1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
4BE7B 5AWFC 2GZDA 2VQSA 2QI9C 4A36A 5SZIA 2EFEB 1E0KA 4GBMA 2C03A 1S96A 4MRRA 4HAVA 5EUMA 4D6PA 4OQLA 4IXMA 2GCPA 2F6RA 4JVMA 5CYPA 3TH5A 3AVYA 1IHUA 1Q44A 1X1SA 4MYCA 3EIHA 5AUPB 2QBYA 4RD0A 5EXXA 1JNYA 1DARA 2WJHA 3CW2A 2F1IA 3GJ0A 1HV8A 2WWHA 1J90A 3QJYA 3U7GA 2IYXA 4FCTA 2BMJA 4E22A 2E1RA 3L8ZA 4UJ5A 1GM5A 2NO9A 4ON9A 1R7RA 3KKMA 4KBGA 1JXMA 1E2JA 1VHTA 1DAMA 1KO4A 1ZC3A 2WZQA 2RGNC 3UKDA 4DKXA 2XXAB 1QHHB 5DSZA 2LWIA 2QMEA 2J3EA 5DISB 2AK3A 2GBLC 2JIZD 2QAGA 5AUQA 2A9KA 1VECA 2DBYA 2QPOA 1W2GA 3CO5A 3FDIA 1IN7A 2J0UA 4NBSA 1OIVA 3R9XA 2QRZA 4PO9A 1FUUA 2ANBA 1KSFX 4HAWA 3Q7QA 5HE8A 4ESHA 1ONBA 3AEZA 1GUAA 1XP8A 1ZUIA 1KDTA 1QDEA 2YYZA 1XTQA 1SULA 2W2VA 4DDWA 3QVUA 2WAYA 1KSJA 1KMHB 2NG1A 3QG1A 1T91A 3SOPA 1UBFA 2EW1A 1Z6XA 3PUXA 3VU9B 3WNCA 1U90A 2J7KA 3JVUA 1ESNA 2G6BA 3Q8XB 4HLCA 4KXFB 3GLFE 2IF0A 2W83A 1R4AA 5JHHB 1BH2A 4O25A 1IN4A 5BW8A 4Q18A 3AUYA 2GCOA 3FHTA 1T3HA 1YJ5A 3DO6A 1TPZA 3KJHA 3HJNA 3HR8A 1T5LA 3G82C 2DWOA 4PAMA 2AWOA 4B3DA 2KBFA 4DHEA 1XNJA 4IKEA 2C96A 2ZRHA 4ESVA 2FPLA 5CLQA 3ZVLA 2RGNA 1G8GA 1SXJC 4G5RA 3NC0C 1T8UA 2H17A 1T0JB 4NKRA 2WMOB 3Q3JB 5EE3A 1FL9A 3THXB 2GK6A 1JAIA 1KNQA 1P9WA 2ZJZA 2O0HA 3CM0A 4GFDA 4Q21A 2C99A 2VPPA 1GFIA 1I4DD 3R7WB 4FI3C 4J0QA 2FX3A 2PLRA 2D2FA 4JLAA 4PSVA 4TQAA 2P6RA 2A5GA 1Q1BA 5TV2A 4O3MA 4HAXA 2QSYA 2QE7D 3LW7A 1KI6B 1JQLB 2YNMA 4MQBA 1WRBA 4JLJA 2CHQA 2YOGA 4JLDA 5JI3E 3TSZA 1Z47A 3TVTA 2IK8A 1XTSA 4NCKA 2QGZA 4BZPA 5LD2C 4PXAA 1Z0IA 2QM8A 2IYLD 2FPKA 4PPFA 2W6IA 1KJZA 3FMPB 1AQYA 1D9XA 3TAHA 1KO7A 1J7KA 3B9QA 4DEXA 3LW8A 2JLUA 2XNDD 1G19A 1W46A 1XCPA 4DDUA 3RRZA 1SXJA 3MGCA 2R8RA 3ZS8A 2WMNB 1TNDA 3PIRA 2OE2A 2HJGA 2H18A 4PR0A 4LC1A 2Q0HA 4DDTA 3GLHB 1R0ZA 4Q48A 1ZU5A 4B76A 2JA1A 3I4LA 4C7OB 4GPTA 1W7AA 4PFSA 1UBEA 4UNQA 1HY3A 3FPAA 2JDIA 5CDFE 4QKQA 3LX5A 3K0FB 3VTKA 2JJ1D 5AJXA 2FZ4A 3GLIE 4Q1EA 5JWRA 2IEZA 3AVVA 3RS7A 1XMSA 2OCBA 4LYJA 2NPIA 2AN9A 5L3RA 4P4UA 2X2FA 2WWYA 5H8WA 2ZJ2A 3AF1A 3REFA 3RS0A 2HYDA 3IBGA 1XBTA 2ZANA 4M1OA 3UIEA 4Q7KA 3CWQA 2V9PA 1KI1A 1BYIA 1W5TA 2FSIA 5D3QA 5JECA 4QBFA 5KTYA 3SJZA 1E2LA 4W7SA 2HCBA 1E0AA 2AKYA 1G8PA 1OV4A 2ZRPA 3GLIA 2CLSA 4B74A 4BLOA 2GEUA 6Q21A 1FX0B 121PA 2CVHA 2DHRA 1YQTA 2GJ8A 4LGMA 4ZCIA 1E9EA 2YWGA 1XCGB 2BEJA 3C8UA 1ZW6A 4KYIB 3A1WA 2JLXA 2QP9X 1UF9A 1TQ4A 4E5UA 4HAZA 4DT1A 2W0SA 4R71A 4ABYA 2I4IA 3BAFA 4JBXA 3QEJA 4OHYA 1Z0FA 4QHTA 5EP4A 1DADA 4L8GA 2E9SA 3OIYA 4TQ9A 4DLRA 3EZ7A 1BMFD 2NQ2C 3EPKA 4MKHA 2XB4A 3AGPA 4JL8A 3IQXA 3KL4A 4N1AA 2G3YA 4EQ6A 2FPMA 1ZM3A 1I4LD 3DM5A 3LXRA 1KJWA 4UQOA 2IYTA 2JEOA 1HT1E 3VR3A 4F38A 1T3SA 1YR6A 3BD9A 4LJAA 1G18A 5DGXA 4S35A 4KJZA 4LCBA 3I5YA 2FNAA 3QPVA 3I8SA 5HKKA 5FTMA 1A4RA 2F1HA 2XZLA 1CEEA 5G53C 4RD4A 5SZJA 3RC3A 1NBME 3TUIC 4RZUA 2YC2C 4OHXA 3CIOA 1HYQA 3RS4A 1OHHD 1T9HA 1N0VC 2WJIA 3FE2A 3S1AA 3T1OA 1MT0A 2A5JA 1W36D 3OFNA 4UNPA 2ODWA 1MABA 4B48A 5BQ5A 1ZVQA 3RWOA 2XOKD 3MWJA 1U81A 2OG2A 3FTQA 1E79A 2WTUA 2O8DB 3ZYCA 3SYKA 4DDVA 4GNKA 4B3FX 4JT4A 4HAUA 4KVAA 2VSOA 1HQCA 3QOFA 2XTZA 3IILA 5EE9A 1WXQA 1ZD8A 1YZQA 2ZI6A 3KQUA 4IDPA 3F0TA 4NCIA 2R65A 1AS2A 4DIDA 4TLCA 2CJWB 5DIFA 2ZAOA 3A58B 3L43A 2EFGA 4C0JA 2Q3MA 4M8NE 3GEEA 4XTRA 2JLRA 1YZUA 3MAAC 4FMBB 1KK1A 1CJUC 2QL6A 3EWSA 2IHYA 3NH9A 3U3MA 4CZ2A 3KKNA 1R6BX 4Q47A 2QAJA 2FSHA 2ZVPX 3DL0A 4IW3B 3PG5A 5DHFA 3LBIA 2BM0A 4TSFD 1EK0A 3D3QA 3P26A 4G5QA 1GAJA 4TMWA 5FBQB 1KSGA 3LA6A 2DFTA 2RGBA 2ZREA 3CRMA 5EZ6B 2ZXUA 4HDCA 2WVJA 4IEIA 5AJYA 5IT5A 3NEJA 3B2EA 3Q9LA 4DLSA 4NZYA 3RVBA 3VHLB 4TYNA 3WYFA 5GJBA 1R5BA 3EG5A 4M9SA 3W6OA 5DE3A 4KU4A 1YZKA 2F43B 2F55A 2IEYA 3UATA 1IBRA 4PHGA 2OZEA 2H57A 1YRAA 1RRFA 3I72A 4C0LA 3DOEA 1XTJA 5DN6A 4R98A 2YWEA 4YMTA 1XMIA 2H92A 1T3LA 2NTYC 4OK5A 4RD2A 3NDBB 2SHKA 3OAAD 1E2HA 1N25A 1TAGA 4PC6A 3A1TA 1E1RD 3EPJA 1DS6A 1P5ZB 4JMPA 1KIMA 3W8NA 5M04A 2IWRA 2O8EB 1F3OA 1LS1A 1ZP6A 5A0FA 3K09C 2J0SA 1ZD1A 3U44A 1DE0A 4IDHA 2GETA 1OFTA 1RZ3A 1TTTA 2OCAA 3NG1A 3MLEA 1OXSC 1KDPA 4EFNA 3TMKA 2KB0A 1NLFA 1JQJC 4RFVA 4LV6A 3X1DA 1QHYA 4ZDJA 4RSGA 4QBHA 1W2HA 2FH5B 1G9XA 5JRZA 1XD2A 2VEDA 4KLNA 2ASEA 1U94A 1G3IA 4NCNA 5AJZA 1NVXQ 3FB4A 1ZD9A 1QVRA 2XB2A 4KITB 2AXNA 5LDDC 3U3OA 1E9SA 2I1VB 4M9QA 4A8JC 3L2OB 2WKQA 4FWTA 1HUQA 4LSGA 3K70B 5FBVB 4W5HA 3ZS9A 2ZJ5A 4P4SA 1TF5A 4PC7A 2W00A 1S8FA 3VR4A 4BECA 2OHFA 3X1WA 4M1WA 4JKIA 2ZSDA 3DZ8A 4KFRA 1CR0A 1IM2A 2FJUA 4LJ6A 4V03A 1Z0AA 4Y0VA 3MJRA 4QGAA 4NU0A 3TW8B 2ZSFA 5G3YA 2EWVA 3P4YA 5LBIA 2QPAA 2NO0A 3HU3A 1JR6A 2PL3A 2VH5R 5JEDA 1XRJA 5EXSA 4Q7MB 3FMIA 3CR7A 2AD1A 1GKUB 5EQTA 4E07A 1G7TA 1CBUA 5KDDA 3PITA 2IW3A 3H4MA 1L4YA 1OXXK 4YXWA 1II8B 3I8XA 4JLKA 5JI2E 4ZDKA 1J70A 5F2EA 5JSZA 2WJGA 2LCFA 5KSPA 4B2PA 2NGRA 2ZRIA 2V55B 1E32A 2AX4A 4YMUA 1RIFA 3D31A 2AFHE 2Z5FA 2ZRNA 3FFBA 2PCJA 4HB3A 1R5OA 1FTSA 5EP3A 1KDOA 3H0KA 4QGFA 1PJRA 3O47A 1DG1G 3BFKA 4FMCB 5KSOA 4A8JA 4MGYR 4W5JA 5CIWA 4QM7A 2GEDA 4IVPA 2FSGA 3ICEA 1GITA 2V7QD 2QP3A 1KO5A 4MKFA 3B60A 3NBXX 4B3CA 4X8MA 1D2NA 3C14C 2HT6A 2ZS8A 5IK2A 2JJ2A 1UBGA 2GJ9A 3TJZA 4DZZA 2B92A 3PUZA 4IFBA 2AL7A 4I1OA 4OQMA 4BFUA 1KI8A 3K9HA 4FW9A 2Q3HA 2ZRLA 4JT2A 3PR1A 1PLKA 2YV5A 3HPRA 1XX6A 3QF4A 3TQCA 4A4DA 5JHGB 1B23P 3GMTA 3SHFA 5LPNA 2QAGB 2UZIR 4PO1A 3PUYA 1QG4A 2J1LA 2P0EA 2J0UB 1YZTA 5FTLA 1G64A 2HT1A 1COWA 1SVIA 1W5SA 2ZROA 3QSYA 2IS2A 3LLMA 2XSZD 3ETLA 1ZNWA 1UKVY 2BBSA 1D2EA 4ZDWA 4DLYA 3AVWA 3AVUA 3CZQA 1ZNZA 2WSSA 3F8TA 3L0SA 1F2TA 4B47A 3LQQA 4CDGA 3U60B 1ZCBA 2CNWD 2QA5A 3NVAA 2GK7A 1JI0A 3OEHA 5J5CA 5DI3B 2FZLA 1N6RA 4IOLA 2IF2A 4BFVA 2VA8A 2I1QA 4EPTA 3IEUA 2ZRAA 4ASUD 2QEQA 3KKPA 3B1VA 3H2YA 1FQJA 4R2IA 4Z8XA 4HZIA 4A0RA 3MFYA 4QGHA 5FL3A 4Z1MA 4MA4A 1OJLA 2ZS7A 3Q5DA 2IS1A 4LJ5A 4PHFA 1W48A 1E96A 5J4YA 4BFXA 5FPKA 3T1VA 3G5UA 3N2IA 1RPZA 2VP4A 4AG5A 4CVNA 3QKUA 3TSOA 3GLFB 2XZOA 2VP9A 4Q4JA 1P72A 1J8YF 1G3MA 1Z0DA 1N6NA 2BKUA 1N6HA 1WP9A 2CLDX 1MH1A 1US8A 3ADKA 4D4JA 3V4RA 1NY5A 2IHBA 5KO2A 2ONKA 1E9RA 1NKTA 4RZXA 4KFTA 3VMFA 1U9IC 3L0OA 4AY2A 1R8SA 2D7CA 5BN3A 4KODA 2QG6A 2JLSA 3FFAA 2FFAA 2WWIA 2N42A 3CUEF 2W2TA 5FPYA 5K8IA 2FGKA 1G8FA 2DWQA 2ZYWX 3I61A 2I3BA 1JR3E 1WQ1R 1E0SA 3SN6A 5JS8A 4V0MA 4ZDIA 1VG8A 4QOSA 3TBKA 3MCAA 3DVLA 3KFVA 4BEJA 1EFHA 1II0A 2D06A 4B44A 3WY9A 3T06B 1UKZA 1DTSA 2GXSA 1EFRD 2QY9A 2RHMA 1AIPA 2AHOA 2L0XA 3LO5A 2GZHA 4YMSA 4IXNA 1KK3A 1ELOA 1GRQA 2XGJA 2DWPA 1HE8B 2IT1A 2JIZA 3KXLA 5J4LA 3FMOB 4Q9LA 2V3CC 1AZSC 2NOAA 5EP2A 1VPLA 4DUGA 3LVQE 1FMLA 5IDVA 3W3ZB 5D3MA 4HSEA 1Q21A 1JR3A 1G291 1XD8A 3EA5A 3O8CA 1UFQA 1ZIOA 1G3RA 2Q9CA 1DAKA 1P60A 3U4QA 3SBEA 4HUQA 1U9IA 1Q20A 3GJ3A 4K81B 5GJCA 3RRMA 4B34A 1U8ZA 5B58C 4WA7A 2HV8A 4BWYA 4D4KA 3LWNA 2OBLA 2OILA 5JRJA 1CXZA 1N6LA 2BCJQ 2DB3A 1FP6A 3TSWA 3EC1A 3C5CA 5LD2B 2IYRA 5FUXA 2P6NA 4OI2A 4M0LA 1M7HA 4OQXA 4IVRA 4MGIR 4P0TA 1VCOA 4CT5A 2Z43A 4IDOA 2P5SA 4BPBA 2ZPTX 4A0FA 1JEDA 5CB8A 2ZE6A 5JEEA 3EXAA 1H8HD 2O8FA 5UKDA 5JCZA 2YINC 2KWIA 2CE7A 1E9AA 2FA9A 4BLQA 2CEAA 1N5LA 4IDNA 1P62B 1E98A 3GLIB 3GJ7A 3HR7A 2ODNA 3WMGA 1A1VA 1HQYE 4MRSA 4EFLA 4DRZA 3B7GA 1Z83A 4G01B 2IS6A 2HDNB 1G6HA 4DT1B 3I5XA 5KYKA 1G41A 2CLCX 4II7A 1NG9A 1E1QD 2QE7A 3V4FA 4AYXA 4A6XA 1SVSA 2A5DA 3LRPA 3NHBA 3H86A 3KKQA 4ZV4A 4LJ4A 4GOXA 1NN0A 2O8CA 1W0KD 3LBHA 2J5XA 5FI0B 3VX4A 4B6FA 4EKDA 4NCJA 2BIFA 3AV0B 3P20A 3WHLA 4A2QA 3MD0A 2PBRA 721PA 2VTKA 3Q5EA 3UWOA 2BV3A 3VKWA 1XTIA 5CM8B 5FOWA 4FD2A 3VR6A 3ADDA 3GJ8A 3DOFA 1X1RA 3B1XA 2NZ8A 1ZM9A 2BJVA 3KX2A 4LI0A 4CT4B 3CLVA 3SFZA 1HA3A 1XFAA 1NVVR 2MSDB 4IOMA 1KMQA 2XNDA 1Z63A 3HU2A 3BS4A 3U7FB 4Q4AA 3FMFA 1E9FA 1N5KA 1BOFA 1KDRA 1N5JA 3K0CC 4TQUS 4XD7D 4G3XA 3HU1A 1XDBA 3U3KA 1TL7C 2N46A 3FWYA 1ZU4A 4NCHA 2BM1A 1OYYA 2IYSA 4HLQB 1JPNA 3T15A 3CPJB 3THWA 221PA 1PUJA 4EPRA 3CH5A 2OXCA 2IBMA 3R9IA 3SYLA 2B8TA 1OXUA 4UXHA 3UANA 2JJ1A 4QHYA 1VCMA 5G41A 5EJEA 1S3SA 1E9DA 1XXHA 2YZ2A 2WWFA 3SDZA 5E7JA 1VHLA 1VG9B 3TRFA 3BB3A 3PFIA 1G7CA 4IEEA 3WBKA 3CRVA 1CJVC 1Q1ZA 5HCNA 2OFXA 3IDQA 3AP1A 2ZYVX 2JLZA 2QU8A 3QKRB 4HYYA 1U2RA 4M2LA 3ADCA 3IIMA 2WOJA 4IVQA 1A7JA 1U0HC 4LPSA 4I1SA 1FOEB 1YU9A 4RFSA 2QENA 2QMHA 2WSMA 3SI7A 2IX3A 1P2UA 1S9HA 1Z29A 1VCNA 5E4FA 1LY1A 3C7KA 1SZPA 2GTPA 3CF6R 4PAOA 3Q85A 3T12A 1A2KC 2ZVQX 2OLKA 2XTNA 3K0CA 3PV0A 4EIWA 1VYTA 2J0VA 5C46F 4XIGS 2GCNA 2J45A 3K70D 4QJ5A 4BFYA 3NIBA 3K8YA 1CR1A 2CVFA 2OSBA 1W0JD 2JGNA 1TUEA 1L4UA 4EPVA 4EJSC 1HTWA 1N5IA 1WMSA 2WPDD 4C30A 3I3SR 2DR3A 2ZIAA 3CNNA 4V0KA 4Y0AA 2Z83A 2J7PD 4L9SA 4JIMA 4MH0R 1SXJE 2EQBA 2FG5A 2H5EA 3QE0A 2IA5A 2YVUA 3QVVA 3OESA 2FEMA 3GFOA 4X8LA 1G8HA 1T5IA 2YHSA 4KI0A 1LB1B 4KVGA 4C2TA 1E2DA 3OIUA 4OI0A 1CRQA 2O5VA 1AS3A 3DKPA 1OFHA 4OI4A 3EWAA 2ERXA 621PA 4S2EA 3TKLA 4BFWA 5FOUA 2REOA 1OKKA 1YR8A 1XEXB 1OPXA 4DC9A 2YWFA 4FINA 2OM2A 2PEZA 4LK2A 1EWRA 1F2UB 4TTQA 3SR0A 3ZZUA 3CKLA 4ILEA 1XCMA 5FR1A 3NTUA 1OIWA 3K9NA 5FPTA 3ADBA 2KI5A 1KI4A 5CYOA 4HB2A 4M4SA 3ZH9B 4FMDF 1XPOA 4HEJA 1OSNA 4LJYA 2BVNA 2ZRGA 4EJSA 4EPYA 3KQKA 5L3QA 5KNDA 1G16A 2A2ZA 4R2HA 4US2R 4Q1AA 3QF7A 1G8YA 3SU8A 3WP0A 3M4YA 3X1ZA 1N6IA 1CJKC 1QHIA 4MGKR 3GCGA 1DEKA 3H1TA 4URZR 4NMMA 2HF9A 2JLWA 2QGNA 4HATA 4BFZA 3AF4A 3IKJA 4YONB 4CEHB 2REBA 2BOVA 4QGGA 1Q12A 5F98A 2YOFA 4MKIA 4Q1FA 3N5CA 1Q3HA 2FEOA 1VIAA 3JZMA 4KSBA 3DEFA 4OJQA 1Z0JA 4DEYA 1E99A 3MG9A 1LW7A 1ZAKA 2EFDB 3QXJA 5AK0A 2NZJA 8OHMA 1GKYA 3FOZA 4TSFA 2HXYA 4DLVA 1CKEA 1G4AE 1ZIPA 2ZR7A 3PVSA 5BWMA 3AKDA 1FNNA 2R6CA 3T35A 3RDPA 4IFEA 4RD3A 3BBPA 1NLZA 3O8BA 1FZQA 3TR5A 3L82B 1TQDA 4PPNA 2R44A 5FL7A 4EAQA 1RVDA 1IJEA 4WXPA 1D6JA 1E6CA 3B1ZA 5H70A 4PZZA 2PMDA 3TLXA 4DSNA 2PX3A 3ZZ0A 3KUDA 3VKGA 1P2TA 4CEJA 1TQ6A 5HR5A 1X86B 3KJGA 4LHXA 2H1LA 1TEXA 4D81A 2IUTA 4PC1A 1C9KA 1R10A 4LBVA 3OAAA 4I99A 2ZYTX 2ZE5A 4JVLA 4MITA 2B8WA 3KJEA 5J40A 4JLNA 1E1RA 4W5WA 1OXTA 4WIAA 4DLUA 5EP1A 3HP1A 4QJ3A 2ZUCA 1RRCA 3TK1A 5FTNA 4A15A 5E3HA 4JYBA 5TMPA 3AF2A 3EARA 4U5XA 2CE2X 1H65A 1O3YA 1W44A 2V54A 2OFOA 2CHVA 2A5FA 1IQPA 2GEVA 3PCRB 3X1XA 1GKIA 3VHXA 5FUWA 2BJWA 2CMKA 5C4MA 2DFNA 2DFLA 3QXCA 1XJ0A 3MUFA 4D0NA 4CF7A 421PA 1GL7A 3AP2A 4OHZA 5L3SB 1T8TA 2QN6A 1SKYE 5IHPA 1KJYA 3EASA 2P3SA 3V00A 2VYFA 3I1FA 5EZ5A 1JPJA 2W6ID 4Q1DA 1II9A 2YWHA 4Z54A 5J4HA 2XXAA 1QHHA 1F2TB 1FFHA 4TL9A 2AFIE 4HZUB 4ACAA 2QZ4A 1EX7A 1GDDA 2ZITA 2BMFA 4E09A 1NF3A 1NMZA 3IGFA 3TR0A 4GL2A 3REGA 3FKSD 1Z3IX 3E2IA 1Z0KA 2PMKA 1DVRA 2X19A 1KI7A 1DG3A 4GP6A 4KSCA 3WMFA 4HUTA 2GHIA 2FN4A 2NO1A 4KO8A 4F92B 3A36A 4TMXA 5KUTA 1CU1A 2DYKA 1LVGA 4GMXA 4F7WA 3AVTA 1KMHA 3BERA 4KFSA 3D6TB 4AKGA 3VU9A 4U02A 1P61B 4C0KA 2RMKA 5A4JA 1Z22A 1E2PA 5H68A 2O0KA 1AA9A 2QROA 4F4CA 1Z5ZA 3UG6A 2QMUA 2CK3D 5DI9A 2GRJA 5SZKB 1UEJA 2ZJOA 4Q1BA 5KSZA 2GJKA 4OQNA 3IBYA 2X8AA 1D5CA 5K8LA 1US8B 3CF0A 2ORIA 5KPDA 4TYYA 2ZJYA 5JLJA 4Q66C 4EFMA 4PHTA 4OHWA 5BN4A 3IPXA 5CJ2A 4LDJA 3ND8A 1W4CA 5HZHA 1M2OB 1Z28A 1DAIA 2V7QA 1Z2CA 1FMJA 3BB4A 4JBWA 1J2JA 1A82A 1RJ9A 4OHVA 3ZVMA 2E87A 3PXGA 1H8ED 4PHHA 4V0OA 2KSQA 4I1UA 4MYUA 1U99A 2VP5A 4QBIA 1HEIA 2EYQA 3KQLA 3CWZA 4O2LA 4TL8A 4A0HA 2BBOA 4DCSA 5EUQB 1AQUA 2Z6VA 2FV8A 4OL0A 2RHDA 3BORA 2OCPA 2FE4A 3BJIC 3E5HA 3R7WA 4V02A 3CR8A 3RSLA 3KXIA 3ZGXA 5GADl 1P6XA 2OAP1 3SJAA 1PZNA 4B43A 4ZCMA 2X2EA 1UPTA 1SVOA 4JVNA 3ONWA 5BXQC 3EZ2A 3A4MA 1MRNA 3AM1A 3WBJA 4GP7A 3WYAA 1CR2A 1UEIA 2IYWA 2JAQA 2ZRBA 1P9NA 4WVFA 3SS8A 4TZ0A 5D3MB 2Z4SA 3KDSE 5EE0A 2HUPA 3OIVA 3JZAA 4M1TA 5CK5A 2CCJA 5B2ZA 2WHXA 2AR7A 3U4QB 1OFIA 4OK6A 4AKEA 1R8QA 1XMJA 5HKKD 2WAXA 4DSOA 1CJTC 4HUQB 1F6BA 1WF3A 2OT3B 1NMXA 1KK2A 4QNRA 2BMEA 2CL0X 4Q03A 3UPUA 3WHKA 1ZBDA 4G5OA 1TMKA 1KK0A 3NBZC 3BGWA 1XEFA 3KTAA 3LDAA 3N2EA 5B30A 5JCPA 2GILA 4ZI3A 3VQTA 2X77A 3T1QA 2W6JA 2YC4C 3LX8A 2D74A 3PQCA 4Q4HB 1UKYA 3OFND 2W0MA 4C7OA 2RKOA 2C9CA 4LRWA 4YMVA 1OT3A 2O0JA 4DCVA 1XEWX 4MDEA 1N2CE 2V8OA 3IHLA 2Q9BA 1E79D 4DJTA 5DNYB 3K0SA 3W3AA 1FQKA 3FHOA 3PENA 2O52A 3SJCA 2ZRJA 4OKSA 5JJKA 821PA 4C4PA 2IYZA 1NBMD 1TEVA 1C1YA 1WA5A 2ODEA 1P2SA 5FTJA 1IONA 2ZU6A 4IDQA 4LBZA 1UKEA 2GAAA 4M9XA 1Z08A 2IXFA 2JATA 3DPUA 1DAEA 2NO6A 3SE0A 2C2HA 2BBTA 5G3ZA 1ZM7A 4B2IA 3PEWA 4PQRA 3A1SA 4N0DA 3W6PA 3IIKA 1NMYA 4PO8A 2IUSA 2ZI9A 4R9UC 3AKYA 1E4YA 1FX0A 3TE6A 3K9LA 2QBYB 3ZD6A 4KCGA 4FCVA 2BC9A 4JJZA 4Q9JA 4B32A 4PZLA 5CITA 3IQWA 4MKGA 1V5WA 4NTZA 1TUIA 1D9ZA 4CRWB 1W1WA 1MKYA 3RAPR 3IEVA 4N0EA 2ZRCA 3PJRA 2QT1A 2F9LA 3H84A 3KUCA 2QTFA 3M0EA 4TTRA 2Q9AA 4O0MA 4Q7LA 4D0LB 4OI1A 4DSTA 1N0UA 2PLFA 3AH8A 1OFUX 1MOZA 1RW4A 2B21A 1MO3A 1M74A 3GPLA 2C78A 1G3UA 1GNRA 2P67A 2P2LA 5LB4A 1NL3A 1OLOA 1X8LA 1Z07A 4RCYA 4YMWA 4FXPA 1M7BA 1CULC 4KLZA 1X8KA 2RB4A 3QPWA 1JB1A 4HAYA 1YKSA 4RKFA 4G0NA 1OW3B 1YZGA 4WOPA 5DN6D 1BYUA 3THWB 1YRBA 4WBSA 2OEPA 5IF9A 1Y3AA 3GEIA 3KQNA 1SQ5A 2QTVB 4DVGA 1M1YE 3K1JA 4LHZA 1FTNA 3NWJA 2GXAA 2NO7A 3AUXA 2HLDD 1GL6A 2GZAA 3CH4B 1JJVA 4B3XA 3MSXA 2OLJA 1L7VC 3F3YA 5JMTA 3PEYA 4RVCA 4MGZR 1ESMA 3CRQA 1VYVA 3KXKA 3RWMB 4TLDA 3SHWA 4BFSA 1P3JA 1GZSA 1R2QA 2R2AA 1QF9A 4MRVA 2ZSBA 2CL7X 2GCOB 4JLMA 1IOZA 2RGXA 2V4ZA 2XITA 1G5PA 1SGWA 2C77A 2ZU0C 5DYIA 2O8DA 2D4HA 1SHZA 1Z6AA 2GA8A 1G21E 1P4SA 4DBLC 5L3VA 1V43A 3J81k 3RS2A 1NRJB 1NSTA 5F9FA 3CX7A 4NHOA 1KSHA 2A7QA 2FFBA 2BBWA 3OEED 1L2TA 3WP1B 3BC1A 5BYKA 3C5HA 3AF3A 1NSFA 2YKGA 2W58A 3B6EA 4TN1A 3L0PA 4V0ME 3MWLA 3A6PC 3ZZTA 3QXXA 1MV5A 4PPQA 1QZXA 3ASYA 3P1JA 4ARZA 2HYIC 2CJWA 3C16C 4HB4A 1QRAA 2R62A 1E1QA 1E2MA 4A2WA 1LS6A 3QIAA 4QRHA 2FU5C 1AK2A 1U0JA 2ZSEA 2ODBA 1XJQA 3T34A 3C15C 3A4NA 1E2KA 3KZ1E 5HTKA 4RD6A 1F5NA 4V0LA 4URYR 4AK9A 1U8YA 1IY0A 3PUWA 4N3NA 4BASA 4B2LA 1G3QA 5TXGA 2UVQA 3EZFA 4M1MA 4X8HA 3GP8A 1ZJ6A 4BGDA 4BUJA 1QHSA 1UM8A 1I4TD 4LHVA 4YXWD 4QM6A 2OBMA 2C8VA 4XVQA 4JYCA 1X8JA 2O8BA 1WCV1 1IY1A 2F43A 4HDQB 2V6IA 4LY6A 2IUUA 5AUOB 3R8FA 4XSHA 4UNSA 4HDOB 4LJ8A 4LYFA 3K70C 1OYWA 4Q01A 4BZXA 1SXJB 3K0AA 4YDSA 3VFDA 2D62A 1UADA 3T5GA 4GMDA 2Q6TA 5FUVA 4A2PA 4I81A 4FWIB 1E69A 4QXAA 4MRNA 1GILA 5E7MA 2ONJA 4EJSB 4RD1A 5JJIA 3VR1A 5L3QB 2OXRA 5K8UA 3LV8A 2JJ2D 1OH7A 1GTVA 4Q1CA 3UK6A 2O8EA 3SEAA 4URWR 1VIYA 4P31A 5DH9A 1W4BA 2OCYC 3TW4A 2J41A 4U00A 2J59A 3SFVA 3IIJA 5GJVC 1R5NA 5G40A 2XX3A 5HE9A 3B8HA 3DDCA 1KKLA 5GJWC 2VF8A 4FIDA 4KFUA 2OESA 3UMFA 4JSTA 1NY6A 4ITRC 4US1R 4PPGA 1YE8A 4LYAA 4K8OA 4KBFA 2A78A 2R6DA 4XVRA 3GQBA 5CB6A 1EGAA 4B73A 3KKOA 3P27A 1IN6A 1EESA 1YZLA 3B13B 3WRXC 3A1UA 1GIAA 5AJWA 1I2DA 1NJGA 5FBRB 2D2EA 2OV2A 1Z6GA 3DM9B 2FFHA 3U61B 3C4JA 2WICA 1W0JA 3HYTA 3OE7D 3OEHD 4NYJR 4UJ3A 4WXRA 4LHYA 1GP2A 1NN5A 1S3GA 4MUAA 4B6EA 1TF7A 4X8OA 1UDXA 2J7PA 2OBNA 1GG2A 2C98A 2WBLC 1XZPA 3IO3A 4JJKA 4LX0A 4TMZA 1IAQA 3F5FA 3CZPA 2QTHA 1KY2A 2VF7A 4Z1MD 2W2XA 4IHQA 5ANRB 1A5TA 2QP4A 2GAOA 4QBGB 1G5TA 3SJBA 4EQ6B 1AKYA 2C04A 4M1YA 2VRWA 4LOAA 2WWXA 1RRPA 4NL4H 1II8A 1EG7A 3CPHA 5P21A 1N6OA 1Q57A 1UAAA 2D3WA 4M22A 4OYHA 1NG1A 3U7HB 1BS1A 1Q22A 1XXHE 2PT7A 4XJXA 3QUSA 2ZRKA 1KO8A 4KAXA 4HB0A 2F1JA 2JJ8A 1S2MA 4WAUA 4W9MC 2VHCA 2QMOA 3EZ6A 1NVUQ 2F1RA 3DKVA 1KKMA 5C1BA 1LFDB 5JJLA 4TT3D 4WZBE 3Q7PA 1XPUA 2C95A 3W90A 5C2JB 3M1IA 3S1AB 2OUKA 3LQRA 3TNFA 3QENA 4AKHA 2WKPA 5AJVB 4PQYA 1F60A 1L8QA 2WWGA 1MABB 1UJ2A 4NYJQ 4Z51A 4TYQA 2QRNA 2IYYA 1AJEA 1K5DA 2XZPA 4ERNA 4ZCLA 1LTQA 2GVZC 1R0WA 4C0HA 1KO1A 1U8AA 2EVWX 4XTCS 1JXOA 4D4MA 1NNEA 4D80A 4AD8A 3SNHA 4OQFA 1RRGA 3UG7A 4AIIA 1SVWA 3FHCB 3ZIAD 4H1VA 3GFTA 4K46A 4DUGD 3A37A 2ZR9A 1ZC4A 2XEXA 1IJFA 2CDNA 1G20E 4ZIRA 3GEHA 1JR3D 1KHTA 2MMCA 4Q9KA 2ZSAA 3QKSA 4PANA 5TDHA 2ZJBA 1RFLA 2BDTA 3U6KA 1SKYB 2GWHA 2UZ3A 1XEWY 3DMDA 1U0LA 4AG6A 1YR9A 1DAHA 1NVVQ 1G1MA 4G5SA 4D4LA 4TZ6A 4OBEA 2G88A 1VTKA 2UKDA 4DCTA 3ND9A 4M9ZA 1E0JA 1QVAA 2QM7A 5DI3A 4H9GA 4BRWA 1BO6A 1W36C 2XJ9A 4YC7A 1AGRA 2G0NA 4RCZA 4CEIA 4NYMR 4XWOA 4OK3A 1SVLA 1QHGA 4XOIA 2ZUBA 3NDPA 4YQFA 1BMFA 4PQFA 2Q21A 1QHNA 3MMPA 3EIEA 5DYGA 2A30A 5FPSA 3TAUA 3U3JA 1RC8A 4C2UA 1BIFA 5KDOA 1GOTA 3W6NA 2X1VA 1G6OA 1PV4A 1IY2A 1P75A 4L9WA 3EC2A 521PA 1KY3A 3W5IA 1G5RA 1RJ9B 1TADA 1XZQA 2GBLA 3UXMA 4NYIR 5A5GA 4XWAA 3RABA 1DBSA 1CJMA 3GLFA 2B7CA 3FVQA 4BFTA 2R6FA 1OB2A 2HCJB 4WZAE 3RC8A 2J9RA 1DOAA 1ZRHA 5AR1A 1Q1EA 4TLAA 2RGDA 1SHKA 2B6HA 2JLYA 5E7IA 2GXQA 2ZI3A 2MSEB 1J8MF 5BN5A 3QEOA 2ZS9A 3U2QA 1OHHA 3K0EA 4TMVA 5H1YA 2IS4A 2EFHB 5CLLA 3ZLJA 4Q4LA 1MO5A 2C9YA 5FOSA 1MR3F 3U44B 4CGZA 4ZKEA 4FN5A 2KJQA 5B57C 3D7MA 1NP6A 1N0WA 2FDCA 4UXIA 5FUYA 2H7VA 3GFPA 4POAA 1Y63A 1ZCAA 2XOKA 1ANKA 1VG0B 4C9BA 3FYHA 2ECKA 2ZYUX 1IN5A 2ZTSA 3B9PA 4NYMQ 4C0SA 4L15A 2IYUA 1W4AA 3AVXA 2GKSA 5CK4A 1XD2B 2WV9A 2G0TA 3LH5A 2VHJA 3UMRA 2HXSA 5J47A 3QI2A 4QNMA 4AYTA 3KJIA 4AWXA 1LF0A 1I2MA 4QHSA 4LYHA 2V1XA 3FKSA 4Q00A 3RS3A 1ETUA 2RH5A 2J87A 3U5ZB 2F3TA 2GJAA 3ZDQA 3HPQA 3KTAB 1MO4A 3QPUA 2IXEA 2AXPA 4P4SB 2PJZA 3ZD7A 4NYIQ 4RZ2A 5TB5A 2FOLA 2LKCA 2WOOA 3I92A 4A1FA 3CB4A 4A92A 2B7BA 2FF7A 2OFWA 2Y8EA 2QSZA 5FBLB 5TY0A 2CCGA 5JZVA 3GLGE 1AGPA 4GZMA 1DAFA 2MMGA 1S0UA 3AP3A 5DHAA 3ZQ6A 5EE1A 3ECCA 4JZKA 1JECA 2A5YB 3OZXA 4L4UA 3B82A 1Q0UA 4URVR 3B85A 4B33A 1GRRA 4LC0A 4PSAA 1W4RA 4IRUB 4CYMA 2CK3A 1T4GA 1NN3A 2ZQ5A 2VLIA 2ZJ8A 3TVDA 1HE1C 1N6PA 3N70A 3NC1C 4A0GA 2H16A 2ZE7A 3THYA 4U7DA 3VNVA 4BLPA 1B0UA 5EE5B 5JSZB 1EX6A 5EXPA 4FCWA 2QORA 1IXRC 2F3RA 5KNBA 1ZUNB 5GVSA 3O8DA 4P4TA 1FUKA 1X6VA 2AK2A 4M53A 1YVDA 3TUZC 3GLGA 2RAPA 3OF5A 3WRYC 4DCNA 4ZKDA 1EWQA 1Q3TA 5CDFA 4GSYA 4TLEA 4A8JB 4B71A 2V1UA 1Z6TA 2F7SA 2V6JA 1H8EA 2MSCB 3CF2A 4KHZA 4ZI2A 5IRCD 4WW0A 4DB4A 4TTPA 4LV8B 1TF2A 2YOHA 4DSUA 1AKEA 2WWWA 2BHRA 3QY0A 3U7EB 4C0AC 4PZYA 3NBYC 1TQ2A 4JBYA 1P7CA 2ZRFA 4FMDB 1FNMA 2VSFA 5FOTA 1C4OA 3VAAA 4C0BA 4B3GA 5KNCA 3AVOA 3GJ4A 4I4LA 2ZEJA 3RHFA 1N3BA 2CL6X 1XJCA 3AB3A 2VO1A 1P73A 3K53A 1DELA 4IJMA 3QF4B 4YDHB 4HLDA 3ZVRA 1ZNXA 3VR2A 4BLTA 2VP2A 2XAUA 4NONA 4B35A 4B75A 2RCNA 5J4VA 1U98A 1XTRA 2RGGA 2XNSA 3CNOA 4UNRA 1MO6A 4JLVA 3CX8A 1EFTA 1JAHA 2ZR0A 4M1SA 5KU1A 4AC9A 1VMAA 4GT1A 1SVKA 1NVWQ 4TMKA 2BMDA 1OKKD 1E2QA 2EFCB 2ORWA 4P32A 2PCLA 2QNRA 3LLUA 4PC3A 1RKBA 3MRSA 3BIFA 4JVSB 1XTKA 1ZM2A 3A4LA 1UDWA 1OXVA 1SXJD 1ZINA 2K5UA 3L0IB 1ZUHA 3GD7A 5JS7A 3I62A 2ZUDA 2P5TB 1GRNA 2PZFA 2ATXA 3BB1A 1E2NA 2QQ0A 2REXB 3NH6A 1LNZA 1TX4B 3WMEA 3QXHA 4LHWA 3CONA 5J4KA 2Z4RA 2OAQ1 3W9YA 1NBMA 1AS0A 2VP0A 2JDID 3NEYA 4LZZA 2RGEA 3TQFA 4LJ7A 4DIEA 2PZGA 4PTLA 3R20A 3LVRE 1E9CA 4JKYA 4RZ3A 3QKRA 3CBQA 5FTKA 2GVDC 1S9DA 3LD9A 4Q4JB 4US0R 4URUR 3AVPA 5FI1B 4EDHA 4ARZB 1SKQA 3WNBA 3BFVA 3UWKA 3B5JA 5K8TA 3PEUA 3JVVA 1EXMA 2R6GA 2PX0A 4BLSA 1GL9B 1KI9A 1Z06A 5F9HA 1S4QA 3W34A 3BH6A 3NBFA 4TL6A 1TU4A 1RYHA 1KOFA 3RRYA 2J46A 2J0QA 3DMNA 2PT5A 3CRRA 4TWZA 2HF8A 3QKTA 5KOYA 4TLBA 2GXUA 1WBBA 3V9PA 1XPRA 4A82A 3THXA 3R9WA 3ZJYA 4XVUA 2P6UA 1E2GA 1VKJA 4F93B 2WIBA 1PVOA 2ZRDA 3NKVA 5FL7D 1WBDA 4DLWA 1FPMA 2O8BB 1M8PA 2Q3FA 3IPYA 2ZM5A 2R6AA 1CTQA 1WDTA 1PLJA 2G9NA 3UMSA 3GJXC 1KI6A 2VBCA 4TYPA 4F4JA 1YZNA 3BOSA 4UKDA 3A8TA 4BQSA 5CM9C 3CRW1 3K0AB 1BKDR 2ZRMA 3GLHE 4DLXA 1R0XA 3VNUA 2NPFA 2FSFA 3E1SA 5JBQA 2IYQA 5KPJA 5DO9A 5JFGA 2XSZA 1K8RA 1M6NA 3EPHA 2ANCA 1LF5A 3LY5A 4V0NA 4DXAA 2QQEA 5HZKA 1WB9A 1XEXA 4FMCF 2HLDA 4JL6A 3SBDA 5JWHA 1AN0A 1JALA 2CNWA 2GNOA 1TU3A 1KAGA 1F2UA 4JLOA 1UBCA 5F3WB 1XF9A 4BEBA 4HLUC 1AM4D 2VHQA 3RS5A 2WJYA 3AKEA 1G7SA 3QXSA 1X3SA 1CIPA 2GDJA 3EIQA 3NXSA 4ASUA 1OE0A 4ACBA 4EUNA 5B64A 3G0HA 3CPEA 1ZMXA 3GLHA 4LWZA 3KB2A 2D7DA 3BH7A 2QT0A 2LKDA 4URXR 2RGAA 5DLQC 1Q1QA 1WE2A 4RY2A 3B78A 3OEEA 3Q72A 5FOVA 3HYRA 3K0FA 3SQXA 4B3BA 3CX6A 5FH9A 2RGCA 1GNQA 2YJTD 4Q9HA 2O8FB 1KNXA 1KGDA 2A3RA 1NIPA 4MYHA 2BEKA 1NLYA 2JLVA 2ZETA 3AVQA 3OHMA 4L5BA 1OH6A 4OJKA 1NIJA 3GJ5A 1GWNA 4CEHA 4UNNA 5HPYB 4AKIA 5BYJA 2P65A 1NKSA 3T5DA 5ELXA 2C9OA 1FW6A 5KDLA 4F4IA 4MDFA 5FBWB 4JLPA 3WNDA 2R9VA 1RYFA 4GDFA 3MWKA 1T6NA 2ZJAA 4LV5B 2ZI5A 1XWIA 3VKHA 3K09A 3W5JA 4AYWA 4HLUA 4M21A 2VHTA 2C5LA 2O8CB 4JL5A 3U6BA 3D8BA 5HCIA 1HH4A 3EZ9A 4G1UC 1KZGB 4PSKA 2H8KA 3P32A 4P3YA 4Z8YA 2CCKA 4G5GA 5AUNB 1EFRA 2FMXA 5E95A 1JEEA 1E2IA 2G1KA 4LJ9A 4LPKA 4A9AA 3EPLA 2ZI4A 4MUBA 3SQWA 4D82A 2WJJA 3LFUA 5FFMA 1Z6YA 4LBWA 2BWJA 3MWYW 4Q4AB 1ZNYA 3PEVA 3RANA 2IC5A 1E94E 5LB2A 1OF1A 1DO0A 2WIAA 4Q9IA 4O2RA 4DLTA 1M7GA 2FFQA 4MYTA 3BK7A 4QG7A 2IL1A 1W47A 3LBNA 1G17A 2Z0MA 5L8VA 2FGJA 2HJVA 1E2EA 1P9RA 4M1KA 1OB5A 1KZ7B 4JSYA 3RYTC 2NMVA 1NN1A 5GVRA 1N6KA 1NI3A 4C3ZA 1E9BA 2DFKB 1CS4C 2IYVA 4DWJA 2BKEA 2AKAB 3L8YA 2QUZA 1XXHB 3HWSA 4A6PA 1G7RA 3KFXA 4RJLA 1LV7A 1QHXA 1S1MA 3GJ6A 1EFCA 1XD9A 3M6AA 5C4GB 1ODFA 5L3SA 3O8RA 1T0HB 4NE2A 4NPHA 4Q7JB 3B1WA 4PC2A 4ZIRB 3FKQA 2JASA 3IHWA 3SC3A 2VSXA 4RFSB 1EFUA 2VP6A 3KB1A 3QKSB 2IXGA 3ICQB 3T61A 4Q02A 4DCUA 1H8HA 3AKCA 2N1BA 1VG1A 3TUJC 4EPWA 1E2FA 3X1YA 1AZTA 1XB2A 1D2MA 3T1TA 5CJPA 4HZUA 4NDZA 1G4UR 2XTMA 4BZQA 1XMVA 2CBZA 3OE7A 1IN8A 1W49A 3QBVA 4I1VA 4TMTA 5KSYA 1O87A 3E70C 1E3MA 2GESA 1VYUA 1JJ7A 3QG5A 3LAWA 2DPXA 4ZPXA 4QFMA 4CEIB 3RRNA 1CLUA 1E4VA 2QPTA 4QJ4A 4YLGA 1J99A 2WJVA 2W6JD 2F9MA 4NP6A 3DHWC 5C18A 3B1YA 3LXXA 4QC2A 1CP2A 1RE0A 1ZYUA 3EAQA 4LBYA 2WKRA 1W0KA 2KBEA 1KAOA 1JBKA 1SVMA 4D25A 1IXZA 4D2IA 3KQHA 4TL7A 1K5GA 2FWRA 3ZQJA 5JWOA 1CR4A 4HI0E 4WZ6A 1ZM4A 2ORVA 1QG2A 3BE4A 5SZHB 1VCIA 3IUYA 2PH1A 4NH0A 4XSGA 3RSOA 3BWDD 4UXJA 1YR7A 2EWWA 4MRPA 1A2BA 4DLZA 4LUCA 4CW7A 1OIXA 4AURA 4RKEA 4EPXA 3PUVA 4XD7A 3EA0A 4GOJA 2GF0A 2ZAMA 3QBTA 4TT3A 2IWHA 2GF9A 1P2VA 1XU4A 3WXMA 3I32A 1W36B 4IOKA 4L16A 4P33A 5FR2A 4H1UA 4AI6A 2AWNA 1D8TA 1F48A 5TVKA 4D0GA 2CXXA 1VDZA 2PEYA 4GI7A 2G83A 3NHAA 2ZI7A 5CIQA 4KV9A 5IK2D 5FPHA 3THOA 2EU8A 1R0YA 4JS0A 3IO5A 4ZO4A 3RNLA 3QQ5A 1CF4A 4C0QC 4F91B 3ZIAA 1PLLA 1QBKC 2NIPA 3ASZA 4E03A 3ZVNA 3SYNA 1DPFA 4Q19A 2VL7A 3QNUA 3HDTA 3A1VA 3TIFA 1GVNB 3OIWA 3TGPA 1KYIA 2KE5A 2DCUA 3U3RA 3BFXA 3CNLA 5FOXA 2OO7A 1DAGA 4GRAA 3AF0A 3FGNA 2TMKA 2GJSA 4PAQA 4PX9A 3SZRA 1COWD 2AD5A 4GOKA 3VX3A 2WM9B 1HURA 1NJFA 1KTVA 2BCGY 5TARA 3R8CA 5KHOC 2VHUA 3AQ4A 2JLQA 2WSSD 2XJ4A 2DY1A 1S1CA 3LNCA 3VR5A 2PJRA 3WYGA 1KI3A 2G77B 3C41J 1DO2A 4R7ZA 1M34E 2ERYA 2JCSA 3DZDA 4BLRA 4TYWA 3THYB 2WPDA 1IXSB 4DB2A 4Q4HA 3RLFA 1Z8FA 2G1JA 1Z2AA 4D26A 3BXZA 5EXTA 1GSIA 4GZLA 3AGQA 4XH9B 1YHNA 2ATVA 2EYUA 2HEIA 3BH0A 3W8RA 4BRUA 2ZE8A 3I73A 1OH5A 4Q5IA 4CIDA 4XWKA 3GLGB 1CRPA 4JLBA 1GNPA 3MJHA 3K9GA 2VIIA 3X2SA 1HT2E 1K6MA 4CEJB 1KI2A 4IOJA 2CHGA 3EX7C 1MRSA 4QL3A 2QAGC 3P4XA 1OH8A 2PZEA 1PUIA 1FP7A 3EW9A 4KYUA 3BRWD
chains in the Genus database with same CATH superfamily
1ST2A 2REQB 3HBAA 2GZDA 2H08A 2QI9C 3CPSA 1ZQ9A 2A6PA 3LZCA 3NORA 4XGRA 4F1KA 1PL7A 4GBMA 4TTAA 2ZWOA 4MJ7A 4Q4CA 2EP7A 1CEXA 1S96A 5E3IA 3N3BC 5HKBA 2A9VA 3A28A 4EY5A 1RAGA 2WJHA 3QMVA 1GARA 4KYTA 4TMFA 4R1LA 4YJFB 5HVNA 1I7PA 4LYGA 4H7HA 2NZYA 2FPOA 3TRKA 2ZDHA 4G81A 2RGYA 1GPKA 2WF9A 1X9GA 4KNYA 2J6CA 4WFKA 3T9FA 3NOVA 2QN7A 3F5QA 3EG9B 3Q10A 3WV5A 4F6LA 2NO9A 2JEZA 4IZHA 4KQFA 3D0KA 2BDUA 4HEA6 4KBGA 3A4TA 2MIIA 3RB8A 2Z6UA 4LMPA 5TMDA 3GFGA 4JQOA 5M2QA 1KO4A 1ZC3A 2SBTA 2V7WA 3IURA 2JI9A 3UKDA 3G3EA 1Z4OA 2J3EA 1R1DA 4EELA 5IC4A 4N65A 2GBLC 3WAGA 2QAGA 3SF0A 4NOJA 2QPOA 3CO5A 1KYTA 3FTDA 1IN7A 2J0UA 3INYA 1OIVA 4LMAA 5HA5A 3TLGB 3V7WA 1FUUA 4QUHA 4RJTA 1GFZA 3BWMA 3U3ZA 3JQ8B 5AKXA 3Q7QA 2PJRA 2X3YA 1ONBA 1GUAA 2JBAA 1PBNA 1SNYA 1VSQA 1Z4JA 1ZUIA 1KDTA 1VSVA 3JAWA 1RYDA 3FAKA 4G4SP 2J3HA 4DJAA 2Z3ZA 3GQVA 2HC9A 5KVAA 1UZLA 2QOEA 4YJ3F 1UM9A 3GH3A 3FWKA 1RZRD 1P44A 1NMSA 2PLNA 1TC1A 1U90A 2JI7A 3Q8XB 2I34A 2J3JA 4HWRA 4KXFB 2G4VA 4FZJA 2DTEA 2NW6A 5KOHB 3HKDA 1PZFA 4S1VA 3IRUA 1LBIA 4O25A 1IN4A 1CSEE 3OQ6A 4NJEA 1XDSA 4C6SA 3AUYA 5B55A 1YJ5A 1FY2A 3K7EA 3KJHA 3HJNA 3INTA 5HJ5A 1K8YB 3WTBA 2BKXA 4FUQA 2DWOA 4IWXA 1XQYA 3DPIA 3JXEA 4TXMA 2XADA 4DHEA 1M2EA 4LOHA 1XNJA 4KN8A 1Q17A 4E2XA 2NSYA 4AJIA 3SF8A 4FFOA 2FLWA 1J1UA 3U16A 5FT9A 1F6DA 4FFBA 2H17A 1BMQA 1NULA 3L5KA 4TXHA 5A04A 1CY6A 3GA5A 4X7PA 2ROQA 3PC3A 4WJKB 3WLRA 3NIDB 2WTXA 1PNRA 4WFIA 1JAIA 1B2LA 1P9WA 2C4WA 2Q27A 4LF8B 1KP2A 2NVBA 1C3XA 3F5SA 4J0QA 1EM8A 2D2FA 3LXUX 4HMQA 1A8PA 5TV2A 2PL1A 3QMWA 4ZAVA 3FPFA 4O3MA 3FR8A 2OYRA 3FHJA 3B6ZA 1LJLA 3PCXA 3FFWA 1HNNA 3IIIA 4Y9DA 5FNZA 4K0RA 4MQBA 4UBLA 4CM1A 3RC9A 4H1HA 4M6WA 3Q7EA 2NACA 2YOGA 1EBBA 5EWMA 3U19A 4K6CA 3UAOA 2AJTA 5JI3E 2OTCA 4IHAA 3TVTA 3E9EA 1EP1B 1WLSA 4NCKA 1KZYC 1YMUA 2NU6A 1DU4A 4HAIA 4PXAA 1EJ2A 4PYIA 5KTKA 1Z7EA 1TKRA 1EFPB 1Q14A 1WJGA 2W6NA 3K0HA 4IH9A 4EVIA 5ADVA 5INTA 3W6ZA 3FMPB 3ETNA 1KQGA 3P52A 3TAHA 2FX2A 1YB5A 3ENQA 5A05A 3LW8A 2K2QB 3FTFA 4MB0A 5A03A 2JLUA 4HV4A 1C1DA 4YQZA 5DHUA 4DDUA 4BLWA 3VR6H 3MGCA 1IQUA 2NQTA 2OL4A 2V7XA 5F78A 4DZTA 4MWTA 2R8RA 3G5MA 5REQA 2RCYA 3DA8A 2WMNB 3OI7A 3ZI4A 4C6TA 3AI1A 1GSOA 2O7SA 2XA2A 3HKCA 4DDKA 2WT4A 2ILTA 5KQRA 4LC1A 4WHMA 3S6JA 4DDTA 4QASA 1J8DA 2FEKA 2Q4RA 3PNMA 4ZP1A 4OOEA 1NI4A 3DT9A 3KXDA 3I4LA 3OOEA 3Q2OA 1USUA 4I4TB 4J16A 3UGKA 5ALGA 3E0XA 4G37A 2XF2A 5MN5A 4F84A 3FPAA 1G5QA 5CDFE 4LWQA 4QKQA 4MDYA 1I4OA 5EZYB 4JDPA 1HM5A 1NQTA 5D51S 5ER6A 4ZRDA 3AVVA 3RS7A 3OQJA 4CQNA 3R3XA 2OCBA 5BWCA 1N2XA 2QRGA 5A5FA 1WVIA 2GFIA 4R5HA 1GY8A 3G2IA 1ODTC 4MMXB 3LC7O 2ZANA 3EOBI 5E4YA 3EGCA 4GL4A 3UIEA 5CA1A 1E18A 1LRJA 1BDMA 3E23A 4Q7KA 2V9PA 1HEUA 4I14A 3WWEA 1B6RA 3DBRB 4DNQA 3BSWA 5K0FA 2P9HA 5CLGA 5ERXA 5H0IA 4BAUA 4LXGA 1J2EA 3PHBE 5KTYA 4ZI7F 5JDIA 2L19A 4LQCA 3LXMA 1LEHA 3IUSA 2JI8A 3FMGA 4F5WA 5A5VA 1VPTA 2FCRA 5KVSA 1WSAA 3F71A 4R16A 2GASA 3DWIA 2Q0SA 2WUDA 2LRHA 3FGPA 3VGJA 5ADWA 4WRRA 7YASA 2GA9A 1KMMA 2B1QA 121PA 1MFZA 5H3HA 1YQWA 3S3TA 1P7VA 5IS2A 3FCEA 2GJ8A 4YP6A 2V7EA 3ETDA 3DFKA 1QP7A 4KYIB 4FSXA 4AUKA 2JLXA 1J9GA 1N1MA 2CXSA 4IDBA 2XOEA 1V6SA 2QYTA 1WZUA 2Z57A 3W2HA 5BOSA 5THKA 3QEJA 3K0KA 3BXOA 2P6PA 2Q4EA 1PZGA 4TQ9A 3OIYA 4ND4A 3ZHZA 4HN2A 1NXPA 2NQ2C 2G08A 4DDMA 1XCLA 2P0AA 3KL4A 4G36A 4JL8A 3MMSA 1THMA 4P81A 3MJ4A 4HEA1 4INAA 4F86A 3M6FA 2FPMA 1VKHA 1ZM3A 1O8BA 3DM5A 3GBPA 3LXRA 4LVNA 1P2DA 4UQOA 2NU8B 4B5LA 2EJCA 3V1TC 1T1IA 3IVXA 2RGWA 3VR3A 5CB4F 1T2NA 1T3SA 1L4FA 1WU8A 3A9WA 5B6PA 4CUZA 1XELA 2D1TA 4KJZA 2PXCA 1YL6A 1BRTA 2VLBA 2FNAA 1F3LA 4EBFA 4Q3CA 4CL3A 4DV5B 2OOSA 3DAOA 4PO3X 3SSNA 1WETA 4Q39A 1QNFA 3RC3A 1GVHA 5F2OA 2YC2C 3ZX5A 4UHCA 1OHHD 1T9HA 1UOOA 5K2MA 3EZXA 1N0VC 5K0ZA 4CGZA 2NUTB 2C9BA 2ZQYA 4ZVPA 2BGJA 3G9QA 3OJWA 1RNLA 1TRHA 4YJ2A 3IT1A 3FNHA 3LCRA 2IP4A 3G68A 2PA3A 4B48A 5BQ5A 3EEBA 5IUJC 1MIOA 2VSQA 2HRDA 1OTHA 5IBCA 1C80A 2PUWA 1USIA 2PFGA 2PZ8A 3HY4A 3BWYA 3FZGA 4Q37A 3ZYCA 1KJIA 5KC8A 2IHTA 3MW8A 5K3EA 1PTKA 4BKOA 4JT4A 2OZVA 3D8NA 4IQ0A 2I6XA 4TWRA 4G26A 1O95D 5I7FA 2OR3A 3H2ZA 5HHTA 4D3FA 3ZK9A 1W52X 2XTZA 3REQA 5AUQA 3IILA 2JAWA 1RTTA 2M9MA 3E9DA 3BPSA 4R2WA 3W79A 5KNDH 1E6WA 3KQUA 1T9AA 2EGHA 2GZ2A 3Q0EA 1SD1A 3TPZA 4NCIA 3WRVA 2P9GA 4MQ6A 4LJKA 3A0UA 1JSRA 4KDEA 1C4XA 2CJWB 2TMYA 1SCUB 3KV1A 3KLOA 4ESOA 2ZAOA 3FPJA 4G07A 4K7JA 4H7DA 3IEPA 4JBHA 3NW9A 2E82A 1O54A 3ES9A 3EWNA 4WLFA 4XTRA 1I01A 4BLVA 1X14A 4B87A 1JFFA 2G71A 5IPFA 2X0RA 1CJUC 1UFKA 1DC8A 3EWSA 1AGXA 3LX4A 3NH9A 3OJ0A 4BP1A 1GZUA 2D0DA 3URMA 4J1SA 3WYCA 4U63A 2QAJA 3HVUA 4U9IS 1K5HA 4IW3B 4J4TA 1JJAA 3N6XA 3PG5A 3OTWA 4ZK6A 3U48A 2BI8A 4V38A 4TSFD 3GV0A 2FHPA 4TMWA 3BD6A 4REQA 5FBQB 2X5NA 1AHIA 2FPPA 3G2JA 2RGBA 2WD8A 3IH5A 3QMMA 3AUJB 1KSGA 3D2AA 2C8KA 4IEIA 4JLSA 4Z3KA 3B2EA 5KYXA 4OEHA 2FSUA 4ER3A 4AROA 4NHEA 1IRXA 1NOIA 4UUNA 4XZ3A 4CR8A 5L51A 1MHTA 3P9PA 4MGEA 5DE3A 3W6OA 1YHZA 5BUQA 1OBOA 1M6EX 2F43B 4YT5A 5KYYB 2IEYA 4HTAA 5C8ZA 2GAFA 2Q4TA 1KAMA 3PRJA 5F4ZA 5JRDS 3ELUA 4GQBA 3OWOA 5JYBA 1Z36A 4C0LA 1DQPA 1JG6A 5ILQA 5JC1A 5DN6A 1YOVA 2CKMA 2H92A 5MN6A 2NTYC 1CQXA 1PP4A 3CLTC 1X1TA 4G4IA 1C5KA 4RD2A 5A1JA 4AJLA 5B1IA 5ITVA 3WA7A 3BA1A 4FHZA 1JQKA 2WT8A 3I2JA 3CISA 3BEOA 4PC6A 3A1TA 3OT5A 1Y80A 3SC4A 2OXEA 5FEUA 4YJHA 5COQA 4XGKA 1LS1A 1T0UA 3R9KA 2VP3A 3VAYA 3Q7TA 1J42A 5JOQA 2J0SA 4F46A 1JYEA 4GW3A 1ZD1A 1ZDMA 4Z6KA 4B2YA 2C4UA 5L9AA 4YJ3A 4N7MA 2A33A 1XQXA 4B17A 5A9SA 2VQ6A 5C80A 2OCAA 2PWPA 2OQRA 3NG1A 4Y1RB 4DV7B 3T4EA 4BMSA 1RAFA 1ESZA 5JAQA 1R9NA 2EZ4A 2M6LA 1NLFA 3TMKA 1YVEI 2G76A 4RFVA 3V2HA 3X1DA 4PLVA 1SU7A 2FH5B 3SKYA 5JRZA 2AEJA 1DAPA 4TX1A 4BVFA 2XEDA 4H08A 5B3JA 2ASEA 3DSRA 2V03A 1RJWA 1AURA 1COZA 3T3HA 2AXNA 4O6VA 1YZ3A 5FJJA 2QHXA 2R68A 4IQ8A 3L2OB 4LSZA 4OSEA 2NT3A 2WU8A 1YK0A 1LBTA 1ODSA 1TI7A 3K70B 7AT1A 2QUJA 3PYMA 5EI5A 1ZOLA 4LHEA 3C1TA 4PAWA 2RIPA 4NAHA 1IH8A 2OGUA 3A25A 2R8PA 3N0XA 3VR4A 3OM9A 3ODPA 2JGDA 2ZSDA 1HQDA 3DZ8A 1Z7GA 1MQSA 3RK4A 1IM2A 1N9ZA 4LJ6A 3VPSA 1Z0AA 2PRKA 2QE6A 3QFTA 2V7BA 3MJRA 4NU0A 1XU9A 4EKEA 1UPBA 3QOWA 4Q9AA 4OHRA 2CUNA 3CEJA 4CMCA 1SHLA 3V1MA 4Z1OA 5LQDA 1LI5A 2NVOA 4K9PA 5GPBA 5ABPA 1NW9B 5KDDA 3PITA 5KMGB 2BGGA 5AVYA 3NP7A 3H4MA 3WWCA 1L4YA 1OXXK 2AOUB 3LWDA 4P0QB 3P2EA 2UZAA 4JLKA 5JI2E 5F2EA 1EPUA 5JSZA 1M34B 2DE0X 2O2ZA 5T41A 2NGRA 1HZZA 2ZB4A 1E32A 4A16A 4I5FA 4H3HB 1IHXA 3NT2A 2W71A 3D31A 4HMOA 3ZCTA 2RHLA 2ZRNA 4LIPD 4JB0A 2NTVA 4J0HA 5AP9A 1GTZA 1CUAA 4MGYR 4W5JA 3DLCA 4B4OA 2DECA 1EUCB 1MEOA 2Z8ZA 2H07A 3NGXA 2WJPA 3LBFA 1RKQA 1X15A 3MEQA 5FBKA 1GFWA 3TNJA 1AQNA 3PC7A 4OQZA 4ANFA 4JJFA 3WOVA 1G55A 1JP7A 4E3ZA 4L85A 3ROPA 3CUVA 1IZYA 1RP7A 2X7JA 4NG4A 4K2HA 1GGFA 3C14C 5AVKA 1UBGA 3I76A 4ZD6A 4IFBA 4ER7A 5KB3A 1IL0A 2M98A 1OVMA 1M1UA 3HH8A 1K2VN 4FW9A 1VKRA 1MV8A 1OI3A 3O4RA 4G4JA 4PRLA 5FHQA 1K08A 3ZWPA 2W70A 5IJ0B 5K0JA 2YV5A 4K9DA 2Q5QA 2V7GA 3GFVA 4W9NA 2JBWA 4I1YA 1Y8AA 2UVPB 3TQCA 3B7PA 5H9WA 5E6UB 4I2NA 2BR4A 4YRPA 3SHFA 2E18A 4OKNA 4ZOBA 2J1LA 2YFHA 2P91A 4ENSA 3R9XB 1WHTA 1WW2A 1NJ8A 1CYEA 1SVIA 5JS6A 5C51B 2ZROA 4BO1A 1UIRA 3JQBA 3LLMA 4FZ3A 4JEUA 4ZDWA 1ZI8A 4B8ZA 3AVWA 1SBZA 3QBDA 5IN5A 4PIVA 1ZNZA 5IABA 3L7DA 1ODCA 1P2GA 4ZI7A 1RJGA 2CLLB 1M2KA 3GDWA 3U60B 1JFLA 3B20A 5HGXA 3UV3A 2XWJI 1XL1A 5JG7A 2ACWA 1IPHA 4FX2A 1N6RA 4C7BA 3R7DA 1IVNA 2C84A 3PA8A 4XW2A 2NP6A 2C4VA 2I1QA 4UMFA 3NHUA 3PI7A 4ASUD 1XR3A 2GT1A 1VE3A 2QTWB 3KKPA 1AKWA 1LPSA 3H2YA 3PFHA 1ZVKA 4MS3A 4BKPA 4Z8XA 3C3CA 3O4FA 1B43A 1BU8A 4MW2A 5G4KB 4RADA 1VLJA 2B7LA 3E8SA 1CP3A 3ZG6A 4Z1MA 3E3AA 3QPBA 2ZS7A 1LC3A 1PEYA 3GNLA 4AO7A 5BVGB 3DGFC 4JI0B 2VAWA 1D1PA 4XE5A 1R0KA 4CKZA 1EWVA 3C8HA 3E5RA 2UUAB 3T1VA 4F2DA 1I10A 3CZAA 5EHXA 3ZOZA 1V35A 1LLDA 4L95C 5L7TA 3D3WB 4QRIA 4YRLA 4LY9A 5HJEA 4HH0A 4N82A 1OXKB 5CB4A 4EWLA 3R5KA 2VP9A 3AFNA 3JYOA 4LY0A 3WLTA 4BO4A 5F7XA 2X4IA 3R5XA 3FRHA 4DIBA 1VJDA 1Z0DA 5U4XA 3UJ9A 2BKUA 3NVKI 2CLDX 1E3IA 1US8A 3ADKA 1CUJA 1ZJYA 1YCGA 3SSAA 1EXVA 1F4VA 2IHBA 5KO2A 2O59A 5HFJA 1W59A 2ZWPA 3M9LA 1ZWKA 4RZXA 3C3MA 4Z49A 4ZYZA 3L0OA 1R8SA 2FEWB 2OXFA 4IF6A 4MW4A 3OHPA 2FGKA 2H5IA 2YL2A 4R1PA 1VJ5A 2I3BA 1FS6A 4MKRA 3SBXA 2PUFA 5JS8A 2CSXA 1NQXA 3DYIA 4F2GA 1GN9A 1PYDA 4IAOA 4K2AA 2C1EA 2MT9A 3I01M 5SV2A 3VC7A 3OC0A 4OGFA 4V0RA 3T06B 1DTSA 4Z4FA 3GGDA 4GICA 1ZJ4A 1A7AA 1EFRD 4MV7A 1AIPA 2QYHA 1PG5A 2GZHA 1FFGA 3CKYA 3WFIA 1QP8A 4EB3A 1DSSG 1ELOA 3N2GB 4QYTA 2PSFA 4DM4A 2XGJA 1HE8B 4XYMA 1OLSA 2VBFA 1ZXBA 5J4LA 2E3JA 1AZSC 3L07A 4DUGA 5C7YA 1VPLA 5ICMA 2D5LA 1H4TA 4I5DA 5LDHA 4IMRA 3IA7A 1JQ5A 2BEWA 2OO5A 3FYUB 3D6AA 2I65A 4HSEA 5JD6A 4PLPA 2O3UA 2ATEA 2GQ0A 1ZIOA 3CZ9A 2OHGA 3VVLA 1ECJA 2Q9CA 3U4QA 2BR5A 3M6MD 1L6IA 1JPUA 4KPYA 2JHPA 4HUQA 4HFNA 4MICA 1U9IA 4BS9A 3GJ3A 4EHIA 1E61A 4TV8F 4RLSA 3MSCA 5A71A 4L28A 2GAIA 2AGVA 1J21A 1P9OA 1Q11A 4FYVA 5AVRA 4BWYA 2K2WA 3LCCA 3THSA 3T1HB 5CW1A 2OILA 1Y8QB 1R6VA 2LGJA 3DBIA 2VPZA 4M0MA 2DR0A 5DU2A 2B1JA 5JAPA 2BCJQ 1B3RA 3G1UA 1P4AA 5LD2B 1QO0A 1U2SA 3O4VA 3MN1A 1NXVA 1LK7A 3M6WA 4LNHA 1BWRA 2Z43A 3C4VA 2VJAA 3JY6A 2K87A 5GZ6A 2QXTA 4JLWA 3BYZA 1HFEL 1OWMA 5LP1A 1DIGA 1KJNA 2YVAA 1OLXB 5UKDA 2SICE 2FA9A 3PFNA 5AVSA 4W5RA 1P62B 1E98A 2G7MC 4IUDS 4PYKA 4GPZA 3ZIAA 1JZTA 3NCTA 3RBXA 4CM3A 3UA3A 1HQYE 3C5WP 4MRSA 2QMYA 1UDRA 3D7KA 1PW7A 2UUPA 1Z83A 3LLCA 3C7CB 4BOYA 3KLBA 2HDNB 2OHHA 2OD7A 1EVIA 1X7DA 4RKWA 4ZAYA 3T7AA 1QTRA 4DT1B 4X1KA 2CLCX 1SOMA 3TX6A 1YK1A 5CIYA 3KAQA 2WMDA 4HDSB 4A6XA 4AYXA 2ZTVA 3G2MA 1SVSA 2QDXA 3NHBA 3EDRA 5F33A 1W93A 4AJ4A 4LMBA 4ZV4A 4LJ4A 4GOXA 1MF7A 5B6IA 3RF7A 5FI0B 5ALZA 1J56A 3VX4A 2BT4A 1YJCA 1NHGA 2Q41A 4JA0A 1UXKA 4NCJA 1NM5A 3P20A 4L5YA 1F5SA 4A2QA 2QN3A 2PBRA 3MD0A 3VR6A 5C9ZA 1E7QA 1F2DA 4R2LA 3BMCB 3OC6A 3CJTA 2AS0A 3V4ZA 5FWYA 1A8QA 4LI0A 3RI3A 3OECA 4F9GA 3NDRA 8ADHA 3HL0A 3SEZA 1LD3A 3OSUA 1NVVR 3CLUC 3L6UA 1QZZA 2QL7A 4HNHA 4MPDA 5FNVB 5IM4F 1Z63A 3H8WA 2R4UA 3UHAA 1VCHA 5ICGA 4XYLA 2J5KA 1MXFA 1BOFA 1KDRA 2OMEA 4IV5A 2VYNA 3A05A 2CJPA 4KTVE 4WUVA 1IHOA 2AJDA 2BHSA 2GZ1A 3HU1A 4NV1A 4BVLA 4EGCB 4F60A 2K7ZA 1Z5UA 1XDBA 1ENZA 3O7WA 4U2CA 2ZSJA 2N46A 4KVZA 4AW9A 2BM1A 1ZGAA 3KE9A 4ABTA 1QP0A 3AL0C 3RHTA 3CPJB 3LYLA 3THWA 5LJIA 2FXIA 1B6SA 2QLTA 4O5OA 4QFBA 2B8TA 1L8LA 3D4LA 2ECQA 2QTVA 3LVBA 4UXHA 5ESWA 3SY8A 5U9CA 1J00A 1S3SA 2ZBUA 1NQWA 1RC0A 3PHCA 3QLUA 4PLYA 4CM4A 4MDHA 1DGQA 3SDZA 4KNVA 5EQFA 5E7JA 3DZBA 3TRFA 3GBSA 4JP2A 3CG4A 2DAPA 5AW4A 3WBKA 1U0GA 2WE8A 2WAOA 3IDQA 2XKKA 1HE5A 4OKIA 3AP1A 3HFJA 4J7CA 3E8XA 2JLZA 1XVVA 3VJLA 1ULSA 4UU8A 5AHXA 3MNFA 3TQOA 4EA9A 2QX8A 2WOJA 1U0HC 3FZYA 5K51A 3WADA 1M6VA 2EIHA 4RFSA 5F3DA 4BNTA 3SI7A 3C1OA 1JHVA 1UWKA 3B3AA 4CGYA 4H1WA 1VCNA 4U7HA 2OYSA 5ED0A 1LY1A 5AOBA 3DNMA 3CF6R 3H3FA 2FZKA 2WM2A 4PFJA 4L76A 2ZVQX 4JC5A 2OLKA 3K0CA 3PV0A 4MQFA 4U8GA 3VOBA 5BNIA 4H16A 2H2IA 4I55F 3CR3C 4RVGA 4RZSA 4EIWA 4YMLA 4LF4B 5IXJA 4BVEA 4ODIA 1WDWB 2CHFA 4XIGS 3K70D 2XDWA 4QJ5A 2PRZA 3NIBA 1CR1A 2ZCVA 3OOHA 2OSBA 3IP1A 2VDVE 1Z37A 4EJSC 1HTWA 1N5IA 1ESDA 2WM8A 3IMFA 2SKCA 3ILVA 3L05A 3HCNA 4JR1A 5H02A 5CFMA 5I8PA 5DGHA 3H13A 4Y0AA 2J7PD 2FSVA 3WK9A 1YUMA 1BXGB 3HA7A 3OCVA 2B99A 2P41A 5I45A 5KVQA 3UMCA 3TYXA 2EQBA 3DMTC 2J9YB 4XQ0A 1XA4A 2MTBA 3EJWA 1J24A 1XYYA 2ZSKA 3IALA 4YFVA 4GKBA 3UMYA 4AZWA 1VL1A 1N5RA 5EJAA 1V8BA 1NDUA 3PUIA 4HQKA 4MVCA 1K97A 1T5IA 4RLFA 4A1OA 1M75A 1UT5A 1YI1A 2Y68A 4MP3A 3ZBUA 1CRQA 4H17A 2QF7A 2IXAA 4OI4A 2AI2A 3EWAA 3KQYA 1JX6A 1T3TA 2PANA 3IDFA 621PA 1N2OA 2CNOA 2BMVA 2Y77A 3R74A 4CLXA 2O6LA 3WYBA 3M83A 4OGWA 5ARCA 3FOEC 3P0RA 5GY7A 3ZZUA 1PJZA 2TMDA 5FR1A 3D59A 1GDHA 5DBFA 5EOVA 1N92A 3B12A 4FC6A 3TFWA 1C3EA 2JL1A 4NATA 2VDKB 4ZN6A 4M4SA 5H3CA 4FMDF 1XPOA 4JI3B 4UEWA 4EKYA 5BUZA 1CUGA 1HRKA 3OURA 4MWEA 4EPYA 1DJLA 2P8SA 5L3QA 5KNDA 4BQIA 1M2NA 5CPFA 2AG1A 2ADFA 1I3OA 4Q1AA 4Y2YA 2Y0EA 4XASA 3GCWA 2I8CA 5C5DA 1G8YA 1JDPA 4HQ0A 1TAQA 5L45A 3DZKA 4NBTA 1IG3A 5JVDB 3KQWA 1B16A 2G8LA 4QO8A 3AEYA 2XUGA 4YAOA 2HB6A 1QHIA 2JJMA 3R77A 5HF9A 5CCDA 4DSAA 5DTIA 2FQXA 2J3QA 1PEDA 2G1UA 3DNPA 2QGNA 4HATA 2DBVO 3AF4A 2QRUA 1OUMA 1B26A 3IKJA 3KO8A 3NOXA 3LT1A 3D02A 4DA8A 2Z30A 1J5PA 2REBA 2BOVA 3DO5A 5FTJA 4QGGA 3MZ0A 2YOFA 4MKIA 4HGYA 3N76A 1NU8A 2BGMA 3N8IA 1T36A 2FEOA 1VIAA 3JZMA 4KSBA 1JA9A 1HTTA 1Z0JA 2HF7A 3DBHB 3UAVA 2PIDA 3MG9A 3W1VA 3ZC3A 4DEYA 5LWQA 2EFJA 1QIIA 4D45A 4KMMA 4EW2A 3LPCA 1J22A 3QLTA 4MB6A 1ZIPA 2MYTA 3K2QA 2IGBA 5H4GA 2JZCA 2R6CA 2B83A 5HF5A 3OWXA 3KAPA 2Y0DA 5JH7B 5KQSA 3BBPA 1NLZA 3BK2A 1KOGA 2I2AA 3T3DA 3PPYA 1NP7A 3DD5A 5C34B 1EE9A 3JZFA 3ENZA 1XYVA 3I30X 4WXPA 1BJKA 1E6CA 6LDHA 1AU9A 5H70A 1TUBA 1LX7A 4RIFA 4WCFC 2B61A 2W4IA 2ZUEA 4OG2A 3NBAA 2PMDA 1OU0A 1CNMA 1MH9A 1IJBA 1W19A 3BE6A 4BKMA 2DMRA 4WERA 3KUDA 4XEUA 1P2TA 4LHSA 1NWCA 3VKGA 3LK7A 3CCFA 4EI2A 3AERA 4F56A 2PT9A 1TEXA 3RGGA 3LFTA 2WD7A 1UIMA 1C9KA 2B35A 1OA1A 1M54A 2DULA 2PDAA 3Q41A 3OAAA 3TLZA 3IQIX 1ORTA 4JVLA 1WXHA 4WBNF 5GGYA 4OP2A 3KJEA 1DQNA 4W5WA 4WIAA 1M72A 2FUNB 3HP1A 3KV3O 3SE7A 1XVAA 5KYNA 3HGQA 3HWRA 3FCAA 1L5HB 1PSZA 4DRYA 3H7IA 4ZZ3A 2XQVA 3EARA 1QWSA 2AFHB 4G0YA 3A7DA 2ZUVA 4YRFA 1A71A 1FK8A 2QTMA 3RJTA 1PO7A 3A3KA 1QR2A 2GEVA 3VO1A 4AVYA 2XD4A 1TM7E 5DNAA 1TEHA 3FLAA 3PCRB 4TV8A 1MAAA 1DCFA 3EUEA 5DGTA 4PLCA 2C7GA 2R00A 2DFNA 1T2FA 4O59O 5E1BA 4D0NA 2P7IA 1P9LA 4P7GA 1LDGA 421PA 3ELYA 4BDSA 2AUMA 3CXUA 2Y66A 4ZAWA 1QGUB 4HNQA 2PPVA 4L57A 4LZLA 3WXBA 3HG7A 2VAMA 1W4ZA 1SKYE 4YN3A 4RL4A 4B6GA 4WNAA 3V00A 5BRAA 5ES4B 1V5IA 4IV8A 2VYFA 4GSKA 3L49A 3IERA 4L7VA 1H2RS 2AJ8A 3BMOB 2PL5A 1WO8A 2WPNA 4UPVA 4CF4A 2W6ID 2HQ1A 2YWHA 5J4HA 1KP3A 1TZJA 1Z88A 4JIGA 2XXAA 2VDRB 3K32A 1MA3A 2CMHA 3PBKA 3RVRA 4D9GA 1E2BA 1R15A 1XG5A 1A1SA 1IZ8A 4DLKA 2P35A 2BMFA 4K28A 4OGKA 2WSBA 4E09A 1NMZA 4LF9B 4B8WA 5ALIA 3TR0A 3REGA 2HCRA 3PC2A 3TXXA 4OQYA 4RYLA 4CKEA 2WVGA 3G59A 3QFSA 2IXTA 2X19A 3DL2A 2FJPA 4PNPA 4RVNA 4HTFA 4D1YA 3LTEA 3WMFA 4PLGA 2QRVB 3BDAA 3HDJA 4UHBA 3DMGA 4QYXA 4KO8A 4K86A 1L9KA 2YUIA 3NRJA 4RHEA 3SDBA 4CMEA 3A36A 4F92B 1BZYA 1YFKA 3AUFA 1K2WA 3BBLA 3DDZX 4AB1A 4ARSA 3R23A 2V5UA 4AKGA 1Z22A 2XUAA 4NBUA 1DUVG 2M1XA 3OH8A 1PG2A 1AA9A 5CLHA 2QROA 3ROGA 4F4CA 5G4LA 3ZWDA 3NPAA 5DX1A 4O4LF 2GM5A 3R0QA 4DLNA 4DUZB 1X9IA 1PWHA 2GJKA 3DP7A 3IBYA 2VPXA 2X8AA 3EA4A 4OQNA 4RLQA 5BRNA 1A04A 2A0XA 1Y4ZA 2XMZA 1JEYA 5C7IO 4TYYA 4LVCA 4MWOA 5C7LO 1LLUA 3GOHA 2IU4A 4EFMA 3A2NA 4P82A 3IPRA 3IPXA 5K3DA 4LDJA 4N8DA 2CFIA 1JDVA 3ND8A 5HZHA 4KE6A 5IM4A 1RXUA 1DAIA 1ZGJA 2V7QA 1Z0SA 1FMJA 4JBWA 4HWKA 1A82A 2E87A 5F2KA 1ZR2A 4F6RA 1ETHA 2JA2A 5P8WA 2RARA 3B1FA 3GLRA 1V11A 1W85B 4MI3A 4MYUA 4I1UA 4IR7A 2VP5A 4V0OA 4QBIA 3ZLUA 5MF6A 3KQLA 1ILWA 2AOXA 1EA5A 3M1LA 4NENB 4UZEA 1JHUA 3PNSA 4WFQA 4CG2A 2OCPA 2IITA 2R1ZA 3BJIC 2X1LA 2OAP1 2GBCA 4JJEA 5KNCD 1TGVA 4R8MA 5ESRA 5HGJA 4ZCMA 4NECA 1UPTA 2O3JA 1SVOA 2WABA 3RBVA 5E9JA 5BXQC 4HD8A 4LVUA 5FLEX 3JASA 3AM1A 2EAUA 1P1BA 2I3AA 1CR2A 5AHWA 3SS8A 2V58A 1P9NA 4WVFA 5CT5A 5EJ8A 2Z4SA 3H1GA 1ZKMA 2QXUA 3ZBPA 5EE0A 4D8WA 4IIHA 3OIVA 1ODKA 2CCJA 4CFSA 3ZDDA 2X42A 1IAVA 3C74A 1OFIA 3IC5A 1YNSA 2M32A 3QXGA 3VZPA 3KPVA 4LRTB 3FAZA 1F6BA 1VRWA 3KUKA 4JAVC 2YHUA 5KHLB 1L4MA 3BMXA 4MLDA 2C61A 2OT3B 2B36A 3AHHA 4EY4A 5K05A 3J81A 2FWBA 2IUEA 2CL0X 2LXNA 3C8ZA 2UVDA 1SY7A 5CD1A 3ND7A 4GC9A 4BNIA 5CA0B 5KWJA 5KNLA 3T3GA 4FEEA 3AYZB 4I55A 2YYAA 3N2EA 2DEUA 1BJRE 1B8NA 2F2TA 4UTZA 3QVGA 4ZI3A 2EBFX 2O2GA 1LPPA 3BXEA 3I9V6 2X77A 4YEDA 4B0OA 4DV3B 3LX8A 4J91A 1JHRA 3JQ6A 3PQCA 4RBNA 5K7SA 1FMFA 3WLFA 2W0MA 5LFAA 1L4GA 5F12A 2C9CA 1BXRB 3H0EA 2Q5CA 5D85A 4YMVA 1A7KA 1OT3A 2O0JA 3VTFA 1XEWX 5JSHA 3L7BA 1GNVA 2P90A 2WYUA 3FY4A 5AW2A 2H3HA 4ZAGA 3G1TA 4RA6A 2YZGA 1MUUA 5EYPB 5AI9A 1X1AA 3W3AA 1FQKA 3PENA 4QX6A 3SJCA 2ZRJA 4IG4A 3WDSA 4KDRA 3WMWA 5JSUA 1YFLA 3FJOA 2GSDA 1R0LA 5I9SA 3CW8X 4Y30A 1X1CA 3HGTA 1P2SA 4X20B 3EF3A 1HWYA 2W2LD 3CLSC 1RQLA 3ULKA 1YR3A 4LBZA 3N1UA 1IY9A 4I50B 4QOHA 1JEQB 3GIDA 1Z08A 1JWAB 3GGSA 1XMQB 4D7AA 4G6ZA 2XNKA 2XRFA 2H0AA 2P3QA 4HX5A 1SXPA 1N78A 2IY9A 5IULC 1UJNA 2BBTA 2D7JA 1SQGA 1CUZA 1KEWA 1WKVA 1Z0ZA 4RMNA 5G3ZA 4PQRA 2MJLA 3A1SA 5FD8A 4BLOA 3IIKA 4N47A 4PO8A 1Y1SA 5FAKA 1IDOA 2ZI9A 3DW3X 4Z3DA 5BNFA 3AY0A 4QXOA 1FX0A 1V3VA 3M3PA 5IZCC 4PNHA 1VJTA 3KT3A 4CTMA 4DV6B 2BC9A 4Q9JA 4X3CA 1YJAA 3KVOA 4PZLA 3TMYA 2BISA 3IQWA 4ALMA 1KH1A 3NOQA 2WSLA 3S0JA 1POWA 4IEFB 4DPLA 1D9ZA 3DONA 4J2TA 1W1WA 3GGCA 4AY4A 2XTAA 3RU9A 4BMXA 3SR3A 4MWCA 4EGSA 1E9VA 1Q0LA 1B6GA 3WKEA 2UYQA 5GONB 3KUCA 1JHXA 2GRAA 1XWFA 2Q9AA 4O0MA 4Q7LA 4DANA 1FFXA 2MSNA 2GO7A 5T4FA 5IG2A 4EG7A 5K9ZA 2BSXA 1TA4A 2QX7A 3BWVA 3D3NA 5T4HA 1GUZA 4NU8X 1ZXXA 1Q74A 1O77A 3G8CA 1M74A 1YIOA 1TM3E 3WNQA 1GNRA 1UJMA 2JEYA 2P2LA 5LB4A 1NL3A 1NF8A 1OLOA 3LC0A 4OU4A 4CODB 4FM9A 5D01A 1CULC 3KJFA 3S4YA 1X8KA 4FBGA 4PBRA 3FCOA 4Y18A 4JB3A 1PI3A 3JWJA 1UBLS 2O7NA 3LDHA 1NR7A 1ZGZA 2QTGA 4D3ZA 3G8DA 1VMKA 4BFCA 2E37A 1EWTA 1HLDA 1W5AA 1KJJA 4C0WA 5LQUA 2OEPA 1EINA 1HSZA 4KWCA 1AQIA 1H6AA 3D1LA 3L6RA 3TFQA 4TPKA 1SQ5A 5J1SB 4B09A 1M1YE 3K1JA 1XAJA 3ONVA 1B8OA 4YVFA 3SP1A 3NGMA 1KRXA 2NO7A 4LX8A 1K89A 4RWEA 3HKEA 2HBRA 2OLJA 4DCJA 5JMTA 3PEYA 3HO1A 4QUEA 4QTUB 2POCA 1ESMA 2C00A 3CRQA 4I9UA 1NMEA 1VYVA 3Q7IA 3RWMB 4DRXA 1OV6A 1W88A 2NX2A 4DNPA 5A3VA 2ECFA 1GZSA 1T6XA 4RL6A 2PAAA 4ZTUB 2R2AA 1IRIA 4ZQCB 3AY7A 3KEGA 2ZSBA 2CL7X 4IHJB 4JLMA 4OB8A 4RTNA 1J0CA 4O5AA 3UH1A 4EMTA 2O8DA 5DYIA 2NSLA 3SVTA 1FVFA 5AVTA 2JF0A 2XLCA 4OYLA 1QIMA 1TOAA 2GA8A 4MROA 3BFPA 4CHTA 5L3VA 2B8EA 1U1CA 1PJ3A 1V43A 3Q88A 1N3LA 4NJMB 1NSTA 4JYAB 3KPYA 2P4UA 4KLAA 1KSHA 1M1YA 2GEJA 3ANNA 2A9JA 4CM8A 2UU9B 1U0OC 5LLSA 4G63A 3AC0A 4HN4B 5BYKA 1OA0A 2O3QA 1H4QA 1RFGE 5I9NA 1PV1A 1T2DA 3E58A 5JS2A 3C7TA 4L8FA 5EJGA 1MV5A 4PPQA 1Z5NA 1M5UA 3KJQA 4INPA 1FMCA 4YP0A 5CD9A 4AN1A 5KX5A 2HYIC 2HU5A 3C16C 4WBNA 1GQYA 1FDRA