1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
1Q3HA 2ZI5A 3H1TA 5JSZB 2JJ8A 1R6BX 1AK2A 1YE8A 2FZLA 4RD2A 2AR7A 4WBSA 2IHBA 2XEXA 2WM9B 4AYTA 1FQKA 1RYFA 2ZI6A 4R2HA 4BPBA 2HXYA 3WNBA 4V02A 3FHOA 3GP8A 2ZAMA 1XJQA 1FQJA 2ZRCA 3QPUA 2OESA 3O8RA 4FWTA 1YR9A 1AJEA 2XTMA 3R7WA 2Z4RA 4PC7A 1JR6A 1G8GA 1OKKA 4DLRA 1WF3A 1VG1A 3S1AA 4BEJA 4US0R 4MRRA 4LY6A 3AP2A 3CRMA 1N5LA 2J1LA 4HB0A 3ICEA 1BYUA 1LNZA 2OLJA 5FBRB 1D6JA 3LLUA 4RD6A 2NO6A 2RKOA 3NXSA 4EFLA 1Q1EA 1XEXA 2ZRKA 2XZPA 3BFXA 3TUIC 4HB4A 2BDTA 2ERXA 2HF8A 5CIWA 1F2UB 4GPTA 5HE9A 3OIWA 1G3RA 5CLQA 3BBPA 3CX8A 1R7RA 1Q57A 4QBGB 5EXXA 5AK0A 3KB2A 3GLGB 1GIAA 3D6TB 4P31A 2ZS7A 3T34A 3U7GA 3AKCA 1COWD 2IS6A 1F48A 2ZUBA 1N6KA 2NO7A 4D2IA 4URUR 1KJWA 3QI2A 2BCGY 3WP1B 5BYKA 3N70A 4M9SA 5LDDC 1YZTA 2VP9A 2WWIA 3QVUA 4QGFA 1P2VA 4BZPA 5JCZA 2GEUA 5K8LA 1SGWA 3EASA 4GL2A 1YZGA 2ODEA 3OZXA 4JT4A 2VH5R 1DAFA 4LYJA 4M22A 3IBGA 1IY0A 3RDPA 4LV8B 2NZ8A 3CRW1 2CMKA 3I92A 3RANA 2O8DA 1G8YA 1MKYA 4OI0A 1DAEA 1FMJA 4MRSA 3DOEA 3VR4A 1AKEA 2ZYUX 3NHAA 4TQUS 3R8FA 4A2PA 1ZNXA 3PUYA 1EK0A 2ZSDA 3MGCA 2QI9C 4UQOA 3TIFA 4D0NA 1JAHA 1KMHA 4Z1MA 4AYWA 4GT1A 4ZIRB 2VF7A 1S1CA 3CW2A 4X8OA 2F55A 1E94E 1FZQA 2VHJA 521PA 3TVTA 4AIIA 3VHLB 3H2YA 3WMEA 4Q1BA 1NI3A 4HAXA 1W36C 1XJCA 5H8WA 2L0XA 3ZIAA 2GK6A 3B85A 5JHGB 4KVGA 3FDIA 4JMPA 3LLMA 2N1BA 3QUSA 5DE3A 1Z22A 2XJ9A 3QBVA 1J70A 1KO5A 2P3SA 4V0MA 4ERNA 1D8TA 4QM7A 3MD0A 4MGZR 3B82A 4HAWA 2GRJA 4WAUA 3AVOA 1M8PA 1V5WA 3TNFA 2GZDA 2V55B 2QMEA 3PCRB 1U2RA 1OT3A 4HLDA 4TQ9A 4F7WA 4MGYR 4LV6A 2NO1A 1H8ED 2D4HA 1S3SA 1G6OA 3H84A 3IIJA 3MWKA 3C16C 2GCPA 1N6PA 4JVSB 3TUZC 1UF9A 2CLCX 1A82A 5GVSA 1KI1A 3U3KA 1G7SA 3DM9B 2ZE6A 3IPYA 4FMDB 5DI3A 2GZAA 4R98A 1T3SA 3PUVA 3LXRA 2UZ3A 4GP7A 4PZLA 5SZJA 3BWDD 1JPJA 3N5CA 3TSOA 1BYIA 3KQKA 1RRCA 2V3CC 3QQ5A 3SR0A 5ANRB 3LY5A 4XH9B 2GCOA 5KDOA 2ZUCA 2AFHE 2ZR7A 4U5XA 4FCVA 4NMMA 2JLSA 5SZHB 2NG1A 4ZKDA 4TTRA 4E5UA 2W0MA 1RRFA 1W4CA 5EJEA 1II8A 4MKGA 1ZIPA 1BS1A 2YVUA 3SEAA 3KFVA 2VA8A 4LJ9A 1DVRA 2J41A 2VP4A 1PZNA 3MWYW 4MUBA 3EARA 3GJ8A 2QP3A 1AQYA 1OFHA 4TYQA 3CPJB 3TUJC 1YRBA 2QQ0A 3CO5A 5AJVB 2HYIC 1TQ4A 1KKMA 3M1IA 4QJ5A 4BLOA 2YJTD 3EPHA 3E5HA 4HI0E 4QHTA 3CNNA 1R0ZA 3TLXA 1D5CA 1WCV1 1XMSA 4PANA 3DHWC 4PSAA 1PLJA 2AHOA 2WVJA 2A78A 4HLUC 4DIDA 3THYA 1GP2A 4FMBB 1D2EA 1W7AA 4BFYA 5H1YA 4UNNA 1FX0B 4G5GA 4G5OA 5C4MA 4OHYA 1IAQA 3OEEA 3CPEA 3KQUA 3L8ZA 3D3QA 3GJ6A 3PG5A 3QBTA 2NO0A 3B1WA 1E2MA 2CCGA 2ZE7A 4MDFA 4TZ0A 1X6VA 4I1VA 2QSYA 5KNDA 4EFNA 1NVVQ 2WSMA 3GLHA 5DH9A 3U6KA 2QMHA 4G1UC 1EESA 2VP2A 2FPMA 4BASA 2BMJA 3QVVA 2ORIA 2ZYVX 3NBYC 3DL0A 4LJ5A 1R8QA 2FE4A 2A3RA 4KLNA 4DCUA 1OH5A 1UKYA 1K5DA 1QVRA 4QL3A 1U94A 4WXPA 1G3QA 4A1FA 5JWHA 1KSFX 1F6BA 4LHXA 3PUWA 1L4UA 2QE7A 3QSYA 3A1TA 2BKEA 1F3OA 4YDHB 4QNMA 4XTRA 2JLZA 1H8HA 1JXMA 2D3WA 2O52A 2O8EB 2F9MA 2IK8A 1U0HC 3A4LA 3IDQA 3LH5A 3CNOA 4PQYA 2J87A 1QVAA 3VHXA 4XWAA 1NSTA 3AVVA 3NEYA 2FFQA 2IF2A 1YKSA 3GQBA 1DAIA 1P2TA 4JJKA 5AJYA 2IUUA 5DHAA 1E4VA 1OV4A 4B6EA 4Z1MD 2LCFA 1NVVR 3FGNA 2KI5A 1HQCA 4KSBA 4WXRA 1WP9A 2EVWX 1BO6A 4Q5IA 3AVXA 1VTKA 3RVBA 1ZBDA 3AP1A 3THOA 1QHYA 3ZIAD 5LD2C 3ZZTA 2BEJA 4QHSA 2H92A 3AV0B 2G1KA 3ZS9A 4Q7KA 4DSOA 1M7BA 4DT1A 3T1VA 2OXRA 2QM7A 2A5FA 3HYTA 3VNUA 1XD8A 1Z47A 3FMOB 3HYRA 4G0NA 4PQRA 4C0BA 1ZNWA 2MSEB 1PJRA 4GP6A 2NQ2C 1E2DA 4TLBA 1G9XA 2HT6A 1RKBA 2IS1A 3SBEA 2ZRDA 3W6NA 2A2ZA 1XDBA 3RHFA 2V9PA 1P3JA 1EWRA 2QT1A 3CM0A 2W6ID 1Z8FA 4EPVA 2D74A 1GNPA 3RC8A 3IILA 5CDFA 4ASUA 3PITA 1ZVQA 2JLUA 3OFNA 1O87A 2OCPA 2ZJOA 3B1XA 4CYMA 4D25A 2WKPA 4DSTA 3B1ZA 3ZYCA 3TSZA 2ZJZA 4MRVA 4A4DA 1M2OB 2O0HA 4G3XA 5FOVA 3NC1C 2VTKA 8OHMA 2PLRA 3W90A 2GKSA 4FCWA 3AF1A 1SKYE 1YU9A 3GFOA 3MWLA 4B32A 1J90A 2RHMA 4DDUA 3KQHA 2YOFA 4UJ3A 1NJFA 4W5JA 5CM9C 2XXAB 3GJ0A 4AC9A 4KFRA 2WJHA 1FW6A 3LAWA 1IN4A 3BC1A 5FPHA 3T1QA 5TXGA 3K8YA 2IC5A 2OFXA 2XITA 4NE2A 4HAVA 5C46F 4PHGA 1XRJA 5L3SA 4KI0A 1EWQA 2UZIR 3KTAB 3Q8XB 4P4SA 4HZUB 4LPKA 1KGDA 3RSOA 1KYIA 2OAP1 3BORA 1U90A 2N42A 4XVQA 1US8A 1NY6A 4FCTA 1T9HA 1TL7C 3LQQA 3IIKA 3DEFA 3WBKA 2QAGC 1IXSB 2R6CA 2GZHA 2ZJ8A 4BFUA 1JJVA 1PLKA 2GNOA 2WOJA 1QG4A 3OEHA 4V0ME 4CEIA 4BEBA 4BE7B 5K8UA 2ASEA 2OCAA 3UMFA 5TARA 2YV5A 4DLTA 3L0OA 1LB1B 1ZC3A 3OHMA 3OEED 4O0MA 2QENA 3KQNA 1R0XA 3ZH9B 4QHYA 2IW3A 1QHHB 1F2TB 2FMXA 1U8AA 1KAOA 1Z0IA 3PQCA 2W83A 2GJAA 1R5OA 3TE6A 4G5SA 2UKDA 2DB3A 5KPDA 3RS7A 4BRUA 3ADDA 2ZQ5A 4E03A 4YMVA 1HEIA 4YDSA 4N0DA 4RCZA 4LBYA 5JRJA 4JS0A 1EFHA 1U81A 4CEHA 5EP2A 3EZ7A 5SZIA 3AVTA 3FYHA 1Z6YA 1SVKA 4MA4A 4NKRA 1DELA 4EPTA 4HZIA 4TYNA 1CRPA 2EWVA 2QPOA 3REGA 2J0UB 2QE7D 1G5RA 3Q72A 4JBWA 1T3HA 4CIDA 5FBVB 2F1IA 3AH8A 5JZVA 1E9FA 1H8HD 1JALA 5AJZA 3EIHA 5FUXA 2PJRA 2JLVA 1KI7A 4LHZA 2OSBA 3L0SA 3B6EA 3FMFA 1J99A 2W6JD 2F3TA 2ZI4A 3AKDA 2XNDA 4Q1CA 1BMFA 4JKYA 2PH1A 2R6AA 2ZU0C 3GJ5A 4AURA 2WKQA 4LHWA 4M2LA 4PZYA 4F92B 1Z0JA 3WNDA 2ZIAA 5J5CA 1YQTA 1QG2A 1KZGB 3KJGA 4E22A 4KV9A 2B8WA 2F1JA 2FSGA 2X1VA 3TAHA 1YR7A 2O0KA 5J40A 2DHRA 3CIOA 2QROA 2ZSAA 1XMVA 2WJVA 1N0VC 1FP6A 2C04A 4I81A 1E9CA 2BBSA 5LPNA 4TTQA 3W34A 5GADl 1OXSC 3SE0A 2QGNA 4PZZA 3B2EA 4DB2A 4HLQB 1NMYA 4ZDJA 3ADCA 3NTUA 4PHFA 2C98A 1DAKA 4DLSA 3FVQA 2DWOA 3GLHE 1TEVA 3FWYA 4V03A 3TR0A 4DB4A 4H9GA 1T5IA 5F9HA 1TQDA 5G3YA 2Z43A 2OZEA 4ACBA 4B43A 2ZAOA 2ZM5A 4WVFA 1FOEB 2AK3A 2VRWA 4GBMA 2QMUA 4ASUD 2G88A 1X86B 4PSKA 2GK7A 3OFND 1WE2A 2IYWA 1E9DA 2WWGA 5KOYA 4V0OA 3H4MA 1VPLA 1Z06A 1G8PA 3SFZA 1KAGA 4Q18A 5E4FA 3V00A 3U6BA 3RS5A 1MABA 4M53A 3HU3A 1EXMA 5B64A 4OYHA 1Z6XA 4ZI2A 1P72A 2RH5A 3E70C 4OI4A 3BH6A 4NL4H 1XEWX 4FD2A 2RCNA 3CB4A 4DLUA 2V7QA 2Q3FA 4DXAA 3UWOA 4GFDA 2IHYA 2QT0A 1XCGB 5JI3E 3LFUA 4NTZA 2OCYC 2V6IA 2JLQA 4XD7A 1T3LA 3LWNA 3VU9A 1DBSA 4NYMQ 1KI9A 4PHHA 1KK3A 3B7GA 2VHTA 4PO8A 1ZNYA 2R8RA 2IYTA 3NBZC 4JLNA 2RGCA 2DYKA 4M9QA 3W5JA 4BGDA 2VLIA 3CRQA 3F5FA 4AG5A 3R7WB 5JJLA 3BAFA 1KSGA 2IXFA 3L8YA 1ZP6A 1Z29A 3S1AB 1KJYA 5E7IA 4URVR 4M4SA 4XWOA 4PQFA 4XTCS 3AF2A 3LRPA 3OEHD 1QHXA 4Q1DA 3ONWA 1X8LA 1LF5A 1HV8A 3A4NA 2RGXA 2IX3A 3G82C 3NDPA 2A30A 3RSLA 1XEXB 5KDLA 3U7FB 4JLAA 1XPRA 4V0LA 2N46A 1XTQA 3U5ZB 1G5PA 1E69A 2PCLA 1KJZA 2VSFA 2HJVA 3U3OA 2GEDA 1XXHA 1OW3B 4LC1A 3QOFA 2ZRPA 1ZD1A 5CDFE 2R6GA 4D26A 5HZHA 4ON9A 4NYMR 5L3VA 2JASA 1E9AA 1WMSA 4JLOA 1UADA 3BERA 4FMCF 4LHVA 4PR0A 3CRRA 4ZPXA 1UDXA 4WOPA 1Q44A 2WMNB 3FE2A 5KUTA 3GFPA 4HEJA 3O47A 4B3XA 1W49A 2OFWA 4JLVA 4Q1AA 5GJVC 2GJSA 1HH4A 2FA9A 1IM2A 2YWFA 1GTVA 4DWJA 1BOFA 1JQJC 2YHSA 5CB6A 3A37A 3RC3A 2OV2A 3KXLA 3AUXA 4Q48A 2IYXA 4EJSA 4KBGA 2O8DB 1JR3A 4N0EA 1T8UA 1FFHA 2ZI3A 2VEDA 3GLIA 4MYHA 2QN6A 2H1LA 2CVHA 2J7PA 2KWIA 1BMFD 2ZI9A 4G5QA 1KI8A 1SKYB 2HLDA 2A5YB 1SULA 2EFDB 4A8JA 3HU1A 4HAUA 3I61A 1KMHB 1CR4A 4ABYA 3SDZA 4YMSA 1AS2A 2CL6X 2AKAB 3RYTC 4LV5B 3KZ1E 1DTSA 3K9LA 1KI2A 4FN5A 3K09A 2Z4SA 1M74A 4BFZA 4DLVA 1C4OA 3ZD6A 4D4LA 4URXR 1NVWQ 3BOSA 4QBIA 3E2IA 2Z83A 4S35A 4BFWA 2GJKA 2ZROA 5FR1A 2DCUA 5A4JA 3SZRA 2ZRIA 4ITRC 2C95A 2OBNA 2XNSA 1CJVC 4HLCA 1G41A 3U60B 2WBLC 2OEPA 3QKRA 4OJQA 2CHVA 2KJQA 2V6JA 3GEHA 4H1VA 1XFAA 2GXAA 3K0CA 1N6OA 2F43A 4DEXA 1TADA 1KTVA 3UIEA 2PBRA 1R10A 1KDPA 3EWAA 1VIAA 4QOSA 1O3YA 2HCJB 4KODA 1IY1A 3C7KA 2AWOA 3NC0C 4B73A 3FTQA 4D0GA 3VR5A 3B78A 1Z28A 4B2IA 2UVQA 2D2EA 2GDJA 4IRUB 5SZKB 1AGPA 1WDTA 3VAAA 5DI3B 2OAQ1 2F7SA 1UEJA 721PA 1VCOA 2CJWA 1A1VA 1JBKA 1WA5A 2PX0A 3R20A 4EFMA 2IYLD 2V1UA 2JLYA 1ZAKA 2ATVA 1UJ2A 3TBKA 1T6NA 3IGFA 4IOKA 5EXPA 5BN5A 4B71A 3ZVLA 4KFSA 3EX7C 2BM0A 1KSJA 2GCOB 3RWOA 1G17A 1XU4A 4A6PA 4JVMA 2V7QD 2VBCA 4R9UC 2F1HA 3IEVA 1TU3A 1GILA 2IYQA 4FIDA 3WMGA 4Q4AA 1P9RA 2PZEA 1CLUA 4BECA 1II8B 1TU4A 2IWRA 2FFAA 1LS1A 4JBXA 1U98A 4PSVA 2HT1A 4P0TA 4XD7D 3T06B 3QKUA 2OFOA 2HCBA 4DSNA 1XTIA 2REBA 2R2AA 4MGIR 4MRNA 3C4JA 4G5RA 1SXJC 2OT3B 3B1YA 3EPLA 1W0KA 4URWR 2QZ4A 3L0IB 2OLKA 2VP6A 1HE1C 5GJCA 1ZYUA 2YC2C 2P5SA 4DDVA 2YC4C 2CL0X 4R71A 2BBOA 3FFBA 5JJKA 4F4CA 3AKEA 2Z0MA 3UK6A 1KIMA 3ZVRA 2C9CA 3WMFA 3THYB 2BMEA 1CJUC 2W2XA 1ZM2A 3MFYA 4Q4HA 2IS2A 2OXCA 3KFXA 1PV4A 4B3BA 1RFLA 2X19A 2BWJA 1TAGA 2IUSA 3HU2A 4DIEA 1Z07A 4Q7MB 3NWJA 4CT5A 4AKHA 2FJUA 3SN6A 4TMXA 1GVNB 1S8FA 2ZSEA 3UWKA 2CE2X 1PUJA 3M0EA 5CYPA 1M34E 4IDHA 2KSQA 3TW8B 4RZXA 3GLHB 1YZKA 1VG9B 1HE8B 2WJIA 1KK1A 4NYIQ 4RKFA 2I1VB 3KXKA 1R5BA 4OHZA 5AR1A 4RD1A 3VX3A 3THWB 1E2FA 3B1VA 3KKOA 4E07A 2B8TA 4U02A 2WICA 1AN0A 1YR8A 2OO7A 3I4LA 4EPWA 4JIMA 2IEYA 1OYYA 4PX9A 2P5TB 4DSUA 1GDDA 3AP3A 4M8NE 5FH9A 1JR3D 4Z51A 4NZYA 1VECA 3M4YA 5BW8A 1HA3A 2WJYA 4BFXA 1Z6TA 3NHBA 2J7PD 1I2DA 4EPXA 4W5HA 3EPJA 1RJ9A 2CK3D 2HLDD 2R44A 4QNRA 4EQ6A 2D2FA 4M21A 2VO1A 2IYVA 4W7SA 3KL4A 1KO7A 2Q9AA 3UG7A 4PTLA 2Z6VA 5EP3A 1T4GA 4MGKR 1Z6GA 5EZ5A 4NYIR 1UFQA 4NBSA 1ZUIA 3PIRA 3SJAA 2AKYA 5KSPA 5IHPA 4MKHA 1DAGA 4GDFA 5J4LA 4TTPA 1GAJA 1E0AA 1OH8A 1XXHE 1IJFA 1MO6A 1ZC4A 2CNWA 3GEIA 4DT1B 3OAAD 3OESA 5JI2E 1M7GA 2PT7A 1NMXA 2MSDB 2OUKA 1CEEA 3Q7PA 1XZPA 4Q9IA 5CK4A 2C99A 3T1TA 2WWWA 3MRSA 4NHOA 3BE4A 1XBTA 1VHLA 1LTQA 3E1SA 3WRXC 4DLYA 4C30A 1UAAA 3U61B 4AG6A 1MO5A 4QJ3A 3P32A 4JL5A 1G6HA 2CE7A 3VKHA 2QU8A 3IHLA 4GOKA 5E3HA 1G8FA 2IT1A 2WIAA 3SFVA 3U7EB 5DYIA 2ATXA 1ESNA 4Q66C 2OBLA 1JR3E 1AS3A 1ODFA 2BKUA 1CP2A 1YZQA 1MT0A 5FOXA 3W9YA 3GLIE 2X77A 1EX7A 1W0JA 1BH2A 1RE0A 4ESVA 3D31A 2XSZD 2SHKA 4GNKA 5KNCA 4M9ZA 4I1OA 4M1KA 1LF0A 3CF0A 4LJAA 5EUQB 4BZXA 1RIFA 1KO8A 3TSWA 2FSFA 1PVOA 4YQFA 1KOFA 3K0AA 4CEJA 1RYHA 1JJ7A 1G3IA 3MMPA 4AWXA 2C8VA 3X1YA 2H7VA 4HUQA 4AI6A 4M1SA 4C0SA 2ZPTX 4PC1A 2VL7A 3FMIA 1E96A 5L3SB 3QXJA 1OKKD 1W0KD 3QKTA 3OIYA 1I4DD 1C9KA 4P4SB 4B34A 821PA 2H18A 5D3MA 5KTYA 4D6PA 1US8B 1WBDA 5JJIA 5FPSA 1E2JA 3CH4B 2VF8A 4L9WA 1LV7A 5BYJA 1HT2E 1DADA 3LBNA 1G3UA 4CEIB 1Q1QA 1NN3A 4XVRA 2H8KA 4TZ6A 1E2KA 3DDCA 3CX6A 1Z0DA 1OF1A 1SHKA 2GF9A 3LDAA 4TYYA 5HKKA 1YR6A 3Q5DA 5JEEA 1DAHA 3CPHA 4QM6A 3ZS8A 4C4PA 3EZ9A 1GRRA 1XD2A 4B3DA 5G3ZA 2CLDX 3QY0A 4RKEA 3B8HA 4W5WA 3RAPR 4DEYA 1GUAA 4Z8XA 2VSOA 2D7CA 4DRZA 4IEEA 3THWA 4CEHB 3AVQA 1RRGA 4LBZA 1OE0A 1ZRHA 3KJHA 3MLEA 3ZGXA 3UATA 3MCAA 1GITA 1F5NA 1ZIOA 2ZETA 1U99A 3RRZA 3LX5A 3LXXA 5FBWB 1P5ZB 4A9AA 3VR3A 4AKIA 1QHSA 2EYUA 5TV2A 3C15C 3KKNA 2H17A 2QSZA 2RGBA 1XD9A 2XZOA 3GCGA 1S4QA 2GXUA 1IN6A 1M6NA 2ZRNA 2BBTA 2R6FA 2ANBA 1E9RA 2NZJA 3TR5A 1E99A 3AF0A 2HV8A 3U3MA 1PUIA 3T1OA 2X2FA 4IOLA 1ZNZA 3K9NA 2Q3HA 1CR2A 3R8CA 4Q19A 3RNLA 4CGZA 4WZBE 2GF0A 2FV8A 2P6RA 2PMDA 3ZVMA 4GZMA 1DO2A 3HWSA 5BXQC 2VHQA 2I3BA 1FNMA 1A2BA 4KFTA 4KAXA 4C0AC 2ZRGA 5AUPB 3U44A 1IXZA 1II0A 4F4JA 2XB4A 4KHZA 3CRVA 1W47A 2CVFA 1VKJA 1IY2A 2PMKA 5C4GB 4HATA 1PLLA 1HUQA 2RMKA 5EQTA 5FPTA 4II7A 2J59A 3SJCA 1GRQA 1JXOA 4ZCMA 1S96A 1S2MA 3C5CA 1G64A 4B44A 1E0JA 1E98A 1MO3A 1E0KA 1EFCA 3EWSA 3LD9A 3V9PA 2JIZA 4A0GA 3CNLA 5JS8A 2KBFA 2G0NA 1D2MA 4ZO4A 4D4MA 4B3GA 4MYCA 4B47A 4BZQA 1Z0AA 2XOKA 3DO6A 1AA9A 4RFVA 4QKQA 2ZS9A 5EZ6B 1AIPA 2ZE8A 1IN5A 4TYWA 3RS2A 2ZR0A 1LY1A 1VCNA 4DLXA 1MABB 3PXGA 1OYWA 3AEZA 4TLCA 1W0JD 4GMXA 1KI4A 2BMFA 2FPKA 4K46A 1Z0FA 3L43A 5JRZA 3O8CA 2ZE5A 4UXIA 3HR7A 5J4YA 4DKXA 1GNRA 2PJZA 5JBQA 4DLZA 4U7DA 1G5TA 2NGRA 1ZM7A 2QY9A 4C0HA 4HLUA 2GCNA 1RW4A 4JJZA 1GFIA 2I4IA 2DBYA 1E2EA 3VKGA 4PAOA 3VMFA 4GSYA 3VU9B 1D2NA 2CCJA 3SNHA 4BLQA 3LV8A 3X2SA 2XGJA 5DN6A 1OPXA 1FL9A 4LJYA 3CR8A 5CYOA 1KKLA 1XJ0A 5KO2A 4UNQA 3VKWA 4ARZA 1KI6A 4C2TA 1E2QA 3W5IA 2AL7A 1N0WA 4NP6A 3O8DA 1S9DA 4JYBA 2ZJBA 3FKSA 3DOFA 3BK7A 3OF5A 4M9XA 1OHHA 1ZM3A 1CKEA 1JPNA 1TTTA 3GJXC 2CLSA 3QG1A 4OI2A 3NBFA 2DFNA 5DO9A 1CJKC 2BEKA 4IFBA 5DYGA 4LYHA 3IBYA 5B58C 1KK0A 3DVLA 4Q03A 1X8KA 2HXSA 4RZ3A 1P2SA 2YKGA 5GJBA 3GEEA 3BRWD 3LQRA 1XXHB 2YWHA 5FTKA 5M04A 1ANKA 2ZREA 2Q6TA 1OB2A 2QTVB 2FX3A 2PZGA 3ZZUA 4TT3A 4L5BA 4ACAA 5BN3A 1U9IC 4M1TA 3MJHA 4FW9A 2ONKA 3A1UA 4UNRA 2JA1A 3QEOA 1T0HB 1N6RA 2F6RA 2WPDA 1YHNA 4K8OA 1MV5A 1TEXA 4TMZA 3ZZ0A 3I5YA 3VFDA 3TQCA 3G0HA 1NRJB 3GLFE 1GM5A 1SVIA 1RRPA 1GL7A 1V43A 4C0QC 2J7KA 2DFLA 1S3GA 4Q4JA 4Q1FA 2GWHA 1N6NA 3I5XA 3TW4A 1R8SA 2QRNA 2V8OA 4EJSB 3W6OA 4ILEA 1KNXA 4O25A 1DPFA 3EZ2A 4Q9LA 3K70B 4IOJA 3GLIB 3K0FA 3PUXA 1RC8A 3RS0A 3L82B 4I1SA 3LBIA 1W46A 1DS6A 2KBEA 2OBMA 1R4AA 2ZVQX 4OKSA 4A8JB 1ZJ6A 1QRAA 1QDEA 2VHUA 3U2QA 2C78A 3P27A 3EA5A 4JBYA 3I73A 4KITB 1KDTA 2HEIA 2W58A 4J0QA 4DCVA 3MUFA 3ND8A 4TMKA 2A5DA 4GRAA 2CCKA 3A4MA 4WZAE 1OB5A 1G8HA 3VR2A 3JVUA 4EUNA 1Q12A 5FTMA 4BLPA 4KYUA 3NH9A 3GJ3A 4NONA 4PC6A 1AZTA 3SOPA 1FUUA 3HPQA 3LBHA 4WA7A 5DISB 4ZDKA 2C5LA 2RGDA 3QKRB 421PA 1UBEA 4LBWA 5F2EA 4F4IA 2F43B 3PEYA 1FTNA 1MH1A 4AD8A 3U3RA 2HJGA 2X8AA 3GPLA 1XZQA 2JIZD 4P33A 4C2UA 1E2HA 1KNQA 1JNYA 2OILA 1SHZA 3QF4A 5KSYA 4NH0A 3THXA 2ZU6A 3LVRE 4F91B 4MYUA 5AUNB 2GBLC 2QAJA 1AZSC 2CJWB 1AKYA 4TLDA 1E6CA 5K8TA 3ASZA 3C8UA 2WAYA 2ZI7A 5HPYB 1MRSA 3N2EA 3UPUA 3GJ7A 4DVGA 1JI0A 1YVDA 4PPQA 5TY0A 3WRYC 1OH6A 2PLFA 1Z6AA 2WWXA 1E0SA 1E2NA 3AM1A 2Q9BA 3QEJA 1P60A 2A7QA 2QAGA 3NG1A 4ZDWA 1HTWA 1Z63A 2P6NA 1W44A 2Z5FA 3C41J 4FI3C 4KSCA 2PL3A 4Q4AB 4XWKA 3B13B 3NKVA 4JSYA 3Q5EA 1UBFA 3NVAA 1WQ1R 4JT2A 4XOIA 3BH0A 1SVLA 2V4ZA 3PR1A 4B3FX 5AUOB 4ESHA 5DN6D 4JLBA 4ZCLA 5EUMA 5HZKA 1NY5A 1C1YA 3CF6R 2DWPA 1OH7A 1U8YA 5K8IA 4DUGA 3QENA 3ZQ6A 4Q21A 4DCNA 3X1WA 3CWZA 1N2CE 5F98A 1N5JA 3FKSD 2NPFA 4YXWA 2ZJ5A 1OHHD 2RGNC 3NH6A 3SJZA 1KO1A 1R0YA 1SVMA 4A0FA 4E09A 3PEVA 2IS4A 1E79A 4Q4HB 4UJ5A 3BD9A 4KLZA 3BIFA 2XJ4A 2GJ9A 4FMDF 1CTQA 2J9RA 2IA5A 1ZU5A 4YMUA 1L2TA 4RD0A 2NTYC 4IFEA 4IVPA 2OE2A 2Q9CA 4S2EA 1NN0A 2JDIA 4LPSA 2IWHA 4IJMA 2NOAA 4I99A 5KSOA 2WJJA 1FP7A 1HT1E 4Q9JA 2A5GA 4WZ6A 2ODBA 1SVSA 4QG7A 1QBKC 4MH0R 4TT3D 1E3MA 4MITA 4OBEA 3QXHA 4LBVA 4URZR 4QFMA 2GILA 5TMPA 2J0QA 4A6XA 2PT5A 3KKMA 3TAUA 4NYJQ 3ADBA 2G1JA 1EG7A 1IONA 1XEFA 1E2IA 1NBMA 2AXNA 5BN4A 1N6IA 1VYUA 3A6PC 4NCJA 3IQWA 4NCKA 1DG3A 3UG6A 1W5TA 3P4XA 1N25A 3F0TA 2WIBA 2K5UA 2CHGA 3VQTA 3TKLA 4XSHA 2XNDD 2O8FA 3KUCA 5P21A 4PO1A 1W48A 1RJ9B 2GETA 2QRZA 3HDTA 4JLDA 4KYIB 4EQ6B 4DDTA 3QG5A 1P7CA 1X1SA 5J4KA 4X8LA 1ZCBA 4D81A 1ZD9A 4BFTA 4HB2A 2QM8A 2QMOA 5EE9A 1GG2A 4HB3A 2RB4A 3RWMB 2VSXA 4P4UA 1MRNA 1XB2A 3BB3A 3AGPA 4NYJR 2C9YA 1LS6A 2ZRMA 3FPAA 5CB8A 3A1VA 4IDQA 3SJBA 4MKFA 2ODNA 2YZ2A 4XVUA 1FUKA 2C77A 4Q7LA 3RS3A 1G1MA 4Q4LA 3MSXA 4LJ8A 5C1BA 4NPHA 1E2PA 2BHRA 4Q9KA 1NLYA 4OQMA 4B48A 3LNCA 3SC3A 2P67A 2R62A 3AVYA 2YOGA 4Q00A 1R0WA 4JLMA 1W4RA 3CKLA 2QG6A 2CHQA 1P2UA 1XF9A 2DPXA 1Y63A 2ZITA 1D9XA 3QKSA 3OE7A 1N3BA 2VHCA 1T8TA 1UBGA 3K9HA 1FPMA 3KX2A 4RFSA 1GNQA 4QBHA 1TUIA 4PPNA 5FPKA 4QXAA 1A5TA 1OFUX 2REXB 4C7OA 1W2GA 4Q01A 2QP9X 5JS7A 1GWNA 1TNDA 4L4UA 1YZLA 3TH5A 2XB2A 1NG9A 2AXPA 2BM1A 1OIXA 2GVDC 2ZJYA 3OIVA 4RCYA 3RRNA 3WP0A 3TMKA 1LFDB 2ONJA 4LK2A 1W2HA 2E1RA 1H8EA 2E87A 5G41A 3PJRA 1FTSA 1SQ5A 4IDNA 1Z5ZA 6Q21A 1IOZA 2G6BA 1E2GA 1JEEA 1H65A 1P62B 3EIQA 5DGXA 1B0UA 1KHTA 4US2R 1CULC 1A2KC 3HJNA 3FMPB 4IDOA 5HE8A 2JJ1A 3CONA 4A82A 1SZPA 3P26A 1ZMXA 2V1XA 1Q20A 3BS4A 3K0AB 4CEJB 4L9SA 1TPZA 3SS8A 2BIFA 4TMTA 2FGJA 2PEZA 4HUQB 3LW8A 2O8BA 1F60A 2AD1A 2EWWA 1JEDA 4MUAA 1NKTA 3IO3A 4DUGD 4UNSA 2WJGA 4ZCIA 1VHTA 5D3MB 2F1RA 1ETUA 2QUZA 3EIEA 3PEUA 4B2LA 1TQ2A 4OQLA 1QHGA 2ORVA 3MWJA 4YXWD 3KKQA 4C9BA 1AQUA 1G21E 1T5LA 2W0SA 4P4TA 1MOZA 5FR2A 4D4KA 1TF5A 3AVUA 5KHOC 1OXUA 3IKJA 2QGZA 4L15A 2EQBA 1G16A 3I72A 1XPUA 1E79D 5F9FA 1W4AA 1ESMA 3SHWA 2YNMA 3BFKA 2PCJA 3SHFA 2WZQA 3VR1A 4WIAA 2VPPA 1NMZA 2LKCA 3DM5A 2JDID 3KB1A 1IHUA 3EZFA 4TMWA 4AKGA 2PEYA 4A92A 1XD2B 1N5KA 1VIYA 1Q21A 2PZFA 3A1SA 5KPJA 1KDRA 4A2WA 3BB4A 4JL6A 2E9SA 2P65A 4BLTA 1DAMA 4JKIA 4P3YA 5FI1B 5FPYA 1CR0A 4HAZA 2IBMA 1Y3AA 1NBMD 2WWHA 3FKQA 1ZM4A 2FNAA 2ZS8A 5H68A 1ONBA 3CF2A 2ZYTX 2BBWA 4JLJA 3B60A 2QNRA 2FWRA 1GKIA 1XTSA 221PA 2GAAA 2FSIA 2QA5A 5E7MA 3UANA 4MDEA 3WHKA 4LHYA 4Q47A 1IN8A 5B57C 1W36B 2KB0A 1VYTA 1JQLB 4PAQA 3K70D 4QBFA 4IVRA 3U4QA 3X1DA 3A58B 4KFUA 3I3SR 3PFIA 3K9GA 2FOLA 3QE0A 1WB9A 2JLXA 1KY3A 3X1ZA 2FG5A 5FOTA 4B2PA 1N6HA 2AX4A 4RY2A 3DZ8A 3GFTA 4RSGA 2QPAA 2RGGA 3PVSA 4OL0A 4URYR 5FTNA 1DG1G 1GL9B 3BJIC 4DDWA 1G3MA 4JYCA 5EE1A 1JAIA 1G18A 3KUDA 2EFEB 1RVDA 4IHQA 4U00A 2BJVA 1NIPA 5C18A 4P32A 3K1JA 3LVQE 2HYDA 1EX6A 1XTKA 2FU5C 3U44B 4BRWA 4KXFB 1QHIA 3CBQA 4KU4A 4QC2A 2ZRAA 5JWOA 1BIFA 2KE5A 4QGGA 1CXZA 1E32A 4IKEA 3WYAA 3OE7D 1XPOA 4HSEA 3BB1A 1R5NA 3WBJA 5FI0B 1TF7A 5HCIA 1NBME 3JZAA 4LI0A 5L3RA 5JMTA 4NCHA 1RZ3A 2O8CA 3VNVA 1GOTA 3SYLA 2H57A 5JLJA 1WXQA 1VCIA 1P61B 4AYXA 1QZXA 3IHWA 2DWQA 2XTZA 4LSGA 2D62A 2QBYA 2G0TA 4LDJA 1VYVA 2WWYA 2XZLA 1SXJA 5JHHB 2B92A 3Q3JB 3WXMA 5C2JB 4N1AA 3RS4A 1Z08A 2FGKA 2RGAA 4DHEA 2IF0A 2W6IA 1K5GA 4BFVA 3GLFA 3EA0A 2FH5B 3L0PA 5D3QA 2ZVPX 4BLRA 4Z54A 4YC7A 4O2RA 2JJ1D 3JZMA 4QRHA 3OIUA 3W3AA 4ZI3A 3W3ZB 1J8MF 2QL6A 4B35A 1KMQA 2VP5A 2OHFA 1KSHA 2IEZA 2R9VA 2LKDA 3F8TA 4LJ6A 1DO0A 3AB3A 4X8MA 1NVXQ 4KO8A 3GD7A 4Q1EA 5GVRA 3A1WA 1E9SA 2XTNA 2EYQA 5AJWA 3T61A 4QGAA 4UXJA 3SBDA 1Z0KA 1MR3F 4FMCB 1EFTA 2J0VA 3N2IA 4D80A 2J3EA 1T0JB 5DSZA 4YONB 4M1WA 5JSZA 3CLVA 4V0KA 3DKVA 4ARZB 1KI6B 2ECKA 1N6LA 3B9QA 2FEOA 4IW3B 2ZXUA 5KDDA 1LW7A 2FPLA 3LO5A 1P4SA 3P4YA 4D4JA 1XMIA 3R9WA 3NIBA 2ZYWX 4V0NA 1XMJA 1XTRA 2BC9A 4PXAA 3V4FA 3C5HA 1G20E 1II9A 1I4TD 3L2OB 1OLOA 3A36A 3K53A 2ANCA 5IK2A 1ZW6A 2BV3A 4RZ2A 3ND9A 5FTJA 2RAPA 2NIPA 5JECA 3O8BA 1X8JA 3P1JA 3T5DA 4CVNA 1XX6A 1OIVA 3HPRA 1DE0A 2B7BA 2WWFA 4IEIA 4IVQA 4IXMA 1G4UR 1OFTA 1IJEA 2DFKB 4GOJA 5LBIA 3W8RA 3WYGA 1J8YF 1TQ6A 5JCPA 4OJKA 1KY2A 4A0HA 4CF7A 2IXGA 3J81k 1UDWA 5GJWC 1F2UA 2ZJ2A 4UXHA 3X1XA 3EXAA 3GLGA 1D9ZA 2V54A 2G77B 2JLRA 3H0KA 5FOWA 3NBXX 3W8NA 2C03A 2DFTA 2J46A 3BXZA 3ECCA 3Q9LA 4EPYA 3FHTA 1B23P 5B30A 4PHTA 3B9PA 4Q4JB 4OK5A 2FN4A 3IQXA 4OK3A 5EXSA 2AK2A 4Y0VA 2D06A 4C0JA 4BWYA 1E1RA 2FF7A 2ZUDA 1Z2AA 3QXCA 3AVPA 5LD2B 5BWMA 1JECA 5G40A 3VTKA 1YZNA 4JZKA 3EAQA 4WW0A 3K0FB 5J4VA 4XJXA 3GJ4A 4KVAA 4OHVA 1XEWY 2VIIA 4OQFA 2ZRHA 3D7MA 1P9WA 1ZU4A 2F3RA 1NSFA 1OXTA 1G19A 2C2HA 4OI1A 4M0LA 3TRFA 3HR8A 4DLWA 2YINC 2C9OA 3H86A 3ADKA 2QPTA 4LX0A 4M1OA 2W6JA 3DMNA 3AQ4A 4LCBA 1FMLA 4A36A 2QTHA 2CNWD 4ZIRA 4LUCA 3RRMA 3CUEF 2DY1A 4YLGA 1M7HA 4NCNA 2JAQA 2JJ2A 3T12A 2REOA 4I1UA 3R9XA 3M6AA 3IO5A 4GI7A 1L8QA 1I2MA 1SVWA 2VP0A 4IDPA 4AK9A 4BFSA 2HUPA 3SI7A 4DCTA 4BUJA 1CR1A 2G9NA 2P0EA 1N5IA 2IUTA 1CS4C 1OJLA 4A2QA 3WHLA 2RGEA 3CWQA 4LOAA 1QHNA 1TX4B 4OQNA 2ZTSA 1ELOA 2WMOB 2WTUA 2XX3A 4W9MC 4OK6A 1ZINA 2VYFA 3QF4B 1KZ7B 4K81B 3THXB 1DARA 3WYFA 3K0EA 1GRNA 3KXIA 5FL3A 1SXJD 2DR3A 1VMAA 4DZZA 2ZRLA 2FFHA 1J2JA 2JEOA 5EE5B 4C0KA 2JATA 3SYKA 1NLFA 4PC2A 4B74A 2QAGB 3PENA 1NLZA 4MQBA 2JCSA 1TMKA 3IEUA 1HYQA 3R9IA 3UMSA 2ERYA 3FHCB 2CL7X 4HYYA 3DZDA 4EIWA 4YMWA 1OSNA 2A9KA 1Z83A 5IDVA 2EFGA 1UKEA 1Z2CA 2ZJAA 5UKDA 1G7RA 4LJ7A 4Q9HA 3EPKA 1OXVA 4HAYA 3REFA 5TVKA 3UKDA 2Q21A 5J4HA 3FFAA 4US1R 5FBLB 5TB5A 1AS0A 1KO4A 3UMRA 1OIWA 4H1UA 2Q0HA 2ZR9A 1UBCA 2LWIA 1DOAA 3QJYA 2GEVA 4TL9A 1AGRA 5CLLA 5CJPA 1ZCAA 2G83A 1IQPA 4B3CA 2QEQA 3A8TA 4HUTA 2NO9A 2B21A 4DCSA 2B7CA 2ZRJA 5HKKD 2FSHA 4JSTA 3HP1A 4F38A 5IK2D 3VR6A 4NU0A 1KK2A 5CITA 3EG5A 2BJWA 1HY3A 4CZ2A 3NEJA 4TL8A 4JVLA 1LVGA 1Q1ZA 1T91A 2G3YA 4PC3A 3LX8A 1MO4A 1FX0A 4TL7A 5JEDA 5L8VA 4MKIA 1M1YE 1I4LD 2D7DA 3AF3A 2C96A 1SXJE 4LRWA 2ORWA 1XCPA 3KQLA 4RD3A 4TYPA 1AM4D 1NIJA 121PA 1YJ5A 4RVCA 3I32A 1UPTA 5B2ZA 5J47A 3UXMA 4GMDA 5FOSA 2XAUA 3KDSE 3MJRA 3GMTA 4FWIB 4XSGA 5G53C 4JL8A 1KI3A 2ZRBA 1W36D 1NKSA 5A0FA 2JGNA 3DMDA 1E1RD 2R65A 4CT4B 2BVNA 3ZQJA 3CZQA 1X1RA 5EE3A 4KJZA 1XWIA 5L3QB 5DHFA 2MMGA 3TK1A 1HURA 2J5XA 5AJXA 1P9NA 1L7VC 2X2EA 3RRYA 2O8FB 4C0LA 3AKYA 1NN1A 4EDHA 4L8GA 3W6PA 3ZLJA 2VQSA 5DNYB 4D0LB 1XP8A 2HDNB 3K0SA 1TF2A 1TUEA 3ICQB 2O8EA 1A7JA 5CM8B 1NP6A 2AD5A 5CK5A 5IF9A 2P2LA 1W1WA 2NPIA 1XCMA 4OQXA 2GTPA 2ZRFA 2GJ8A 5TDHA 2IYZA 1NJGA 4FINA 1FNNA 4R2IA 2I1QA 3V4RA 1SKQA 4GOXA 3QPWA 4ZDIA 1ZM9A 5LB4A 4B33A 3U3JA 2JJ2D 5DLQC 4TN1A 3IUYA 3PUZA 2TMKA 4NCIA 2IYUA 3TGPA 1CBUA 2JLWA 4BQSA 2ZSFA 5FFMA 5FTLA 1R2QA 4BLSA 2W2VA 4ZV4A 2J45A 1YZUA 2FDCA 4EJSC 1E1QA 4TSFA 3I8SA 1G291 4TLEA 1VDZA 2WOOA 4X8HA 4Y0AA 1Z3IX 3K70C 2EFCB 4RJLA 3QKSB 3PV0A 1U8ZA 3PEWA 3Q7QA 3GLGE 4JLPA 5AUQA 1W5SA 1WBBA 4RFSB 2XOKD 4TQAA 1CIPA 3FB4A 4A8JC 2CXXA 5EP4A 1U0LA 1GZSA 2F9LA 5FBQB 4C7OB 2GESA 3I1FA 1E9EA 2WSSA 2W00A 3ZVNA 4UNPA 4R7ZA 5KNBA 3F3YA 2OCBA 3K09C 1K6MA 2GXQA 4Z8YA 3I62A 3EW9A 4TL6A 3EC2A 2EW1A 4KBFA 2CBZA 2QORA 4MYTA 1K8RA 1E4YA 4TLAA 4PFSA 5FL7A 1XNJA 2RHDA 4TWZA 4L16A 4Q02A 2CDNA 4A15A 1NN5A 2GHIA 1UEIA 4JLKA 3K0CC 5ELXA 4UKDA 1UKVY 4RZUA 5EP1A 1ZUNB 4EAQA 621PA 1VG0B 2O8BB 1UKZA 2H5EA 1NNEA 2IYYA 3EC1A 4ZKEA 1EFRA 1GSIA 1IBRA 2ZSBA 5IRCD 4GZLA 4I4LA 2XXAA 4XIGS 5BQ5A 3RLFA 3ZDQA 3QNUA 1G7CA 3C14C 3QPVA 4LGMA 1U9IA 3AVWA 3ETLA 3JVVA 5KU1A 1S0UA 2EU8A 1ZUHA 4HDOB 4B76A 3NDBB 1DEKA 4CDGA 5DIFA 4IOMA 3KTAA 4LC0A 2EFHB 4HZUA 1NF3A 4IXNA 3LW7A 3SQWA 3KJEA 2QQEA 2BOVA 5KYKA 2BMDA 3Q85A 4LYFA 4D82A 1G4AE 3CZPA 1GL6A 2R6DA 5IT5A 1GKYA 2YWEA 3WY9A 5CJ2A 4PPFA 3SU8A 5LB2A 1RPZA 4B6FA 1NG1A 2WAXA 3VX4A 4AY2A 4QGHA 4O2LA 2WPDD 3B5JA 1E2LA 3D8BA 4KCGA 3T5GA 3CR7A 1EFUA 5EE0A 4AKEA 5JFGA 1QHHA 1CJMA 1F2TA 2O5VA 3WNCA 1Q0UA 5A5GA 1COWA 3BH7A 1L4YA 2PX3A 4LZZA 1S9HA 3AF4A 2ZEJA 5H70A 1HQYE 3ZJYA 5L3QA 2AN9A 4POAA 4EPRA 1VCMA 1CJTC 1J7KA 3G5UA 3DKPA 5FUYA 3AUYA 3U4QB 1CF4A 2YYZA 3QIAA 4F93B 5DI9A 2NMVA 2H16A 2J0UA 4DJTA 3T15A 5CIQA 1A4RA 4YMTA 2O0JA 3CX7A 1Q1BA 1CRQA 1QF9A 3MG9A 1KDOA 4RD4A 4M1YA 3KKPA 5FUWA 1WRBA 4DBLC 2ZANA 2CEAA 2IYSA 1CU1A 3FOZA 3T35A 2HF9A 1P73A 2B6HA 4FXPA 4MRPA 2FZ4A 5FUVA 2CK3A 2P6UA 2WV9A 1ZD8A 3P20A 2Q3MA 1E9BA 4EKDA 2GBLA 2IL1A 1GKUB 1IN7A 5AWFC 2FEMA 3DPUA 4PPGA 1OXXK 1P75A 5HCNA 1E1QD 3KJIA 2W2TA 4TSFD 4CRWB 2FFBA 2WHXA 1Q3TA 3AGQA 3BFVA 4QJ4A 1VG8A 2ODWA 4TMVA 4CW7A 3TVDA 2OM2A 5F3WB 2IXEA 2YOHA 4JVNA 1OFIA 3OAAA 5JWRA 5E7JA 3QXSA 1XTJA 4N3NA 2O8CB 2OG2A 4HDQB 5KSZA 2WSSD 4O3MA 3QXXA 2BCJQ 1UM8A 2GA8A 3EZ6A 3I8XA 4LWZA 4A0RA 5HR5A 5EXTA 3U7HB 2QBYB 3ASYA 2QTFA 1SXJB 3CH5A 1Q22A 2QP4A 4Q7JB 3IIMA 1G7TA 3BGWA 3QF7A 4C3ZA 4G01B 3ZD7A 4LYAA 4M1MA 1W4BA 2A5JA 2WKRA 1P6XA 3GLFB 1N0UA 4PAMA 2MMCA 1U0JA 5FOUA 2Y8EA 1SVOA 2J0SA 2RGNA 5FL7D 3IPXA 2GAOA 3MAAC 1S1MA 4OHXA 3LA6A 3SYNA 4PO9A 1NVUQ 1NL3A 3RABA 4DC9A 3SQXA 4LJ4A 4OHWA 2GXSA 1YRAA 1BKDR 5HTKA 1EGAA 3TJZA 1X3SA 2MSCB 2YWGA 4B75A 4NDZA 2AWNA 2GVZC 3TQFA 4HDCA 2XSZA 2IYRA 1JB1A 1EFRD 2AFIE 1IXRC 5E95A
chains in the Genus database with same CATH superfamily
4QARA 1NBOA 3GDWA 1Z13A 3RUHA 2FZLA 1YE8A 1TAUA 2XUFA 3KNZA 4WBSA 2IHBA 2XEXA 2WM9B 4AYTA 3OLQA 4GRDA 3G8YA 3GFBA 1R3UA 5JBIA 4PO3X 3I2HA 4V02A 4BE4A 1H05A 2F3QA 3OOSA 3WNVA 1H2BA 3CC8A 1XJQA 4WJKB 1U7PA 4PBRA 3QPUA 1MW8X 1C4XA 3B12A 4TVSA 1JR6A 1UM9B 2I2XB 3EJ6A 3DXXA 2H9IA 3TQRA 4N5LA 5A71A 1VG1A 1X74A 4Z7JA 3S1AA 4NS1A 5G0UA 1U9ZA 3MJ4A 4CBVA 1LV8A 1TYZA 2C97A 2FW1A 1RI1A 3EEYA 3ICEA 1CQPA 3R1IA 2Q8QA 4MR8B 2OLJA 3HA3A 4J0IA 3LLUA 4YDRA 4DG9A 2NO6A 3W4KA 4E7PA 2RKOA 3NXSA 4F5EA 4INAA 4EFLA 4M89A 1RJGA 5F2KA 2ID7A 1VPWA 3VZBA 4I1YA 2W5UA 3JWHA 1IZ9A 2GCGA 4WX2B 5BSKA 1FTYA 1E61A 2HU7A 3OIWA 1K86A 2J48A 1F8XA 4MS3B 1FBNA 3CX8A 1R7RA 5CLQA 4I46A 1Q57A 3OU2A 4K0RA 5EG5A 1XIVA 1Z68A 4RGVA 4H3HB 2C58A 3T34A 3U7GA 1L6IA 5AVOA 2ZUBA 3Q10A 3HI6A 2I2CA 4YJ3A 4L85A 5CG2A 5LLTA 2BCGY 1HSZA 1SQSA 2H0RA 4MVJG 3N70A 3TGWA 3VO1A 4FDTA 1G66A 4M9SA 4CMAA 1YHYA 1YZTA 1CCWA 3QVUA 2UUAB 4R5MA 2GEUA 2IZZA 1CUCA 5JU6A 2DY0A 1A50B 4Z4HA 3V32A 1P80A 2JCYA 2VNKA 3PE6A 5ESDA 1PF7E 1U5BA 2VH5R 2XE6A 4K03A 4MMZB 5IDXA 2HHHB 4B7ZA 1GQ2A 1DEXA 1MVOA 3A9CA 3RDPA 4ZI7B 2AZXA 2YCBA 3S1LA 1KEUA 2QL9A 2CMKA 2DUMA 4FYXA 3L6DA 1RRVA 2HBZA 5K7SA 1VJ1A 3F46A 5KYTA 3IAM1 2BFPA 3PNLA 2WMDA 4KQIA 4DQVA 4OI0A 2VWQA 1GPDG 4MRSA 4HDKB 2QTTA 1V48A 4HBZA 3VR4A 1Z4KA 3LP5A 3W1VA 1SNYA 2CFIA 4TQUS 2I6TA 2JL1A 5I9IA 3R8FA 5EIBC 4A2PA 3PUYA 4PX2A 1XN4A 4YP7A 2F8TA 3BJZA 2CDCA 2QI9C 2YHIB 2Q1SA 4UQOA 1CVLA 3SCZA 3TIFA 5FBHA 3WGHA 1E3SA 1CD5A 1LQTA 1C0IA 3HSKA 1JAZA 3EGOA 3P19A 3TVTA 4FNMA 2XR1A 3H2YA 3UBTA 2PNJA 8GPBA 1E3WA 4FCCA 4MUMA 4IDCA 1UJ5A 4CMJA 4GXTA 4IS2A 3EGEA 2GK6A 1PJCA 5JHGB 2XW6A 3JYLA 3FDIA 3ETEA 2VT6A 1CS0B 4R3NA 4E6EA 1RQRA 8ADHA 1EFLA 4JU8A 3VJLA 3NALA 4RV4A 2C2BA 5LZ9A 1DG9A 1QX3A 2O3SA 3WGNA 2I33A 1OWLA 3T7RA 2MHCA 2RBGA 4MLDA 3T7SA 2P3SA 4HGYA 1XVVA 4H0NA 4JIGA 1I5OA 4Q0MA 4V0MA 1M72A 4JT9A 4HAWA 2G25A 1YJXA 1Q2XA 1V5WA 5ESRA 5JSHA 3D7NA 4EO4A 3CZMA 2V55B 3QU4A 2VZEA 2PGIA 4RVHA 3EPPA 2OYRA 1TM1E 4O4IB 4TQ9A 2J85A 4E5DA 1TRHA 2CXRA 2D4HA 2PZKA 3H84A 5CP8A 4TS4A 2DM6A 4JVSB 1N6PA 3N2ZB 4ILKA 1HNNA 2W43A 1A82A 4HQKA 1U7TA 3IPYA 2ZE6A 4YRNA 5DI3A 4R98A 5AVRA 2XLCA 5CUQA 3OY2A 5EMMA 2JG3A 3PZBA 1XEAA 4GP7A 3DMRA 1Y7IA 4DV2B 3GD5A 1CY1A 1PR3A 4YWHA 2C2KA 4EGCB 3VZSA 4G84A 4D97A 2O2DA 3SR0A 5E6UA 1NJ5A 5ANRB 3LY5A 4XH9B 2D8AA 1KQ3A 2GCOA 4RVNA 5FNZA 3E1KA 2ZR7A 1JG1A 4B4OA 2O1EA 4UCFA 3CF4G 4NMMA 4AJNA 2JLSA 5SZHB 4P4LA 3WL5A 3GF4A 4FNOA 5DTEA 5K0JA 3G7UA 1JBQA 3ZEAA 2WJ3A 3GRYA 1W4CA 2NPOA 1XXLA 1ZIPA 1BS1A 4OCZA 4F60A 3KFVA 5DTJA 1XMOB 4CCYB 2VA8A 5FP0A 3II6X 1Z7WA 2PD3A 2J41A 3CSDA 1PZNA 4MUBA 5DMXA 4BMPB 3SXJA 4CT0A 1TYAE 2QP3A 4GKAA 3T94A 4P7FA 3PFCA 1VP9A 3WTCA 5IAOA 4EZEA 2WD8A 3MELA 1YUBA 3CO5A 2P4QA 2ROQA 4BLOA 3EPHA 5HGXA 1M6EX 2HSDA 3K30A 3UW1A 1GUBA 1D5CA 1YMQA 3FVWA 4Y2TA 1PU2A 3OCVA 3R7SA 3WIEA 1WV0A 3PX7A 16PKA 2E4YA 3E8XA 3JS5A 5BNZA 3ETNA 4IGKA 4NBUA 1DPGA 1EFVA 2DMRA 3WBBA 4K9DA 3KVYA 1Q0RA 2OV8A 1GZ5A 4S0XA 5LDGA 3THYA 3WV4A 1QQ6A 3ENZA 3NGMA 2FUCA 1W73A 3DV9A 3UPUA 3ZDZB 4FN4A 3B6KA 4W6QA 4G5OA 3CNQS 2AVNA 3LUJA 4H2DA 5C4MA 3DTYA 3CPEA 1DEHA 1TM7E 1OFGA 3L8ZA 1BRMA 3QBTA 3BN3A 3TTXA 1QZZA 1TCAA 2AZDA 1YQGA 2OO3A 2VAMA 3OPQA 3WGZA 2ZE7A 4MDFA 4TZ0A 1X6VA 1JIIA 4NBLA 5B1HA 1EK6A 2VNIA 5LOVF 3TW8A 1NVVQ 2ZIXB 2R66A 3CVWA 1O96B 1TK9A 2QMHA 1S8OA 2QMZA 4BUZA 2BMJA 4Z2YA 1YCDA 4NJEA 1R8QA 1PJSA 2XVYA 2BTEA 2WB4A 4HTFB 4RVFA 1OU4A 1K5DA 2EL7A 3PDIA 4GMHA 1QVRA 2HIMA 4HDNA 4QL3A 4WCFC 2B34A 1UBOS 3T7IA 1F6BA 3KC2A 5FA6A 3I6YA 1A4XA 1EFDN 1EGQA 2QE7A 3RSGA 3QSYA 4LRQA 1VZ2A 2A9JA 2JLZA 1H8HA 1JXMA 4IRXA 1HQKA 4QDJA 2IFTA 1LSSA 3WYDA 4CR8A 2IK8A 5CURA 4DA9A 3LH5A 4EWLA 1FSFA 3CNOA 3AWIA 5LMZA 1YBFA 2LIPA 1YAJA 4ZT4A 3NHUA 2PSHA 3EBOA 4GO1A 3TTVA 1EXNA 4O4JB 3AVVA 2Z3WA 2DQKA 5H3LA 1VZ3A 1Y3FE 1YKSA 4NNJA 1DAIA 5AJYA 4KP7A 5LLSA 2IUUA 1WAMA 2JFYA 2GKOA 2JK0A 2Z8YA 3V8QA 2Q7OE 1M6VA 2WTBA 4P98A 1HQCA 3GV0A 1Y4UA 1ZS9A 2BR5A 2NX2A 2EF1A 3BK1A 4YVFA 4OJTA 3AVXA 2P2DA 4RW0A 2I6UA 2P78A 4KMMA 2J6HA 3PIDA 2N3ZA 1QHYA 3WG9A 5LD2C 1GR1A 1Y6RA 4ZVLA 1MQ9A 4G2TA 4O5OA 4M9CA 3LZCA 2W93A 2TYSB 4J7CA 4F12A 2H07A 1Y6QA 2G1KA 4AZWA 4RK4A 4DR7B 3QLVA 4HVTA 3UAOA 4DA8A 2H5IA 2PIDA 2QM7A 2ZPAA 3HYTA 3O38A 4HDAA 4XFJA 3FMOB 1VLZA 2WU3A 4OHOA 1LI4A 1CETA 1E20A 1NVFA 2B4RO 2FEWB 2XYGA 3OX1A 4PQRA 2J31A 2NQ2C 1E2DA 3PHGA 1K7EB 4F96A 4KTVE 1ZHHA 1TCUA 4Q3EA 1H5QA 5EKXA 5JNVA 3WLMA 2A2ZA 1YDEA 1XDBA 2EQAA 5EINA 3VDRA 1U8FO 2H1IA 1NQAO 4ZQEA 4C5CA 4CQMB 4Q6WA 1KFKB 1PNQA 5DPMA 3U4AA 3ZCVA 2NUAA 3OICA 1NHGA 1Z8FA 2REQA 2D74A 4FGKA 3RC8A 5L45A 1JLLB 1IEQA 1MV8A 2PL5A 2X0KA 4EHNA 3IILA 1NAHA 2C1EA 1WQ4A 2AUMA 3PITA 2VKTA 1F7UA 3W3AD 3C3BA 2W6ZA 4JQZA 3T7AA 3DDZX 1DWPA 2JHFA 3C1TA 2JGIA 5KNBH 2WKPA 1IK4A 1WXDA 4DSTA 4CXMA 4LRYA 3ZYCA 2H2HA 5CVDA 1BGXT 4BCDA 1T3TA 2YUIA 4REOA 3NWBA 1L7XA 2JC3A 2O0HA 4CN8A 4HMOA 4MVXA 4MWZA 3LF2A 5KTPA 1UFOA 4GXQA 3NATA 1ABEA 2HK8A 5H7XA 3ABRB 1V6SA 3T0FA 4F9TA 2FE1A 4LY9A 1X7WB 2ID8A 3EVCA 1ICEA 2I9KA 3UJHA 1QTIA 2AJBA 1GA6A 4KFRA 1FW6A 3CW9A 4JXZA 3LAWA 1O9HA 1TEHA 1FW8A 5EI5A 3VISA 3KUKA 1SK8A 5TXGA 1MG5A 3K8YA 4NE2A 3KUUA 4DS3A 3SYTA 4PHGA 4BIMA 4NU5A 4RJTA 1PFWA 3HSYA 2DHDA 4P4SA 4R16A 1GD1O 4HZUB 3EAGA 1KGDA 4J16A 5ECGC 2QX8A 2Y3IA 3VSEA 1U3GA 1U28A 3DD1A 1DB3A 1SZCA 2MIIA 3WBKA 2VTVA 4HQ0A 3DEFA 1YDHA 4ISCA 1WLSA 5LZ2A 2VDKB 2Q5OA 3C6KA 3GNQA 1JJVA 2WD9A 2GNOA 2WOJA 4HFNA 4V0ME 4BEBA 1JG3A 1JHVA 4ARSA 3ZCQA 4ZVPA 4JOCA 2WJ6A 1DWUA 2IEDA 3H97A 2X2PA 1SC3A 2AGVA 2XDAA 2D0IA 3PXDA 5TARA 3KHTA 3BZUA 1K6JA 2IGBA 4OVKA 3S0JA 1LB1B 1ZC3A 2ZJ4A 3OHMA 4O0MA 3EH2A 2ZXEA 1R0XA 2D7JA 2H3EA 3G88A 3JQQA 4YECA 5AJHA 3ZH9B 4CKEA 1M6YA 4NK4A 4Z0NA 1F2TB 2P79A 4OBXA 1YB7A 5ALTA 1MQAA 4EUEA 2B78A 3C4QA 3BGDA 3FUVA 5KVCA 4KH1A 1R5OA 4H0CA 4HCJA 1WNFA 2VNJA 2AOUA 4G5SA 4KOAA 3TE6A 1YONA 2J30A 2R86A 1WDLA 4PNPA 1I24A 4E03A 4B6GA 2HRZA 1XMXA 3TZEA 3ZPXA 2IU3A 4LBYA 4HXFB 4PAGA 2NAPA 1RBZA 2X9NA 2WTXA 1PGPA 1DRJA 3NZEA 3R23A 4MA4A 3WSVA 3QEMB 1DELA 4UHHA 4EA8A 4TYNA 2B94A 1NURA 1PYGA 2J9YB 3M1YA 1OLSA 2QPOA 2J0UB 3REGA 3F73A 1SEPA 4FONA 1J07A 4JBWA 1T3HA 1L9XA 5FBVB 3GH3A 2QD5A 3GMDA 1H23A 1NATA 2X4LA 5P8WA 3SHVA 5AJZA 5A2QA 3GAZA 2UXDB 1Z18A 3EIHA 4JI5B 3UT5A 5BYAA 2C4VA 4AZSA 2JLVA 5LQMA 4LHZA 4F3YA 1UBMS 4OXNA 4CTKA 2PQ0A 3A14A 4M6WA 4I4IA 3TEMA 2A0XA 5HJ7A 4LIPD 4JYMA 1QFXA 3SKYA 3QVWA 3ZNQA 1CQXA 4M2LA 1RPNA 3FNIA 4DVJA 2ZR8A 3K0BA 3NASA 1BVUA 1YBAA 1QG2A 5J5CA 1Y42X 2OCKA 2F1JA 4B8ZA 5U4XA 2RJNA 3F4KA 3TAHA 1PUXA 4UVEA 5CXUA 2QROA 1XMVA 1FP6A 5A4FS 2BR3A 1YQ9A 2FP4A 2RHCA 1YDWA 5D5QA 5EJGA 3W34A 2Y77A 4C78A 4LGVA 1GCAA 3PQ5A 4PZZA 4C21A 2ZWPA 4ARAA 1NMYA 4M87A 4AZ3A 2QXYA 1GCGA 4ZDJA 1BNCA 3CN7A 4HNHA 3B2NA 2IYFA 2QJTA 4UTVA 2JZCA 4IIJA 4ZAWA 1H3FA 2V6MA 4HQLA 2H1HA 1ZGHA 4U6SA 2CL5A 2XB8A 4ZYZA 1SHJA 1YQQA 4DRYA 1P5HA 1PJAA 2BI4A 4CIBA 1DAKA 2D0DA 2DWOA 4QUJA 2XH8A 4XYLA 4I9UA 4V03A 5B7NA 3HDGA 3PQEA 1T5IA 2JAHA 4H9GA 4JCCA 1KMMA 3WLFA 3EZLA 5HRUA 1G9TA 1TQDA 2H1FA 3KLPX 5KCZA 1UJBA 5KYVA 2I54A 1Y1KE 4CQJA 3OJFA 4MR9A 4HWPA 2AK3A 4IGEA 4Y30A 5CA0B 4AMBA 4DEVA 1XDSA 3P71T 4GBMA 4IHJF 3QU7A 3OFND 2YYAA 2C83A 2WWGA 1E9DA 3KCNA 3MIZA 4NVRA 3SC6A 5KOYA 3HEBA 3ZE6A 1VPLA 3BUSA 4Q18A 3ZTTA 4XX0B 3TTUA 1W88B 4CHTA 3RS5A 2E49A 4DB4A 4HGRA 2PMFA 3PHIA 2OXIA 6AT1A 2OYSA 3HVHA 4ZI2A 1P72A 5H4GA 3HJTA 3KM0A 2JFNA 4JELA 3O95A 4GLJA 4ZP1A 4J43A 1GV0A 4B4KA 4DXAA 2WIJA 2X6RA 1EX9A 3LQFA 1V8PA 4GI5A 4IO0A 3UWOA 3LQ1A 1AGYA 2IHYA 2HHAA 3MQFA 2HV9A 2CFOA 2QN8A 4J0DA 5ED0A 1VMEA 2OCYC 4XWTA 5K01A 1T3LA 3AIMA 1LRLA 1T9DA 3MRXA 3NU1A 4IX9A 1W8DA 4RA9A 5G02A 5BO5A 3RFFA 4CDNA 3RR2A 3GAMA 5DNWA 3D0RA 2QR3A 4L72A 4HH3C 3NBZC 4PO8A 1GAWA 4MUFA 2DQSA 4BGDA 1SG0A 2GTIA 1C9YA 2INGX 1IHYA 2XMCA 3LUAA 3BAFA 1KSGA 3W7BA 4C5AA 2IHNA 1I0ZA 1ZP6A 3AUAA 2UXBB 5A6VA 2OGSA 1QCCA 2X9GA 4XTCS 4PCVA 5TMBA 3OEHD 4Q1DA 1EWVA 4OLAA 4FOLA 4ZAGA 3E8MA 1NONA 3G82C 3Q5GA 5ED4A 2HSJA 1CZUA 4TS3A 2R8EA 3A11A 1KQFA 1D1PA 5G1NA 2N46A 3JWIA 1PD1A 1RXYA 4MP3A 3BXHA 3O9MA 5GOZA 1ZMTA 3SZ3A 1H4QA 4C4TA 4TLMB 4DREA 1XXHA 1FDTA 4BO9A 1OW3B 3MTQA 5D5PA 4LC1A 2XD9A 3N8DA 4K1LA 2YRWA 2UAGA 3H8SA 1XCLA 3OWXA 3WWDA 2FUEA 1ONPA 2FPPB 3SQLA 1JA1A 4MDHA 1E9AA 2V6GA 3CRRA 2JJYA 3ZK8A 1IZYA 3CG0A 3E7FA 4J0KA 3WK8A 4WOPA 4C88A 4LFAB 1Q44A 1I51A 1IZ7A 2YJGA 3G5AA 2RHRA 5T7BA 5CTJA 5KUTA 4HEJA 4TXLA 1YH3A 3O47A 3ROQA 4B3XA 4TWAA 2BE7A 4HEA6 3HY6A 4P86A 5GJVC 1Q0HA 2FA9A 2A0YA 1IM2A 1K98A 1UAYA 1UJ4A 2L82A 2BF7A 2BP7A 2R79A 1YL6A 1BOFA 1JQJC 2YWFA 4L6IA 4CUJA 4DWJA 3RC3A 4L73A 2VOEA 3E2MA 4C4SA 3H6HA 4LRUA 2D0OB 3NP7A 5GOTA 1QG6A 1RJDA 2PM8A 2Q6KA 3AHHA 3C3KA 4K40A 3ZGOA 1HDYA 1UDRA 4J3NA 2CMFA 4N0EA 1T8UA 4CDRA 4EHHA 2VEDA 4MIOA 4MYHA 2FETA 3RVKA 1A88A 2QN6A 2AYYA 3RYCA 3GDFA 1XA0A 1FXWA 3IKTA 2CVHA 4G6ZA 2V96A 2ZI9A 1BH6A 1SKYB 2K87A 1RYBA 3PQFA 2X9VA 3HU1A 1T3GA 4HNRA 3SQDA 1KMHB 3ER6A 4XQEA 3SDZA 1FYEA 4QO8A 1AS2A 2X0FA 3RYTC 5EJ4A 3NRJA 4O4LA 1P6QA 2GNAA 3U19A 1WKVA 2IZ0A 3K09A 2Z4SA 4KTTE 3BIOA 3L8HA 4UCWA 3CA8A 4X3OA 4BFZA 5F9MA 3ZD6A 2QRGA 4P35A 2H0AA 5ERYA 1NVWQ 1E6EA 3BOSA 4A8PA 1TMGE 4RVDA 5DLDA 5B4VA 1E89A 2TECE 4UOQA 3RT9A 2IOQA 1PG2A 1W96A 3F6RA 3SZRA 4DMRA 4B3TB 2K4MA 4U9IS 5IHXA 1FK8A 4HLCA 3GNSA 4HN9A 3U81A 4AW9A 4EY8A 1G41A 5IDWA 5C0OE 2V5AA 1L5MA 3IXMA 3K8OE 1YL7A 4UASA 5EVCA 2AJDA 4NFLA 3U60B 4OJQA 1XMPA 2AI1A 2W2LD 1KQNA 1RCUA 2VZ9A 3O4RA 3CTMA 3LPMA 1N6OA 2H51A 4DEXA 2QGFA 1HYEA 1FVFA 1KTVA 2M1ZA 4H08A 1D0VA 1JEQA 3AINA 5IJAA 3UIEA 3R5KA 1R10A 5I01A 1KDPA 4JOQA 4QOSA 1P31A 2OZLB 2PGJA 4XEHA 4AN4A 4EKIA 2HCJB 5EC8A 1IY1A 4KBYA 2Q5EA 4MQMA 3MGKA 1Z7EA 3H7AA 3BIXA 4UUPA 2BL4A 3B78A 1Z28A 1SCKA 4NZMA 4PE5B 3KAKA 5SZKB 4IRUB 3F97A 4D3DA 4RC9A 4Z9BA 3SICE 3VAAA 3W6UA 4WTOA 4B81A 3C8ZA 721PA 5JAHA 4ID3A 4KNVA 1VCOA 4CV2A 3PYXA 5HUHA 1CIVA 2IPAB 3TLEA 1X77A 2PYZA 2ACVA 3I3OA 3GUUA 3UV3A 2JLYA 3EXIB 1W0CA 4Y2HA 3D6JA 3TBKA 1QXSA 4JI6B 1R0LA 6NULA 1NI4A 4AZ0B 1FU8A 1KH3A 3CIFA 3CUKA 4FBMA 4Q82A 3SF0A 4C7VA 4DARA 1V6AA 3UMYA 2BM0A 1IIBA 1KSJA 1CUYA 1KYQA 1M1NA 1NUAA 2CNNA 2RHGB 1GGNA 4JVMA 4MS1B 2OBXA 4IKPA 4YJDA 1XYYA 4MVJH 2R6R1 4CDMA 4EB6A 2IS1A 2W22A 8ATCA 2FFJA 5L9AA 4D92A 1GILA 1PNOA 4FIDA 4PRZA 2G82A 2YWDA 4PS0A 1MD9A 4TSRA 2C7QA 3NC4A 4K6OA 4PSVA 4JC5A 3QKUA 4RU1A 2HCBA 2PX5A 2A58A 1XTIA 2J3LA 1F20A 1USGA 5JXIA 2XQVA 5G4LA 4EAAA 3CH7A 1XVUA 5ALLA 1Z17A 1Z3CA 1SXJC 2OT3B 4XPIB 5ICSA 1KEKA 4D9NA 3ANNA 2PJDA 1DNPA 5H9VA 1KJNA 3BMQB 4UOZA 5H5JA 3TAXA 4UQPA 5A4AA 1G38A 2OLKA 5ENZA 1GZ7A 1JX6A 3HO6A 5C8DA 1HE1C 1VIVA 4KWIA 2YC2C 5K0ZA 2J67A 2FSVA 2YC4C 1D4AA 2CL0X 2Q4OA 2Q6IA 3QHPA 4OQ4A 4R71A 2E5LB 2RAUA 3UK6A 4BVHA 3BDVA 1UKAA 2P1ZA 3EGDA 3GMIA 1CJUC 3LOQA 2Q4RA 3TZ6A 3WMFA 1NNSA 2R0QC 4WZBA 2IS2A 2P9ZA 1B74A 3IP3A 1KXZA 2JIBA 4GKVA 2RK6A 4DIEA 5CNMA 2DSTA 5T6MA 2KYRA 2R4UA 2HMYB 3J7TA 1J06A 1ZIDA 2HU2A 1K06A 1HZJA 2DCMA 2YV4A 3EUEA 4GRIA 2Z98A 1ULUA 3P0RA 4CT5A 2HRCA 3UWKA 1QYDA 1A7KA 4C7MA 3MS4A 4D9CA 3H3FA 3GFSA 3QUTA 1ZK4A 3RVSA 1DTWB 3AM4A 4RZXA 1BMTA 3GLHB 3JYHA 3AB7A 3JQ7B 1PNVA 2PKWA 1SCDA 1YZKA 5ITVA 3UB2A 1CDEA 4GX2A 1EA5A 1JIKA 3ZXIA 1W25A 1GUFA 3W5HA 1KK1A 1BA3A 3R0QA 5ARDA 5G4KA 1PQYA 5CEFA 4O1IA 4N7BA 4ZAZA 1PE0A 1YNOA 1AZLA 1RWMA 2XODA 3PHBE 4LQ4A 3SEFA 3O7WA 3QVOA 4U02A 4YT8A 1IRXA 1MAVA 1QV7A 2LZ0A 3U4CA 3ETCA 1MOPA 1O95D 3BCRA 3ZV7A 2GN8A 3EXG2 4IP0A 3AR2A 5I9NA 4NXNB 4KO4S 3R6GA 4YMIA 3BMCA 1X0VA 1DJNA 2HSEA 1AN9A 1JR3D 4TKZA 3SSNA 1VECA 1M75A 5DX8A 2CSUA 5BW8A 1HA3A 4EF4A 4RENA 3IMKA 1EM6A 1N5OX 4YK7A 4BVBA 1OUMA 1I2DA 4EPXA 3EPJA 1H2WA 1YD7A 2CK3D 2HMSA 5DNVA 3LDGA 3QYJA 2D2FA 1W85A 2VO1A 4J0CA 5IVHA 4EVIA 4J6EA 5A5VA 3LT0A 2GBFA 2JIDA 4EKGA 4PTLA 2Z6VA 2IQIA 5EP3A 1T4GA 2ECPA 4WACA 4WN9A 3RHTA 4CKYA 1Z37A 2AN5A 1E7QA 3FLAA 3S3TA 1W6UA 4NE7A 2W2OA 4BGUA 1QNFA 1WHSB 3I09A 4JEHA 4NBSA 2PQ6A 1TZCA 3H1PA 5J1SB 3TEJA 2VAVA 4OGLA 3V4SA 1GZUA 1DAGA 1E3LA 1EJ0A 1QF7A 1QYRA 4GDFA 2BZGA 4KX5A 2BI7A 1OH8A 1XXHE 1XZAA 1MO6A 2FPGB 4FILA 2YFKA 3OT1B 1Z73A 4R1UA 1M7GA 1PNRA 2PT7A 3HCEA 2FWPA 4UUAA 2PR7A 2W98A 1ZA2A 2PWBA 3ANSA 3MGBA 2QQGA 4BAUA 1DQRA 2PJUA 1OVMA 1PQPA 3E5RA 3OCCA 3B5EA 4XYMA 1XP5A 1PFKA 2C2XA 1DO8A 3UTDA 1IBSA 4CMCA 5EMJA 2CNLA 1TXGA 3UPDA 1SOWA 3KD3A 1RMYA 1SB9A 3EIUA 1VHLA 2Q62A 2I65A 4RLQA 2DR0A 4BQPA 1YL5A 4CMEC 1GNTA 4C30A 3U61B 1GCOA 1ZXBA 4QJ3A 4TM8A 4JL5A 5EWJB 5INTA 2L19A 5JQGB 4QUDA 5LQNA 4OUDB 3HXOA 3BCUA 2Z1MA 3QFTA 4JWKA 4YO7A 2CNKA 3JQBA 1LPMA 1ESNA 2C7BA 2YJ5A 1VLJA 3LK6A 1RLOA 3A9TA 3T5CA 2FZVA 1OLUB 1YV9A 4K6HA 3I4CA 2BKUA 4E5VA 1MT0A 2BFOA 3IKVA 3IDFA 2CD9A 4NFYA 2X77A 3GP5A 1W0JA 1BH2A 4PYMA 1R4ZA 1RE0A 2HMTA 2OKCA 3I0MA 4WXYB 3VBCA 4ESOA 1KOGA 1H6AA 3S5UA 1ZQ9A 4HDSB 1PFYA 1G5QA 3LLCA 4I1OA 3EY4A 4O8ZA 2XCUA 3Q9SA 3M3HA 4KR6A 2Q07A 1BW9A 3TSWA 3IESA 4AG3A 1PVOA 4EHKA 1KOFA 3E61A 3K0AA 5LUBA 2C94A 1AXGA 1G3IA 4LF7B 2HI0A 3AR4A 3IVXA 5TLSA 1Y0BA 4WOKA 2QSUA 2C8VA 3CINA 2VJMB 3IEKA 2X0DA 5E3IA 4BAGA 2PGXA 4M1SA 1QOZA 1JHYA 2LCIA 4GZ5A 2X1HA 1RI4A 5IASA 5L3SB 4AP6A 4FLFA 4RM3A 3FSGD 3EOAI 1C9KA 4B34A 4CM9D 3T7TA 3IVAA 3K6SB 2BEUB 1US8B 3INRA 5JJIA 1L4EA 2YN0A 1E2JA 1G5IA 2BFBA 2H2IA 2YVAA 3F9CA 4HGQA 4EY3A 1T4BA 4MEAA 1NXWA 3L8FA 1USVA 4IWYA 4YP9A 5BYJA 1HT2E 3OKFA 1DADA 3NONA 3LBNA 1GL3A 4AZTA 4KN9S 3GARA 5KJEA 1J1IA 1Q1QA 2E21A 3JQGA 4CETA 5J43A 1NN3A 2AJ8A 4J1TC 1GDTA 3KWMA 3I6ZA 2CUKA 4QUBA 1ADBA 5BURA 4WZAA 1GXSB 3F71A 4KR7A 1D3AA 1P4RA 3LUDA 2IDJA 4K1XA 4RGQA 2LDBA 2R1UA 1AURA 1EDBA 1DAHA 4RGYA 4C6TA 3ZS8A 3EZ9A 3FUUA 4LX8A 4ODIA 3H13A 4ZODA 5B7QA 3SKXA 4G4SO 2O3TA 4W5WA 4O5AA 4ABTA 3U13A 5FIUA 2IV2X 4EHBA 4Z8XA 4FQ5A 4KXMA 2E85A 3F2VA 4G37A 1IN1A 3RIEA 1IPFA 1Q1NA 3WWYA 5IUKC 4PYIA 3LPAA 3Q0EA 3CG4A 3DMGA 3F6BX 1JJAA 3GUYA 4O59O 4QXMA 4DJAA 1ZIOA 3FA2A 3HB0A 1QAMA 1PVDA 5BWOA 3ZHCA 2LTAA 4NECA 4CCWA 2V4UA 4W1SA 2VFAA 5TPWA 2ZWAA 2C20A 4TV9B 3VR0A 3ZR4B 3OOWA 5EVJA 1E6WA 1P5ZB 4A9AA 4G8CA 2EYUA 3K0KA 4AKIA 3C15C 3KKNA 5B1IA 2ZB2A 3Q41A 4HWOA 1EX1A 3GCGA 5E38A 1V25A 1FP2A 1IN6A 4FSHA 5ETJA 5BYBA 1YB5A 3BJMA 3NMUF 1WX1A 3PRJA 2QVYX 1KIFA 2QYSA 3NW9A 2AQIA 1E99A 2XE8A 3TR5A 2J9FB 4ZAFA 4RXMA 4BNTA 5D6OA 4FR2A 1RYZA 2CFSA 5BMVF 4C4AA 4ID9A 5T5QA 4INJA 1JG7A 1FUYB 3D8UA 4WZBE 3FLMA 2GF0A 1OLXB 3HCFA 2FV8A 4BNXA 3HWX1 4RZQA 3N87A 1C80A 3HWSA 1EQ2A 3CV3A 1GQFA 3OPXA 3T6KA 5K0SA 1XHEA 3ECSA 1XAJA 2FQYA 5AIBA 3TOSA 3U44A 4BWFB 1CR6A 2LNDA 2O7RA 3CRVA 4KHZA 1DQZA 3NIWA 4GUDA 3DEYX 4WKNA 3ZEIA 1JA9A 5EHGA 4R0MA 2DULA 4R9NA 4U8GA 3RSZA 3P9XA 4UBJA 3HCPA 1L5FA 2ICAA 3QVKA 3GYGA 3ORRA 3UHPA 4A23A 1NUHA 1JEOA 1S96A 3ESRA 3C5CA 1G64A 1O0CA 2XCLA 1EFCA 4I2VA 4LNAA 2JIZA 1DC7A 4HRXA 2HPZA 4OG2A 2G0NA 3GDOA 3EFEA 4B3GA 2XOKA 3DO6A 3RJZA 2IHVA 1JSZA 3IAXA 4RFVA 2H85A 4D8YA 2YZMA 4QKQA 2ZS9A 1CW2B 2BFDB 4NXMB 2IGTA 1E1LA 1IN5A 2AZMA 4GP9A 1Z33A 2R1TA 3RIGA 2ZR0A 1EXWA 1XTVA 1I4WA 4R1NA 1VCNA 3PXGA 2XUZA 4FIZA 1GGMA 3ZU4A 4XKJA 2MSWA 4ZPJA 1IC6A 1RI3A 1Z34A 4GMXA 2Q4BA 1KI4A 2JIMA 1SUIA 4K46A 1RXSA 1Z0FA 2FW9A 2XA2A 2YV2A 3L43A 5JDCA 4RULA 4UXIA 1DBQA 2BHNA 4NBWA 1GEEA 2AOVA 5HF9A 1YK1A 1NV9A 2VHVA 3RSSA 5EKUA 1Z6ZA 3DP7A 5A7GA 4CMKA 1X7XB 2I8LA 3MYRA 4RTQA 4UTNA 1ENYA 1RW4A 2DPMA 4NENA 1GFIA 4H7JA 4B9EA 2DBYA 4WGGA 3S27A 3RBVA 1E2EA 2JH8A 3JVEA 2IY9A 3T3MB 4CF6A 1OC2A 1ZH4A 3NHWA 3PD0A 4IYJA 2H2DA 3VU9B 1KVSA 5BSWA 1ZVKA 3IT2A 3WK7A 3LV8A 5CVJA 5I7FA 5DN6A 2XGJA 2EJWA 1FL9A 1RTTA 1V6CA 2JD1A 2YIDA 3EEIA 1NDUA 4UD6A 4CV0A 2ENWA 2I8CA 2JZOA 2ZTUA 3TD2A 1Z5WA 5KO2A 4UBKA 5I51A 4BLWA 4IBOA 1KI6A 4LMRA 1R88A 4C2TA 4NP6A 3LM8A 3D8NA 1S9DA 2CW5A 5AK6A 3WAKA 3OEWA 4M9XA 3BK7A 2I34A 2WFLA 4J4HA 1JPNA 2V0NA 3H19A 2TRSB 1TTTA 1GN9A 3B8EA 3PNKA 1BHSA 3KPVA 1I6LA 3I6BA 2OG1A 3VNAA 4EENA 3KO8A 1ECLA 4REQA 4UEQA 4G1CA 2CBGA 1ZRNA 3HFRA 4GSLA 4M38A 3JRNA 4OP1A 2VYVD 4Q37A 5HQJA 3S2UA 1EWTA 3BRWD 2B8JA 3C97A 2BJHA 3GEEA 3LQRA 4NPAA 3UT6A 5AVWA 3MYYA 2I3GA 2B4QA 5E6SA 3EE6A 5IDYA 1YOBA 1ANKA 1ZLXA 4F2DA 4ZZ2A 5KNDD 5I3ZA 2NZYA 3EDRA 1KAEA 2QTVB 3BWEA 5KQGA 3PX2A 3R24A 1FSZA 1V26A 3U0VA 4H7PA 1ZUD1 2JIQA 4L5BA 3FPCA 1PFGA 2JA1A 1T0HB 3E48A 4FC6A 4M0MA 2AF4C 5C80A 3FJYA 3LGAA 3OZBA 4Q9NA 1MV5A 1TEXA 2WF7A 3ES9A 5BXYA 2FOXA 3IYLW 1I1HA 1TJ3A 2H2FA 1SVIA 5D51S 1PX0A 2WA1A 1U6IA 3UFXB 3AEXA 1V4BA 2DFLA 1B3BA 1S3GA 3PHHA 1K4YA 2VK4A 1ISPA 1P1FA 1WL8A 1Y8AA 3I2YX 4FC7A 4MJXA 3TXXA 3AERB 1R8SA 3ZVKA 1V9SA 2GCIA 2MINA 3A10A 2UZ4A 2JKVA 4EJSB 3W6OA 4JB3A 2FZCA 4DA7A 1VGVA 1JSCA 3G8BA 3K6KA 1PVVA 2P4HX 4LXHA 2Z04A 2NACA 4OM8A 4XVCA 4QREA 4B3MB 5AHOA 3L1UA 3AL3A 3PKJA 3CWCA 2GPBA 5BRJA 1BGWA 3AQIA 1FS5A 1JNXX 1OXKB 1W46A 1PZGA 2VYCA 3M6IA 1VIDA 2KBEA 2NLOA 2P9JA 2XMGA 2WU4A 4A8JB 1QDEA 3QUAA 5LP6A 4Y1FA 3KWFA 3P27A 3F6SA 3A4TA 2IE8A 5IT0A 4KR3A 4UVIA 1RBYA 3ZCPA 1N8NA 3MUFA 4IZHA 2QI9F 3VOSA 5BN1A 2A5DA 2F59A 4GRAA 4LGCA 3KV3O 4JJGA 1CY6A 5EIFA 4L4ZA 4WZAE 3ROZA 1GTJ1 1FFWA 1Q12A 2PS3A 4BLPA 3V8VA 5CLIA 4QOHA 1QB7A 5DYYA 5BT8A 5JAMA 3DEZA 4PC6A 4RJIA 3UVEA 5BQOA 3HPQA 1K7CA 4IQFA 4WA7A 5DISB 3TPFA 3RVMA 2PU5A 421PA 2LGJA 1UC5B 2IUEA 3C74A 3FROA 2OHVA 4L75A 4UAGA 1L5HA 2O14A 1OX6A 2R4TA 1BMDA 1FJ2A 3FRIA 1UL1X 2RCYA 1FTNA 4U7TB 4P7JA 2XAAA 1OBFO 2HJGA 3MIIA 4D8WA 3R74A 1EA7A 2MOKA 4L8WB 4P33A 3RM3A 2XKKA 1E6LA 4C2UA 5BT9A 2H52A 3A28A 2FKAA 1IUOA 3GUZA 3QELA 5KSYA 4NH0A 1NNLA 3NUQA 1ZN2A 4F91B 4MYUA 1MP0A 1HMPA 2Y4OA 1RQLA 3HLYA 4RNDB 4DBZA 1AZSC 1GZ6A 3QJGA 3DL4A 3VHQA 1AKYA 3ZWYA 3LC7O 5BQPA 4K9LA 4TLDA 5K8TA 3GGGA 5EFOA 3A26A 4O2BF 1OI2A 2P4EA 4JWTA 3JQRA 4IJVA 2IH5A 4J1NA 2WJZB 2ADMA 1Z6AA 2JIRA 4L0DA 3QEJA 1FFBA 2A7QA 2QAGA 1E4EB 1FLVA 3NG1A 4ZDWA 3C41J 1HEUA 4WKBA 4KSCA 2QTCA 2P2SA 4BNVA 2Z30A 3VR1A 2OECA 2VBIA 1DI0A 1PR2A 1WW2A 2O0LA 2BFMA 3K8ZA 3BH0A 4GZ3A 2AS0A 4N65A 4XOIA 5A4DA 3I58A 4ALJA 3FWHA 5KOHA 3KXDA