1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
4E07A 2V54A 4XJXA 1XNJA 4LY6A 4M8NE 121PA 3KQNA 2F1IA 3P27A 2GBLA 4US2R 4TQ9A 4RJLA 2CBZA 2J5XA 4B6FA 3W5JA 4F93B 1VIAA 1JBKA 3FMPB 1RIFA 4FN5A 3PEUA 5HZHA 2F43B 2R8RA 4W5JA 3R8CA 3WNCA 4A6PA 5FBRB 2GCNA 4C0AC 2VHUA 4BASA 1E98A 4Y0AA 3W5IA 1Z6XA 3U4QA 1WP9A 3U3JA 3UIEA 1E4YA 1D6JA 4MUBA 2C04A 3H4MA 3NTUA 4ZI3A 1AZSC 1E2EA 1KI6A 1JI0A 3SJAA 1E0KA 1D5CA 1CR2A 3EC1A 5CM8B 1YJ5A 2OG2A 2XZPA 1YE8A 3L0PA 4GOJA 1KY2A 4XTRA 1Z63A 2DPXA 1KO7A 3DOFA 3IUYA 4L15A 1XPUA 1GFIA 5BN5A 1KI9A 3EAQA 3VX4A 3PITA 1SKQA 2P65A 2ZETA 4MGYR 4QHTA 4FXPA 1T91A 2XOKA 3AB3A 1SHKA 2H17A 2IK8A 3IIMA 4H9GA 3VMFA 2FU5C 5IRCD 2XOKD 1ZM4A 2GILA 1U9IC 1CJVC 2NZ8A 4DCVA 5JECA 1JR3A 1LB1B 1QHGA 3E1SA 3NKVA 2C8VA 2GCPA 3H1TA 3M0EA 1P61B 2ZUDA 3LNCA 1II0A 3H86A 2XJ9A 1U81A 2B7CA 2F43A 4MDEA 2D06A 1GG2A 5KSZA 1WCV1 2GTPA 2QTVB 4LV8B 2C99A 4DDTA 2ZRCA 4MGZR 5J4YA 3LV8A 4BLPA 1TL7C 1XCGB 1MR3F 4KYIB 2WSSD 5JHHB 3U3RA 1KK1A 4NCKA 1KO1A 2GXQA 3QSYA 2YYZA 3P4YA 4QG7A 4V0OA 4D81A 2AD5A 1IBRA 4C30A 5FUYA 4BGDA 1FX0A 3N2IA 4ZPXA 2J45A 3PUWA 4JIMA 2ZRMA 4B43A 1DPFA 4HLUA 2WKPA 3UXMA 1XTQA 5FTLA 4HAZA 4DLTA 1IXSB 2OXCA 4HDCA 2QSYA 1UBGA 2YNMA 2BMEA 1E99A 1E1QD 4P4UA 1AN0A 3U3MA 4P3YA 3WRYC 1Q20A 5TARA 1NSTA 1GWNA 1W4CA 1XX6A 1KI7A 3RC8A 1MRSA 2RB4A 4F4JA 1WF3A 2PLRA 2W0SA 4E5UA 4P4TA 1I4TD 3EPKA 4UNSA 2OLKA 5GVSA 3HR8A 3EIEA 2CVHA 1Y63A 1OH7A 4WAUA 4HSEA 3C14C 4C2TA 2D7CA 3M4YA 1A2KC 2EFGA 2AFHE 3B13B 4DBLC 1S96A 1T6NA 2P67A 2WV9A 2Z43A 3LDAA 1CJMA 3GJ7A 1WE2A 3RRNA 1Z07A 4KXFB 3H84A 4GT1A 1OE0A 1RJ9B 4KAXA 2GVDC 4PANA 3LA6A 1Q3TA 1XCPA 4M1MA 5A5GA 3SZRA 1NMXA 3K0AB 2WIAA 5DE3A 1XP8A 2D2EA 2VIIA 2IWRA 5D3MA 4EFLA 3ND9A 1GILA 1X3SA 3GEHA 1W4RA 4YMUA 5GJCA 4EPTA 2A30A 1ANKA 2GAAA 1M8PA 4EPWA 5L3RA 4B6EA 4BFXA 4ZKDA 1E2NA 3AH8A 5GJWC 1U2RA 2FV8A 2QT1A 3IQXA 1LF0A 5DLQC 2PT7A 1U8AA 4Q9IA 5FOSA 1M7BA 2R6AA 2JASA 2KJQA 1N5JA 1NY5A 3DM9B 1CJKC 2JJ2A 1U94A 3MSXA 2ZAOA 2IXGA 1PVOA 3C15C 3OAAA 1RFLA 2O8CB 4AY2A 1OYWA 1Z2CA 4V0LA 1DAHA 3GEEA 1ZUNB 4YMSA 5JSZA 3IEVA 3Q7QA 4TTRA 2MMCA 1AQUA 1YQTA 4LJ5A 4B3GA 4JT4A 2QGNA 3MWJA 3FKSA 3IPYA 3TAHA 4A9AA 5DI3B 3WRXC 1VCMA 2FFQA 1AKYA 1CXZA 1GNQA 4OJKA 3NC0C 1U0LA 5E7JA 3CLVA 1FNNA 3WHLA 3FMFA 1XEWY 3E70C 3VAAA 1L4YA 1R0ZA 4MRVA 2DBYA 4KSBA 3SQWA 1UKEA 5CDFE 4C7OB 3RHFA 1NRJB 3FHOA 1EX6A 2AFIE 5CYOA 1YRAA 2E87A 1IN7A 3RS2A 1DVRA 4KCGA 2HYDA 3KZ1E 5CM9C 4G5GA 3MUFA 4A6XA 4G3XA 4JT2A 2EFEB 1DTSA 2W58A 2JA1A 4MYUA 3X1XA 2CE2X 2ZREA 5DYGA 3Q85A 4IW3B 5HPYB 1SKYE 4JVLA 4K46A 3VU9B 4DUGA 4GP6A 2HJGA 3NDBB 1G8FA 3PR1A 1OB5A 3I62A 1FNMA 4ZI2A 5JSZB 1ZBDA 1RRCA 4RSGA 5AR1A 2BCGY 2PZFA 2JDIA 4WW0A 2KBFA 3NH9A 1XBTA 3TVTA 2ZI7A 1DG1G 2QM7A 4QGGA 1HY3A 1R5NA 3QENA 1N5IA 3CPHA 4IEIA 2FPMA 3BK7A 1KDOA 4DIDA 1S3SA 2GJ8A 1EFRD 1XEXA 1SXJD 1Z06A 3U4QB 1QVAA 3OEED 2FPLA 3G5UA 2OE2A 1LFDB 2NOAA 3RRMA 4CEJA 2R6FA 2ZXUA 1X86B 2VBCA 3A1TA 4AURA 2V4ZA 4FD2A 2FSGA 4QJ3A 1MO4A 1ZYUA 2YC4C 1O3YA 3OE7A 1VDZA 2HLDA 4IDQA 2YVUA 1G8YA 2A2ZA 5CLQA 4BFVA 1Q57A 4PO9A 2PCLA 1P9WA 3G82C 2ZRAA 3GLIE 4EDHA 5KNCA 1YRBA 4Q9LA 4HZUA 2CCGA 5EUQB 3X1WA 4DKXA 2J9RA 3O8RA 2P6UA 1VTKA 4ACBA 4TLEA 2IHYA 4DCSA 1TUIA 3QXCA 2OFOA 1N6HA 2R65A 4G01B 2P0EA 2O5VA 3TAUA 4WZBE 1R8SA 3WMFA 4Q4AA 1A2BA 4NCJA 2C2HA 1G7CA 4MYHA 5BYJA 1Z28A 3THXB 3RVBA 3TRFA 4RCYA 1C4OA 3KKOA 1VG1A 4ZCMA 1JJVA 4URWR 1G1MA 3L2OB 4DIEA 1FUUA 5EXSA 1G7RA 2V6JA 1OFTA 4DCTA 3CX8A 2OLJA 1AM4D 4QNMA 2W6JD 3Q72A 4JBXA 1PLKA 5AK0A 3KL4A 4B73A 1JEEA 5HCNA 4RKFA 4ZIRA 5GADl 2J7PA 4QNRA 2WICA 1NVVQ 4M4SA 1UAAA 2DB3A 2ZRJA 4TL8A 3QKUA 3VTKA 1GRQA 2ASEA 2EWWA 4O25A 4RD4A 5KU1A 2BMFA 3FWYA 2PMKA 5J4LA 1XJQA 3WBKA 1E94E 3W6OA 4L5BA 3AF1A 4E03A 3VX3A 2BHRA 3AVQA 4A0FA 2O0JA 3HDTA 2ZU0C 1TQDA 1FTSA 1KKLA 3DMDA 1EFTA 3BOSA 4FCWA 4OHVA 2LKDA 1W5SA 3UKDA 4C9BA 3B7GA 1IN4A 4PPNA 4LI0A 2O8BA 2D62A 1KNQA 1ZJ6A 5P21A 5KPJA 1E9FA 4TMWA 4TSFA 2OT3B 4BRUA 3LFUA 5TV2A 1JAHA 1EWQA 1SVOA 4XVUA 3A4MA 4OQNA 5JHGB 3W9YA 2ZI9A 4ZO4A 2V3CC 2GK6A 3AKEA 3B60A 4GP7A 5CK4A 3QF4B 1E1RA 2O8DA 2CL6X 5DNYB 4ILEA 2KSQA 3GD7A 2YJTD 1Q44A 2PH1A 2AKYA 2IA5A 5D3QA 1CR4A 1F5NA 4FCVA 3PV0A 2ZR7A 2FNAA 3SDZA 3E2IA 1EGAA 5E4FA 1TF2A 3AF0A 4RZXA 2VP5A 4DHEA 4I4LA 4DEYA 2JLUA 1NKSA 1PLJA 4AWXA 2WJGA 2CNWA 2YWHA 3I3SR 2FFBA 1Q3HA 5AUOB 1NMYA 5L8VA 4NYJR 5DHAA 3A1SA 1JPJA 4HB2A 4W5WA 1IY2A 4QC2A 1SVWA 4WZ6A 3P32A 1OXUA 4HLUC 3GLHA 5DGXA 2REOA 4HAXA 3NBFA 5EXTA 3O8BA 2WSMA 2XTMA 2YINC 3BJIC 3SBEA 3QUSA 1DBSA 2D2FA 4AYTA 1JQLB 2XXAB 4Q48A 5JFGA 1NN5A 1MRNA 1PV4A 3TR0A 4ZDKA 1YVDA 1P75A 3HU1A 1N5KA 1LVGA 4LYFA 3U61B 5JS7A 4KVAA 2W0MA 2ZRLA 1MT0A 2QN6A 1OH5A 2F3RA 5EP1A 3TLXA 2EVWX 1RPZA 3VR6A 2A5GA 4EAQA 5JMTA 4OK3A 2IS2A 1E79D 3P20A 3W3AA 4KLNA 2GXUA 3FYHA 3QQ5A 4OK5A 1XDBA 4B33A 3C5HA 3RLFA 2GJAA 3EG5A 3VR2A 1COWA 4QKQA 4BFUA 5K8TA 4P32A 1Z3IX 5ANRB 3T61A 4HAVA 2ZANA 1JECA 1SGWA 2OO7A 5JWHA 5IK2D 4A8JC 1US8A 4JKIA 4ZIRB 4WXRA 5BN3A 3CNLA 1E69A 1R0WA 2J1LA 1L2TA 3CPJB 1TNDA 4I1VA 1E9BA 3ICEA 2TMKA 1OFIA 1KAOA 3GLHB 1ZNXA 2OBLA 4V02A 5J4HA 5FL7A 3FFBA 4GOKA 3CZQA 1J70A 3CW2A 3GLGA 4GOXA 5FTKA 4B3DA 1BKDR 4PAOA 2C9OA 1HEIA 2BC9A 3OIWA 3NDPA 3L8ZA 5JCPA 3K0CA 2H7VA 4Q1BA 2EU8A 4LJ6A 4IJMA 4F7WA 4F92B 1SVIA 4MRSA 3ZIAA 2A9KA 2RH5A 4HI0E 5D3MB 4U00A 1K8RA 1Q21A 4M1YA 1NVXQ 3DDCA 3CH5A 5BW8A 1DO2A 2AX4A 1ZINA 2CMKA 3DPUA 3KB2A 4OBEA 1VKJA 3L0SA 2BJVA 1M74A 4Q7KA 4LV5B 4PC7A 2HCJB 5EJEA 2BM0A 4GPTA 4RFVA 5L3SB 1KOFA 5FPTA 2FSFA 3RNLA 2WJYA 5KDLA 5LDDC 4JLKA 3QXXA 2Q6TA 2FFAA 3IILA 1SKYB 4JLMA 4B74A 4GDFA 2WOJA 2VL7A 2MSDB 3FMIA 5HKKD 4CIDA 4N0DA 4LOAA 2ONKA 1E2PA 1P2UA 3GCGA 3KXLA 3Q7PA 1Q12A 2CE7A 1H8EA 5F98A 1NBMD 3QKSA 1AQYA 1M2OB 2EQBA 3BORA 4EUNA 3BB3A 5TVKA 4LBYA 1CR0A 1GP2A 1MOZA 1NBMA 1G4AE 1RKBA 4LSGA 3SS8A 4DB2A 5KPDA 1TTTA 1JR3E 1U99A 2WWHA 1KMHB 2WHXA 3NG1A 3QKRA 5JI2E 1QHHA 2IHBA 4POAA 1RW4A 1W2GA 3AUYA 4J0QA 1JPNA 3ASZA 2H1LA 5J4KA 5K8IA 2XZLA 4LHWA 2J41A 4YMWA 1YR7A 1MH1A 5LB4A 3REGA 4M22A 3TW4A 4M1WA 4TQUS 2VP0A 3CNOA 2XSZD 4AD8A 1R0XA 4LGMA 4MITA 3LY5A 4RKEA 1P9NA 4KFSA 2Z4SA 4NYJQ 2R6CA 3BAFA 1GIAA 2WWGA 1RZ3A 4MGKR 2RHMA 5KHOC 3AEZA 3RANA 3K09A 4GZMA 2QP3A 4QRHA 2BMDA 4IVPA 4A92A 4QJ5A 2ZE6A 1KSJA 4TZ0A 3GLGB 1G4UR 2J0UB 1LW7A 1CRQA 3PVSA 3SC3A 1VYTA 2WWYA 4UKDA 4B32A 1GKIA 2VP6A 4TLCA 3VR3A 5H8WA 1GNRA 3KJHA 1C9KA 3DEFA 1QHIA 1R6BX 2NO7A 4Q1DA 2JAQA 3HR7A 3CF2A 2WBLC 2IYVA 1XPOA 3RAPR 1LV7A 1GM5A 3ZD7A 2IUUA 1D2EA 3WHKA 5BN4A 4ARZB 4TQAA 1NKTA 4IEEA 4JSYA 1BOFA 4MA4A 1FFHA 4JS0A 1WBDA 5FR2A 2PZGA 3RRYA 4LBZA 4GFDA 4BQSA 5EZ5A 1FP7A 2NPIA 2UZ3A 3ZD6A 2GEUA 4DWJA 1DOAA 4UJ3A 4BLOA 1A1VA 4BZXA 2ZR0A 3TMKA 5JEEA 3MJRA 1J99A 1NJGA 4TMKA 2PX3A 4Z1MA 4A0HA 3I61A 2IUTA 4HUQA 3CUEF 4I1SA 1KO4A 1NVWQ 2GHIA 2Z83A 5KTYA 4OHYA 1SXJB 1VIYA 4TLBA 2CK3A 3EWSA 1HE1C 4LK2A 4X8LA 2G0TA 1JQJC 3DZ8A 1ZUIA 3ND8A 3NHAA 3ZZUA 1G3IA 4U5XA 3PG5A 3WMEA 3AF4A 1RJ9A 5BWMA 3FPAA 3MAAC 1G20E 1T9HA 1E1QA 4GMDA 2F1HA 2QMOA 1Z83A 4DSNA 1II9A 1MABB 1SVKA 2H92A 3LW7A 5FOWA 2JLYA 4HEJA 4LYAA 2V9PA 1CRPA 3Q5DA 2DYKA 3U44B 4TMVA 3EWAA 5IF9A 1JR6A 2C98A 2WWFA 5EXXA 3M1IA 2RGXA 3RS7A 1S1MA 5SZIA 4FMCB 2GAOA 3WNBA 3CIOA 3LX8A 4D4JA 2QM8A 3IBGA 5AJWA 1OHHD 5TDHA 4JLPA 4A8JA 2D74A 2FSHA 4NYMQ 1G64A 4QBHA 2Q9AA 1E9AA 1K5DA 4XD7D 1XU4A 3NWJA 1TMKA 3SJZA 2O8FA 1D9XA 4QFMA 1GTVA 4A8JB 1XEFA 2YOFA 3TSWA 4CEIB 2YKGA 1R8QA 3GJ6A 3IPXA 4H1VA 1ZNYA 1G19A 1KNXA 3RYTC 3RS5A 2O8EB 2LKCA 4KVGA 4A0GA 2ANCA 3HU3A 1OFHA 2YWGA 2BEJA 4PAQA 3QF7A 1P5ZB 5SZHB 5FH9A 4PQFA 1NG1A 4TSFD 2QPOA 4MDFA 1M7GA 2JJ1A 4Q18A 4U02A 4W5HA 3F5FA 1E6CA 3I73A 1YZKA 2F1JA 1R2QA 1OW3B 4QM7A 2QY9A 2GK7A 3EASA 4DSTA 1TADA 1RC8A 1EFUA 3ZDQA 2HYIC 2CVFA 5CIWA 2J7KA 3TQFA 1P60A 4ESHA 5CJPA 4RY2A 2IEZA 2ZS7A 1T8TA 4Q9KA 1KY3A 3T5DA 3K70D 4EPXA 5IK2A 3AP1A 3DL0A 4R9UC 1Z0AA 1EXMA 3CONA 3RDPA 1Z6TA 2F55A 1I2DA 2FX3A 2W6IA 3NH6A 1ZM7A 5FR1A 4TZ6A 4IXMA 3IDQA 3DMNA 4G5SA 3Q8XB 5FBVB 3GP8A 1ZD8A 3Q5EA 2UKDA 3KFXA 2WPDD 4JJKA 4LRWA 2ZEJA 1XTKA 1J7KA 3CNNA 1N5LA 4AC9A 2GEVA 3IKJA 4WBSA 3BE4A 5JWOA 4NCHA 1N6RA 5EP2A 3I72A 4NYIQ 4FMDB 2C03A 5AUPB 1XMSA 1YZLA 3GJXC 3NEJA 1XTSA 3CR8A 3IEUA 3QPUA 4LBWA 4LHZA 4HYYA 4P31A 3L82B 4YXWA 1Z6GA 4EFNA 1C1YA 1QDEA 1FQJA 4RD6A 4G5OA 2CEAA 1CR1A 1NN0A 2C95A 1KSGA 3SJCA 3RS4A 4DLWA 5F9FA 1NLFA 4Q21A 3PENA 5LD2B 2QTFA 1US8B 1IN5A 4QBFA 2BKUA 3TVDA 3ASYA 3ZVRA 1CP2A 2Q3HA 3L8YA 3ETLA 4XTCS 2V8OA 1WRBA 4XSHA 4UNNA 4EFMA 3GFPA 4US1R 1S8FA 3U7HB 1UBCA 2ZJ5A 3VR4A 4RZ3A 1NG9A 3C41J 1YR9A 3KJEA 5G3YA 5HZKA 5AWFC 1U98A 2PEYA 2WJIA 2XNDA 4B2IA 1KI2A 2MSEB 2J0QA 1AGPA 4KFUA 2W83A 4LUCA 1E32A 4OQMA 2NG1A 4S2EA 1W1WA 2HV8A 3ZZ0A 3QIAA 2XTZA 3WP0A 4L9SA 1XTRA 3KKMA 3RRZA 2VHQA 3GEIA 1XXHE 2F9MA 3O8DA 3B5JA 1HQCA 3F0TA 3OIYA 1T3SA 1F2TA 1T4GA 2ORIA 4BFWA 1X8LA 1W46A 1FMLA 4FWIB 2XTNA 4ZDJA 1TU3A 4M9SA 4LHVA 2NTYC 5FOVA 4PXAA 3R7WA 3K09C 3W90A 4BFYA 2NMVA 1VPLA 1G3UA 1ETUA 1W7AA 4OI1A 3NVAA 1UF9A 2C78A 1ESNA 2NQ2C 4GNKA 3EA0A 2IYXA 5AJYA 1R5BA 2R44A 2G1KA 1EFCA 4MKGA 3LVRE 5JZVA 5E7MA 2KE5A 4Z8XA 4NYMR 3R9XA 1XZQA 3AVXA 2D7DA 3TE6A 2C9YA 5FUVA 1P73A 4KU4A 2BCJQ 2JLSA 2ZSEA 3FB4A 4DDUA 3K0FB 5C4MA 2FDCA 2BEKA 3U5ZB 3SJBA 2NO6A 5HR5A 3QEJA 3PJRA 3ZIAD 1Z0IA 1P6XA 4RFSA 3QPVA 1JB1A 4TYPA 3Q3JB 2HF8A 2ZSAA 5CIQA 2IF0A 2IYRA 1S1CA 2PX0A 4B35A 4NYIR 5KO2A 3OEHD 1ZM2A 4CEIA 2P2LA 1SVSA 2PJRA 1W0KA 4URYR 2RGGA 3SQXA 3UWOA 3NC1C 3A58B 3SFZA 4URXR 2NPFA 1N6KA 1XPRA 4OL0A 1DELA 1XMJA 1OKKA 2FPKA 2ORVA 2O0KA 1QHHB 2VHJA 4L4UA 5KDDA 4C0BA 1FTNA 1E9DA 4B3FX 4DCNA 3ZGXA 4Z51A 3WNDA 5CITA 3QY0A 3CX7A 4PPQA 4LHYA 3B85A 2DR3A 3LQRA 3CR7A 5H70A 2V7QA 4BLTA 4JL6A 4MH0R 5CK5A 1AA9A 3GLHE 1DE0A 3LBIA 1GRRA 2VLIA 3N70A 1Q0UA 1P9RA 2FZ4A 2G0NA 1GNPA 1NLYA 3I8XA 4EIWA 5JJKA 1TQ4A 1QZXA 2PLFA 3BH0A 5JWRA 1S3GA 3DVLA 4TYNA 5LD2C 1A82A 5GJVC 1MKYA 4LPSA 1NI3A 1IJEA 3AP2A 5FL7D 3PUVA 2QMEA 2B8TA 4M1KA 2ZI6A 2V1XA 2WKQA 1F2UA 2FF7A 5DISB 4Q01A 2FGJA 2IYLD 1S4QA 2FFHA 2NGRA 3QPWA 3ECCA 1G291 4UQOA 1XMVA 1JNYA 3VHXA 2F7SA 2ODEA 421PA 4CF7A 4AKIA 1NP6A 3B1VA 4PC2A 5B58C 1E4VA 1UDXA 2JLVA 1VHTA 1PUJA 2GJ9A 3QG1A 1G3QA 3QI2A 1DAKA 2CCKA 5B30A 3GJ0A 4A2QA 4B3CA 2NO1A 4AG5A 1OSNA 1J90A 2W2XA 2H5EA 2OFXA 4KV9A 1TPZA 5BXQC 3CM0A 4DLUA 2ZYVX 1W36C 2PMDA 2RMKA 4MKIA 3KQLA 4LWZA 2G88A 1XZPA 4A2WA 2GNOA 2WOOA 3OE7D 1R10A 2JLZA 2CLDX 3PXGA 3TR5A 3QVUA 4R98A 1SXJA 4NDZA 5EE5B 4Q5IA 5G53C 2B6HA 3UANA 1XD2B 1G16A 4LJ7A 4Z54A 3THWA 2JJ1D 5EUMA 5G41A 1UBEA 2ZRIA 2EFHB 2ERXA 4GSYA 2IWHA 1RYFA 2IBMA 721PA 4YC7A 4TN1A 2QG6A 1Z5ZA 2JCSA 2FZLA 1QVRA 1KKMA 2H16A 2AD1A 2YOGA 3CWZA 4JLJA 2GESA 4MRRA 5JEDA 3OAAD 2HJVA 4D6PA 4TMXA 2XZOA 1KI3A 4W7SA 5A4JA 2QP4A 2CXXA 1GDDA 3TBKA 2KBEA 4PSKA 1JAIA 4ZCIA 4K8OA 2DCUA 3T5GA 1FUKA 1OXSC 1NVVR 5TY0A 1Z2AA 4UXIA 4RD2A 2ZQ5A 3UATA 2BJWA 2B92A 1R0YA 2QSZA 3LX5A 4C0LA 3KUCA 1OV4A 3AUXA 5FTNA 5HCIA 1YR8A 4OJQA 1X1RA 4M53A 2QQEA 2H57A 1G8GA 2YOHA 1SXJE 3AKCA 2VP2A 3AF3A 1Z08A 4PR0A 1HYQA 4RZ2A 5DN6D 4PTLA 5KUTA 3BWDD 1BYIA 3EW9A 4FCTA 1GSIA 1KMQA 1XJ0A 3U2QA 3ICQB 3UK6A 1W49A 1KDRA 3IO5A 3K70B 1H65A 1U8YA 3TNFA 4ZDIA 2F9LA 2VHCA 3LW8A 4X8MA 5KYKA 1ZAKA 3CRRA 1AGRA 1Z0KA 4CVNA 5H1YA 1MO6A 2ZUCA 1DAMA 4R2IA 3E5HA 3TKLA 3EIQA 1OH6A 2WAXA 1KZGB 1Z0DA 3L0OA 4NH0A 3WMGA 4H1UA 1ONBA 3SFVA 4MKFA 3AQ4A 4FWTA 4Q1AA 2OXRA 1YU9A 4XD7A 2IS1A 4C7OA 4RFSB 1G8HA 1LS1A 1XCMA 2BDTA 2YWEA 3MGCA 1L8QA 1OH8A 2R6DA 1IY1A 4HAWA 5F3WB 4DEXA 1II8A 1PLLA 3CRMA 4RZUA 4AKGA 1UM8A 2REBA 1YZQA 4JLAA 2OAQ1 2HXSA 1AS2A 1NN1A 2RAPA 2ZVPX 2CCJA 2QAGA 821PA 1W47A 4PQYA 3ZQ6A 1NLZA 4GI7A 5J4VA 2ZRDA 3GLFE 4IVRA 1WQ1R 2CJWB 1OYYA 1F2UB 2BKEA 3K53A 3KB1A 3P26A 3IHLA 5F9HA 4PAMA 2WKRA 1DS6A 2VP9A 2P5SA 1HTWA 1BH2A 2N42A 1RVDA 4TL6A 4JMPA 2HLDD 5DO9A 3MCAA 4JLNA 5GJBA 2WWIA 3BFKA 3CWQA 5FPYA 4FW9A 4EPRA 1PUIA 2W00A 2ZI4A 4FMDF 1IHUA 3SNHA 5E95A 4HUTA 4A82A 3GJ3A 5CJ2A 4IDPA 2ZPTX 4IOKA 1N6OA 3AVOA 3K0AA 4D4MA 2XGJA 1TAGA 3REFA 1G7SA 3SBDA 4F4CA 3D3QA 3TK1A 3H2YA 4C2UA 3DO6A 3D7MA 2PBRA 1EX7A 3C5CA 2AKAB 1OFUX 3OIVA 4HZIA 4CT4B 1HV8A 5HTKA 5JJLA 3M6AA 4ACAA 4E09A 1OHHA 2D3WA 3C4JA 5FOXA 4NP6A 1G41A 1LF5A 4IFEA 2Q0HA 4WOPA 3AVPA 4K81B 4V0KA 1Q1BA 2J0VA 4JVMA 1S2MA 1VYVA 4TL7A 4P4SA 2XB2A 1G6OA 1FOEB 1BMFD 3HU2A 3U3KA 1QG2A 2ZE5A 2CK3D 4HB4A 3EPJA 3MG9A 2QI9C 4TL9A 2ODNA 2QE7D 3W3ZB 2NIPA 2ZRGA 3AGPA 3DHWC 2C96A 2XEXA 2AK3A 3H0KA 4F4IA 4UJ5A 4NE2A 3QE0A 1KK3A 2VH5R 4OQXA 4PO1A 1D9ZA 2FGKA 3QBTA 4TYYA 521PA 4US0R 3IGFA 2WWXA 3ZVNA 1G9XA 3D6TB 1XWIA 4JBYA 1AIPA 1N6NA 5LB2A 1ZD1A 1DADA 1ZU5A 2FSIA 1NJFA 3VNVA 3EZ9A 3ADDA 1UFQA 4ZKEA 4Q1EA 1HA3A 1E2LA 5KNDA 2XXAA 3BRWD 1TX4B 2X77A 2ANBA 4MYTA 4PHFA 2QMHA 3KXIA 2JGNA 4V0MA 3QXSA 2AK2A 4PHGA 4DUGD 2A7QA 4OYHA 3PQCA 1J8YF 2YZ2A 3QEOA 5JJIA 1VHLA 2PL3A 3MFYA 2G6BA 2ZRKA 2CHGA 1XD2A 4N0EA 5C4GB 3TUJC 3PEYA 3MWKA 1IAQA 3CZPA 3RWMB 2ZSBA 5SZKB 4BEJA 5C2JB 4YMTA 4X8OA 1E1RD 2G3YA 2C9CA 1OLOA 2XB4A 2CHVA 1G5RA 1N0WA 1EFHA 4Q19A 4V0NA 4XWKA 3CKLA 5KSPA 3A8TA 4R2HA 2JIZD 3W6PA 3KKQA 5E3HA 2O8BB 4LJAA 3A4NA 2NZJA 2REXB 4UXJA 3LQQA 3TIFA 3ZLJA 3BIFA 4O0MA 4KYUA 3L43A 3D31A 1AS3A 1P3JA 3WXMA 2OCPA 1QHSA 3QXHA 3OEHA 2ZIAA 3SR0A 1GL7A 5CDFA 4I81A 4OHZA 1R5OA 3SYNA 1RRGA 1RYHA 1KAGA 1EK0A 5FBQB 3ZVLA 5KDOA 5KSOA 4L16A 2O8CA 2AXPA 4Q4JA 2AHOA 3K9HA 2Q3FA 4L8GA 5EP3A 4DLXA 4TWZA 1A7JA 5HE8A 1OKKD 4UNRA 3AVWA 3BH6A 1G7TA 4OQFA 4C0JA 5EP4A 3GPLA 3DKPA 1ZIOA 4BFZA 1NVUQ 1KSFX 3TUZC 3I5XA 1G3RA 2IEYA 5KSYA 4C0SA 3HYRA 2V7QD 1G5PA 4Q03A 5FTMA 2CL0X 1W0KD 4XWOA 4EJSB 4PFSA 2N46A 2Q3MA 1X8JA 3FHCB 3PEVA 5GVRA 3SEAA 2YV5A 2J0SA 3I32A 1MO5A 2JEOA 2ZYWX 2HT1A 1KIMA 4GBMA 1N0VC 5FPHA 4DT1A 4B48A 1CBUA 4RD1A 1KDPA 2J3EA 1IM2A 3AV0B 3KQHA 3ZZTA 2OEPA 4DT1B 4O3MA 3AM1A 3JZAA 3FOZA 2O0HA 1VCNA 4NHOA 2Q9CA 1YKSA 2F6RA 2CJWA 3EZ6A 4M21A 3R9IA 1E2FA 1QRAA 1ZNWA 5FPSA 5J47A 4KLZA 1R4AA 4UNPA 4Q7JB 4D0LB 2N1BA 1Y3AA 4BFTA 1NN3A 1X6VA 1T5IA 2EWVA 3B78A 3O47A 2OFWA 4BE7B 4AKEA 1KK0A 4R71A 1AJEA 4DSOA 4IDOA 2ZRFA 1E2MA 3A37A 4URUR 5AJZA 3ZVMA 5B57C 4D4KA 2RGCA 1W5TA 1NL3A 4M9XA 2GVZC 3EPHA 1Q1QA 2ZJOA 4XVQA 1U0HC 2CHQA 2R6GA 5L3QA 3BC1A 3MLEA 4RD0A 4XSGA 1KMHA 3QKRB 3B9QA 3JVUA 5JBQA 3BXZA 4TYQA 3U7GA 3KKNA 2WAYA 3UMFA 4C4PA 1HQYE 2IX3A 1KGDA 3DZDA 5EE3A 1GUAA 1EFRA 2HUPA 2WJJA 4Z1MD 4KFRA 1WMSA 3K9GA 3OEEA 4IOMA 2QENA 3RSLA 3NBYC 4DRZA 1UEIA 4FI3C 4AK9A 2RGBA 3SYKA 4B2PA 4C0QC 2QQ0A 4JYCA 2H18A 3TJZA 3BGWA 5EE9A 2OSBA 3QJYA 3GMTA 4PX9A 1BO6A 3VFDA 4NTZA 5FL3A 3R7WB 4ASUD 2GRJA 3MWYW 4KBFA 3AKYA 2CLSA 3B2EA 3T1QA 4ASUA 3UMRA 3OIUA 3GLIB 4Q66C 3NIBA 2KI5A 1E9EA 3NEYA 2E9SA 2A5YB 4Q7LA 2ZAMA 4QOSA 5AJVB 4Q02A 2ODBA 3QKTA 3K0CC 1Z22A 3SI7A 1VG8A 2ECKA 2MMGA 4OI2A 2ZYUX 3LLUA 4Q4LA 1XEWX 3IHWA 5DI9A 1OXXK 3T15A 3MJHA 2G83A 2ZJ2A 1NIPA 3GJ4A 3K0FA 4A4DA 4DCUA 1ZM3A 2QPTA 4Q4HA 3KDSE 2OZEA 4BLRA 4F38A 3EZ2A 3T34A 3ZQJA 4D4LA 3LXRA 2Y8EA 1YZGA 3FTQA 5UKDA 4S35A 1B23P 4CGZA 2WSSA 4KODA 1F2TB 2QROA 3HPQA 3BB4A 3N5CA 4W9MC 3LXXA 1SQ5A 5IHPA 3WY9A 2AR7A 3VQTA 1U90A 3EXAA 4KO8A 3P1JA 3GLIA 4QGFA 4FMCF 4B44A 3EX7C 2K5UA 3THYA 1X8KA 1N3BA 4PZZA 4QL3A 4ERNA 2WIBA 1U8ZA 1AK2A 4YLGA 4BRWA 2GBLC 3K9NA 4D25A 5JCZA 4HLQB 5TB5A 2ZRNA 1TEXA 1OJLA 4KSCA 4E22A 5TMPA 1FPMA 2X2FA 4PZLA 1D2MA 3UWKA 3O8CA 3ZS8A 4DLVA 2ZRBA 1CEEA 3C8UA 3N2EA 1W2HA 2Z6VA 2ZTSA 3KQKA 1VG0B 2AN9A 4C3ZA 1M34E 1DO0A 4M1SA 1DAGA 3KKPA 4BUJA 3FMOB 1WXQA 4P33A 3U6KA 4TT3A 2FEOA 1ELOA 4HUQB 1GL9B 2IYQA 1P7CA 4HAYA 4JVSB 4IDHA 3VR1A 2GXAA 2ZRHA 3CF0A 2L0XA 1EESA 3SYLA 5FOTA 4B71A 1FQKA 4QXAA 2IYWA 2WPDA 3VKGA 2BBOA 3C7KA 4MRPA 5JRZA 1OXTA 4BPBA 1M6NA 2AL7A 5B64A 2W2TA 4P0TA 3OESA 2BVNA 4EQ6A 2ZJZA 4MKHA 2BWJA 1W0JA 4PPFA 2GF9A 1KJWA 4URVR 1ZRHA 2OAP1 2IYUA 2WZQA 1II8B 1KHTA 1WDTA 2J59A 2QRNA 3HWSA 3VR5A 5LPNA 4HB3A 3EPLA 2FWRA 4NPHA 2ZI5A 3R20A 3VKHA 3V9PA 2FOLA 4FINA 4XIGS 5ELXA 3LAWA 2EFDB 4HATA 1KO5A 4NMMA 5JRJA 1W36B 1KO8A 4X8HA 2O8FB 1UJ2A 1M7HA 1NF3A 1W4BA 1JXOA 4PHTA 2AWNA 1N0UA 4JL5A 4LZZA 3T06B 1BMFA 1ZUHA 2H8KA 1LTQA 2QAGC 4OKSA 5EXPA 4YXWD 2QBYA 1G5TA 4CRWB 2J7PD 2LCFA 1A4RA 4YMVA 2VHTA 3IQWA 2WJHA 3TUIC 2QRZA 4A1FA 2IUSA 4Q4JB 2HCBA 3GLGE 4V03A 3R8FA 3MD0A 1E9RA 5AUQA 5IDVA 5K8UA 1W36D 4UNQA 3MRSA 2BV3A 1OIXA 4TLDA 1XB2A 1F6BA 1E2IA 1QHXA 2VA8A 4EPYA 3THOA 4LYJA 3K9LA 2VF8A 1DEKA 2ONJA 3DKVA 3VHLB 4Q9HA 3IO3A 3FKSD 3EA5A 2JLWA 1D2NA 4G0NA 5G40A 2BOVA 1QBKC 2IYTA 1E9CA 3BFVA 4NZYA 4BEBA 3UG6A 4DLYA 5DHFA 4BZQA 1Q22A 1N6IA 2FMXA 2VSXA 2KWIA 1M1YE 4AIIA 3FE2A 1ZM9A 1EG7A 4GZLA 2Q9BA 4XOIA 1IN8A 3HPRA 2GJSA 4OI0A 4NCNA 2DFTA 1TUEA 3QF4A 3SHFA 1E2QA 4A36A 4MRNA 2PJZA 1IN6A 3T1VA 2ZVQX 1G8PA 1ZC4A 1CKEA 3I4LA 4U7DA 1E2KA 4Q4HB 5EZ6B 3AKDA 3CX6A 5BYKA 2DWOA 4Q1CA 1SVLA 2QGZA 4LJ4A 1ESMA 4ON9A 5E7IA 2G9NA 3X1YA 1G18A 2IC5A 2VP4A 4CZ2A 3QXJA 1G3MA 1TF7A 4GL2A 2ZJAA 4PC1A 1NBME 3K0EA 1NY6A 2RGNC 4NL4H 2GEDA 2ZJ8A 4TTQA 1OXVA 5DI3A 1CF4A 4G1UC 1DG3A 2CNWD 1JR3D 4LHXA 3ADBA 1EWRA 2WWWA 3QNUA 5DH9A 2IYSA 4OHXA 2F3TA 4DLZA 4YQFA 1TQ2A 2EFCB 1E0SA 2ZROA 1P4SA 4IDNA 4PSVA 5DSZA 3BFXA 3GFTA 2RKOA 2J0UA 4B47A 1N2CE 3TGPA 2LWIA 1CTQA 1Z6AA 3QG5A 3NHBA 2SHKA 4A15A 4CEJB 1YZTA 4B2LA 3SE0A 4L9WA 1YR6A 4M1TA 3LD9A 2HF9A 4B3XA 5FOUA 4A0RA 3A4LA 3V4RA 5FPKA 2YHSA 5L3SA 1ZNZA 2GDJA 5G3ZA 1KYIA 4Q00A 3WBJA 1E0AA 1UKZA 4LCBA 4BLQA 2Z0MA 4GMXA 2FE4A 1T0JB 4N3NA 1T3HA 4II7A 2W2VA 4NCIA 3PUXA 1E79A 1XF9A 3GQBA 1WA5A 2WVJA 4QGHA 3B1XA 2QP9X 2DFNA 4JLDA 1F3OA 2WM9B 4Q1FA 2YWFA 2P3SA 3W8RA 1V43A 3KTAA 4OHWA 2XNDD 1LY1A 4EJSA 4BZPA 1GL6A 3VU9A 2QAGB 4YDSA 3UMSA 1Q1EA 3MWLA 4DDWA 2G1JA 4TLAA 4EJSC 2QORA 4IKEA 2HEIA 2RHDA 1KI4A 3QBVA 2OCYC 3ZH9B 1GITA 4MGIR 4QJ4A 3CB4A 3LH5A 4RVCA 4BECA 4HLDA 3RABA 1G21E 2KB0A 2IS4A 2ATXA 2IYZA 2V1UA 1OIVA 3OF5A 5JS8A 3F3YA 5C46F 4ZDWA 3WYFA 2UZIR 3ADKA 2IL1A 4PC3A 5TXGA 4DVGA 3GLFA 2QE7A 4CEHA 3D8BA 1A5TA 2D4HA 2BIFA 4DLSA 1XEXB 1UBFA 1VCIA 4G5QA 2VO1A 5JI3E 5IT5A 4ABYA 3TH5A 4D82A 1BS1A 2C5LA 3P4XA 3PUYA 2ZS8A 4PPGA 4URZR 5B2ZA 4Q7MB 4FIDA 3KX2A 1E3MA 1NIJA 3OFNA 1SHZA 4ITRC 1DAEA 1RRFA 3EZFA 1G17A 1WB9A 2GETA 2JJ2D 4JZKA 4XH9B 5CLLA 1X1SA 5EQTA 3SOPA 2A78A 4WZAE 3CPEA 4M9ZA 3AVUA 1CLUA 2B8WA 2A5JA 3I5YA 4JSTA 5K8LA 4I1OA 3MMPA 2RGNA 1FP6A 4OK6A 2DWPA 2HT6A 3U60B 1ZD9A 1T0HB 1LNZA 1BYUA 2HXYA 3S1AB 2QAJA 3EIHA 4CEHB 2A3RA 4Q9JA 1XJCA 4CT5A 1U0JA 4DC9A 4IVQA 3ZS9A 3K8YA 3OHMA 4Q4AB 4Q47A 5AJXA 2IF2A 2R62A 2VRWA 4RD3A 3DOEA 2UVQA 4AYWA 3X1ZA 1W0JD 2JLRA 3FKQA 3HJNA 4CDGA 4JBWA 1WBBA 2EW1A 3RS3A 4KITB 2J87A 1DAFA 2ZJYA 3BS4A 4XWAA 3W8NA 4DB4A 2YC2C 4KI0A 2GZAA 2FA9A 2JJ8A 1R7RA 4DLRA 2BM1A 3C16C 2FN4A 1AKEA 5DN6A 1IXRC 2O8DB 2I4IA 1T5LA 4LJ9A 2QTHA 4QBGB 1UKYA 1FW6A 4I99A 1CJTC 2V55B 5BQ5A 5J40A 4JJZA 3U7EB 3GJ5A 2ZSFA 1BIFA 3AVVA 4V0ME 2I1QA 2WMOB 1I4DD 2GCOA 4BWYA 3KQUA 4MYCA 1NSFA 1ZVQA 1HUQA 1VECA 1SXJC 4NKRA 5CYPA 5L3VA 2FEMA 3WYAA 4NBSA 4QM6A 2BMJA 2I3BA 5FI1B 1OIWA 4M9QA 4N1AA 1ZCAA 4P4SB 1W4AA 4Y0VA 1N25A 1MO3A 2ZSDA 6Q21A 3F8TA 3PUZA 4Z8YA 2Z5FA 4HAUA 5FUWA 4D0GA 5A0FA 1QF9A 3THYB 1E96A 2R2AA 2WMNB 5KNBA 2VYFA 3UG7A 4DZZA 3HP1A 3J81k 2WJVA 3SU8A 1PZNA 4XVRA 2ZU6A 3G0HA 1E2HA 2X1VA 1TQ6A 1QG4A 1V5WA 1AZTA 2XNSA 1DARA 5DYIA 2IW3A 3GJ8A 2AXNA 3R9WA 4IFBA 1L4UA 3B1ZA 5FUXA 1GOTA 2GCOB 3IIJA 4B76A 3KXKA 1FZQA 4M0LA 2OUKA 2JATA 1GKYA 1XRJA 1JALA 3I1FA 3KJIA 1NNEA 3KUDA 2ZITA 2OM2A 1VMAA 1I4LD 2OESA 1XFAA 2QT0A 3WP1B 4HDQB 2F1RA 4CW7A 2P5TB 1UPTA 1Z47A 2QZ4A 2VEDA 3JVVA 4DSUA 2X19A 4EKDA 3FFAA 1FX0B 3CF6R 2BBSA 2EYUA 1F48A 4AYXA 3U7FB 4QHYA 2ZR9A 5H68A 1OF1A 4JLVA 3ZJYA 1XXHA 4MUAA 1W48A 2XITA 3NBXX 4IHQA 1H8ED 5FI0B 1VYUA 3LWNA 2XJ4A 2QPAA 3LO5A 2RGAA 3PFIA 1KJYA 4IRUB 5SZJA 3VNUA 3BBPA 1P2VA 2P6RA 4FMBB 1UEJA 4M2LA 2VTKA 1E0JA 4D80A 2A5FA 5EE0A 3K0SA 5KOYA 1KDTA 1KK2A 3B1YA 3PCRB 1MV5A 3BH7A 1QHYA 2ZM5A 1HE8B 1HT2E 5LBIA 2GZHA 5JLJA 1ZCBA 3KJGA 1Z8FA 2Q21A 3GLFB 2Z4RA 4D26A 4IOJA 1MABA 3TSZA 2AWOA 2GF0A 1IJFA 4EQ6B 2VF7A 3RC3A 5FTJA 4RCZA 2QEQA 3NXSA 5AUNB 2ZE8A 4NONA 2QUZA 4LC0A 3WYGA 1U9IA 1KI6B 4G5RA 3T1OA 1VG9B 4WA7A 4WIAA 1N6LA 3CH4B 3L0IB 3CO5A 1XXHB 2MSCB 1KTVA 4O2RA 2OBMA 5F2EA 1CJUC 2B21A 2W6JA 2NO9A 1O87A 4AKHA 3RSOA 3BB1A 3V00A 1L7VC 2W6ID 3IIKA 3THWB 2QNRA 2FH5B 3B1WA 3CBQA 1J2JA 2VSFA 4AI6A 4ESVA 3U44A 2OV2A 3ADCA 3THXA 1KI8A 2ZYTX 2EYQA 4TMTA 4PC6A 2IXEA 3TW8B 2E1RA 4PHHA 4JLBA 1TEVA 3Q9LA 4HLCA 1UADA 5C1BA 1Z6YA 3B8HA 3FHTA 3U3OA 4D2IA 2ZE7A 1PJRA 1IONA 4QBIA 4ARZA 4BFSA 4TT3D 2JLQA 1J8MF 1G6HA 1ZP6A 4R7ZA 2VPPA 4ZV4A 5DIFA 2XAUA 3DM5A 1HH4A 2VQSA 3K1JA 4GRAA 2ZI3A 1S0UA 3B82A 4LV6A 2ERYA 2QU8A 4YDHB 1NMZA 3RS0A 3T12A 3X2SA 1ZU4A 4JYBA 1VCOA 1TU4A 4KBGA 4JVNA 3PIRA 1SULA 1GAJA 3I8SA 1IOZA 2ATVA 4OQLA 4TMZA 4B3BA 2VSOA 3AVYA 2RGDA 2IXFA 5J5CA 1W44A 1KZ7B 2PCJA 2ODWA 3CRVA 3EARA 5FFMA 2ZJBA 3CRQA 2CL7X 1FL9A 1DAIA 1Z29A 2NO0A 3AGQA 2QA5A 1F60A 1GVNB 1HT1E 1LS6A 1YZNA 1YZUA 3QVVA 3S1AA 1OPXA 221PA 4F91B 1KI1A 3A36A 4LJYA 1P2TA 1UDWA 3LLMA 3LBHA 4O2LA 3LVQE 1XD8A 1OB2A 4HDOB 4KHZA 2GKSA 3K70C 5FBLB 3B9PA 4LDJA 2ORWA 2X2EA 4IOLA 1T8UA 1GKUB 1ZIPA 2DWQA 4PSAA 3SHWA 3T1TA 2G77B 3EC2A 3QKSB 2IT1A 2ZS9A 1K6MA 4CYMA 2JDID 1Z0JA 3A1WA 1QHNA 3LBNA 3V4FA 5HE9A 2IS6A 1CULC 1GRNA 1OT3A 2JIZA 2O52A 4PZYA 4ZCLA 2XX3A 4QHSA 5M04A 4TYWA 3BERA 4C0KA 8OHMA 2P6NA 5C18A 4TTPA 1AS0A 4B75A 2R9VA 3T35A 1CIPA 3TSOA 4KJZA 4A2PA 2OCBA 5CB6A 2DHRA 2GA8A 4LC1A 1P72A 1UKVY 3A1UA 3AP3A 2DY1A 2QL6A 4KFTA 3X1DA 1XTJA 1IQPA 2QMUA 2FJUA 1IY0A 5L3QB 3A6PC 3KFVA 3EZ7A 3FDIA 5CB8A 1JJ7A 4AG6A 1COWD 2PZEA 3VKWA 4LX0A 3IBYA 1E2GA 2O8EA 3TQCA 2BBTA 3PEWA 1FMJA 2WTUA 2C77A 2CLCX 3BD9A 2GJKA 3ONWA 2BBWA 1I2MA 1XTIA 2OHFA 4LBVA 4WXPA 4QGAA 4PO8A 1P2SA 2RGEA 621PA 4MQBA 3OZXA 1HURA 3SN6A 3OFND 1H8HA 3ZYCA 4B34A 4HB0A 1CS4C 1P62B 1ZW6A 2FG5A 3GFOA 1XD9A 1H8HD 1E2DA 1ODFA 2OILA 1RE0A 3KTAB 1SVMA 4BLSA 2I1VB 2OCAA 2GXSA 1JXMA 1D8TA 3JZMA 4JL8A 3AVTA 1SZPA 1CU1A 3FVQA 2HDNB 4EPVA 4IXNA 2X8AA 2JLXA 5EE1A 2PT5A 2XSZA 2QBYB 4HZUB 4M1OA 1GZSA 4NU0A 5FBWB 1KJZA 3U6BA 1IXZA 1ZMXA 3A1VA 1RRPA 2B7BA 2RCNA 4YONB 1Z0FA 3QOFA 3W6NA 2OBNA 4DJTA 4DDVA 3B6EA 3AF2A 1XMIA 3RWOA 2DFKB 3UPUA 4PQRA 3LRPA 1TF5A 4DXAA 1Q1ZA 2ZRPA 2GWHA 4UXHA 2ZUBA 1K5GA 1E2JA 1N6PA 1S9DA 2IYYA 4WVFA 2CDNA 4LPKA 2PEZA 3I92A 1E9SA 5HKKA 2V6IA 1T3LA 4JKYA 1JEDA 1B0UA 2DFLA 2GZDA 3CRW1 4LYHA 1YHNA 1S9HA 4OI4A 1ZC3A 4C0HA 1KSHA 3W34A 2J46A 3HYTA 2A5DA 4JLOA 4D0NA 3NBZC 4I1UA 4LJ8A 3FGNA
chains in the Genus database with same CATH superfamily
4E07A 4IF4A 4ISBA 4XJXA 1XNJA 3BTOA 2DRIA 3GIWA 1JHQA 1XVAA 3LUJA 2PY6A 5B36A 6PFKA 2QWXA 3A27A 1DEOA 3ZE2B 1VMEA 1L7QA 1JDVA 4FZ3A 3WL8A 4MV1A 1FTQA 3V1MA 4E15A 1LPAB 1DJLA 4K6GA 3TTXA 2CBZA 2J5XA 1CZNA 4F93B 3ZWNA 5ECGC 1JBKA 3SCZA 2R48A 3KYBA 4A03A 1RIFA 3LUFA 2R8RA 2W2QA 3HUTA 4A6PA 2ZQZA 2C2GA 3GFFA 1YOVA 4YUWA 1GGNA 1ESCA 4KRGA 4BASA 5EESA 1W581 2REQA 2WTXA 2UYCA 1Z6XA 3U4QA 1IMOA 1R9JA 1E4YA 4MUBA 4F7DA 1LSJA 4MVJF 4CKZA 2Y0PA 5EIEA 1T6BY 3SVTA 1VFNA 3F4BA 6REQB 3WL4A 1Q77A 3V1TC 1DQYA 3SGLA 5CM8B 3A2LA 4NC9A 2Q4TA 2XHZA 4OB7A 1YE8A 2BFNA 4MUHA 3O2JA 1DWPA 4R1QA 4L15A 1X7GA 3WLPA 1MRZA 3EAQA 1KEKA 2ZETA 4KTTE 3PRJA 4WGFA 1SPXA 2PRJA 2B61A 4IS2A 4TZTA 1T91A 3A3YA 3AB3A 4JJFA 1DIRA 3VMFA 4H9GA 4IR7A 1RXIA 1SHLA 1WM1A 2NZ8A 2XOKD 4KXYA 4LVCA 4WNIA 1E3TA 3H97A 1JR3A 4YRQA 3NKVA 4HV4A 3GNQA 2X7XA 2XE4A 1JLRA 1XVVA 2VPIA 2EKBA 1C3LA 4LE2A 2Q4EA 2ZUDA 1EDBA 3LNCA 5HG0A 4RVFA 4PSDA 1Z8NA 1TUBA 4UVIA 3TAXA 4MDEA 1GG2A 1RWWA 4MICA 1WTCA 4F06A 5KNBH 5JNTA 2E55A 1E89A 4TQGA 2C7BA 3AETB 4ER7A 3CN7A 5K6AC 1C8LA 3H2JA 3ANTA 3L49A 5IG2A 3ZLBA 4HWSA 4LS3A 1ZONA 1OXBB 2GXQA 3LOQA 5EHIA 1DRJA 3QOYA 4A16A 1QX4A 2JFVA 1JXAA 3BF7A 4V0OA 5HRUA 2H4JA 5CFQA 1IBRA 1GT91 5FUYA 3GLUA 2HK6A 2XMDA 2D8AA 4IEFB 5IC6A 1E5DA 1DPFA 3II6X 5CD1A 1OLUA 1VB3A 1BCRB 1XTQA 2SCUB 2WYUA 4I6GA 3ZU5A 5KQSA 3WYDA 3CVWA 4DLTA 4UAJA 1Y8RA 1WWKA 3H0CA 4HG2A 3WRVA 4CKBB 5AVTA 2YIMA 1ZEMA 2QSYA 5FTWA 4MX8A 4MQFB 2YNMA 4OXIA 3K71B 3WGLA 2C2WA 2BEVA 3JARA 3NQ41 1E99A 1AN0A 1NXTA 2BHLA 2P9YA 2XCQA 3IAHA 4HSGA 5TMBA 1J1IA 3M4JA 2WD8A 1W4CA 2WMDA 1OA0A 1KI7A 2DE0X 5LCXA 7REQA 1MRSA 2C2MA 1X1CA 4S1NA 2VDKB 2P91A 2W0SA 1R4ZA 5ICGA 3DUFA 2OLKA 2JJQA 4LRXA 4RABA 1Y63A 1U8CB 3DZGA 3UAXA 3HLTA 4YRBA 1OH7A 3DP9A 5C8VA 1QS0B 2D7CA 1QTIA 4I46A 1A2KC 1EKXA 2VOJA 3K30A 3KCNA 4J29A 5KCMA 1G5QA 1S96A 4ZQFA 1PSWA 3V7YA 4DR2B 4D0RA 4MHOA 3GJ7A 1J22A 5K0TA 3HWX1 1MX1A 4HDRA 5ED4A 1I2CA 1K97A 2OAGA 3KZKA 4S3MA 1HMYA 2P3OA 2JAPA 4WK6A 5DXFA 4CPDA 3LK6A 1E1NA 1HLPA 4B4UA 5AVJA 2E7ZA 4F1WA 5A5GA 4LXXA 2B5WA 1WD7A 2WIAA 4X7BA 5DE3A 2VIIA 5D3MA 1F0YA 3BHIA 3ND9A 1X3SA 5AH0A 3G1TA 1EUYA 1ZD3A 5BRNA 1UBKS 1ANKA 4UQLA 1M8PA 4EPWA 2XT9A 4YR7A 4ZYWA 3RFCA 3SQNA 4IJUA 3AH8A 4EO4A 5CD9A 1U2RA 3TNJA 4DN6A 1MQSA 2YVQA 1RI1A 1CJCA 3DTVD 2QNIA 3KV3O 4PZUA 4TRMA 1YZYA 1ZHFA 2RHCA 3BHNA 2I2AA 3HBAA 2PT7A 5EZYB 5AXDA 5I7UA 4IIYA 2R6AA 1OILA 1HORA 1JWAB 2KJQA 3DXFA 1CJKC 2JJ2A 2HPHA 1HYEA 3QI7A 1FDIA 2IXGA 2ZSHA 3AB8A 1XZFA 4D44A 1RQLA 3BDAA 1PVOA 3OTGA 4CMIA 4AY2A 1OYWA 2EJBA 3NHJA 1KYYA 4V0LA 4HEQA 5IABA 4R4JA 3V8EA 4BQFA 3Q7QA 4HH0A 2APJA 4R5HA 5J1TB 2PWBA 1YQTA 1DJOA 4EY8A 4YRSA 4B3GA 5C46F 1NV8A 2QGNA 1BJKA 4J6FA 5DKFA 3TAHA 3TRIA 1H2AS 1E6WA 3MTIA 1GL3A 4LGYA 2VF5X 3EN0A 4EKEA 4YYEA 4HVTA 4OJKA 2C2ZA 2O57A 2A7XA 2X7HA 4O1IA 4KR9A 3W04A 4BLWA 3AWIA 4GYWA 1FYVA 4ZVLA 3UCFA 1ODKA 1E6LA 2AOUB 4KSBA 1R0ZA 1RWNA 4QXQA 3TNDA 5CDFE 2PD4A 1CNEA 3NHSA 4UBKA 3LDFA 4N01A 1EX6A 2NU6B 2E87A 4RA9A 2JLBA 3RS2A 1C8KA 3EZGA 5K0ZA 3KZ1E 5CM9C 1V8DA 4AJ1A 3SY8A 5KAMA 2I0FA 2GN4A 3P2EA 3VDMA 3WTCA 2FPGB 2ZREA 3GRUA 5DYGA 4NBUA 2GASA 4HAIA 5AYVA 5FIUA 1QQAA 4ZCPA 4K46A 3PD7A 3ZCTA 5G0WA 4NRDA 3PR1A 4M6WA 4DM4A 1FNMA 2I6QA 3F9IA 2H4XA 5EIHA 5BNZA 3NTVA 2Q29A 4FC6A 5AR1A 2BCGY 5D5HA 2PZFA 3ZUGA 4DMMA 2QQ5A 4U7PB 2ZR8A 3W8EA 2FLVA 1Z3CA 1IDN1 3TB4A 2IEIA 1Y9DA 5IJAA 1QXSA 3R3YA 4LIPD 4MUNA 5K8JB 1XSEA 1TMYA 3GG2A 4NOKA 5KJFA 1X7XA 3L7OA 3SVZA 1Q84A 3I1JA 1H1TA 3QENA 2YJGA 3CPHA 4IEIA 3WL6A 3BK7A 5I7VA 1QP0A 5DBEX 2GJ8A 5AXBA 2PFKA 4R1TA 2GPTA 4MWCA 4UCWA 5IYZB 3U4QB 4ROTA 3OEED 1BNCA 4I08A 3D8NA 5DSXA 4UOQA 4QBTA 3RB8A 4EFDA 3G5UA 3P5BA 4AL4A 2X5NA 2L42A 1IE3A 3S7ZA 1JWLA 2GK4A 2ZXUA 5F1OA 3WG9A 1X86B 3HI4A 4ETNA 1I51A 3A1TA 4AURA 2Q3EA 5J9FA 1AF7A 1JIIA 2FSGA 4FONA 3D81A 1H5UA 1MO4A 1A88A 2O8VA 2AN5A 4BO6A 2O8DB 1JE0A 1YQWA 3NP9A 2FMUA 3QMWA 1QJCA 4LDPA 3ICPA 2GD1O 3I1YA 1RLMA 5AVZA 5IXJA 4PO9A 1AOXA 3NI2A 1AMUA 3VPAA 2ZRAA 5KC8A 1O9HA 3RBZA 1BE1A 4G4GA 5A4AA 2CCGA 2VH1A 2XGSA 3L8DA 3ACBA 2BZSA 3KG2A 1Z7GA 3AHIA 3T41A 3QXCA 1SOAA 2OFOA 1Y7PA 4JMLA 3WJ2A 1ADGA 1QQ6A 5HIMA 2VQFB 3L7MA 4JX9A 3TAUA 3VOSA 2FMHA 4C0XA 3A4YA 1R8SA 3V4ZA 2RGYA 4Q4AA 1A2BA 2Z56A 4D3YA 4RS4A 5I3CA 4MYHA 1VXOA 1Z28A 3V7FA 3ETGA 3RVBA 3TRFA 1QRSA 4DLLA 2H0QA 3IMFA 1BVHA 3V2IA 1VG1A 3DBRB 4URWR 5K3BA 2DBZA 2WY2D 1TVCA 3EFBA 4C6SA 4UDOA 4WRRA 5AI9A 1ILWA 1G7RA 2VFAA 1E3EA 3LE8A 3OI7A 5D00A 5TS2A 4CUKA 4TLMB 5CA0B 5AM3A 2Z1MA 5JARA 4O4IF 4QPPA 3ZWDA 5LP1A 1G2IA 2RC6A 1E3IA 3O9MA 1QFMA 5AK0A 2WF9A 2N47A 2OCLA 3M9WA 1NC1A 2J7PA 2XNCA 4UPVA 5BSUA 4F56A 3DP7A 4HGNA 4KXNA 1EIZA 4QNRA 2A1TS 1QZTA 1RD4A 2XTJA 4M4SA 4W9NA 5DM2A 2ZRJA 4LXQA 4XCQA 2DB3A 4MMXB 3FUWA 1JZSA 3VOBA 1USGA 1QKKA 2GEBA 3VTKA 1OCEA 1T8RA 2VCHA 4RD4A 2KW5A 4MVJE 2H4HA 5J4LA 3NWPA 2JRCA 3EXHB 4CNQA 4MEAA 5DW0A 4UZEA 5BWLA 3ILXA 2O0JA 3OQIA 4UTOA 5L51A 1TQDA 1JHRA 3DMDA 5GPBA 5DM1A 3BOSA 1VC2A 1UPXA 1JLHA 1R74A 3GPDG 3ICCA 5DCLA 3TLKA 3FLAA 3FPBA 1IN4A 1GO2A 2PSEA 2D62A 1ULSA 1G2OA 3P9SA 4ZAYA 3CEHA 4KR6A 4NFYA 5P21A 1AKRA 1QIIA 5KPJA 1E9FA 4TMWA 4DUZB 1JH9A 3HACA 1KOJA 1CC1S 2ZW9A 3MILA 3MGBA 1C1XB 1M6EX 5BMOA 3A4MA 5E9JA 1MGOA 2QLTA 5JBNA 3N2ZB 2C54A 3IVGA 4RENA 1NUUA 1XAHA 4ZO4A 3JQBC 3AKEA 2B1RA 1LSOA 3NETA 3QF4B 1E1RA 4PZEA 2O8DA 4H7PA 5DNYB 2IP4A 2A4MA 4LXTA 1WBJB 1OI4A 4DOMA 3K0BA 4M7WA 2AKYA 2HBZA 2I8LA 3PHIA 3AG5A 1O97C 4NV0A 4OHFA 3LBYA 2ZR7A 3SDZA 5LQRA 3E2IA 3TYXA 3I01M 2B69A 4QD3A 1PBNA 1F17A 4RZXA 3ZIDA 2ZBGA 3E1GA 4LA4A 4IP0A 2P8JA 2R8ZA 2ZTHA 2LUOA 3D6MA 4BKPA 2VNAA 2O7VA 2WJGA 1NU6A 4NFSA 3R7AA 3WWYA 2YXLA 3UKJA 4XDZA 2HJWA 3FDZB 3ZDAA 1FDWA 2BI4A 5L8VA 1YR3A 5K3OA 4LTMA 4PY2A 1P1IA 1X1BA 3FJ1A 2ID9A 1JIQA 3H3JA 4FFNA 3C5EA 3ZV3A 1MXFA 3MTEA 4DG9A 4WNAB 3GWGA 2ZZNA 4RXMA 1TDJA 1FTWA 3QVXA 4YUYA 3NWBA 2REOA 5EXTA 3RJMA 2WSMA 3P9KA 5FV4A 4I50B 3QUSA 1JVSA 4KUHA 4PG4A 2O54A 5CA0F 5GIPE 4IDEA 1JQLB 2QMQA 3M1YA 3G2NA 2O2DA 4D99A 2I3AA 1Q5PA 5JFGA 4M8KA 2XXAB 1U1DA 1Z62A 3DKIA 3FFTA 4LYFA 5CT8A 4XSVA 3ZHSA 3RIMA 4FKBA 4YY3B 1JZTA 1Z15A 5AMXA 1L5NA 5KYTA 1OH5A 3D4PA 4HGOA 4EHLA 5FLKA 2IH5A 2PHZA 2VF2A 1V6CA 1V4BA 1I0ZA 3DE5X 3EDMA 1RPAA 1XMQB 3KXPA 2IS2A 3OOWA 4TYMA 1ACLA 4KLNA 2R8YA 2VJLA 1E3LA 1FXSA 2Z3ZA 5DLDA 5EIWA 2AUNA 4NH4A 1PO7A 2VNSA 2GJAA 3C74A 3H18A 3VR2A 5EWJB 3H11B 4QKQA 1C50A 1LUAA 4HAVA 3DAOA 3B70A 4LHSA 2OO7A 5DNWA 4CLOB 5IK2D 1N7HA 4A8JC 1FA9A 2H59A 1UIRA 4IWXA 4C01A 3NWOA 4PNHA 2J5RA 3FPFA 3ICWA 4QYXA 2JGIA 2CFIA 2QTWB 3QVMA 4H7FA 1XCBA 1L2TA 3BWXA 5A5FA 3ECAA 5LMNB 3ICEA 2XGOA 4HX2A 3CNQS 3NM5A 2DQZA 2OBLA 1QYDA 3MUNA 5J4HA 1FRFS 3K9BA 4IIXA 4PCUA 5FL7A 1R9NA 3AR2A 3CXRA 4F2HA 2XOEA 3FFBA 4M76B 1PFQA 2PQMA 3TEJA 4PAOA 2PZAA 1YRLA 4R8LA 4FDVA 1HEIA 2QUHA 3FNRA 4LSZA 3O95A 4XM1A 2CN1A 5JCPA 4IGIA 1M1ZA 4Q1BA 2FPPB 2H2HA 5F21A 4F7WA 3BPSA 5J3JA 2A9KA 3IELA 2CNNA 5J43A 4RTOA 3DEIA 5G4KA 1TCUA 2R8XA 5CB4A 2LR0A 2NYUA 3CH5A 5HMMA 4NSNA 1TW2A 2P78A 3LZDA 2P9TA 3DVRX 7AT1A 2CMKA 2NU9B 4D9EA 5AQEA 5DHQA 3CZAA 4OBEA 1W93A 3Q7TA 4P98A 4EENA 1A8IA 4LZJA 1M74A 4Q7KA 2P9QA 1YQEA 2FUCA 2HCJB 1BCRA 3IR6A 4MUFA 2BM0A 3UK2A 5L3SB 5C9ZA 4PSUA 2HNBA 4JOSA 3ONFA 4QRDA 2OA0A 1IL0A 1Z2DA 3RC7A 4B3SB 2H07A 5AT1A 2PVCA 5MGBA 2GZ2A 3DBOB 3VVLA 1I5EA 5ALSA 3WBFA 3DTVB 3GLTA 2Q6TA 4Z9XA 3MK31 4FM9A 2FFAA 2JH3A 3IILA 4I4TB 3FRHA 4X44A 5FI5A 3RYFA 1YRHA 2VL7A 4FCCA 4EA6A 3BZUA 3I6BA 5JQGF 4YJ2F 1E2PA 4PYJA 1P2UA 3GCGA 3KXLA 4X91A 1JW9B 3RVMA 5JNLA 1U9CA 2ECQA 3QKSA 5FWAA 4W9NC 2C9MA 1E7QA 4LBYA 1GP2A 4NOMA 1G4AE 4OHCA 5KPDA 1LDBA 1TW3A 2Q1XA 2WWHA 1NNSA 3IOCA 4BVGA 3S81A 4YDQA 4O1HA 1AH2A 4GUDA 1QM5A 4MEJA 1JPNA 1SBZA 4PYQA 4RY8A 5J4KA 2TMDA 5ALJA 3UM9A 4RY9A 1YR7A 5LB4A 3REGA 4RESA 2CVPA 4TQUS 3CNOA 3H9QA 4JLSA 3U4GA 3D02A 3OETA 4AECA 1A5AB 1EA7A 3DBHB 4AZ0A 4D5GA 4LGMA 5CFNA 3JWEA 3F9RA 4GEKA 4MITA 4RKEA 3U1TA 4KFSA 1SCIA 1LI7A 1ZY2A 4CU5A 1T3ZA 4OCZA 1GIAA 1FFXB 2FQYA 2VJQA 3CZRA 3E22A 1OZ0A 3K5HA 4MGKR 4Q3BA 3S68A 1FFYA 1MH9A 2RFLA 1Z12A 2RHMA 2WKWA 3K09A 4FGUA 2QP3A 4UHHA 2JARA 5B58T 2YXDA 4TGLA 3WK4A 4CTJA 4IHJF 4JYZA 1BKYA 1UM9A 3GLGB 2X5KO 1PK8A 1LW7A 2ZG6A 3PVSA 1A5SB 1P74A 3ABSB 4G2TA 4HT3B 3WB0A 4F0JA 5EXEA 3T3IA 2ACWA 1N9GB 4WVLA 4BFLA 2B3TA 4Q3LA 1BWQA 2NUTA 2VWPA 3CF2A 2WBLC 3QPAA 2QYHA 4PEVA 3W9SA 3RAPR 4Y9SA 4RK1A 4EY4A 4F4FA 1GM5A 2KYRA 4L22A 4RANA 1P4AA 1R88A 3CW8X 4CKBA 3WHKA 2DPLA 5GIOE 3WLQA 3CZ5A 4ARZB 1NKTA 5IDYA 4L8VA 1BOFA 1FFHA 3KVNA 4FDTA 1WBDA 4RSMA 3WNQA 2XYVA 4GFDA 4BQSA 5BSTA 4CM4B 1E7RA 1FP7A 1RQGA 3O9ZA 5ICFA 2OG1A 1QRDA 4YAGA 4W1PA 2X0JA 3M4XA 3R6DA 1N2JA 2DERA 2HA5A 2WP8J 5ARCA 5DRTA 1LBTA 3X44A 1DOAA 1GJRA 2H2AA 3HDQA 1TT7A 4P0PB 1DQPA 4RF4A 4UJ3A 3KJZA 5K3DA 5TPZD 2X0DA 2ZR0A 3E0XA 1KWKA 2QD2A 4FR0A 2YH2A 1R6DA 3MJRA 4DR7B 3CO0S 4L74A 4DNFA 2YX1A 4O4HF 4E5MA 1N92A 1KRWA 5JMOA 4F1KA 1KO4A 5CA1B 1NVWQ 2INGX 3LQ2A 3I39X 1WXIA 3M89A 4C3VA 2GKGA 2XMCA 4TLBA 2I4NA 1ZVMA 3N6XA 4O02B 4WA8A 4R1NA 2G0TA 4Y98A 5BRJA 5GY7A 2Q28A 3IVMA 4C7XA 3N2GB 3HXKA 3USCS 5LUAA 5HNKA 5A0VA 4NHEA 2DAPA 3ND8A 3HVUA 3WIOA 3ZZUA 3PG5A 1QCZA 1BH6A 3RVKA 4RKRA 4CE6A 1GQSA 3H5OA 4RPKA 3HJUA 5L7YA 1SA0A 2QMOA 1XKLA 2QTCA 1WXWA 2HMUA 3P19A 5TJ9A 3SLGA 2H92A 5ALKA 1IHDA 4HEJA 2V9PA 4LYAA 3EW7A 3Q5DA 2DYKA 3RM3A 2QKYA 1WB5A 4BVLA 4B87A 4TMVA 4K2HA 4GGPA 4CMEC 3UJ7A 1ZMBA 2WWFA 5LKAA 5JNRA 5TVGA 3BSSA 1U3FA 3M1IA 3NNNA 4BQRA 1XRLA 4BE9A 2H9AA 4LYEA 4DMLA 4R9RA 4HDAA 3PR3A 4UUPA 2Z5LA 4DA9A 1QVWA 1PQPA 2OXEA 5TDHA 1Z4JA 2Q8NA 1PFWA 3M6IA 2F3PA 4ZALA 2D74A 1E1DA 5GONB 3LUBA 1JYFA 3SYMA 3B2NA 3IVAA 4DBLE 2O8FA 4G9EA 1CY6A 2VZ0A 4HBZA 3DO5A 1Y3CE 3O7WA 4QFMA 2J3JA 4A8JB 3ZV5A 1VA5A 3BWVA 2WTMA 3QVJA 1R8QA 3KVOA 3IPXA 3MYRA 2PKRA 3TIGA 3VPFA 3RTCA 2JGDB 2YFQA 4BB0A 2ENWA 3D8UA 5I48A 5A4KA 3D1VA 4NVRA 1ENYA 3W7BA 2BI7A 2HU5A 3MGAA 3GUCA 3PLNA 4Q9DA 3HU3A 3CYFA 1DKUA 4YRRA 3SX2A 1YJQA 2BEJA 2FUG6 4PAQA 5SZHB 1NG1A 5BMVA 4TSFD 4M7OA 4IG9A 5C31A 3SYTA 3F5FA 1E6CA 1POXA 4R8KA 4W1RA 3KAJA 1A7UA 3C2QA 2F1JA 1R2QA 3EA4A 4MI6A 5BNTA 1RWXA 4DSTA 4UDNA 1HLDA 1FNBA 2OV1A 2OZPA 2X2PA 4MYSA 3ORRA 4YP9A 5KS2A 1EFUA 1TC2A 5DLYA 2HYIC 1W9HA 1JKJB 3INTA 1UDCA 1P60A 4ESHA 3DTTA 2IEZA 1Z56C 3LQFA 4Q9KA 3T5DA 1KY3A 2CXNA 4Y1GA 4UMFA 2HIAA 4GE3A 4R9UC 2O06A 5F52A 1Z0AA 4BMOB 3M5WA 2ZCUA 1FNSA 4U39A 1A8QA 5C34B 3IBSA 3U40A 2G70A 2W11A 3M8KA 3UOAB 4EX6A 4PV7A 4YHHB 1IAVA 3TXXA 2PTHA 2VRNA 3GGOA 5FBKA 3U37A 3G2JA 2YIJA 3P2OA 2O9JA 3E81A 3DMNA 3URMA 2X5OA 1R9GA 3Q8XB 5FBVB 4IIBA 2AJTA 6GPBA 1YQQA 3AONB 3KFXA 4YQYA 4JJKA 4KQ6A 2DSTA 5D5PA 1M5UA 2IHNA 2ZEJA 3VSBA 1XTKA 5MF6A 1J7KA 2PGDA 3CNNA 2C00A 4ZQBA 1DTWA 3D8SA 3IT1A 4KNVA 3BE4A 3OPYB 4FSDA 3JWPA 1TZKA 4WSOA 3U7RA 4DB4A 5EP2A 3D0KA 4Q7EA 3O7MA 3UJ6A 3ZJ5A 1RKQA 3E82A 1OPRA 2JFYA 4FMDB 4QFDA 1G38A 2W70A 1E1LA 1T0IA 4PLCA 2JAOA 2Q3BA 3KWLA 4QFBA 4ZVQA 4E6PA 2HQSA 3CR8A 1LVUA 3IEUA 2FPRA 1J7JA 4WOBA 4F9EA 1UUFA 4EFNA 5KEIA 1KQ3A 3LTNC 3B48A 4FEAA 3ONEA 4RD6A 5T5QA 4G5OA 2C95A 4O4IA 1KSGA 3A26A 3RS4A 3EC7A 3QK7A 4CIVA 3TVDA 3KOOA 3PRYA 2BKUA 3ZHQA 1Z88A 2I76A 4I3HA 2Q3HA 2NP6A 2P90A 2VLBA 5CVUA 3FIJA 1G2PA 2UVPB 3CIFA 3O8OB 3VAYA 2DKOA 3QWFA 4DV6B 3SHQA 4OFXA 3AUFA 2HQ1A 3WB2A 1SC9A 1J0BA 2H0RA 2OORC 3U7HB 2HBQA 2B37A 4GZ5A 1UBCA 2BF7A 2NVWA 1ESEA 5FUMA 1NG9A 5EWJA 4RTRA 1V6SA 2HQBA 2TSYB 3LFHA 1NSYA 3KJEA 4IGKA 3H6GA 4RHXA 4XDGA 2PEYA 2WJIA 2XNDA 4A7PA 2MSEB 1ECGA 5HZKA 1AGPA 1YJXA 4OQMA 1R5JA 2A0UA 1GAQA 2HV8A 2VAXA 3AHFA 2JIPA 1BEZA 3QIAA 4J2OA 4P4NA 3HJCA 5G02A 1UKAA 3RRZA 4CF3A 3FGPA 3GEIA 2DT8A 5KI6A 5FJIA 1L6IA 3OIYA 4OFZA 2ORIA 3LPAA 3EVZA 1VKRA 1KJNA 2YFKA 1X8LA 3KQSA 5SYAA 3DEYX 1FMLA 2ERCA 3EYAA 1DP4A 3MJFA 2G6TA 4P34A 1LSSA 2HM7A 2PRSA 4IHKA 5FPPA 3PPXA 3K09C 3ZX5A 1X80A 2NMVA 4FYXA 3E15A 1ETUA 3PI7A 3ZE1B 4OI1A 1W7AA 1DLIA 1F8XA 2R3SA 4P36A 3GA0A 4J1TA 3H4TA 1A0OA 1UOQA 1YDMA 3DAPA 3FN4A 3OU2A 4XYLA 5CEJA 2OBBA 2G1KA 5JH7F 1XE3A 5E7MA 2ICAA 2Q5IA 3GYBA 3IBTA 4JD5A 4WK2B 5FV7A 1NUPA 1YCHA 2YIVX 4ALJA 1V8PA 2JGEA 2D7DA 4E5KA 1G8KA 3TE6A 3CCFA 5FUVA 3KBBA 2ZSEA 2JLSA 2Q4OA 3LYAA 5CURA 4DDUA 3AMVA 5I3ZA 5IJ9B 2V45A 3OOYA 4RACA 4FHDA 3UK7A 4F9TA 1E5QA 5HR5A 4Z4FA 3HG7A 1Z0IA 1NX6A 2BTOA 1DC7A 3QPVA 3WGHA 4LVOA 4J0FA 3BVPA 4M0MA 1ADJA 3L46A 2VT6A 4K87A 2EJUA 4TS1A 3ZXIA 4NULA 2GAJA 4D5EA 2LVBA 2EKLA 4TRRA 5C32A 2HMTA 5EMKA 3R5JA 5CIQA 1L5HA 2IF0A 4QDZA 3UEOA 2G9RA 1ZHHA 2MINA 2VI5A 2GCIA 4NYIR 3OEHD 3RYFB 2I2FA 4XQ0A 4DLKA 2H7YA 1SIWA 1IM8A 2RONA 1JXQA 1KIFA 3AFIA 3WDSA 4EW1A 5I9IA 4D9FA 4IH4A 4L51A 3SFZA 2WZBA 1VIVA 3UWSA 3WB1A 1NX9A 2BUAA 1MJFA 3EMDA 4K9SA 3P9YA 1RYYA 2HUNA 2X5JO 5NLLA 5EJ5A 2DHQA 4ICIA 5KDDA 4FGKA 5DT2A 4C0BA 1X7ZA 1Z74A 5H3HA 4B3FX 1XI2A 1E7MA 2MDTA 1EM8A 3BKWA 3QY0A 3WNDA 4E0BA 3Q8KA 3I3OA 3B85A 5B2FA 1Y4UA 2PGOA 1ZNQO 2VJPA 5K0SA 1V3TA 3DZIA 5E1OA 1LD3A 2VP3A 4YRLA 4BLTA 3JD2A 5CK5A 4KOEC 1X15A 3RASA 1KJQA 5TJHA 3ZGNA 4QEDA 2BFDA 2BZ1A 2FI1A 1A7KA 4KQEA 1WDKA 1TQ4A 3I4FA 4I9UA 4R3NA 2PLFA 4LQLA 5KJCA 3U49A 3ACDA 3Q8MA 2AJBA 5G1OA 3JQGA 1A82A 4HOYA 4CM8B 3BEDA 3BMNB 4LPSA 3HA2A 2CD7A 3JQ9C 4CM6A 3RJ9A 4YBZA 3RARA 3MTGA 1QYCA 4M88A 2C29D 4X54A 4ARUA 5I4BA 2JIBA 2N3ZA 4K9DA 3A1FA 1CZLA 2NGRA 3HCRA 3NXKA 4XUGB 5E3JA 4EOGA 421PA 1B00A 1T26A 4PLFA 2IP1A 2ODEA 1FMCA 2J4DA 3ROTA 3V2GA 3ZU3A 1Q3KA 4AKIA 4ZWNA 1I24A 1PS9A 3B1VA 4PC2A 3FZEA 4KO1S 2A67A 1PUJA 3B3QA 2QLJA 2J4CA 3K5IA 2O3UA 4ZAGA 1XVIA 1YFLA 3WFZA 3I9KA 3K96A 1ZHOA 2IXBA 4G1MB 4IDBA 1UAYA 2V3VA 3PJGA 2WSIA 5HBGA 4A2QA 3ZWWA 3RODA 4B3CA 4DXDA 1XFDA 4AG5A 1OSNA 1A97A 2PMBA 2X13A 1C9YA 3C4QA 3HKCA 3IDOA 2JZCA 4X1YA 4YRCA 5DNCA 3DOCA 3AR6A 1LDMA 2J5BA 2QLFA 4DA8A 2RMKA 2DQSA 4MKIA 2KLBA 2VJCA 5NULA 1BGWA 4BNTA 2DUMA 4JCOA 3KJQA 2GNOA 3OE7D 2JLZA 5ICCA 3TR5A 5G53C 2YWBA 4OM8A 4JJEA 3DULA 2FSVA 2ES4A 2JJ1D 1WMDA 3NR2A 4B6OA 1UBEA 4ZMRA 2EFHB 4CLOA 2ERXA 4GSYA 2A14A 2W4QA 3FZQA 3HZHA 5I7AA 4IKOA 4F1JA 1Z5ZA 2DJ5A 3LQ4A 2H16A 4MRRA 2YOGA 3CWZA 3VZCA 5JEDA 5KTSA 1Y0BA 2X58A 1W2WB 2VS1A 2Z9DA 1QG6A 2M6SA 1QB8A 2HJVA 3OAAD 4R6WA 4TMXA 5BQFA 3OUZA 2XZOA 2XIQA 3L92A 4HYQA 4J1TC 1VLMA 3S40A 2HOQA 5I9LA 5IJ9A 3PNSA 3I05A 5K4AA 1YZFA 2WQ6A 2KBEA 1C29B 1HDIA 2C3OA 1KAHA 2AOTB 4K8OA 1GPNA 3KB6A 4HWGA 1BA3A 1FUKA 1NVVR 3ANNA 3HWWA 3T5GA 2P9GA 3BJZA 4UXIA 1HKHA 2R8EA 3VJLA 3CH7A 1U04A 1L4EA 4MXDA 3U39A 4UFPA 5HCIA 3AUXA 1KERA 2ACVA 3GWZA 1OZHA 1S2IA 1SMKA 1YJCA 1PD1A 1CQZA 2CLFB 3AJRA 1X1RA 2FKAA 3MBIA 1I1OA 2QQEA 2YOHA 1E3WB 3DFIA 3LSYA 3T52A 1O5TA 3W2IA 4EF4A 3VYWA 3AF3A 2F59A 2NUTB 3O73A 1FY2A 4RZ2A 3AUKA 3ZV6A 5KUTA 3F90A 2E89A 4BV8A 3BD7A 3EGXA 4IVNA 1XJ0A 3ICQB 1SOMA 1XC7A 3GLKA 3I9FA 1TM7E 3TNFA 4BUZA 1J49A 4LOKA 4TMYA 4B6SA 1KY5A 1J8VA 1P0PA 2VXCA 3I9V1 2JFBA 5DCUA 5EKSA 1DFHA 1RAEA 5JG7A 1Y1RA 5LP6C 3L41A 1HZZA 1PW7A 4RAOA 4NPAA 4C7KA 3I6MA 1REQB 3DOHA 4OGLA 3JAKB 5KMGB 1PJTA 1RHUA 3KOWA 4X97A 3WIEA 5AVVA 4WXEA 3OM9A 1WDMA 3TKLA 4ZHQA 1OH6A 2WAXA 2DULA 1CY4A 2K2WA 2Z2KA 2YVKA 1MFPA 3L0OA 4QUHA 1IHPA 4G0WA 3WMGA 1NW3A 4H1UA 1XKTA 3AQ4A 2QTZA 4MKFA 3HN6A 1S7CA 3IPCA 1IUOA 4KQ9A 4C7OA 2EJWA 2CFCA 3CE6A 1NXVA 1VBNA 4G0MA 1G8HA 4P81A 4N9WA 2BJHA 4RFSB 4DIBA 4QJIA 4Q37A 3WLNA 3RC9A 4RWZA 5IEJA 1CQWA 2YWEA 1V2GA 1PYDA 5BOSA 2IPAB 2FEWB 4NBLA 2QNBA 3VR5H 1RC0A 4U7FA 3ZCUA 3VOAA 2HA4A 1PLLA 1XV5A 4DEXA 5K6AA 1OZGA 1UM8A 4ZYTA 2FEXA 5GONA 4EKIA 1X13A 1T3TA 2IYAA 2OAQ1 4HDMB 4N9QA 4CXMA 1NN1A 4MAAA 1DWQA 2ZVPX 2CCJA 3WLSA 1D1TA 1SZCA 2VZLA 3ZQ6A 5J4VA 1OLXA 2ZWIA 5FP0A 3PWKA 4IVRA 1C0EA 1LJLA 1WQ1R 3H4IA 5KYGA 2BKEA 2H2FA 4YA6A 2WKRA 1IVNA 3KAKA 2BEWB 1M1NA 2P5SA 3ISJA 3ZLTA 2OQIA 3MRXA 3ZE0B 4ML3A 1BH2A 1N2BA 1M2KA 1WJGA 4TL6A 3EDQA 2PWYA 2PZJA 2NTJA 1T4MA 3BN3A 3FTFA 2YMLA 2YDYA 4F72A 2ZI4A 2W98A 3PL1A 4MUIA 4KHPB 3N2NA 1DNPA 3IVCA 5BVHB 4D4MA 3AVOA 3K0AA 4W8HA 2WF6A 1LZKA 3AI7A 3IAS1 3KPUA 2XGJA 5HIKA 4P9NA 4MLZA 4YCMA 2R5FA 1Z5PA 3PGXA 4K1XA 3SBDA 1Z8HA 3DZFA 2FP3A 3AUSA 1E18A 3TK1A 3H2YA 4C2UA 3QJ5A 2G8LA 1OFUX 2ZUSA 1HV8A 2X1MA 5F51A 5HTKA 5JV5A 3CUUA 2AMFA 4H16A 4GW3A 1NJ1A 2IHUA 1OHHA 4E09A 2C84A 2D3WA 5EJMA 1A8SA 3G2OA 1LF5A 3FLBA 4IFEA 1MZPA 1QANA 3W9BA 1UZMA 4UATA 5DDIP 1XZDA 4K81B 3RAFC 1RQRA 3TZEA 3N6VA 1S2LA 3N3BC 4G8CA 1VYVA 1EFPB 1G6OA 1FOEB 3HU2A 5E6UA 5DP2A 3T4XA 1EA5A 5EHGA 4R1SA 3O74A 1MIOA 4HB4A 3FNEA 3B89A 3FR8A 2ONZA 4MLPA 4NG5A 2QE7D 3HP4A 4OPMA 3A1EA 5I9MA 4EKNB 5CEEA 3MJDA 5J1SB 1RKXA 4Q3DA 1YHZA 2AK3A 1PRYA 2CFTA 3QTTA 4B17A 2OD7A 1SUEA 3CTMA 3OMXA 3QE0A 1RU3A 4C6HA 2VH5R 4PO1A 3TZKA 1D9ZA 4TYYA 2H1OA 1P4RA 1YQGA 2WWXA 3I23A 3NKLA 4OXXA 1XTPA 4IO1A 3U7JA 2CUTA 4HYEA 2WJWA 4GLFA 1ZD1A 3D0OA 2PGAA 3U7QA 1ZU5A 1CF9A 1WUTA 1NJFA 3IB3A 1M9NA 1K2VN 1W73A 1ACJA 1E2LA 5KNDA 2VG8A 4KIFA 4PWZA 5EMLA 2DPMA 3VYTB 2ECOA 2ANBA 2YN2A 2XQKA 2CB0A 2QMHA 4UM9D 3IKMB 3QXSA 2AK2A 4NR0A 2BONA 4DUGD 1NQAO 4OYHA 4RQUA 3SR4A 3KQQA 4DDKA 1GSOA 1VQ1A 2YZ2A 3QEOA 3Q3HA 4JUFA 1M0EA 5JJIA 1WCXA 5LYYA 1FRNA 3FOBA 5C3UA 3TUJC 3PEYA 1NMEA 3MWKA 4J2HA 4ZREA 3AY3A 3GEDA 4EEXA 5C2JB 3IJPA 3OQBA 4BEVA 5ELLA 1PR1A 3MCWA 1UBHS 4MCIA 1OLOA 1M66A 2CHVA 5IT4A 1N0WA 2XB6A 1EFHA 3TBHA 4BNDB 2WM8A 3UGQA 2O1WA 4R2HA 3S2UA 3W6PA 1U3VA 4KO3S 3DMHA 1JRLA 3SHTA 4BKMA 4EY7A 2AZXA 3H1FA 3PYXA 2HV9A 4LJAA 1RLJA 1I5RA 2R96A 4UXJA 4ZRMA 1E60A 3LQQA 3BIFA 3P0RA 4AXBA 3ZY2A 2YFYA 2FUEA 5KYWA 3WXMA 4YCDA 2IQIA 1JLLA 2JRLA 5C1DA 1QHSA 4FFBB 4XPZA 5LZ4A 1CZUA 3C3WA 3SYNA 1N1DA 2Q4DA 1RYHA 4FQ7A 4RJKA 5KSOA 4ZOCA 4Q4JA 4LJSA 3BWMA 3K9HA 2I7VA 1A7JA 4RMNA 2OBXA 4BNJA 1Q0TA 3AVWA 3BGSA 3IPRA 5C7OO 3BH6A 4HWKA 3JASA 2I7CA 2JBAB 2CLEB 4Y3UA 4CDRA 3FJOA 3UMBA 1LQUA 2JCVA 3L8HA 3ENVA 2IEYA 4NE9A 4JI5B 4HEA1 4YK7A 3RHSA 2ENUA 3WNZA 1EGQA 3DE1X 3O4VA 4FOLA 4Q03A 2PV0A 5K0LA 2AYXA 3S2SA 4C07A 1NI4B 1W0KD 5ALQA 1USVA 2WJ3A 1RYNA 4BWVA 5LMCA 2H1CA 2OECA 3ZCXA