1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
2DFLA 4D4MA 3R7WA 1F3OA 4QNMA 4B34A 3U7FB 2QROA 2WJIA 1YZKA 1VECA 1RRPA 4BRWA 1SXJD 2ZYUX 3KKMA 5FI0B 3KFXA 2C04A 2GF9A 5B30A 2ANBA 2VHJA 4POAA 2A5GA 4M2LA 1YR7A 3Q7PA 4M1SA 4XSGA 3HJNA 2QPAA 3PJRA 1FMLA 1SKYB 3CONA 2ZRFA 4OJKA 1FW6A 4Z8YA 3O47A 4CEIB 1T8TA 2C78A 4D2IA 2CXXA 4IOKA 5C4GB 3SN6A 3EPKA 3TSWA 3AVUA 1IJFA 1TF2A 2K5UA 3SYKA 4O25A 4PXAA 1IM2A 4BEBA 4EQ6B 3EWSA 1LW7A 2G0TA 3QXHA 1KO8A 2YJTD 4BQSA 4ZDKA 2ZE5A 4U5XA 3KJHA 4LJ6A 2XITA 3U6KA 3IUYA 2REXB 3MGCA 1MOZA 1II8A 1QVAA 1T3LA 1ZIPA 2QM8A 3A1VA 5EP2A 5JI3E 2XSZA 3PEUA 1NN3A 2OAP1 2QTHA 3LQQA 3MG9A 2WIAA 4KO8A 5FTMA 1KI1A 1A4RA 4JSYA 1M2OB 3AVQA 5E7IA 1U8YA 1VIYA 4A8JC 3IPYA 4DCSA 2P5SA 1NY6A 4CF7A 2JIZD 5CM8B 4X8OA 2P2LA 4LCBA 2KB0A 5ELXA 2CL7X 1TUEA 3ETLA 2WWHA 5UKDA 3PFIA 4DWJA 2HDNB 4JLDA 5FBRB 2ZR7A 2IEYA 1NVVR 2WWYA 3X2SA 4DCNA 1IJEA 1Z06A 3TUZC 2LCFA 1GL6A 1Q0UA 2GILA 5AJVB 1KK0A 4TZ6A 3D8BA 4KSCA 4QHYA 3BXZA 5EUQB 4LV5B 3CZPA 4UQOA 3T35A 1UEJA 4O3MA 1RW4A 3IIMA 4GL2A 5P21A 4IDNA 2ZRKA 4PHFA 4DT1A 2XSZD 3B6EA 3W5IA 4RD3A 4TLCA 1I4DD 2ZXUA 2AK2A 2X2FA 3CBQA 3WHLA 1OB5A 1Q20A 1U94A 2C96A 4O2LA 3Q5DA 2IYZA 1ONBA 3MAAC 2Q3HA 3I5XA 2RGAA 4PHTA 4MYHA 2RAPA 1R0ZA 4LHXA 2JIZA 1R2QA 1OFIA 1LF5A 3K09A 2F1HA 5J4VA 5HR5A 1M74A 1GSIA 3Q8XB 3K0CA 5AJZA 3A1TA 3FOZA 2AXPA 1D2MA 2BBOA 3CRQA 4E5UA 4HB0A 1KMHA 4JKIA 2B21A 2F1IA 2J46A 2HF9A 2VHTA 2P65A 4N0DA 4EFLA 4Q9LA 3U61B 3WBJA 1GG2A 3WHKA 1LNZA 4NE2A 1G20E 4PPQA 3FMIA 1KZ7B 1KZGB 2BEKA 4A2PA 1XTRA 1ZCAA 1M7BA 3GJ4A 2F9LA 3TMKA 4DEXA 3PEYA 4TYYA 4ZI2A 1NVUQ 5D3QA 2RKOA 1E96A 5D3MA 4WZ6A 1G7RA 4L8GA 4JLPA 1OXVA 3AV0B 5HKKA 3NG1A 4TQUS 3TW8B 3VNVA 3KQHA 4BFZA 1EX6A 4BZXA 4JSTA 1FPMA 3TVDA 4ZPXA 2R2AA 4LC0A 3SNHA 4F91B 1Q3HA 5KSOA 1VIAA 2V55B 4WOPA 4JVNA 1KSHA 1XEXA 2VHQA 5JHHB 1SKQA 1SXJA 3T1QA 4JJZA 4H9GA 2VH5R 2GDJA 5JI2E 4PPGA 1N5LA 1DELA 1CBUA 4LX0A 1Z47A 2ZAOA 2ZUBA 4DDVA 1JPJA 3I73A 3T15A 1NNEA 1KI9A 2CHGA 1IBRA 1E2IA 1OHHD 2H5EA 2VSOA 4CW7A 1HURA 3QNUA 2W2TA 2GJ8A 4ESVA 2IYLD 3MMPA 2IF0A 4AKEA 4PC6A 4F4IA 3U7GA 1E1RD 4CYMA 4C7OA 4C3ZA 4IVRA 2R6DA 3LVQE 2ZPTX 1II0A 1UKZA 2WWIA 2XJ4A 4W9MC 1O3YA 4BEJA 1CJKC 3THYB 2QSZA 2W2VA 2Q9AA 4BRUA 2YYZA 3VR6A 1TNDA 4MYUA 4QHTA 3KJEA 1GFIA 1Q12A 3RRNA 2DYKA 1N3BA 2EQBA 3S1AA 4A36A 2IYVA 3T12A 4LZZA 3THXA 2Q6TA 3EZ6A 3I4LA 2VL7A 3IGFA 1Z22A 3N5CA 1GKYA 3I61A 1G8YA 2GJ9A 4KYUA 4W5HA 3RYTC 4KI0A 4V03A 3CWQA 2OXRA 1KI3A 2RGEA 4II7A 4Q9KA 5DI9A 4Q21A 5EE0A 1BH2A 5LB2A 2GAAA 4OHZA 1RJ9B 1Z28A 1V5WA 5EE1A 2MSCB 1H8HA 4LK2A 5G3YA 2JJ1D 4BLSA 2ZRGA 1Y63A 1CP2A 2ZRJA 1ZD8A 1RRFA 3BS4A 2O5VA 2QP3A 4F4CA 3BWDD 3GJXC 2V7QD 3REGA 4RFSB 2ERYA 2YKGA 1N6NA 2WKRA 1VPLA 5EXTA 1XTSA 2FZLA 1KDTA 3EW9A 3QENA 5J5CA 4FIDA 3SYNA 3ZIAD 1CS4C 3MCAA 4A92A 3BRWD 2UKDA 4HLUA 1KI8A 1PUJA 3E2IA 3ONWA 5TB5A 1R0YA 4DIDA 1JAHA 1E0KA 2PT7A 5EE5B 2ZITA 2FA9A 3RS7A 4KXFB 1J8YF 3QJYA 2JJ1A 3IQWA 3LX8A 4WZAE 2QP4A 2F43A 2EWVA 1M7GA 2DWOA 2GXQA 3OAAD 4V0ME 1Z6YA 3EIHA 1H8EA 3T34A 2LKDA 4IVPA 5A5GA 4UJ5A 2FSFA 3TSZA 4NCHA 1Z2AA 3U6BA 3V4FA 3SC3A 2PEZA 2XNDD 1GNQA 3KUDA 5B2ZA 4TMVA 2NPFA 4OQXA 1C4OA 1QHSA 4BLPA 4FINA 1XJQA 3CF2A 3LNCA 2JJ2A 4Q18A 2ZE8A 4DRZA 3B1XA 3K8YA 3QF4A 2JASA 2IUTA 4TL7A 1RIFA 2EW1A 1OH8A 1MABB 1LFDB 3KKPA 1U98A 4R7ZA 1SVWA 4OQMA 4G5QA 3SFVA 4JKYA 3FWYA 4Q4JB 1NVWQ 1OFTA 4DCTA 3ZZ0A 1GOTA 4Q4LA 2GXAA 1JQLB 4MUAA 2GEDA 5BYKA 1NJFA 1AGPA 1VYUA 1Z0DA 2MSEB 1QHHA 1WXQA 2FPLA 2NO7A 2Z4SA 1Z08A 4ARZA 1HE8B 2ZI3A 5JHGB 3SJAA 5JWOA 4JIMA 2D3WA 3H0KA 4URUR 5FR1A 3SJCA 1MO3A 3SJBA 1GUAA 2OG2A 3ADKA 3DOEA 3PUXA 5K8UA 5E7JA 3KXKA 1U90A 4IDHA 1UBGA 3TK1A 1M7HA 3FKQA 4I1UA 4AIIA 4YMTA 2FV8A 2GK7A 1IHUA 3CNOA 3GEHA 4JYBA 3TE6A 4Q01A 2XZOA 4F92B 4PQRA 3SYLA 4CEJB 3U4QB 4AURA 4OHWA 3GP8A 4XWOA 5BQ5A 1BIFA 3KKQA 2DB3A 4B2IA 1R6BX 4LHYA 3TNFA 4A0GA 5CB8A 3SJZA 3DEFA 3GCGA 4NYIQ 2JCSA 2ORWA 1G4AE 4LY6A 1KY3A 5FOVA 1E9FA 3P1JA 3UK6A 4QFMA 3AVYA 4ZKDA 4PAQA 3U3JA 5JRZA 4Q47A 1NF3A 3OE7A 1P61B 2VLIA 2J3EA 4OJQA 3AKCA 3SE0A 1SHKA 1UKVY 4CVNA 1NKTA 2PX0A 1GZSA 2RHDA 4DLVA 4MKHA 2PMDA 3QOFA 2VP5A 2EYUA 3GFPA 1OXUA 2YWFA 2P6RA 2VHUA 3ZD6A 3BE4A 3ZQJA 4B3CA 4MGIR 5L3SB 1MR3F 2J7PD 3KL4A 2JLQA 3TR0A 1G8GA 4KLNA 2ORIA 4TTPA 4EIWA 4YDHB 1RPZA 2ZJBA 5KPJA 1L7VC 1S9DA 1KK2A 4NCKA 5SZHB 1H8HD 4GZLA 2JDID 3B60A 3OEHA 4GNKA 2C2HA 3GD7A 3CRMA 4HAVA 3QG1A 5JEDA 4ZCIA 5JCZA 3D3QA 3DHWC 2XOKA 2BMDA 3O8BA 1E2KA 1PV4A 3KJIA 4DSNA 4ZV4A 2IS1A 1P9WA 2R44A 4R71A 2E1RA 4NH0A 4TLBA 4NP6A 3I62A 3GLIB 1ZNZA 1E9SA 1OIVA 3VKWA 5DYIA 2J41A 5F3WB 2QT0A 3C4JA 4QGFA 3JZMA 1X1RA 2ZU6A 121PA 3NHAA 3OEHD 1N2CE 2HXSA 1IN7A 3IBGA 2V6JA 4JMPA 3PUWA 3QXSA 1EFRA 2RCNA 1OXTA 4IFBA 4OQFA 4XD7D 2H7VA 3W34A 1U8AA 2IL1A 1CJMA 3U3KA 2QGZA 1TU3A 3F3YA 4MRPA 2H57A 2P3SA 3FB4A 2XNDA 3WNCA 4A2QA 4Q7MB 5JBQA 4TQAA 1OFUX 1XMVA 4F93B 3MWKA 4CT4B 1BOFA 5GJVC 4RCYA 1OYWA 2DFTA 1EG7A 4DSOA 1FUKA 2A5YB 3KX2A 2ZQ5A 1E9DA 1IXSB 3U44A 5FTJA 2GBLA 3SBEA 2JLSA 5BWMA 2WAYA 4Z54A 4AYWA 1T91A 1E4VA 2ODEA 3BB3A 4PAMA 2CLSA 1IOZA 4M1MA 5F2EA 3AQ4A 4M9ZA 4XJXA 1W4RA 3A58B 4LJ9A 5HE8A 3CNNA 5EZ6B 1M8PA 4I1SA 521PA 4MKIA 4PC7A 1NVVQ 3RS4A 5FBWB 1G64A 4CZ2A 1II9A 2J0UB 1IN4A 5KNCA 1PLJA 421PA 3PEWA 2VEDA 2DWPA 2OSBA 5GJBA 1TF7A 3U3RA 5L3QB 2CJWA 3AF4A 1NSFA 1KI7A 1EXMA 2ODWA 4XSHA 5DLQC 5A0FA 1YQTA 1JR3D 2GHIA 1DO2A 1E2HA 3I72A 3IDQA 1Z63A 4BZQA 1YZQA 1AZSC 2PEYA 4UXHA 3FMPB 2XTNA 1ZD9A 3KFVA 4DDTA 2W58A 1XEFA 1OIWA 4BWYA 4LJ7A 1XTJA 4QKQA 4BGDA 3QEOA 1PUIA 2GZAA 2JA1A 4PANA 2GXUA 1ZAKA 2X19A 2X2EA 2RGBA 4ITRC 4QJ4A 1VG1A 2QGNA 4S2EA 4PPNA 4Q03A 2I3BA 3GLFE 1RVDA 4FMCB 1Q44A 4RKEA 1P60A 4DCVA 2XNSA 3NH9A 1CJUC 4TLEA 2NG1A 2NPIA 3CPJB 4JLNA 4QBHA 4W5WA 2ZYTX 2IUUA 5K8LA 2OEPA 5M04A 5FPHA 1HH4A 4DXAA 3TW4A 1LY1A 5FOXA 4QM6A 1AS0A 1G8FA 2D4HA 2HXYA 4Q1CA 2O8FA 3GJ5A 2O8EB 4NKRA 3WP0A 1NIJA 4JZKA 3NEYA 3OEED 2HT6A 5FL3A 3QUSA 2BM1A 2I1QA 3SEAA 1GL7A 2BJVA 3BFVA 4KODA 1PLLA 4F7WA 1NRJB 3DOFA 4LHZA 2EFDB 1WP9A 4GP7A 5FPTA 1MO5A 4ACBA 1N6OA 2QA5A 1ZNXA 4HZUA 3ZVLA 1J90A 2W00A 4DLYA 4QJ5A 2BBWA 2ZI9A 2OUKA 3CR7A 4EUNA 4UXJA 3VFDA 4EPXA 3AVOA 1M34E 1W49A 2YWHA 4NL4H 4IRUB 4B48A 2QP9X 3THOA 3TSOA 2N42A 3K0FB 4TT3A 3KTAB 5DI3A 4QBIA 4YMWA 4Q4HA 1PJRA 2QQEA 4OK5A 4JL6A 4B3DA 2QTVB 3QKSB 3ADBA 2IK8A 3B1WA 2C9YA 3IKJA 3H4MA 4Z1MD 4LYHA 1N6PA 5FTKA 2ZVPX 4G3XA 3EPLA 4KYIB 2RGCA 1P75A 5H70A 3LAWA 3QE0A 3I8XA 5FFMA 3VTKA 2IYSA 1T5LA 2CL0X 4DIEA 1ZYUA 3SHFA 5L3VA 3TLXA 1OIXA 4NCJA 1F60A 1I4LD 4Q19A 2GZHA 3QKSA 4WIAA 2WM9B 3IQXA 4LPKA 1FX0B 3KUCA 5EXSA 2AX4A 3CH4B 1BKDR 2IWRA 4C0QC 3P4YA 3GLIE 2VRWA 2YOFA 3LVRE 1E9RA 4QGGA 5JWHA 4Z51A 2R8RA 1UDWA 3RDPA 4QBFA 2PMKA 4I81A 4TWZA 2GESA 3QVUA 2FOLA 1KNQA 1W4AA 4RZUA 3DMDA 4PZLA 5G41A 4PFSA 2Q21A 1E1QD 4OI1A 5KNDA 3MLEA 3VNUA 2KJQA 3LDAA 2ZUCA 5JZVA 1NY5A 1W7AA 1YJ5A 1TU4A 1G8HA 2E87A 1EWRA 1G19A 3HP1A 3SFZA 1WBBA 1C1YA 4NHOA 4BLTA 3AUXA 2ATXA 1KJYA 2JJ2D 1YZTA 2ZRAA 3IHWA 2IC5A 1RKBA 2ZRCA 4IDQA 2DY1A 2O8FB 4B43A 2CEAA 4DZZA 4IOLA 4EDHA 5J4HA 1T6NA 5JECA 1KO7A 1JALA 1XEWX 3QPVA 4KFTA 4W7SA 5TDHA 4Q9IA 821PA 4P4UA 4RZXA 4FWIB 4R98A 2JLZA 1DPFA 4K8OA 3MFYA 2IS6A 3X1DA 2AHOA 1ZU4A 1Q3TA 2P6NA 3SQXA 1XXHA 4URXR 1YZUA 1JQJC 3TGPA 1P9RA 2A5JA 5LD2C 3D31A 2WJYA 1GDDA 4NZYA 2AFIE 2HF8A 3U60B 1FTNA 3KXLA 5LBIA 2OM2A 2QEQA 4MGZR 2RGNC 4OK3A 3JVUA 3W6NA 3AF3A 5J4YA 2MSDB 3GEEA 1XJ0A 2IF2A 4IDOA 2V8OA 2V1XA 2ZI4A 3DKPA 2VSFA 1HY3A 1NVXQ 2V4ZA 4EAQA 4QM7A 4TYPA 1E9BA 2GCPA 2N46A 2VHCA 1ZW6A 2CJWB 3WBKA 4RD0A 2PLFA 2FFAA 3B7GA 5ANRB 5KUTA 4LHVA 3SU8A 1TQ2A 4BFTA 1XZPA 3BFKA 3OE7D 2GETA 3A1UA 4BE7B 4AKHA 3GLHA 3RSOA 2J0UA 5F9HA 4NBSA 2WJGA 2AFHE 4UJ3A 3HWSA 3NTUA 2WOJA 1CEEA 1CJVC 5IT5A 1AKEA 2CBZA 5IRCD 2UZIR 2QAGA 1R5BA 4U02A 4UNSA 3R9XA 1X8LA 2IT1A 3AGPA 1TQ6A 1G6HA 1ZINA 3U3OA 4P0TA 2OLJA 1OF1A 3G5UA 5GJWC 4IW3B 1W0KA 3CPEA 2OCAA 2WWWA 3SOPA 1CR1A 3EIQA 2D06A 2IHYA 1UF9A 4Q7JB 4Q48A 3Q72A 2IYRA 1SZPA 1QRAA 3K53A 1U9IA 4HDQB 2DHRA 4U00A 5FPSA 2ZJYA 2MMGA 3CPHA 1N0WA 3EWAA 2AWNA 4AK9A 1MT0A 2YC4C 4YDSA 4IFEA 3TQCA 2FWRA 2O0JA 2OO7A 4D82A 3PVSA 4OHXA 3SS8A 3NKVA 1JPNA 1VG9B 1SVLA 1S8FA 2ZIAA 2WMOB 3MWJA 2ZRLA 1W0KD 2QL6A 2DPXA 3HU3A 5EP3A 1E2MA 4V0MA 3SBDA 1FFHA 3OIYA 1DADA 1DAHA 5AJXA 1EWQA 1DOAA 1KKMA 4MQBA 1J7KA 3L0IB 4LWZA 1N5JA 1KJZA 4HAUA 2WBLC 2QSYA 2JGNA 2ATVA 4LJ5A 1DS6A 2V6IA 2BBTA 4MDEA 2NO1A 4JLKA 3GLIA 4GMDA 5AUOB 4RSGA 3CM0A 4L9SA 2FSGA 2FFHA 4XTCS 3WYFA 3SQWA 1P2VA 4KV9A 5CLLA 3DM9B 2QRZA 4IVQA 3KJGA 1VCIA 2R6FA 1MV5A 5JS8A 2J45A 2FGKA 1J70A 1XD8A 1P2TA 4EPWA 1BO6A 1FOEB 2J5XA 4FMBB 2WWGA 1Q1QA 3ND8A 4C30A 5KO2A 4GT1A 1NG1A 3BC1A 4B3FX 2A7QA 3W8RA 1HTWA 4LGMA 5JCPA 3VHLB 4JLAA 5CJPA 1AS2A 3NH6A 4N1AA 2D2EA 1HE1C 4UKDA 3GQBA 2PCJA 1GAJA 1R0WA 2GA8A 1ZCBA 2KBEA 1X8JA 2W6JD 3PUZA 4GOJA 5KSZA 4M1TA 1OHHA 2G77B 2J0SA 4ERNA 4FWTA 1D9ZA 3MD0A 4EKDA 4EPTA 1RZ3A 4LYAA 1YR6A 5KDOA 4MA4A 2FPKA 4LPSA 1CIPA 1ZP6A 1LF0A 5SZIA 1NMZA 4LBYA 2HLDA 4M1OA 2G6BA 1RRGA 3M6AA 4TYQA 4BFVA 4UNRA 1NMYA 2BCGY 3B9QA 4P32A 3NVAA 2FZ4A 5HZKA 1F48A 2QAGB 3L8YA 3VKGA 4JL8A 4TTQA 4HDCA 1K5DA 4KHZA 2VP6A 5KSPA 8OHMA 4FMCF 4HZIA 5DIFA 4KSBA 3JVVA 2WZQA 1YZLA 1Z3IX 1L4UA 2BV3A 3EXAA 2IBMA 1VTKA 4PSKA 3U4QA 1OLOA 3GLHB 3VR4A 1FQKA 4ILEA 2ZRIA 1Z0KA 5G53C 4M4SA 1EESA 4L9WA 5DNYB 2ZYVX 2FDCA 1SULA 3MUFA 4PSVA 2W6JA 4IJMA 4JLBA 4Q7LA 3ZLJA 3AKDA 4LRWA 1YR9A 4A0RA 1E2QA 1OJLA 1P6XA 1G7SA 2A9KA 1VG0B 5IK2D 5SZJA 2OFOA 3UXMA 4UNPA 4ARZB 5LDDC 2G3YA 3OZXA 2D7CA 1QVRA 3BB1A 3P26A 1DAFA 2QN6A 3GLHE 4X8HA 5C4MA 4HLQB 1XCMA 5EP1A 3EASA 2G1JA 4DLZA 1G18A 2IA5A 4Q4JA 4AI6A 4LYJA 2X1VA 3AUYA 1OYYA 4QJ3A 4OHVA 3Q5EA 4I1VA 2IXGA 3C5HA 2EFGA 4FCTA 1Z0JA 4Q1DA 3RS3A 3QF4B 1WB9A 3KXIA 5FUXA 1QDEA 4B33A 1XXHB 2P6UA 2P0EA 3FKSD 1IY1A 1KSGA 3GFTA 3OESA 5FOSA 2BMEA 1ZNWA 4R2IA 1E69A 1MO6A 2WJVA 5CLQA 4DSTA 1R5OA 1SQ5A 3EC2A 2PZFA 2GEVA 2Z43A 5J40A 5EQTA 3P27A 2VO1A 2XGJA 4P31A 5TARA 4KITB 2PL3A 1XRJA 4L5BA 5EXXA 3HPQA 3CRRA 1IN8A 4TL8A 3RNLA 3T1VA 2ZR0A 1R5NA 2NO9A 2ORVA 3UWOA 4UNQA 4C0LA 2JAQA 4F38A 4DSUA 1OH6A 5HPYB 5LB4A 3K70D 1TMKA 3E5HA 2OBNA 2OCBA 3E70C 4Q1AA 4D80A 5HCIA 2WMNB 3RWMB 5CIQA 1ZC4A 1HQCA 3KKOA 4JBYA 4AG5A 3T1TA 1ESNA 1COWD 2H92A 3PIRA 4QG7A 2ERXA 3FGNA 4YC7A 4B3XA 2GVDC 1CR2A 5AUNB 5EJEA 5G40A 3O8RA 4B74A 3CRW1 4LJ4A 1U0JA 4HYYA 1N6IA 1QHIA 1YRAA 3WRXC 3ZDQA 1TQDA 3NXSA 2JLRA 3KQLA 3HR8A 1FX0A 2AD5A 3L0PA 2GVZC 3OIUA 1AM4D 2H8KA 4KU4A 5HZHA 1KSJA 3RWOA 1K8RA 2CVFA 3EX7C 3B78A 1CR4A 5FUVA 2DCUA 3S1AB 4RCZA 2D62A 2QT1A 4TQ9A 5K8TA 1XXHE 3CZQA 1L2TA 2PLRA 2PX3A 5TY0A 3NEJA 4AKGA 4ABYA 4JJKA 1GILA 3FKSA 1KIMA 4M0LA 1XTQA 3VQTA 3VKHA 4DEYA 3LX5A 4WVFA 3THYA 5JEEA 2BM0A 3HYTA 2ZREA 5FPKA 1NLYA 4CDGA 1A2BA 5HE9A 4Q4HB 1G5PA 3R8CA 4KVGA 4JLOA 1JBKA 4XIGS 3KTAA 3NBZC 1T3HA 3K0FA 5DI3B 4MGYR 3TUJC 1SVKA 3B1YA 1I4TD 3VR2A 1XF9A 4OQNA 5CB6A 1HT1E 3ZVRA 3E1SA 5FI1B 2B8WA 3QBVA 3N2IA 1X3SA 2IYTA 1AIPA 2X8AA 5KYKA 2ZEJA 2AK3A 3IEUA 4LI0A 1VCNA 1I2MA 4GOXA 3NBYC 4LSGA 4HZUB 1AN0A 1G16A 4TSFA 2GEUA 1SXJB 2HV8A 1IY0A 1XEXB 5JWRA 2F1JA 1AKYA 2QZ4A 2ZI6A 3K9HA 1UDXA 1BMFA 3LLUA 3U7EB 1UBFA 2EWWA 2PJRA 1E9EA 2IS4A 2AWOA 2ZRDA 3W5JA 4KCGA 4RD2A 3TAUA 2NMVA 1P7CA 2YOGA 3EG5A 2F3RA 3SHWA 2O8EA 2QE7A 2C77A 1SVMA 3EZ2A 3L43A 5CM9C 5D3MB 4B3BA 1G3IA 2Y8EA 3OFND 4KFRA 4JVSB 5CK5A 3FE2A 3SDZA 1RE0A 2QORA 3NBXX 5J4LA 2YWGA 3WNBA 3ZH9B 2C03A 4HAYA 4NU0A 4DHEA 1E2FA 2BIFA 1D2NA 4PPFA 4QGAA 4ZDIA 4CIDA 1IN6A 2JLUA 4I4LA 3WYGA 4URZR 3RRYA 1KMHB 2GXSA 4IEIA 1AZTA 4IOMA 2QE7D 1N0VC 4CRWB 4PZZA 3IILA 2FFQA 3L2OB 1JJ7A 1W2GA 4FI3C 4D0NA 2VIIA 1W1WA 621PA 2FF7A 2ZE7A 2AL7A 5TMPA 1VHLA 4PZYA 4Q5IA 5DYGA 3EPHA 1Z29A 1CULC 2JATA 3BAFA 3RS0A 4LC1A 3V00A 3H86A 1E32A 1ELOA 3QKTA 4EFNA 1AS3A 1JEEA 2IUSA 2AN9A 4C0AC 1VMAA 2ZJZA 4DT1B 5C18A 1Z0FA 2D74A 2R6AA 5LD2B 1B23P 2BMJA 2O0KA 1XTKA 2CCJA 1O87A 3MJHA 2G9NA 4ASUD 2ZSEA 5L3QA 1K5GA 1XX6A 4HEJA 2D7DA 1KMQA 1KO5A 2VSXA 2FSIA 2GK6A 2QNRA 3C7KA 4GSYA 4QOSA 1W5SA 2FJUA 4M9XA 5J4KA 3IPXA 2KE5A 3LXXA 3B82A 3R9IA 1W48A 1YE8A 4GZMA 2CDNA 2Z83A 3T1OA 2BWJA 1N5KA 1R8QA 1AA9A 1COWA 2N1BA 2FN4A 2J87A 2P5TB 2CVHA 3QBTA 1CRQA 1E99A 2RGNA 2VP0A 2WWFA 3ASYA 1A7JA 3PQCA 4Q7KA 3U44B 4Q00A 1TL7C 3N70A 4RKFA 4RD4A 2GWHA 4PHHA 1R7RA 2TMKA 5DO9A 2VP4A 3MWLA 2VP9A 2V3CC 1KTVA 1KDOA 1ZM4A 2CLCX 2IXEA 4BLOA 1RRCA 1G41A 3UMSA 1DAEA 2C98A 4J0QA 1S2MA 3WMGA 1KOFA 1OE0A 2BHRA 4ZCLA 1IAQA 1XFAA 1A82A 2NZ8A 3LXRA 6Q21A 3X1XA 4EQ6A 4DB2A 3QXXA 1XMJA 5JJKA 1W0JA 2XZLA 3X1WA 2L0XA 1ZMXA 2FFBA 1LVGA 3AF1A 5B57C 2GNOA 1WCV1 3BK7A 2HUPA 2ZJ5A 1GITA 1M1YE 4WBSA 1G1MA 1TADA 4TYWA 5JS7A 1Q57A 1QG2A 2BKEA 5A4JA 4WXRA 3IBYA 4FN5A 4HB4A 4KVAA 4UNNA 4BLRA 1X86B 1H8ED 2LKCA 2FNAA 1OXSC 3B1VA 3PV0A 4IOJA 4NYMR 1SVIA 3K9NA 3QPUA 5H8WA 4LYFA 4N0EA 1MRNA 3R7WB 3MWYW 3T5GA 4AC9A 1VG8A 5BN3A 4GMXA 5E4FA 1B0UA 3BB4A 3FMFA 4PC2A 1DARA 5CJ2A 4E03A 2FH5B 3ASZA 3QI2A 2EFEB 1E9CA 1X6VA 1NN0A 2IYQA 2W83A 1N6LA 4OYHA 3AM1A 4PHGA 2YVUA 5L3SA 2J59A 4NCIA 1TTTA 3OIWA 4H1UA 2A5FA 3GEIA 4NYJQ 2J7KA 3BFXA 1D9XA 4BFSA 3ZD7A 4C9BA 3DKVA 3LY5A 3W9YA 3UWKA 1EFTA 2WPDD 4LV8B 1RYFA 1GNPA 3V9PA 5KNBA 3FFBA 2JDIA 4JLMA 4RJLA 1Z0IA 4A2WA 1Q1BA 5GVRA 1XPOA 1WBDA 5FOUA 4OI2A 3OAAA 3BIFA 3ZZUA 4NDZA 4BFUA 4P33A 4TT3D 4A6PA 4YMSA 4XOIA 3FVQA 1FMJA 5KHOC 4MGKR 1Z83A 3QKUA 4G1UC 1XNJA 2A30A 2QAGC 1N6HA 5DHAA 3CF6R 5GADl 4OKSA 3TQFA 2ZSDA 2OCPA 2NZJA 1KO1A 4GOKA 2O8CB 4QGHA 3H84A 3AH8A 2ZU0C 1XTIA 2F3TA 4KBGA 1KSFX 2UZ3A 2WVJA 2ZANA 5KDDA 2ASEA 1KHTA 4CEJA 5FR2A 2XJ9A 1XD2B 1XPUA 2REOA 4OI0A 2Z5FA 4TYNA 4PO9A 5KDLA 2IHBA 4BFYA 3BOSA 1M6NA 3KQKA 2GCOA 2JJ8A 5DSZA 1LS1A 4XWKA 3C16C 3A4LA 3EIEA 2KBFA 1KK3A 4NYJR 1W2HA 1HUQA 2Q9BA 1UPTA 4FXPA 1UFQA 4XTRA 1G3QA 3K1JA 4JS0A 2W2XA 1NBMD 1QHHB 2QPTA 2VYFA 2CHQA 4DVGA 1NKSA 4EPYA 3EC1A 4C0JA 1E1QA 1F5NA 4B3GA 2F6RA 2VP2A 5C46F 1QHYA 4GDFA 2O0HA 3AB3A 2ZSFA 5DN6D 1XWIA 2GJAA 1T5IA 4EJSB 2CL6X 2V54A 5DHFA 4D4LA 1G6OA 4TLAA 4TTRA 3DL0A 2G1KA 1E79D 2B7BA 2H1LA 2LWIA 4KAXA 4L4UA 4BFXA 3K0SA 4D0LB 4C4PA 4CEHA 1MABA 4G5RA 4Q66C 1QG4A 2HJVA 3KZ1E 4NYIR 1DG1G 4D4JA 2C9CA 3OF5A 2QMUA 2YZ2A 3PR1A 2FEMA 1YZGA 1PVOA 3DO6A 1TPZA 3B8HA 1W36D 2IYWA 2QU8A 3DPUA 4QNRA 2IW3A 2F7SA 4A4DA 4MH0R 1UKYA 3ZS9A 1FQJA 3QSYA 1OSNA 1DEKA 1W46A 2F9MA 3ZVNA 3FHOA 4DJTA 1DAGA 1OV4A 3RS2A 2DWQA 3I5YA 3FHTA 1E79A 2B8TA 2GCNA 1G5TA 3UMFA 2F43B 4B32A 1S3SA 1T8UA 4M53A 5IK2A 1N6RA 221PA 2CMKA 5FL7D 4LBWA 3UMRA 3K0EA 1P3JA 1NSTA 3SZRA 5TXGA 4O0MA 3LW8A 1XPRA 5EZ5A 2J7PA 4P4TA 4B2LA 3QEJA 2YHSA 3QXCA 4PSAA 1XDBA 4G0NA 3NBFA 2CLDX 5KTYA 3W6OA 1NLZA 4RFSA 2A78A 4QXAA 2J0VA 2Z0MA 3DM5A 3F0TA 3A37A 3IEVA 2W0SA 2FSHA 2ZRPA 3TIFA 4M1KA 3BBPA 3A36A 2A5DA 2NTYC 1JXOA 1RJ9A 1PZNA 2NO6A 3FPAA 3P32A 2J1LA 5F98A 2A3RA 1U2RA 5DH9A 1P2SA 3G82C 1SVOA 1VCMA 1SXJE 2BVNA 3FMOB 5CIWA 2ZVQX 3REFA 3MSXA 1GVNB 4TN1A 4EPRA 2JLXA 1WQ1R 3THXB 5KSYA 1C9KA 5G3ZA 3FTQA 1NIPA 2FEOA 3ICQB 3N2EA 1ZUHA 2AD1A 3NHBA 1Z6XA 2WPDA 2ZSAA 4FCWA 3NIBA 3FHCB 1UBCA 4YMUA 2Q0HA 5TVKA 1R10A 1P2UA 4JT2A 4AG6A 2XAUA 1CRPA 1IONA 2OV2A 2PZEA 1JI0A 1MRSA 4R2HA 3O8CA 2Q9CA 2GBLC 1YZNA 1E2DA 1RC8A 4C7OB 3ZYCA 4B6FA 3CUEF 1CR0A 1D5CA 3LBIA 1W36B 4HATA 5BN5A 3R8FA 2A2ZA 4PR0A 4QBGB 2OLKA 1VYVA 3ZIAA 1NN1A 1N5IA 1S1MA 4RVCA 3OIVA 4HI0E 1CF4A 3AF0A 1FTSA 2ZJ2A 1JXMA 2YINC 2RH5A 2WV9A 2XEXA 4Q1BA 2WJHA 4BUJA 4JL5A 1A5TA 4MYCA 2IX3A 1Z6AA 3UG7A 4A0FA 5FH9A 4L16A 2W6IA 3VX4A 3ZQ6A 2RGXA 5B58C 4HAWA 1QHXA 1LS6A 2XOKD 2C99A 4TMZA 1W4CA 4ZKEA 4ZI3A 1NI3A 1E94E 2G83A 2WIBA 1K6MA 3LBHA 5HTKA 3FDIA 2QG6A 2NOAA 5FUWA 4NONA 2Q3MA 4XWAA 1T9HA 2GJSA 5EXPA 2O8BB 4JBXA 1MH1A 3NWJA 4TL6A 3AVXA 4XH9B 1SVSA 2IYXA 4XVQA 2CNWD 2VF7A 3KB2A 1D6JA 4PQFA 4ASUA 4IEEA 3VU9A 4HB3A 2ZTSA 4MUBA 4YMVA 5K8IA 2EFCB 1CJTC 4BZPA 3W8NA 3UPUA 1CKEA 1KGDA 1UBEA 2B7CA 3LO5A 4W5JA 4YXWD 2VQSA 4NMMA 3UIEA 3NDPA 3GFOA 2NGRA 1EK0A 1QHGA 1DAKA 2NIPA 1NP6A 1ZC3A 4KBFA 1YR8A 1U0LA 3LBNA 2NO0A 1NMXA 5FTNA 4DLWA 4DC9A 4PAOA 4Q1FA 4OI4A 4M9QA 3DZDA 4HAXA 2JLYA 3IO3A 5DISB 3OFNA 4A8JB 1J8MF 1GNRA 1UEIA 3VHXA 5BYJA 3EA0A 4A15A 4GBMA 4LBZA 3O8DA 1AK2A 1D2EA 1KO4A 5AJYA 1GRRA 4C0SA 1WF3A 3RHFA 4P4SB 4UXIA 1G5RA 3WMFA 2QTFA 3K70C 5FUYA 4FW9A 3CWZA 1KI6B 3TUIC 3KB1A 2X77A 1SGWA 2FGJA 3B2EA 1TEVA 2OILA 3CX8A 1VDZA 5JMTA 2CCGA 4HDOB 4E09A 1Z5ZA 1JECA 4KFSA 1KJWA 5GJCA 2QBYB 3BD9A 1ODFA 3BGWA 1G9XA 4HUQB 1WDTA 3QXJA 2VF8A 3QIAA 1Z6TA 5EE3A 3MRSA 1J99A 2OFXA 2WSMA 3PCRB 1G3UA 1EFUA 3FYHA 1E3MA 2V9PA 2CNWA 2ZI7A 1G291 1IY2A 1IXZA 4AYTA 3WXMA 1NG9A 1II8B 3RABA 3QF7A 1S1CA 2ANCA 3LV8A 2SHKA 3BH7A 5FBLB 4TMKA 1FNNA 3WY9A 3OHMA 5GVSA 4F4JA 2O8DB 4YXWA 1TEXA 3J81k 4GPTA 1VCOA 3CRVA 3QKRB 4XD7A 1DAIA 4BFWA 4QC2A 1HYQA 1FP6A 3Q3JB 1G8PA 1S3GA 3KKNA 2R9VA 2R65A 4TLDA 1U8ZA 1GL9B 3BERA 2ODNA 2WTUA 4CEIA 1XCGB 2E9SA 4WW0A 4B35A 3AVPA 2ZROA 1F2TB 2ZS9A 5DGXA 3I92A 3SR0A 4ZIRA 2BEJA 1P9NA 2EYQA 1EX7A 3D7MA 4AD8A 3BJIC 1W5TA 4OL0A 1PLKA 4DUGD 2ONKA 3QG5A 2ECKA 2WOOA 4LJYA 4GRAA 2ZE6A 1YRBA 1ZM9A 4MYTA 1S0UA 5JSZA 5L8VA 1WRBA 2BCJQ 4X8LA 5J47A 1D8TA 3CW2A 4RY2A 5FOTA 5AUPB 3GLFA 3NC1C 3RVBA 4A1FA 1BMFD 3HPRA 3F8TA 4URYR 4AYXA 1J2JA 1DVRA 2W6ID 3RC8A 3F5FA 2RB4A 1U99A 5IHPA 1OT3A 2ZAMA 3HR7A 2OXCA 1XEWY 3PXGA 1OKKA 2XX3A 3GJ3A 3LA6A 1EGAA 1IXRC 1DTSA 3AEZA 2Q3FA 2VTKA 1G3RA 1CLUA 5F9FA 4OQLA 1RFLA 5E95A 5HCNA 5BN4A 3KQUA 4HLDA 3Q7QA 5FTLA 5JLJA 3W6PA 4B75A 1YVDA 4HLCA 2FU5C 4URVR 1E0JA 2XTMA 4LUCA 1JR3A 3BORA 4B76A 4PO1A 2WJJA 4C2UA 2REBA 4JT4A 1GKIA 1T0JB 4Q9HA 4US1R 1E2NA 4B2PA 5AK0A 3U3MA 1MO4A 2AXNA 1NL3A 2R62A 1Z6GA 5E7MA 2OBMA 2D2FA 4IXNA 5AUQA 1R0XA 3EZFA 1OB2A 1F2UB 3LD9A 2DR3A 4DBLC 1Q22A 2FPMA 3RC3A 1T0HB 3LWNA 1GP2A 2YV5A 4PTLA 4QHSA 1E2EA 3V4RA 4ZO4A 4PO8A 1CTQA 2O52A 2XTZA 4DUGA 1F2UA 5L3RA 2PZGA 3TR5A 5JJLA 3HU1A 5C2JB 2F55A 3NDBB 4DLRA 2AKAB 2XXAB 2BMFA 4B71A 3ZJYA 2FE4A 3M1IA 4RZ3A 1LTQA 4C0HA 3RRZA 4LV6A 3K09C 4ESHA 1P5ZB 3X1ZA 1KYIA 1FUUA 3TAHA 1MKYA 4V02A 1NN5A 4B73A 1G17A 3QPWA 2QMOA 1CXZA 2VPPA 1S9HA 2ZJAA 3I1FA 1HT2E 4S35A 3VR1A 4OHYA 3AVTA 1NJGA 4M1YA 2IYUA 2H16A 3W3ZB 3K9GA 3C15C 1QF9A 1E4YA 1U81A 3VMFA 2WAXA 1W47A 1AJEA 2YOHA 1GKUB 1E0AA 4KLZA 3GLGE 1JAIA 3A6PC 3R20A 3TH5A 3T61A 2OCYC 1KK1A 1Z07A 2CHVA 2OAQ1 3EPJA 4AY2A 3BH6A 5B64A 1BS1A 1KDPA 3B9PA 3GLFB 3C5CA 3WRYC 3VX3A 1E1RA 4JYCA 4CGZA 5EE9A 1ZD1A 2BOVA 2DFNA 2HCJB 2IYYA 5JSZB 3CR8A 4NTZA 2B92A 4NYMQ 4TMXA 2ZRMA 3B13B 4A0HA 1ESMA 1DO0A 2DBYA 4DDWA 4FMDB 4DKXA 3LQRA 4K81B 2GF0A 4ZIRB 1HV8A 1F2TA 3A4NA 3CB4A 4FCVA 1ZUIA 3UKDA 3C8UA 2CCKA 3PUVA 4P3YA 4I99A 2RMKA 1ANKA 1ZM3A 5BW8A 1FZQA 3I32A 1DE0A 5DN6A 2IEZA 3QKRA 4Q02A 4C0KA 4HB2A 1N0UA 2O8DA 2ZUDA 1ETUA 3UG6A 5IF9A 3H2YA 3TRFA 2ZM5A 2H17A 1KDRA 3ADCA 4C2TA 4V0NA 4NPHA 4WAUA 4V0KA 2CK3A 2HYIC 5SZKB 2RGGA 2R6GA 4ZCMA 2I4IA 2EFHB 4QL3A 3W90A 1G7CA 4A6XA 4HUQA 3IIKA 3TBKA 1OKKD 4O2RA 3TJZA 4D0GA 4DB4A 4RD1A 4G5SA 2CE2X 4XVRA 2WWXA 1WE2A 1TAGA 1Z0AA 4D4KA 2QBYA 1G4UR 2GZDA 2KI5A 3T06B 1P62B 4Q4AB 3LFUA 2VA8A 1KI4A 2BDTA 3I3SR 2JEOA 3CKLA 3RANA 4MDFA 5CDFE 5FL7A 1KI6A 2ZRNA 2CK3D 1XMIA 3GJ0A 1R4AA 3DDCA 3PUYA 4ON9A 3UANA 2C95A 3CO5A 3WMEA 1Y3AA 3LLMA 3GJ6A 2R6CA 4M8NE 1DAMA 3PEVA 3HDTA 3B1ZA 3PENA 3TVTA 1X8KA 1QBKC 4LBVA 4P4SA 3D6TB 3B85A 1DG3A 3AP3A 4R9UC 4YONB 5H1YA 2GRJA 1F6BA 1GIAA 1TF5A 1ZM2A 2GAOA 4QRHA 1JEDA 4GI7A 4A8JA 2GKSA 4US2R 1KAGA 1DBSA 1N25A 3WYAA 4M9SA 4A82A 5IDVA 1YHNA 4IKEA 2GJKA 1YKSA 1IQPA 1GWNA 2XB4A 1OH7A 4LDJA 4IDPA 3MJRA 2PBRA 1KNXA 4RFVA 4MRSA 1E9AA 4MRNA 721PA 3THWA 1UM8A 1LB1B 3K0AB 5DE3A 3GLGB 2ZI5A 3A1SA 3AKEA 1XP8A 2HCBA 2FX3A 4DLSA 3ZS8A 1XD9A 4PX9A 3VU9B 1YU9A 3UATA 2YNMA 5CDFA 3CLVA 3U5ZB 4CT5A 1JNYA 1OPXA 1UJ2A 1Z2CA 4EPVA 2OBLA 2OESA 1OXXK 4HAZA 1US8B 1G21E 3GJ7A 3LH5A 4Q1EA 1E2JA 2HT1A 2O8BA 4YLGA 1L4YA 2HYDA 4HUTA 4DDUA 2G88A 4JBWA 5JFGA 3NC0C 1CU1A 1US8A 1ZUNB 4MKGA 4WXPA 1SXJC 4Z1MA 1EFHA 2ONJA 5E3HA 5JRJA 2WSSA 4Z8XA 1V43A 2OHFA 5KOYA 2J0QA 5JJIA 1NBMA 1E2LA 2QMEA 3K9LA 5KPDA 4US0R 2W0MA 3GLGA 2HEIA 4KJZA 3W3AA 2UVQA 1XCPA 1ZVQA 3EZ9A 3K0AA 1W44A 4K46A 1P72A 1I2DA 1XB2A 3THWB 4V0OA 4B6EA 3P4XA 4TMTA 5CK4A 1W36C 1XMSA 2HJGA 4JLJA 2AKYA 1ZU5A 3CX7A 2ZRBA 4U7DA 4EJSC 1ZM7A 1NLFA 2NQ2C 3P20A 1FL9A 1VKJA 2C8VA 2ZJOA 1U0HC 5EUMA 3G0HA 3C41J 2IWHA 2V7QA 3C14C 3PITA 4LJAA 4WA7A 3IIJA 1E0SA 3GMTA 1E6CA 1WA5A 1HQYE 1GRQA 4URWR 1JR3E 3K70B 2ZETA 1GM5A 1ZNYA 5FBVB 1SHZA 4BLQA 4MKFA 4WZBE 3BH0A 4PQYA 2ZR9A 2WICA 2EU8A 2H18A 4IHQA 3FFAA 4XVUA 5FPYA 2QENA 3WNDA 2P67A 4FMDF 4D26A 2WKQA 4Q4AA 2QAJA 3DVLA 3R9WA 3CX6A 3L8ZA 2AR7A 1GTVA 4MRRA 3CH5A 1VHTA 4V0LA 3L0OA 5AR1A 1ZRHA 3CNLA 5LPNA 1AQUA 2ZSBA 2BJWA 1KI2A 3H1TA 4HLUC 1TQ4A 4GFDA 5EP4A 4DLXA 2JLVA 1Q1ZA 3K0CC 3RAPR 1KAOA 1X1SA 4JLVA 3CIOA 1S4QA 1T4GA 5H68A 1BYUA 1FNMA 2QUZA 2C9OA 3GPLA 3EAQA 3SI7A 3WP1B 4A9AA 2QM7A 1AGRA 5CYPA 2BBSA 3AVVA 1T3SA 4TSFD 1S96A 4JVMA 4JVLA 1OH5A 1G7TA 1TUIA 2FMXA 4H1VA 3ZZTA 3AKYA 1U9IC 4G5OA 1G3MA 3LW7A 4LJ8A 5AWFC 4OBEA 1N6KA 1E2GA 2ZJ8A 1UAAA 1TX4B 2OT3B 4TL9A 3M4YA 3AF2A 3U7HB 4D25A 3QQ5A 2PT5A 4Y0AA 4GP6A 5TV2A 1KKLA 3A8TA 3KDSE 4LOAA 4PC3A 1XJCA 3RSLA 1Z8FA 2RHMA 2HLDD 4E22A 2FG5A 2MMCA 4I1OA 2QQ0A 3RRMA 1ZBDA 4RD6A 1OW3B 3KQNA 1JR6A 3A4MA 4LHWA 3M0EA 4BECA 2QMHA 2WHXA 2QRNA 2ZS7A 2YWEA 1VYTA 3CF0A 2V1UA 3DZ8A 4DCUA 3U2QA 2IXFA 2OFWA 1UADA 4CEHB 2KWIA 3ZVMA 3AGQA 4HSEA 5FOWA 3I8SA 2QY9A 5FBQB 4B44A 1ZIOA 1P73A 4EJSA 2BC9A 2ZS8A 2OE2A 1XU4A 4D6PA 1AQYA 3HYRA 4G5GA 4Q9JA 2JLWA 1HEIA 3RLFA 2PJZA 4BASA 1XZQA 4E07A 2ZRHA 4L15A 2KSQA 4X8MA 1SKYE 4OK6A 1IN5A 2J9RA 2WSSD 3GJ8A 3AVWA 1A2KC 4DLUA 3VR5A 3A1WA 4ZDJA 3EA5A 2RGDA 3VAAA 3X1YA 2GCOB 4D81A 1RYHA 1GRNA 1ZJ6A 1JB1A 4MRVA 1E2PA 2I1VB 2QPOA 2Z6VA 4FD2A 3DMNA 3L0SA 1A1VA 1XD2A 2XXAA 3Q9LA 2PH1A 1NBME 1R8SA 4AKIA 1XBTA 3VR3A 4YQFA 2ODBA 1UKEA 4AWXA 2GTPA 2OZEA 1WMSA 2C5LA 3AP1A 4M22A 4M21A 4C0BA 5CITA 2DFKB 3ZGXA 4RZ2A 2B6HA 3B5JA 5KU1A 4TMWA 2O8CA 4Y0VA 2XB2A 1HA3A 1FP7A 1BYIA 2YC2C 1LV7A 3ADDA 4NCNA 3ND9A 2G0NA 1EFCA 2BKUA 1L8QA 3ICEA 1W4BA 1E98A 1Q21A 2IS2A 2Z4RA 4DLTA 2PCLA 4TZ0A 1Q1EA 1KY2A 3EARA 2VBCA 2ZYWX 1H65A 3JZAA 3QVVA 2WKPA 5BXQC 4IXMA 3AP2A 1OFHA 3PG5A 3LRPA 5CYOA 3T5DA 3RS5A 3HU2A 4BPBA 1JJVA 4G01B 2XZPA 1EFRD 4PC1A 2EVWX 4KFUA 5AJWA 1P4SA 3IO5A 4ACAA 3EZ7A 4N3NA 1QZXA 4B47A 1W0JD 2CE7A 4ZDWA 2F1RA 2QI9C 4EFMA 1QHNA 4M1WA 3IHLA 5HKKD 3OEEA 3QY0A 4MITA 3ECCA 5C1BA 3L82B 3Q85A 3TKLA
chains in the Genus database with same CATH superfamily
4WZAB 4EY8A 3R7WA 1F3OA 4E13A 1U7OA 3U7FB 4R2JA 1X0VA 2D1RA 1CY4A 1ZRNA 1HZZA 2GZMA 2Q5HA 2WJIA 2WTEA 3GOHA 1AT1A 4BRWA 5FNVB 5KYGA 2QUBA 3HBFA 3QWHA 4A3SA 3URMA 2C04A 3N53A 3BDVA 5MF6A 3OP1A 1XOIA 3UJCA 2AI2A 2B0CA 2ONYA 2ANBA 4PXSA 2NU8A 5ALGA 3SXPA 4PHCA 4D43A 4POAA 4YQYA 3VU8A 1GPWB 2XWJI 3R09A 3PDIB 5LQRA 1AUOA 4TROA 2F00A 2QPAA 4J75A 2PD6A 2ZRFA 5EFZA 3B52X 3O47A 4CEIB 4HOYA 5NULA 4KL8S 4WY2A 4UE2A 1OX4B 4Y9SA 1YXMA 1LPOA 2RC5A 1SC9A 3AVUA 5BMVA 1RT9A 3PX2A 5ALRA 4BEBA 4Q6BA 4E7PA 1O0SA 1S89A 2G0TA 4HG2A 4QXOA 4S0XA 2GS9A 2JG3A 4TM7A 3DJFA 1R12A 3P94A 3KJHA 4LJ6A 3TO5A 1NW8A 5KX5B 1IDN1 1GHTA 5CH5A 4PINA 1WBJB 1L5GB 2R1ZA 1PJTA 4RYLA 2NO4A 5A2GA 1T3LA 4OAQA 4WN9A 3UWPA 1DQSA 2QLBA 3PEUA 2G80A 2VDLB 4JBLA 4YRTA 4EW3A 4KO8A 5FTMA 5LA6A 4C7VA 3LQKA 1M2OB 4JSYA 4NBVA 3DQQA 1IY9A 1U1CA 3PXUA 1AMOA 1GQ2A 1T34A 3T5AA 3G8DA 1ODSA 3IPYA 1MQAA 1DDGA 4DCSA 2VSQA 2VAXA 4CF7A 3IA7A 2TMGA 5CM8B 3G9TA 1J8VA 1ULZA 4MIKA 2X15A 1UJ5A 1ZMOA 1TM2A 2YY6A 4LCBA 3MZ0A 3PXXA 4IF4A 1Z5OA 1GZVA 3QU5A 4KRGA 1PV1A 3JARA 5UKDA 3GLUA 1XNHA 1DMSA 3PFIA 1PP4A 4DWJA 5FBRB 5DMXA 4O4JB 4QEZA 4ZVMA 5DZSA 3L7YA 1IB0A 5C8YF 3MERA 1IJEA 1JXQA 2UZ4A 2OZLB 1Q0UA 3O3OB 1NI4A 1Y3DE 4QULA 3D8BA 3WNQA 1ZESA 3OKCA 3BXZA 5HSGA 3C1AA 4MWDA 3SR3A 3O75A 3R7DA 2JCGA 1RQXA 1MT3A 1AV6A 1T2CA 3D59A 4W7IA 1HNWB 9ATCA 2CLKB 5F78A 5P21A 2Z2JA 5BSWA 3VHXB 1N0IA 1V8DA 3HBAA 1QV7A 2UZ1B 2ZRKA 3BYZA 3QSGA 4J49A 4PHFA 2XSZD 2F64A 5LZ8A 4E14A 4RD3A 4TLCA 1AQJA 2AK2A 3L0YA 1KEZA 3L7BA 3CBQA 1ND6A 3L7MA 1NJ6A 1Q20A 3RJMA 4O2LA 4X54A 1W9HA 4QJIA 4G97A 5SY4A 2FQXA 1TC1A 4IG4A 2RGAA 4K7JA 2YUIA 3AHGA 4J03A 2JAXA 3JV7A 2EKPA 1BXRB 2JIZA 4Z5XA 4BL5A 5JUWA 2WUDA 1OFIA 1JEQA 1LF5A 2AE1A 1JIUA 3AFNA 3L4EA 5J4VA 3SQXA 4OD0A 1GSIA 3A1TA 5I8ZA 2OBXA 2AXPA 2OXIA 4HX5A 2VHYA 4E5UA 4HB0A 3G02A 1ONOA 2VJOA 2WSIA 1EZ4A 4G89A 3ZDYB 3Q3GE 5DYTA 3LCJA 1R6AA 2PH7A 4LSWA 3W3AD 3ZXSA 3RJTA 1S4MA 4XGNA 1P4HA 4MAAA 4Q9LA 1DDIA 3WFJA 3WBJA 1LNZA 4NE2A 5HIKA 3U61B 1LPNA 5BV2P 3FMIA 3Q9NA 3LY8A 3WAKA 3D8SA 2E7ZA 2H59A 1XTRA 3GJ4A 4TYYA 3CLKA 2Z9CA 3E5MA 1HNZB 1BMQA 3S2YA 4TXJA 7REQA 1JEOA 3KYJB 1DTEA 4RVDA 4W6ZA 4TS1A 1G7RA 1U8EA 3FLAA 2JH3A 3PEEA 1LBQA 5HKKA 3NG1A 1MGPA 4MCIA 4IDFA 5HWSA 2NP6A 3C98A 5DEIA 4BZXA 1RAEA 1FPMA 1PT6A 2NNLD 3QIVA 3TVDA 3O38A 1ZH8A 4S24A 3SNHA 3TD9A 2VDUE 1K3UB 5JD3A 1HDGO 1TJ3A 2GK4A 2V55B 4RVNA 4WOPA 2VYVA 1N7IA 1UQTA 1ZVJA 4INAA 1YBAA 3E5RA 4FOOA 4I6JA 5HGXA 3KVRA 4YO8A 5JHHB 5K0CA 4N65A 1BRMA 2EP5A 2VH5R 2W2NA 4E30A 5BSFA 1M76A 4CIAA 5K6RA 1DELA 4OL9A 4DDVA 1Q77A 3DBLA 5JAPA 2IGTA 1K9VF 5HFAA 3GRPA 5ALSA 3P9IA 4JASB 3H5RA 1ULSA 2HIGA 1ZHOA 3NM6B 2FSVA 2XE7A 4HAIA 2GJ8A 1E3LA 5HZMA 2IYLD 1NUHA 3L04A 4Z4FA 5CLIA 4F4IA 1XDSA 3OX3A 2QYTA 2HR1A 3PT9A 4V39A 2JKVA 2YR0A 3ONVA 4F4HA 3C2QA 2ZPTX 5TMBA 1OVMA 5BT9A 4W9MC 1O3YA 4BEJA 2J9GA 4WADA 1CJKC 1Z18A 3HMQA 3P5BA 3L7LA 4Y9UA 1FUEA 4ARBA 4LE2A 3B5IA 4UHJA 1KAQA 3RBXA 4CI9A 3PPVA 3D4OA 1NXSA 4YCNA 4MYUA 4XM0A 4X66B 2VBIA 3IKTA 1J0EA 2DU8A 1I36A 1EE9A 1WVIA 3S1AA 2YHIB 2IYVA 1OFVA 1ZCZA 2AFHA 3EZ6A 1Z75A 2X0EA 1QUEA 1G8YA 2GJ9A 1QC5A 2F1OA 1KEUA 1A4UA 1KH3A 3OOEA 4RAOA 4V03A 2OQRA 3RYTC 2C2XA 2GBIA 1GXSA 3I9MA 1KI3A 4PG7A 4II7A 4G0ZA 3OUUA 3H2SA 1UOPA 1BH2A 1EGHA 4Q21A 4KR3A 1Z28A 2CUKA 3C3WA 1V5WA 4LRUA 3AT1A 2MSCB 2RI0A 3GPBA 2V96A 3WDMA 2JJ1D 3MTGA 3M3HA 2E48A 4L6CA 1NE7A 1TQ8A 3MVEA 1QDUA 2YMLA 4F2GA 5CFPA 1Y34E 1Y8RA 1U1GA 1GCOA 2X9QA 4UAJA 2O2SA 2YMMA 1HE4A 2YKGA 3C1OA 3OOJA 2PYDA 3DDSA 3MAJA 5J5CA 5G1OA 3RIGA 4BE4A 1NMEA 3ORHA 1CS4C 3I2HA 1AXRA 1V45E 4I4TF 1ZGCA 2UKDA 4XZ3A 2BE9A 1GZ3A 1ORIA 2HD4A 1Q11A 4Z9YA 1A8IA 4RHXA 5TC4A 1Z56C 2Q3BA 3S40A 2CNOA 3R5FA 1IPHA 2Z2YA 2DTEA 1W75A 2ZITA 2JJYA 4YUWA 5AXAA 1P0MA 1TYBE 4FYKA 5A5EA 3IQWA 3LX8A 2PLWA 2Y9PB 2VXCA 3OMXA 3U7QA 1MNAA 2AS0A 2DWOA 2EWVA 2GXQA 4WN3A 2Z6AA 1Z6YA 3GFGA 4BX0A 1XHLA 1LPMA 3OC0A 1H8EA 2LKDA 4UJ5A 2Z5LA 2O59A 1WHSA 2OO5A 3LDFA 3RU3A 1G5HA 3ZWNA 3G5AA 2H7YA 4TMVA 1P1IA 3G49A 3K6SA 1T1IA 4OQXA 4R1UA 3DCYA 2D1FA 3N6VA 3LNCA 2JJ2A 2Y1OA 3PHHA 4M1ZA 4Y7CA 3RRFA 1PZHA 4DRZA 5JTUA 3WMXA 1W30A 4TL7A 2EW1A 3DEJA 4LNHA 1T8PA 3KKPA 1U98A 3WV4A 4B46A 1JHZA 2IY8A 3GBVA 3NANA 3SC2A 3TDNA 3T3EA 4CKEA 3SLGA 1IM8A 1UWLA 4Q4JB 1M6EX 1OFTA 2QW1A 4EUFA 1ZGHA 4KOEC 2X22A 1GOTA 5KOHA 3D6AA 4DV1B 5JVDF 1F6DA 5FFFA 1ISSA 2GSDA 4UUNA 1UBKS 4IIVA 5HIAA 1PAUA 1R88A 4URHA 5LC1A 1AGPA 1Z0DA 2FPLA 1L5HA 1WCXA 3FFWA 5CT4A 4ARZA 2MYPA 3E1GA 1HE8B 1PQ4A 2ZI3A 5JWOA 1JHOA 1MO3A 3MLBA 4M86A 2OG2A 3NS7A 3PUXA 3KQUA 1BFKA 1JIVA 2O3RA 1U90A 4IDHA 1IL0A 1N4AA 2CW5A 1UBGA 4GSLA 3TK1A 2WIGA 4J0EA 2NNWB 4YMTA 1K06A 2CF6A 1GPYA 1IHUA 2EDAA 2FV8A 2RB5A 4Q01A 4RX1A 3TE6A 4B4DA 5CLJA 5BP7A 5K8VA 3SYLA 3KQYA 1J06A 5AHKA 4OJYA 4TTTS 2ZTMA 2QNIA 3AR6A 1LJUA 3KKQA 1CZKA 4FOPA 4B2IA 1NRXA 3AFOA 1DQNA 1J1ZA 2WFZA 4GBED 2D5LA 4MPDA 3SJZA 1HE5A 4YT5A 5HQ3A 4LY6A 1UQUA 1HYBA 4CM3A 4MTCA 1IBLB 3BWYA 1JEAA 4UFNA 4JEHA 4DEVA 2CFSA 1QHEA 2GMWA 3I01M 4BP9A 3IAXA 1CIJA 1VI2A 3OE7A 3MHTA 5BRJA 1C7FA 2VLIA 2J3EA 3IXLA 1GG5A 4EF4A 1SHKA 2GUGA 1RQGA 3WX0A 1GZSA 2JI7A 3BHJA 3MRVA 3OG9A 5HG0A 4RE6A 3QOFA 3NTOA 4L51A 4DADA 1NVKA 1OXUA 2P6RA 2VHUA 2W5UA 2OD9A 4I46A 5CVVA 2ID7A 3L6DA 3ZY2A 5A5FA 5K03A 4KYTA 5L3SB 3EYAA 3SQLA 3W2TA 3CRZA 3KL4A 1Y5RA 5T8KA 4BVFA 1DIOB 1G8GA 1LLFA 2A1TR 3FAKA 2R25B 3I0MA 4YDHB 4EIWA 1I7LA 1L7VC 1FVOA 2EJVA 2J6BA 2FKAA 4N5NA 5SZHB 1H8HD 1WS6A 4C78A 3BMCB 2WMYA 4GNKA 3ETEA 3F3SA 2ZB8A 4YT8A 2MR6A 3CRMA 5B2EA 3QG1A 5JCZA 3D3QA 1NR7A 4G4GA 4BWVA 1CV2A 2XOKA 2BMDA 4F5WA 3PU6A 1E2KA 3E0XA 1YKGA 3OU7A 1DBQA 1P9WA 2R44A 2Q1YA 2E1RA 1XZGA 3U1TA 1RJGA 2HRZA 4P84A 4TLBA 3I62A 3R6LA 1E3WA 3S70A 1ZNZA 3M4XA 5DYIA 3IOMA 2J41A 1G55A 1CZNA 1I7NA 4O29A 1DINA 4JZYA 1EVZA 1KDZA 1OD6A 4HTFA 4R41A 3D6VA 1X1RA 1ZH0A 2ZU6A 4KK3A 3ZX4A 4H6XA 4JMPA 5B7PA 2H4HA 1ADCA 4ZI5A 2P2CA 4I3HA 4XD7D 4B81A 1MRZA 1C3OA 4TWJA 3U3KA 1NVGA 5EHQA 5KYVA 3IVAA 3CHYA 1VKRA 3G0GA 3H8JA 1A5BB 4N40A 4MRPA 4PZEA 4RXTA 3K8QA 5SY9A 2O8BA 4A2QA 1JEYB 5EHGA 4TQAA 4TOIA 4F93B 2CDBA 2EJTA 2RIRA 3MWKA 1B93A 4QX6A 4RHEA 3M6FA 1O94D 5H82A 1NURA 1V1RA 3LBYA 4RH0A 3AERA 4BQRA 3N28A 1KS2A 1UWCA 2FQQA 4K6MA 4G26A 5FF9A 4JJIA 3M89A 4LOKA 2J8ZA 3KX2A 3L4SO 1DBIA 4MYRA 5JXHA 3U44A 2GBLA 2WHQA 4PLFA 4QVKA 3ESCA 5IN4A 4R54A 4Q12A 5DNEA 2JIMA 3IV6A 3K6JA 3KT8A 4I36A 1LPSA 3U7IA 4DR4B 3UC9A 4QUHA 1U3WA 3BB3A 1E4VA 4M1MA 1HL7A 2CLSA 2QTGA 4PAMA 2P5YA 5DGDA 5F2EA 1MW9X 2IXAA 2OHGA 4XJXA 4EG3A 4BV8A 3OJOA 1HETA 5HE8A 2E18A 5A9TA 2AKEA 1M8PA 3H2HA 2VATA 4FFSA 4KX3A 4AMUA 1EWYA 3NJ4A 3O1IC 5ALYA 2R68A 1PNVA 2NU6B 2J0UB 1PR1A 4K86A 2AJCA 3RUEA 4RJTA 3RVDA 3SKVA 3KLMX 1APBA 2Z8YM 5EPUA 2A84A 4HNQA 2FE1A 5ES4B 5LYJF 1YDHA 3ILYA 1CY2A 1N0HA 5GJBA 3HWX1 3JQ9C 5ITZB 2NM0A 2I6GA 1NSFA 1WUTA 4PV7A 1KI7A 4XSHA 5DLQC 3A2LA 3FPFA 3HCNA 2HDWA 4JN6B 1YQTA 2X86A 3TMAA 4IZHA 3T5MA 1JR3D 4Z7QB 1DO2A 2MOKA 1Z63A 2WM2A 4BZQA 4FX2A 3R3YA 1KH2A 1NXXA 1RI4A 1AZSC 4F2HA 1V1MA 2P41A 3TYXA 3ENVA 3JATA 1PJCA 4JITA 3RKRA 3RVKA 1AY0A 4DDTA 4LNUA 1HDRA 2HMWA 1RCUA 5ED0A 5C1IA 3BT7A 4HRAA 2ZYHA 4HGPA 3UCXA 5IZCA 3FLBA 4LJ7A 3PNKA 2FN3A 3D7KA 3TX2A 4BGDA 4D4GA 2GZAA 1P1RA 4LECA 4M9UA 1C0KA 3EULA 5GGXA 1MHPA 2BGRA 3Q2KA 3VV2A 1FF9A 1IZYA 1ZAKA 2X2EA 2RGBA 1VJDA 4DMRA 1NYTA 2RJOA 4J0DA 4S2EA 5K3FB 2I2CA 4BMSA 1HSOA 1RVDA 3JWEA 2GBGA 2HNBA 4RKEA 4QARA 2H9AA 3RU7A 4KJXA 1YI1A 3CPJB 4PZPA 5K8LA 5CX1B 5FI3A 1M2FA 1BDIA 1UC5B 5AKZA 5C7YA 5M04A 2HXGA 1T5BA 3QFHA 1QZZA 4YRNA 1GG9A 2MSNA 1L4FA 1EXNA 2J9YB 1AS0A 4XWTA 5H0IA 2DUNA 2H4YA 3OFJA 3UJ6A 3WOVA 1REQB 5JYEA 5LMZA 1U5BB 4CM4B 3VNBA 2I3GA 5IMSA 1ORWA 4DWVA 1V95A 3NEYA 1BH6A 3HCCA 4Y6GB 2R751 4CFYA 1JBQA 2HT6A 2YFHA 3GLKA 5FL3A 3QUSA 5FWYB 1SELA 1UR5A 3IUSA 1EIZA 4MS1A 3SLKA 4CIVA 1FDUA 1IJKA 2UAGA 1YB5A 4OHOA 2Q8PA 1ND5A 2CJXA 3DOFA 1AXGA 2A35A 4IGIA 5FPTA 4GGPA 1EFVA 1MO5A 3LTEA 4HBGA 1DG9A 3SQNA 1PR6A 3ZCXA 1IZZA 4WFKA 2V5UA 4FP9A 4UEKA 3G9QA 5C1PA 2O1EA 3CH6A 4MQMA 2W98A 1U9YA 4YALA 1WOYA 1HOXA 4W1QA 2EFYA 4IWNA 5H4HA 2O19A 3LP8A 1R0RE 2N42A 3THOA 5DI3A 1QORA 1WV1A 1Z39A 1ZSNA 2NXJA 3QY9A 4KIJA 5G1NA 3ANTA 4UDYX 3DT6A 1Q0HA 4B3DA 4F11A 3DTVD 3ZC3A 2QRGA 3BL8A 1KP2A 3RSFA 4QYMA 5KTOA 4GOOD 4LWOA 2HDOA 3IX7A 4X1KB 5FTKA 2ZVPX 3PQEA 3TDKA 4KO2S 2UYHA 2OYSA 4AKSA 4KYIB 2RD2A 2LE0A 2RGCA 4HEQA 1P75A 4KQFA 3FWKA 4MRMB 1SUAA 1THZA 1EHYA 3I8XA 3QE0A 3HA2A 5D8DA 5E1BA 2CL0X 2P4EA 2BL4A 3IR5A 3G2JA 4DIEA 5L3VA 3RE1A 1IE3A 1OIXA 1QZTA 1Q16A 2VAVA 5KHLB 2P9BA 1KPGA 1K0FA 4FYVA 5AFSA 5DGCA 2XRFA 3WRXA 1J97A 1TZKA 1UUFA 3LYUA 3Q0IA 3DAOA 4DCCA 3OMLA 1VLJA 3ESRA 5A4AA 3GLIE 4B3JA 1NONA 1GGVA 4R8KA 5EI5A 3STUA 5A6SA 2FWNA 5GONB 5EWJB 3RDPA 4BIMA 2PMKA 2R3SA 4DAOA 1FB5A 3K2BA 3B7WA 1T9GS 2XD9A 5A02A 5A4IS 2SECE 3HXMA 2YMPA 3OZEA 2BW0A 5I5EA 3AJDA 2KJQA 2QX6A 1XCJA 3OUZA 2BTEA 2PK3A 4XLTA 2JCYA 2I54A 3IXQA 1YJ5A 4FEAA 4FHCA 3EQ6A 4R0MA 4C14A 2WQ6A 3OBBA 3SSOA 3HP1A 2APJA 4PRLA 4OGKA 1WXDA 1Z88A 2X9NA 2PV7A 3EOZA 1BE1A 5EIOA 4MVJE 5FEUA 2C3MA 2GN2A 2IC5A 1RKBA 2PZAA 5D5HA 3TOZA 3ZHYA 2DY1A 1REQA 2PUWA 5A6VA 1RAHA 2WC1A 5J4HA 5K3EA 1GTMA 2X58A 1T4BA 4RENA 4ZOCA 4ZYUA 2F8TA 1Z26A 3O1LA 1XEWX 4RXUA 4JLWA 1QIDA 3PYXA 2BGKA 3DOHA 2JBAB 2P68A 5CX1A 821PA 5U9CA 3HACA 2NSYA 3A1CA 3WB9A 4DW8A 3GAZA 3IVXA 3SHOA 2JLZA 4K8OA 1FLDA 1C2YA 4IHAA 5K3FA 2VWGA 3V1NA 4NY1A 4JT9A 4KRFA 3DEAA 1M83A 1P9RA 1Z5UA 4FYYA 4AY4A 1U0EA 2WJYA 1VJ1A 1GDDA 5AW4A 4IMPA 5JSUA 3GFVA 4TPKA 2Y4NA 2IHZA 4YJ2F 3HLTA 3C8ZA 2CXHA 3KK0A 5JO9A 3CV3A 3GEDA 3BRWA 4KI7A 4LNUB 2OBYA 2PKCA 3QUAA 1C3VA 1MA0A 3AF3A 2CN1A 2NX2A 2MSDB 3JATB 1L5WA 3W6NA 4BVGA 4GYJA 2XUIA 4B3HA 3AJAA 5CB4F 3MB5A 5AKGA 1O7JA 1VZ3A 2ARKA 3SVLA 1NVXQ 3UXYA 1IVNA 3HXKA 4EAQA 4QM7A 1VCHA 2CNNA 2EGGA 2C8LA 3DFMA 1E9BA 2N46A 2XVMA 3IP7A 4K2AA 5E4YA 4WKNA 2Y1DA 4ZXFA 5ITZA 1UC4B 4I6GA 3HP4A 1HLDA 2PLFA 3NBMA 3Q3EA 2FFAA 3C7AA 2O0MA 4EJ2A 3H42B 4LHVA 4IHJA 3T7DA 1K8QA 3KDPA 4BO3A 2WHEA 3TTXA 4C0XA 1ZGBA 4BFTA 4FM9A 3BFKA 3UJ3X 3LC0A 4ARCA 1PVDA 3RTCA 4EENA 5LIPA 3AZOA 2J0UA 5F9HA 3DT8A 2WJGA 3D7SA 4NBSA 5EZQA 2MTBA 2AFHE 4UE3S 2B61A 2AJDA 1U7WA 3CLSD 4IZOA 2XE6A 4OA8A 4UJ3A 3U0VA 4R51A 1HZZC 4LZLA 3VC1A 4BU1A 4KUHA 1HYHA 5IT5A 3JYPA 1T4CB 2QAGA 1XDWA 3P9KA 2IYEA 4PN3A 3W2HA 4X7PA 1TI7A 1PZGA 3E4CA 1QU3A 1CY8A 2GZ1A 1KYXA 1JU9A 4R16A 2RBKA 1GA4A 2OCAA 2G07A 3TF5A 3MCVA 1EEXB 2LCQA 4KR6A 4Q7JB 1AGXA 4RUKA 1IEQA 3AERB 3Q72A 3DMPA 2J4CA 1SZPA 5DYNA 3I83A 2YS6A 2WUWE 5DW0A 5JDIA 3PZRA 4P38A 2ZJYA 3CPHA 3G2PA 4IIHA 3HB1A 4UCFA 3OZSA 3GAMA 2JBWA 1MT0A 4AK9A 5HZGA 2WVAA 4YDSA 1GZHB 2VQ6A 2XI4A 4IFEA 3VNAA 2HUNA 5KB3A 1I30A 1M75A 3AR9A 2GSWA 1TGYA 1YIDA 1C3OB 5IDQA 3LWDA 1IRXA 3IBTA 1SVLA 2FPPA 4LY9A 4EK9A 4NBRA 1FVHA 2BR3A 2FTKE 4HQKA 3AEXA 2ZRLA 3KHSA 4JJEA 3EVZA 4BO5A 2DSNA 1ZJ4A 1DDOA 3RHZA 4CI0B 1EBFA 2P0YA 3OCCA 5AJXA 1EWQA 3M6LA 2DBZA 3N76A 1J7KA 3DYBA 1YCDA 3L0IB 5KYXA 1N5JA 3PJFA 2BUAA 2ATVA 2QNBA 1KYYA 1JDSA 1YDEA 2BBTA 3T9AA 1MJ5A 2NO1A 2YJGA 1E3WB 1O8CA 3EB9A 3IUNA 3LDGA 3MHPA 4J1NA 4RSGA 3ZHZA 5AUOB 3E3AA 3JAMA 3AM4A 3CU5A 4XTCS 4LG1A 3WYFA 3C3JA 2HU2A 1F2DA 4YO7A 1X74A 1Y48E 1RQ2A 3CX3A 4HJXA 5CLLA 3DM9B 1SBHA 3M9WA 1U0OC 4L0QA 3VKVA 1Y9JA 1WQ4A 3O9MA 3VO9A 2PZKA 3KJGA 1P4AA 1TLFA 1VCIA 4ENPA 1UXOA 2OMEA 3KQOA 1N8SA 3DZKA 2VQEB 1D8AA 1CW2B 2R6HA 2YX1A 5FX2A 2EEZA 2N75A 1FOEB 4E51A 1Q7EA 1Q50A 3OP4A 4KGXA 5K0ZA 3ND8A 3GRCA 5JZOA 5KO2A 1J0AA 4BNWA 1RXCA 3AUJB 4GT1A 3BC1A 5DW3A 3ZWMA 2A7QA 4R5MA 2PGJA 4D56A 3OJLA 4JLAA 3ZXUB 1XPJA 1ZOOA 2SBTA 2CXNA 2LGJA 4XPIB 3V9AA 4NSNA 4TX1A 2Y76A 1Q0TA 4BDTA 4DUYB 1R0WA 2IIVA 1GLGA 3ROEA 5KSZA 3PUZA 1JLRA 1V16B 2XMQA 2G77B 3F5DA 4M1TA 2J0SA 3CZMA 4J0CA 8ATCA 4FWTA 3MD0A 2EL9A 4GO1A 3N7UA 4D6XA 4LF9B 1RZ3A 4PFKA 5C7OO 3LK6A 4MULA 3DFIA 2F8MA 1WXFA 4HNGA 4LBYA 3ETCA 2QJOA 3P2EA 3LVBA 4PEVA 2EBWA 3BAZA 1TZCA 5HJ5A 3NBKA 4YJ3F 1XVIA 2BCGY 1JA0A 3KZKA 3CG0A 4EHKA 4D3FA 5C80A 3R9XB 1SQFA 4AJ2A 4CF3A 4JL8A 1N36B 3C6MA 1U1EA 2C5HA 4KHZA 4O1IA 5KSPA 4FMCF 2FMKA 3S8MA 2J3LA 3TQOA 3LYAA 4OUDB 5CDUA 4JYMA 4HF7A 1YZLA 4N54A 1BCSA 2BGIA 2FI1A 3BWBA 1GG8A 1OLOA 4UZEA 3ENWA 4FYXA 5H81A 3S55A 2GDZA 4P86A 5F2OA 4O3FA 4L9WA 3VDXA 4TVOA 5IXJA 1SULA 4PSVA 1NW4A 3SAJA 1JG2A 1HRKA 3LC7O 3U4DA 3KR2A 1VPDA 3OLWA 4IJMA 1QVWA 4ML3A 3VKUA 1MV8A 1YR9A 3VR5H 3IAEA 2JFGA 1TJ4A 1VG0B 1J0BA 3GARA 4M0MA 5SZJA 3SF0A 1TJPB 4GBJA 5CAEA 4E2ZA 4PZCA 4ARZB 4I7EA 3FVRA 2C97A 2QN6A 4X8HA 1X7XA 5DJ5A 1ZH6A 1LVHA 3DDUA 3A05A 4H6PA 5EP1A 5KOHB 2G1JA 1A9PA 1EAMA 1UMKA 3H11B 1O9BA 3VR4D 2IA5A 4Q4JA 4ZYTA 4K0KB 1V6CA 3SC2B 4RZQA 3OM8A 4TTJA 2HMTA 2QN9A 3BK2A 3DB1A 2HQBA 4HSGA 2IXGA 4IXWA 1Z0JA 4Q1DA 5BNFA 3RS3A 1Q92A 4ZFNA 1WB9A 2V9ZA 4L4ZA 1T3GA 3EGWA 3V1UA 3CBGA 1P91A 2J3IA 3QJ5A 3OHSX 5H3CA 2TMDA 3K6SB 3RREA 1FYEA 1O0CA 1P4RA 1SBYA 3SZUA 4M9CA 2XBLA 4X24A 3PWKA 2O2JA 3MJFA 5T57A 4AMBA 3EF3A 2EZTA 5CLQA 1WHSB 1SQ5A 4DSTA 3EC2A 1XG5A 3NM5A 1NQ5A 2GAIA 1Z6ZA 1JMKC 8LDHA 1L8OA 3P27A 2VO1A 3FUCA 4P31A 1ABEA 2OXTA 5MN5A 2X41A 1JFRA 3U7QB 3LPNA 3HO8A 3RNLA 4TL8A 2C61A 2VXYA 4WQMA 3TM5A 3FNBA 2ZR0A 3DR3A 4HDMA 1R5NA 2NO9A 4ZEWA 4JJ8A 3LDUA 2OC4A 4MDYA 2JAQA 5CDHA 4F38A 2YWDA 2I76A 3GVIA 3W7BA 1LI5A 2O3JA 1XWWA 2J3QA 4EVRA 2A4MA 1J5XA 2OBNA 1SIWA 1PYDA 3GJZA 1KOJA 5JD6A 5HCIA 5B1SA 1RI1A 3R44A 1P7WA 4DXDA 1A9SA 2GNPA 4V3BA 4C6SA 3EFHA 2H92A 2IZOA 3PIRA 1ILWA 4QG7A 4YC7A 4B3XA 3BIWA 3O92A 5IBCA 2BUBA 4XIIA 1CR2A 4JI8B 3Q3IA 5A3RA 4RULA 1XMQB 2D5BA 1NXTA 1FYWA 3W6UA 3WTBA 4HYYA 1J0XO 4K6CA 4OUKX 4J0KA 3AJ9A 4WFJA 4PLPA 5H5JA 2G6TA 3FCOA 3WRXC 4A26A 5IDWA 5A2QA 2H31A 3N3BC 1YMVA 1O0BA 2IXTA 3ZLUA 2EGHA 1EA5A 1TB4A 2GVZC 1AM4D 2ALJA 2I2BA 1ESCA 4NOKA 4Z9XA 4DR3B 1ABBA 1J23A 1QAMA 2GPWA 4WLUA 5CVJA 2AFHB 3RO7A 1CR4A 2J85A 3ROMA 4BEWA 3WKAA 1JDBC 3S1AB 4EZEA 2G5TA 2QT1A 4DUZB 1XXHE 3SSNA 3RSCA 5D85A 5EKDA 1CF2O 2EEPA 1RI2A 1PGJA 4JJKA 4ABYA 4CF6A 1KOGA 4JMLA 4K1LA 3VQTA 3U4HA 4Z4EA 3EDOA 3LX5A 1JKIA 5C4IA 2D5AA 2BM0A 5D6NA 3WLNA 4BO1A 4ARSA 2I2WA 1YCGA 4E5DA 2B37A 3A2NA 3M6XA 2VKQA 3ZD8A 4Q4HB 3BA6A 4ZVNA 3R8CA 1GJRA 4HFNA 4F6LA 2ZUFA 1ZJWA 5F77A 3RVRA 4D8WA 3NBZC 1T3HA 1SVKA 3QXGA 4UM9D 6ADHA 1XF9A 4OQNA 3P0FA 3T3OA 1GNLA 2IHNA 1DBWA 1MB0A 3N0XA 5FI1B 2B8WA 3T5PA 1A8PA 2GM3A 2D2IA 4F45A 4ZZ3A 4KQCA 4LI0A 3IQZA 1LVUA 2VJDA 2C9ZA 5CTAA 3K6KA 4WGGA 5IX8A 1A9TA 1G16A 2ECFA 4MV6A 1Q5PA 5EPOA 3VNRA 2CKMA 2KW5A 4G5HA 1G9TA 3NTRA 3OOYA 2O2XA 3KBBA 3L8EA 1GPNA 2QZ4A 2W2OA 2ZI6A 2YCLA 3AFGA 2VTVA 3B1JA 3RUPA 1MN6A 1UBFA 4G07A 1L9KA 4DY4A 2IS4A 2FZWA 1X1BA 3OU6A 5KAMA 3TAUA 3GUVA 4UM5A 3D2BA 5CCBA 3SHWA 3TNJA 3TWOA 2ERCA 3S7ZA 3MTJA 4BIIA 1CVIA 2ORYA 4B3BA 1G3IA 2Y8EA 7REQB 2EKQA 3PA6A 2QUIA 4AXXA 1QMPA 2PVPA 3VO8A 1Z74A 3FE2A 2FMFA 2QORA 2GM5A 1XRLA 3NBXX 1EI9A 1VLMA 2YWGA 3SX0A 2IYPA 3WNBA 4M60A 4XDHA 3ZR4B 1Q3KA 1D2NA 1Q1GA 4DMCA 3FYDA 1KEWA 1DZ3A 5IAJA 4J43A 2VNAA 4ZTZB 4U7HA 5HILA 5F4BA 3KSRA 2D8AA 5K8JB 3RTGA 5JPIA 1A7UA 4IOMA 4AP9A 3MWEA 4HVLA 4YRDA 2QE7D 4PZZA 3L2OB 2FFQA 1EKXA 1W2GA 5C51B 3AUKA 4D0NA 1XK7A 4O59O 2YRXA 1JEQB 1JLLB 1YK1A 3K30A 1L8XA 3PP8A 4M87A 4JI5B 3HBJA 1BXRA 1IZ8A 1VHLA 2JHCA 4UM7A 1X70A 4WZBB 3V97A 5FNZA 2NYVA 3EPHA 1QM5A 4P7GA 4BMYA 3BXEA 4EKGA 5KINB 1YDWA 1IWBB 3F3KA 2VH1A 3RD5A 2PMWB 3ZJ5A 4UBOA 4QXMA 3UAOA 2WFAA 1QX3A 1AHIA 2P3OA 1JEEA 2IUSA 2H06A 3GC6A 1NDUA 3B3AA 4LRSB 1TKRA 4OMUA 4OM8A 5BSHA 2ZJZA 3IOYA 5C18A 1EBUA 4FDVA 5AHWA 2UZ1A 3T7RA 3V1MA 4AICA 2YHUA 2CBXA 2O0KA 2G9NA 1XTKA 3PL1A 1O87A 3C5EA 1F1BA 4BNJA 1OBCA 4V1CI 4HEJA 4N12A 1KMQA 1Z4OA 1ZOIA 5K0LA 3IURA 1W5SA 1P0IA 4M9XA 2H0AA 2EKZA 2P2GA 1N57A 3RV3A 3QW2A 2NT4A 3U62A 1JIKA 3B82A 1JYSA 3GZTB 2J07A 1ECCA 5AKJA 1NI4B 5EY5B 3R9IA 4C7XA 4D9HA 1YE8A 4GR9A 1P6QA 1H2AS 5IJAA 1UK9A 1HOTA 1N5KA 4IILA 4M88A 5EZYF 3SFTA 2A9VA 3Q7IA 3ZNPA 2QLMA 1QP8A 5F21A 4OY3A 3DDHA 1PT5A 3JARB 2X0RA 2CVHA 5EIBC 2VP0A 3MAGA 4CMEA 4FGWA 4D46A 3GUYA 4RLFA 4F0JA 3KLOA 1NI5A 4Q7KA 4BFLA 2R96A 1JILA 4Q00A 3BM5A 1C50A 1YZVA 4WCDA 4YMHA 1DWOA 4C4AA 4DA0A 2IW1A 4O1MA 4PHHA 2G17A 2G0AA 4XI9A 1YRHA 2R7LA 3HJHA 2VP9A 4DQUA 3HB4X 1KC1A 1Z3CA 1SU8A 1GQYA 1VSBA 1BWQA 2GCGA 4NATA 1Y0BA 4IQ4A 1LNQA 3DHYA 4Z3KA 1QP7A 5A06A 1S2MA 4H7JA 4UUOA 3AHIA 3LWBA 5DM0A 1ECBA 4DR1B 1XFAA 5DLYA 3KPWA 1XTZA 5I9TA 1VPVA 3CGWA 3NEAA 3SEZA 3VPDA 3ZQ4A 1JDPA 4Q37A 1DUSA 1Z5GA 2YVLA 4GGMX 4C7KA 5BMVB 2VEOA 1VL2A 3QXXA 1M2VA 1XMJA 5IVHA 4MHTA 5FUVA 2FUCA 4DA8A 3M9XA 4JJ4A 1KEVA 2L0XA 1JQ3A 1KARA 3FI0A 3Q98A 4IMRA 4II3A 3FYSA 4WBSA 2HQ1A 1L7XA 2HUPA 5AW9A 2E4ZA 3V46A 2NTEA 4NBUA 4E1BA 4LFAB 3VM6A 1P9LA 3PDIA 3F5QA 4YB8A 2BKEA 3D3EA 2WA1A 3IBYA 4HB4A 3N9IA 4RM3A 4P4GA 1RYBA 4D45A 4YUAA 2A88A 2LXNA 4HL6A 1QGZA 4OSPA 1ISFA 2IQIA 3PV0A 3AIKA 3KEMA 3K9NA 2QWXA 2ZVDA 3U3DA 3V33A 1VA4A 2DKFA 5H8WA 3T3GA 1BMTA 3K35A 3I8OA 1MRNA 1VI6A 3MWYW 2BRUC 5SYAA 3R7WB 4AC9A 1JFSA 1PL7A 2WZBA 4WZAA 1MLDA 5JNVA 1GAWA 3T7AA 3NHKA 2G40A 4JB8A 2OVBA 4D0RA 4YYEA 2R4QA 3P9ZA 4BBAA 2Z98A 3WGTA 4Q1VA 3KAJA 1OI7A 2AJ8A 4RA6A 1NN0A 2BT4A 3QX8A 2JGDB 2W83A 3KKLA 1N6LA 2M6SA 4YR7A 5HXAA 2P9YA 4L6AA 4C06A 4PHGA 2JARA 5KQSA 3NIGB 2R7NA 4UBMA 4IQGA 1TVKA 2A5FA 4NR0A 1M33A 1Z4LA 3AONB 2H4WA 4GF5A 4BFSA 2XKJE 3LY5A 3ROPA 3V7FA 3ZD7A 2HMAA 4QDKA 3UWKA 3V9PA 3NZEA 1GNPA 2G7MC 4YGYA 1T0UA 1N5DA 2W8BA 4RJLA 5JE8A 5TS3A 3KR9A 4BB6A 3UH0A 3CG4A 4ZT4A 4YRSA 3DE7X 3ZZUA 4WWHA 4FZJA 5JSYA 4NDZA 2J33A 3SQMA 1MFZA 3E35A 5FD8A 3PJRA 1DP4A 4FZ5A 4LMPA 3I52A 4WNYA 4Q9AA 2VHWA 3E9YA 2CYCA 1VQ1A 4GZ5A 1R6VA 1WKBA 3GDOA 3QKUA 5G2OA 5CDGA 5JHGB 2QAGC 2GRUA 4QDXA 2IU0A 1IHPA 2Y0PA 1N6HA 1AB5A 2ZYRA 4G1EB 2G08A 4KE7A 4RKWA 4GOKA 1WEHA 4YRJA 2O8CB 1GCUA 3STHA 5KJCA 2E21A 3JWHA 4NNPA 1QU2A 3PQ2A 1GLNA 4KBGA 4JUBA 1KSFX 5CXSA 1K0UA 1HYEA 2UZ3A 2B8JA 3DFUA 4W7HA 5IKOA 5KDDA 2ZT5A 3E03A 1RBMA 3LF2A 3RAEC 1ST2A