1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
4H9GA 4JT4A 1W0KD 2BJVA 4NCKA 1OYWA 4LWZA 4KFTA 4PHHA 4V0OA 5FBQB 1YR9A 1KGDA 2QTVB 2TMKA 1N0WA 1II8A 2YOHA 3AVTA 1XBTA 2O8FB 2Q6TA 3A8TA 1G18A 1EFUA 1TX4B 4B3GA 1ESNA 1NJGA 1NLFA 2WZQA 1RC8A 2ODNA 1Z2CA 3EIHA 4LJYA 1MABA 4B43A 3W90A 1WXQA 3L0OA 4C0QC 3EPKA 1NVUQ 4UNPA 3B60A 2R6FA 1TMKA 3QKRA 1ZD9A 3WRYC 3Q85A 1AIPA 2VP4A 4TT3A 2RGGA 4PC1A 4U7DA 1KI6A 1XX6A 1QHSA 4PQFA 1WA5A 2FN4A 4IDPA 4K46A 4LPKA 4DT1A 1G19A 1Z6YA 1D9XA 1MO4A 3O8BA 5FL7A 2FDCA 1P4SA 1LY1A 2C99A 2GCOA 5FOWA 3QXHA 3J81k 2V3CC 5EP3A 2QBYA 4QBHA 1DEKA 4JMPA 3WXMA 3BAFA 2WWGA 1GZSA 2FGJA 4Q4HA 4S2EA 4D4JA 3SJZA 3WP0A 4B47A 2GBLC 1XJQA 1MKYA 5FUVA 2IUSA 1E4YA 4C0SA 2CE2X 2CVHA 2H18A 3ZQJA 2Z43A 3GLGE 4PQRA 2NG1A 1JQLB 3L8YA 1HYQA 3S1AB 5TY0A 3W6NA 2D7CA 4Z1MA 3ETLA 3W9YA 3U7GA 1M1YE 1HEIA 4OQLA 3EPJA 4LHVA 3NC1C 2W6ID 2ORIA 2XGJA 3QBTA 5L3SB 1YZKA 5CM8B 1FL9A 2BMEA 4LJ7A 3WNDA 4OL0A 1GG2A 3P4XA 2OSBA 2WJJA 2JLRA 1OXTA 2XB4A 1QHHB 3SJCA 4EFLA 4JVLA 4JJKA 1FW6A 1XEFA 1SVOA 4AD8A 4A9AA 3QKSA 3RHFA 3HDTA 4A2QA 4LHWA 5TV2A 1UBFA 3HU1A 4QJ5A 4WW0A 2VYFA 2QZ4A 2WWWA 2JIZA 1J8MF 1M34E 4UNSA 3VKGA 1Z22A 4KVAA 2A78A 4WZAE 1U0LA 4FMBB 2F6RA 3BE4A 1N0VC 4TTQA 3CRRA 4C7OA 5DO9A 1Z47A 1CBUA 2QP4A 1JXOA 2ZRIA 2OXRA 3I8XA 4U5XA 4KODA 3ZIAA 2OXCA 1VPLA 3GLHA 2JJ8A 2F9MA 3IPYA 4NYJR 2FX3A 2OESA 1FQJA 4PTLA 3AGQA 3C15C 4PPQA 3AVYA 4M0LA 2QAJA 3BFVA 3AVOA 221PA 4FINA 2NO1A 3ZJYA 2PCJA 4US1R 2JDIA 1LS1A 1G3IA 2QGNA 2ZUDA 5FPHA 3K9HA 1F2TA 4GNKA 1E98A 1Q1ZA 1ZAKA 5FPTA 2CNWA 4CRWB 4CEJB 3AKCA 4QKQA 1TPZA 4ZKDA 5LD2C 2QAGB 5JWRA 4TLCA 2D06A 1M7GA 4JLBA 2ZRHA 3U3JA 4JL5A 1KI3A 3U6BA 3E70C 3L8ZA 4QM7A 4RD2A 2H7VA 4D25A 2V8OA 2PX0A 1IJEA 3NEYA 2EU8A 1W7AA 2P6UA 5L3RA 2V54A 1XNJA 2ZYVX 4KBFA 4YQFA 1X3SA 4RKEA 3N2EA 4GMDA 4Z8XA 3LV8A 4QBFA 4P33A 2FFBA 3U3OA 3AF4A 1NKTA 3EA0A 3GEEA 1Q1QA 4GT1A 3OAAD 4RZUA 2NPFA 1CS4C 2XX3A 5FOUA 5EE9A 2ZR7A 4TTRA 3OFND 1KOFA 4NMMA 2OILA 1T4GA 3BBPA 4G5SA 5KHOC 1IOZA 4IW3B 1VYVA 2JAQA 3DO6A 2ZYWX 4JJZA 2F7SA 2P65A 1AQUA 3U44A 1N5IA 1YR8A 5G3YA 2GXAA 4MGKR 1G5RA 1DO0A 2A5FA 4ACBA 4RFVA 1XB2A 3KXLA 1G8FA 1WMSA 3DDCA 1S4QA 4M1YA 2VSOA 4JLPA 3SHFA 2J3EA 3QE0A 3GD7A 4PAMA 2ZSDA 4KO8A 1AZSC 3TAHA 2WPDA 3AH8A 4C3ZA 2EYQA 3F8TA 3ZD7A 1HURA 1EFTA 1SKQA 4D81A 3WYAA 4DB4A 3SC3A 3KXKA 4KBGA 4BZPA 3QXJA 2L0XA 1YZLA 2CDNA 4PO9A 3IQXA 2VLIA 1W4RA 4NCJA 3CPEA 3P4YA 4LJAA 1R5BA 4M1MA 4BFZA 4EJSA 2BHRA 2IXFA 4CEIA 2ATVA 4IVPA 1C9KA 1ZJ6A 4D4KA 5FTLA 3TRFA 4RFSB 2CCGA 2IUTA 2IYSA 1GL6A 2ZI7A 3NBYC 1W5TA 3UG6A 3X2SA 1XJCA 1G16A 2PZEA 1W4CA 5EP4A 3EC2A 2RGDA 3NH9A 2MSDB 1VHLA 1PVOA 2P5TB 1E2PA 2GJSA 2ZRPA 3EA5A 1JR3A 1ANKA 1NL3A 1OXXK 2JLZA 1P75A 3SBEA 2DFLA 2Q3HA 4J0QA 3DKPA 1D5CA 2ZROA 3RS4A 1GAJA 2J5XA 3B1VA 1Z0DA 4Q7MB 3K8YA 2ZUBA 3CKLA 1XCMA 3VR3A 2ORVA 2P6RA 2IS4A 2D7DA 2JJ1D 3B9QA 5BN4A 3PUXA 1JPNA 1DE0A 4LYFA 5DI3A 1NMYA 2WHXA 3R9IA 3HR8A 1FZQA 4KHZA 4JSYA 1KSGA 2ZREA 2GEDA 4RSGA 3Q5DA 4IEEA 1TF5A 1H8EA 2XOKD 2OFOA 3NEJA 5J40A 4EJSC 3O8RA 1Y63A 1UBGA 3BH0A 1G5PA 2VO1A 1VG9B 1OFIA 4HI0E 2GJAA 2G1KA 1AKEA 1KO8A 2FSFA 4OHXA 3ADDA 1SVIA 2GCNA 4M4SA 3UG7A 2J0UB 3DEFA 2D3WA 5A5GA 4AI6A 2FPLA 2O8FA 3O47A 3LQRA 1HY3A 1WDTA 4R9UC 2CL7X 3SJBA 4HZUB 2CK3D 4ZKEA 2A30A 3LQQA 4M9QA 2XB2A 1X8JA 4ZO4A 1TADA 1DADA 2VHCA 2P3SA 3LY5A 3D8BA 1U90A 4Q02A 4V03A 3T35A 3PVSA 2WAYA 3NH6A 1U0HC 3VX3A 1KY3A 3LD9A 1KAOA 3BK7A 4X8OA 3ZVRA 1VIAA 1W46A 4BLQA 5KDOA 2WWFA 4JIMA 2GA8A 2F1JA 4LHZA 3IUYA 1S3SA 3REGA 3SI7A 4KVGA 1OLOA 1AM4D 2I3BA 3GEHA 3VR5A 4N0DA 1ZIOA 5EUMA 4LJ4A 4LV5B 3K70B 2WJHA 4TYQA 1AS3A 5IT5A 1S1CA 2WBLC 3KX2A 1IAQA 1UADA 1MR3F 2IXGA 2QT1A 3TIFA 5E3HA 721PA 3K53A 4KITB 1TF7A 4I81A 3S1AA 2B7BA 2QROA 4PHFA 3T1VA 1IXSB 1UEJA 2X2FA 5CITA 4LZZA 3L0PA 4NYJQ 1UBCA 4ZCLA 4PAQA 1UKEA 2EFEB 3LDAA 2O0JA 1YRAA 4GOKA 5L3SA 1R0WA 4DCVA 1Z6GA 1W49A 4DLTA 1GM5A 1HTWA 1DAHA 1QRAA 2GK6A 2QP9X 2BM1A 2PMKA 3Q7PA 3KTAA 2G1JA 3TLXA 3U3RA 4IEIA 2B6HA 1Z6TA 4PSAA 4DCNA 1Z2AA 3BC1A 2H92A 1C4OA 4JBXA 5FTKA 2FJUA 1KK2A 4G5QA 5HCNA 3N2IA 4C0JA 4CT5A 5JEEA 4LBVA 4WXRA 2F9LA 3KZ1E 1NLZA 2GWHA 3WMGA 2BCGY 3LAWA 3X1XA 1YZNA 3RYTC 3M0EA 5C18A 1K5GA 3DOFA 1NP6A 5DN6A 1CF4A 3ADBA 2ZRAA 4IFEA 3U4QB 1IHUA 2NO6A 1KYIA 4Q5IA 5KSYA 2C8VA 4FMDB 3VKWA 1E9AA 2YYZA 5L8VA 5K8IA 3WNBA 1ZVQA 2CL6X 1QF9A 5D3MB 2GF0A 3W5IA 2IF2A 4O25A 1TEVA 4TT3D 1COWD 2ZSEA 4DSTA 1J7KA 3NBZC 3ND8A 2ZJYA 3Q9LA 3SFVA 1JJVA 1GRRA 1QHNA 1ZNWA 3LH5A 3M4YA 5FL7D 1OH6A 1IY2A 4TL6A 1XMSA 3BOSA 1F5NA 2VEDA 2ZR9A 3A1VA 4O2LA 4V0MA 1GRNA 4PANA 2FNAA 1S0UA 3TR5A 3UATA 1US8B 3VKHA 4O3MA 4RZ2A 4CEJA 4LJ8A 1I4TD 4IXNA 421PA 3TVTA 2QAGA 4F38A 4NYMR 1S1MA 2FEMA 4JVSB 1RRCA 5KSOA 1OKKA 4P4UA 5HR5A 4A1FA 3RRYA 3WBJA 1KMQA 5SZKB 1G8HA 3A58B 3RSLA 5JMTA 2GJKA 5KNCA 3GFOA 2FMXA 4Z1MD 3GCGA 4L8GA 2Q21A 2JJ2A 1SXJB 3IGFA 3MD0A 4GI7A 2Z83A 1I4DD 5IF9A 4BZQA 4B76A 1XD8A 4MKIA 4OQNA 3B5JA 1XTKA 1KI2A 3Q8XB 4XWOA 1T6NA 3U3KA 4KXFB 1WRBA 1X1SA 4G0NA 3IHLA 2IYWA 4JVMA 4PO8A 1FUUA 3F3YA 4ZI2A 1DAEA 4ZIRB 1VIYA 4OHWA 2YKGA 3FFBA 3QI2A 4D4LA 1VCOA 3EZ7A 1EFRA 1W4BA 1VG8A 5EE3A 2RGAA 2G0TA 4LYHA 1ZCBA 5TMPA 4DIDA 1AQYA 2JIZD 3IQWA 5TVKA 3CBQA 3U3MA 5FBWB 5E4FA 2OFWA 4TYNA 3X1ZA 3A1TA 4YONB 1NVVR 2WIBA 1OJLA 3LW7A 5EZ5A 2ZSFA 5DIFA 2GXUA 4Q66C 1NG1A 2QTFA 4TMXA 2PT7A 5FPKA 3SQXA 4QXAA 2JLVA 4Q7LA 4PX9A 2YC4C 2BEJA 4MRPA 1OYYA 3ZVMA 3ZIAD 1KNQA 2GNOA 1KSFX 1JI0A 2A3RA 1HH4A 4MKFA 1G17A 4W5JA 2B21A 2J59A 4PC6A 3R8FA 5KDLA 1XZQA 3A1UA 4C9BA 4HAUA 4X8HA 5AK0A 3VTKA 1HQCA 1Q20A 4DWJA 2JDID 2XNDD 3AF1A 3P20A 2DFNA 3QG5A 1DARA 5DE3A 3NWJA 1OE0A 3BB4A 5HTKA 4B2LA 3BJIC 1U2RA 2YWEA 3SQWA 2OT3B 4XVQA 2NO7A 5AJWA 2ZJBA 2CNWD 1H8HA 2W6JA 4LBWA 3A6PC 5GJCA 4HLQB 4TZ6A 1FTNA 4GZMA 4Q00A 4Q47A 3RABA 1OB2A 3CPHA 2RGBA 1U98A 4DXAA 1X86B 1X8LA 1HT2E 3W6PA 3PEWA 4C0HA 4KFRA 1E1RA 1YU9A 3LVQE 1MH1A 4MKHA 3DPUA 3ASZA 3AVXA 3BRWD 4ACAA 4IVRA 4KSCA 5KPDA 2JLSA 2RH5A 3OIWA 2PEYA 2ZJ2A 2V6JA 4TYPA 2FZ4A 1XXHE 4URWR 4TMWA 2FG5A 4D0GA 1WF3A 2F1RA 4LPSA 5H68A 1KAGA 2WJYA 5J5CA 3AGPA 3GMTA 5E7IA 2FH5B 3THWB 1G21E 1KO4A 1G7RA 2IYZA 2UVQA 3DMDA 4UNQA 2ZS8A 3NIBA 4WBSA 4Q48A 1XWIA 5FH9A 2YJTD 5EQTA 1ZUNB 2IEZA 3RAPR 5C4MA 4A2WA 1XTQA 2V55B 3B2EA 1Z6XA 1ZC4A 3LBNA 4YC7A 2IYLD 3GJXC 4OHZA 3ZS8A 4AWXA 4HUTA 1GNRA 5JCZA 1OHHA 4MGZR 4US2R 3AF2A 2OCPA 3LNCA 2ZJOA 3AV0B 3Q72A 4HZUA 1Z29A 2WPDD 3AP2A 4LYAA 5L3QB 2CHQA 1T3HA 2D74A 3BFXA 3QKTA 1P73A 2QMOA 1Z3IX 1IQPA 4CW7A 2XAUA 5IRCD 1DG1G 1TQ6A 4B6EA 4RZXA 2N1BA 1ZW6A 4WA7A 4OYHA 3DVLA 4BUJA 2IS6A 3I32A 2EVWX 2KJQA 5KSPA 3UPUA 1IY1A 1L4YA 2CE7A 1N3BA 1GDDA 1GNPA 3QXSA 1ZUHA 2XITA 1RJ9B 1RE0A 1RKBA 2QRNA 1JR3E 4HAVA 1EWRA 1GVNB 1XEWY 1Z0IA 2W00A 2BMJA 3K09A 3TNFA 4XWAA 1WP9A 4LJ9A 2C98A 4HAXA 4EFMA 2VP5A 1M2OB 2GDJA 4QHTA 1JPJA 1XP8A 4Q4JB 4Q4AA 1W44A 3AF0A 2VHTA 3LLUA 4GOXA 1XD2B 5FUYA 3VFDA 2PCLA 2W2XA 3CW2A 4ZDIA 3JZMA 4MDFA 1CJKC 4F4JA 2WWHA 4HLUA 3IKJA 4OQMA 1BO6A 4A2PA 4AG6A 5JSZB 5JEDA 2OBLA 1JR3D 3KKNA 1HT1E 4Q18A 3OIYA 5FBRB 4YXWA 5K8TA 3ICQB 2P2LA 3PEUA 1G7CA 2FSIA 3IPXA 4P3YA 3T5GA 1P62B 1R0YA 1G3RA 2R2AA 4PFSA 3TR0A 2ZPTX 2GHIA 1Z08A 2PMDA 1M74A 2FSHA 4AYXA 3TVDA 1FMLA 3JZAA 5DHAA 5FTJA 621PA 2VBCA 3WNCA 5GADl 5JJIA 4AYTA 4B3FX 4XD7D 2FF7A 1NVXQ 3RWMB 2N46A 2PL3A 3CNNA 2ZE6A 4GRAA 4Q7JB 3PENA 2GILA 5EJEA 3T1TA 4LK2A 4ESHA 3K09C 4IJMA 4ZCIA 2WTUA 2MMCA 3LBIA 3U61B 1CJTC 2WOJA 3GLIE 4B48A 3MJHA 5BYJA 1CRQA 2QE7A 1N6IA 4IDNA 4NYMQ 3CRMA 5G53C 1NI3A 1GKYA 3KQHA 4AG5A 4BZXA 1GOTA 3GQBA 4LUCA 2QNRA 2VF8A 2GZHA 1VYTA 2ZSAA 3BH6A 4US0R 4ZI3A 1ZD1A 4Q01A 4YMSA 3TSZA 1CTQA 3KFVA 5FBLB 2YC2C 3PR1A 3GJ4A 3T61A 1VCIA 4HLUC 1ZNYA 2QM7A 3C5HA 3CB4A 1Q1EA 4UNNA 3T5DA 5JRJA 3CIOA 3FKSA 2ODWA 3MLEA 1RFLA 1EG7A 3HP1A 4Q1DA 5D3MA 4D26A 1P9NA 3IIMA 2AN9A 4LHYA 4CF7A 1YJ5A 3VX4A 4BFSA 4E5UA 2RMKA 4RJLA 2C9YA 3DM9B 3LW8A 4LJ6A 4OI2A 1BMFA 4KV9A 1SGWA 4IKEA 3KJEA 4C30A 1I2MA 3U7HB 1D2EA 2WKPA 1GL9B 1LV7A 1DAGA 2GVDC 3EZ2A 3L2OB 1NNEA 1KO5A 2AKAB 3A4LA 3HWSA 3B13B 2V6IA 1G3QA 1JQJC 1W5SA 1EFCA 2OCAA 2X19A 4OK6A 4QGAA 3W8NA 4GP6A 4NP6A 3EARA 2YWGA 3BH7A 3KJGA 1E69A 2NZJA 2WSSD 4Q19A 4QM6A 4B32A 4M9ZA 3OZXA 2GAOA 1TQDA 1E2GA 1XTRA 4JKIA 1W0JA 4LDJA 3T34A 2G77B 3K0FA 5EE5B 1CKEA 1SQ5A 1SXJA 2ZS7A 2XEXA 4BFXA 2UZIR 3QJYA 1F2UA 3ECCA 5L3VA 1IONA 1C1YA 2DFKB 3BORA 3DKVA 2YINC 2OZEA 3FHCB 4P0TA 2ZS9A 4OI1A 3RSOA 4M9XA 4HATA 2QL6A 1E79A 1KNXA 1P60A 3KKMA 3OIUA 4QHYA 4DDVA 1ETUA 4PPNA 5J47A 2EQBA 3I62A 3TJZA 2BMFA 2A5YB 1ZM2A 1X1RA 2F43B 1AJEA 1E2FA 1KI7A 4DDUA 2J41A 4O0MA 3FPAA 4AC9A 3B82A 5IHPA 1JEDA 2CCJA 2B7CA 3GLGB 1GSIA 4EFNA 3KUDA 1ZU5A 3AF3A 4QGFA 1KSJA 2NMVA 2GEUA 6Q21A 2VQSA 4B3XA 2XXAB 3RC3A 2DPXA 2OHFA 4EPRA 2EFDB 5DN6D 4TN1A 1OIWA 4DJTA 4ESVA 3VR4A 1JJ7A 5LB2A 2A5JA 3FDIA 4Q1EA 2W2TA 5JI2E 1JECA 4PZZA 4Z8YA 1YE8A 1BYIA 2O0KA 4UQOA 4TMZA 2ODBA 4MA4A 1WBBA 3RS7A 2VTKA 2WKQA 5DSZA 3KL4A 5AUOB 4DEXA 4AKGA 3LX5A 5D3QA 1XFAA 3THXB 4RZ3A 2IWRA 2IK8A 2DB3A 1JEEA 1T5LA 3EZ9A 4NBSA 2VH5R 2OCBA 3TK1A 1P2UA 3R8CA 3C7KA 1P61B 1SVKA 4MYCA 2V9PA 3G82C 5BXQC 2GETA 1RRPA 1UDXA 3QF7A 3UWOA 4UNRA 2WVJA 4BGDA 3CM0A 3EWSA 3I5YA 1P9RA 3AQ4A 4NYIR 4G3XA 1TAGA 1E0AA 1PJRA 1PLJA 2LCFA 2Z0MA 3THYB 1U0JA 2J7PA 2JA1A 2FV8A 1A4RA 2ZRLA 3DM5A 5HCIA 3A4MA 1OKKD 2ZR0A 2HXSA 2ANBA 2XJ9A 1AGPA 4F92B 1M7HA 5IK2A 4IDQA 5AJZA 5CDFA 1TU3A 3W5JA 3LA6A 5CYPA 4PPGA 2JEOA 2KI5A 3RRZA 1Q12A 2AK2A 1KO1A 2AXPA 2R62A 1N6NA 4A4DA 4KU4A 2YNMA 4A0HA 4B34A 5JS7A 2JLYA 1UKYA 5E95A 4QOSA 4E22A 3K9NA 1ZUIA 4KLZA 5F98A 1KMHB 1KI1A 1UM8A 3GJ0A 5B57C 2R6CA 4KAXA 1KDPA 2OLKA 2EYUA 4PZLA 3JVVA 1FNMA 4NU0A 5TB5A 2C9OA 4B33A 1DOAA 2I1QA 2GCPA 3WHKA 3LRPA 5A0FA 3GFPA 4V0NA 4EQ6B 1A5TA 2AD5A 1E9SA 1EFRD 2ZU0C 1SKYE 2A2ZA 3GJ3A 2F3TA 3ASYA 3AUXA 2FWRA 3FHTA 4BRUA 1KK1A 3QPWA 2VSXA 3FWYA 3E1SA 1P9WA 4MGIR 5FR1A 4TMTA 2GXSA 3GJ8A 5L3QA 3IILA 4EIWA 4KSBA 4A8JA 4CIDA 1E96A 1NY5A 3C4JA 5KPJA 1MRNA 3VHXA 3IHWA 3CWQA 1O3YA 5IDVA 1GUAA 1WE2A 4AKHA 3MAAC 3MMPA 2JASA 4B3BA 3VNVA 3D6TB 4U00A 2OCYC 1ZRHA 1BS1A 3CF6R 5FTNA 1G291 1U8AA 2ZRMA 4DSOA 2ZI6A 4EPTA 1E2HA 2ZXUA 2C96A 2MMGA 1DG3A 1R0ZA 1E2LA 4G1UC 2CJWB 3RWOA 5M04A 4RCYA 3CZQA 3I4LA 1NMXA 3KKOA 1U81A 1TNDA 2QM8A 4IDHA 1SVWA 4M1TA 4Q4JA 4LJ5A 4BFYA 4B75A 2W6JD 1H8HD 5SZIA 3LLMA 4DDWA 1A7JA 1OPXA 4A82A 3W34A 4LI0A 4ASUA 1GILA 2ZUCA 1LFDB 1IBRA 4TLDA 4YDHB 3VR2A 3B1WA 2Z5FA 2ORWA 5JSZA 2F55A 4W7SA 1GIAA 1E1RD 2GAAA 3HYRA 4IVQA 3CPJB 3HR7A 1P7CA 1Q22A 4FXPA 3P32A 2XZOA 2N42A 5ANRB 4IOJA 4A8JC 1NVWQ 4DIEA 1TTTA 3HJNA 1ZP6A 3JVUA 4F93B 3TW8B 1JALA 3ZZ0A 1OW3B 2V7QA 2RGEA 2C5LA 2ZI9A 2WWXA 4C4PA 1E2DA 3MWKA 4P4TA 4FN5A 2D2EA 3WRXC 4POAA 2ONJA 1CR2A 1L8QA 5K8UA 2Z4SA 3PEVA 2R6GA 2HCBA 1Z63A 1I4LD 1CJUC 2WM9B 4QRHA 3N5CA 1Y3AA 1RW4A 2QQ0A 3B8HA 4HEJA 1AN0A 4G5RA 2VRWA 4IRUB 4FMCB 2HF9A 4XWKA 3P1JA 2NTYC 5CM9C 1OHHD 4IOMA 5FPSA 1GITA 3K0CA 4W9MC 2P6NA 1B0UA 2XTMA 4XVRA 1DAFA 4B3CA 2ZI4A 3MWYW 4DKXA 1L7VC 1K8RA 2ZITA 3RLFA 1F6BA 4ILEA 4BE7B 2AL7A 5JBQA 1IN5A 4Z54A 2WV9A 4BRWA 2VL7A 3QBVA 1WQ1R 2QTHA 2GJ9A 1LB1B 2W0MA 5EE0A 3RDPA 3TSWA 3SZRA 2IC5A 2R8RA 3VAAA 3BD9A 2VHJA 2ZJ5A 4IFBA 4HLCA 2A5GA 3RVBA 4DLSA 5DGXA 2GTPA 1ZM7A 3VU9B 1MO6A 4MYTA 3W8RA 2IL1A 1UKVY 3O8CA 3CNOA 3SE0A 1J2JA 1GRQA 4TLEA 4RKFA 5EXSA 4QG7A 5AJXA 4WZ6A 1NRJB 1NN1A 3BIFA 2P67A 1LTQA 3K0AB 3C14C 4KJZA 1CR1A 4OQXA 4GL2A 4TL9A 1N2CE 3ADKA 2G9NA 1KI8A 4OK3A 4KYUA 2O8CB 2R65A 3B1XA 4YXWD 5F3WB 1OFHA 5H70A 3WYGA 1II0A 2FZLA 3FFAA 3FMPB 4MITA 4TSFA 4RD3A 5JZVA 3QOFA 1QHHA 3IIJA 4DUGA 3ZZTA 5CIQA 5FTMA 3HPRA 2QY9A 2V1UA 2PH1A 5GJVC 2LWIA 5K8LA 1XEWX 1F60A 5AUQA 1G7TA 4OJKA 1CU1A 5B58C 5BN5A 2BEKA 2C03A 1SZPA 3U6KA 4QBIA 4HSEA 3SYNA 1QBKC 121PA 4LC0A 3GLGA 2EFGA 5JLJA 2LKCA 5ELXA 4OJQA 5C46F 1UEIA 1XTSA 5HPYB 5GVRA 3CO5A 2QORA 3TE6A 1G3MA 4NE2A 2CHVA 3QXXA 3T12A 2WMNB 4BLPA 2VHQA 1FP7A 3WP1B 2XXAA 4TLBA 1O87A 1G5TA 5J4YA 3V4FA 2WJIA 2BBTA 3A37A 4GSYA 3KUCA 2A9KA 2OAQ1 2OE2A 4XSHA 1I2DA 1KO7A 2GESA 2RGXA 3AB3A 2EWWA 4PAOA 5DH9A 3OEEA 5JS8A 2DWQA 2DFTA 3TAUA 1LS6A 4M21A 3FKSD 1JBKA 2HF8A 3EC1A 1JR6A 3AVUA 1TEXA 3TSOA 1OIXA 3THXA 3K9LA 2QMHA 1RVDA 3VMFA 1MV5A 1AZTA 1EX6A 4TQAA 1FNNA 1BMFD 1KI6B 2ZI5A 1OXSC 5AWFC 3T1OA 1A2KC 4Q9HA 2C77A 4I1UA 4L15A 2H57A 4ITRC 3ZYCA 2HUPA 1W1WA 1VTKA 1G41A 1Q1BA 2JLWA 3C8UA 3TW4A 3ZVLA 5BN3A 1YZUA 2F1HA 1NMZA 3PXGA 3EPHA 3W3ZB 3THYA 5C1BA 3AVWA 5FOXA 2ZIAA 4RY2A 4A92A 3B85A 4ZPXA 3LBHA 1W0JD 3T1QA 1AK2A 4IOLA 1N0UA 2JLXA 2PJZA 2Q3FA 3QVVA 1DAKA 4NTZA 3B1YA 3GLFB 1NBMA 2IF0A 1N25A 4FCWA 1KK3A 4QBGB 2DCUA 1KHTA 2IX3A 2VIIA 2Z4RA 4M22A 4YMVA 2GF9A 1QG4A 1P6XA 2X1VA 1EX7A 4P4SB 2I1VB 1VCNA 3GLHE 3HU2A 1L2TA 2PLFA 5CB8A 3OAAA 1OIVA 1ODFA 2OEPA 2NQ2C 5LPNA 3IBGA 3OFNA 4I1VA 3EIEA 4EQ6A 1TQ4A 2CLDX 1HA3A 3CONA 1XDBA 3U60B 2C04A 3QKSB 2QAGC 3QY0A 1W47A 4M53A 1FPMA 2ZRDA 5LD2B 3QEJA 4OK5A 4YMWA 3NVAA 4RVCA 2MSCB 4E03A 1R5NA 2H1LA 1NF3A 2W2VA 5AR1A 2G3YA 4GOJA 5JECA 1NJFA 1P5ZB 2DY1A 2W58A 4JZKA 1XMVA 1CJVC 5KU1A 1EK0A 4NDZA 4HZIA 4B71A 4P31A 4EKDA 4C7OB 3R20A 4PPFA 1XEXB 3RRMA 3OE7A 3R9XA 3U7EB 1A82A 1E32A 1XZPA 5EXXA 2HXYA 2XTZA 4BLSA 4LBZA 2A7QA 1SULA 2W0SA 1ONBA 3I3SR 4RFSA 5CLQA 3NHBA 2H5EA 4GMXA 2IS2A 1F3OA 4JSTA 1XF9A 2O0HA 2CJWA 4G01B 3T15A 5AUPB 4WXPA 4KFUA 1XCPA 1N6HA 1G6OA 1OT3A 2GZDA 4Q1BA 3ADCA 2VP0A 3TQCA 3L82B 5JFGA 2HT1A 1RRGA 2QA5A 2FA9A 5EP2A 3OESA 3I73A 5CIWA 1P3JA 3AVPA 3ZD6A 1JB1A 3K0EA 1R8QA 4DB2A 2J7PD 2AXNA 3FOZA 4LGMA 2GVZC 4IDOA 1NSTA 1DAMA 1GWNA 2NO9A 1MRSA 1PUJA 5H1YA 5IK2D 1SHZA 1HQYE 3QEOA 1E94E 1X6VA 4WAUA 4YMUA 2ASEA 1KIMA 3WYFA 1T91A 3PCRB 5EUQB 2IS1A 3PUZA 4HB0A 2ZETA 1VKJA 5FUXA 4M2LA 1TQ2A 4LBYA 4M1SA 1TF2A 2LKDA 4DLXA 2HJVA 2RHDA 4OQFA 4HB4A 4GDFA 4II7A 4BLOA 2B8WA 5FOSA 3MGCA 3KQUA 3IDQA 2J0UA 1OV4A 3PQCA 1E9DA 2AWNA 3I61A 4AY2A 1UFQA 3CF0A 4NPHA 1LW7A 4PZYA 3HPQA 2IXEA 5B2ZA 1IJFA 2Q3MA 1Z5ZA 1KJWA 4JVNA 4AURA 2ZRFA 4M1OA 1N6OA 2A5DA 1ZYUA 4M9SA 1G8GA 3AKEA 4XTRA 1VDZA 5GJWC 4NHOA 1IN4A 3GJ5A 3CR7A 1XXHB 4LV6A 2AR7A 2EFCB 2BBOA 2ZANA 4KFSA 2C78A 4Q1FA 4JLNA 4MRSA 3UMRA 3WMFA 1VG0B 3EASA 4PC7A 4URZR 4MUBA 1YHNA 4H1VA 1R7RA 5AJYA 1KK0A 3M1IA 1XMIA 1E0KA 1NLYA 1CEEA 1KTVA 1TUIA 2VA8A 1HUQA 5FUWA 1P72A 2EFHB 4ERNA 5KYKA 4JLDA 3Q3JB 2BC9A 3BERA 1IN7A 4FI3C 4N3NA 4O2RA 4HUQB 1YR7A 1RYHA 5SZJA 2OBNA 4EJSB 4CEIB 4HB2A 3VU9A 4AYWA 1KDOA 2SHKA 1OH7A 1A1VA 3H86A 3CR8A 3THOA 4RD4A 2CL0X 3QXCA 4ARZB 3RS5A 1XJ0A 2CVFA 2REBA 3K1JA 3Q5EA 1PLLA 5CLLA 2J46A 3B9PA 4LSGA 4F91B 4B74A 2KBEA 1AS0A 4ASUD 1V43A 3A4NA 3IBYA 3K0AA 2G83A 4BPBA 5JHGB 1W2GA 4FMDF 1E9EA 1TU4A 3B78A 3NKVA 1KY2A 4TLAA 3LVRE 8OHMA 2REXB 2O8CA 1W48A 1F48A 4BLTA 1OSNA 2REOA 4NH0A 4CT4B 1W36B 2Z6VA 3ND9A 3PEYA 1OFUX 1G3UA 5TARA 2HYDA 3SS8A 2V7QD 1JAHA 2G0NA 1NN5A 2H8KA 1YKSA 5KSZA 4DCSA 1H8ED 3K70C 1RYFA 4L4UA 3LX8A 1U94A 1J90A 1FX0B 2WJVA 2NPIA 5JHHB 2XTNA 5DI3B 2F1IA 2BVNA 4URUR 1G64A 3BFKA 3CNLA 4BLRA 3H4MA 2AX4A 4JLAA 1KJZA 2OFXA 2ZVPX 4D80A 4DLRA 4K8OA 1K6MA 2GBLA 4OHYA 5J4VA 1EWQA 2BWJA 3KXIA 4JLVA 3U4QA 5H8WA 4XTCS 1N6KA 4UXIA 3VHLB 4LV8B 4EAQA 1ZINA 2XJ4A 4HAYA 2ZJAA 4K81B 4ABYA 2PBRA 2O8BB 2BJWA 5G3ZA 4XSGA 1E2QA 1JNYA 3QPVA 4JLJA 4IOKA 1KSHA 2XSZA 1E0SA 3HYTA 1LF5A 3NBFA 3GLIB 1XU4A 1YZQA 2O5VA 2H16A 3AUYA 2ONKA 1CRPA 2QU8A 2VPPA 1COWA 4X8MA 5J4KA 4TMKA 2RCNA 5P21A 1US8A 3VR6A 5BWMA 1YQTA 2IYYA 1NN3A 4JYBA 3D31A 5JJKA 2XZLA 1NVVQ 2DWOA 1WBDA 1CULC 2FFHA 3AP3A 2OLJA 1II9A 2QPAA 1SVSA 3KKQA 4IXMA 4BFVA 1ZBDA 4Q9KA 2J0QA 2R44A 5FOTA 5B30A 4URVR 5F9HA 2IUUA 1BH2A 4Z51A 3EZ6A 1W4AA 4XOIA 1HV8A 1U99A 1Q21A 1T0JB 3QSYA 4JBYA 5KDDA 1YVDA 3ZLJA 3GLFA 2QUZA 1NN0A 1YR6A 3ZQ6A 4HDCA 4TSFD 5EZ6B 1G4AE 2AHOA 2JLQA 4DUGD 4ZIRA 4HDOB 2ZRNA 4P4SA 3WBKA 1R5OA 4BEJA 3ZDQA 3QKUA 3A1WA 5DI9A 3FMFA 3UKDA 2GK7A 3R7WB 1V5WA 1TUEA 3KTAB 1IY0A 3WHLA 1IXZA 4PC3A 1EXMA 3W6OA 4L9WA 2ZJ8A 4JLKA 4JT2A 4W5HA 4Q9IA 821PA 3VR1A 3FYHA 3NC0C 4C2UA 2BCJQ 5E7JA 1W2HA 4PSKA 3X1DA 4V0LA 1OFTA 4MRVA 4V0ME 4D0LB 4EPVA 1E9BA 3CF2A 1KDTA 3PUVA 1ZC3A 1SXJC 2GKSA 2YOFA 3A36A 3CLVA 3NHAA 2B8TA 3ZGXA 4FCVA 2BDTA 3SOPA 3UWKA 4BFWA 3CX8A 1DAIA 3OEHA 4V0KA 3RANA 3OEED 4Q9LA 1FTSA 4PHGA 2IWHA 1XEXA 2HDNB 3EIQA 4FWTA 1JXMA 3DL0A 4PHTA 2HYIC 4GP7A 3SDZA 2FSGA 2IEYA 3GP8A 3MRSA 4XH9B 5EP1A 2D62A 4EPYA 1P2TA 3EG5A 2KWIA 1D9ZA 2ERYA 4RCZA 4D82A 2HLDA 1ZIPA 2KSQA 1NBME 3EPLA 1G9XA 4L5BA 3X1WA 2PT5A 2WSMA 2XNSA 2XNDA 2P0EA 3EWAA 3LO5A 3TMKA 3PJRA 3FKQA 1CR0A 3V00A 2YHSA 3CX6A 4NONA 4B35A 1L4UA 5HE9A 2WOOA 1DPFA 1RZ3A 4BWYA 1Q57A 1UDWA 3AM1A 2ZEJA 4R98A 2JJ2D 4D4MA 1OB5A 2DBYA 4MRRA 1GNQA 3V9PA 2AK3A 3I1FA 3SEAA 3TUZC 2CCKA 1DVRA 3GJ6A 4OHVA 3EZFA 2ECKA 2JLUA 4DBLC 2JGNA 2QSYA 4UXJA 1SVMA 2G6BA 2PEZA 3QVUA 1ZM3A 4TYWA 1R4AA 1DELA 1RRFA 2QENA 3AKYA 1NBMD 3F5FA 5TDHA 4NL4H 3KQKA 1NG9A 4MDEA 1E4VA 2VHUA 4M8NE 3THWA 1VG1A 5FBVB 1U8ZA 2IBMA 3MJRA 3PUYA 2AFHE 3E2IA 5F2EA 4B3DA 5JJLA 1ZM9A 3IO5A 3L43A 2Q9CA 1FQKA 5CJPA 2BIFA 4YMTA 1N6LA 1T8UA 2B92A 3CH5A 3FB4A 1G8PA 2ZQ5A 2DWPA 1NSFA 1Z0JA 5G40A 2UKDA 4QHSA 1DS6A 4TZ0A 5CK5A 3MSXA 4DZZA 1R2QA 4PXAA 3RNLA 3CH4B 1FFHA 3K0SA 4E07A 1CLUA 2FU5C 4HYYA 4Q03A 1J8YF 4R71A 1Q3HA 1Z28A 3OF5A 4R2IA 5HE8A 3PV0A 3TH5A 1M7BA 3KJIA 2ATXA 1OXUA 5J4HA 1K5DA 2VP2A 4PO1A 2H17A 4BEBA 1YZTA 4DHEA 1XXHA 2HJGA 2Q9AA 2YV5A 5HKKA 1E2JA 4WOPA 1S3GA 3CX7A 2ZAMA 2QG6A 3IO3A 4LC1A 2O8EB 3WY9A 2ERXA 2BMDA 1RJ9A 5LDDC 1KKMA 4N0EA 3QF4B 3RS2A 1MO3A 2IW3A 2BKUA 4IHQA 3OE7D 4P32A 2J0VA 1QDEA 2WKRA 5CJ2A 3FVQA 1IN8A 3SHWA 2ZE7A 1UAAA 4BECA 2ANCA 1SKYB 3QUSA 4CEHB 1LNZA 2VF7A 3V4RA 4DVGA 2VP9A 4HUQA 2AD1A 1AS2A 1XD2A 4BFUA 1E1QA 1Q44A 1Z8FA 2KB0A 2ZE8A 4Q1AA 5FI1B 4A6PA 1ZM4A 1KJYA 1N6RA 2WIAA 4ARZA 3ONWA 4RD1A 1AGRA 3K9GA 2PZGA 3DHWC 3B6EA 3TUJC 3BS4A 2QEQA 4QGGA 4GPTA 3AKDA 1S8FA 3F0TA 4TQ9A 1E9CA 3ZS9A 1KI4A 1E2KA 1E0JA 2ZRBA 3QENA 4OBEA 2ZVQX 521PA 5FFMA 4ZDJA 5FPYA 3MFYA 4PR0A 4TWZA 2GXQA 2HEIA 2UZ3A 1FP6A 4N1AA 3R9WA 1QHXA 3REFA 1A2BA 2YOGA 3RC8A 1VMAA 4C0LA 1CXZA 3NTUA 1S96A 4I4LA 2V1XA 2CLSA 4I1SA 1ZD8A 1KI9A 1FX0A 2GZAA 1KDRA 4JL8A 4XD7A 4HAZA 3IEUA 3FHOA 5AJVB 3LXXA 1VECA 1QZXA 5JWOA 1W0KA 2KE5A 4UJ5A 3QNUA 4Q21A 1PUIA 2J87A 2RGCA 3OHMA 4QNMA 1N5LA 1JAIA 3I92A 4OI4A 1J70A 4EPXA 2QGZA 4Q7KA 1IM2A 5JWHA 4ZDWA 3L0IB 3CRVA 4MQBA 5SZHB 2DR3A 5CB6A 5B64A 5LBIA 2O8DB 2JATA 4C2TA 1D2NA 2O8BA 2VSFA 4UXHA 1GL7A 1ELOA 1W36C 5LB4A 1XMJA 2CBZA 2GJ8A 3TQFA 3GLIA 3FE2A 3K70D 1DTSA 3AP1A 1CIPA 5A4JA 1ZCAA 3W3AA 2IYUA 1WB9A 3OIVA 4LCBA 1EESA 1U9IA 1NKSA 2HT6A 2OV2A 5DYIA 2IYQA 2ODEA 4JS0A 4LHXA 5C2JB 4C0BA 1Z6AA 4KI0A 4NCHA 2WWYA 4XVUA 5DNYB 1R10A 1QHYA 2ZRCA 1Z0AA 4GFDA 4JLOA 2GRJA 2X2EA 3RS0A 3AVVA 1R0XA 3K0CC 5GVSA 2IA5A 5JI3E 2WSSA 1T0HB 4JKYA 2IYTA 4Q4AB 4JLMA 4B6FA 4BQSA 1BYUA 2BM0A 4G5OA 3WMEA 3O8DA 1E6CA 3U5ZB 1M8PA 2W6IA 3CZPA 1EGAA 2X8AA 4UKDA 4B44A 2W83A 1ESMA 2C9CA 2PZFA 3EAQA 2C2HA 4LYJA 1XPRA 1Z0KA 3GEIA 2WAXA 1D2MA 4M1WA 4DEYA 5KNDA 2NIPA 4F4CA 2QSZA 4URXR 1EFHA 1B23P 3LXRA 2ZTSA 4CYMA 3EX7C 2F43A 5KNBA 2CEAA 5BQ5A 1E2NA 3BB1A 3KQNA 1XRJA 4NYIQ 5HZKA 2QPTA 1E2EA 4TMVA 1PLKA 3R7WA 1RIFA 1WCV1 2QE7D 4ZV4A 4M1KA 1FMJA 2J45A 4MYHA 2QPOA 1BOFA 2R9VA 1U9IC 3QPUA 4OKSA 5C4GB 4CVNA 4Q1CA 4HAWA 5KUTA 4I1OA 1UBEA 3HU3A 5KO2A 1X8KA 5BW8A 3ZVNA 4YLGA 3T06B 4HDQB 1HE8B 5UKDA 3SYKA 1T5IA 1Z0FA 3KDSE 1II8B 4ZDKA 3SR0A 4CGZA 3TKLA 3UXMA 4NKRA 4LOAA 3RS3A 3BXZA 4NZYA 3N70A 4A0FA 1Z06A 5KOYA 1E9RA 2WICA 4KCGA 4QJ4A 4LY6A 2RKOA 1OF1A 4QNRA 1MABB 2BV3A 3QKRB 4NCNA 3P27A 2AKYA 1T8TA 1SXJE 3KFXA 4GZLA 5TXGA 2FFAA 2XSZD 2KBFA 3I8SA 1E2IA 5JCPA 2FOLA 3MG9A 2ZE5A 2YVUA 4DCUA 1SHKA 4DT1B 1AKYA 2BKEA 2G88A 1M6NA 3L0SA 2GCOB 1GKUB 3KB2A 2BBWA 5F9FA 3GLFE 2J1LA 1J99A 3SFZA 2QBYB 5EE1A 5EXTA 3SJAA 3NBXX 4Q4HB 4W5WA 4FCTA 1FOEB 3AVQA 4Y0VA 5G41A 3TUIC 2BOVA 3KKPA 4XJXA 2YZ2A 5JRZA 2ZM5A 2FFQA 1MOZA 1Z83A 1OH8A 2QMEA 5CK4A 4YDSA 4OI0A 2QN6A 2OBMA 1DO2A 1SXJD 4A6XA 4QGHA 2WJGA 2YWFA 5KTYA 2ZRGA 1G1MA 1IN6A 3H1TA 1NY6A 2RB4A 3SYLA 2NGRA 2GEVA 2IHYA 3LWNA 2VP6A 4TTPA 4B2PA 1QVAA 1GP2A 1E79D 4AIIA 3DMNA 1KMHA 2RHMA 4D6PA 4D0NA 3K0FB 4EUNA 2CLCX 1UJ2A 4JL6A 3FTQA 4C0KA 1F2UB 1VCMA 2NOAA 3C41J 2E87A 3IEVA 2IYRA 3PIRA 4V02A 2EWVA 4X8LA 5E7MA 1BIFA 4DSNA 2Y8EA 3MUFA 1RPZA 2WWIA 3NXSA 2QI9C 3BWDD 1R8SA 3KJHA 4C0AC 2IYXA 4MYUA 1DBSA 2ZRKA 2OAP1 1VYUA 1E3MA 1HE1C 2ZJZA 4UJ3A 1OXVA 3KB1A 4JBWA 3ZH9B 5FI0B 2D2FA 4NCIA 4AK9A 1LVGA 2QP3A 2FPMA 1YZGA 4PSVA 2OUKA 4KLNA 2E9SA 1YRBA 3VNUA 4MH0R 5J4LA 2BBSA 1N5KA 4DSUA 1PZNA 2FEOA 4MGYR 3PUWA 3DZDA 2HV8A 3M6AA 4WIAA 2O8EA 3GLHB 3OEHD 3QQ5A 2ZYTX 5BYKA 1CP2A 3D7MA 2E1RA 3NDPA 3QF4A 1NIJA 1IXRC 4FD2A 1GFIA 2J7KA 5CDFE 1NIPA 4TQUS 4S35A 2FE4A 1UKZA 4RD6A 2IT1A 1E9FA 3H84A 2ZSBA 1QVRA 3DZ8A 2PJRA 4CEHA 5EXPA 3RRNA 4BFTA 4QFMA 2HLDD 1F2TB 1P2VA 1G20E 3LFUA 4FMCF 4EDHA 4I99A 1UPTA 5AUNB 2C95A 4F7WA 4A0GA 1OH5A 4QJ3A 1Q3TA 2QT0A 2AFIE 5HZHA 1CJMA 2DYKA 1T3LA 2NO0A 2Q9BA 3MCAA 3Q7QA 4QL3A 3MWLA 2CXXA 4R2HA 2O52A 2OO7A 3D3QA 2R6AA 1MO5A 4LRWA 1T9HA 3IIKA 3DOEA 1CR4A 5DHFA 4L9SA 4DCTA 2FPKA 3GJ7A 1ZNZA 3A1SA 4FIDA 1D6JA 5FR2A 4B2IA 3NG1A 1LF0A 2D4HA 2DHRA 3PFIA 4PQYA 2JJ1A 3TGPA 4L16A 3C5CA 1P2SA 1S9HA 5DYGA 2RGNA 4AKEA 3SU8A 3ICEA 1Z07A 1ZU4A 1TL7C 2XOKA 2X77A 2MSEB 4LX0A 3U2QA 1T3SA 4Q9JA 3U44B 3FMIA 3TBKA 2OG2A 4DLVA 3GPLA 4CDGA 4TL8A 3H2YA 3MWJA 2YWHA 4A0RA 4Y0AA 1G8YA 1KZ7B 2I4IA 3CRW1 3CUEF 3E5HA 2K5UA 2FGKA 3PG5A 1D8TA 2CK3A 2P5SA 5FOVA 4DLYA 1BKDR 2JCSA 1AA9A 4TL7A 1UF9A 3QIAA 1MT0A 2Q0HA 3SBDA 3UANA 3UMSA 4DLZA 4DDTA 1VHTA 1S2MA 3H0KA 5HKKD 2QQEA 1XTJA 4B73A 5CYOA 3EW9A 3B1ZA 2O8DA 1XPUA 4MUAA 3UIEA 4DLWA 4TYYA 4JYCA 1ZNXA 4U02A 4A8JB 3SN6A 1U8YA 4QC2A 2HCJB 4D2IA 3C16C 4E09A 2AWOA 4ON9A 5GJBA 2EW1A 3BB3A 1FUKA 2J9RA 3B7GA 1KZGB 1N6PA 2NZ8A 2WMOB 1R6BX 3BGWA 4XIGS 4R7ZA 3CWZA 1PV4A 5DISB 1SVLA 4BASA 2RGNC 1E2MA 3QG1A 3FGNA 4HLDA 1KKLA 3FMOB 4A36A 2ZU6A 2V4ZA 1G4UR 4G5GA 4WZBE 2ZYUX 3I72A 1ZMXA 3G5UA 1E1QD 4HB3A 4PC2A 3PITA 3EXAA 2ZAOA 4EPWA 2OM2A 3GFTA 1N5JA 1QHIA 4WVFA 3NDBB 4A15A 1Q0UA 2XZPA 4MRNA 1GKIA 2QRZA 3AEZA 1QG2A 5FL3A 1QHGA 3UK6A 4RD0A 2R6DA 2PX3A 2IHBA 4GBMA 4URYR 1XCGB 4DC9A 3U7FB 4KYIB 2ZI3A 2CHGA 3CRQA 1XD9A 4MKGA 2F3RA 3KQLA 2QMUA 1W36D 2ZRJA 2PLRA 4H1UA 3G0HA 3ZZUA 3I5XA 3X1YA 3UMFA 1G7SA 4FW9A 1S9DA 4F4IA 1E99A 1H65A 3VQTA 1XPOA 1G6HA 4CZ2A 3P26A 1GTVA 4FWIB 2CMKA 2IYVA 4ZCMA 1XTIA 4DRZA 3SNHA 5DLQC 4AKIA 4Q4LA 4DLUA 2J0SA 2RAPA
chains in the Genus database with same CATH superfamily
1OXBB 1E1KA 4H9GA 5LQMA 1W0KD 4KK4A 4BV2A 2NUBA 2H6EA 4WE3A 2YFYA 5IAEA 1YR9A 1KGDA 4LMAA 4OB7A 2OV1A 4XUGB 1N0WA 2R1TB 1II8A 4LJSA 3SC2A 1PFVA 1YAJA 2Q6TA 5TGTA 1J6UA 2JLAA 4O4HB 3T9BA 1NLFA 1IOVA 5KWIA 2ODNA 1Z2CA 4DR6B 1Y4SA 4YHBA 2BR5A 1MABA 3K2QA 4P3NA 2I8AA 1UP4A 1WXQA 1E9VA 1PK9A 2YV1A 1ISFA 1NVUQ 4GLLA 4UNPA 1TMKA 1PFGA 1ZD9A 2OLEA 7YASA 1TC1A 1D6SA 1AIPA 1NP3A 2QIPA 2VP4A 4J2OA 4FB5A 4U7DA 3ROKA 4PVCA 3QMVA 1E3WB 4IDPA 4W9NC 4K46A 3SM9A 1JTFA 4DT1A 2YN0A 1Z6YA 3O8BA 2I4RA 4FOLA 1P4SA 3RBXA 3W2HA 1LY1A 5FOWA 3A28A 4XJVA 1NVBA 2XLBA 3AERB 2QBYA 3OEWA 2L19A 2IUFA 3EEIA 2Q4OA 1Q14A 3PZBA 4Q4HA 4D4JA 5JNUA 1EXWA 1WBJB 2M98A 3GDGA 3SJZA 4BU0A 5B7GA 3G7SA 4PCVA 2VDQB 4TKLA 4KTTE 5ER9A 1D7AA 3KD3A 3RC9A 1WX1A 3UJBA 1G66A 4RDXA 4FYYA 1E4YA 4C0SA 2CVHA 3NYWA 2H1SA 4IQ0A 2QPLA 3JS5A 2G67A 3AEUB 4P98A 4MR7B 4UFNA 3W6NA 1CV2A 3JWHA 1JPVA 4IIDA 4OEHA 5MDHA 5DP2A 2B8JA 2E4WA 2XY4A 3A6ZA 3LCCA 3QVJA 4R1QA 3UMGA 4DADA 4YFVA 2Y1LA 1X1EA 3R75A 5ICCA 1IUKA 3PDJA 3MTIA 1AOXA 1CUIA 1S4MA 2FW0A 4L5CA 3QBTA 1J9EA 4HQNA 2GM5A 3TDKA 1T2CA 4CL3A 4YP0A 5L3SB 4NZMA 3MMXA 1XRNA 4DIFA 1FL9A 2VA9A 3H3FA 4R8MA 3P4XA 5TQ0A 2OSBA 1WMDA 3CIFA 4M9CA 2XB4A 3H1BA 1QHHB 4EFLA 3EVGA 4JVLA 1FW6A 4RGYA 1SVOA 4KXQA 1ZIYA 4A9AA 3FWHA 3SC4A 4GI3A 3AF5A 2CHUA 3W6UA 3WL6A 2FQXA 4LHWA 5TV2A 1D4AA 3F7TA 4IQ4A 4QJ5A 4RA6A 4WW0A 2FJPA 5JAMA 3SR3A 3JAMA 4PLTA 2VYFA 4EYEA 1RJFA 2JIZA 3WA7A 5FT9A 3ROQA 4L4YA 1Z22A 4LZNA 2A78A 1NKVA 3DFMA 3FD8A 4OLJA 5ELLA 3KPVA 3AM5A 4BE9A 1KTIA 5JQGA 2R60A 5TQJA 2D13A 2RHLA 3W90A 1LH0A 3KLOA 3BE4A 4U7GA 3MJ4A 2PR7A 4ALKA 2PXCA 2I2WA 4CG1A 1WXIA 3UHOA 4ETIA 3CRRA 3IAM1 3OG9A 2P7IA 5TE9A 1CBUA 2QP4A 1JXOA 5IFLA 3TFWA 1PZGA 1QIHA 3I8XA 4CNQA 3RFXA 4U5XA 1SKMA 1DTWA 4R31A 5K2OA 1UK7A 1WTAA 1J42A 3MQFA 1BWPA 1CQJB 1K68A 3IPYA 1JT2A 2FX3A 3QSGA 1QIKA 2VNSA 3RVOA 2XADA 2GD6A 3T5TA 4PTLA 3UFBA 1SHJA 2DBQA 4PPQA 3HJUA 2JFYA 5FO0A 2PS1A 3D2LA 5AW5A 221PA 3J7TA 3LPNA 4RIFA 4GQIA 2PCJA 1T2EA 4WLUA 2JIOA 3ZJYA 2LXNA 4JYMA 1J24A 3JQDA 1JQAA 1P80A 2J3HA 3MEQA 5E4TA 5IBQA 4HNVA 3K9HA 5TT1A 1J23A 1F2TA 1E98A 1QIDA 3TLCA 1ZAKA 2CNWA 3AY0A 4FD3A 1E64A 3AKCA 1E1MA 3ZW9A 1TPZA 1QGOA 4PYNA 2OP0A 4UVGA 1USUA 3PC8C 2DH6A 4JL5A 1YDFA 1R8YA 3LOPA 5MGBA 4RD2A 2H7VA 1GT6A 4QASA 5CVCA 4D25A 3NEYA 5ALDA 4F84A 4JC8A 4R69A 3WBBA 3QE2A 1LGYA 5D6OA 5L3RA 1J09A 1O94C 5CYFA 1XNJA 1OI4A 4G0UA 2ZUUA 2W4IA 3NETA 2Y3IA 1WS6A 5B3JC 2VEOA 3H2SA 3DDZX 4U2KA 4QIHA 1QFSA 4KWCA 4BO6A 2OO5C 4HN2A 4B1FA 1NKTA 2AG0A 3W2IA 1GU1A 2IXAA 3TFOA 1BCSB 2J0EA 3MT9A 4PS0A 1JEOA 4UOQA 2PNJA 1FYFA 2OILA 4ZMRA 3K3PA 3JATA 5ABPA 3F9IA 1XVVA 4IW3B 3JAKB 1VYVA 4RMJA 3UGKA 3O83A 2ZYWX 2F7SA 2FWIA 1O96A 5J3JA 1L4HA 4RUKA 2GN6A 3PWZA 3F4KA 3RE1A 2G72A 4QTXA 2MINA 2E4VA 2W6OA 3VSDA 1LDYA 3P8ZA 1ZGGA 1KOLA 3DWGA 3UBMA 4F3TA 5KX5B 1PGQA 2RIPA 3DB2A 3INRA 3IV7A 3DDCA 3PC6A 2VSOA 5IXYA 5FF9A 1YZHA 3CVUA 3GD7A 1IZ7A 4PAMA 5HDBB 3ZG6A 2ZSDA 3KT3A 3PJDA 3VPXA 2FUCA 3RSHA 1AZSC 4ENTA 2WIJA 2WPDA 5EJ9A 1VZ2A 3AH8A 1A9ZA 1IBCA 5ES3A 4GKKB 3F8TA 3ZBQA 1HURA 1XO1A 4U7JA 2WWVD 2V6BA 5JH7F 5IKXA 2AFHB 4MVJP 5A02A 3JQAB 4D81A 1YQWA 4S0XA 1GAWA 4I3HA 4BVLA 3GGCA 4JOCA 4RH0A 1CUCA 4TPKA 1WKVA 4FHFA 4EO7A 2XVAA 4ZZ1A 1FXUA 5EFOA 5IABA 1L9KA 2OAGA 3N2KA 4JFRA 1Y4DE 2XT9A 1QCDA 2ZBQA 4PO9A 5AKKA 2JB9A 2VLIA 4WKPA 1OGIA 3P4YA 3JSXA 4LJAA 2WFZA 4EG7A 1AHIA 2JARA 1CIJA 2BHRA 2IXFA 4ZO7A 1E62A 4YXFA 1HFJA 2A1UB 1XQ9A 1ZJ6A 4V0QA 4D4KA 4U6SA 3TRFA 1VGRA 3RK0A 1UZUA 2JGMA 4JQZA 1GCAA 2CCGA 4CQJA 5KTKA 4B7UA 1OLXB 2RARA 1SUIA 2V03A 3GUVA 3LTEA 4R0VA 1GL6A 1DINA 4HX2A 3FUXA 4JT9A 4YJ2F 5I7UA 1W5TA 1T2DA 3UG6A 1FLNA 1G16A 3PQ4A 3X2SA 4AM8A 1W4CA 1ZD3A 1S01A 2EDCA 2XA9A 2R00C 2C07A 3DDSA 3OPYI 3NH9A 5EP4A 5FTWA 1IQUA 4O08A 2PSEA 3SAJA 2VYQA 2XWJI 4B9AA 5B55A 4WXEA 1ANKA 1FB5A 2W22A 2WJ4A 4K9RA 2Q3HA 5BNTA 2ZROA 4QEDA 2HQSA 1ZH6A 4GKBA 4RJTA 4M9UA 2H7XA 4FHEA 3K8YA 4RLHA 1ST3A 4Q0MA 3DFKA 2P6RA 2IS4A 5CUQA 2BGNA 2JJ1D 2DH5A 4GIBA 3PUXA 5BN4A 2G5PA 1KEKA 1DE0A 4H4CA 2VKQA 4PXYA 5CDGA 3AXSA 3DP9A 1I9CA 4KQ2A 4UFOA 2PS3A 2WHXA 3T7CA 5LZ8A 3V7FA 5DM60 4KHZA 4JSYA 3B6IA 1DZ3A 1JMKC 4NENA 3DEJA 3K8ZA 3Q5DA 3GY0A 4UVDA 2JGJA 3GVXA 4OLAA 1H2XA 4Z9FA 3BILA 4Q9NA 4CGYA 1UBGA 2EP5A 2TSYB 3A9VA 3BH0A 4C7BA 4MV1A 3ON5A 1BEEA 2GJAA 3BFJA 5DXFA 5AVWA 3TG2A 4TVSA 4H7KA 4PICA 1JF8A 2DTEA 2CUTA 2YYAA 3DV0A 1ONNA 3F4BA 4OHXA 1PP4A 2G4LA 2WV7A 2J0UB 2FQ1A 3L84A 1O95D 4FUQA 3CT6A 1YVEI 5H02A 3W1WA 2R1TA 3O47A 2Q8PA 3EXHC 1F0NA 1WDTA 3SJBA 3V8QA 3QPCA 1O89A 1B74A 4HZUB 2Z3VA 4O4HA 4ZKEA 2EWMA 5AKJA 1P0IA 1T26A 1YB4A 4JCOA 4PVDA 3N2GA 1JTVA 5EJ2A 3LY5A 2CL5A 1Z6ZA 3D8BA 4L07A 5I7HA 1H6DA 3HB5X 4PIMA 2WAYA 3NH6A 5EWLB 2Y0BA 1DV2A 2GPSA 4DM4A 5ERXA 1KF0A 3OCUA 3KUKA 2O8NA 2GA8A 4ZAGA 4F2GA 2XWBF 3KJFA 3ELDA 3MRVA 1P18A 2DQSA 3GJSA 3IUYA 4M6WB 4EI2A 1E3WA 3K8OE 5ICGA 3VRHA 2V6FA 2I3BA 1AM4D 4G4GA 4JBGA 4MUMA 2AN3A 4P8RA 5IBRA 3P2KA 4XJSA 1Q5PA 4KZKA 2GUWA 1BGXT 4MW6A 4RENA 3MBIA 3A32A 2WJHA 3CEMA 2I4NA 4Y9UA 3MYRA 5COQA 3V7UA 1V4BA 3MS7A 2B4QA 1GRCA 1YCDA 1GNSA 2ZJFA 1I3CA 1RXYA 3R6TA 4LJKA 4OJYA 2X8BA 3U3XA 4HYTA 3KX2A 3K5HA 2VCHA 4RADA 2FZWA 2PVPA 3JWIA 3BBLA 4YNBA 4YRLA 2ZQZA 3ABSB 1UADA 1MR3F 2G6TA 2IXGA 3GGOA 1RC0A 1X15A 2VATA 3IVCA 1TVCA 3R6GA 2VJCA 4QAJA 2O2YA 3NJ4A 4PHFA 1IXSB 1UEJA 2EIHA 4PNPA 4QYXA 1C7FA 2NO4A 1F20A 2Q07A 3ZNOA 4LTDA 3ZDEA 1UT5A 3UJPA 1S2GA 4TRJA 1SUDA 2OYRA 1YRAA 2AJCA 4YRFA 4DCVA 5L3SA 1Z6GA 4L6AA 1UBSB 4HUJA 1HTWA 1OAOA 2ST1A 2XHZA 2YWBA 3N8GA 4FUTA 4Y98A 1Z0UA 2QP9X 2BM1A 2ROQA 1IE3A 3KSZO 3M5CA 3EULA 3FTCA 9ABPA 3AG5A 1TTHA 1UKAA 1AA6A 2GPYA 5KYXA 3PC3A 4IEIA 3GRCA 1H0KA 2AFRA 1L5FA 4PSAA 3B48A 4COOA 3LE8A 1XZIA 1MNQA 1C4OA 1VBMA 1QOZA 3P0JA 4FYXA 1N2CB 4JBXA 4M7PA 4C0JA 4D99A 3VR0A 4WX2B 4JHXA 2OORC 5JEEA 2HMWA 3L7OA 1NXXA 2F9LA 4FOPA 3ZN2A 1DBIA 3QVGB 1MQ9A 2C7VA 2BP7A 3WMGA 1MXHA 4YP6A 1RLOA 4P2GA 4CIAA 3HE3A 3M0EA 1SQSA 4OA8A 4LXIA 3L92A 2B3DA 2X4GA 5AD1A 3AONB 3ADBA 5CMLA 1K8XB 4KOEC 5L4NA 4IFEA 3NV9A 2YFQA 2X5JO 4OB8A 4INPA 2J4DA 2NO6A 1M2VB 5KSYA 4FMDB 1C3OA 2Q6VA 5A5FA 3QEBZ 5TR9A 1ML4A 2CL6X 2PH3A 2UXCB 4ID3A 2GF0A 3W5IA 3ZLUA 5ALPA 5A4IS 1TEVA 3M7IA 1NBEA 3NORA 2OMKA 2QXTA 1IHPA 5DHSA 1BNCA 1LWNA 3CE9A 3PL5A 4JWKA 4RF4A 4WRRA 1HNNA 1QTIA 3VYVA 4EKYA 5C5CA 3BMCA 4MQMA 3T1HB 1IXYA 1ISIA 1ZNWA 3VH1A 4E5MA 2PLNA 4UBKA 3BOSA 4J3NA 1F5NA 3DEYX 1TYZA 4QXMA 5AXCA 2VEDA 3MK31 4K26A 2KLHA 5BSEA 1GRNA 1XOIA 2EZ8A 3RIHA 4HFRA 1RYDA 1US8B 1C8VB 5DWVA 2ZBRA 3QKIA 5K51A 5JISA 5HP4A 1X9HA 5CT6A 2YRFA 1KC3A 1O0CA 2B37A 3U3DA 4PG8A 1I4TD 3W7AA 421PA 1GEGA 3R2JA 3TVTA 2Y92A 3HDYA 4IDDA 4NYMR 4WDQA 5CURA 1JVSA 4DMCA 5L7TA 1Z2DA 2VR1A 5HW0A 5KSOA 3HHEA 4A1FA 2YBEA 4FYVA 3RSLA 2B1GA 3P9SA 1RI4A 2FMXA 3GCGA 4L8GA 1NPDA 1RAEA 4J4BA 1NVFA 4M0PA 1JSXA 3IGFA 5JOQA 2JAXA 3S8MA 4UVIA 1NBIA 4EJFA 2Z83A 4FXOA 5IF9A 1Z15A 3DMRA 1EUYA 1K06A 1VLLA 2IIBA 1YOVB 1YA6A 2GFQA 1R9NA 4NAVA 4ZHQF 1ZLXA 2H63A 4MA5A 3MGBA 4HRAA 2YWXA 5L4LA 3DKRA 2FG7C 1WRBA 4RLSA 1UJ4A 4RQBA 5K6AA 1O6GA 4OMUA 3WKAA 2YS6A 3MCUA 4ZVKA 4AIRA 5JNTA 3T5BA 3V5NA 4FR0A 1U7DA 3FFBA 1K8QA 1T0BA 2J5KA 3F1KA 2GEBA 4UHBA 1VCOA 4IV5A 4UMFA 3RKSA 4CKBB 4N41A 2QJTA 4RANA 4N18A 3K2EA 2BGMA 5EE3A 1K66A 1M8FA 2ZUWA 1ZCBA 2AOTB 3NHLA 4LYHA 2JCVA 4X1IB 3GGJA 1AQYA 1QPGA 1QS0B 2JIZD 3IP6A 3CBQA 5F7ZA 5ADVA 3KOZA 1VE5A 4L1KA 5ITWA 5KX5A 2HW8A 2OSVA 2YMPA 3UTCA 1N57A 2PX8A 1DRVA 2WIBA 4NE9A 4NZPA 3NVMB 4I7EA 3QIVA 3TX6A 3GYGA 3FMGA 5DIFA 2GXUA 4NX2A 1YMVA 4ZOQI 4TMXA 5FPKA 3ORRA 3ROFA 1OI2A 4OYRA 4QXAA 5K0LA 4WT7A 4EW1A 5AESA 3MPUA 1QIIA 1EFVB 2P9FA 3QU9A 3FJ1A 3JQAA 4RLFA 4MRPA 4UM7A 1EJ6A 2AEFA 1GJRA 3N28A 1UJMA 3OIGA 4K03A 1RHKA 5CX1B 4JEMA 1JI0A 2A3RA 4KOAA 4W9RA 2Z98A 2V7VA 2Z2IA 4CV0A 1FJHA 1G17A 3HDGA 4W5JA 5D3KA 4K6HA 1AK1A 3NC4A 5KDLA 1XZQA 3A1UA 4IIVA 3VM6A 4C9BA 1CRLA 1GFZA 3GBPA 4DWJA 1ORRA 1P7VA 1JH8A 1QLWA 2OA0A 2DFNA 3EUEA 4X3PA 3NAZA 2GEFA 5EERA 1JFLA 3BJIC 2CZQA 3SQWA 4BFCA 1OLXA 4XVQA 1VKZA 2WG1A 2Y9MB 4LVUA 4PBRA 5AJWA 2CNWD 1EA7A 3P9XA 4HLQB 4TZ6A 1Y1PA 4GZMA 3RABA 2HK7A 2GI4A 2RGBA 1UANA 2GSDA 5TPZD 3JAWB 2WFLB 1SVNA 1ULHA 4HS4A 5EJFA 2P40A 1HT2E 3W6PA 3FA2A 1RVV1 1JR4A 3FM9A 2GGSA 3HYLA 1E1RA 2X3YA 4KFRA 3ZK9A 6YASA 4ND8A 1MH1A 3Q3VA 3PNOA 3DPUA 3ASZA 4ALIA 3AVXA 1GZDA 3WK7A 4KN6A 1R5JA 3RM3A 4EUEA 4FHDA 4Y2QA 5KPDA 3EGWA 3UJNA 4RTQA 3Q8WA 5GWXA 3LBYA 4IG9A 1PVDA 3M6UA 4TYPA 2A35A 2FZ4A 4G0PA 3RK1A 1MA0A 1Q7RA 2O2JA 1L9XA 3LCJA 1R0RE 2BT4A 4WGFA 1Z88A 3UJHA 2DP4E 4ALNA 4D0GA 2F1RA 2RBGA 1LQ2A 4YQZA 2OZKA 5H68A 5J5CA 1K9SA 4GEKA 3RG8A 5HRCA 1YGPA 3GMTA 1OLUB 2ODPA 5TMBA 3DMDA 2C5SA 2C4VA 3WLIA 5HIJA 1GPKA 2ZYGA 1OQAA 3NIBA 2ZPAA 3BXGA 1P7PA 4MW9A 1PR1A 3KWJA 2IEZA 4YMGA 5AVZA 1YRWA 3DBRB 4ZU6X 4YRMA 1MB3A 2V4MA 2DR0A 4MS1B 4D97A 3GJXC 2FDXA 1M1ZA 1XTTA 3G2JA 1GNRA 3N5KA 1KPGA 5JCZA 3KOOA 1Y82A 4MGZR 1BS9A 2BW0A 3T7SA 5KVQA 1WMFA 3ST7A 4Y7CA 4RGBA 2K2WA 2ZJOA 3AV0B 3Q72A 4JJ4A 4HZUA 4QUBA 1ZICA 5H16A 1KVRA 1VMEA 2PXAA 2WPDD 4LYAA 5DCLA 1QGAA 1T3HA 1THMA 3KPWA 3QKTA 4WMLA 1T9BA 2ESRA 2J8ZA 5CX4A 2YFHA 3R76A 2GO1A 1FJ2A 2XAUA 5EWLA 3WNQA 2PH7A 3NNSA 1PQWA 1TO2E 2BPOA 1HG0A 2CJYA 3GLSA 4FYJA 4QPPA 1ZW6A 5E9QA 1QUFA 5KAMA 3KO8A 4AB1A 4YPVA 5EESA 5FCDA 1JHDA 4ZJUA 1IY1A 3RHTA 3Q3GE 4MR9A 4RTOA 1RJ9B 5FNVB 1CRZA 3EVTA 4C0QC 1GVNB 1R4NB 2BH9A 5A03A 3KSBC 1WP9A 3CINA 4E5DA 2A92A 3KZMA 1E3EA 1RHQA 2WJZB 1W59A 2D59A 4HAXA 4Z9YA 3UJDA 3KSDO 1OUMA 5CG1A 1IUPA 1JVBA 3HB9A 4JR1A 2GDJA 3QFRA 1T4CB 1XP8A 1ID8A 2VT2A 3NWBA 1SCUB 1Y1RA 5F23A 3LPCA 2CV2A 1CJKC 3WQRA 4FB4A 1EINA 1ZJ4A 3NCTA 3QJ5A 5ECDA 4BCBA 3TD2A 3D0QA 3OO0A 4HLUA 2JI4A 4A2PA 1PR2A 5JSZB 3BE6A 2CLIB 5KYYA 4DDKA 5CDYA 1XLUA 2V0GA 4KXXA 2P2LA 3PEUA 4PTYA 5FD8A 1KAQA 1ICIA 4G8DA 3DAYA 4OHCA 4PZEA 2AEJA 5K0FA 4X65B 2YHUA 5DHRA 4P7GA 3VSEA 2A1IA 4JI3B 5DP1A 1EK5A 1UWCA 2OVBA 2Q2VA 2D8AA 2R79A 1LSSA 2ZPTX 5TMDA 2FHPA 1Z08A 3QU4A 2I91A 3B7PA 1UDCA 2FSHA 2ZSKA 4EATA 1BEUB 2Q27A 4C0WA 5JASA 4R3UC 1U7ZA 4B3FX 4MA0A 4K9DA 2PL3A 5GY7A 4GRAA 3S8EA 3VC2A 5A5EA 3PENA 4Z5XA 2PL1A 1N3IA 5B1HA 4LK2A 4ESHA 2WTUA 4L4RA 3X1KA 1NQOA 1ESEA 4ZCIA 1ZN2A 1VL6A 5C7YA 1N2CA 3WJ1A 3U61B 1CJTC 4MW0A 5L53A 4HG2A 3MJHA 1CRQA 5IUJC 1U3GA 3IP5A 3QVGA 1DHTA 4J7XA 1GKYA 2WHRA 3I6ZA 5KWEA 1J25A 1Q6ZA 3IP3A 2ET6A 4BZXA 4ZOBA 3F67A 4LUCA 1K5HA 2QNRA 5AJUA 4C2AA 3H05A 4D98A 5K0EA 1WXWA 1P4RA 1NC3A 3I5UA 3KFVA 5FBLB 5GTDA 1W73A 5AVQA 4BTEA 4EKEA 3DEIA 1IULA 2G8LA 3ZLBA 3BEOA 1VCIA 4M1ZA 1GTZA 1U3DA 3D6NB 1M2VA 2PWBA 1NWHA 4BVFA 4PX2A 4UNNA 3FKSA 3PT9A 4YH1A 1EG7A 1W6RA 4XGKA 3TKAA 3O3CA 1F2VA 1Z2OX 4JNKA 2AN9A 1WCXA 1YOBA 4FM9A 1STOA 4LHYA 1FNBA 3WYBA 1XRPA 1TCUA 1YJ5A 4E5UA 1I24A 3JWPA 1W9HA 2HA5A 4LJ6A 3H97A 3TKYA 4DPMA 1SGWA 3LK7A 3DYIA 5KJEA 1LV7A 1DAGA 2GVDC 2YMLA 3PE3A 1V1MB 2AKAB 1LI4A 3A4LA 3WGNA 3F71A 2QVXX 4OK6A 3DDNA 2OCAA 2R6JA 4QGAA 4Y6QA 2HX1A 4NP6A 4FONA 3EARA 1D6NA 5AH0A 4ZT7A 2A86A 4MPTA 3KJGA 1XDZA 3NBMA 1WUYA 3LY9A 2YIVX 4UZEA 3DXYA 3HM2A 1X19A 3Q3IA 3VDRA 5DMXA 1X80B 3KEFA 1DRWA 4RDCA 2M1XA 5HTOA 2ZULA 1E2GA 1T4BA 2QN9A 4LDJA 4FC6A 4F2DA 3LIIA 4XI9A 4X1YA 1X1AA 5TNXA 3SKVA 3MJCA 2G77B 5EE5B 4NJMB 1DC6A 3G7UA 5E3IA 1M6HA 3L04A 2XEXA 1XZ8A 2NU6B 2UZIR 4RPLA 2WJ3A 4LE0A 1F2UA 3FCYA 2HPVA 2YASA 1C1YA 2XTJA 1HKHA 1XZBA 3RHSA 4G86A 3FHCB 3PFCA 4BMPB 2YYYA 1YOVA 2JFVA 3BE8A 4OI1A 4KGZA 1KNXA 1KARA 1P60A 3KKMA 3KFLA 2PKQO 4KQ9A 1OAKA 2EQBA 5CVJA 1Y7LA 4YRCA 1L7XA 4YRIA 1UXJA 1LJ8A 3BWXA 3TOZA 8ADHA 1VRCA 1E7WA 2DF8A 3Q5GA 4DNFA 1SG0A 1ZM2A 4M89A 4BCCA 4I8IA 5JSUA 3FR8A 1JLRA 2PGLA 4U0JA 4AC9A 3V1UA 3C98A 5FIUA 1SUEA 1CSEE 2FW9A 2PZ8A 1TKRA 4X1IA 1OYVA 5HQ3B 1ZU5A 1QS0A 2NADA 1Q84A 1VJGA 1IJKA 3AC0A 1AG9A 1YIAA 1OY1A 3H1FA 1A04A 2P6OA 3HL0A 1GPBA 4QYWA 4B3XA 3RC3A 3EIXA 3X43A 1ZH4A 1Y8CA 1MAUA 2DPXA 4MRAA 3M83A 4EPRA 2EFDB 3A6KA 3KOUA 2QZJA 4IIUA 5LDHA 4ZYXA 4V2IA 4ESVA 1MVNA 4UD6A 1LTKA 3H8JA 5LB2A 4XIIA 1HDOA 1HT0A 3BCHA 4Q1EA 3KXPA 4D8XA 2W2TA 5B3AA 4DR1B 3UCXA 2V3VA 1IHOA 1Z5NA 5CVDA 5I8WA 1EFVA 4KBYA 3PI7A 3M4NA 3ETCA 4TMZA 4MA4A 3DH0A 2IHNA 2DE0X 2WKQA 5CX1A 1FYDA 3CLRC 4CR6A 3OX2A 4YRAA 5D3QA 4F3NA 2A5LA 4RZ3A 4UFPA 1JEEA 1WVGA 4WASA 3LUHA 4L8FA 4YRDA 3TK1A 3PRHA 3HKDB 5MGNA 3ENWA 3HVKA 5CFOA 3G82C 2I7CA 3ECSA 5I8PA 2K7FA 4FGLA 1RRPA 3MCZA 1NHWA 3E53A 4IEFB 4MUJA 3QWHA 4JFAA 1EJBA 5IU6A 1WUHS 3GN1A 1IVYA 2ZB4A 3FBWA 3I58A 3I5YA 1Y7PA 3AQ4A 1MORA 4RJ2A 4B6JA 1I3LA 1NF9A 1T2UA 1XAGA 2LCFA 3RJ5A 4JI5B 2I2DA 4CV1A 3D2CA 3JAWA 3A4MA 2WFLA 3MVEA 1CT9A 2OGUA 4F92B 2CFSA 1KFBB 1XRSB 3UTDA 5AJZA 1R0BA 3MB8A 1AGXA 1TU3A 4AMBA 2JCYA 4AMZA 1RS0A 4MQEA 3W8EA 4UD2A 3FNFA 3HZZA 3HXQA 4P0QB 1NOKA 1VMKA 2F1OA 2BTOA 2FOIA 4A26A 3GRUA 4KU4A 4A4DA 4A0HA 4B34A 3BULA 5JS7A 2V7UA 2JLYA 2MDTA 4QOSA 4BNXA 1JE1A 3K9NA 1F51E 1QKKA 3F6YA 1IZ8A 1GLVA 3Q10A 1UM8A 3GJ0A 4KLZA 3S29A 1I80A 3L7NA 3NVDA 4D8WA 3H4VA 3PCXA 2P9EA 2JRCA 4RK5A 1OLUA 3O91A 3P52A 4I4TF 1KL7A 1N2HA 5JO9A 2I1QA 4EDFA 1IH8A 4FBGA 3WHKA 4YRNA 4PLZA 1U0NA 1JZQA 3UWPA 3AESA 4UEWA 1LDGA 2JGLA 1YE3A 3DNFA 3DBRA 3KQYA 2B0CA 2I6TA 5GQSA 4MI9A 5IBCA 4ZCRA 1SKYE 1A0OA 2A2ZA 3A14A 1ZR4A 4MS1A 3AUXA 1YTUA 3DV9A 1K6JA 2XMGA 3NT2A 5B4UA 1H1LB 1KK1A 4JR0A 2BSAA 3FWNA 3L8EA 2VSXA 3KZXA 4K86A 4CR7A 3FWYA 4IFTA 4XLLA 4OP3A 4F8YA 2ZB2A 5ECYA 1V3UA 3D3NA 4HEHA 2J6CA 1H2BA 4TMTA 2D0OB 1CQPA 3IAEA 3C6XA 3IILA 5B6PA 2HY7A 4CIDA 1VL0A 3GMDA 3C4JA 4NOKA 3U7JA 2J30A 3RYHA 2Q5QA 1MRNA 4WWHA 1JQDA 1TCBA 1JAYA 3PHIA 1RLIA 3JQAD 4UCWA 5CH5A 4DRYA 1P2BA 5ALJA 1WE2A 1K97A 1R3UA 3MAAC 2D3TA 4HLNA 5L40A 2CXPA 3RVQA 2CSXA 5JROA 1RJDA 4FU0A 4U00A 4CHGA 1BS1A 3DZHA 3HWX1 1EXDA 3AHGA 4UCXA 1C0EA 4MAFA 4ZQIA 5FNVA 4ZCPA 1R4NA 4WLFA 1U3CA 1WV0A 2WP0A 3OOYA 3TW0A 3OCZA 4YCNA 2ZBUA 3CZQA 3I4LA 3M1AA 2Q3JA 4CMBA 5EY5B 1CLEA 3KKOA 4QOHA 4CM6A 3OD5A 3CEJA 1DEAA 1ESCA 5T6MA 1CP3A 1SMKA 1T4CA 4M1TA 1H69A 2HTFA 4LJ5A 4BFYA 4B75A 5E6UB 1SZJG 4X00A 4YI5A 2DFPA 5SZIA 5K05A 1SCUA 2AZMA 4KRFA 4K40A 1ZAYA 3LG2A 5BUQA 2QSJA 3CC8A 1K4MA 4LI0A 2WUDA 5FWXB 1LFDB 4OXYA 3F8WA 3AHHA 1QM5A 3NBUA 5JSZA 5JZBA 4QSHA 5EVCA 1E1RD 3GAFA 5AI9A 3SZMA 1FRZA 2FX2A 3HR7A 1K0UA 1N5RA 2AJLI 2P0YA 2RC6A 3P32A 4YALA 4ND7A 1NVWQ 1OTHA 4JGBA 1TTTA 2C83A 2Y77A 1Y8AA 3ZKWB 3HJNA 1ZP6A 5HWSA 3TW8B 1L4LA 3ZZ0A 1W5BA 3WYNA 4FCCA 4RHUA 3OY7A 1ZSYA 4J6FA 2QVZX 1O97D 2VTVA 2WF9A 3NHPA 5J59A 2JH9A 4M1EA 2IODA 3IOYA 4MW7A 5ELMA 2NAFA 3E48A 4MDHA 1TLLA 2B6NA 4ZT3A 1V7CA 2HCBA 1Z75A 3S0JA 5JWRA 1CJUC 3HH8A 1XWFA 1YUBA 4CIBA 1Z63A 3N5CA 1FXWF 1H4VB 1BD4A 4MINA 5BO5A 2I7TA 3O4HA 3F47A 5WRFA 1LBHA 3BHNA 4EI7A 4YUAA 3BWEA 1E5VA 3C1AA 3TOXA 3VTZA 1T8RA 1C3JA 2VPIA 4IRUB 4HSGA 4RKQA 2ETXA 1PL8A 5JCOA 5JDCC 4L4ZA 2NTYC 5CM9C 4IOMA 5FPSA 4JBHA 3ZTWA 2HJSA 4PONA 4YQEA 3H18A 3LLSA 1B0UA 1Y7IA 3BTUA 1JG4A 4GGOA 2FE1A 1DAFA 2VJBA 5LZ4A 2BKXA 2ZI4A 4L9RA 3SGLA 1YH3A 5HA5A 3U4AA 2RHBA 1K8RA 4HP8A 5DNWA 3VZRA 4BNYA 2GOYA 2X14A 5K8VA 4HHEA 4Y2PA 2NNLD 4OAPA 3OM8A 1K7CA 1BDJA 2DWUA 5LJIA 4BRWA 3LCMA 3PGVA 4R1MA 2V65A 1KAMA 5KYUB 1HO3A 2W0MA 1CUBA 5LWQA 4FBMA 1RI1A 3Q4GA 3N58A 3RDPA 3TSWA 3ZCUA 4KG7A 3R3JA 2O6HA 2R8RA 3BD9A 4FT4A 3W5HA 3WIBA 1RQ2A 2PYIA 4K87A 1Y3IA 2VXOA 3FCUB 1YS2X 1V1MA 4F6CA 4DLSA 2ZIGA 1KXJA 1DWPA 3JWJA 4ZFNA 2NU7B 3W8RA 3W2TA 2E0IA 3ELYA 5K0CA 2E3JA 1YJQA 5DCWA 3O8CA 4QTUB 3TYXA 2LZ0A 3SE0A 1X80A 4G89A 4TWRA 4F0JA 3TB4A 3FTPA 1XKQA 1YS6A 2IBTA 1ODIA 1NR1A 2IOHA 3PZRA 5THKA 3OC0A 1LTQA 3K0AB 4OQXA 4X63A 1LQTA 1ZIXA 3ADKA 3KBBA 2DJ5A 4OK3A 2G9NA 3WGIA 3NRCA 2NU6A 4RL4A 3B1XA 3ZLTA 1YKGA 2ZXFA 4YAKA 1N75A 2OTCA 4YJDA 5F3WB 3FFAA 3UV6A 3BRQA 4LRYA 4TSFA 5F76A 4RD3A 1ODSA 5IKEA 4OU4A 4QUKA 3R9KA 3ZZTA 1ZRMA 4BIMA 2IXDA 5FTMA 1V5FA 1FVOA 3IB3A 2V1UA 2PH1A 5EGNA 4PIPA 5K8LA 5F1OA 5DTRA 3DOOA 3S81A 5AUQA 3REQB 2HOQA 1MV8A 1IWPB 1OX5A 4QXPA 3WSVA 2HQRA 4FZVA 3VTAA 4Y6GB 3C6MA 4KX3A 3GRYA 1Q1GA 3EOZA 2I1LA 3G59A 4QBIA 1QBKC 1BZYA 4L4XA 4NOJA 4GX2A 1DJQA 5JLJA 4OJQA 3SLKA 1RWVA 1Z33A 5HQ3A 3FTDA 1ZFNA 2ID7A 1QIMA 4GPZA 2TS1A 4JAVC 3AL2A 4LFBB 2Y6VA 2C5HA 2L17A 3NDIA 1YI8A 2PAFA 4NZNA 5KQMA 3KZCA 4TLBA 3IV6A 1G5TA 3FDZB 1ULUA 4ZN6A 1SC9A 5AHWA 3QHPA 5LYJF 2I66A 4XCQA 2PZBA 3KUCA 4RTJA 1PNVA 2OAQ1 5KQPA 3LCUA 2PUTA 3GIDA 5AJTA 3BHJA 4CCSA 3U37A 4CF3A 4KUGA 5DH9A 5JS8A 2DWQA 1J8DA 2DFTA 1E89A 1RTTA 3KVYA 3PNSA 1BXRA 1KVQA 3FKSD 3QWFA 4K9MA 2W6PA 4U1RA 4HDSB 3GU3A 3EC1A 2XCOA 2RHRA 1H2FA 1TEXA 5D5HA 4J3JA 1OIXA 2YHIA 1H2YA 5FLYA 3AVUA 3Q0EA 2QMHA 3ASUA 2WVGA 4NEHB 1AZTA 6ADHA 4WKCA 4ANFA 3KQMA 2XUGA 5T4BA 4FZ5A 1KI6B 4C21A 1OXSC 5AWFC 1R6UA 2X22A 2P9ZA 2C77A 1TZJA 2PIAA 5T57A 4OATA 4YV1A 1QPZA 4J16C 1VTKA 2VRCD 5MN5A 1P4HA 3C3DA 1KYQA 3K6SB 2IYEA 3ZVLA 4AJ2A 2JLWA 1YZUA 3FUVA 3WDSA 2F1HA 3C87A 1XZAA 1AUXA 5IEJA 5JZSA 1EDDA 3HL4A 3VU1A 1A7AA 4A92A 2ZIAA 4R8KA 2X4DA 1MJGM 1BJTA 3LBHA 2P2SA 3RVJA 1AK2A 3WFJA 1L0BA 4ZOLB 2JLXA 2ZT5A 3TN7A 4BAUA 4MPPA 4CMHA 1G6Q1 1NBMA 3GT7A 2IF0A 9LDBA 1N25A 3PA6A 3UMVA 3JV7A 4R1OA 4XIFA 2UUBB 1MA3A 2XCLA 1C1XB 2XKAA 3EBOA 1QG4A 5REQA 1SBTA 4G4IA 3WIVA 2X1VA 5HHTA 2OPHA 2FX5A 1QIJA 4R1LA 3GLHE 1QYVA 3HNRA 3ZJTA 1DKLA 1L2TA 2PLFA 3GMIA 1I0IA 1OIVA 4W99A 4C4ZA 4KR0A 4CL2A 2QT9A 3IBGA 4U6QA 3CT4A 1XZGA 5B7PA 3G8DA 3PXCX 2F8TA 1L8OA 3CONA 4Q82A 5TJ9A 3VR4H 1J8QA 5KU7A 1EEXB 4GPBA 2C04A 2QAGC 3VDMA 3GZJA 1F5SA 3M33A 3QY0A 3ZWOA 4ATNA 1EK2A 1WCWA 1UR5A 2BSXA 2G76A 1KR5A 3N8KA 1H1LA 4UHCA 3WIOA 2F59A 1PWEA 4UOEA 4OK5A 5AHRA 3KU4A 4E46A 1DCMA 3BMQB 3U39A 3PIIA 4I5GA 2MSCB 1RRVA 5CCXA 1P6UA 3V7NA 3BXXA 3DW3X 2B2NA 4N5DA 2A3NA 4PSUA 4GOJA 2F1KA 4EP1A 3WNZA 4XWTA 5JECA 2DY1A 1SM4A 3ZY6A 1XMVA 3H17A 3KE9A 1GDTA 3KCQA 4HZIA 4B71A 3R1IA 4EKDA 4C7OB 2PWPA 4GX5A 4XQEA 1IIRA 1YVUA 3KD2A 2AMYA 3JARB 1DKNA 2YX1A 4UEKA 5LBUA 3ZU5A 4LRSB 3WZMA 5DNCA 3I3SR 1SQ6A 3JWEA 4H6PA 2YV4A 2JFNA 3CCCA 5HDQA 5T41A