 3C4JA 3IVRA 3FFWA 4MUHA 5GZ6A 1VIDA 5JZMA 1N2CB 2Y67A 3MS7A 3UT6A 1NI4A 1DVRA 1NQ5A 3H75A 3WA7A 4E4YA 3G2JA 2FWBA 2CEAA 2ZJBA 3G68A 3U7QB 4BY9E 2H4JA 2B4YA 2WT9A 4ACAA 3GEGA 3TR6A 5FTJA 2ZI6A 1ZRHA 2QI9C 3BL6A 4B8YA 1B1AA 1R6TA 3BRWD 2PZGA 3K9CA 4IJVA 3TI9A 3IVXA 3NC4A 1SGWA 2GASA 3CR7A 4LHYA 3GP3A 1VE6A 1TO6A 4D44A 2CJPA 3RFVA 3FSEA 2H2IA 4MKGA 3M6VA 3V4FA 4MKXA 2V6MA 1QAOA 4UBMA 2W8BA 4O1HA 3IVGA 5KYYB 1RQ2A 2FWNA 2Y6UA 2PCLA 1JHYA 3GELA 2HH9A 3HLKA 4R2MA 2QBYA 1I6MA 3M4YA 3KUUA 1C9YA 3GDOA 1M8KA 1TTHA 1VPLA 4Y98A 1JSXA 5GINE 3MGBA 3MYYA 2H7YA 1WNTA 3S2IA 3AF3A 1L7VC 3KJIA 1T1IA 1EFRA 4JJIA 1GTSA 1IB6A 3ASVA 1D2NA 2GCOA 3NR2A 4B9EA 2BF7A 3IUSA 2R1TB 2JI4A 4DZTA 5A0TA 1YULA 5ICMA 3R24A 3UOWA 4AKHA 2WM8A 4L4XA 1HSZA 3Q7QA 4US2R 3GLRA 1TD9A 3D8RA 1AXGA 2H9AA 2HA3A 5IVDA 4CODB 1F1BA 5FA6A 5JJIA 5AJYA 2XWBF 3EDRA 3GGCA 4PNPA 4TOIA 4PRKA 4PZ9A 3OZFA 2LKCA 4TYPA 5JISA 2G6BA 1ZYUA 1MVLA 4R6XA 1TNDA 5LC1A 3A4MA 1XNHA 3N53A 4CIXA 5LSAA 2OZLA 4TVSA 1MZPA 1TW3A 5ECGC 2QTWB 3HY3A 4TWRA 3QH4A 5TGDA 4IZ6A 6GPBA 3CUUA 1D03A 2IY8A 2NZJA 3AUXA 3QKRA 3TTVA 4DDTA 4A2PA 1WV1A 1GZDA 4F56A 3RYTC 1RM3A 4PG8A 1SHUX 2QXTA 4BVBA 1Q2UA 4C6RA 3GQBB 4L75A 4YXFA 4EVQA 5E1DA 5JFTA 1DFHA 2QPTA 5I9SA 2O8CA 3MM4A 2VNKA 2VR1A 4MK4A 1Y8QA 3VOAA 2ZUFA 3DJYA 1B74A 1SQFA 2JLBA 1M6WA 3BTUA 1P31A 4O3FA 1JTFA 1RE0A 3T9DA 3B3JA 1ZRSA 1L5WA 1TPZA 4JVMA 1WCXA 5LA6F 2G5PA 3SSMA 4WGFA 3R6DA 4KWIA 3ZDCA 3B3QA 4BX3A 4OLFA 1O03A 4YUZA 3OF3A 2WZDA 2RI0A 4R2LA 2VUIB 3HRHA 3BK1A 4J4TA 4S0XA 2H29A 2YRFA 4YJGA 3CE6A 3VKVA 1XDZA 4I9GA 3IAXA 4G1VA 3FR8A 4RIEA 5EIFA 5DMHA 3WR5A 3ZKWB 2W6IA 1OGIA 1ZGCA 4OFBA 3ZLVA 1KKUA 5EESA 4CHGA 4F2WA 2XEXA 1HT1E 1Y1RA 3ONNA 1ZUNB 3DGFC 3N0WA 1RFLA 4R8MA 2VWQA 3OQ6A 4ZAXA 3PJFA 2NQ2C 4N49A 1SBZA 1Q3KA 3HJGA 3QMPA 4ZVPA 1FW6A 2E7ZA 5FUBA 5DM2A 1WXXA 4CKYA 1S1MA 2Q1TA 5DULA 4L7QA 2JK0A 3QVMA 1QIEA 3OFVA 4R81A 4QFBA 3S3TA 1JA0A 5JLJA 3OQBA 1DZ3A 2IHVA 4KQ1A 4Q4JA 2VBFA 4U7HA 4DBVO 1GGEA 2GB4A 2V97A 1QBGA 1UDXA 2HLNA 1J2JA 3CXRA 3EUFA 4HEQA 4WVFA 4ZAGA 5HIMA 1KDRA 1TYBE 3ANMA 1TVMA 3ESAA 3IQEA 1VKNA 1C50A 4H27A 2GCPA 1PR4A 1RXYA 3VGJA 5JZVA 1RADA 1FSSA 3Q7RA 2H1WA 3COZA 2QSUA 4L5AA 4OQLA 1QDEA 2ZAMA 4WFQA 5C8YF 1IQRA 1TCAA 2R7AA 5DYYA 4FBMA 2O1WA 4LRTB 5CB4A 1S3IA 2PZ8A 5CG1A 2QWXA 2VCYA 3V6LA 1OLOA 1X7YB 3GLKA 1NI3A 3S7TA 1CR1A 3ZY6A 1J0CA 2ZJ3A 4KSCA 4HAOA 5LWHA 1Q1EA 2H92A 4BX8A 4MUBA 3UB3A 2WHYA 3JZDA 4K0RA 3E7WA 3SD7A 4EK9A 4F38A 1P2UA 3DW1X 3ETDA 4EFDA 4F3TA 3VVCA 4CT5A 5BURA 4NFLA 2ZRQA 1LY1A 1T4BA 1GPH1 3EZNA 1L3IA 2QD3A 3MJEA 3QPCA 4E12A 1EFCA 1SCIA 3LUHA 5KWVA 5LQNA 3JASB 4DQUA 3GG9A 4LHZA 2WE8A 1SG0A 2FSSA 3RC7A 4AJKA 4CIAA 3JSAA 2C83A 4FFOA 3WB0A 2AG0A 4TZ0A 3R09A 5IZCC 3PFWO 4YUYA 2H0AA 3V48A 2HIAA 1D5WA 1MO2A 2IYTA 2NTJA 1CS4C 3L6CA 3FBGA 1C8LA 1ILWA 2ID8A 4F04A 1UZNA 2G06A 2H2DA 3ZU4A 3RD5A 3QFCA 1DU4A 3IPXA 2ZS7A 2IWRA 5JU6A 3LDAA 2OZVA 2IIVA 4UAVA 3S70A 3QF4A 3VDRA 1H69A 2JFNA 2RGNC 1XEWX 2MR5A 4NNPA 4R31A 4YMUA 4JNKA 1YFLA 2GFQA 3D2AA 1T3SA 1US8A 2ZBUA 2IGBA 4QU8A 1YZ3A 2WHPA 2JI9A 3U80A 4JLPA 1VJ0A 3Q72A 4LSMA 2PUFA 5CBPA 1YZQA 4YBZA 1C30B 4U3JB 1VBKA 1NP3A 1OBCA 4POOA 5LQDA 1U3UA 2GA8A 2RK3A 3Q8XB 5G0TA 1UEXC 2ON6A 2GWHA 3JARA 3L7JA 1U2DA 1URPA 4GGOA 4AXBA 4H1WA 2PRZA 4IMIB 3DF7A 1Y9JA 3ETCA 3H2YA 3V4LA 1U0HC 1PYDA 1UPXA 1I2CA 3HA3A 5HKKD 2VTBB 3UWPA 1ZKDA 5FOVA 3IQIX 1CUGA 3L8ZA 1Y7TA 3RHSA 3SQOA 3HC7A 3LOUA 3KTAA 4I50F 4B85A 4UAGA 1QRTA 3HN6A 1SUBA 3CURA 4IIYA 5AKEA 4OL9A 4PX9A 1GQQA 4J7CA 4LYYA 2C2HA 4Y9RA 2CFIA 1X80B 3AGQA 1Q5PA 1C0KA 4RACA 1UM8A 4YUXA 1XMOB 5FFFA 2X4IA 1JKJA 4C29A 3ZJVA 2AMJA 3FCOA 4RU1A 1U9IC 1GVHA 1T43A 1RLTA 1JDBC 4UFOA 3PQCA 1U5AA 2E9SA 1K2WA 1ORVA 3STYA 4I9HA 4LJSA 3INGA 4MWCA 3HVIA 1KJNA 1XNQB 5FULA 1SC4A 2ZYAA 4BP9A 2VDLB 4Z9FA 1GDDA 1GFWA 2RHTA 3BJMA 4UEQA 3OLYA 2C59A 3E0QA 3MJCA 4WCDA 1VSUA 2OHXA 1G291 3LM8A 5B7NA 2VNAA 4FVTA 4ZKDA 1V5FA 3JPYA 1EK1A 1M8JA 3K72B 1XU4A 4G41A 3OPMA 2DOKA 3AJEA 3OE5A 4K7JA 4TRRA 4KLAA 4I9FA 1XRSB 2BP7A 1EBBA 3IP7A 4Q39A 2CL0X 3KWFA 5CK5A 2P35A 3Q3IA 1QZUA 3G89A 1DELA 4N54A 3N0TA 3ZW9A 1S2NA 4EHIA 1ICIA 3Q1KA 3HZOA 4J3JA 2MDTA 2NPOA 3UK0A 2HBQA 2BGGA 1WXWA 2JIMA 4O1MA 3MPOA 1BMFD 1QTIA 4MUIA 1M1YA 1E92A 2F3QA 5JEEA 3KEMA 4L73A 2G0AA 4TLCA 1E9SA 4OM7A 1A69A 3T5DA 5FWNA 2IH4A 1RXUA 2EKPA 3AF2A 4L8GA 1UWCA 3LQ1A 1BO6A 4D9CA 4EITA 3IAS1 4ROTA 4AQ7A 1RE1A 2ZJ4A 4EY6A 1DV1A 1ETHA 1WQ1R 2JJ1A 3Q3HA 4FC6A 4U7WA 3RF6A 5LD2C 3PVZA 1C0PA 4G0PA 4M6WA 1TEXA 3ZGVA 3CUSA 1I10A 3BCRA 4RKQA 2J31A 3PVSA 2VT3A 2CLKB 2LCIA 3NRJA 4IHQA 3U0VA 3A27A 1DE0A 3KJXA 4J7XA 5B3JA 2QAGC 2C98A 1GUFA 2EXXA 1H9BA 2WB2A 1BHSA 4YREA 3PVCA 3N3BC 3NHWA 3E5NA 5BOSB 3DMHA 3ZW7A 1OFUA 3DEZA 4BP3A 1FNDA 1JR2A 3PEVA 2JIDA 3N74A 3NXKA 2QN7A 4L9AA 1YB2A 5LQAA 1E2EA 4URWR 3WOVA 2J0QA 1UM9B 3OECA 3KE8A 2WAXA 2UZ1B 3UQZA 4K40A 3KEFA 1BCRB 1TLFA 3PL5A 5A71A 5F3WB 2VPTA 2LXNA 4KEAA 1M6VA 5CNIA 4RPCA 2VYFA 4Z3DA 5HJEA 3GRRA 4W5WA 2HFJA 1QU3A 4RHYA 4Z5XA 1ZESA 4YAKA 3KS9A 1EPUA 2QDKA 3FLBA 4Y2SA 5ILOA 4EM6A 1K0UA 1PE0A 4PAGA 4F7DA 4KUGA 1ONPA 1V96A 3GUUA 1PN3A 4MR7A 2H1LA 4ND6A 4Y6SA 5M29A 1A9TA 4O1IA 3QEMB 4I4NA 4NQRA 4XX0A 1G20E 3L4KA 2X8JA 1VE5A 4MUKA 3D0OA 3CKLA 1LKZA 1VA4A 4LY9A 4DCOA 3OPYI 3T95A 4F1JA 4NKRA 4RFVA 4OTZA 1T5SA 4O4JB 4AW9A 1JFTA 3Q3GE 2YS7A 1AQNA 1XCLA 1P60A 1E2HA 4EJ6A 4JOQA 3EVFA 4O2AB 3NM4A 1KZ7B 1P6XA 1SZPA 2PZMA 5JJCA 1XYGA 3AR9A 1Y82A 3EN0A 5EXTA 1R6BX 5C2JB 3QUCA 2J32A 3LWBA 5J2UB 1L1FA 3A1TA 3ZCSA 2GH1A 2Q5QA 1XTQA 5E6UB 3U44B 2ISQA 1Z7YA 1E7RA 4IHJB 4WI1A 1JHVA 3CLRC 3QI7A 3VX3A 5BXQC 4FN4A 1ZIDA 4DV0B 1IDOA 1AMOA 3DWGA 3O74A 5MHTA 4EFLA 3I23A 3IAM6 4F21A 4BV2A 1UBFA