2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
2ZJ2A 4PO8A 3KTAA 3K0SA 5LD2B 3AV0B 3LFUA 1NP6A 1QHSA 4M1WA 1A7JA 2RCNA 3LQQA 4JL6A 1N6PA 1JEDA 4YQFA 5FUYA 2JJ1A 3H2YA 1GFIA 3UANA 4MGIR 1SKYB 3P1JA 2BOVA 3TAUA 4CIDA 2HXSA 2FFQA 1XPUA 2B7CA 4TT3D 1RC8A 4CRWB 2HCJB 1ZNXA 3B1VA 4QG7A 4TT3A 2WOOA 2W2TA 5FUXA 2XITA 1VKJA 5LB2A 2Q21A 1C4OA 1TPZA 4G0NA 5FR1A 4EKDA 4OQMA 1GKYA 1KO4A 1VHTA 1XPOA 1P3JA 2VP9A 1G21E 3AVXA 1KOFA 2R8RA 1EFRA 2X2EA 1GRNA 1YR7A 4B35A 2GILA 2H1LA 1E0JA 1SVWA 3I8XA 2ZE6A 3T5DA 2J5XA 2GZAA 2WWFA 4R7ZA 1E2NA 1W1WA 2KBFA 1TEVA 4II7A 4JYBA 5FBVB 2ZRBA 3IHWA 4AKHA 4LBYA 3RS2A 4CZ2A 1I4DD 1YRAA 3AVOA 3W8RA 1ZINA 4OJKA 4D0GA 1NG9A 2AWOA 4EDHA 4B73A 1X8KA 2V4ZA 5IK2A 2IYYA 1R0WA 1Z5ZA 1G7CA 2ZYUX 1YVDA 4UKDA 3ZVMA 3LY5A 3IKJA 5CYPA 3WNCA 4R2HA 1YZTA 3ZJYA 3QG5A 4DIEA 1DAEA 5H68A 4G1UC 2GJAA 3ADBA 1PZNA 1W4CA 1E0SA 4BWYA 1QHXA 1N5IA 4H1VA 1G19A 3T5GA 4KFTA 3CM0A 2ZQ5A 1E99A 2Z83A 2OCPA 3SQXA 2FPMA 2QMUA 5EZ5A 2JLVA 4UXIA 2BM1A 3RS5A 1HYQA 5TV2A 1BYUA 3SJBA 1MABB 4TMTA 2JDIA 3I72A 3IIJA 4PTLA 4LK2A 4V0OA 4EQ6A 1P2VA 3KKOA 3LV8A 4AY2A 1D2NA 2BV3A 1AGRA 1AK2A 4TWZA 2BHRA 1P2UA 3DMDA 3GLIE 1R0ZA 4QJ3A 3IDQA 4A0GA 1NKSA 3CR8A 2QT0A 4IFEA 2XSZA 1GKIA 1SGWA 4FW9A 621PA 1S8FA 2OILA 1U99A 3NVAA 4XD7D 2O8EA 1ZD9A 3NBFA 1IJFA 2OCYC 4TSFD 1RYHA 4DC9A 1G4UR 3U4QB 2FH5B 4L16A 2DFKB 4URZR 3O47A 3FMFA 3T15A 2WTUA 2JJ2D 1G3RA 2CHQA 2MSDB 3L43A 1QVAA 3EPKA 1ZMXA 3CW2A 3RS0A 4QBFA 2VP6A 5FBQB 1FPMA 2R6AA 1L4UA 5GJCA 4OI1A 2QY9A 4BASA 2BEJA 2G0TA 2GZDA 1RVDA 3OEHA 3T35A 1RE0A 1E2FA 3PENA 4M9XA 4Q47A 3X1ZA 3CX8A 3AKYA 2J87A 3U2QA 3RABA 4RKFA 1JR3A 1IY1A 3LX8A 5SZJA 3SYNA 3U7HB 1COWA 3KQUA 2WM9B 2X19A 5JWOA 1X3SA 4IVRA 1KO1A 3TSZA 4DCVA 2GVZC 2FJUA 1P6XA 2QG6A 5D3MA 2HT6A 3P32A 4BZXA 4GL2A 4TZ0A 4ZKEA 1OHHA 4CEJB 4IDHA 2IK8A 1S1MA 3CH5A 4NZYA 4D4MA 4GSYA 2G83A 4CEIA 1WP9A 3Q8XB 1VDZA 4P33A 3F3YA 3GEIA 4I81A 4IOLA 5FR2A 4HEJA 3M4YA 1VG9B 3WXMA 2IYQA 4AKIA 3BK7A 4KLNA 2GZHA 1E32A 3AKEA 4Q48A 1G5RA 4LGMA 3GQBA 4JKYA 3VR6A 2OSBA 1VCMA 2I4IA 1N25A 4G5GA 1P9NA 2JJ8A 4M22A 5L3VA 2PJZA 1KDPA 4Q7JB 4B43A 3FDIA 3IILA 2BBSA 1OKKA 1Z0FA 4B6EA 1VIYA 5L8VA 1NSTA 4PAOA 5M04A 3QBTA 3T61A 3D3QA 5JMTA 4FMDF 3HJNA 2ODBA 2XOKA 4N1AA 2A78A 3TAHA 2QBYB 2MSEB 2GCPA 2EQBA 5DI3B 2AK2A 2GDJA 2GXUA 5FTKA 1RPZA 1C1YA 3DEFA 3AF2A 3KUDA 4JBXA 1G4AE 1N5KA 1OIXA 2QQEA 2REBA 3U7EB 2J46A 3RNLA 4JJZA 3GEEA 3RC3A 4QM7A 3SE0A 3BH6A 1TUIA 1XMVA 4PZLA 3QXSA 1IN4A 2F9MA 4PAQA 5IK2D 3A36A 2WPDA 3KKMA 3PUXA 4X8LA 2VTKA 2A5DA 4JIMA 4JKIA 4DLSA 1Z6GA 2GXSA 5EQTA 2JAQA 2ZUCA 3AVWA 2YOGA 1MO5A 2O0JA 3I1FA 2GESA 3Q9LA 3NHBA 2RMKA 3IO5A 3SDZA 3RWMB 1F5NA 3KTAB 2B21A 3ASZA 3ZDQA 2FMXA 2CCGA 3DM9B 5FFMA 1JQLB 2F1IA 3BFVA 3O8BA 5FPTA 4L9WA 5AUOB 2CMKA 4OYHA 1ZM2A 4QL3A 5LD2C 1T8TA 1MO6A 1R10A 2RGAA 3E2IA 3M1IA 5LBIA 4BFWA 3GJXC 1VG0B 2C96A 5JSZA 3MD0A 3SI7A 1BO6A 3EWAA 3TRFA 4BFTA 2EU8A 2IXEA 2R6GA 1Q21A 5FTJA 3U3RA 3CBQA 2J9RA 1WBBA 4TYQA 1OF1A 2IYUA 2RGNA 1TQ6A 3F5FA 3EA5A 1Z63A 2CL7X 3GLFA 4TSFA 1I4TD 1N6OA 5C2JB 4HB3A 3OIWA 3R9WA 1DAGA 2XTZA 1R2QA 4KXFB 3FOZA 5JI3E 2RHMA 3UMSA 4MQBA 2IYZA 1NLFA 1D2EA 4Q9LA 4PSAA 5HKKA 1G20E 3HPQA 4DHEA 4HAUA 1D6JA 4FIDA 1E9EA 1XU4A 1IAQA 2REOA 3QF7A 1KJYA 1AGPA 3X1WA 5CDFE 4PAMA 4R98A 1MO3A 5JSZB 4C2UA 5FPYA 2GBLA 2A3RA 1G7TA 5J5CA 4KSBA 3REFA 1Z2CA 2OXRA 5F98A 1SXJD 3EIQA 3QXXA 1XD9A 2ZIAA 3QF4A 2H92A 2WVJA 1BYIA 1N6KA 2W2XA 3CONA 4QGHA 2IUSA 3VKWA 3UXMA 2F7SA 1WBDA 2HLDA 3AP2A 2QPOA 2RGXA 3X1YA 3FMPB 3K9LA 4HUQB 2HLDD 4JYCA 1Z08A 2X1VA 3RLFA 2NO1A 2CL6X 4MRNA 2ZREA 1CRQA 1RRFA 2QAGB 2WWGA 3WYGA 4EPWA 5KNCA 3THYA 1N5JA 3WBKA 4AG5A 1ZM7A 3B85A 4ZV4A 4A92A 2KSQA 3AGPA 4KODA 1N6HA 1XXHB 2BM0A 3UIEA 1B23P 1XEWX 2WOJA 1SXJE 2KBEA 3NH6A 3KB2A 1KAGA 4LV5B 3PR1A 4BPBA 4GOKA 1W46A 2KE5A 2WAXA 4QHTA 5AJXA 1GUAA 3A58B 5GVRA 1E2EA 4OHVA 1CF4A 4HZUB 3B9QA 3P4XA 3ZGXA 4EFMA 3DM5A 1OFUX 4B6FA 1P7CA 4US1R 4WBSA 3WHKA 5B57C 1DO0A 1OIVA 1P4SA 2Q9AA 3KJIA 5L3QB 3ZS9A 1OT3A 1KDRA 3AQ4A 3Q5EA 5CYOA 3KFXA 2J7KA 2MSCB 2YNMA 1ZM9A 4PC3A 2ODWA 4A0FA 2QMOA 4EJSB 3GEHA 3KQNA 4XVRA 1UFQA 3V4RA 1E2JA 1T0HB 3QY0A 1E3MA 2AXNA 1D9XA 2NZJA 4JSTA 2FSGA 4LJYA 4PANA 4V0MA 3NDBB 4PC1A 2DFNA 1U9IC 2JA1A 2BKUA 3NDPA 4F4IA 4TYWA 4P0TA 4FI3C 3B9PA 3IQWA 2QORA 3ADCA 3J81k 4JZKA 1OH5A 3DKVA 3KB1A 2DB3A 4PC2A 3TGPA 1ZC4A 4M9QA 3MSXA 1TQ4A 4QJ4A 2J0QA 3PFIA 1YJ5A 2ZS8A 3FKSD 4A2WA 4HATA 5D3MB 3MWJA 1VHLA 4NTZA 2V9PA 4RZUA 1AZSC 1D9ZA 4TTQA 4V0ME 1HQYE 4AC9A 4GPTA 1CEEA 2QM8A 4KCGA 1FUKA 2QAGC 4LX0A 1ZJ6A 4JLOA 5FPHA 3A4LA 2Q9BA 3WMFA 1R4AA 3CRMA 4X8OA 1HA3A 521PA 2G9NA 3W6OA 3EPHA 1NVWQ 2GNOA 2VA8A 1E2DA 4TMZA 3U3KA 2Z5FA 3GLGB 1GM5A 1E0AA 2O5VA 4HLQB 5GVSA 4LHZA 4LI0A 1EFCA 3LD9A 2OFXA 2KB0A 3MFYA 2GTPA 3FGNA 3LBHA 2GCNA 4B48A 2AR7A 2CNWA 3CRRA 3QOFA 1GOTA 3NXSA 4J0QA 4QHSA 2YZ2A 3TVDA 5KTYA 2ZAMA 3K8YA 1U2RA 2GCOB 2R6FA 4IEEA 1M8PA 4DDUA 1ESNA 2F3TA 2HEIA 1XBTA 2ZEJA 2NO6A 1TQDA 4WZBE 4EJSC 3KQLA 1G6OA 2WAYA 3JZAA 4JBWA 4BLPA 1AQUA 3VAAA 2XNDA 4W5HA 3GLGA 1OB5A 2ZANA 5EE3A 4B76A 2YOHA 3N5CA 1JAIA 3TUJC 2ZAOA 4C7OB 1OXXK 2PMKA 2XJ4A 4Q4HB 4WVFA 3GLIB 1KSJA 3BB3A 3QEJA 1SXJA 3VFDA 2QT1A 4NYIR 1WQ1R 2QI9C 1O3YA 3FFBA 1AM4D 1FP7A 3MCAA 1W0JA 5EXXA 3UWKA 4LBWA 2I1QA 1HURA 4TQ9A 2QROA 4ZKDA 5ANRB 1GNPA 1QDEA 2J0UB 1A1VA 4PPNA 1Z6XA 2CVFA 1KSFX 3AF3A 2HF9A 4A6XA 2YYZA 4M1SA 1OB2A 4M1YA 2FGKA 3CX7A 1GRQA 4TLDA 3SOPA 1KO7A 1NY5A 5FPSA 4ACAA 2P6RA 3NEYA 5FOTA 2P3SA 1GDDA 1SXJC 5BWMA 4URYR 4U02A 3PEWA 4IDOA 3U6KA 3ZLJA 2WWHA 4URUR 1E94E 1XJCA 1QHHB 1UBEA 2V7QA 4ITRC 2QGNA 3QQ5A 2RGBA 2V1XA 2QENA 2W2VA 3BXZA 3RS7A 3TSOA 1ZNYA 3BH7A 3L82B 4QJ5A 3TBKA 1X1RA 2BCJQ 4C0KA 4FWTA 2ECKA 4AI6A 3VX3A 4LHVA 3V9PA 1P62B 2R2AA 4QFMA 1D2MA 4GRAA 4JL8A 3AVTA 3HDTA 3O8CA 1R5BA 3RANA 5EZ6B 1TADA 4BECA 1UJ2A 1IN7A 3HYRA 4PO1A 4A6PA 4KHZA 4AYTA 3ZVLA 5B30A 4ESHA 2ZI9A 1PUIA 1A2BA 1SZPA 3IQXA 2JGNA 5TMPA 3AB3A 4YMUA 3RRZA 1U8AA 3EZFA 2F3RA 3THXA 4MYCA 4PR0A 4DZZA 3CPHA 4Q1BA 3VNUA 4BLQA 3D8BA 1OLOA 2A5FA 4G5SA 3SHFA 4NCIA 1XZQA 3MAAC 4RCZA 2Q3MA 5JECA 1M7GA 2XNSA 2GAAA 3QPWA 5CM8B 2Q6TA 3ASYA 2W58A 2W6JA 2BEKA 2OCAA 2WSSD 4GOXA 4O25A 2O8DB 4LY6A 1F2UA 3PUYA 3THWB 2C5LA 1AQYA 2VHJA 2WSSA 3IHLA 3K9HA 4Q9JA 2FEOA 3SNHA 1DG3A 1NMZA 1ZU4A 5KSPA 4FCWA 3W5IA 5AJYA 1QHHA 3BD9A 1I2MA 1ZCBA 4LC1A 1K5GA 2FF7A 5LDDC 5F9HA 4C0AC 1KI8A 2WJIA 5DE3A 1IJEA 1NVVQ 2NPFA 3HU2A 3QE0A 5HZHA 1XTJA 4TLAA 3EW9A 4Z51A 2ONKA 4PQYA 1XRJA 3S1AB 3DHWC 1VG8A 2XB4A 3L8ZA 4G3XA 3RAPR 4YMTA 5JS8A 3CF0A 3L0IB 3GJ7A 3W8NA 1P9RA 1U9IA 4D4LA 5DN6D 1X8JA 2NO7A 4PHGA 4LZZA 2G3YA 2WZQA 2GRJA 3IIKA 3MMPA 3U7FB 3WRYC 3ETLA 3JVUA 4B3DA 1ZIOA 4B3GA 2SHKA 5KO2A 1E69A 3LH5A 4DRZA 2DWOA 2RB4A 1HUQA 3GJ6A 2QEQA 3RDPA 5A5GA 2CXXA 5FBRB 4LWZA 4N3NA 4XIGS 4WZAE 3LXRA 4PFSA 2EYUA 3CNOA 1SVSA 4PPFA 1U8ZA 2ZS9A 1G6HA 3T1QA 1G3IA 3A4NA 3MGCA 1XEFA 1EXMA 4TTPA 2VYFA 2J45A 5JLJA 3B8HA 3PEVA 4B3XA 1ESMA 4QKQA 1GWNA 3VR5A 2GK6A 1K6MA 4K46A 4LV6A 3IPXA 1JPNA 2A5JA 3QPUA 3VU9A 3DOFA 2OFOA 3ZVRA 4TZ6A 3CPEA 1T3HA 5J4YA 4IVQA 2ZPTX 4IW3B 2GJKA 1JB1A 3Q85A 4TL7A 3TQCA 4Q4JA 1NNEA 4ILEA 2BBTA 4EPTA 3K0AA 4C4PA 1Z06A 1NL3A 2OBMA 1KI4A 4PHHA 4M0LA 4LYFA 1SVOA 1QG4A 3AVUA 4NU0A 1DAHA 4DLTA 1KDTA 4HLUC 3RWOA 3BIFA 1Z07A 4NPHA 5IHPA 1MOZA 4DWJA 3EZ7A 1XD2B 4FXPA 3K70B 1T9HA 3B1XA 5GJWC 2ZU0C 3BFXA 4Q1FA 1E2LA 1W36B 4D0LB 2NGRA 1RRGA 4NCKA 2WWXA 2ZM5A 1KI2A 1OH7A 4N0EA 4C0SA 1CP2A 1U0LA 3UMFA 2ZRLA 3Q7PA 3UG7A 2OLJA 3AH8A 3G82C 3BJIC 2OCBA 2PLRA 3A8TA 2GJ8A 1XD8A 2WJHA 5JI2E 3H84A 5HKKD 3C5CA 1S4QA 3B6EA 4TMVA 1GNQA 1KI6A 2V8OA 3BC1A 1A2KC 4XTCS 5FOXA 1RRPA 4E07A 2QPTA 1Z0KA 2JLWA 3LAWA 3PEYA 3DZ8A 1AN0A 2D2FA 4BLOA 2AN9A 1Z47A 2H16A 4B3FX 2WWIA 1NKTA 1E79D 3G5UA 4TL6A 1PLLA 4C9BA 4TMWA 1X8LA 4B2IA 5J4LA 4XWKA 4H9GA 4IXNA 3HR8A 2QRNA 5FL7A 2ZJ5A 2ZUDA 2E9SA 3QXJA 3E5HA 3UMRA 4LHWA 4I4LA 5AUNB 2VP5A 3I73A 5G41A 3B2EA 1UAAA 1GAJA 3GFTA 5ELXA 2D7DA 3ZD7A 3FYHA 1KO8A 4GP6A 5EP4A 2FDCA 3QUSA 1HE8B 4NHOA 4EFLA 5KYKA 3GLHB 1XD2A 1ZNZA 4LJ8A 4JVSB 1KYIA 3VKGA 1G41A 1XF9A 3P20A 3FMIA 3CNNA 3BERA 1W2GA 1T0JB 4F4CA 4AKGA 1N6RA 1KK0A 1VYTA 3MJRA 3N70A 4NH0A 4YXWD 1JXOA 1F2TB 2IHBA 2ZI3A 1CTQA 4MYUA 2N46A 5KOYA 4B33A 1W0KA 1J7KA 3T34A 1ETUA 2GCOA 421PA 3I62A 2H17A 1IHUA 1W0KD 2PCJA 2AD1A 3MUFA 4I1OA 4OL0A 5DN6A 4KYUA 2IUTA 2UZIR 2O8FA 3R9XA 1WF3A 2X8AA 3L0OA 3X2SA 3LLUA 1DELA 2WICA 3QENA 3FTQA 2PX3A 2HUPA 4HI0E 2FGJA 2R9VA 2WJGA 3CF6R 3PIRA 1JEEA 4V0LA 1CULC 4JJKA 3NBYC 4RZ3A 4BFZA 4R2IA 2D2EA 1CXZA 5FOUA 1T4GA 4IDPA 221PA 1XEXA 2FSHA 3MRSA 2AHOA 2JLQA 4OQXA 4V02A 3LX5A 3BGWA 3K0CA 4P4UA 1MABA 1MV5A 2ZJBA 3IO3A 1E2MA 3KFVA 2WPDD 2AFIE 4OK3A 1OHHD 3CO5A 4XOIA 1LW7A 4DLXA 1G291 1S3SA 1GIAA 5EE1A 4M2LA 1W4RA 2DWQA 1ZUNB 2QN6A 4JT4A 1CJUC 2ZR0A 4ZO4A 4BRUA 3U7GA 1D8TA 3TKLA 2G0NA 1ZVQA 4M1OA 5G40A 3UKDA 3BS4A 4DDTA 3GLFE 1IXSB 1HT2E 1TF5A 4JLKA 3FPAA 4TYPA 3ZD6A 4NYMQ 5CLQA 1XDBA 1WB9A 1RFLA 2VSXA 1KJZA 1E9DA 1TQ2A 4YLGA 4B3CA 4DT1A 5B64A 1O87A 2ZE8A 3EASA 4V0NA 5IDVA 4M1KA 1BKDR 1W36D 3MWLA 3NWJA 2GXQA 3C8UA 1DEKA 1BMFA 4RD3A 2FPLA 3TE6A 3MWYW 3U44B 1KMQA 5SZIA 2BBWA 3LBIA 4L8GA 2PZFA 1SVKA 1UEJA 4BEJA 2F6RA 1L2TA 4F91B 1XCGB 3VMFA 5KPDA 4LV8B 1CKEA 1U94A 1DAIA 3KZ1E 4KBFA 3THXB 1Q20A 2QP3A 2G1KA 4R71A 4Q9IA 4NBSA 2AD5A 4ZI2A 2FFAA 4G01B 4OHZA 2RKOA 5JBQA 5H1YA 2ZVQX 1IY0A 3GJ8A 3KJEA 3SJZA 2RHDA 1QG2A 2IX3A 4HLUA 1XPRA 2RAPA 1GL9B 1ZBDA 5AJZA 1QF9A 4W7SA 4QGFA 3IBYA 1AJEA 2C77A 4GFDA 2FFHA 3TW8B 3VR1A 3CKLA 1GILA 2FSFA 2C03A 2OZEA 5TVKA 3CZPA 3V00A 3VR4A 1R0YA 1Z29A 4YDSA 2FZ4A 2OESA 4ZCMA 1VCOA 4M8NE 1E1QA 5KSYA 3BWDD 4BGDA 2JLZA 1GG2A 2QP4A 2Q9CA 4K81B 5SZHB 4M1MA 4MYHA 5FL7D 4ARZB 1EFHA 3WYFA 2DHRA 1NSFA 1ONBA 1IN8A 4US2R 4OK5A 4BZQA 4DT1B 4I99A 2O8CA 4DLUA 3NC0C 3U5ZB 1JJVA 2H8KA 4C2TA 3FKQA 3WP1B 3AM1A 2GJSA 2HYDA 3QF4B 2ZSEA 1OPXA 3W5JA 2ZYVX 1KZGB 1MR3F 2AWNA 3DZDA 4EAQA 4RD0A 3DOEA 5JHGB 3KQHA 4D4KA 3QI2A 1J99A 3BAFA 4X8HA 5J4KA 3OIYA 3AKCA 2AL7A 5EP1A 1WA5A 3ZVNA 4DXAA 4W9MC 4A15A 2DFLA 4AWXA 3MG9A 1MRNA 4YXWA 1Q12A 2V6IA 3HU1A 4O0MA 4P4SB 1W4BA 2BKEA 2UVQA 4TYNA 2NG1A 2IF2A 4DSNA 4CW7A 3WNDA 1Y3AA 4TYYA 1E98A 4NYJQ 4E22A 1WE2A 1JECA 1DAFA 3PUZA 2N42A 3W6PA 1FUUA 4UXHA 2B92A 2JATA 5DHFA 1XTQA 2WIAA 2VL7A 5JZVA 3BBPA 3O8DA 1M7HA 1XMJA 1Z6AA 1T5LA 2XNDD 1YZUA 4KFSA 5IRCD 2KI5A 3C14C 1N2CE 3B78A 2GF0A 1AS2A 3K0FA 2FE4A 3U60B 1N0VC 1EGAA 1MRSA 2HJGA 3SFVA 2A9KA 3SJCA 2PMDA 2ZRNA 4D81A 4TLCA 3AVQA 3I3SR 4Z1MA 3NIBA 2B8TA 2IS4A 3RSOA 5AUQA 3SYLA 4P3YA 3ZIAD 2QM7A 1TMKA 3GMTA 4LJ5A 2O0KA 3DO6A 1EESA 1Z3IX 1VCNA 3FFAA 4MRRA 4XWAA 1K5DA 5TY0A 4OHWA 3RS3A 2CK3A 3SZRA 2BC9A 2BMFA 3KJHA 1E1RD 2YC4C 1XTIA 2NPIA 4ZCIA 3MLEA 4G5OA 2ANBA 3L8YA 3LA6A 4KV9A 4BLTA 4BUJA 1WCV1 1Z8FA 2ODNA 1NRJB 2P67A 1XXHE 3H86A 5AR1A 1ZP6A 2YV5A 2R44A 4BFUA 1G17A 1XCPA 3PJRA 2LWIA 3BFKA 4Y0VA 4E09A 4ERNA 4GZMA 3AP3A 3TQFA 1TUEA 1XZPA 2W0MA 2AKAB 3GFPA 1VIAA 1D5CA 2HV8A 1J8YF 3TUIC 4CDGA 3FB4A 2ZRMA 2PEZA 1W36C 1F2UB 2O8DA 2J7PA 1ZUIA 3RRYA 1YZQA 5FUVA 1ZAKA 4WA7A 2B6HA 2W0SA 1LTQA 4US0R 4TQUS 1FX0A 1OH8A 1II8A 1EK0A 2ZJAA 3OIUA 2ZXUA 1G5PA 1G7SA 2C9YA 3OFNA 3H4MA 4D82A 2PEYA 1UBGA 1I4LD 1FQKA 1P9WA 4C0HA 1DOAA 3B1ZA 3EX7C 3ZZUA 2QRZA 4LOAA 1YHNA 3AUXA 4LBZA 2ZRHA 2XXAA 3FWYA 2BWJA 2DY1A 5AWFC 3EPJA 1S0UA 5FI1B 1FZQA 2JJ1D 5KSOA 2BVNA 2E87A 4JSYA 4OI0A 5KNDA 5FPKA 1NIPA 1KKLA 1Q1EA 1XP8A 2D4HA 2XZPA 3NHAA 3UATA 2FPKA 3KX2A 2CE2X 4QGAA 4OI4A 4RY2A 2OE2A 2AXPA 3THYB 4V03A 1US8A 3QXHA 1LVGA 1AS0A 1KAOA 1FNMA 3FHCB 1JR6A 5JEEA 4GNKA 2OG2A 1RW4A 2GVDC 3ZYCA 4MGKR 4PPGA 4KAXA 1EFRD 4DDVA 2PBRA 1N6LA 2QQ0A 3LLMA 1G18A 2GEDA 5DO9A 2PT7A 3TR5A 3F0TA 2ZI4A 3ADKA 4LRWA 2XX3A 1CJMA 3W34A 2PH1A 3SQWA 2BMJA 2IYXA 5F3WB 3R7WA 2J3EA 5EJEA 1UDWA 5JCPA 2D3WA 4UNSA 3OE7A 4PZYA 3OEED 4QRHA 3A6PC 1XFAA 4PSVA 4RD2A 1FFHA 3LVQE 1EX7A 4HAYA 2Q3FA 1LY1A 2HDNB 1YR9A 2RGNC 4Q02A 2IS6A 2WBLC 4PZZA 1KHTA 3SR0A 3K53A 4CEHB 2NMVA 4CT4B 5HR5A 3Q7QA 4E03A 1H8EA 3GLFB 4ZDIA 4RD6A 4HLDA 3EARA 2W6JD 3GJ5A 1C9KA 2XB2A 5DI9A 2JLUA 1L7VC 1NBME 4DKXA 3LDAA 3D7MA 4IOMA 3DMNA 1G1MA 1XJ0A 1ZRHA 3DKPA 3OIVA 4PHFA 2O8CB 4D6PA 1PJRA 4NDZA 1VECA 2P5TB 2CJWA 1SVMA 2JDID 3EZ6A 3W90A 2FN4A 4XWOA 2PZEA 2V7QD 4QC2A 1E9RA 2NQ2C 3LXXA 2C2HA 1G8PA 1LF0A 3JVVA 4XD7A 2BMEA 4ZCLA 2WV9A 3VHLB 1XX6A 4NCHA 1U0HC 4TL9A 5EP3A 5BYKA 2VPPA 4QBHA 1F3OA 3T12A 1U98A 3K09A 3L0PA 3SBEA 4DB4A 4M4SA 2RH5A 2WJVA 3GLHE 5BN4A 2K5UA 2FG5A 2JLRA 5DYIA 1LS6A 2ZYTX 4JS0A 4TL8A 5DHAA 3R8CA 1FMJA 1FOEB 3GP8A 1YU9A 2F43B 3ADDA 3AGQA 4FN5A 5HCNA 2WMOB 3MJHA 1VG1A 1GKUB 4RJLA 4UNRA 2BDTA 4RD1A 2IXGA 1TU3A 1PLJA 4Q1EA 2BIFA 4X8MA 1N6IA 3EG5A 3OEHD 4K8OA 2WJYA 1TTTA 2ZI6A 5BQ5A 3VTKA 4KFRA 1COWD 4DLZA 2IHYA 1NJGA 4ZDWA 4C0BA 3A1VA 3PUWA 3GLGE 4GI7A 3IIMA 3TUZC 2KWIA 2ZRKA 1FX0B 3DDCA 4HYYA 4FMDB 4KO8A 4O2LA 3CLVA 5FBWB 2EFGA 1BH2A 2FZLA 821PA 3FVQA 1OFTA 4HDOB 3VNVA 1RJ9A 4HB2A 1A4RA 1E9AA 3O8RA 1Q3TA 4HB4A 3B82A 1XTSA 2QTVB 1RKBA 3B1WA 2D7CA 2Q0HA 5LB4A 4CEHA 1UKYA 1UKZA 4S35A 1TX4B 2IUUA 1VYVA 1OFHA 1GITA 2J0VA 3T1TA 1E0KA 2VRWA 5CLLA 1G8YA 2OFWA 1KDOA 2H5EA 3K70C 3WRXC 1GSIA 5H70A 1JNYA 3R8FA 1DARA 4L4UA 4NCJA 1CS4C 4ZIRB 2IT1A 3DL0A 1G9XA 4GOJA 5JS7A 4DCUA 4O2RA 4MDEA 3LBNA 4LUCA 2PZGA 3HP1A 3E1SA 4A8JC 2ANCA 4HUTA 1HT1E 4WXPA 1ZC3A 4LHXA 4MKGA 1II9A 1XMSA 3WBJA 1R5OA 5KDOA 2NO0A 4FWIB 3BH0A 2QGZA 2Y8EA 2WWYA 5DH9A 2DR3A 1MO4A 5HCIA 4E5UA 1A5TA 1G64A 5EUMA 4BFYA 2ZRDA 4Q4JB 5FTMA 4CF7A 2BCGY 2QAGA 2NZ8A 3U3JA 3ECCA 3B1YA 2ZRJA 2O8BB 1YKSA 4HDCA 5BXQC 3VX4A 1YR8A 1NJFA 5BN5A 3AVPA 2ZRFA 1P60A 4BLSA 5JWHA 5CK5A 1M2OB 2DWPA 4AYWA 4F4JA 3ND9A 3AVYA 1XTKA 2W00A 2JIZA 2VEDA 2WWWA 1KNXA 4LBVA 3ZZ0A 4AIIA 2V3CC 4GZLA 1CR0A 2EWVA 4A0RA 2WIBA 4ASUA 3UPUA 4DBLC 3IEUA 4JVMA 4HAZA 3EC2A 1B0UA 1CR1A 3HPRA 2XXAB 3A1UA 1R6BX 1G3MA 5F2EA 3RHFA 1II8B 5H8WA 5FOVA 2ONJA 1BMFD 4D0NA 2YWGA 4MUAA 3W3AA 2C04A 5FTNA 3CZQA 5K8IA 3NBZC 4MYTA 2CLDX 1W47A 4XSGA 5TB5A 1OXSC 2XSZD 2ERXA 4ZIRA 1VMAA 2OBNA 1NN3A 3U3OA 2MMCA 5F9FA 4OJQA 3RVBA 5J4HA 2ZE7A 4GT1A 1XJQA 1V5WA 2CBZA 5K8UA 4D26A 3VQTA 2AK3A 4PHTA 1AA9A 5E7IA 2C9OA 3QG1A 3RRMA 1DS6A 2VHCA 4NONA 5CK4A 2VLIA 3SYKA 1Z28A 1DG1G 2TMKA 1OFIA 5KSZA 1IY2A 2XEXA 5GJBA 3SU8A 2QU8A 1E2PA 4EPXA 3I92A 1MT0A 2VHQA 2QA5A 1EWQA 1DVRA 2Z43A 2ZRGA 4FINA 4PQFA 4EPVA 3SN6A 1J8MF 3JZMA 4JLAA 2PJRA 5KU1A 4PPQA 1UF9A 1JR3E 4S2EA 4IVPA 5CB6A 4D25A 1UDXA 1HE1C 5A0FA 1Z6TA 1ZIPA 2CCJA 4Q4LA 4KJZA 4M53A 3V4FA 4OQLA 4RFVA 3LRPA 1E2QA 5KPJA 2IA5A 1XXHA 2F43A 3LW8A 1ODFA 2CL0X 1G3UA 1E2GA 3VR3A 1AZTA 5DI3A 5KHOC 2GAOA 3LVRE 4UJ5A 4DLRA 1W5TA 3EZ2A 4MRSA 4QNMA 2W6ID 1W5SA 2Q3HA 3X1DA 3QPVA 4KI0A 2VF8A 2OO7A 1Q22A 4DUGA 1Z0DA 2QAJA 5EP2A 1PUJA 2YC2C 1W44A 4LHYA 2R65A 4LYHA 3THOA 4B44A 5IT5A 1Z0AA 1XWIA 1ZD1A 3SJAA 4AG6A 1P72A 1QVRA 3ZH9B 3U61B 1OE0A 1U81A 3BB1A 3CPJB 4QM6A 1WRBA 1GTVA 1ZUHA 4JMPA 4PSKA 5DNYB 2XZLA 3K0FB 4HAWA 4RKEA 1M34E 1I2DA 2RGCA 6Q21A 4Q7LA 4LJ6A 1HY3A 2KJQA 4V0KA 1DAMA 2AFHE 3ZQJA 1OXUA 3BB4A 1XCMA 4LJ9A 5KNBA 2C8VA 3C16C 4DCSA 2WHXA 1IQPA 1DTSA 1Q57A 5CIQA 2PLFA 4WOPA 4C3ZA 4FMCF 3K70D 2X2FA 2QE7A 5HPYB 4ESVA 1JXMA 5EXPA 5JHHB 2D06A 1E9SA 3OZXA 4IDNA 4B2LA 5SZKB 4AKEA 4NKRA 2EYQA 1V43A 4Q00A 4KU4A 4P4SA 1TF2A 2W83A 4UNQA 1FL9A 1P75A 1XB2A 2N1BA 3EA0A 1TF7A 2JEOA 3CH4B 3R9IA 4MDFA 5TARA 2G6BA 1QRAA 1T6NA 3X1XA 4AURA 4A36A 2DPXA 4URVR 2F55A 1NVXQ 4XSHA 4KITB 1A82A 3FKSA 1R8QA 2XJ9A 1T3LA 2FNAA 3AKDA 2G77B 1KY2A 4Q18A 1E2KA 3AP1A 4HDQB 3TLXA 3NEJA 2R6DA 3D6TB 2J1LA 3ZZTA 2V1UA 1Z6YA 4ASUD 2GA8A 1M74A 2IEYA 2IXFA 4U5XA 4JLPA 3NTUA 4KLZA 1BS1A 1JAHA 3THWA 3C4JA 2DCUA 4EFNA 4P32A 3SHWA 1W7AA 1UKEA 2CCKA 3EWSA 1HH4A 2PL3A 4Q1DA 4TN1A 1LNZA 5DISB 3EIEA 3Q3JB 3TR0A 5GADl 2ZI7A 2HYIC 1NN0A 3IPYA 4DJTA 2FU5C 3DVLA 4UQOA 4C30A 1OIWA 3KUCA 4YMSA 1M6NA 4P31A 4XVQA 1SKQA 1H8HD 1YZLA 3OAAA 3QJYA 2LKCA 2P2LA 4NL4H 4OHXA 2ASEA 4PXAA 5E7MA 3GD7A 1NN5A 3LQRA 4RZ2A 4BFSA 5E3HA 3D31A 3GPLA 2EFCB 5E7JA 4Z8XA 2QL6A 2IS1A 3BE4A 4QNRA 2YHSA 4PO9A 3NKVA 3EXAA 1Z0JA 4DCTA 2P6NA 4Q1CA 2Z6VA 4EPYA 1CBUA 1E9FA 1G8FA 2CDNA 3EPLA 4WAUA 1YZNA 2ZSAA 3SFZA 4DCNA 5FOWA 5EE9A 3U44A 3F8TA 5FH9A 2FFBA 3QKUA 2OEPA 4IRUB 2VIIA 2F1RA 2FSIA 2V55B 3M0EA 2IBMA 5HZKA 3FHOA 2QP9X 2YVUA 4C0LA 4BEBA 4DLWA 3CIOA 5AUPB 721PA 2VP2A 1AIPA 2IYVA 1U90A 4TMXA 3ONWA 1KI6B 4B75A 4JT2A 3BRWD 5AJVB 3VHXA 1ELOA 1X86B 3QKTA 4UXJA 4DSUA 5JRJA 1KNQA 2C99A 3OHMA 2MMGA 3CB4A 4L15A 1R5NA 1UBCA 2NOAA 2IYTA 4IJMA 1RRCA 5DSZA 3P26A 1Z0IA 4EJSA 4MGZR 1AKEA 2IYLD 3LW7A 4JVNA 4W5WA 4CT5A 2IYWA 1GNRA 2I1VB 4KYIB 4MGYR 1KSHA 4Z54A 4CEIB 4MKHA 1FMLA 3LO5A 4CGZA 2W6IA 1NMXA 5KDDA 4OK6A 1YZKA 1M7BA 2GBLC 1P2SA 4RCYA 5J40A 2A5GA 2EW1A 2GF9A 1NIJA 1XEXB 2QNRA 2D74A 1S1CA 3R7WB 1SXJB 5G3YA 2VBCA 2ORVA 4LJ4A 1UPTA 1OYYA 3AUYA 3B7GA 2VP0A 1ZM3A 3C15C 5B58C 1XNJA 1VPLA 1DADA 2GWHA 1S9HA 1SQ5A 2WSMA 1CJKC 1X6VA 3RYTC 3PUVA 1OXVA 3ZQ6A 3ZS8A 5HE8A 2IL1A 1WXQA 3U6BA 1Q3HA 3CNLA 1JQJC 4A8JB 4HUQA 4DIDA 2H7VA 3VKHA 2QTHA 2O8FB 4NMMA 2O8BA 3TMKA 4FD2A 4MRPA 1Z22A 3CR7A 2VO1A 4WIAA 1E79A 3TW4A 2G1JA 1R8SA 4Z1MD 5JEDA 3U4QA 4OI2A 2RGEA 4IHQA 2VHUA 4JBYA 1EX6A 1XMIA 3CRW1 1F2TA 5HE9A 1FNNA 2P65A 3OFND 1H8ED 2GJ9A 2IWRA 1FP6A 1F48A 2B7BA 4NP6A 2D62A 3L0SA 3Q72A 3QKRA 5L3RA 1YE8A 3MWKA 5DIFA 2VSFA 3KXKA 2ORWA 3QIAA 1ZD8A 1N0UA 4TLEA 1N3BA 4B74A 3P27A 3I5XA 3CWZA 4RZXA 2WJJA 1IM2A 1U8YA 3WMGA 4EUNA 1FW6A 1OW3B 4LC0A 2QSYA 4Q9KA 2EFDB 5HTKA 2ODEA 3K0EA 5CJ2A 4ACBA 5BW8A 3ICEA 3GJ3A 2PT5A 4D80A 3KDSE 1TL7C 1S2MA 2ZI5A 4O3MA 1HV8A 1JJ7A 3K0CC 2ZETA 4NYIQ 4Q9HA 1QHIA 2C9CA 3OESA 1OSNA 1T91A 2FX3A 3WP0A 1E9BA 1ZNWA 4KBGA 1Q1ZA 1NBMD 5TXGA 4DEXA 1KMHB 5J4VA 4JVLA 2Z0MA 1NBMA 2UZ3A 4Z8YA 3EIHA 2CE7A 4Q66C 5JJKA 1Y63A 5EUQB 4RVCA 3I8SA 1GP2A 1E9CA 3PITA 5FL3A 4A1FA 4YONB 3Q5DA 3UG6A 4LCBA 3KQKA 3RRNA 1IXRC 4JLBA 5FTLA 2XOKD 3QVVA 4PX9A 2H57A 4Q03A 3CF2A 4PC7A 3NBXX 4M9SA 5FOSA 4A9AA 1K8RA 2GEVA 3SC3A 2WKRA 1CJTC 3QBVA 3U3MA 4M9ZA 2FEMA 2OLKA 1JR3D 2CEAA 1TEXA 4FCVA 3R20A 3RSLA 4AK9A 3FHTA 5AJWA 3UK6A 2ZRAA 3OE7D 1DE0A 4BFVA 2VH5R 4QBGB 1NLZA 5DYGA 4NE2A 3CX6A 4IOKA 3SS8A 1CR4A 3W9YA 2ZTSA 4JLNA 4D2IA 1CRPA 2ZJZA 2RGGA 4DEYA 3BORA 3TH5A 1KJWA 2ORIA 3EC1A 3NC1C 3GJ0A 1CU1A 4DVGA 5L3SB 3LNCA 3QNUA 1WDTA 2IYSA 4CYMA 5LPNA 4OQNA 2ZR9A 4GMXA 4G5RA 3VU9B 1YQTA 4EIWA 3G0HA 5DLQC 2L0XA 2CLSA 2EFHB 2ZYWX 3IGFA 4LJAA 4MA4A 2F9LA 2IEZA 3GFOA 4UNNA 5JFGA 4DDWA 4KVAA 4YC7A 1PLKA 4ZDJA 3TSWA 1Q0UA 5TDHA 3K1JA 4LYJA 2FWRA 1P5ZB 1YZGA 4PQRA 4URWR 4WZ6A 4A4DA 4F38A 3PEUA 2QMHA 4AYXA 1KO5A 4KFUA 5UKDA 3TVTA 2YKGA 2VQSA 1N5LA 1MH1A 1NF3A 4YDHB 2E1RA 1E96A 3NG1A 5A4JA 3QVUA 1IN5A 1TNDA 4Q4AB 1AS3A 4BE7B 4YMWA 4IXMA 1CIPA 3N2EA 3C41J 3WHLA 1G8GA 4U00A 5JWRA 5C46F 1KKMA 2LCFA 2NTYC 2ZJYA 2C95A 2ZUBA 2NO9A 5C18A 4CEJA 3OEEA 4ABYA 1NMYA 2GEUA 5KUTA 1QHGA 2HXYA 2XTNA 4TQAA 4Y0AA 1P61B 4F93B 4LSGA 3KL4A 2F1HA 5D3QA 2F1JA 1QHNA 2A30A 2ZS7A 4IOJA 4EPRA 3WMEA 1EG7A 2QSZA 8OHMA 1PVOA 1FTNA 3ND8A 1Q44A 4W5JA 1KK2A 2OAP1 4C0QC 1T5IA 1R0XA 1W48A 4WW0A 4Q4AA 1EFTA 4ZDKA 4XJXA 5J47A 1RJ9B 4HAVA 2NIPA 1U0JA 3T1OA 3UWOA 2CVHA 3PG5A 4FCTA 2YINC 3KXLA 5K8TA 4GDFA 5KDLA 1IBRA 2UKDA 4DB2A 2ATXA 1L4YA 1ZCAA 1G7RA 3A1WA 3W6NA 1BOFA 5FI0B 4A0HA 5L3SA 3NH9A 2OBLA 1J90A 2O52A 3EAQA 4LDJA 4LYAA 2ZITA 1HTWA 3A1SA 4XVUA 2O8EB 1FQJA 1TU4A 1ZM4A 4FMCB 4IFBA 5AK0A 4LPKA 1GL6A 3GLHA 3W3ZB 1J2JA 1KIMA 2JLSA 3PVSA 2OUKA 2XAUA 3KKQA 2IS2A 1IN6A 2JJ2A 1E6CA 1Z83A 4I1VA 4M21A 4CVNA 2J59A 4EQ6B 2H18A 4LJ7A 2GXAA 5FUWA 1W2HA 2IF0A 3WYAA 2VHTA 1HQCA 4I1UA 3K9GA 1EFUA 3I5YA 2VF7A 3H1TA 4QOSA 3AF1A 1II0A 1KZ7B 2EWWA 1NLYA 5BYJA 3A1TA 4I1SA 2RGDA 4U7DA 2AKYA 1KGDA 2A2ZA 4DSTA 4Q7KA 5C1BA 2QE7D 4JLJA 4RD4A 4UJ3A 2JASA 1NN1A 3KXIA 4YMVA 2CJWB 4KSCA 4JL5A 4ON9A 1KMHA 2Z4SA 3AEZA 4Q7MB 1G8HA 1KTVA 2ZJOA 3TJZA 4ZI3A 2IWHA 1ZW6A 4L5BA 2O0HA 1XTRA 2OHFA 3PV0A 5K8LA 1RZ3A 2HCBA 2ZE5A 1LB1B 5CIWA 1L8QA 1UEIA 2QZ4A 2JIZD 5P21A 4NYJR 2CK3D 4F7WA 2ZSBA 3IBGA 2C78A 5C4GB 1PV4A 4Q21A 2YJTD 2J0UA 2OM2A 4UNPA 3VR2A 4Q4HA 3GLIA 1CR2A 1WMSA 4DLVA 4C7OA 4XTRA 3IUYA 1DAKA 3B13B 3QSYA 1W4AA 2XZOA 5G3ZA 4OQFA 4B47A 2XGJA 1OKKD 1LV7A 3KJGA 3M6AA 1GL7A 1R7RA 2BJVA 4HZIA 4Q5IA 4RSGA 5CDFA 2V54A 1W49A 3QKSA 5EE0A 4B3BA 4BRWA 2JLYA 3QKRB 2ZROA 4TMKA 3I61A 4Q01A 4HSEA 2QMEA 3K0AB 1G3QA 5JJLA 4IEIA 2ZRPA 5C4MA 5DGXA 2R6CA 1G16A 1XEWY 1S3GA 1GRRA 2OAQ1 1YRBA 1US8B 5E95A 3T06B 1S9DA 3GJ4A 2QTFA 2ZRCA 1NY6A 5B2ZA 3C5HA 2HF8A 1RIFA 2FA9A 3AF0A 4A8JA 1NVUQ 2CHVA 5IF9A 4BZPA 3OF5A 4MKFA 1N0WA 4BLRA 4L9SA 4NCNA 1E1QD 1KI3A 2ZU6A 3QKSB 1F6BA 4N0DA 2A7QA 3WNBA 3E70C 3DPUA 1E2IA 3I4LA 1E4YA 3K09C 1SKYE 3BOSA 4F92B 2XTMA 4TTRA 1NI3A 1E4VA 1F60A 1KI7A 1Q1BA 1VCIA 5CITA 4QBIA 4IKEA 2YOFA 1T8UA 2VP4A 1NVVR 2P0EA 3ICQB 4ZPXA 2AX4A 3AVVA 2P5SA 1GZSA 2HT1A 1KI9A 1E2HA 4A2QA 5JJIA 4LPSA 3SEAA 2CHGA 3FMOB 3KKNA 1TAGA 1IONA 3PQCA 1QHYA 2G88A 2QUZA 5GJVC 4DLYA 4PC6A 2J41A 2IYRA 3QXCA 4DUGD 1JALA 3I32A 2OT3B 4WXRA 4DSOA 1OYWA 1M1YE 3B60A 3HWSA 4A82A 3S1AA 1KY3A 2BJWA 4QXAA 4GP7A 3FE2A 4AD8A 1DBSA 1DPFA 2FV8A 4ARZA 4BFXA 2IC5A 2X77A 2CLCX 2JLXA 2LKDA 4B32A 1FTSA 1P73A 2DBYA 1ANKA 4OKSA 4Q19A 3EZ9A 4FMBB 2OV2A 3B5JA 3IEVA 1SVLA 3RS4A 4JLDA 2YWFA 1JPJA 3N2IA 4JLMA 1AKYA 4HZUA 3WY9A 1N6NA 3HYTA 4GMDA 5G53C 1LF5A 2ATVA 4D4JA 1S96A 5CJPA 4MUBA 3PXGA 5L3QA 3TK1A 1G5TA 4P4TA 4HB0A 4KVGA 2A5YB 1ZYUA 4TLBA 3T1VA 2BMDA 4XH9B 4MRVA 2ZVPX 4G5QA 4R9UC 1UADA 1CLUA 1UM8A 1W0JD 4QHYA 5EE5B 1DO2A 3KKPA 1JI0A 1GVNB 2ZJ8A 4HAXA 2REXB 3A37A 3QEOA 1UKVY 3ZIAA 1KSGA 1HEIA 5FBLB 5E4FA 2I3BA 3CWQA 2VSOA 5CM9C 2YWHA 4A2PA 2QBYA 2GHIA 1OH6A 2ZRIA 3CUEF 1EWRA 2ZSFA 4POAA 1QZXA 2ZR7A 4B2PA 2J0SA 4MH0R 1CJVC 2P6UA 2IW3A 2GK7A 3H0KA 4OBEA 1E1RA 1ZU5A 1KK1A 1OJLA 4H1UA 5JCZA 3HU3A 3PCRB 1J70A 2FOLA 1KI1A 3CRVA 5EXTA 4GBMA 1UBFA 1P2TA 2R62A 1VTKA 2B8WA 5EXSA 2WKQA 1RYFA 1Z2AA 1SHKA 1VYUA 4RFSB 1Q1QA 2QPAA 1OV4A 3AF4A 4BQSA 1OXTA 4MITA 2WMNB 1KK3A 1BIFA 2EFEB 1SHZA 1IXZA 1SULA 4B71A 2WKPA 4QGGA 5JRZA 1H8HA 2GETA 3OAAD 3GCGA 1NG1A 2CNWD 5BN3A 2DYKA 2HJVA 3CRQA 1YR6A 3P4YA 2V6JA 3HR7A 3LWNA 2BBOA 1LS1A 2ZSDA 3TNFA 3REGA 2J7PD 2ERYA 1SVIA 1IOZA 2OXCA 4B34A 2EVWX 1JBKA 4HLCA 1H65A 1T3SA 5CB8A 4JLVA 1QBKC 4NYMR 3A4MA 2YWEA 2JCSA 4Q1AA 4M1TA 4URXR 4OHYA 4RFSA 4MKIA 3L2OB 4IDQA 3TIFA 2PCLA 1MKYA 4C0JA 1LFDB 121PA 3C7KA 2PX0A 3SBDA 1X1SA 2Z4RA 2C98A 3K9NA 3RC8A 2DFTA 2GKSA
chains in the Genus database with same CATH superfamily
1S2GA 3K0SA 3DWGA 3KTAA 2J9GA 5JNTA 1C7QA 3RB8A 4W8GA 5EJ8A 1A7JA 3TNDA 4UDNA 4JL6A 1ID8A 3E3MA 4JYPA 2WILA 2CJFA 5FUYA 2BFEA 3H2YA 4IUYA 3UANA 3RSQA 1L5QA 1U0SY 2NN3C 2VJMB 2EBFX 2VJAA 1ZRNA 3LQKA 4IUBS 4CIDA 5IXYA 1K1EA 5SYAA 2A9QA 3HXKA 3JQCA 1Q1NA 3OVMA 2B7CA 4WX2B 1SXIA 1I2CA 1XPUA 4GR4A 3PRKE 2O57A 4TT3A 2R7MA 3B1VA 1T2CA 1W4LA 2WOOA 4OLHA 4R05A 1KQ3A 5SYNA 4CKYA 1VKJA 3EXFA 3OETA 3QX3A 3O95A 5DULA 2V7BA 5LB2A 5E38A 5FR1A 1QWOA 3WXBA 5KSWB 1UT6A 3TJRA 5L40A 4X95A 2IYNA 1EFAA 4A3SA 4UD2A 2R84A 1CRZA 1XPOA 1P3JA 1SCAA 1ODKA 4GIBA 4KWEA 4TXHA 1E2BA 5JSYA 4J7XA 1E3TA 2R1ZA 3FNBA 3JW8A 1GRNA 3KBBA 1GZ5A 4B35A 1M76A 1L6RA 2GILA 2QUJA 2H1LA 4RV4A 1L5ZA 3EXG2 3V7WA 3PFKA 1EVZA 2CVQA 4RSHA 3E8XA 2C9BA 1U0RA 2UUBB 1ST3A 2YICA 3D7KA 2GZAA 3R3JA 4R7ZA 1RWXA 2W2OA 4PXYA 3WO1A 4BZZA 1NW6A 2IHVA 4IY1A 1D09A 1TEVA 1Y7TA 4II7A 3ZOKA 3M3PA 3U09A 2VG8A 4AKHA 4IGIA 1A9ZA 1PGPA 1PYOA 2VDOB 3PWTA 5ULLA 4CZ2A 5GZ3A 1I4DD 3W8RA 1QRUA 5D00A 3BQ9A 4P5EA 5AVJA 3ZHZA 2AWOA 2N3ZA 3KAJA 2XUDA 3QOYA 3VR4H 5AM2A 3KB6A 2GPTA 3U7QA 1NC1A 1Z5ZA 4CCSA 5HWSA 3LY5A 2CHEA 4R2HA 2Z2YA 4PLVA 3QG5A 3BRWA 4Q3OA 2GN2A 2H7YA 4RC9A 2BEWA 1SU7A 1KXJA 2GJAA 1PZNA 1XZDA 1JG6A 5L7YA 4FN4A 3UO8B 1ODJA 4PG5A 1RHRA 5FKJA 1G19A 1AGNA 4UQLA 1VRWA 4WCFB 1RSZA 2BW0A 5C5DA 1Q16A 1GV0A 4YMIA 3NONA 4NXNB 2ZQ5A 4EABA 1EK2A 2Z83A 3ZUPA 3DTVD 1EBUA 3AERA 3SS9X 1UUFA 1Z17A 3E2PA 4BDTA 4KOAA 5DTRA 1PIWA 1Q0SA 3OM0A 4ID9A 4IHAA 1E1DA 4UXIA 2FN7A 3RS5A 4ENPA 1BYUA 3SJBA 5JU6A 3KQYA 2HQRA 1G21B 4FE7A 1P2VA 4AY2A 4R6WA 3JALA 4U7WA 4H7IA 1ECJA 1U9CA 3GLIE 1VBFA 1PFUA 3DMDA 2QYSA 4D9CA 3RIMA 1DBWA 4IUCS 4IFEA 3LYLA 2XSZA 3OFSA 4QYTA 3WLEA 4MQMA 4R54A 3KEQA 5CPBA 2X9VA 4R81A 2OILA 1LWOA 3RG8A 3TZLA 2I4NA 4MS3B 4RL6A 2OA0A 1ZD9A 2W2LD 3V4LA 4S12A 2C88A 3Q0TA 3JARB 3BCRA 4EHIA 3U4QB 5B4TA 2O06A 2DFKB 1YDGA 1ISGA 1PEKE 4G0OA 5EIAA 3T15A 2WTUA 3W5SA 3R6GA 1G3RA 1A8HA 1PGNA 3WWCA 4HFMA 1N2OA 4HS4A 1PN3A 3GI1A 4W7HA 2JHGA 3GIWA 3EPKA 5CFRA 4UVHA 3JARA 1XIVA 2XVAA 2PAAA 4PCAA 3RS0A 4NCAA 4QBFA 3A6ZA 2F8MA 1EP3B 4PNPA 2R6AA 4QUEA 4BV2A 2D8AA 1U9ZA 1U1DA 5GJCA 3PIDA 4YGXB 2GZDA 1RVDA 1E2FA 3HDYA 2D0PB 2N1MA 3F7NA 1GPMA 2I76A 1U0OC 2J33A 2IY8A 4TZKA 3RGGA 3DVQX 3S2YA 1JG4A 1KYZA 4B6JA 5DWDA 2ZTUA 3JQAA 1TKAA 1JR3A 3B20A 3KC2A 1Y1KE 5SZJA 1COWA 2NX2A 3A25A 3JQAD 4OHFA 1JEQB 5C81A 2WM9B 1BQ3A 3BPSA 4E33A 1JSXA 1RHQA 4C6SA 2VXOA 4JQSA 2HPAA 3AERB 1KO1A 4IVRA 1WSBA 1Z4JA 3KV1A 5J2TF 3RTGA 2L69A 1P6XA 2AUTA 3I2YX 3P32A 3J7TA 5D3MA 4QZVA 3D6HA 3TAXA 1Y9JA 1OHHA 1U11A 1YKFA 1G21A 4IDHA 1JV2B 3RUHA 3V2GA 6YASA 2XB6A 3FSGA 3L7YA 3M4ZA 4GSYA 1ISFA 1T2DA 2FKAA 2EX1A 2P7HA 4WJZA 4UM7A 3A6JA 4YIKA 4DG8A 4MHTA 1NJ1A 1T3TA 5JCXA 4LA4A 3M4YA 1VG9B 3BWYA 3IEIA 2IYQA 1NFQA 4AKIA 4ODIA 4KLNA 5KMGB 5MF6A 5IUKC 2JHCA 3NEPX 3LUDA 2A0UA 1HL3A 4V0RA 5EMLA 1QQ6A 3GQBA 1PQUA 3VR6A 4W7IA 4ONEA 1K9VF 2DSTA 3NASA 4G9BA 1YXMA 4YRCA 3VH3A 4DLKA 2I4IA 5KJCA 4G5GA 1P9NA 3CLTC 2NT4A 1NF9A 4BE9A 4B43A 1DAOA 3IILA 1OKKA 1Z0FA 2IPLA 2X6TA 3NC4A 4XYEA 2EF0A 3IT0A 5ES4B 4UPVA 1PJQA 5M04A 4FKMA 4LDPA 4NFYA 3QBTA 1J5XA 4Q3AA 4BO6A 3T61A 3A6HA 1N57A 4D8WA 1DHRA 1ESDA 3E53A 3HJNA 3IRUA 4LY3A 3QEBZ 1QH8B 2A14A 2XOKA 2F3UA 4UEWA 4C21A 3COWA 2MSEB 1A4UA 3ISJA 4IP0A 2AK2A 2P11A 5LP6C 2I9KA 4QWMA 3PGLA 3KK0A 3UBTA 5KCZA 1OIXA 2AF3C 1QU3A 3A28A 3D4IA 3USZA 2H5JA 5DHRA 4W9NA 1IB0A 3U7EB 3ZGZA 5EINA 1WLYA 2JIMA 4Y6OA 3ZGYA 3MJTA 5J9FA 2ILTA 4J07A 4YJFA 4QRIA 1E60A 2X8WA 3PYXA 4ZARA 3QXSA 1IN4A 2F9MA 3BILA 3CUVA 4J7AA 4O4LA 3O2JA 3DO8A 2QQGA 3KKMA 2XCLA 4AU1A 4U39A 4X8LA 2P5YA 3LQ4A 3CKKA 1ZH6A 4B4UA 2ZUCA 1M9NA 3A6DA 3FSRA 5FO1A 3E7XA 4AG3A 2XQJA 1O97D 1QIMA 1Y4ZA 2G04A 3MCUA 3NBAA 3NHBA 2NU8B 3RWMB 1WABA 4UW9A 1J8DA 1GLVA 4H3KB 1JQLB 3SHQA 4Q37A 4YCNA 2O2ZA 4G5YA 4OYYA 4AY3A 3AEQA 3KR9A 3WE7A 1QC5A 4G8JA 1PQPA 3K0HA 4AJKA 3AUTA 4QL3A 1W9MA 2WE7A 1Q19A 1UMDB 1B76A 1R10A 4XW2A 3HJFA 3A05A 5TPZD 1PV2A 3VC1A 3KZMA 1VG0B 2C96A 3V6MA 2WMDA 1K8YB 3MD0A 1BO6A 3SI7A 3INRA 2ZCVA 3U3RA 1Q21A 4BV9A 1A4XA 2A1TR 1OF1A 2PG3A 3MT8A 3F5FA 5T6MA 4EI8A 1TYBE 1UPBA 3GVPA 5FWAA 3WFIA 4EGAA 5C2JB 1NULA 5JAPA 3HYCA 2QT9A 2XTZA 3OD1A 1R2QA 4EB8A 3L0BA 3E05A 5GPBA 2IHNA 1NLFA 4C04A 1WHTB 2DQSA 5FWNA 4DMHA 3JYLA 1BN6A 3AB7A 3OZ7A 2COEA 2ZATA 4DHEA 4I2NA 1K4KA 1D6JA 1O08A 4XM1A 4ARUA 3SQLA 1TK9A 2VK1A 3ECAA 3L0ZA 1KE1A 1UBLS 4HAIA 1TB4A 1W73A 3FDXA 4PAMA 4P5DA 3TSAA 5CDFE 4TOIA 4FQ8A 2D0OB 2P2YA 5K45A 3WQBA 1U0BB 2OXTA 5KKCA 1KQGA 1C3OB 1Z2CA 2OXRA 3EIQA 4BCBA 4NARA 2ZIAA 3DL7A 2H92A 3TJMA 1C50A 4PX3A 1GQRA 3T9BA 2F7SA 1SKMA 1D6SA 2HCRA 4UTXA 3BMQB 4NQRA 5CLIA 3X1YA 1FP4A 1VLVA 3PWSA 3H42B 4HUQB 4JYCA 2X1VA 3TPZA 3R6WA 5I5GA 1CRQA 3AFIA 4HVAA 2WWGA 1YQQA 5KS2A 4EPWA 1QAOA 3FJ1A 4COKA 1PTJA 1N5JA 4CF5A 1GQOA 2YV4A 4K2AA 4AG5A 3AY3A 2HSDA 2AJ8A 1I51A 4MK4A 1L4KA 5HDBB 3RIHA 3ON5A 1SPBS 5A9TA 3UIEA 4V0QA 1B23P 3GXOA 3IB3A 2WOJA 3GVIA 3A1FA 3NT4A 4IXTA 3WL3A 3I04A 3KB2A 3S1SA 4YRKA 5EUBA 3SF8B 3VDMA 4BPBA 1Z15A 1O9HA 1FFXB 1FJHA 2JLBA 2RHBA 3VZPA 4CCYB 4ROSA 3I9JA 1W1IA 5GVRA 4HZUB 3FLAA 2E7ZA 1GR0A 3P4XA 1QRTA 3TBHA 4FOTA 4RVUA 4J76A 1P7CA 2C3PA 4US1R 1NRWA 4PZCA 1DO0A 2IHKA 1JHUA 5JSFA 3L5KA 3FJOA 2HW8A 4RCVA 1KDRA 4I55F 2FPUA 2GTHA 2YNMD 2P6OA 3IERA 4XQ0A 2ZW9A 2ZYIA 3UH0A 1H0KA 3ZZMA 1TIBA 2MSCB 2YNMA 3L4KA 2AEEA 4PC3A 2AFHB 3IV7A 3L84A 2W9XA 3V1TC 4YCDA 4Z0TA 4A0FA 2B8JA 4EJSB 1FLVA 4YJGA 3P45A 1T0HB 3JQEA 5HOEA 3P9CA 3SIPA 1A5AB 4QTZA 4C4AA 1WW8A 2HRQA 3OPYI 1A9XA 4REQB 3HBNA 3RRJA 3NDBB 3ZYZA 2JJYA 5CA1F 2DFNA 1U9IC 4J9VA 3H9JA 2BKUA 4J2OA 1BXGB 4YJ3F 3L8HA 5GTDA 5J5VA 3EXHB 5AIBA 4LOLA 3MQFA 3B9PA 1PBTA 4G8DA 3BN3A 4IFTA 1RAAA 4UM8B 3G02A 1EE1A 2GN0A 4OBWA 4UDYX 2RD2A 3LXMA 2DB3A 3GRFA 3DKVA 5A0VA 5A05A 4PC2A 5IJ0B 5IZCA 3EAFA 7ABPA 3ZWCA 2FUG1 4QJ4A 4MP3A 3EY9A 3PFIA 3S27A 4EELA 4Y6PA 3PK0A 3DDNA 3QBDA 1YJ5A 3ACDA 5IVPA 3FKSD 4ZRMA 5D3MB 1VHLA 4Y2UA 4ZVNA 3PD7A 3V1MA 5JZMA 2R00C 3GRRA 2XMGA 4KCGA 1IN1A 1DC4A 4YUXA 1AG9A 1NXOA 4LG1A 4OAOA 5TNXA 3V8RA 3W9UA 2Q9BA 2P30A 3WMFA 5TGDA 4X8OA 1FP1D 3A11A 2G9NA 3UOAB 1IUKA 2X41A 2JD1A 2VA8A 3H6GA 4J0EA 1UAGA 4TMZA 3FTCA 2Z5FA 4JA2A 2GNPA 4IIVA 1E0AA 4HVTA 2I2DA 5ICEA 3GHYA 1C3JA 5TIIA 4YROA 1ULTA 5JSHA 1BZYA 1QTNA 1V6CA 3MJSA 1PEYA 3RU3A 3MTJA 2ZG6A 2KB0A 4D9EA 2CV1A 4MQEB 2X8BA 2XODA 3AG5A 2CD7A 4D3FA 3MFYA 1IRIA 3QE9Y 1EFPB 2GCNA 3OOJA 1NMQA 1ZGZA 2AR7A 2CNWA 4B48A 5BPHA 2RGUA 3M4XA 1X1BA 1SBCA 1GOTA 3TVDA 2YZ2A 2ZWPA 2OC9A 4WHMA 3NP9A 4BQIA 3FTPA 2O07A 1TOAA 4HXYA 2V03A 4RQUA 4LF8B 4DDUA 1ESNA 2FLVA 5CVDA 2HIMA 2OCGA 2EHJA 1FUIA 3ADOA 3QUTA 4OXQA 1AD2A 4WZBE 1E8NA 4BLPA 4F1WA 4MVJE 1BFUA 5A7HA 1H0SA 3UMMA 3CNEA 1MQ8B 3WB0A 4CR8A 3VR4D 4DS3A 3VYTB 4WACA 2ZANA 2OECA 3COSA 1RWBA 2GHTA 1LTHR 2H0AA 1KORA 3H1FA 1A8QA 1EGVB 1OXXK 2QV7A 3OMLA 2PMKA 4PY2A 1FPQA 3TGWA 1LI4A 3GIDA 3PIIA 4O2AF 1NZFA 3C7CB 3WB9A 3PD0A 1CUJA 1POWA 2WG1A 4G23A 4D0RA 5KYXA 4X1YB 3I39X 2PKEA 5EXXA 5KKAA 4QUBA 3UWKA 4FSHA 1HURA 1PWZA 2AMFA 3FF1A 1GNPA 2F59A 3AIKA 2M1XA 3HZHA 1JKFA 4QDOA 3TRHA 5K05A 4PLPA 4ZCRA 3L0YA 1A1VA 2NAFA 2R85A 1WV0A 3PE4A 3O83A 1KSFX 2CN1A 2HF9A 1BAPA 2IPXA 4M1SA 3M5DA 4HQRA 3STWA 1UT5A 2FGKA 3WWDA 5CFOA 2Q29A 1LDYA 3FJYA 2X0NA 3PKIA 1F1JA 3QVMA 5FPSA 4HV4A 5FOTA 1P3DA 4F2WA 4J03A 1M1XB 3M4NA 2J5KA 2QWXA 4ZD6A 4L08A 1VXOA 1GDDA 1SXJC 4QUGA 5BSFA 2OHJA 3BEDA 4IDOA 4U02A 3HEMA 1RLOA 5E4JA 1QHHB 2V7QA 3ANNA 5DW3A 1R16A 3RC2A 3G2JA 4ZTUB 5C5CA 5D3KA 1TKBA 4P80A 2W2VA 4U2KA 4P8RA 5ENVA 3TSOA 1X9GA 4K6OA 3L82B 3W79A 2GUGA 1INLA 4QJ5A 1RVV1 2VRCD 1XTTA 2CW5A 3N0XA 3OX1A 1MVLA 2DUJA 3OO0A 4ND5A 4L27A 4LHVA 4ZT3A 1P62B 4QFMA 4YX9A 2PX6A 4WXYB 3H6HA 4JL8A 4IWYA 5T4FA 3BRCA 4Z7JA 1ZXBA 5EZ6B 5LXTF 2MR6A 3MZ0A 3WQRA 4NBUA 4XYLA 1SIWA 1N2ZA 1PRYA 3ZDDA 4KHZA 4O4HF 2V7XA 4OH7A 4HEHA 4ESHA 5JUWA 1EX9A 4INPA 1A2BA 1ST2A 1SZPA 1T1GA 2DT5A 1ZY2A 2GZ2A 2JFNA 2JGNA 3FB1A 4LZNA 1GO2A 3AB3A 1RWVA 2PE5A 4JB3A 4B6PA 5KKNB 4N3BA 1X94A 4YO8A 3BHJA 5TF4A 3CPHA 3VNUA 3S8YA 4HG2A 3D8BA 1WZIA 2JFBA 4GG1A 2A5FA 3H0EA 2JIPA 4EQZA 3F1LA 1XZQA 3RBXA 1QIIA 2JNWA 4RCZA 1B74A 1PD1A 1XQ1A 3C7TA 4ZOCA 2B36A 2VNJA 1S6YA 1TA9A 4O25A 1H9CA 1T9KA 1ZA2A 1Q7TA 1E3EA 4MJ3A 4IINA 3FVTA 4A5OA 3K9HA 2H5IA 3SNHA 1OZ0A 2IZ7A 1PR5A 1CY4A 1RM0A 2OBBA 4O4IB 4DBZA 3FZGA 3MRVA 3N5KA 3EVFA 1QTQA 2P77A 2QLTA 4MRMA 1QQ7A 5LQNA 1HEYA 1SXQA 4LC1A 2FF7A 4YB8A 2FZGA 1VSVA 3QVLA 1EFKA 1P9LA 1Y82A 1LXCA 4LQLA 1M33A 1Z36A 2XE6A 3C7AA 1XTJA 3KEGA 3DQZA 4N40A 4TLAA 5CYFA 2CC2A 3OM8A 5AM4A 3RT7A 3WJ2A 3ZHBA 1WD7A 2GA9A 3L8ZA 4F4FA 3HDQA 1U3FA 1KEWA 2Q49A 3HN6A 3CF0A 3OA0A 3QVTA 4XDGA 4YMTA 3K6SA 2DUNA 2FB9A 3GDGA 4HP8A 3W8NA 3EZLA 2WV7A 2LRHA 4QU5A 4R8SA 4YAEA 5DN6D 1PI3A 4DPLA 4LRTB 4CFSA 4E2XA 1Q17A 2MJLA 3C6BA 1F9EA 1JJBA 1L7NA 6LDHA 3U7FB 4B3DA 2FQYA 1DEAA 4KIUA 4B3GA 1E69A 1VKZA 4ZQEA 3RJ9A 4TV9B 4KR7A 2CF6A 3MGBA 1BC5A 1HUQA 3ZLTA 5JXJA 3HXTA 1XTPA 3O3CA 3U37A 5A5GA 2CXXA 3UT5B 1RI4A 1EMDA 2FEKA 2ID9A 4WINA 3RU7A 4XQCA 2C3YA 2XBLA 1W52X 3CNOA 4NBWA 5GOTA 1IEXA 1NMEA 3SQDA 4ZEVA 3PWKA 3E7DA 3VSAA 3FR8A 3OUZA 4MKXA 1UZNA 2JVKA 3HV2A 5AI8A 3WLTA 3C6QA 5KVVA 2RE8A 1U3TA 1T4CB 1YQEA 4K0RA 4LMRA 4OA5A 4QKQA 2OD2A 3EGWA 4FQ7A 4IDGA 4R7GA 3IPXA 4AS2A 3TFOA 2GHRA 2A5JA 2DH6A 4G9EA 5ALIA 3R0QA 2LBPA 1W75A 1YFZA 5JW6A 3VU9A 1SA0B 3W2TA 2HHJA 3DMYA 2VPXA 2C94A 1XVVA 3CF4A 4FDVA 1Z12A 3BRSA 3UWSA 2VCEA 3G2LA 1DOZA 5LZ9A 2QNBA 4F06A 3QRWA 1J39A 1ONPA 2P9ZA 1PTKA 5GMOA 4LYYA 3RGWS 5CT6A 2OTCA 3MT9A 3TEFA 3RK1A 5A6SB 1RXSA 3QPCA 3F67A 3RIEA 1TVMA 2G4CA 3NALA 4NG4A 2ID4A 2WRZA 4UFPA 2O2YA 4WBNF 4PICA 2FY8A 4IV8A 4UUPA 2JGFA 5K51A 2ZIWB 3CO0S 1SCDA 1VJ5A 5JXGA 2NUPA 3VC2A 4NPHA 3OM9A 3V97A 5ADWA 3EZ7A 4L3VA 5CD1A 3X0DA 2R3SA 5AFSA 3K70B 4JV5B 5GJWC 1BU8A 1F06A 1YB6A 1W36B 2XNKA 2NGRA 4WWHA 3DFIA 4NCKA 3OCZA 3LY7A 4P4LA 2DTXA 4YN3A 1UKBA 4C0SA 2VSYA 5H4GA 1U0LA 3UMFA 3Q7PA 1NBOA 2E85A 2XE7A 4KYVA 1QFXA 5ALOA 4ZGWA 4RTNA 3A8TA 3MMNA 2K6GA 2QJWA 4FC7A 5FV7A 4NI5A 1G6KA 1C0PA 3QK7A 3UNXA 4BBPA 3OZDA 5EMNA 2OV8A 3DZHA 4AFNA 5JI2E 4K88A 1XN4A 4ZC8A 3RAFC 2UUAB 3O31A 1LQ2A 4X6UA 1YAHA 1XLWA 4D7AA 1GNQA 1KI6A 2V8OA 3BC1A 4KQ2A 2JIOA 1RRPA 4FDUA 4E07A 1FDWA 4X7PA 5TSDA 3HUFA 3N3BC 2JLCA 3HCAA 3TTWA 2HSJA 3EZGA 2WWIA 3G5UA 4ERXA 3OKPA 4W8OA 4ETIA 5AXDA 1UJBA 3R3HA 1B93A 5JZ9A 5J43A 5DX1A 1X8LA 1WXHA 2PANA 1SBYA 2D4AA 5CPFA 2NQTA 4HH3C 3STYA 3LOUA 2ZJ5A 2PGAA 1XI2A 3QXJA 3OJWA 5LA6F 2P1RA 4BY9E 2DMRA 3VAYA 2ECPA 3F71A 2VP5A 3B2EA 3GFTA 2D7DA 2V3WA 3S6JA 1VHDA 5H59A 5EP4A 1Y9EA 1HE8B 1E5XA 3DBRB 1JR4A 4KVFA 3WR5A 2V9CA 1U0NA 4I19A 3PQEA 4JVSB 1DRWA 1G41A 3F6PA 3UJ6A 4Z3DA 1UDBA 1MP0A 3FMIA 3HZOA 4CDNA 2Y05A 4K0KB 1W2GA 1B43A 1N6RA 4MS4A 1ZPDA 1KK0A 1VYTA 3MJRA 3K8OE 3N70A 3CT6A 3O6VA 1F2TB 1P77A 2IHBA 3R7SA 1CTQA 5J2TA 4MYUA 1RQ2A 3W2HA 4C0WA 1J7KA 4R5HA 1ETUA 421PA 3EXEB 1DQNA 4B3RB 2H17A 2C1ZA 3A9SA 3MBKA 1NBAA 3S2GA 1L4BA 2AD1A 2PCJA 3MUFA 4P3NA 3JQFC 1NPDA 3OY7A 2C54A 4KYUA 2IUTA 3I42A 1BDIA 3L0OA 4Y1EA 2JI4A 1DELA 3FTQA 2PX3A 3ZHUA 2VPIA 2FGJA 4JWTA 5C37A 1VRVA 2B82A 4LKOA 2HF7A 5TLSA 4Q3EA 4J16C 4TKMA 1E2UA 4R2IA 2NZ2A 3F6BX 2YJ6A 4IO1A 4IIXA 4KPUB 3FDZB 4TV9A 3TQSA 2VXYA 1MB4A 1YR3A 1F4LA 2FSHA 1HSZA 5T4EA 3OCYA 3HA2A 4XM0A 5A4IS 2JLQA 3LX5A 3BGWA 3L1IA 3K0CA 4P4UA 4TTAA 3GNLA 3IOMA 1CWUA 1MABA 2ZJBA 3QLJA 1MW8X 2NU7B 2OVFA 3HB4X 3V4OA 4Q15A 5JVDB 2NU9B 1PKEA 4HNAB 3UH1A 2JB9A 1JKXA 3AZQA 3CO5A 1NJSA 4DLXA 1JWLA 1M6YA 1W4RA 2QN6A 1CJUC 3NRCA 1D8TA 5CX4A 5G40A 3IUEA 4DDTA 1YJXA 2HSZA 4AICA 1HT2E 1GU0A 1DCTA 1XDUA 1HRDA 2GSDA 2N47A 2A9OA 1I9CA 1SXGA 5EFOA 4TMFA 2X6QA 5MN4A 4PGAA 2EKPA 2WYUA 1E9DA 4G56A 4ZO8A 3EVNA 1O87A 3DDWA 4A0SA 4YK7A 3I30X 1R27A 1DT5A 3MELA 1J1ZA 5JAQA 3ZHVA 3NWJA 2CYAA 3NPAA 2GXQA 4PG7A 2WY2D 5BUSA 1GY8A 1ZCFA 3IT2A 2OQIA 4KQMA 1LVUA 4WZBA 3U44B 1KMQA 3FYSA 3GCZA 4NNJA 1FFSA 5SZIA 1ZD5A 5KJEA 4DAEA 1SVKA 3C87A 1FVOA 1KQNA 4NMLA 2BZSA 4OKNA 4F91B 2BUBA 4YRQA 1JLLA 5KPDA 4FSXA 4KBFA 5F1YA 1G6Q1 2B3DA 3I45A 3HL0A 2QP3A 3R2JA 2G1KA 3TX6A 2YFYA 4Q9IA 3OQBA 4ZI2A 4JLSA 5I9NA 3OLQA 5L45A 2Z98A 3W05A 1U8TA 3WGGA 4A8TA 1Y80A 5D1NA 2DSNA 1PO7A 2KMLA 4AZTA 1T9CA 3PDJA 1B41A 5IK2D 1A8UA 3R1IA 2PV7A 1O9GA 2FJ0A 2FPPA 3QPBA 4JFAA 1ZSYA 1ZBDA 3I6MA 4W7SA 1AJEA 2EL9A 3GF4A 4F1KA 4TKUA 1J56A 2XWQA 3CKLA 2YXBA 1HT0A 1GILA 2FSFA 4Y9TA 5G1PA 2C03A 1JBQA 3VR4A 4Z2YA 1Z29A 2L42A 4YDSA 1FVXA 1QB7A 3DNMA 4FFRA 4UMEA 3UGTA 4GE3A 4BWGA 1UJ5A 2OESA 3JD3A 2CBGA 2ZTMA 2JH3A 5KSYA 3EPHA 2HJSA 2GI4A 1GARA 2QP4A 1RAIA 3FUWA 3H2BA 4K81B 4KGZA 1DINA 3IT1A 1EFHA 3WYFA 3ENWA 4ZYLA 4RJ2A 2BY4A 1RTKA 1IN8A 4US2R 4IIJB 1GTL1 4F7DA 4H16A 2PMCA 3GROA 4HNQA 3K1TA 3CRZA 3DFFA 1JJVA 1LBTA 2PT6A 2C59A 4XR9A 3FKQA 3GBVA 3U5ZB 1POXA 2BI4A 3NYRA 3AM1A 2VQDA 2HYDA 3N8GA 2ZSEA 1JTFA 4P9NA 4Z99A 3W5JA 2ZCJA 4X93A 3SLGA 4C88A 4TXJA 3NHSA 4J0CA 1V8OA 3F2IA 3HBAA 4FE4A 4J0DA 4P7JA 3SF0A 5DNUA 3BAFA 1YK0A 5FBKA 4YO7A 2GCGA 2AL7A 3OTQA 1WA5A 4BKQA 1DOHA 4OVKA 2DFLA 1NI5A 1UBUS 4OJMX 3U7RA 4E70A 3D0KA 1ZDMA 1MRNA 3K5IA 4LTMA 4Z7OB 3SCZA 3IAHA 4HH1A 5DGDA 4HDKB 1P1JA 3G8BA 1WHSA 4NFHA 4CMCA 4AJ2A 3QIVA 2C5AA 1M1UA 2UVQA 1KU6A 4O2AA 2BT4A 1QOZA 2G8NA 4CW7A 2I71A 3HXLA 3LC2O 4D02A 1JECA 3B12A 2J48A 4Z9FA 2P69A 1BNCA 3LPCA 1HKHA 3FMGA 1Z6QA 1BWQA 1QQ5A 4RMNA 2Y4OA 1Y9DA 2YJGA 4TLMB 4CM9D 2PGIA 4RORA 1PJ4A 4YNBA 4CQJA 7GPBA 3OQ6A 3AO0B 1GCIA 5LL6P 2DBZA 3TIVA 1SU6A 5I9SA 1LEHA 1OPRA 1YZUA 3ZE7A 5B7QA 3B78A 3PPXA 1E6EA 5IABA 3IE1A 3RO7A 2WEKA 4CFZA 4L6IA 4TLLB 1K63A 1QYRA 1MRSA 4HQOA 2HJGA 5K0BA 3ZI0A 5B7NA 1JIQA 5AVKA 3SJCA 2WU4A 2RAVA 2NVUA 4QFBA 5AVRA 4BNFA 3QMWA 5CHEA 1F14A 1BH6A 2DKFA 2FW8A 2Z57A 3CEPB 4UZSA 5E6UA 1U2ZA 1ZN7A 3RSOA 3MIIA 1I7DA 4BNYA 2JZOA 3O9MA 2FETA 1R9MA 1J8QA 4UBKA 1J25A 2ZQZA 3BF8A 1TMKA 3GMTA 2PRIA 3Q5GA 3F9CA 1V6AA 1Z3IX 3TBFA 1VCNA 5CRIA 5ILQA 5FI3A 3FFAA 3T95A 3UK2A 3QA3E 3ANMA 3COVA 3CMMA 4OHWA 3RS3A 2CK3A 4NZPA 4UEJA 3ZXXA 1FYFA 4EBBA 4F4UA 3O74A 3KEMA 3S55A 4EI2A 4YRLA 3NOVA 4P58A 1Z62A 3JATB 4FYVA 2JBHA 5KVCA 1J00A 2NPIA 1Y48E 3ZCTA 4HDKA 3A1CA 3TLJA 1Z0SA 4KV9A 3OJEA 2Y2VA 5BSKA 2Q8PA 2X1LA 4NC9A 3JVDA 3SYMA 4NEQA 3W1WA 3ZI4A 3LFHA 3HSYA 1BVRA 4GMFA 3SGLA 1QP0A 2EEPA 4HQNA 3O4RA 4K9NA 1KR5A 1K8XB 2QQFA 1ZXLA 1ZLYA 3OG9A 4LCJA 2C4VA 3SG0A 3JWGA 3KZXA 2O7VA 1QH1B 1ZMTA 2R44A 4M9CA 5MN6A 4I1IA 2EKDA 1HE5A 1WLSA 2FW1A 3GZJA 1PGQA 4M1EA 3A6LA 2XWPA 4RWEA 3N53A 2R6R1 3N8HA 4Z6KA 3AP3A 3TQFA 4D42A 2NXEA 4J1TC 4QQKA 4YJ3A 4UOZA 3V55A 1OX6A 1LSOA 3IOCA 5HKOA 4KBYA 5B7PA 1VIAA 3TLEA 5HRCA 4CDGA 4DBVO 1I1NA 4LECA 3FB4A 2B1IA 1QIJA 2P9EA 1L4LA 2C1EA 4KQ6A 4NAHA 1FXWA 3KV3O 3A04A 3LTEA 1ZJ4A 3NOXA 2W0SA 4WA7A 3AWDA 2ODQA 4YP0A 5FWDA 4DN6A 1OH8A 1RWNA 2H7CA 1BGVA 4MUEA 2C9YA 2QYOA 2GEFA 3OFNA 4EY7A 1UBGA 1T5SA 4JMLA 4U7FA 2HQSA 1DKQA 4NOJA 4DY6A 2ZZMA 1JSCA 1DOAA 3B1ZA 3DMTA 4XE5A 4UARA 1P4HA 5GIOE 2QRZA 4DGQA 3PXCX 1SC9A 4FZRA 4OYRA 1XLTA 1YHNA 2P4SA 3AUXA 4NICA 1QO7A 2YRXA 1A2OA 1TJ5A 4H35A 5AVWA 3FWYA 1M6VA 1S2IA 3PICA 2BWJA 4FZJA 4H6WA 4KOEC 3RFFA 5HQ3B 3S5JA 1EXDA 1DX6A 4G4GA 3B6MA 3EPJA 5I48A 4FTWA 4ZWNA 1B2LA 3EXFB 3TQIA 3IP9A 1U8EA 4OI0A 4DZTA 2QXUA 2Y0DA 3QUCA 4GW3A 3ZY5A 1Q1EA 1Z5VA 1ZGAA 2BM8A 3NHAA 1X7YB 3BQMB 2YHIA 3FXAA 3VNQA 2FPKA 3KX2A 5LUBA 2ZR8A 5DFAA 5EG5A 5KOHA 3PXDA 1Q0TA 4P86A 3U81A 4RDXA 1US8A 3QXHA 4G0VA 4G1FA 4HNRA 1C30A 2OG2A 1MB3A 3KUKA 1YMUA 1OCEA 1PR1A 4G97A 1P8JA 1U0EA 4MGKR 4KYTA 3IVXA 2K4MA 4ETMA 5HJ7A 1EFRD 1K9SA 2PBRA 1N6LA 1QVWA 4B84A 2XNCA 4BMOB 5BWOA 3GPCA 4CUZA 3KZKA 2CGEA 2GEDA 4FBGA 5LM3A 1NQOA 1C8KA 4AMZA 3PNYA 3IMFA 2JAXA 1F5SA 4FNOA 1KOJA 3BGVA 1NW3A 3GGOA 3H5VA 2W2MA 1PS0A 3SQWA 2YXLA 2BMJA 4DR2B 3ORHA 2NV2B 4M8LA 1G2QA 2A9VA 2EKLA 1Q77A 1TYZA 3ZNQA 3LUAA 1XFAA 5AESA 2Z04A 4JNCA 1XRLA 5C31A 1ACLA 5AKHA 3NMUF 2PVCA 1LY1A 2HDNB 2QNIA 2PZMA 2RGNC 4BU0A 1FLAA 4H3HB 1IBLB 2DFDA 3ZHQA 2WBLC 3SR0A 3K53A 2OXFA 2VTBA 1NQAO 1BOOA 5ILOA 4ZEWA 1KERA 3UV6A 1H8EA 1N32B 1M8GA 4FDAA 3ZWAA 1MW9X 4RD6A 4ZDIA 3EARA 2JAOA 4RGVA 1C9KA 2BMWA 5JO9A 4EG3A 5IT4A 2Y0EA 3GEPA 2IJGX 4YMGA 4MWCA 1J2RA 4DKXA 4HWSA 2IQ5A 4C07A 2GFQA 2IEIA 4ZAZA 4OHRA 1U3CA 3IDFA 3DMNA 1X0XA 3DTVA 5JCOA 2Q1TA 1ZSNA 5FWXA 2O8CB 2QX9A 3FPJA 4KWIA 4C4RA 1PJRA 2P5TB 2CJWA 4EVSA 4EEZA 1SVMA 4CV3A 2F00A 3NGXA 5EAIA 2CY0A 2FN4A 2I33A 4XWOA 3SKXA 2PZEA 4BQOA 2FN9A 4FBLA 1WPGA 4F3YA 2W48A 3EHEA 3F78A 4RSMA 5ECYA 4XD7A 1T6XA 2YZ7A 3DVAA 2WV9A 1EAMA 2H1CA 3HCDA 3BULA 1XX6A 2YWJA 4L28A 4S3MA 3PRHA 5BYKA 1JTEA 2I67A 3L0PA 3WDKA 1PZXA 3EZXA 4YAUA 5ALGA 2CXTA 4UZEA 2WJVA 4OV6B 4WZZA 2K5UA 4NLLA 2FG5A 1H5NA 1VE9A 2C2KA 2GZ1A 4I36A 2XE8A 2O3QA 3VVMA 4DL9A 2ZYTX 5JPDA 1BMQA 2PKQP 3H5TA 4TL8A 3CQ9A 2R47A 4TSKA 1FMJA 1FOEB 2LNDA 1X8XA 1L5YA 5DHAA 3R8CA 4FN5A 5HCNA 3CZ5A 3N6VA 3MJHA 1DX9A 1VG1A 4OBXA 1UANA 5FTWA 3AM4A 4XCQA 1JDSA 2BDTA 5CB4A 5L51A 3RPEA 3T54A 1PLJA 4FEAA 4Q1EA 4R3NA 5HFAA 4P98A 3JQGA 3EG5A 3OFVA 3CGGA 1LK0A 1GRCA 2WJYA 3FYUC 4LXHA 3IODA 2P8JA 5KJFA 3QA9A 1WL8A 4QQFA 4IX1A 3K3PA 3I83A 2EXXA 4QXMA 3TINA 2GPJA 5DU2A 1HDEA 2UU9B 4FMDB 4KO8A 1U7DA 4IXDA 5E9QA 3ZE9A 4HFJA 2VAXA 3CLVA 5T7BA 5JASA 4RXUA 2R4QA 2C97A 3FVQA 1OFTA 3ODGA 3VNVA 4G2TA 3V5NA 4HB2A 3NR2A 2PUFA 1M0WA 4N6GA 1Q3TA 5IBQA 3IOYA 4P2BA 3B82A 1NQVA 2FQ1A 3AV3A 4ZMBA 3G7NA 4N3AA 1UKZA 4S35A 2POQX 1TX4B 2IUUA 1U80A 5LP6F 3HJUA 2QUIA 1H66A 3WGOA 1SG9A 5FYDA 3FWZA 1SQSA 3OX4A 2VRWA 4K9MA 2PR2A 5CLLA 1G8YA 3RW9A 1KDOA 2H5EA 1W0CA 4Z3KA 1GSIA 2C4HA 1JNYA 5L6LB 1WXFA 3E22A 3ENNA 2Q4OA 2HZBA 1D1QA 2WFAA 1CS4C 2VT6A 1G9XA 4GOJA 4CU5A 3B3GA 1GZ4A 1TW3A 3A7DA 4O2RA 4DCUA 8ABPA 1SM4A 1YR1A 4GICA 2PZGA 2IYAA 3HP1A 4IRXA 3AUJB 4KGXA 3F90A 4L07A 1CUCA 1IU9A 5CTJA 4RVHA 4A8JC 1FFWA 4OATA 4AJHA 5K8IA 1EXWA 1FDUA 1VP9A 2P4HX 5ALZA 4YCMA 5E9AA 3BIXA 3C7DB 4MKGA 1II9A 4Q4DA 1TIKA 4NMXB 3WBJA 2IDJA 4H7JA 1E1MA 4U7JA 2C57A 2YHUA 3H2JA