1L4YA

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp at 2.0 angstrom resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 56
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1l4yA00
5C18A 1KI4A 2IT1A 3DMDA 2W6JA 2W00A 2WM9B 2QROA 5SZHB 4M2LA 2RCNA 2FH5B 3IDQA 1SZPA 3LH5A 3THXB 2WJGA 2ZI7A 2A7QA 2C8VA 4TL7A 4LUCA 3ZS8A 2YINC 1G8GA 3QIAA 4Q03A 4MA4A 4QC2A 1I2MA 2FPKA 1H65A 3RRMA 3WYFA 1C1YA 4JLAA 1BIFA 4Q9JA 2N42A 3BB3A 1NMXA 1SXJB 2XB4A 1P75A 4TQAA 4Q1EA 4NE2A 2ASEA 4OQXA 4GDFA 1GNQA 1GL7A 1N5LA 4JLBA 1G3IA 1NRJB 3VNVA 1KO8A 3BRWD 4UJ5A 4MH0R 2C77A 2YVUA 3E2IA 1G7RA 4CW7A 3B1XA 3I73A 3GEEA 4MRRA 3DL0A 3ZQJA 1R7RA 3LV8A 5CYOA 4JSYA 3SFZA 2GKSA 4PHGA 1UF9A 3QKUA 4AYWA 2ZE8A 3R9WA 1JEEA 2ANCA 5HR5A 5E7IA 2IS2A 1L7VC 5DIFA 3QI2A 4DUGA 4TLDA 3VKGA 3FDIA 1Z0JA 3DOEA 3C5HA 1XTKA 2IXGA 3AF2A 4AIIA 3T35A 4JLNA 2FGKA 5AUOB 4DCSA 2I1VB 2C95A 1NKTA 4G5GA 4D0NA 3U6BA 4JVMA 1XRJA 5GJWC 1OIXA 3TW8B 2HLDA 3NC1C 4R2IA 3VR6A 2VL7A 3CR7A 3F5FA 4EQ6B 2IWHA 1ZIPA 5KPDA 1DO2A 3U7FB 4EUNA 4HZIA 3K0FA 1P4SA 4AG6A 3Q3JB 3UMSA 1Z6AA 4JVNA 1TNDA 3A4MA 1NI3A 1F2TA 3MJRA 1KNQA 3W90A 3B9QA 3OHMA 3Q9LA 4PC3A 4RD2A 2JLQA 4PFSA 3LA6A 1W0JD 1G20E 1R6BX 3EWSA 3PUVA 4M1YA 2PCLA 4PZZA 2P0EA 1HT1E 2CL6X 1VIAA 2FFQA 2QY9A 2GZDA 1N0UA 4BEJA 3O8RA 3SFVA 2A5FA 4JT2A 2WSSA 1UM8A 2GJ9A 4MDEA 3OEHA 4CEJA 2GA8A 1S9HA 2C5LA 2OT3B 2OV2A 4P4TA 2F1RA 2PMDA 1RFLA 1DG3A 5JEDA 4GOJA 4PO9A 2D4HA 1MABB 5EUMA 3LRPA 4EPYA 1TEXA 3SYNA 4OQFA 2FDCA 4EPVA 1OH5A 3UG6A 1R2QA 4O2RA 3QE0A 2J7PA 1E2HA 4HLDA 3RLFA 1E0KA 4EJSA 4DDUA 1VCIA 2X8AA 4Q7LA 3KB1A 4XJXA 1Z63A 1IJEA 3OAAA 1Q12A 2QAGB 5FI0B 2XX3A 3NBZC 1I4DD 2EFCB 1EX7A 5JWHA 3C7KA 3V4RA 4OQLA 1W36B 1T4GA 4ZKDA 3U3MA 4Q1AA 3EPJA 4WZAE 4IFBA 3ZYCA 3U5ZB 3SC3A 1IM2A 1P2UA 1XXHE 3HU2A 4V0LA 5DHFA 1YR7A 2EU8A 1CR1A 1E2MA 2QENA 1QBKC 2VP4A 4BUJA 1X6VA 3DOFA 4Q01A 2JJ1D 2FEMA 3E5HA 3I4LA 3LQRA 4NCHA 1ZW6A 1G41A 4QNRA 4X8LA 1W2GA 1L8QA 4D81A 3THYA 5DLQC 2A5GA 1ZUHA 2J41A 3QEJA 2ZJ2A 4PQYA 1AJEA 4CEIA 2GAOA 4I81A 2XSZD 4PAMA 1G3UA 1OHHD 5EE9A 5J5CA 1OKKD 2ZE5A 4HUQA 1DAFA 3U44A 4FMBB 2KI5A 4HLUA 4PC2A 3GLIA 1EFHA 4PR0A 3LW8A 2XB2A 2ZI6A 4G3XA 3GLFB 1ODFA 1E1QD 2HT1A 3NC0C 1A5TA 1OPXA 1H8EA 2QSYA 4Q4JA 4C30A 3PQCA 4DEXA 5E7MA 2ZRMA 3VKHA 1K5GA 1FUUA 1U0LA 4II7A 3V4FA 1PVOA 3SJBA 4ON9A 3ZIAD 2J46A 1JAHA 1JR3E 1OYYA 1KK0A 3EIQA 5FPSA 3TBKA 2ZE6A 1I4LD 1KI6B 1MR3F 1KY3A 2VO1A 2QBYA 5KNBA 1T8UA 4OHXA 3Q85A 2RGDA 5IK2A 1E9CA 3K1JA 3GLGB 1QHHA 3T61A 1G7SA 1HQCA 1JR6A 1FX0B 3B9PA 3WMEA 3I8SA 2VIIA 4B3FX 2ZVPX 1QHSA 3QQ5A 4YMSA 1G7CA 2AKYA 4LGMA 1Z6XA 1M2OB 5EZ6B 3RS3A 1TMKA 2JDID 2IEZA 2QA5A 4KVAA 4H9GA 5AWFC 1U8ZA 5JI3E 3CRRA 3L0OA 4NONA 1E2LA 4P4SB 2R6FA 2XOKA 1BYIA 4JLPA 2PX0A 3CLVA 2P65A 5JFGA 4DRZA 5FL7A 4KBGA 2D2FA 4BLOA 1E9SA 3DHWC 3B6EA 2A2ZA 3BC1A 3VKWA 4ARZB 4PPNA 2W6IA 5DGXA 3WP0A 4O3MA 2ZEJA 2L0XA 4HDCA 3K0AA 1KO7A 5KYKA 2W2VA 5CLLA 2UKDA 2Z83A 4AURA 3CM0A 4I1OA 1QHYA 4ESHA 2QMEA 1CR2A 2ECKA 2QPTA 5E4FA 4PAQA 1XFAA 1II8B 1IN5A 2F1IA 4Q1DA 4TQ9A 5K8IA 1XPRA 4TZ6A 1WP9A 3GJ6A 4OI0A 1IXZA 4CEHA 2XXAB 3W9YA 1J70A 3B85A 5JBQA 5BN3A 4GRAA 4C7OB 5L3QA 1U0JA 3CBQA 1FP7A 3N5CA 3GFTA 4DIDA 1HTWA 5BN5A 1GAJA 3NEYA 2VHCA 4NZYA 4V0NA 1WQ1R 2R62A 1SKQA 4A8JA 1TUEA 1HT2E 1MRNA 1KI2A 4JYBA 1N6KA 3H1TA 1GWNA 3CUEF 1FQKA 2H57A 3AVWA 4B3BA 2QT0A 4JMPA 4RCYA 2XZLA 5DN6A 1KI7A 1S9DA 2NO7A 4K8OA 4PX9A 3F0TA 3ZQ6A 1E2KA 5UKDA 1KI8A 5D3QA 1NNEA 4NCNA 4D4KA 2EYUA 2OLJA 2R8RA 5B2ZA 1GSIA 4D0LB 3PEWA 1S3SA 3I62A 3S1AB 4M1SA 4DSOA 3VAAA 1CKEA 1DE0A 821PA 2DY1A 1GNPA 4CF7A 4B6EA 5GVSA 1QF9A 3MJHA 2QTFA 1P60A 2ZVQX 1J2JA 1QHNA 2QTHA 1KKLA 5AJVB 1G6OA 2Q9CA 1HYQA 3QENA 2DWOA 1G8YA 1S0UA 1VG1A 3KKOA 5DISB 2OUKA 3HR7A 2REBA 2OHFA 4GNKA 1TU4A 2OFXA 3A1SA 5JWOA 5LDDC 4UKDA 2CNWA 1XD8A 3X1XA 4TYWA 3P26A 1KO5A 2OE2A 1CJUC 1KJWA 1N6PA 4HSEA 3K9HA 3T15A 3ZZ0A 1N0WA 4BZPA 4URXR 1N6LA 4TQUS 5JCZA 3UK6A 4LOAA 3CNLA 2FZ4A 3CKLA 3TIFA 4DLZA 4GZLA 1II0A 1NJFA 3D7MA 4ZI3A 1T91A 4KFUA 2SHKA 3AF1A 2WJJA 2ZRFA 3GJ8A 3QKRA 1RRCA 1HH4A 1YKSA 3HR8A 4QBFA 3BORA 2GZAA 3VR3A 4R71A 1GNRA 5J4LA 3WRXC 1GG2A 1UKZA 3W6OA 3WBKA 4Q9IA 4MGZR 4XIGS 1XTSA 3CRMA 2ZI3A 4EPWA 1XXHA 1IOZA 2XZOA 4G5OA 2IHBA 4BFXA 1M74A 3LNCA 2ONKA 3QVUA 4TL6A 5IDVA 3T5GA 4AKEA 4JYCA 3EZ7A 3AV0B 2ONJA 2BEKA 3SDZA 3P4XA 1GRRA 3GLFE 2R65A 1KHTA 5BXQC 4CDGA 4CT5A 3THXA 1J7KA 1CRQA 3LBHA 1KSGA 1G3RA 3K09A 1ZNXA 5HCIA 3KKPA 2HT6A 2HJVA 2WOOA 3QKTA 1XPOA 1II9A 4Q1BA 2NIPA 4L15A 2PCJA 1SXJA 1B0UA 1U0HC 2BM1A 4XVUA 1X8JA 3Q7QA 1DBSA 5JLJA 5KHOC 4BE7B 3W3AA 5KNCA 2Q9BA 4FWTA 3B1VA 1XEXB 3DKVA 3AVTA 2ZRAA 2R6CA 1N6HA 2H8KA 1WRBA 2ORIA 4LJ8A 4NL4H 5IT5A 4QKQA 2Y8EA 2ZYVX 3AVVA 1GL9B 1JR3A 1UKYA 1HUQA 1TUIA 1DADA 4A15A 2OILA 1VTKA 4JJKA 2Q3MA 2QU8A 5CDFA 4AKGA 1XZQA 1G291 2JJ2D 3CX7A 1LW7A 2QTVB 1FNNA 1XEWY 1R5NA 1EGAA 5FH9A 2CL7X 5TMPA 1CULC 2ODBA 4DCTA 1IXSB 1FOEB 4NHOA 2HDNB 3IIJA 1M7GA 2BCJQ 3KXLA 1Z29A 2HJGA 1CEEA 1PUJA 4DLUA 4PSKA 2IUTA 3BFKA 2O8DB 4Q4LA 3BFXA 1Q3TA 2D2EA 4RD0A 4KITB 2WHXA 4BFZA 1FNMA 4H1VA 1OXVA 2WMNB 2VTKA 4MYTA 4EQ6A 1RW4A 1W4RA 4TMWA 3CRW1 5KU1A 1UADA 2DWQA 2HYDA 3BH6A 4P0TA 5J4KA 3FWYA 2IYSA 4GI7A 3H2YA 1P6XA 4FN5A 2CE2X 2EWVA 3RS4A 2IL1A 5LB4A 2J59A 2AKAB 1DO0A 2D7DA 3AUXA 4L5BA 2PJRA 1AZTA 2IXFA 3QXSA 4QM7A 3IO5A 2FF7A 2FSFA 1JI0A 1SVMA 1ZINA 2ZR9A 4O0MA 4POAA 3PEVA 3CPJB 3FB4A 3FVQA 2ZUCA 2PJZA 4LY6A 4TSFA 4Q47A 1D2EA 3GFOA 3RS7A 1CIPA 3PEYA 2GCPA 1JJ7A 1KYIA 1P62B 2BKUA 5DSZA 2G83A 1MKYA 4LV8B 3K70D 3TE6A 2Z5FA 1MABA 4RD1A 1KMHB 3GPLA 4TLBA 4ZKEA 4PHTA 1GP2A 1RRFA 3IIKA 5ELXA 1KZ7B 3KTAB 3SHWA 1UDXA 4D26A 1IY0A 3VR2A 3H86A 3I5YA 2NO1A 2PT5A 3UATA 5J47A 4FWIB 3NTUA 2RGGA 1VIYA 3AQ4A 3IO3A 2VP2A 1XCPA 1NVWQ 1OYWA 3RWOA 2QAGA 1COWA 1GITA 4D4MA 1HY3A 2BHRA 1IN4A 3ICQB 2W6JD 2RHMA 5H68A 4AD8A 3CX8A 3KQKA 2J0QA 4NU0A 4MRVA 3LVQE 2WZQA 3A1TA 2WBLC 4DLSA 2ZJ5A 3T5DA 2GVDC 4QGGA 5J4VA 3C15C 2OZEA 2UVQA 3JZMA 5JS7A 2QN6A 1L2TA 5HKKA 4K46A 3MUFA 2VF7A 3EC2A 2OFWA 2DCUA 5FI1B 2IS4A 4A82A 2RMKA 1OFHA 3ND9A 4R9UC 4WIAA 5HE9A 4LX0A 4A6XA 4PO1A 1E94E 3AH8A 4FCWA 3Q5DA 5LD2B 4JSTA 2GTPA 3FFBA 4RFVA 3AUYA 3BXZA 4BZQA 5B30A 1ZAKA 2R6DA 1AS2A 1QG2A 2IX3A 4URZR 1EFCA 4GP7A 4Q7MB 3OE7A 4KCGA 4Q21A 3T06B 1IJFA 4JLDA 2YOHA 2V8OA 4FMDF 3SQWA 1S3GA 3GLFA 1P2VA 3BIFA 5KO2A 4M8NE 2CLDX 1SVIA 4OQNA 4C4PA 4US2R 1T0HB 4MRNA 1N6RA 3W5JA 1P9RA 4ZDKA 3KXIA 2RGXA 4GMXA 4DUGD 3I61A 4DSTA 1W4AA 5EJEA 4UNRA 3AKEA 3FFAA 2ORVA 2GXSA 1RYHA 4Q00A 4LSGA 3KUCA 1KI6A 5FR1A 1XNJA 2VP9A 3L82B 5SZIA 3VX4A 2IYQA 5JCPA 3FPAA 1TL7C 1JEDA 3GLGA 2ODNA 3KB2A 3TVDA 2HLDD 1MO6A 2ZRCA 1ZVQA 4UXJA 2ODEA 2OO7A 3AVQA 3QF4A 4WXRA 4F4IA 4IFEA 4V0KA 4C0SA 2GEUA 2KSQA 5EUQB 4C0BA 3G0HA 4B3GA 2R9VA 3SU8A 4LHVA 5GADl 2YYZA 1G6HA 2ZRGA 1A4RA 4P4SA 3THOA 1IN6A 4DLXA 4LJ5A 1GOTA 3FHCB 4M22A 2RGBA 1AN0A 3BB4A 2I1QA 2A5YB 4MKGA 1LNZA 2CVFA 1Z28A 5SZJA 4ARZA 5TB5A 4Q19A 2ZYWX 3LBNA 3T1VA 3EPLA 5FPTA 2VA8A 3SN6A 3ADDA 3AP2A 3NVAA 5B64A 1LF0A 1OH6A 1JXOA 4NMMA 4BFWA 4U7DA 2FE4A 1II8A 3M6AA 1MV5A 4WXPA 1LTQA 1XD2B 4WA7A 2WSSD 1UPTA 3OEHD 2XXAA 2JJ8A 4QL3A 1S96A 1VDZA 1U94A 1QVAA 4C7OA 5AJYA 3O47A 1NY6A 4HUTA 1W44A 2GK7A 2YWGA 3C14C 3VTKA 1T5IA 4QHYA 1AIPA 1ELOA 1OT3A 1SKYB 2GRJA 5CB6A 1E2IA 3LO5A 4Z8YA 2QMHA 1A82A 3GP8A 1QHXA 3SBEA 2NZ8A 2J7PD 2O52A 2WAXA 3CRQA 2ZQ5A 3QPUA 2ZU0C 4A2PA 4LHZA 3TAUA 1JECA 3A4LA 1UBFA 4JS0A 4QGFA 1BOFA 1US8A 3GFPA 3OAAD 2V6IA 4B2PA 4I99A 2AX4A 1Z2CA 1AQYA 4MYHA 2MMGA 3LFUA 1VG8A 4G5QA 2XTZA 3HPRA 2V55B 5F2EA 3S1AA 4NYJR 1PZNA 2FPMA 4B3CA 4LPKA 4B3XA 4YXWA 2CHVA 3CRVA 2AFIE 1A2BA 1JAIA 1KOFA 5E7JA 3A37A 1N2CE 4OKSA 1RJ9B 5FOXA 4LJAA 3N70A 3CH5A 1E32A 3K0EA 1ZM3A 5FL3A 4NKRA 4TLCA 1ZC3A 3VQTA 2D06A 1VPLA 1F2UA 1JALA 5L3RA 4Z1MA 2NPFA 2WIAA 2ZUDA 5AJXA 1Z2AA 4KAXA 2W0MA 3WHKA 2VHUA 3EZ2A 3I32A 3CNOA 5L3SA 4KI0A 4PC7A 3CONA 1XMIA 3VHLB 3KJGA 3WYAA 2XNSA 2VRWA 2GEDA 1E2EA 2MSDB 3FHOA 3EG5A 1H8ED 2DFKB 4AWXA 5SZKB 1KY2A 3LDAA 2OBNA 2F9LA 5KUTA 1KDPA 2PLRA 721PA 1T3LA 2LKCA 3K9NA 2HF8A 3NKVA 1PV4A 2QUZA 4Q9HA 2ZU6A 5HTKA 1AKYA 4TZ0A 4LYFA 2D7CA 4B47A 1H8HA 5IK2D 3TUZC 5A4JA 3U2QA 4BEBA 4ZI2A 4PSVA 4ZCLA 1KKMA 2GXQA 3B1ZA 4RZ2A 5CITA 3ZZTA 4MKFA 3BAFA 1R8QA 121PA 3B2EA 4RKEA 3W8RA 2CHQA 4MGYR 3UIEA 4OL0A 4EDHA 4Z51A 3B1WA 1NP6A 4DWJA 4MGKR 5KDDA 2C9OA 3TGPA 4DB2A 5AUNB 3UWKA 3QXJA 3ZGXA 1EFRA 1U90A 4CGZA 4AYXA 2C96A 2DFLA 2GJSA 5FL7D 4FCTA 4GP6A 2JLUA 3AP1A 1UKEA 2QPAA 1N5IA 4RD4A 1XEXA 1CXZA 4PXAA 1E3MA 4UQOA 2W6ID 2J0UB 3BFVA 2OEPA 4OHYA 2V7QD 4IOMA 2FOLA 2XNDA 1T3HA 2PBRA 1PLKA 2P67A 3OESA 1CP2A 3I92A 1K8RA 4W5HA 2IYRA 4DLRA 8OHMA 2FN4A 2ZYTX 1YRBA 3H4MA 4LHYA 4OK3A 3LXRA 4GBMA 4URYR 1U98A 4DC9A 5B58C 5L3VA 4LDJA 1G5PA 2K5UA 2Z0MA 3DZ8A 1JQLB 1NIPA 2ZJ8A 1TF2A 1IQPA 3K9GA 4Q4HB 3SQXA 3OEEA 5JS8A 1KDOA 3FE2A 5DI3A 1P9WA 3BERA 2IA5A 3KKNA 2PT7A 4I4LA 4NYJQ 2J87A 4OYHA 4A2WA 5CK4A 2JLYA 3ZVLA 2OM2A 3K70C 4WZBE 2GXUA 5DN6D 1E79A 2DBYA 2FGJA 4E09A 3R9XA 1E0SA 1ZC4A 1T6NA 1XX6A 2O8DA 4DHEA 5FUYA 1R0XA 4PPFA 2I3BA 1LS6A 2REOA 3DPUA 3IPYA 4HDQB 4OJKA 4Q66C 2IWRA 4CT4B 3GLHB 1XZPA 1RPZA 3LX8A 3O8DA 4NDZA 4J0QA 4FI3C 5EXPA 5H1YA 1SKYE 1XU4A 3TUIC 3CZQA 1CTQA 1TPZA 4TMVA 5FOWA 3LWNA 2HXSA 2RGNA 3TUJC 4E03A 2Z4RA 1OXUA 1WE2A 2ANBA 3SS8A 2IYZA 421PA 1VHTA 4BGDA 2GVZC 3O8CA 2PZGA 2EFEB 3TQFA 1OB5A 1ZM4A 5JHGB 4XVQA 2CNWD 5JMTA 5TDHA 2GZHA 5DYIA 3SEAA 5EZ5A 1E4YA 2KJQA 2A3RA 1G1MA 3FMPB 3JZAA 4E07A 3V9PA 5BYJA 3Q7PA 2Z4SA 2ZSAA 1ZD1A 3NHBA 1VYUA 5FOTA 3TSZA 4JZKA 4OJQA 1SXJE 2HCBA 5FTLA 5FUVA 1WBBA 5CIWA 4IJMA 3GJ7A 2X19A 2WMOB 1KMHA 4LCBA 1G3MA 1M8PA 4A2QA 4QJ3A 4IEIA 3HWSA 3TSWA 3IEUA 3RAPR 1U9IC 2FWRA 1KDRA 3KTAA 3T12A 1GKIA 3RWMB 5AJWA 1ONBA 2KE5A 1R0ZA 2G1KA 1Z0IA 2GAAA 2QAJA 2BBWA 1CJMA 2ZUBA 3SZRA 2VSOA 4B48A 5E3HA 5CDFE 4US0R 4LC1A 2ZTSA 3AVYA 1M7BA 4IEEA 4GFDA 2ZIAA 4B2LA 5F3WB 1P72A 1NKSA 5EXSA 3VFDA 3QBTA 3TKLA 1BS1A 5FBLB 1E0AA 2JIZA 3TQCA 2QGZA 2ZAOA 1NF3A 5M04A 3K0CC 2NZJA 3IGFA 4B34A 1W7AA 4RZUA 3CPHA 1NSTA 2FPLA 4EKDA 4HZUA 2V3CC 2H18A 3LVRE 3FMFA 1ANKA 2ZI9A 4ABYA 3BGWA 3IHWA 3E70C 1VECA 1YZTA 4JL6A 3PV0A 3VU9B 4LHWA 3LD9A 1NVUQ 4HAXA 2C99A 4D82A 2QPOA 5C1BA 1QZXA 1IAQA 1GKUB 4G1UC 1MO3A 2QM7A 4W5WA 2DYKA 1JR3D 3OF5A 2JASA 2NGRA 1W5TA 4TWZA 3EASA 4C9BA 3RS0A 1FFHA 1XCMA 2WJVA 2H16A 3P1JA 5D3MB 4D6PA 5AUQA 4N1AA 2XEXA 1SVOA 2CEAA 2BVNA 1UDWA 3NXSA 2QM8A 4HAYA 2R44A 4OHZA 4EPXA 2AL7A 4HLQB 2ZSDA 4V0ME 1NVVR 5EE3A 1IY1A 5J4YA 1E6CA 5HPYB 2IYXA 1EFTA 3RRZA 1ZD8A 2WWGA 4V03A 1XTJA 3K70B 4M1WA 3JVUA 3SJCA 4GMDA 5CJPA 2JEOA 4ACBA 2O0JA 4URUR 4BLPA 1D9ZA 4WAUA 5JRJA 4F93B 2G0NA 3QJYA 1F48A 1AA9A 4IDOA 4UNQA 4RZ3A 4C0JA 3PIRA 4BFSA 2CCGA 3I3SR 4EJSC 4QOSA 1Z5ZA 3TLXA 4BPBA 1QG4A 1YE8A 4JLVA 5KSYA 2GJKA 2WPDA 1SVWA 1AGPA 4PQRA 1DAKA 1GFIA 1XB2A 4RFSB 1OXTA 4KLZA 2ZJZA 4KXFB 4PQFA 5JJKA 3DEFA 4A4DA 2BOVA 3ZLJA 4XD7A 3VR1A 1KZGB 1CR0A 3U7HB 1IXRC 3U3RA 3AP3A 3SNHA 4EFMA 3LLUA 1G8FA 4PZYA 2MSEB 3NWJA 2ZJOA 1NG1A 1P9NA 2C04A 2BBSA 1T8TA 4FMDB 3PXGA 2F9MA 3CWZA 3GLHE 3GJXC 3Q5EA 4TYNA 4EFNA 2O8BB 3KQHA 4F4CA 1N3BA 1N5KA 2CDNA 1XD2A 2JJ1A 3U7GA 1W5SA 1MT0A 2B8TA 1X8KA 1Z6TA 4IDNA 1M1YE 2JATA 3PENA 4C0AC 4UXHA 4YMTA 1KNXA 2P3SA 4WZ6A 2UZIR 3CWQA 1N6NA 1UEJA 5L8VA 3KQUA 1HURA 1OHHA 3RANA 2QNRA 2RGAA 1ZCAA 1G18A 4JBYA 2J9RA 1V43A 3K8YA 3QY0A 2V9PA 3W5IA 5CB8A 2J3EA 4XWOA 3AB3A 2V6JA 1KSJA 3GQBA 1EXMA 4IXMA 4D80A 4QJ4A 4MKHA 4XSHA 1W46A 1KO4A 2V4ZA 1G8PA 1W36D 1OIVA 4B35A 1ZCBA 5DNYB 5LBIA 4BLTA 3BE4A 2QORA 2FSGA 3NIBA 3OIWA 4K81B 4V02A 2JLSA 4EPTA 2EVWX 2ATXA 2P6NA 3ETLA 3K0SA 2GESA 1WMSA 2UZ3A 3RHFA 1Q44A 3WYGA 1KTVA 4QJ5A 1NY5A 3T1OA 5KDOA 2QP3A 3CH4B 5HKKD 2AHOA 4MKIA 3GLGE 5FTNA 3IBYA 1RJ9A 3QF7A 2JDIA 4QBGB 2CCJA 3L0SA 2ZAMA 3CPEA 4O25A 3UXMA 5GVRA 1NVVQ 1UFQA 1Q1EA 5KTYA 4TTQA 1GKYA 2VHJA 5G40A 4Q18A 3TMKA 2C98A 3D6TB 5CM8B 3I5XA 2O8CB 1EWRA 2W83A 2AK2A 2ZJBA 4IW3B 1MOZA 1UBGA 3ASYA 3L0IB 5K8TA 3OE7D 3TR5A 3TW4A 2WJYA 2YHSA 3NDPA 5C46F 3EXAA 3KFVA 2H92A 4G5RA 4OBEA 3C4JA 4GPTA 2HYIC 2A78A 4L9SA 2EWWA 2G0TA 4PC1A 4UNSA 3IILA 3EZ6A 3QXXA 3T34A 3MSXA 2Q3HA 2QI9C 3AKCA 3GMTA 3REGA 1U2RA 1CR4A 2C9CA 4CEJB 3LBIA 4TL8A 1Z06A 2BWJA 2P6UA 2ZRKA 1BMFA 5JI2E 1TTTA 2GETA 5JHHB 2J0SA 1R0WA 4A8JC 4PPQA 4PO8A 4B33A 4LJ9A 3TNFA 3TSOA 5FBWB 4ASUD 1E9EA 1OF1A 1P7CA 4B75A 1U8AA 4RKFA 1E9BA 1RE0A 2XJ4A 3B78A 3FTQA 2IBMA 5KSPA 3IKJA 4NCIA 1YR9A 3ND8A 1JQJC 4QFMA 4OI4A 2YWFA 4IVRA 2FU5C 5C4MA 1IY2A 4PTLA 3L43A 4LBYA 3GJ5A 1XEFA 3VMFA 4ZDJA 1OFUX 2GBLC 1JXMA 2OXRA 4JKYA 4V0MA 4GOKA 2J0UA 2XJ9A 3QVVA 4URWR 3SYKA 4QHTA 3SBDA 4L16A 2ZSFA 3QNUA 3AEZA 1X86B 4ZIRB 4EAQA 1NBME 2B6HA 2YKGA 1DOAA 2YOFA 2ZI4A 4X8MA 1G4AE 1A2KC 1T3SA 1UBCA 2GF0A 1S1CA 3UANA 2EFHB 4NTZA 3BBPA 3HU3A 2IF0A 2RB4A 2RHDA 3P4YA 4LI0A 2HUPA 2WWIA 4IDQA 4PANA 4Q4HA 1N6IA 1D2NA 2GNOA 3HPQA 2RKOA 1QDEA 3LQQA 1OW3B 2A30A 4Q9LA 1FZQA 1EX6A 1YQTA 3BOSA 3MLEA 1XTIA 2FMXA 3PG5A 4DIEA 5FUWA 3U44B 1SQ5A 4CIDA 2HF9A 4I1VA 2DB3A 4KO8A 2A9KA 4TLAA 3EIHA 3SJZA 4BFYA 3E1SA 1GRNA 2ZRBA 3G5UA 1Q1BA 2GEVA 2QP4A 3KXKA 4R7ZA 2BMFA 2FFAA 3VHXA 1GRQA 3U4QB 4V0OA 3TVTA 5AR1A 3ZVNA 3GLHA 3NBXX 4UXIA 5LB2A 1CU1A 3HJNA 3WRYC 1E99A 2PEZA 2JLRA 4XWKA 2QBYB 2AFHE 5A0FA 1ZYUA 1ZM7A 5IRCD 4YXWD 2WWYA 4QG7A 2BDTA 1NLZA 4B71A 4DBLC 4MYUA 5DE3A 5CYPA 621PA 1XCGB 2VYFA 4HB2A 1G17A 4I1UA 4HB4A 4TMKA 2IYYA 3K09C 1W0KA 3THWB 3QEOA 1YR6A 3D3QA 2GDJA 1W48A 2WVJA 2Q9AA 4IVPA 2JGNA 5G53C 2H17A 1Z08A 2IK8A 3WY9A 5B57C 4LJ7A 1OE0A 3U3OA 4YMUA 2VPPA 4Z1MD 4XTRA 1FW6A 4NYIR 3WP1B 4HAWA 1K5DA 2FNAA 1KIMA 4FW9A 2MMCA 4HAUA 4JVSB 5BWMA 1Q20A 1Z83A 5DHAA 3UMRA 4IDPA 2NG1A 2QG6A 1CJVC 3VR5A 1SHKA 1E2NA 2BKEA 2R6AA 1M34E 2GCNA 1KSHA 5JZVA 2BEJA 1Q22A 2NTYC 2BMJA 2EFGA 3GEIA 2G6BA 4UJ3A 3WNCA 1OB2A 4QBHA 1JBKA 5JEEA 4TTPA 1DG1G 4ZO4A 3WMGA 1JNYA 3ZZUA 3ADBA 1YZNA 5L3QB 1BYUA 3IHLA 1JB1A 2YNMA 2O5VA 1FX0A 1H8HD 4C2TA 2WKRA 3WXMA 1OV4A 1PUIA 1C9KA 4XH9B 3NH9A 1SGWA 3KJEA 4IDHA 5GJCA 4IOKA 1GUAA 5FBVB 3A1UA 4YMWA 3X1ZA 2P2LA 4C0QC 1GTVA 4XSGA 1Q1ZA 2E87A 2N1BA 2OLKA 4TT3A 3A6PC 2WAYA 4DKXA 1TQ2A 2IS1A 1SVKA 1F5NA 1G7TA 4GZMA 3DVLA 3FKSA 4A0HA 4BZXA 3EW9A 5EXXA 1TQDA 1EFRD 4RD3A 3L2OB 1DPFA 5HZHA 1TQ4A 1WB9A 2CK3A 4X8OA 3RYTC 4BFUA 2XGJA 3VU9A 5H8WA 2X1VA 2RGCA 4IOLA 3MWLA 4KFSA 4KYUA 1E1RA 1J8MF 1KK1A 4HI0E 2ZXUA 1FTNA 3VNUA 1YZLA 1X1SA 5CM9C 2XNDD 4LC0A 4IOJA 1OIWA 4TYQA 2ZRHA 5P21A 3EPKA 3B60A 4JL8A 1ZUIA 5HE8A 3SHFA 5JECA 2F3RA 4JLOA 1E9DA 1S2MA 1Z0DA 3TK1A 4HEJA 2CLSA 5D3MA 1AS3A 2ORWA 5EP3A 2ZRJA 3PCRB 4NBSA 1RRGA 1RRPA 3EARA 2NO9A 3FYHA 4M9QA 2PH1A 2F1JA 3B1YA 1Z8FA 1FP6A 5DO9A 4QHSA 2PLFA 2ERYA 4BLRA 1FQJA 1G5RA 4DB4A 1V5WA 4JIMA 1D9XA 4JVLA 1OFIA 4TMZA 1CS4C 6Q21A 3BH0A 1ZNYA 1SVSA 3GJ4A 5JSZB 2P6RA 2EQBA 2FSIA 2WWXA 1KK2A 3SR0A 4DEYA 4DZZA 1E79D 2CVHA 2VP0A 4OHWA 4DDWA 1P73A 2IC5A 3IQWA 3PFIA 2P5SA 3FMIA 1NMYA 1SVLA 4ACAA 4IKEA 2D3WA 3SE0A 1WF3A 2Q3FA 2BBOA 5G3ZA 3TAHA 4DJTA 4TTRA 4X8HA 1N25A 1ZD9A 2AK3A 1GDDA 4DDTA 2F7SA 1NBMA 4Z54A 4KJZA 2NPIA 3EA5A 3MD0A 5H70A 4ZCMA 2J0VA 4RFSA 1D5CA 1OXSC 1F3OA 4NYIQ 2EW1A 2OAP1 2WV9A 4B3DA 3NH6A 4A0GA 2NMVA 1W36C 5A5GA 1KI9A 5CJ2A 3LLMA 2DFNA 4UNPA 1Q0UA 4KVGA 3L8ZA 2C03A 1GIAA 4OI2A 4B32A 3KQLA 5GJBA 1P3JA 3FKQA 1BH2A 2O8BA 1NLFA 3CB4A 4YMVA 5TVKA 2WJHA 3QXCA 4DXAA 5JWRA 3QG5A 3AKYA 3IQXA 2X2FA 3UKDA 2QE7A 3KL4A 5DH9A 2WWHA 3IIMA 3RNLA 5EP2A 4F91B 1DARA 3HYRA 3MWKA 3TJZA 2ZYUX 5FUXA 5C2JB 2JLZA 3ZD7A 3OFNA 1XMVA 1FMLA 2JA1A 1U8YA 3D8BA 4B2IA 1E9RA 1YR8A 2BC9A 1U9IA 1WA5A 2G88A 3AVPA 3QUSA 1A1VA 1G19A 2ZR0A 4KHZA 4BLSA 5IHPA 3KQNA 2AR7A 1I4TD 1G8HA 3NG1A 5EP1A 3EAQA 3ZVRA 2AD1A 2O8FB 4QGAA 1ZU4A 3MMPA 3IEVA 1GVNB 4FMCF 2ZRPA 4KFRA 2JLXA 4JL5A 2YV5A 2BM0A 3ECCA 5FTMA 2ZSEA 1HA3A 2EYQA 2QP9X 3TH5A 1KAOA 2R6GA 4GL2A 1N5JA 2QEQA 4KLNA 3KZ1E 2JIZD 5C4GB 4U00A 4URVR 521PA 3K0CA 3A1VA 2XOKD 3BWDD 4TMTA 2FJUA 4E5UA 4MQBA 3RC3A 1RKBA 2ODWA 3MWJA 4KSCA 3V00A 5JRZA 3EPHA 2OCPA 4DLTA 4JKIA 1E9FA 1G3QA 3QPWA 1DAEA 2A5JA 1I2DA 2IYUA 1M7HA 1XTQA 2J7KA 2OSBA 2ZRLA 2IYTA 4ZV4A 3D31A 1DEKA 4HDOB 3ZVMA 2WWWA 3A1WA 3KFXA 1KO1A 1Q1QA 1ZRHA 2VHQA 3R7WB 5KSOA 2O8CA 1E69A 3CF2A 5F9FA 1T5LA 1ZM9A 4M53A 5DYGA 4OI1A 1LV7A 3K53A 3BS4A 4BFTA 2VLIA 2AWNA 1NN5A 1NL3A 2BJWA 1KJYA 5FPHA 5EP4A 1DAHA 4QRHA 3I8XA 2F43B 4MITA 1EG7A 1VCMA 4B43A 4OQMA 4A9AA 2O8EB 4FXPA 4DCVA 1E2FA 1XTRA 4PSAA 2CJWB 4D2IA 2ZROA 2QL6A 4PZLA 1X8LA 3A58B 2OBLA 4Q1CA 1D6JA 2XTMA 4PAOA 5FOVA 4ESVA 5CK5A 1ZU5A 1CBUA 1CLUA 1ZP6A 2E1RA 3DDCA 4W9MC 1G64A 3ASZA 3AKDA 4UNNA 4B74A 1KAGA 2WWFA 4C0KA 2CXXA 3KKQA 4Q48A 4DDVA 1P2SA 3FMOB 4XOIA 1K6MA 2IYLD 4DLYA 4LJYA 4YONB 1YJ5A 2PEYA 2WPDD 1EWQA 1AZSC 4LK2A 1KSFX 1W4BA 1R4AA 2LCFA 4HLCA 2H1LA 4QBIA 2V1UA 2FEOA 2YZ2A 2P5TB 2J1LA 1VG9B 4KU4A 4XD7D 2IF2A 4M9SA 1NIJA 5EE5B 2AD5A 2TMKA 3SYLA 3C5CA 4M1MA 4FINA 1X3SA 1UKVY 3C16C 4P33A 5FPYA 3U3KA 5K8LA 1EFUA 2B92A 2VF8A 4JBXA 4IVQA 1D8TA 3AGQA 2WKQA 4ERNA 4ZIRA 1CJKC 3X1WA 3CNNA 2GK6A 3H84A 2G3YA 1GM5A 3I72A 4F4JA 4LHXA 4BRWA 3RSLA 2JAQA 5FBRB 4TYYA 1ZMXA 5JJIA 2OBMA 2GF9A 1GILA 2IW3A 1LS1A 2OCYC 1E2GA 2FA9A 3P20A 4M1TA 4HAZA 4TN1A 2YC4C 2MSCB 4QNMA 3F8TA 2AXPA 1DVRA 3MG9A 4ZDWA 221PA 4D4JA 2CCKA 3EA0A 4YC7A 1Y63A 2W2TA 1IONA 3RDPA 4P4UA 3LAWA 2OG2A 4OK6A 3GD7A 5J40A 3U4QA 4AY2A 1DAGA 1CJTC 3CZPA 4N3NA 1XEWX 1XMJA 2FSHA 4XVRA 1SULA 1RVDA 2O0HA 1EK0A 3F3YA 1Z3IX 1VCNA 2OFOA 2G77B 4DVGA 1VYVA 1XWIA 4MRSA 3NEJA 3WMFA 1SXJD 1BKDR 1Z07A 1DS6A 1NJGA 1Q3HA 4P31A 3C8UA 4R2HA 3ICEA 1W1WA 2DR3A 5KOYA 2REXB 4M9ZA 4G0NA 3QF4B 1VHLA 3CF0A 3UWOA 3IUYA 3CO5A 4BQSA 3A4NA 4M4SA 4HB0A 3THWA 4ILEA 4A6PA 2NQ2C 4TYPA 3MAAC 3QKSB 4TLEA 2WIBA 2ZANA 3NDBB 3KJHA 1E2PA 2R2AA 4RY2A 2PZFA 1OSNA 4M0LA 2RGEA 5G41A 1MO4A 2QMOA 4DLWA 1W0JA 1AK2A 4NCJA 2GJ8A 3ZDQA 1YHNA 1RYFA 2XAUA 3AVXA 4JBWA 1ZUNB 4NPHA 2V7QA 1T9HA 5EXTA 1FMJA 4EIWA 3B13B 4RCZA 1WBDA 4DT1B 1Z22A 4N0EA 1CRPA 1LFDB 1PJRA 4A1FA 1G4UR 4L9WA 2VSXA 4HB3A 2X77A 3PITA 3N2IA 2OCAA 1Z0FA 3M4YA 1O87A 4F7WA 2EFDB 4O2LA 3DKPA 3HDTA 1T0JB 4JJZA 4LPSA 1BMFD 4C0LA 1XPUA 2GCOB 2QSZA 2J45A 4RJLA 3REFA 2ZPTX 2OXCA 2XZPA 3P27A 3PR1A 5TXGA 2GJAA 2H5EA 3SJAA 2BIFA 1XJCA 1IN7A 4W5JA 5HCNA 4AYTA 1NG9A 3CW2A 4AC9A 4Q4AB 1J99A 3EC1A 4MDFA 1KJZA 2ZSBA 3DO6A 3GJ0A 5EE0A 1KGDA 1N0VC 1N6OA 3B5JA 1R10A 1US8B 1XMSA 1ZNZA 1KI1A 2VH5R 1F60A 3CX6A 1NN0A 2F3TA 1WCV1 1UAAA 3R20A 1AKEA 3BH7A 2WKPA 3HP1A 4US1R 3AF0A 3KX2A 2GBLA 2VSFA 4GSYA 2CLCX 2FZLA 4PPGA 5HZKA 1WDTA 3C41J 1EESA 2HCJB 1Z0KA 2V1XA 2YJTD 4LYHA 3WBJA 2RGNC 3K9LA 3EWAA 1D2MA 4MUAA 3TRFA 1IN8A 2Q0HA 4HATA 1FL9A 4TSFD 3AVUA 1G16A 2WJIA 1QHGA 4ZDIA 4A92A 2NOAA 3EX7C 1E2JA 4IHQA 4U5XA 1XP8A 2BMEA 1HE8B 2ZRDA 5BN4A 2ZRIA 3FHTA 5AUPB 3U6KA 5EQTA 2XSZA 4A36A 4F38A 1OKKA 2ZRNA 4NCKA 1F2UB 1AM4D 1W47A 1G9XA 3N2EA 5FTKA 4HLUC 5KNDA 1TADA 1E1QA 5JSZA 4DSUA 4KV9A 5L3SB 1UEIA 1J8YF 3MCAA 1COWD 2FFBA 3HYTA 4CYMA 3RVBA 1ETUA 2XITA 3ZIAA 3W34A 4E22A 3R8CA 2Q6TA 3X1DA 4A0FA 1LY1A 3W3ZB 3FGNA 2GHIA 3P32A 3RSOA 4QGHA 4WVFA 4LBVA 3HU1A 3OIYA 4OHVA 2KWIA 4KODA 4G5SA 4DCNA 4D0GA 1QHIA 4G01B 3VR4A 2PMKA 2A5DA 2H7VA 1J90A 5ANRB 5E95A 2YOGA 4I1SA 3PUWA 1P5ZB 2PZEA 5F9HA 2ZE7A 1AQUA 3QOFA 4JLJA 2IS6A 1FUKA 4M1KA 4ITRC 4QM6A 3UG7A 3BB1A 3K0FB 1R0YA 1W0KD 2D62A 2HEIA 4ZPXA 3NBYC 2JLWA 1TEVA 1E0JA 4U02A 1B23P 1F2TB 1ESMA 3M0EA 4EFLA 1VKJA 5IF9A 1L4UA 1ZJ6A 3ADCA 1NVXQ 5TV2A 1P61B 3WNBA 2XTNA 1RC8A 3M1IA 4IRUB 4XTCS 4Q7JB 1Q21A 3KKMA 5LD2C 1S8FA 2QRZA 4N0DA 4BFVA 2IYWA 2RH5A 5BQ5A 4A0RA 4NP6A 2QMUA 2RAPA 1HEIA 2IYVA 3PEUA 2F6RA 1R5OA 1ZM2A 3KUDA 3AVOA 2IUSA 1ESNA 4LBZA 5KDLA 3W6NA 2VHTA 3WNDA 3X2SA 4IXNA 1TF5A 3RC8A 2O8FA 2FV8A 3KJIA 2FX3A 5FOSA 2QRNA 3ZS9A 2QQEA 2AXNA 3DM5A 2C9YA 5DI3B 3U60B 1G21E 4L4UA 1IHUA 4EJSB 3T1QA 4RD6A 3AF3A 2JCSA 4LV6A 2F55A 4FD2A 3MRSA 4W7SA 4TT3D 1XF9A 1P2TA 4YDHB 3W6PA 1KI3A 4KFTA 4D4LA 3FKSD 2VBCA 3PUXA 4WBSA 4BRUA 4MGIR 3QXHA 4LZZA 3BJIC 2JLVA 2CK3D 2OCBA 4NH0A 1JPJA 3LW7A 4S2EA 1XDBA 1E1RD 2CMKA 2ZITA 1Z6YA 2VP5A 1QVRA 3QSYA 4GT1A 4S35A 3R7WA 5EE1A 1NLYA 1TAGA 2IEYA 4Q02A 4LWZA 5FOUA 2G9NA 4DLVA 1ZNWA 1TF7A 4CVNA 2B7CA 1S1MA 3UPUA 2DWPA 5FFMA 1ZIOA 3FOZA 3DZDA 3THYB 1XJ0A 4H1UA 3R8FA 1W49A 2F43A 3EZFA 1KMQA 2QZ4A 2O0KA 2VEDA 4PC6A 2G1JA 2ZR7A 4CEIB 4C2UA 3U61B 2O8EA 1XBTA 2ZS8A 3PVSA 2CE7A 4FMCB 4FIDA 4YQFA 2AN9A 3BK7A 4HUQB 2CJWA 4Y0AA 1TQ6A 2B21A 2HV8A 4OK5A 4M1OA 3GLIB 1XJQA 5CLQA 1MO5A 3ONWA 1LB1B 1XD9A 1HV8A 2ZM5A 3LY5A 3U7EB 1Q57A 1GL6A 3GEHA 1F6BA 1YRAA 4LYJA 5LPNA 4Q4JB 2BCGY 2CBZA 4P32A 3LX5A 1NMZA 2YWEA 1E96A 2ZREA 5AJZA 2WICA 4XWAA 4D25A 3A36A 3OIVA 1E4VA 1RIFA 2BJVA 2ZI5A 4LBWA 5FR2A 3RS5A 1DELA 1Y3AA 2BBTA 1NSFA 2LWIA 1C4OA 2AWOA 1NBMD 1QHHB 3Q8XB 3UMFA 3IBGA 3JVVA 4B44A 5J4HA 4YLGA 1MH1A 1S4QA 1OJLA 2OAQ1 4HYYA 3AGPA 5FPKA 1L4YA 2IXEA 4ZCIA 4KBFA 3VX3A 4LJ4A 4R98A 3Q72A 1W4CA 1YZKA 4Y0VA 2HXYA 1QRAA 2V54A 1HQYE 3PUYA 1KDTA 5TY0A 3ADKA 2Z43A 1PLLA 4NYMR 2C78A 2FG5A 4RSGA 3R9IA 4Q1FA 2Q21A 4Z8XA 4BASA 2WTUA 1VG0B 3CR8A 1SXJC 3L0PA 4CRWB 4HZUB 3RABA 3ZD6A 5F98A 4AKHA 1YZQA 1DAMA 1KK3A 2D74A 1AGRA 3J81k 1OLOA 1YVDA 1E2DA 3GCGA 5KSZA 1JJVA 1BO6A 3K0AB 3QG1A 2VP6A 2QE7D 2ERXA 3SOPA 4HAVA 4WW0A 3MWYW 2IUUA 2Z6VA 2KB0A 3LXXA 4QXAA 3T1TA 1NN3A 3IPXA 2ZJYA 3NHAA 4FCVA 1OH7A 3OFND 2W0SA 4C0HA 5KPJA 1OFTA 1WXQA 1Z6GA 3DM9B 2BV3A 1ZBDA 2FFHA 4KSBA 4CEHB 2W2XA 2C2HA 2DPXA 2JJ2A 1R5BA 4PHHA 4LJ6A 2WOJA 2DFTA 2ZS7A 1PLJA 4F92B 2KBFA 4A8JB 3PJRA 3KDSE 4P3YA 1FPMA 2N46A 3B7GA 1M6NA 3RRNA 4B76A 1W2HA 4M21A 4GOXA 5FBQB 1UBEA 3ZH9B 1TX4B 4LV5B 3EZ9A 4AG5A 4B6FA 1X1RA 5CIQA 1HE1C 2VQSA 3QPVA 3TR0A 4RVCA 5DI9A 3B8HA 2PX3A 3A8TA 1Z0AA 1E9AA 3OIUA 3QBVA 2ATVA 3X1YA 3O8BA 4BWYA 4WOPA 3WHLA 3L8YA 3AM1A 3H0KA 1JPNA 1YZUA 1U81A 2ZJAA 4ASUA 3GJ3A 4TMXA 1MRSA 4MRPA 5BYKA 1YU9A 4JLMA 5FTJA 4AKIA 3I1FA 3EIEA 4LRWA 4BECA 1DAIA 4C3ZA 3QKSA 4MYCA 2LKDA 3BD9A 5GJVC 3RRYA 5BW8A 2J5XA 5TARA 2YWHA 1SHZA 2NO0A 1E98A 2OESA 2QGNA 1E2QA 2PL3A 2W58A 2WSMA 3B82A 3DMNA 2CL0X 4YDSA 1GZSA 4L8GA 3RS2A 2E9SA 3SI7A 3AF4A 3MFYA 1TU3A 4TL9A 4JLKA 3OEED 2NO6A 2B7BA 2KBEA 1U99A 4RZXA 2YC2C 4CZ2A 4MUBA 4DT1A 1DTSA 4Q9KA 3PUZA 1Z47A 5JJLA 3CIOA 1VYTA 2IHYA 3QKRB 1UJ2A 2GXAA 2F1HA 1O3YA 1A7JA 1LVGA 4M9XA 3W8NA 1OXXK 3U3JA 4LYAA 2QQ0A 3G82C 1NN1A 1G5TA 2GCOA 2I4IA 1IBRA 1RZ3A 3CF6R 5AK0A 5G3YA 4PHFA 4AK9A 1AS0A 2ZETA 1FTSA 1OH8A 4JT4A 3OZXA 4BLQA 2GWHA 1XXHB 2B8WA 4Q7KA 1LF5A 4Q5IA 3NBFA 4B73A 1CF4A 4AI6A 1R8SA 4KYIB 1VMAA 2GILA 4NYMQ 4DCUA 2DHRA 2ZS9A 1YZGA 3ZJYA 4EPRA 5K8UA 2X2EA 2BMDA 2CHGA 4Q4AA 3MGCA 4DSNA 1VCOA 2QT1A 2QAGC 3GLIE
chains in the Genus database with same CATH superfamily
5C18A 4AJNA 2IVFA 1KI4A 4PG5A 4E31A 5HTOA 4OXXA 4X92A 3V4OA 1YRHA 4ZA2A 5CDHA 4GO1A 5SZHB 2H51A 2FH5B 5LZ4A 1JEYB 3GOQA 1SZPA 3OJOA 4KGZA 4PGAA 3K94A 3GEMA 4QICA 2A7QA 4M0FA 5IXYA 2YIVX 3EVGA 2D5LA 2ORED 1M2JA 2ABWA 2SNIE 5TE9A 2P0AA 5BMVA 3WYFA 1ZCZA 5KQRA 4Q9JA 4J1NA 4DUYB 1JIXA 4YWHA 2E0IA 4YCMA 2FZKA 3CX4A 2L17A 1D0VA 1GG5A 4P7FA 4Q1EA 4UVDA 3SQNA 4OQXA 5KQSA 3X1KA 2GI4A 3W0LB 4E5MA 4GDFA 1GNQA 2CGEA 3ANYB 1SD5A 2OHGA 2WHEA 4FBGA 2RARA 3BCSA 2GERA 4YQZA 4DDKA 4MH0R 5DHRA 1YV9A 2YHIA 3A6KA 3DT6A 1H2BA 3EUFA 4C7BA 3B1XA 3L18A 4Z4EA 4ND4A 4XM2A 1K3UB 2RKWA 4HWTA 2AUNA 3SXUA 3ZQJA 1R7RA 1NOJA 4JSYA 3STXA 1CY7A 5K6RA 4TLMB 1T29A 1ISFA 2WA2A 3JR3A 1PYOA 3GNLA 4DV6B 2DU8A 1WUJS 1DSSG 3IP7A 2FKAA 1RXUA 2FETA 1BGXT 1T5HX 3BMQA 1SCQA 2R48A 3NUQA 1V8BA 4KKXB 4G85A 5E7IA 2IQIA 2X9NA 1D8AA 4J1TA 2QK4A 1CUHA 4XQCA 4JAVC 1N2BA 3DOEA 2FN9A 2ODPA 1ZCJA 5IU6A 3FYSA 1ZITA 5IUKC 4AP9A 4KWEA 4GPEA 1R16A 1XTKA 3AF2A 4K2HA 3SCZA 2FPPB 4AIIA 2PSHA 1QQTA 5F3DA 5B3JA 4MQMA 1JH8A 3PXEA 3COSA 3DFFA 1NBWB 1PL7A 3HB1A 1NVAA 5EQJB 3UKOA 3EBOA 9MHTA 2FYTA 1MF7A 3GUZA 2AH5A 2AE1A 4M0UA 3V8BA 3I2FA 1MVLA 2H07A 4WVLA 4GKVA 2IWHA 1ZIPA 2B20A 4XWWA 4WBNF 4PLWA 4GPAA 3BTOA 1OAOA 2IPAB 2E89A 3SS9X 3N6RA 4WQMA 5F73A 1VSTA 1ESEA 2CHFA 1H42A 3FIUA 3E3NA 3Q3JB 3Q8LA 4JVNA 3B38A 5EIAA 1OZAA 1NC1A 1F2TA 4RTLA 1KNQA 1DWOA 1N2HA 2AI1A 2VNAA 3D8NA 1GZHB 1XLUA 3DBLB 3Q9LA 4H6XA 4MP6A 3D6NB 4IGIA 5EPOA 4ZOBA 3DV0A 3GRUA 1PR5A 2P1ZA 3H5VA 2WR8A 5E2BA 5CU7A 2JLQA 3LA6A 5T4FA 1W0JD 5CD9A 1G20E 1KMMA 3D4NA 3GUVA 4IJVA 4M1YA 3HA7A 3J7AC 3AHEA 2EIHA 3M6MD 3ZQKA 2XGGA 1VIAA 2FFQA 3KS9A 5IBQA 1H3FA 2GZDA 5J2TA 4W5QA 4GGPA 3SFVA 3HHPA 3W2EA 2WSSA 5FHQA 1ND5A 4MDEA 2Z9DA 3OEHA 3TW0A 4UCXA 2OT3B 1RLIA 4K9DA 5KOHA 1ZL0A 2PMDA 2J9GA 3S7ZA 3G0DA 3ZZ1A 5BW6B 5A5DA 1AK1A 4RK4A 1E9VA 2JLBA 1WMAA 5HNKA 4FUQA 7REQB 3LRPA 2VOJA 4MKXA 1DBVO 4B84A 4PIPA 5HK8A 3UQZA 3DEHA 1XTVA 3UV6A 2FDCA 4NBLA 1FK8A 5EZQA 3H5AA 1SUPA 1C4KA 1RCFA 2C5BA 2O0MA 2O7VA 4TV9A 3VSCA 1TUBA 1E2HA 2J7PA 2J5BA 3PQFA 4HLDA 3RLFA 4M1QA 5DHUA 3TPZA 5C5EA 1P8JA 3RFTA 2BM9A 4Q7LA 2BFBB 1J42A 1TZ2A 4L6IA 4K87A 5LC1A 2JFXA 4RW0A 2QAGB 4XDGA 1XVIA 3V4RA 3U48A 1EX7A 4HX9A 3C7KA 3BAZA 4UNIA 5JWHA 4IDBA 4OQLA 3T4XA 4D8UA 3BL5A 1GGFA 3S44A 2C4MA 3GFFA 2Q5QA 1RHJA 4B3MB 4M0CA 1V6AA 1Z2OX 1LI5A 3CZ4A 4ZI7F 4PG7A 4R9VA 3QVGA 3SC3A 1TW3A 1EJ0A 3QE9Y 2JVJA 1T43A 2FPUA 4Q9DA 5DHFA 1YR7A 2PYIA 5EZYB 4GEGA 5DB4A 3U4MA 3TL3A 3WDKA 2FZVA 2CUTA 3H4IA 3PDIA 4TUYB 5DWQA 5ESRA 4EHDA 4ZZ3A 2O05A 4KE8A 5BSEA 4JELA 2HY7A 3L01A 3DOFA 2QYOA 4Q01A 2JJ1D 2FEMA 5SY4A 4EMSA 4NCHA 3IP3A 4GW3A 5DP1A 5E6RB 1ZW6A 4DBLE 4HGZA 1OX6A 5DULA 5K5EA 2X1LA 2Q29A 4YXFA 4BUCA 4ADSG 3BJEA 2J41A 3NCHA 5IT9A 3QEJA 1DFHA 1LNQA 1XGKA 2RHOA 4FE3A 2XSZD 1Y1TA 3HB9A 3O73A 1GADO 5J5CA 1Z5PA 1LRJA 1DAFA 3HFJA 4FMBB 2F62A 2KI5A 1F4PA 2YQZA 4XQEA 4DN6A 1UMCA 3ZW7A 3R0JA 1XKXA 1ZH8A 2D7JA 4CMKA 2AF3C 3ZDYB 3MJTA 4UBIA 3SBOA 4AZWA 2BSXA 1LVUA 3AFGA 3ME5A 4EY7A 4I1PA 1H8EA 4C30A 5K03A 5AI4A 2J3QA 4ZI5A 1O94D 1U31A 2P7IA 3G5LA 5JAIA 4TKVB 1L4LA 3CVJA 3ZIAD 3TAXA 4BNVA 1DXOA 1BSVA 2O2YA 3EIQA 4MVJH 2HL6A 2GPWA 3TBKA 1COZA 1KI6B 1KMIY 4MIYA 4QAQA 3QEMB 4EOGA 5JNTA 7MHTA 1XZIA 3DGEC 1T8UA 3Q85A 4JJ4A 2RGDA 1TMGE 5IK2A 1E9CA 3K1JA 5FQNA 1QHHA 3VSBA 4LF6B 1JR6A 1G8KA 3B9PA 3VUEA 2QMZA 3F97A 1OILA 2FUKA 3DLPX 2IP2A 1VQ1A 3Q3IA 4JJGA 1NR7A 4LGMA 2VYND 3CVYA 1YDMA 5EZ6B 4R2JA 4FJ0A 3B8EA 4UUAA 5FWYB 2QA5A 4H9GA 1TT5A 3VI4B 1XVTA 3CRRA 3ZV6A 4AMYA 4ZZ0A 1DQZA 1QX4A 4F9TA 3TFWA 2QIOA 2F3PA 4JLPA 4DV2B 4XDYA 2FZEA 2VNSA 3N28A 4DRZA 4D3XA 3IMKA 4KBGA 2D2FA 3B51X 3KRTA 3PC7A 4NE7A 2RGWA 3F98A 3H3FA 3CFYA 4UTNA 2R5NA 2A2ZA 3L6DA 3VKWA 2EG5A 1XPRA 4LGCA 1VL1A 2I6UA 5DGXA 1KJIA 3GDWA 2L0XA 4HDCA 4M9RA 3GU3A 3HSYA 3K05A 4X20A 4BNMA 5CB6A 1M0EA 2A4MA 1XQ9A 1H2HA 3DDUA 4H0FA 1SQGA 1T4DA 1IEQA 5JSQA 2N3ZA 1Y3DE 2GN2A 5LOVB 1IN5A 2ZTUA 4TQ9A 2XDYA 5K8IA 4TZ6A 4G41A 3I5AA 1NFFA 5DASA 4OI0A 1IVSA 2DBZA 5I7EA 2VUUA 4JUFA 5PGMA 2V7TA 2IEAA 3CBGA 1J70A 5LMCA 2DQ4A 3G1UA 2RAUA 4KQ9A 3OP1A 4L27A 3FWPA 2FZWA 5IYZF 1WLSA 2R7NA 3IQFA 1DL5A 1HMPA 1U0GA 3CBQA 4DIDA 1VPVA 3JYOA 5TQ0B 4YCCA 1W88B 2GOYA 1TUEA 1QWSA 3S2SA 3PZBA 5KX5A 3AV3A 1A04A 4JYBA 1N6KA 3RB8A 3NBQA 4DFDA 4M98A 2MYTA 1T2EA 1C14A 1JR4A 1ULBA 3EQZA 2QT0A 5AOAA 5F5XA 1B93A 2YW9A 3DMTC 2XZLA 1X42A 1UQRA 2I99A 3OFVA 4RPIA 3S1SA 1EGHA 4RWZA 3H6GA 2DC1A 3O4VA 3OZFA 4MI9A 1O9GA 3B3FA 1QORA 5CXXA 5ILQA 3RUPA 1E2KA 5UKDA 1P1KA 1EE1A 1WDLA 3ZQ6A 5D3QA 3ZXYA 3RC7A 1NNEA 3HFSA 4D4KA 2JBHA 2BN4A 3ZE2B 2OLJA 2JFWA 2R8RA 3N2KA 5B2ZA 4I9HA 1CVRA 1A69A 1UT5A 4D0LB 2RKBA 3S1AB 4MV0A 1SIWA 5KYUB 3C3XA 3R0QA 3ZYZA 4CF7A 4B6EA 5GVSA 2YIMA 1QF9A 1NQXA 5EUCA 1P60A 3GJZA 2X1HA 1J2JA 1QHNA 2I54A 1P7YA 2QTAA 1WXXA 2Q9CA 1V11A 1G8YA 1Q3KA 1QCYA 3HJBA 3KKOA 4HXEB 1NVGA 5DISB 4C43A 4LRUA 3D7KA 2VBIA 3JD3A 4GNKA 4YPVA 3FUUA 5FYDA 5JCOA 2RG1A 2CNWA 2ZSUA 4HS9A 3WMRA 3X1XA 5EJ5A 3UMBA 3WWEA 3LQFA 2OE2A 2Y1GA 3HHEA 4FR5A 3VOBA 4Q5IA 3ZZ0A 1VIMA 2HU5A 2IDZA 4UC0A 3LCUA 2Q8QA 3A6GA 3HJRA 5FULA 3ZE0B 3A70A 4URXR 5JCZA 1M54A 4LOAA 5BORA 2Q62A 2FZ4A 1LC3A 1NBOA 3CKLA 1OT5A 2X5OA 3IDFA 4PBRA 5GV7A 3W7BA 1II0A 2BF4A 4DLZA 4RTPA 2RJOA 3Q7SA 3RYCA 3GL9A 3ORYA 3WQHA 2WVGA 3AF1A 5ADUS 3LJKA 3RFXA 2VJQA 2ZRFA 3QKRA 4LVCA 4RVOA 5K3SA 4X7RA 4BX9A 1RRCA 5FFFA 5I7AA 4F6RA 1EDBA 4QBFA 4TTTS 2DFPA 5FLKA 4R71A 1K0FA 3MMXA 3JQ9A 3WRXC 1UKZA 3W6OA 4ARBA 2O2JA 1PDWA 4YRGA 1CEYA 4CWAA 1XZBA 2A92A 3CLRD 3GFBA 4GC5A 4BMCA 3CRMA 1MAVA 2QW0X 1DRKA 4AZ3B 3P9NA 4Y18A 5E0KB 1KAEA 4CCAA 4YUAA 5M7EA 1WWKA 1O54A 4BRSA 3BGDA 1IOZA 2P9TA 2XNKA 4FDAA 1L7XA 4JNCA 4R8VA 3T0IA 3JQPA 4G5OA 4DKJA 5DMXA 4KPYA 1JFRA 2E4AA 4LXTA 3I34X 5B4UA 1CZUA 1AZLA 4MQEB 2Q8NA 3GY0A 1Y37A 2H1WA 4QUDA 3EQ8A 1KE2A 3KLOA 2R65A 3SNKA 5BXQC 1JTEA 4K9SA 1GJRA 3R5FA 1JEYA 5EJ7A 1Z6PA 2IGBA 1RRVA 4P1ZA 4RS3A 3CA8A 3NTVA 2TMYA 3KALA 4Z7JA 4OEHA 1QONA 1RRMA 1VOTA 2HJVA 3GNQA 1XPOA 1BROA 4C05A 3EDQA 1SAYA 4K1XA 3L8EA 3I6IA 3H4TA 1SR8A 2FHPA 1C9JA 3G8YA 3OTQA 2B9VA 2NT4A 3SKVA 3LTNC 3FTPA 3JQDA 4WUTA 1WDKA 2BM1A 4HR7A 1DBSA 2RBGA 3D6FA 3SBXA 5JLJA 3W3AA 3UAOA 1O6BA 2Q9BA 4FWTA 1GPWB 3DKVA 3N8DA 4B35A 1FVOA 5K99A 2EEZA 1VP9A 1N6HA 4X1OA 3LXMA 4AFNA 2A9OA 2YZMA 1WZUA 3SZMA 4OLJA 3JZIA 1I6LA 1U2PA 3AVVA 2CMDA 4XA8A 4YLEA 1GL9B 4N5IX 4C20A 4EAAA 4YV0A 3D59A 4U4AA 1SMKA 1DADA 2OILA 3ND7A 1BQ4A 4XUGB 1AV7A 4JJKA 5KYVA 4B6OA 4BOYA 5T8KA 1Y9ZA 5LCXA 4DJJA 5H3HA 2HWWA 2QU8A 5HK9A 5CDFA 4HYEA 1G291 4OMFG 1FNNA 2AYXA 4JOSA 3W78A 1R5NA 1EGAA 3F5QA 5FH9A 1PR9A 2VJPA 2IHKA 4ITUA 4B7XA 1MW9X 4ZQCB 1K4KA 3NXKA 2IHJA 2ZJ6A 3L8GA 1MB3A 4M76B 2ILTA 2ZZKA 4XGRA 2HDNB 1HKUA 4B87A 1QYVA 1T9CA 1Z6QA 2BCJQ 1HL3A 4MUYA 5B37A 3KXLA 1T8PA 1Z29A 5D51S 3RTBA 2FPPA 2ZB4A 3NTOA 4D6YA 2WHPB 4EL0A 3HU5A 1YB4A 2WNSA 1TM3E 3DXXA 1YJAA 2FQYA 1HZZC 3G3EA 2FY8A 3QU7A 1VBNA 3IE1A 4NK4A 1VBFA 1FP4B 2AXQA 2Q6KA 2QL5A 3BFKA 5LJIA 2D2EA 4RD0A 1QH1B 1L5RA 1KYZA 1NASA 2CYCA 1N7HA 4PLVA 2KM1A 4ECAA 4Y7CA 3GIWA 4WLFA 2VTKA 4BNUA 4YNBA 1RW4A 3FBGA 4JI6B 3AUJB 5DM70 3TQRA 5J5VA 4FOPA 1WCIA 1A88A 3HO6A 4FYWA 4M87A 5ICGA 1UPAA 1JF8A 3RS4A 4ZJZA 3QVTA 2J0EA 1JG2A 1YJCA 1XDGA 1VE9A 4LMBA 1QQBA 2AKAB 5C9ZA 2I6TA 2WV7A 1DO0A 2ZYRA 3DE4X 3DBLA 3KYJB 4FFLA 2D7DA 1JHZA 1EWKA 4HWSA 5JVDB 2X7XA 3AUXA 1FUEA 2B35A 3EGWA 2Y92A 1DCFA 1R50A 3WK7A 5CFPA 4RZSA 5KI6A 1SVMA 3L7YA 5E6SB 4BYGA 2DLNA 2QYHA 3UPTA 2PJZA 5CPBA 3ZTYA 1JNXX 1TPYA 3F7MA 1D2EA 4FBLA 3VC7A 5ARBA 2OB2A 3NJRA 3PCTA 3PEYA 1Z56C 5TVGA 2AS0A 3LC1O 4RVNA 1VI6A 3QYFA 2FB9A 3B9BA 3ZWXA 5HFAA 3TE6A 4CG1A 4RD1A 1KMHB 2H00A 4K6KA 1YSCA 2I22A 2PYZA 3NIFB 3KL2A 3F6EX 4MS1B 4PHTA 4ZKEA 4EH1A 1LA2A 5ELXA 1IC6A 4YT4A 3AOEA 1QMPA 5EMNA 2OBBA 2DTDA 4CV2A 3W06A 2VTBA 5LMUB 1I3LA 5J47A 4L2IB 1XHEA 4JC5A 1I3MA 1PSDA 1VIYA 3JRWA 1BMTA 2AZMA 2FPXA 3IO3A 3MJFA 1JAZA 4FX5A 4UVGA 3UGJA 3EQ9A 2X0EA 3TLJA 4U6QA 1Q0TA 2QAGA 5DCLA 3PFWO 1GITA 3UA4A 4ZVLA 5CXQA 1HY3A 2BHRA 4JR0A 1W34A 1S2OA 4I08A 3LCVB 3H4VA 2R85A 3AR4A 2FLKA 3CZ9A 2JZCA 3NTLA 3WLEA 4MRVA 3FXAA 1DAPA 1SVNA 3EAFA 5F35A 2LBPA 4CTOA 4ZOQI 3CUUA 5J4VA 2OZEA 2UVQA 2VJKA 3JZMA 1Y3BE 4J1SA 2P9FA 4NULA 4NZOA 2YJ5A 5JS7A 2VDQB 2HBRA 4N8DA 3EC2A 2P4UA 5EZYA 5BSHA 3U13A 2OFWA 3TJMA 2OV8A 2E18A 4TUYA 3DO8A 3WB1A 1IM5A 1CT9A 4QPNA 4JYAB 3K8OE 1RC0A 4A82A 2IS4A 4ZYYA 1ONNA 2XXJA 3AW8A 1TZKA 5C3MA 5EPEA 1DRWA 4DDMA 1GA1A 2IFTA 1QLJA 1T6XA 5E6RA 1USKA 3AH8A 4KPUA 1Q7BA 3K72B 4ZTUB 4GU5A 3BG5A 1DJNA 1EVIA 3HCNA 3KC2A 3LUGA 2GTPA 4JSTA 4MXDA 5E9WA 4RFVA 3R8XA 4PZ9A 3BXZA 4BZQA 2ZWAA 4C4ZA 1NQUA 1OFVA 4IG9A 4MCIA 4LW8A 5DGCA 3G1TA 3R3XA 3H5LA 4QQ8A 4URZR 2QR2A 4DZTA 4ZYZA 5TT0A 2AC4A 3E1KA 3I9V1 1I4OA 3EEIA 1IJFA 1WZCA 2HRZA 2QRGA 4UM8B 3VI3B 3V2IA 3BIFA 4G4SP 2CLDX 4OQNA 2WYWA 4US2R 2Y0BA 5JDIC 1PQWA 3L4SO 3TTVA 3W5JA 2GNAA 4GR4A 2V3VA 4TKLA 1YQ9A 5AXAA 2JGEA 4P53A 2ZUFA 1NSYA 4TKVA 1EB8A 4GF5A 4H27A 1ZGZA 4FFPA 3CNEA 3Q9NA 4GPBA 4CF6A 1Q17A 1SHTX 1PJTA 3ZCXA 1KI6A 1VBKA 2JVIA 3FGPA 3QEMA 5FR1A 4S1NA 4DCCA 5HVNA 1K66A 5LLTA 1TL7C 4KRFA 4IJUA 4OIFA 4YJFB 4LDAA 1CZRA 2HLNA 3KHUA 3OUZA 3O1IC 1WEHA 3QI7A 3I9MA 3TVDA 1Z2PX 2HLDD 3DA8A 4Q0MA 2KPOA 2ODEA 3OM1A 4BZWA 2VF4X 2R1ZA 2ZBGA 2YYYA 3QF4A 1GGNA 4WXRA 4F4IA 1N5RA 4IFEA 2BKVA 5FWYA 1I6MA 5AHXA 2LCQA 5AW4A 2QGFA 2R9VA 2VHZA 3O38A 4YCDA 2IHNA 4QEKA 4YIKA 1G6HA 4DLXA 1A4RA 2Q5CA 3ETDA 2A9QA 1ZMOA 2B9EA 2W2KB 3PB3A 4NXMB 4LJ5A 2JD1A 5KU7A 5GMOA 1GOTA 1CNMA 1GGVA 5M3BA 3R6DA 2A5YB 4AUNA 1AKNA 4MKGA 3DXYA 4NY1A 2CUZA 3D7NA 1T2VA 4HEA6 3DONA 5SZJA 5TB5A 4A5OA 4Q19A 3UTCA 2ZYWX 3ZOKA 5GINE 2YIDA 5EGNA 3EPLA 5A1JA 5FPTA 3SN6A 3PGMA 4K28A 5AXDA 1LF0A 1KXJA 4NMMA 1WQ3A 5CLIA 4ZREA 4E13A 1K6JA 2FKNA 4BFWA 2FE4A 3UH0A 4NEHB 1J25A 5CB0A 4UHCA 2RCYA 4C08A 5KQLA 4L8LA 4JQZA 1J33A 1RM5A 2CMHA 2GYWA 3OZSA 3NTQA 3Q7TA 4EHFA 1YE3A 2KHZA 5DGDA 1TAUA 4V3CA 2WDPA 1VDZA 3VZRA 3DEIA 3IDZA 4L8YA 4NENB 4P2BA 5EC8A 5IBRA 4NFYA 1OMOA 2JL1A 3K2EA 4YJ3F 5AJVB 3CKKA 5TQ0A 1FLNA 3V3TA 2YDXA 1W88A 4YR7A 1AIPA 3R76A 1C8LA 1SKYB 3DBRA 1DLJA 1NURA 2OUIA 2Y0DA 3QA3E 4YR9A 5A3RA 2QMHA 2YMLA 4PG6A 1CIJA 4D0SA 2FUEA 1Q7TA 3LDHA 4QSMA 2WAXA 3UUGA 2IBSA 2ISCA 3BHJA 2JFNA 2JGMA 2I7DA 2ZU0C 3FAZA 1RS0A 2WF9A 2Q49A 3IURA 4ROSA 5GAJA 3Q8MA 1RXVA 4A2PA 4KNYA 1UBFA 2NSYA 4JS0A 1PJBA 1QZUA 3GFPA 1FFEA 2QVBA 3O3CA 8MHTA 2EFJA 3ZKWB 1ONPA 1Z2CA 4QDZA 3AM3A 4HEQA 1JYFA 2LD4A 3DG9A 3LFUA 2GD6A 1G4HA 5DRTA 3GW8A 5IMBA 1XXLA 3MWEB 1IB0A 4HNAB 3S1AA 5I4BA 1ZH4A 2CJYA 2NN3C 3PEEA 5KYUA 1TCCA 2BFAA 1SU4A 3DL7A 3ROTA 4B3XA 1ZNQO 3QVOA 3OZCA 5CGQB 2DFDA 4UMFA 3E22B 2NVWA 2O1WA 2O6HA 1JAIA 4FKMA 3SXJA 4OLAA 5EYPB 3RCBA 1XC7A 4RM2A 1WUYA 4D9BA 2Z6QA 4JX9A 4J49A 4RMJA 1L7BA 2IKQA 2WHYA 3FSGA 3H3XA 4LJAA 2X7HA 4L78A 1KGSA 2CNNA 5ALPA 3ZHTA 4EJ0A 4UTVA 3HGQA 5IASA 2UVPB 2YHAA 4X1YB 2D1QA 4OMCA 1QSGA 4TLCA 5COAA 1SEPA 3BICA 3VQTA 1D4FA 2RGRA 4ARCA 1RJFA 2X6RA 5EIOA 2ZIFA 5TJHA 2G17A 1C3XA 1KQOA 2FOXA 1T4BA 5DTMA 4ZJPA 3BKXA 2A88A 2H29A 5FNVF 1WY5A 4KAXA 2W0MA 5CNKA 1T36B 1CY6A 1NUHA 4C7MA 3O8OB 5LFAA 2ZTLA 4QLBA 4IQ0A 2HSWA 1XMIA 2C5AA 2PL5A 2XKAA 3WYAA 1FXWA 1E6UA 3G89A 2H31A 3ZCVA 5A4DA 2IGTA 4C7XA 2MSDB 2XQGA 2R1UA 3ANXA 3MRXA 5DFAA 3WL4A 4D9IA 1RT9A 3LDAA 3R3UA 3O94A 1NDQA 4LZAA 4MVJE 4AZ3A 4RESA 3RARA 5B2FA 2TRSB 2QUZA 4K9LA 4R9RA 3RHTA 3GMIA 4J0DA 4MJ3A 2ZU6A 4DLPA 5HTKA 4II3A 3VO2A 2AMVA 4HSGA 4CLHA 2IXBA 1H69A 1UBTS 4CIVA 1VLJA 5KNBD 3RRFA 1ZJ4A 3P5SA 1H8HA 1FVHA 2B4RO 2VP3A 3PC6A 3RJ9A 5A4JA 5BR4A 3ABSB 4BMZA 5EERA 4PSVA 1KKMA 3EOZA 2HSDA 2G1PA 3PIIA 1L1EA 1YL7A 1OAAA 4K9KA 3ZLVA 3ZZTA 3NT2A 3BAFA 4RKEA 3B2EA 1YAHA 3W8RA 3AJEA 4HVLA 5IJZA 1UP6A 1EI9A 3UMJA 2F9FA 1P1FA 1VE7A 1UWCA 4TS9A 1BE1A 2XZOA 1JDVA 4MGKR 3NOXA 4DB2A 3QXJA 4RETA 1EFRA 1I0IA 1QRUA 4WOKA 4W9NA 1G2PA 3C7AA 2IXDA 1J8FA 3X3HA 4FYIA 4IGFA 4OP3A 2QQFA 3GWZA 1JDSA 4X3CA 3VJLA 3C3BA 1E3MA 4JXKA 1VJTA 3KQTA 4D3ZA 3LCMA 3VZDA 3CNBA 3FOWA 1HG1A 1PGQA 2W6QA 3ZD8A 2PBRA 1JQDA 2ID9A 4ETIA 4P3NA 3OESA 2R2GA 3KPVA 5CVDA 1K8RA 4DLRA 3KAKA 1VJCA 2OKCA 2FN4A 4R2KA 4JU9A 4LHYA 2QTBA 4GBMA 5B58C 2A9RA 4R54A 1RLOA 3ORQA 1I1HA 2O2CA 1ZSYA 2OHIA 3ZDBA 2AW5A 3K9GA 2XIQA 1A9YA 1IQPA 4YN3A 3OJWA 4ATNA 5JS8A 1SY7A 2G63A 3D5EA 2KS6A 4XYLA 3CR3C 2VQ6A 3HCCA 2PX2A 3GT3A 4WJLA 4I4LA 2J87A 2R6JA 2R6R1 4LN1A 4P93A 4TTJA 5IVPA 2OM2A 1RZUA 3ST7A 5JATA 2Z6AA 2WHPA 2GXUA 4WZBE 2GYYA 2O6LA 3E1GA 2MSWA 1S01A 1FP4A 1XX6A 3KLNA 1TM4E 4X1IB 1R0XA 3G7UA 4YGXB 1QH1A 4NBRA 2I3BA 1J97A 5SY9A 3IPYA 2YXLA 2OZVA 4GH5A 4RVDA 4CT4B 1XZPA 2D1SA 4WLNA 2GASA 4YDQA 5JPDA 2B1JA 2BFFA 4RGBA 2QYTA 2XAAA 4AQ7A 1XU4A 4QDUA 4D42A 5A5FA 2CT8A 1TPZA 2OO5C 5U4QA 2HXSA 4E03A 1U3UA 2Z4RA 3LVBA 1GFZA 4B79A 1F6DA 1KORA 3QLUC 3O8CA 2V5UA 4Y7DA 4G8CA 4RMIA 5DBEX 2EG9A 1XT6A 4DTIA 3NWPA 4NMXB 3PXBA 5A05A 5JHGB 2JLAA 3L41A 1KRHA 2CY0A 5TDHA 5BOSA 5AP9A 4L73A 4FQ8A 3E3AA 3JATB 3MELA 5I4CA 2EAUA 1I5RA 4PZ0A 1UMKA 4LXQA 1E4YA 2KJQA 1GGJA 2VDOB 3MEQA 2WFZA 3NORA 5EZ5A 1TTTA 3V8NA 2B99A 4RTNA 2EL7A 3IJ5A 3OCUA 3W5HA 5A7FA 3I45A 2EKPA 3FMPB 3SVTA 1ODSA 5BYJA 2CUNA 2R7LA 2Z4SA 3FYDA 1U7WA 4EW1A 1JSLA 5FOTA 3GCZA 3HWX1 2HCBA 3VTAA 1T2NA 3LOUA 4XZ3A 1AU9A 1NFRA 2BTQB 2C8JA 3TIXB 4E5VA 1KMHA 4LCBA 4PSCA 1IJKA 4MS1A 3BQMB 1AMOA 3E9CA 3IAS6 3OZBA 4M1EA 3L84A 2C82A 3EIXA 1KDRA 2VCYA 3LT5A 4QEZA 4A10A 2HOQA 1XZDA 5AJWA 1INLA 4H16A 2PTGA 1C3EA 3U9SA 1RHQA 2DPMA 2WJAA 4L2IA 4IRMA 2VXOA 2BBWA 3ND6A 3O3NB 1X2BA 4G4JA 3SZRA 4G0UA 4P3XA 1Z8HA 2PQ2A 1Q15A 4LWQA 5FBHA 2A67A 2N9UA 2RHBA 3FSRA 4EG8A 2MR6A 3VR4D 2X0NA 4F46A 1R9JA 1OXBB 4EB0A 4JH0A 4OH1A 5JAUA 4MJLA 1XCJA 1YWGO 2ZTSA 1YTLA 3L0ZA 4JCOA 3MJSA 1JMYA 2EKDA 1H23A 4G84A 5AFSA 1ULTA 2P7HA 3RJMA 4B5LA 2XWPA 1NKSA 2QTMA 4O02B 1A9PA 4YRQA 4AY6A 2BMAA 2Z8ZA 2H5IA 4R40A 2JIZA 1SU8A 2QUBA 2ZAOA 5LU9A 2P35A 5M04A 3K0CC 2WK1A 1VCHA 2GEJA 4Y0NA 4O4JB 1NKVA 2Q1UA 4Q7QA 3O75A 3PGA1 2HK6A 3H1GA 3K73O 4D46A 4HNTA 1HYEA 5F2NA 3JZDA 5L7WA 3FMFA 4DC0A 1Y8RB 3IHWA 2IBTA 2P5UA 3I64A 2VZ8A 1CRZA 3DBIA 4JL6A 4LHWA 2ZAYA 1NVUQ 4HAXA 2C99A 4D82A 3GMSA 3Q11A 2BH9A 1MEEA 2BGRA 1QZXA 1ULSA 5G1PA 1GKUB 3WIBA 1XVVA 2QM7A 4HWRA 3R6GA 4FNOA 5COQA 1GPLA 2J07A 1IBKB 1SOVA 4NMHA 3BMCB 2JASA 1UJNA 2NGRA 3W1VA 4CV0A 4FDVA 1FFHA 5C3UA 3JQRA 4B82A 1E7QA 1W52X 4R1NA 3CE9A 5AUQA 2XEXA 5CBKA 2F3UA 2RJNA 5JNRA 2CEAA 3L5KA 2BVNA 4IQFA 3OZRA 3QYJA 5DM60 3CSUA 3GGGA 2EP7A 1FRVA 3GPDG 4JI5B 3P9SA 1NT4A 2YR0A 1RAHA 2X8LA 3NFRA 4HLQB 5BNFA 5C35A 3OG9A 2HBQA 5HPYB 5AVZA 3RW9A 3PQ6A 1YQUA 4MK4A 1ZUD1 1W9HA 2NV0A 4UUOA 1LK0A 3BFPA 4WSOA 1VZ2A 2O2HA 5CHEA 3JVUA 3SJCA 2JEOA 5EXDA 1HZZA 4YJFA 1Y3FE 3BEOA 4YJ2B 3A4TA 1VRCA 1GUFA 4F93B 1RXEA 1ZGAA 2EOAA 3OTHA 3PIRA 4P0QB 2L2QA 4H3SA 4YJGA 1QG4A 4JLVA 4DR5B 2WPDA 5LDHA 4YRLA 2UYGA 1XB2A 1IU9A 3ILVA 2JFVA 3IVXA 1OXTA 3KT3A 1K06A 1NXPA 1WG8A 4KLZA 4Z1OA 2C2WA 1GARA 1OC4A 2W2KA 4CQLB 1A98A 4GZ3A 3ZLJA 1UBJS 4XD7A 1KZGB 1CR0A 2P2NA 3RVJA 1QGAA 1QTNA 2XUFA 2CC2A 3EGOA 3KAQA 4FVTA 3ESYA 4QYTA 3WIDA 4YH1A 1G5HA 1M8KA 1VL6A 2ZJOA 3AFNA 4IH9A 2WYOA 2C04A 1F4LA 5CT6A 2W98A 3QE3A 5HF6A 4FMDB 1ML4A 1MDFA 1I0ZA 3R1IA 3PXGA 4FFRA 2POQX 3GJXC 1M9NA 3CY6A 3WLHA 4UE3S 5DT2A 3Q5EA 5TIIA 4TYNA 2Q5LA 1ZUWA 3C3PA 4RJTA 4JHLA 1NW4A 4IIYA 3WGYA 1BE0A 1VKZA 2UZ1B 2Y0PA 2BELA 4PYLA 4DAEA 4DPMA 2IU3A 2PV7A 1B4DA 1QPZA 4I5DA 4WGGA 2DE0X 1HE2A 1X74A 1NVBA 1Q2UA 1K98A 1KEWA 4MEJA 4E15A 5GTDA 4NENA 1KNXA 1V4BA 2IIVA 4JWTA 3KEGA 4BMDA 2AB0A 4WZ6A 1AH2A 2FRVA 1UL1X 3P19A 1NAHA 3CWQA 1XN4A 1BMQA 4MCJA 3ZJUA 3ET5A 2AFHB 4M8KA 3L0YA 3F4BA 1NQ5A 2Y67A 1P91A 2JI4A 4I6GA 1C9NA 3UJ6A 9ABPA 2C97A 3K8YA 3QY0A 2VJBA 2J3DA 4W99A 4ND1A 3DHEA 5BUCA 2IU6A 5C53B 3T3IA 4BY9E 2DLCX 2UAGA 3RFVA 4LYYA 5GPBA 2DBRA 5ER6A 5BSTA 2JF0A 5LQRA 4K03A 3FB1A 1JR2A 1P8AA 1W46A 1Y8CA 2PRIA 4L76A 2DUJA 2HDHA 3PFBA 4QU9A 5DEIA 1G8PA 3ZKWA 1W36D 1OIVA 3ZE7A 4PIVA 4B2YA 4CMIB 3DOHA 3NIBA 4K81B 3VSDA 4BX2A 1LSJA 2W43A 5CA0A 2GAIA 3MWEA 1W8DA 1FDTA 2B69A 3NZEA 2XCLA 2YL2A 2UZ3A 5JAHA 3K0SA 1HR0B 2XMRA 1Q44A 1KTVA 1PR2A 2HFKA 3GK3A 3V97A 2DUMA 3NAZA 1UIMA 1DC8A 3T1OA 3L4JA 4B8WA 2C8KA 2C5GA 3EVDA 5HKKD 4IJQA 4DILA 5LWQA 3ZIDA 3GLGE 4MKIA 5EYPA 1X9IA 4HL6A 1MNAA 1VIVA 2VWHA 1G2IA 3GJQA 5FTNA 2HEGA 1QFZA 4HMPA 1V5EA 1XRQA 3T5BA 1XZ8A 1HNNA 4EA8A 2ZAMA 3CTPA 2VZEA 2UVPA 4X1YA 5FYQA 2BFCB 4ZGBA 3FHLA 5GVRA 3ZJTA 1JPUA 5A4KA 1UIRA 3TMKA 4IFIA 1ZVKA 2W83A 3S2GA 3TG2A 1A71A 1B0AA 3ISTA 3EGXB 5D7BA 4B7CA 4DE5A 2EQAA 1XKQA 5EZSA 3HJFA 5C46F 1T36A 2WJYA 3NDPA 2VT2A 4CLXA 3O8OA 3EJWA 3PHLA 2ZZMA 4R2LA 2JIPA 3KFVA 4PCVA 5JNWA 5LIRA 4OBEA 1B8VA 3N5KA 1L5GB 1M33A 4IFTA 2BFPA 5JDIA 4DREA 4XIJA 2EWWA 5AW3A 2G0TA 2IZ5A 2V0NA 2VK1A 3RUAA 3EZ6A 3T34A 4CKCB 2PUWA 3MSXA 1N2ZA 1N4AA 2QI9C 1CUVA 3GMTA 3KPUA 4OMUA 3LBIA 4NPAA 3MGBA 1APBA 4O4IB 3H17A 4WY8A 3CINA 4ZVNA 3ZV4A 1XVUA 1TM5E 3E7DA 3LP8A 4Z9BA 1ETHA 3QE4A 5JI2E 4RTKA 2J0SA 2I7XA 4DR3B 1R0WA 3SIWA 3DMPA 2GN6A 4AROA 4PPQA 5F1PA 1SBCA 1ZJJA 5FBWB 3Q10A 3R6TA 4B75A 1U8AA 1QIHA 5TEVA 3AY3A 3TRDA 1UAGA 1B26A 1FFYA 5CT8A 2VR1A 2K6GA 3R5SA 1JQJC 1L6RA 3F7NA 1FFCA 2YWFA 2Y1EA 4IVRA 1ZH2A 2FU5C 4FR0A 5KJCA 3DAPA 1JDNA 3W5BA 3I6YA 1E66A 5ERGB 2ZT7A 3VMFA 4DWWA 2WTXA 1OFUX 4FYMA 2GBLC 3EZNA 4DW8A 3G9ZA 3V8QA 1AHNA 2XMBA 4GOKA 5C5IA 2VUHB 4DLBA 2V74B 5K0CA 2E7ZA 4JZYA 2O23A 3EF1A 5FV4A 5IAOA 3SBDA 4CM9D 2G08A 3HMKA 2ZSFA 5G0UA 5MFPA 4E46A 2R5FA 3AEZA 1PS9A 4ZIRB 2AEJA 4U9HS 1JHVA 1NBME 1QIIA 1CS0B 3GPBA 2YKGA 2X42A 1G4AE 1A2KC 1UBCA 4S1WA 1NVKA 3BTVA 1YOBA 4NTZA 3A6DA 4WEOA 4BKQA 3BBPA 2IF0A 2P3QA 3P4YA 2HUPA 3LP6A 2P9BA 4LXIA 3K8ZA 4Y1EA 5T67A 3LIIA 4OHMA 3G2NA 3L02A 4EI8A 3FPSA 5JXHA 2GNOA 5LYJF 4GL4A 4FFDA 3LQQA 1EX6A 1YQTA 3KVNA 3PG5A 3N0RA 5JQGA 5AIAA 1E3JA 4KN5A 4ZCRA 1ODJA 1SQ5A 1QK3A 5F77A 3DV9A 3PGKA 1HE3A 4F2HA 3E18A 1SQ0A 1RAAA 2DB3A 3EEBA