2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
5SZIA 2UZIR 4RFSB 4MKGA 2J1LA 4Z1MA 3VMFA 5BXQC 1JR6A 2QEQA 2ZE6A 1NIJA 4C0HA 2YYZA 2ZRAA 3WYGA 3DEFA 4DBLC 1QG4A 4M22A 2KJQA 2CCJA 4JVSB 4EPWA 3LBNA 2ZYVX 4OI0A 1NVUQ 2F1IA 3K53A 4TTQA 3AKCA 3M4YA 3VNVA 3EZFA 1KAGA 4DDTA 1OB2A 2E9SA 2HLDA 2G0NA 2GKSA 3KB1A 3MJRA 4DSUA 1E9DA 5DN6D 1XPRA 1E1RA 2ZUDA 4NYJR 4A82A 2VH5R 4AIIA 1QHHB 2OFWA 2R2AA 3SHWA 4L5BA 2ODNA 1AGRA 5L3SA 2VQSA 1ZINA 2EFCB 2WJVA 4KJZA 3B1XA 5DHFA 1KK1A 4U00A 1H8ED 2XEXA 2ZE7A 4GI7A 5LPNA 4OJKA 3U3RA 1CP2A 3P1JA 1HT2E 2G6BA 3F0TA 4DIEA 2FU5C 3UIEA 1N0WA 1P5ZB 4HUQB 1IQPA 2X8AA 4GZMA 5HPYB 3RS2A 2WAYA 1C4OA 2WIBA 1NN3A 2IXFA 1UKZA 2REXB 3HP1A 2BMFA 5FL3A 5GADl 4JVMA 5TY0A 5DYGA 3ZVRA 4MUBA 3N2EA 4QFMA 4LBVA 4PZYA 4ZDKA 4BPBA 3CH5A 3A1SA 5K8LA 4KO8A 4IDNA 3W90A 3K70D 2C2HA 4ZPXA 2H18A 5LBIA 1G7RA 4PPNA 4D0NA 5D3MB 4C0AC 3T06B 4CYMA 4JS0A 1P9NA 5HE9A 5K8UA 2YKGA 2GNOA 3ADBA 3THWA 2GBLA 3SHFA 1FFHA 2QPOA 1FNMA 4MYHA 1FUUA 1OFTA 1JJVA 2VTKA 5AJXA 4IDPA 1X1RA 1K5GA 3ZQ6A 4HLUA 2IF2A 3M1IA 2EWWA 2C8VA 3AVPA 3OE7A 2PMKA 4US0R 3GLFE 2Q3MA 3T35A 3B8HA 3Q85A 4I1SA 2WPDA 1CJMA 2ZR0A 4NCKA 4WOPA 2JJ2A 2ZRLA 1NG9A 2D7CA 1XNJA 4QC2A 3KUDA 5FPKA 3AM1A 1EESA 1F60A 3RVBA 1OXXK 2ZI7A 4LV8B 2GXSA 1N6KA 2H8KA 3BH0A 1H8EA 1T0HB 4KYIB 4GT1A 1OXSC 2C9OA 4Q03A 4ILEA 3AVQA 5KTYA 1M74A 2V54A 2F3TA 5K8TA 4M1WA 2CEAA 4O25A 4LBWA 1O3YA 2RCNA 1F2TA 4OHZA 1KSGA 2GDJA 4CT4B 2QSYA 4PQYA 2ATXA 4BLOA 3K8YA 4W7SA 2WHXA 3FWYA 3KKNA 1KDPA 4Q7MB 4BLRA 2ZUBA 4M9XA 1UBGA 3FYHA 3CZQA 4HZIA 1YRAA 1OE0A 2BBSA 3GLHB 4NYIR 3BJIC 1T9HA 2N42A 4D82A 1SVSA 1YZKA 2DWQA 3KXLA 1II0A 3OEHA 5FOWA 2BM0A 4KSBA 5KHOC 4UJ3A 4RD2A 2ZAOA 2O0JA 4KU4A 4M1SA 3L2OB 4ZDIA 3B1ZA 3NEYA 2NZJA 4F38A 5C4MA 1GNQA 5DISB 5EXPA 1DG1G 1Z28A 3TK1A 1AKYA 3AKDA 2BHRA 2OLKA 3K70B 1DVRA 2HXSA 2GJ8A 2JJ1A 3HYTA 1HY3A 5CK5A 1UM8A 3PFIA 5EP2A 3IO3A 3SC3A 1MV5A 5FOVA 4KHZA 1SXJD 5FR1A 1ONBA 2F1JA 1QHYA 3SS8A 5FUYA 2IYYA 3VU9A 2DFTA 3PUVA 5JBQA 1OYYA 1BYUA 1MT0A 3O8BA 3FKQA 1V5WA 4I4LA 4AKHA 1CF4A 2JA1A 2VHTA 2ZRMA 3AGPA 4MYUA 4B48A 5JECA 2PCJA 4JBYA 3J81k 3K9GA 4ABYA 5JCZA 3RRNA 1W47A 2MSDB 1II8B 2EVWX 2XNSA 3VFDA 4EPXA 4LCBA 3TBKA 2CL6X 4QBGB 3QNUA 3CZPA 4KAXA 1G6OA 3L0PA 2ZI9A 1UBFA 2PEYA 2EYUA 4LBZA 3WYFA 1NNEA 1RRPA 4R7ZA 4Q4AB 5FTJA 4D4LA 5E4FA 2CVFA 4FIDA 2ASEA 3EW9A 3IQWA 4KLNA 3W5IA 1Z0IA 5DI3B 2WSSD 1LS1A 4MKFA 1HTWA 3U3KA 2F9MA 1ZM3A 3B78A 4YXWA 5FUVA 2OBMA 3HPQA 1P2SA 4L15A 3R9WA 1YJ5A 2Q0HA 5KPJA 1YRBA 3BD9A 3JZMA 5CM8B 3R8FA 4KVGA 1ZNXA 3JZAA 2JCSA 4L4UA 2J3EA 2GF0A 3A4NA 1E2PA 4IXMA 4DT1B 1Q20A 2CMKA 1T3LA 3KTAA 5JSZA 4ASUD 4PC2A 4Q02A 2H1LA 1YZQA 3EXAA 4LHXA 2D7DA 2O8BA 4LJ5A 3VQTA 2F3RA 4TMWA 3T1QA 4DEXA 2HUPA 1SKYB 2BOVA 2W00A 2J46A 2D2EA 2PMDA 2ZREA 5L3RA 1Y3AA 2JASA 3REGA 1SQ5A 4EPRA 1OB5A 1G3QA 4B47A 4B3BA 2J0UA 2ANCA 3IIKA 1U99A 1X8KA 3CF0A 2P5TB 3QSYA 1E99A 4FMDB 1VCMA 4RZ3A 1E2FA 2VSOA 2VL7A 4OI1A 5C46F 5JI2E 4GL2A 2IUSA 1R6BX 3K70C 1G8GA 2ZJOA 1GDDA 4HYYA 1NVWQ 4V0NA 2JLYA 4QBIA 3I5YA 5EUMA 3WNCA 2CHVA 1RJ9B 1SXJB 3K9NA 1BO6A 3P4XA 3C15C 4QBHA 1G3UA 4W5HA 1S3GA 2ZJAA 2VBCA 1E9CA 2ZRJA 4P32A 3U7EB 2XB4A 1N2CE 1GTVA 3RNLA 5AJZA 2QROA 3VKHA 2CE7A 3OEED 3SI7A 1XX6A 3DDCA 4QHYA 3ZVMA 4MDFA 4B2PA 4U5XA 5HZKA 3T1VA 3QUSA 3QPWA 5EP4A 1DE0A 3NEJA 1BMFD 3T12A 1GL9B 1NMYA 1Z6AA 2AXNA 4Q1FA 4CDGA 4ERNA 5FPYA 1NL3A 3A4LA 1R7RA 4TQ9A 1ZU5A 3NTUA 4Q19A 3U4QA 4FMCB 3C41J 5EUQB 2CHGA 3DPUA 4BFUA 4F92B 1PLJA 2A3RA 3BOSA 1J70A 5LD2B 2V6JA 4EJSA 4HB0A 1UJ2A 4F4IA 1VDZA 4Q5IA 1FZQA 4JLAA 4LHVA 4TL8A 4HUTA 1WDTA 4AI6A 2J0VA 3ZVNA 3NG1A 1W48A 2VLIA 1N6HA 2IYRA 3QIAA 2GXUA 4K46A 3FFAA 3DOFA 2UKDA 3B5JA 4A2WA 4LGMA 4AG6A 1VKJA 2ZRHA 4YONB 3MWJA 4A6XA 1UKYA 4ACAA 4LHWA 1XRJA 4M1OA 1Q1BA 4B3GA 3W6NA 3FKSD 4CRWB 1DTSA 3LW7A 2O0HA 3LX5A 4BFWA 2FSIA 1GAJA 2VPPA 3C14C 2O8FB 4LDJA 1DAFA 2GZDA 2ZS9A 3DO6A 5CB6A 1M7GA 2VA8A 3K9HA 4ZDWA 2P3SA 5FFMA 3W6PA 1VG9B 1W2GA 3U7GA 1OJLA 1E2GA 4WAUA 4DWJA 3RS0A 4NTZA 2W58A 5KSPA 3EIEA 4QGHA 2JLQA 2WAXA 4FCTA 1W4BA 1KY3A 2PEZA 2AD1A 2AKYA 3KXIA 3NC0C 4JJKA 1R5NA 1BIFA 1TEXA 2A5FA 4EPTA 1BMFA 2ZRCA 3EA0A 5JLJA 3RRZA 3S1AB 3B13B 4RKEA 1UFQA 2XITA 5CB8A 5GJCA 2BJWA 3BBPA 1KI6B 3GQBA 2GK6A 3SDZA 4ACBA 2ZE5A 1SXJC 4M53A 2JATA 4EKDA 1IN6A 3CR7A 3SJZA 1OXTA 4ZI3A 1S2MA 1UF9A 3E70C 5SZJA 3UG7A 3AVVA 4X8OA 1II9A 1ZCBA 1FNNA 5AJYA 1RW4A 3CPJB 2EYQA 2XOKA 2KWIA 1E94E 1Z47A 1X86B 4YMUA 2PBRA 1PLLA 3K0CA 1PUIA 4LJYA 1E0JA 1TMKA 2W83A 3TGPA 4KFSA 1GVNB 1JPNA 2WICA 5JHHB 1ZNYA 1E2NA 4N0EA 4URYR 3GJ3A 1G7SA 2XSZA 1KSFX 3DKPA 3GFPA 2IUUA 3V4RA 4V02A 1MR3F 1U8ZA 4HDCA 1I4TD 2PT5A 1IAQA 4JJZA 3CO5A 2WV9A 5LD2C 2IYVA 4US1R 1NBMA 2ZRNA 1N0UA 2QORA 3CNOA 1P3JA 2J45A 1OW3B 3LBIA 3LBHA 4L9WA 4OI4A 1N3BA 1W7AA 4TMKA 1DAGA 5B57C 1GM5A 3HR8A 4AYXA 2WJHA 4A2QA 3EPJA 1UDXA 4R9UC 4TN1A 1QHIA 2GJAA 3UKDA 2DBYA 4OQNA 2RGNA 1GKUB 4O3MA 3GLFB 3ZD6A 3KKQA 4B34A 4M8NE 3EZ7A 2G3YA 5CLQA 4B76A 4HDQB 1VHTA 3T5GA 2BBTA 4BZXA 4U7DA 3VKGA 2O8DB 3U44A 1TQ4A 2P6UA 2GILA 2GXAA 3RHFA 4NZYA 2X1VA 2WJJA 3GLGA 4D25A 1NN1A 2FGKA 5HKKD 5KNCA 4ARZA 1N5LA 4F91B 2GJKA 2ZYTX 5DLQC 3TH5A 3CKLA 1D8TA 1W5TA 4EFNA 1RRGA 2DWOA 1CS4C 2FFQA 5DGXA 4D80A 1KK0A 2GA8A 3A37A 4ZKEA 3GJ6A 1SVMA 4LV5B 2ZM5A 1NVVQ 1SVKA 4D6PA 4PPQA 1ZD9A 4NCIA 2ZJZA 3SU8A 4TL9A 5FR2A 2OLJA 2VYFA 1R10A 2F7SA 3B60A 3R9IA 5J4LA 1W0KA 4NKRA 4MITA 4FWTA 2EWVA 3RRYA 2NQ2C 2JDID 2YV5A 3I8XA 5G53C 3P20A 5FTLA 3GP8A 2F9LA 1CRPA 5BN3A 4DUGD 3SJBA 2DPXA 1E79A 1AA9A 3SBDA 3AV0B 4HB3A 1H8HD 1R0WA 5H8WA 2WWIA 2C96A 2V1XA 4IDQA 3RDPA 3ZDQA 1UEIA 2BIFA 2QM8A 1VECA 3RS3A 2YWGA 1IY0A 3LXXA 4W5JA 1VIAA 3OFND 4DCUA 4IHQA 2CCGA 2NO6A 2IXGA 2AL7A 4KODA 2NPFA 1W1WA 3LH5A 3UXMA 4YMTA 2V8OA 1LY1A 2XNDA 2ZI3A 5F3WB 4IEEA 2P6NA 1HE1C 3AH8A 1XFAA 5J5CA 3SN6A 2FPKA 4YQFA 1AIPA 1XTRA 4GMDA 4WBSA 3VNUA 3UWOA 2LCFA 1P9RA 5KNDA 4HAVA 3SYKA 2YOHA 2YHSA 3NDPA 4CW7A 1P2TA 3G5UA 1T8TA 1J2JA 4HAZA 1NY5A 5FI0B 5A4JA 3BIFA 5EE3A 3AUYA 3N70A 4RZXA 3U6KA 4C4PA 3RS7A 4RJLA 2IHBA 3KDSE 5DSZA 1VCOA 1NLFA 1ZD1A 5ELXA 4PO1A 4LX0A 4UXJA 4ZIRA 3QVVA 2VIIA 2DB3A 2QTVB 2QMUA 2ZUCA 4DSNA 3DL0A 1M1YE 1VCNA 3MGCA 1UEJA 4XWOA 1I4DD 4P4UA 4LC1A 3GEHA 2Z0MA 2E87A 1CR4A 1E1QA 4DUGA 1DOAA 2RGCA 3Q72A 1XXHA 3K09C 1SKQA 1YZGA 2GCOB 2NOAA 2QE7D 2CJWA 1XD9A 3AKYA 2BC9A 1P73A 3QG1A 3CONA 2QP9X 1G3MA 2IT1A 3MCAA 4TZ0A 1TL7C 3QG5A 3WYAA 1AN0A 4IDOA 3NBXX 3GEEA 4IJMA 5L3QB 2VHJA 3ONWA 1UKEA 3VR5A 5DE3A 2H7VA 3R7WB 1A82A 5KOYA 5KSYA 2CK3D 4XD7D 3CWQA 3GEIA 2OM2A 3EAQA 3LX8A 3I5XA 1NJFA 1EXMA 1FQKA 2OXCA 2V4ZA 2EFGA 2ZJ5A 3QKSB 4MH0R 4DLXA 5K8IA 1R8QA 1RZ3A 1P75A 2D74A 1J90A 4NHOA 3KKMA 2CHQA 2AK3A 4BZPA 1GKYA 1DADA 3O8RA 3IEVA 1ZM7A 1MABA 5JEDA 1OLOA 1OIWA 5H1YA 2IYSA 2XXAA 4C0SA 2ZS7A 2RMKA 2R8RA 1E2DA 3DMDA 2YC4C 3AVUA 4A8JB 1XCMA 1N6LA 1OSNA 1EFRA 1EFCA 5KSOA 4Z1MD 4TMTA 1YR9A 2VP9A 1PLKA 1KIMA 3NC1C 3ZH9B 3VHXA 5DNYB 3C5CA 4NYJQ 3D3QA 4DSTA 3B7GA 3MSXA 5E95A 1GRQA 4LZZA 3T34A 3D6TB 3QBTA 4V03A 3X1XA 5FL7A 4TT3A 2PCLA 1W4CA 1GFIA 3QJYA 2FDCA 2HLDD 1E9RA 3U3JA 1G3IA 1Q0UA 2Z4RA 4TZ6A 1P61B 1D2EA 4DCVA 2G88A 4DDWA 4DCNA 2C9YA 2CNWA 2HYDA 2OFOA 3SR0A 3VKWA 4YMVA 4YMSA 5H68A 1VPLA 2GTPA 3ND9A 1JPJA 5C2JB 1CEEA 3MRSA 1G8FA 1KMHA 1VCIA 2HYIC 1T4GA 3OHMA 2F43B 5KO2A 3QKUA 4IVQA 1U0HC 5B58C 1U90A 5J4YA 4G3XA 3B2EA 1XDBA 4TQAA 4YDHB 4DVGA 3LO5A 2AHOA 4RZUA 4IOMA 3F5FA 3LVQE 2FN4A 2HDNB 2ZAMA 3PUXA 4B2IA 1HT1E 1Y63A 2DHRA 4Q48A 4TSFD 3IGFA 3UATA 4GSYA 1ZNWA 5KDDA 4MGIR 1X8LA 3AF2A 4RCYA 4EQ6A 4UXHA 1CXZA 4X8MA 4OHYA 4WVFA 4TL7A 1FX0A 4DLWA 4NH0A 4V0LA 1KI4A 2OCBA 2QAGB 5A5GA 2WMNB 1JAIA 1VYUA 4MRRA 2X2EA 3ETLA 2V6IA 4HAYA 2V1UA 1NN0A 1G41A 1Z8FA 3OE7D 4WA7A 1E6CA 4RKFA 2ZXUA 3GJ5A 1DO2A 1MH1A 4GPTA 2YNMA 4PC3A 1G20E 4QNMA 4JBXA 4AURA 2AWNA 2JLWA 4UQOA 1IN5A 2WPDD 1D5CA 3HU3A 4Q66C 2JJ2D 2QRZA 1C9KA 1EX6A 1HEIA 5F9HA 5FOUA 4A8JC 1OFIA 3E2IA 2W6JD 3CIOA 4LJ9A 4W5WA 1TU3A 3WRYC 3R20A 2O8CA 5HR5A 1XD2A 2BJVA 3BERA 1WXQA 1RYFA 4XSHA 1KI2A 4B3DA 3ECCA 3BE4A 3RC3A 4H1UA 1ZP6A 4NYIQ 2C04A 5TDHA 1R5OA 1P60A 4LJ7A 2B21A 4QBFA 3GLIA 3AF3A 4QGFA 4TYWA 4TSFA 4DC9A 4U02A 2BDTA 1GUAA 3HJNA 4URWR 3PR1A 4BRWA 6Q21A 4Q7LA 1TF5A 1Z0FA 4IFBA 2QRNA 2R44A 4B33A 1KSJA 4ZCIA 3QKRA 5L3SB 1IN7A 3GJXC 3LLMA 3WMFA 1PZNA 4KITB 1YHNA 1ZUHA 5IK2D 3KKOA 1G8PA 2GZHA 2IYWA 4OBEA 621PA 3SFZA 3FB4A 4OHVA 4URZR 5G3ZA 3FGNA 4KFTA 3OEHD 5BQ5A 3OIVA 3RSOA 4B32A 4Q7JB 2IL1A 3KJEA 1YZTA 4Q9LA 5GVSA 1S96A 1LNZA 1JEDA 1XJ0A 2Q21A 5LB2A 5H70A 2AX4A 1E2QA 1T3HA 2QGZA 4MQBA 1IM2A 2A9KA 2QTHA 5FH9A 1KMQA 1QHGA 2HJGA 1XEWX 3U5ZB 4MKIA 2JJ1D 1RE0A 1NBME 1EK0A 4I1OA 5EP3A 3K0SA 4D26A 1XCGB 1XMSA 2DY1A 3NBFA 1RIFA 2CLSA 1KJZA 2FOLA 2W6JA 2XTNA 2QAGC 3MG9A 4FCWA 3THWB 1MO5A 3I62A 1IN4A 1NMZA 3R9XA 2PZFA 1G16A 4Q7KA 4TLAA 1M34E 1BH2A 4JLDA 3KXKA 4NMMA 5EXTA 5FBLB 2J7KA 2NG1A 4TYQA 3BH7A 2GAOA 1KOFA 3L0OA 4A2PA 1IN8A 5C1BA 1FTNA 3MWYW 4ITRC 4V0KA 5TXGA 4KLZA 1A5TA 2J41A 2V55B 1G5TA 3REFA 1GIAA 2G0TA 2QY9A 5BN4A 3GLGE 3FFBA 4LK2A 1GZSA 5FPSA 3QY0A 1TF2A 3IHLA 1G4UR 4TTPA 4TQUS 4BWYA 2BMEA 4JVNA 4M1YA 5IK2A 1KDRA 4UNQA 1EX7A 2C5LA 4A4DA 1DELA 1HA3A 1NKTA 2TMKA 1NG1A 1QHSA 4PR0A 4FMDF 1J99A 3P4YA 4XOIA 2VP5A 3O8CA 2FA9A 2GCPA 3SNHA 2NZ8A 4B6EA 4QHTA 4CT5A 4YXWD 1EFTA 4L9SA 1OF1A 2ODBA 2GJSA 2HT6A 3C8UA 4F4CA 3AVOA 2YOFA 2J7PA 4TLEA 5KU1A 3THYA 2OXRA 2RGEA 1L2TA 2Z43A 3H86A 4Q4HA 4BFYA 1KJWA 3U60B 4OHWA 2W2TA 1G18A 2NO9A 3IIJA 2NO1A 3OZXA 4AK9A 1E2MA 5KPDA 2W2XA 3H1TA 2A7QA 1Q1QA 3HWSA 2R6GA 2ZYUX 4B3CA 1G4AE 1Z6YA 1OH8A 3PIRA 2WOJA 3F8TA 3WY9A 4AWXA 1G7CA 3LVRE 2X2FA 4WZAE 1HQYE 5J47A 4FMCF 1AGPA 1P2UA 2A5GA 2WWXA 2ZRBA 2ZJYA 3KB2A 1QHNA 3VR1A 4PZZA 4F93B 2HEIA 3V00A 5TV2A 2PJZA 3FHOA 1N5JA 3KJHA 2E1RA 4GBMA 2NGRA 4QXAA 1W49A 2XTZA 2GBLC 3CPEA 4POAA 2H57A 3VU9B 2QT0A 4H1VA 4OQFA 3A6PC 4BASA 5CITA 3M0EA 5J4VA 2A5YB 1P72A 1JI0A 4HLUC 1KI1A 4OQMA 5BWMA 5DI3A 2BM1A 3ASYA 3NH9A 2AN9A 5JWOA 4RZ2A 3C5HA 3B1VA 4LHYA 4MYTA 1X6VA 2ZITA 4OQLA 5IT5A 5J4KA 4KBGA 1XXHE 2R65A 1N0VC 4M9SA 4LYAA 4NCJA 2X77A 5B2ZA 5JMTA 2IBMA 4DT1A 3AF4A 2ZSFA 3K0FA 5JZVA 1S1MA 4EAQA 4MRNA 1B23P 5E7JA 4DLSA 2FZLA 1Q44A 3AVXA 1KO8A 3QVUA 2JLRA 4OK3A 2IA5A 3QI2A 1NY6A 1W2HA 5P21A 3DM9B 2HF9A 4PHHA 1AS0A 1JR3A 4QRHA 4G1UC 3VR3A 3RYTC 1O87A 4XSGA 1J8YF 2ZRGA 4CEJB 4IFEA 3VX4A 2WWFA 4MGZR 3WHKA 4LHZA 3LD9A 2FE4A 1QBKC 1FL9A 2QMHA 1MRSA 1GP2A 1AS3A 2OCYC 2YC2C 1RJ9A 2ZE8A 1BS1A 1WCV1 4JLVA 3KTAB 2J0QA 5JSZB 3DZ8A 1ZNZA 1XEXA 4UXIA 5BW8A 2O8BB 3TMKA 2YWFA 5AUNB 1QDEA 3ADCA 1F2UA 2UVQA 2QPTA 4B73A 2H16A 1NIPA 4URVR 3RWOA 5JRZA 3QOFA 3FVQA 4DIDA 1ZM9A 3QXHA 1COWA 2J0UB 4V0MA 2QU8A 4UNRA 5GJWC 3B85A 4C9BA 1UPTA 1WBDA 5AUOB 1AZSC 1GOTA 3KZ1E 3HYRA 3SBEA 4ZV4A 1PVOA 4RSGA 5EZ5A 4CEIB 5AWFC 1U0JA 2FPMA 2BMDA 1SVIA 2OBNA 2JEOA 2R9VA 4A0FA 4CVNA 3KJGA 1KNQA 1N5KA 4FCVA 2BV3A 1CR1A 2OSBA 5FOXA 4EUNA 2OBLA 3OAAA 1E2KA 3ZGXA 1FOEB 1GNPA 4OHXA 3QXCA 5UKDA 2EQBA 4ZO4A 3H2YA 1OH5A 2W0SA 2PJRA 2XOKD 4V0OA 4NCHA 4DB4A 2P5SA 2FNAA 3FTQA 1F5NA 1XMIA 2FJUA 2KB0A 3N2IA 3FHCB 4A15A 3H84A 4HAUA 3L0IB 1US8A 3EIHA 2MMCA 1AJEA 1ZYUA 1KAOA 4C0QC 1U9IA 2PL3A 4ON9A 3K0AA 1J8MF 2QMOA 3SJAA 3IPXA 2XSZD 4PSVA 1CR2A 1G9XA 1XZQA 2FEMA 2ZS8A 2KE5A 4RD3A 5F2EA 2BCJQ 3U4QB 4AY2A 1Q1EA 1ZC4A 1CIPA 3I92A 4K8OA 4Q1AA 2P2LA 4EJSB 3PUZA 3LNCA 1GRRA 1NBMD 1WRBA 3VR6A 5G41A 2CVHA 2ZPTX 1Z07A 4HATA 4B6FA 4HDOB 3AB3A 1E4VA 4OK6A 1N6PA 5EE1A 4C0BA 3EX7C 3ZS8A 1E96A 4RD4A 3A1UA 1BOFA 3P32A 1FMJA 1JNYA 1LTQA 2DYKA 1DAMA 2FH5B 3IQXA 4ZI2A 2QQEA 3A4MA 3A58B 5CK4A 3B1YA 1E9EA 4JIMA 2Z6VA 4NDZA 4Z54A 4GMXA 4WZ6A 2AFHE 1WQ1R 3FHTA 1LF0A 1G5PA 3LY5A 3PITA 1PV4A 5FTKA 4TWZA 3ICQB 2HJVA 1KGDA 3EASA 3WMEA 1ZIOA 1CJTC 4HZUA 3NBZC 4PFSA 5HCIA 4BFTA 2OILA 3QKTA 4QJ5A 2QSZA 5JWRA 4AKGA 2C77A 1VIYA 1U8AA 2ODWA 1W0KD 4Q4JA 3O47A 1JAHA 1AK2A 3KQNA 1M7HA 2OCPA 1L4UA 2N46A 4QNRA 2BEKA 4RD6A 4LC0A 5JJIA 3CWZA 1KSHA 1ANKA 4CEHA 1E79D 3GLIE 3IBGA 4HLCA 1Z08A 4QM7A 3VR2A 3VTKA 2RAPA 5D3QA 1NI3A 4WW0A 5JFGA 1E2IA 1ETUA 3PEYA 3F3YA 4BEJA 3T1TA 1RRFA 4D0LB 4R98A 1TPZA 4EDHA 4WXPA 1KI9A 1OKKA 2YZ2A 5FBQB 1VG8A 2I4IA 3ZYCA 2KBFA 4DDVA 4Q4LA 4YDSA 1SVLA 1E69A 3WNBA 4TYNA 3QF4A 2YWHA 2NO7A 2ZVQX 2XNDD 2P0EA 2MSEB 5G40A 1G17A 4D2IA 1X8JA 2UZ3A 3ZIAD 2ZJ8A 1G291 3Q7PA 2ZU6A 4URXR 1KY2A 4JKIA 1Z0KA 3AQ4A 3WP0A 3ZVLA 1EWQA 2KSQA 3OIWA 4BLQA 2B8WA 2ZETA 2ORWA 3LW8A 2ZRFA 2SHKA 1E0AA 4EJSC 2PX3A 3V4FA 4JLBA 4LPSA 3B82A 4M9ZA 5KDLA 5KUTA 5CYPA 4PHFA 2QP3A 5DI9A 1WE2A 3SZRA 3SOPA 3V9PA 4TTRA 2AR7A 1XJQA 3A1VA 3DMNA 4BECA 3DM5A 1E2HA 4G5SA 2YWEA 1T91A 4Q21A 1N6NA 1ZM4A 1ZC3A 4A0RA 4BFSA 2FWRA 1KTVA 1UKVY 4M9QA 1E1QD 4C0LA 3U44B 2OCAA 3LA6A 3GLGB 4AD8A 5IDVA 1S9HA 3IKJA 4KVAA 4BLSA 2OHFA 4PC7A 1PJRA 1NLYA 1ZU4A 3RLFA 4ARZB 4EFMA 1WMSA 3NDBB 4OJQA 4NYMR 4A0HA 1Z2AA 2RGAA 1IBRA 5AUQA 2ZJ2A 4QL3A 3BK7A 3A1TA 3TKLA 1K6MA 1IXSB 3KQHA 3ASZA 1RFLA 1NLZA 1P4SA 3CR8A 1VYVA 2B7CA 2ONKA 3W5JA 4MUAA 4PAQA 2NMVA 1Z29A 4MKHA 3E5HA 3THXA 3DVLA 4LWZA 4PXAA 3IO5A 3W8RA 3ZS9A 1FMLA 4OL0A 3ZIAA 4MDEA 2OO7A 3NH6A 521PA 5CDFA 4TYPA 3OF5A 2GJ9A 2G77B 1E9AA 3SEAA 2NO0A 1UDWA 4K81B 1Z3IX 3K9LA 2QUZA 4A9AA 4WIAA 3TRFA 5F9FA 2ZI6A 3H0KA 1W36D 1OHHA 5SZHB 1JXMA 2A30A 3DHWC 3CNNA 4UKDA 1E2LA 3K0CC 5CYOA 2O8EB 2ATVA 2XTMA 4JMPA 3NIBA 4DHEA 3TR0A 3AP2A 4GFDA 1EFRD 1G5RA 3ZD7A 3U2QA 3NBYC 4AC9A 2JLVA 4H9GA 1T5IA 3QEJA 4TMXA 3QENA 3GD7A 4B44A 8OHMA 2GHIA 4JLPA 1Z83A 5HZHA 5CJPA 4IVPA 4DRZA 3G82C 4IRUB 4LBYA 5FL7D 4J0QA 4Y0VA 4BZQA 4TT3D 3D31A 3W9YA 2CXXA 3VAAA 3HU1A 1G8YA 4JLKA 1QRAA 3TUIC 1RKBA 2AFIE 2ZSAA 2CNWD 4MGKR 5L3QA 1P9WA 1W46A 3C16C 4HEJA 4S35A 1E0KA 5JEEA 4ZIRB 1ZVQA 5GJVC 2RGNC 2IWHA 1IHUA 1UADA 3R8CA 3ZZ0A 4MYCA 4A6PA 4IDHA 3D7MA 2Q3FA 2Z83A 4PSKA 1KI7A 4OKSA 3MWLA 3QE0A 4L16A 1XXHB 3LXRA 3CF6R 1T3SA 3B9QA 121PA 1A2KC 2ERXA 3CM0A 2CJWB 1G3RA 4Q1BA 4BEBA 3IHWA 2VP4A 2DFKB 1I4LD 4IKEA 5AR1A 4ESVA 1SVOA 1W4RA 4UJ5A 2IS2A 2DWPA 1VMAA 3MMPA 2ZIAA 4NONA 2P65A 4C7OA 4B71A 4TL6A 2QBYA 1QVRA 1P6XA 2R6DA 3FMOB 2XX3A 5KYKA 2JGNA 1M8PA 1XB2A 4KFRA 1ELOA 2VP6A 1LB1B 4XTRA 3MD0A 3WXMA 2R6FA 1TX4B 4B75A 2CCKA 1GSIA 4I81A 1JR3E 3KJIA 4D81A 3AKEA 3FOZA 3TQCA 3SYLA 1JB1A 1R0ZA 4JKYA 1E3MA 2LKDA 4M2LA 4D4JA 2FSFA 5JJLA 3QPUA 1ZCAA 1MABB 1W36B 5IRCD 3Q8XB 5FUXA 2XXAB 1OH7A 5E7IA 2G1KA 2BWJA 3BRWD 5TARA 2Q9AA 4IOJA 2ONJA 1S8FA 4DJTA 2YVUA 1L4YA 4RD0A 2XB2A 3U7HB 1TQ2A 1GL6A 1FW6A 1P2VA 2C03A 1T5LA 5JHGB 5EZ6B 4KI0A 1AQUA 1EG7A 3MAAC 1KO1A 1R8SA 4Z8XA 1OXUA 1XTKA 5FBRB 4P4SA 3KFXA 3KUCA 3PG5A 5FPTA 1MRNA 3I72A 1Z6XA 2QGNA 3CUEF 1CBUA 4HLQB 2CE2X 5FI1B 3PEWA 2F6RA 4V0ME 1RYHA 1L7VC 1U8YA 2WWWA 1UAAA 3HU2A 1KO5A 4IW3B 1CTQA 2YJTD 1TUEA 3CB4A 1N6OA 3Q9LA 2EW1A 4HAXA 2JIZA 1HUQA 4PHGA 1JECA 3KL4A 3UWKA 1ZBDA 4JT2A 1XTSA 4UNPA 1DS6A 2VSXA 1E0SA 1K8RA 2BEJA 3FMPB 4JLOA 4P33A 4B35A 1KMHB 2QMEA 1TAGA 2XJ9A 3CNLA 2FFBA 2Q9BA 3C4JA 4RFSA 4C30A 5TMPA 5CM9C 3CBQA 3QXXA 5KNBA 4OYHA 4Q1CA 1T8UA 1TUIA 2ZJBA 3WBJA 3ICEA 4AKEA 3AUXA 3X1ZA 1NN5A 1YVDA 1MO4A 2ZRDA 3BFXA 1W4AA 3BB1A 1Q3TA 4QJ3A 3EZ9A 4C2UA 2W6IA 3NHAA 4DLZA 4PPFA 4M0LA 4EQ6B 4ZCMA 1OIXA 5A0FA 1FX0B 5FTMA 1QHHA 5AK0A 4DCTA 3UMRA 1OH6A 3AGQA 2BBWA 4Q00A 2LWIA 4ZCLA 2ORIA 2W0MA 3AVWA 1XTJA 3DZDA 5B30A 2ZI5A 3RS5A 2GCNA 4LYFA 1WP9A 3LDAA 3IDQA 4F4JA 4PQFA 4HAWA 2C78A 4HUQA 4QM6A 2KI5A 1XTQA 4KFUA 1IJFA 5JWHA 1W36C 2IYTA 2MSCB 2CDNA 3B6EA 3RWMB 3MJHA 4NL4H 4TMVA 3HDTA 2CL7X 2W2VA 3I8SA 1DEKA 5D3MA 3PENA 1T6NA 1ZIPA 2WMOB 3GJ4A 1AM4D 2O8CB 1ZD8A 2WM9B 1JALA 5KSZA 1XD2B 4N3NA 1FP7A 1FTSA 4Q9JA 1YZLA 1VTKA 3GMTA 1EFUA 2ECKA 1X1SA 4NP6A 1G6HA 4TYYA 1IJEA 2IS4A 2WWHA 4G5QA 3TIFA 2PT7A 3FE2A 3GLIB 1E98A 3PCRB 3NHBA 4NPHA 1BKDR 1U2RA 2ERYA 1F3OA 3C7KA 3CX6A 1RVDA 1AKEA 3GCGA 2J7PD 4AG5A 3QXSA 1A7JA 3P27A 4XIGS 1A1VA 4KSCA 4E03A 1OFUX 2J59A 1D9ZA 2DR3A 2OG2A 3QKRB 4FINA 2C99A 2IX3A 1D2MA 3I3SR 3W3AA 4IOLA 1U81A 1L8QA 1SHKA 4LI0A 2ZSEA 4BLPA 3TR5A 4WZBE 1NSFA 3CPHA 5SZKB 2O0KA 5LB4A 1ZUNB 5EXXA 2CLDX 2WKQA 4QGAA 4MRVA 3BB4A 1N5IA 2RGBA 3CW2A 3MLEA 4RVCA 2XGJA 2REBA 1LVGA 3QXJA 4QG7A 5DHAA 1KDTA 2D06A 1EWRA 1XMJA 1NJGA 4NU0A 1HQCA 2VHUA 5DN6A 4A1FA 1S3SA 4MA4A 4RY2A 2RGGA 4PHTA 1Z6TA 3LAWA 1DAHA 4YC7A 2FFAA 4LYJA 3RAPR 1I2DA 3ZZUA 2FF7A 1D6JA 2IXEA 2JLZA 5BN5A 3VX3A 3IEUA 3WHLA 3GLHA 1NSTA 5F98A 1TEVA 1OT3A 1GNRA 4JL5A 1Z06A 2X19A 1Q21A 1C1YA 3NXSA 2WTUA 1QZXA 1MO6A 1YR7A 4UNSA 1U94A 2REOA 3RRMA 1B0UA 1TADA 3TAUA 5EE0A 1NKSA 1Z0AA 1OXVA 2VSFA 1CULC 3CF2A 3D8BA 1F2TB 1XWIA 1XZPA 4HSEA 1LF5A 1JQJC 1N6RA 2IC5A 2QA5A 1R0YA 3RC8A 2Q3HA 2VHCA 4F7WA 1J7KA 3CX7A 4TLBA 1Q12A 1KDOA 4EPVA 5TVKA 3THOA 2JLUA 1KI3A 5CIWA 3WBKA 2OAQ1 2PLFA 3PEVA 3W3ZB 1IXZA 1RC8A 4LPKA 4LYHA 1YZUA 4CF7A 4DLVA 1G1MA 4IEIA 1YZNA 2QL6A 4DDUA 1E2EA 4Q1DA 3BWDD 4LSGA 1TQ6A 4M1MA 4I99A 1XEFA 2OZEA 1JR3D 3AP1A 4LJ4A 1Z6GA 3MWKA 1KKMA 3N5CA 4LRWA 4Q9KA 5CDFE 2RGDA 1P62B 4QKQA 2K5UA 3RSLA 3THYB 1II8A 2FMXA 4KYUA 2VO1A 3UK6A 1YE8A 3A8TA 2H17A 5CLLA 1YQTA 2JLSA 4Q4HB 3TVDA 4IXNA 2ZTSA 3T1OA 1MKYA 4AYTA 3Q3JB 5JJKA 3AF0A 1W0JD 3EZ6A 1UBEA 1Q3HA 5HE8A 4JT4A 4DEYA 4QOSA 1ZW6A 3LWNA 3TUZC 3EZ2A 1KJYA 2WJIA 4HB4A 4Q4AA 4R71A 1N6IA 3BAFA 2ZI4A 4N1AA 2QZ4A 2RHMA 3T15A 2H92A 3AF1A 1GRNA 1COWD 1R0XA 1KO7A 1TU4A 1XBTA 2B92A 1IY2A 4BQSA 3I61A 1T0JB 1SULA 3L43A 4YLGA 5DIFA 4S2EA 4Z8YA 2GEUA 4ZDJA 4B2LA 3ZZTA 4JSYA 1G19A 1NP6A 1QHXA 2R6AA 4B3XA 5KDOA 3Q7QA 4OQXA 1IOZA 1DO0A 3OAAD 1FQJA 2DFLA 1AQYA 4JL6A 1JXOA 2XZPA 4BLTA 3QBVA 1I2MA 3X2SA 2Y8EA 5GJBA 3DOEA 4FWIB 1X3SA 3AVTA 2ZVPX 4MRPA 5M04A 2Q9CA 1G21E 1R2QA 2FV8A 4HI0E 4KV9A 1S4QA 4PC1A 1CJKC 2JLXA 4OI2A 3UG6A 3BGWA 1KKLA 4EPYA 5L3VA 1XEWY 5CJ2A 3AEZA 4CEJA 4E09A 1BYIA 5CIQA 3P26A 2CBZA 1Q1ZA 4LOAA 4PANA 2RB4A 5DYIA 4X8HA 4XWAA 3CLVA 2EFEB 1IONA 3W6OA 3A1WA 1ZAKA 3K0FB 3TSWA 3PXGA 1SXJA 3FMFA 2FSHA 2IYUA 3QPVA 5IF9A 3ADKA 1W44A 1W0JA 1Z0JA 2J9RA 3M6AA 4PX9A 4AYWA 1DAEA 1XD8A 2Q6TA 3BH6A 4E22A 1DAIA 3TW8B 2WWGA 5G3YA 4JSTA 4XH9B 4QJ4A 2PH1A 4RFVA 4CZ2A 1E9FA 3PV0A 1HE8B 2AXPA 3LFUA 4Q01A 4BFVA 3DKVA 2OE2A 1ESNA 4MRSA 3TLXA 4CEIA 4M21A 3Q5DA 2A2ZA 4DLUA 3TJZA 1R5BA 5B64A 2F1RA 4PPGA 2A78A 4B74A 3UMSA 1XEXB 1Z0DA 3E1SA 3EARA 5JCPA 1FUKA 5HCNA 2FSGA 3T5DA 3B9PA 3RANA 1F2UB 2QAJA 4XVQA 2WJGA 1WBBA 4FMBB 2ZANA 2WSSA 2BMJA 3NVAA 3W8NA 3H4MA 4JLMA 2J0SA 3GJ0A 1FPMA 2G1JA 2WBLC 2RKOA 5EE9A 1S9DA 2ZR9A 3QQ5A 3X1WA 4D4KA 1CU1A 3KX2A 1SGWA 2GESA 3GJ7A 5HTKA 4B43A 2GZAA 3I32A 4C0JA 2B8TA 2O8FA 2ANBA 2QNRA 2Z4SA 3BORA 2GEVA 2N1BA 1Q57A 1Z5ZA 2IW3A 4FD2A 4ASUA 4O2LA 3TSOA 4P31A 2HT1A 2O52A 3KQKA 4GNKA 4DZZA 3Q5EA 1D2NA 3EC1A 2ZU0C 1QVAA 1OKKD 1GWNA 1G8HA 1HYQA 4G5OA 3GFTA 1U98A 5EE5B 2XZLA 4Q9IA 1P7CA 1US8B 3CX8A 2ZRIA 2GETA 2IEYA 3K0EA 3RABA 2C98A 3LV8A 4PTLA 3IILA 2EU8A 3LRPA 2Z5FA 3AP3A 3K0AB 3S1AA 3K1JA 1KZGB 3PUWA 2QPAA 1Z22A 1KI6A 3EPHA 3WRXC 2ODEA 2AKAB 3WMGA 2EFHB 1UBCA 5EQTA 2GWHA 3U7FB 5EXSA 3ADDA 3WNDA 3QEOA 2BKEA 4O0MA 2OESA 5JS7A 4G01B 3ZLJA 4UNNA 3OEEA 1XTIA 2XZOA 4XWKA 2RGXA 4BFXA 5E3HA 1E32A 1IXRC 3TW4A 4NCNA 2IYXA 4NYMQ 1E4YA 4D4MA 4CGZA 1Z2CA 5JI3E 2D2FA 4E07A 2WSMA 1TF7A 1DG3A 1FP6A 1ZMXA 1QG2A 4Q47A 4URUR 2IYZA 1WA5A 2VP2A 4GZLA 2GEDA 3IUYA 4RD1A 5AJVB 5C4GB 1XCPA 2IYLD 3L8ZA 4YMWA 3TNFA 3MUFA 2I1VB 3TAHA 1VHLA 5FUWA 4C2TA 1DAKA 4P3YA 2BKUA 3G0HA 3IIMA 4JLNA 4HZUB 3JVUA 3EWAA 4EIWA 3BFVA 2A5JA 1MOZA 1Z63A 1NF3A 3BFKA 1S1CA 1IY1A 2YINC 4C3ZA 5JS8A 4DLTA 1AS2A 1LV7A 1SZPA 3GFOA 4Q4JB 4GP6A 3FKSA 1KO4A 3GLFA 3ZJYA 3IPYA 3SFVA 4FW9A 4JVLA 2PZGA 4P4TA 2FX3A 1TNDA 2RH5A 4I1VA 4D0GA 4CEHB 1JBKA 1EGAA 1U0LA 2FGJA 3PEUA 4GRAA 2I1QA 4LJAA 2HV8A 4PAOA 2QP4A 3CRMA 4M1KA 2DFNA 3K09A 2IWRA 1SVWA 4KBFA 4QHSA 1F48A 3NKVA 1KZ7B 2HF8A 1ZM2A 2GF9A 4BE7B 2KBEA 2JJ8A 3ZQJA 2EFDB 1OHHD 3OIUA 2O5VA 1VG0B 1XPOA 1ZUIA 4PSAA 3IBYA 3BXZA 3QF4B 5BYKA 4NBSA 3OESA 3JVVA 2G9NA 2WKRA 4BRUA 2CLCX 1U9IC 5C18A 5TB5A 5EJEA 2F1HA 1EFHA 2IF0A 1NVXQ 2GVDC 1KI8A 1E2JA 3UMFA 3PJRA 2NIPA 421PA 2O8DA 2QN6A 1M7BA 1RRCA 2CL0X 1KHTA 1OV4A 4C0KA 1GKIA 1V43A 1PUJA 4PZLA 4JZKA 5DH9A 4DKXA 3U61B 4LY6A 4Q1EA 2GK7A 2FZ4A 3EPKA 2QI9C 1ZJ6A 3U3OA 3SQXA 3GLHE 1CJVC 1CRQA 2GXQA 2D62A 2VRWA 2PX0A 5J4HA 2V9PA 2GAAA 4NE2A 3KFVA 3CRVA 2V7QD 2L0XA 4GOJA 2IHYA 4Q9HA 2C9CA 2BCGY 3TE6A 2NPIA 2IUTA 4G5GA 1WB9A 1ESMA 1ODFA 4M4SA 2BVNA 4M1TA 3CRRA 3OIYA 1OYWA 2XAUA 2D3WA 2YOGA 4G5RA 1M2OB 1LW7A 1KK2A 4O2RA 2ORVA 4WXRA 3NWJA 1WF3A 2FEOA 2HXYA 4II7A 3A36A 2JAQA 5BYJA 2A5DA 3KQUA 2FPLA 4N0DA 1NRJB 2O8EA 3O8DA 2IK8A 2MMGA 3I4LA 3ND8A 4GOXA 1KK3A 3BB3A 2B6HA 1HURA 4PO8A 4TMZA 4FN5A 3THXB 2GRJA 2J87A 4TLCA 1DBSA 1M6NA 1YR8A 4LJ8A 4A0GA 4R2IA 3LLUA 3CH4B 4US2R 2WIAA 4JYBA 4DLYA 1XP8A 2ZSDA 1AZTA 2R6CA 4QGGA 5AUPB 4Y0AA 2WWYA 4E5UA 3PVSA 3FPAA 5HKKA 4FXPA 1OIVA 2GCOA 4Q18A 3CRW1 3BS4A 4LUCA 1LS6A 5FOSA 5LDDC 3LQQA 3I73A 3FMIA 3EWSA 2VF8A 2VF7A 5AJWA 5GVRA 2F55A 4BGDA 2BBOA 1A2BA 3QF7A 4ZKDA 821PA 3L82B 4G0NA 5DO9A 2JDIA 3R7WA 2V7QA 1XU4A 3WP1B 2VP0A 1E9BA 3TQFA 2LKCA 4GP7A 3GJ8A 1H8HA 1MO3A 4PQRA 2AWOA 1NVVR 3EA5A 3QKSA 5L8VA 3PUYA 3MFYA 1Q22A 5ANRB 2WKPA 4JL8A 1VG1A 2HCJB 2JIZD 2QT1A 4PAMA 2NTYC 2D4HA 3EPLA 1F6BA 4PC6A 1YU9A 3SQWA 3OFNA 3KKPA 4HLDA 4MGYR 4BUJA 2OAP1 5J40A 2RHDA 2IYQA 2R62A 3VHLB 4XJXA 4A8JA 1GILA 3UANA 721PA 1KYIA 1TTTA 1A4RA 1KNXA 4HB2A 4W9MC 5E7MA 4CIDA 2V3CC 2XJ4A 4B3FX 2DCUA 1SKYE 1JQLB 4DSOA 2PLRA 2ZYWX 2WOOA 4JBWA 3X1DA 1HV8A 4I1UA 1YR6A 4R2HA 3GPLA 4DB2A 4LV6A 4TLDA 4IVRA 4XTCS 2ZEJA 4AKIA 1SHZA 2WJYA 2QG6A 1VYTA 1N25A 2OT3B 2ZSBA 4LJ6A 1YKSA 1LFDB 2PZEA 3SE0A 2OV2A 2ZRKA 2G83A 1HH4A 1K5DA 2AD5A 2I3BA 2W6ID 1XPUA 1SXJE 1CLUA 3EC2A 3HR7A 1QF9A 5IHPA 4C7OB 1ZRHA 2H5EA 2VEDA 1GL7A 2P67A 2QBYB 5FBVB 3LQRA 4IOKA 3BC1A 2F43A 1G7TA 2QQ0A 5JRJA 4RCZA 2ZQ5A 3VR4A 2OEPA 1XJCA 1CJUC 1DPFA 1E9SA 4XVRA 1G64A 4PO9A 2ZR7A 4X8LA 4Z51A 3TSZA 2IEZA 3RS4A 4KCGA 2WZQA 4DCSA 2QE7A 2J5XA 3L8YA 4ESHA 2ZRPA 1GG2A 5FTNA 1W5SA 1E1RD 2VHQA 4A36A 3EIQA 5FOTA 1D9XA 2AK2A 3TVTA 2IS6A 3B1WA 1XMVA 2C95A 4A92A 2FG5A 5EP1A 3W34A 4BFZA 4P0TA 4EFLA 3TUJC 3U6BA 1TQDA 3CRQA 2WVJA 3HPRA 1CKEA 1OFHA 4XVUA 1DARA 3EG5A 3I1FA 5FBWB 5FPHA 3SYNA 2IS1A 4P4SB 1XF9A 2QAGA 4DLRA 2CK3A 1JEEA 2OUKA 2ZROA 4XD7A 3U3MA 2GVZC 4FI3C 1RPZA 3AVYA 2QTFA 1GITA 4L8GA 4DXAA 2OFXA 3UPUA 2P6RA 1JJ7A 3T61A 2QM7A 1S0UA 2B7BA 4GOKA 4JYCA 3KQLA 1R4AA 3SJCA 1NMXA 1CR0A 4GDFA 221PA 3X1YA 1OPXA 3L0SA 2HCBA 2FFHA 2QENA 3PQCA 4KXFB 1H65A 4JLJA 4OK5A 3FDIA
chains in the Genus database with same CATH superfamily
3QU7A 3L0YA 3VMFA 2J1LA 3KR2A 5BXQC 1YRQA 1MX9A 1QKJA 1NIJA 4C0HA 2BFCB 2C9BA 2EJTA 2YYZA 2CV1A 1TJ5A 2GFIA 1H69A 3G9UA 2HSGA 3CN7A 3IRUA 4EPWA 2ZYVX 3TD6A 4OI0A 2VBIA 4W9NC 3KOOA 3CWCA 3PEEA 1EJBA 1KR5A 2H2AA 1KAGA 3E3OA 5B2FA 3N8GA 1IEXA 6ABPA 2E4YA 2G0NA 3MJRA 4BO4A 4IZOA 4DSUA 3TOCA 3C6ZA 3S2EA 4A03A 3TF5A 2R1TA 2ZUDA 5I9LA 2Q99A 2AJBA 1W35A 3PPXA 3W2TA 1Z68A 4MHSA 2OFWA 3HB4X 4FUQA 4MV6A 1XVAA 5EVCA 3SHWA 3V6MA 1Z13A 2ODNA 3DFFA 3N6RA 1MEEA 1TVKB 2WJVA 4HDNB 4Y2UA 4IUYA 4EO9A 3KKKA 3CPSA 4OJKA 1LPBB 3R75A 2FMUA 3SSOA 2G6BA 2FPPA 3F0TA 1CUVA 4RK6A 3UIEA 2F3QA 4GZMA 5HPYB 4N3AA 1YO6A 1EMDA 2WAYA 3N2KB 5I9IA 2VTEA 1UKZA 1ODTC 2IIBA 2OHXA 2QV7A 4FFLA 2WUFA 2VK4A 3O1LA 4U2FA 3KZCA 5KTNA 5TY0A 3JQQA 1ZN8A 1ODCA 2EP8A 3N3BC 3SEZA 3PR3A 3N2EA 4QFMA 1D2RA 1RSZA 3CCBA 4L76A 3NWOA 2PZBA 1Z5NA 5CFOA 5K8LA 1X19A 2F8SA 3ECSA 2D0OB 3OWXA 1W85B 4BNLA 1XOIA 4JJIA 4NS4A 4D0NA 3EVNA 4XLTA 3G13A 5HE9A 5K8UA 4EBBA 1AHHA 4TV9B 2GBLA 4KTTE 3PGKA 4H7JA 3VV2A 3A3KA 3IUPA 2HZ7A 3RVMA 2WM8A 4IDPA 4NJMA 4HLUA 2IF2A 4R1QA 4US0R 2EWWA 5KYWB 3I2FA 2JGFA 1ZH8A 2Q3MA 3B8HA 5GMOA 2ZUTA 4FFWA 1K97A 3A32A 3Q85A 2VFAA 2BFEA 5EHQA 1LJ8A 2CNLA 1R6AA 4HMOA 2RBEA 3O90A 2IY8A 3OX2A 1YB1A 1ZVMA 2NNWB 2D7CA 3NMUF 3IEPA 1XTBA 2JEZA 1LNSA 3P9NA 4XLLA 5BOSB 3E9EA 3K15A 4B2YA 3DNMA 4DC1A 3AM1A 1JI3A 3RV4A 2XF2A 4ESOA 1TVMA 3VC3A 1L0BA 2ZI7A 4LV8B 4AECA 1WOYA 2GXSA 4BKRA 3GT7A 4AP9A 1T3ZA 3DLCA 5AK6A 4HKTA 2XCSB 4JV5B 4Z3KA 1M10A 4KYIB 2QXTA 1TZKA 3GHHA 4Q03A 4MWSA 1M2VA 3GOHA 4H18A 5KTYA 2W4MA 2V54A 3HBJA 1BDJA 4BB9A 1DWQA 1QGUB 2VKTA 5C3MA 2RCNA 1F2TA 4EP1A 3BTSA 3NETA 4BBAA 3OIFA 4BO7A 2GDJA 5CVVA 2GM4A 2QSYA 4PQYA 5DTRA 4BLOA 2ENUA 3QYJA 2WHXA 1UFRA 4FKZA 4YJ3A 3MMNA 1T8YA 3L07A 4CETA 5MN6A 3QLVC 4FZVA 5A6SB 1EEXB 2VH1A 4KPYA 1KFKB 2LR0A 4ND1A 2A3NA 3H42B 4HN4B 1V3VA 4NYIR 4Y7DA 1PNVA 2PFKA 4OEHA 4RE5A 3BJIC 1EJ0A 1T9HA 3TZCA 4ZPJA 1K8ZB 2N42A 1TFRA 1WCIB 1C4XA 1SVSA 2PFSA 1XZHA 2QN9A 1DB3A 3ANLA 2WWVD 5MDHA 1DRJA 1G2OA 1TLFA 3L9XA 1DEOA 5EHIA 2BM0A 2XMBA 4Y6LA 1V37A 4UJ3A 4RD2A 3H65A 1DKNA 1PHRA 2ZAOA 4X20A 4S24A 4M1SA 3V48A 3L2OB 1QX4A 3T7RA 5A1JA 1JR4A 3NEYA 2NZJA 3WGKA 3NORA 4CV3A 2GQ0A 3AEXA 1RTKA 4H6PA 1EWVA 1MDFA 4KR0A 3GUHA 3KT6A 5CX1A 3TK1A 4YMHA 4XPZA 1CDEA 1VMEA 2BHRA 4JWKA 3HYTA 2GJ8A 4DUYB 1NLMA 4X1KB 2H7XA 1UM8A 4HQLA 4FC6A 1H6BA 3OZCA 4QOJA 3IO3A 4WMLA 4CLRA 5C51B 3H5OA 4PBRA 5FOVA 5HX7A 3VJRA 2N47A 1SXJD 4I6EA 5FR1A 1ONBA 2Z8YM 2VF2A 4HJRA 2F1JA 4ZTZB 3DTTA 1WULS 1ILEA 4IUDS 4CU2A 2DFTA 1ABBA 2NZWA 3PUVA 3V8NA 1HC7A 1BYUA 1MT0A 3EDOA 4H1HA 3P2MA 3QUBA 3EXEA 3FNQA 2IYEA 1V5WA 4I4LA 5JXIA 1DAOA 2IELA 4ZTUB 4AF7A 2YHAA 3MAJA 4NK5A 3FDJA 3JAKA 4G81A 3LQYA 3IULA 1K4KA 2WMDA 3Q98A 2Y6VA 4JBYA 5DM2A 1C0EA 4B48A 3BWYA 3K9GA 3AIOA 5JCZA 2PH3A 5LQUA 3F2VA 1VL1A 3LRXA 1U7OA 4QPZA 4KI7A 4G0UA 3VFDA 4X44A 1PZXA 3GLQA 3ADOA 4AUKA 2CL6X 4QBGB 4TMFA 3QNUA 7ABPA 4MS1B 3SPXA 3NGLA 4JJ7A 3TLJA 4CTKA 3L0PA 4WKCA 1UBFA 3WLKX 2QX4A 1ST3A 5B1HA 1IVYA 3SKXA 5K0FA 2P2ZA 3O1IC 2PKQO 1VHQA 3NYQA 3P0RA 3M4ZA 3ORSA 1NNEA 2PT9A 4R7ZA 4MYSA 3IPLA 4Q4AB 3FAZA 4D4LA 5E4FA 1RLTA 2PYZA 1GPNA 2IGBA 1U3FA 2XIQA 3AZPA 3EW9A 3IQWA 3MW8A 4KLNA 3E35A 1XLTC 1Z5OA 2WSSD 4MKFA 1HTWA 4UTOA 4BTEA 2YV4A 3ETJA 4YXWA 3DONA 3OMXA 4OMFG 1YRBA 4QU0A 3CVXA 2VZEA 4HQKA 2UXBB 1HZZC 2ON6A 3HA7A 1QMGA 4O5AA 4OQYA 4R6XA 2HMAA 4B3HA 4GZ3A 4XIJA 1NXTA 2MIIA 2JFYA 3UVEA 1Y5IA 5J2UA 4L4UA 4ZRDA 2QI9F 3AWDA 5KB3A 2C58A 1E2PA 1PDVA 3AJEA 4IXMA 2OXIA 3QITA 4X93A 1T3LA 3A05A 3KTAA 4AO7A 5JSZA 4IAOA 4TS3A 2H1LA 4NFSA 2W2KB 4DDMA 4JJ6A 4U7GA 1GU1A 3OZGA 3RGWS 3T1QA 4DEXA 2VJOA 3T4PA 1D2HA 4E32A 4IIGA 3CLTD 1Y3AA 5TE9A 1OB5A 2QTLA 2PA3A 4P54A 1G3QA 4JDUA 4B3BA 3F6PA 4BFCA 2O48X 4OVKA 3QSYA 1E99A 1ISIA 1JB9A 4M88A 5BV7A 1VCMA 2V8BA 2ZIUB 1E2FA 2VL7A 4DBVO 1RBZA 2WHRA 4OQ4A 3S2ZA 5KOHB 4GL2A 2Q2QA 4I9FA 3DC2A 2JLYA 2JANA 4QBIA 3I5YA 1E1CA 4DANA 2Y67A 3P4XA 5JDCA 4ZGWA 1EIZA 4S1WA 3FZYA 1QO7A 4FU0A 3W9UA 5FEUA 3CZ5A 4BP8A 3E9CA 2VBCA 1E9CA 1H9BA 3WS7A 3U7EB 1DT3A 1V1MB 3CSSA 4H59A 5F1PA 1GTVA 5DYNA 2I7TA 4RA6B 4H1TA 5HA5A 4MDFA 4B2PA 4B6SA 5ARBA 2DECA 4Q37A 3HLYA 4TKVB 5CHEA 4IQ4A 5AKZA 3LQ1A 3R24A 4EVIA 3QUSA 2HBRA 2MR6A 1R74A 1BMFD 4PG6A 3T12A 3UT5A 2R0QC 2PUJA 4IDEA 1NUSA 2ZKIA 3EQ7A 4Q1FA 1GAWA 1PDWA 4JXJA 4KZPA 1JIIA 2PRSA 4U0JA 5CT8A 5D7BA 1CZOA 2CVZA 2XZTA 1ESZA 1ZU5A 4P38A 4TQ9A 2EJWA 5CFQA 1PSDA 1QFSA 3H83A 1WL8A 2XR1A 3HKEA 4BFUA 3H2GA 3B7WA 3C7TA 1PLJA 3BOSA 5LD2B 3U48A 3D3KA 3VM6A 2D7JA 4AKTA 3DEHA 1GPH1 1WDKA 3NP9A 4L74A 4TXHA 3E1KA 3EGWA 3TRHA 2H9YA 4C4ZA 4HUTA 1WDTA 4J75A 1U6IA 2PKXA 3BDAA 3QIAA 4RTSA 1K4MA 1W5EA 1LJLA 1NNSA 2VH2A 4IGIA 2OBBA 4AG6A 2LV8A 4YONB 2J67A 4LXXA 1XRJA 4M1OA 1CB0A 1M1ZA 3B3QA 4G9EA 4XSVA 1F1BA 3GRCA 1DTSA 2OFFA 4LA4A 2DJIA 3ENKA 1BXKA 3EOZA 1XXLA 4A8HA 4GU5A 5F52A 2O0HA 3LX5A 1AA6A 3NWPA 2B0CA 1ZRNA 1L9KA 2VPPA 2ZB2A 4BNTA 1P1HA 2O8FB 2UDPA 1QFZA 2W6CX 1N2OA 1W88A 3DO6A 3WQRA 5HUJA 1DTWB 2VA8A 1B6SA 2P3SA 3GEBA 5CD1A 2LD4A 5FFMA 3VVLA 3W6PA 1W2GA 1PWHA 1E7SA 3G2QA 1R6VA 1UWCA 3EMVA 1OJLA 1WVMA 1E2GA 2C97A 2RI0A 1OLUB 2ZUWA 1E8DA 3E8MA 2PWYA 3N0TA 3HUDA 3QV1A 5B3JC 1WSDA 3RS0A 3JAWB 4FQ7A 4W8GA 1VE9A 4NTZA 2A35A 1EFPB 4FCTA 2WAXA 4QGHA 5IM4A 1Z33A 2PUVA 3DTYA 3TD2A 4BLVA 2AIRA 3H6HA 3SHQA 2AKYA 3S1LA 4X66B 4LGVA 1P7ZA 1WHSA 2A5FA 4YGXB 5GY7A 4EPTA 5A06A 1Q6ZA 1SQSA 3B13B 4UFOA 4AMVA 2CUKA 5EJ4A 1GGJA 5CB8A 1MX1A 1MORA 1NU8A 2FXVA 2VDWB 2GK6A 4ACBA 4M86A 5J2TB 4RPKA 1XZNA 4BC1A 3CR7A 2X5KO 1OXTA 4OP1A 4ZI3A 1ZIXA 1F8GA 2HU8A 4JUBA 3AVVA 4IILA 1R4MB 1CVLA 4FOTA 1I6WA 1FMCA 2PMCA 5AJYA 3AL0C 1JDNA 2R25B 3H8WA 3DWEX 2KWIA 4YMUA 1C30B 2QE6A 1OLSB 4P7GA 4O4IA 3K0CA 3L1UA 4E4RA 1K66A 4EJMA 4LJYA 4E13A 4F3YA 4DCGA 1TRHA 3UJ8A 2ORED 2W83A 3F9IA 3D6UA 2CMHA 6NULA 1Y5NA 2GEFA 1B43A 4O2BB 4UMVA 2WICA 4A26A 1ZNYA 4NEQA 5DWVA 4YLYA 4DJFC 4G26A 1G7SA 1WZNA 3H5TA 1IPFA 3DKPA 3GFPA 3TFQA 4B4DA 5JC8A 4RL6A 2WEKA 3R3UA 3G0IA 4V02A 4KAJA 1LK0A 1U8ZA 4W6QA 2PT5A 1IAQA 4UUPA 4JJZA 3CO5A 4HS4A 4X7MA 4F4HA 2Y0BA 4RIFA 2O0MA 2ZRNA 3QMVA 2QORA 4I66A 3LBIA 4OI4A 3LBHA 4FC7A 1N3BA 2JFBA 1DAGA 2QLTA 3L5KA 4I1IA 4WESA 4NOKA 5G1PA 4CQLB 2FSPA 4N3GA 5JS6A 3EPJA 2E6KA 1WV1A 1TM3E 1COZA 3EULA 4UTPA 4R41A 4MXDA 1H4TA 4DJEC 1QHIA 1J1UA 3UKDA 4FI3F 1ID1A 3A1NA 1XL0A 3I42A 3OZEA 4GUAA 4MEJA 2GLTA 3ZD6A 5KYXA 2XZDA 4B34A 2IOFK 4M8NE 5FNVA 3UUGA 3VAZA 5CH5A 2VAXA 4C78A 2J6BA 4CKCA 2BBTA 3VKGA 3AR6A 2VSNA 2ADOA 2O8DB 3KTDA 1SIWA 3HY4A 2AH5A 3QFFA 4FKBA 2P6UA 2GILA 3N9IA 3WZLA 5C1PA 1LDGA 4G0YA 4EG8A 2BGTA 1NN1A 2FGKA 1OFGA 4R83A 4GI2A 4UUAA 3RJ5A 4DQDA 4UTRA 5I7HA 2GJKA 4C3VA 5B4TA 4MCJA 3TCKA 2GI4A 4EFNA 1CG6A 4ND8A 4HDRA 3AVYA 5DGXA 2CUZA 1KK0A 2GA8A 3JYPA 4LV5B 2H3EA 3OZ7A 3UV3A 4CR8A 1QZUA 4S0XA 1N2JA 2FCRA 1SVKA 3CZ4A 4MRMA 3GH1A 4W9RA 4MA5A 1R8XA 3L0CA 2ADFA 2D1FA 1USKA 4C3UA 5FR2A 3ES9A 4LF7B 4DMRA 1Z7WA 3B60A 3V1YA 3LDHA 1W0KA 3WK8A 5J59A 1T2EA 5A3JA 3HDGA 4YCJA 1PQWA 3AILA 2NQ2C 2JDID 2YV5A 2AEEA 2BH2A 4UAVA 5G53C 4CWAA 3RK4A 3R3VA 4FEAA 3MUNA 3VZRA 3LF2A 4DUGD 4BBPA 3SJBA 4HXYA 1VE1A 1E79A 4IMJB 4DADA 1AA9A 4L50A 2Q5IA 4PZAA 4HB3A 3MTAA 5F5NA 2X6RA 4YA6A 1IXYA 3AXSA 1DV2A 2VZ9A 1GCIA 1WVIA 3M83A 2WF8A 2TMYA 3BICA 3H2ZA 2IE8A 3RJTA 4RWZA 1GTSA 4H7IA 3LXXA 3CHYA 4W5JA 1R6XA 4DFDA 4NX2A 4MAMA 1SHUX 1UM9B 2NPFA 1JE0A 2GHQA 1JFVA 1NFQA 2RDMA 3KLBA 1W1WA 5CMLA 3T5CA 3U7RA 4CIAA 2V8OA 1LY1A 5BSGA 4IEEA 1U5BB 1IHDA 1XFAA 1V5FA 1OTYA 2X40A 1AIPA 1M5TA 1TRKA 1UANA 3HN7A 3NT2A 3R5SA 2FSVC 4ENQA 3MCZA 1OC2A 5KNDA 5F1YA 5KTSA 4AT1A 5CA1F 4DIKA 2AHRA 5AVUA 4LRQA 2CNDA 1ENYA 2GN2A 1Z82A 2YOHA 3NDPA 1BX0A 4JOSA 4RVDA 2WQ6A 4ZVNA 3G5UA 4HPJB 2GBIA 4U6QA 5YASA 5ICFA 5BP7A 5CD9A 3I52A 3TLGA 1PNRA 1TKCA 3SKYA 1YB2A 4HJXA 1Q74A 1E3WA 1GUBA 2R7MA 4KDEA 4YAIA 1AG9A 4XCQA 4HEQA 1YC5A 3DD5A 3PFBA 1D04A 2CDRA 2IHBA 1KJQA 3FUUA 4KX5A 2NYRA 4RJLA 4Y9RA 1YVEI 4EYGA 4EY7A 1GQQA 4GF5A 1ZD1A 2IP2A 3VVCA 3WMWA 2HSEA 4K7JA 1ZVKA 5JFOA 1ISGA 4PX5A 5LQSA 1YFJA 3RW9A 5I7AA 1MJHA 1ZGZA 2QMUA 2C3UA 3RU9A 3DL0A 3T0FA 4DM7A 2IZ0A 5KSWB 1O9BA 1PNTA 4XWOA 2Q4BA 1XYGA 4G5FA 3OKPA 4GECA 2Z0MA 4NDAA 4PYNA 3VVMA 1CR4A 3WG9A 5KJEA 4ZT7A 1DRWA 1DOAA 1PNQA 3G7UA 1RI5A 1XXHA 1JQEA 1UPAA 2RBGA 1SKQA 3HWRA 4R1TA 3ZWOA 5CPFA 2VN8A 1GKKA 3OUZA 1W4LA 2FK7A 2GEKA 2NOAA 3R74A 5FO0A 2CJWA 1JFSA 4CIBA 3QG1A 1A9TA 4ZVPA 5IAGA 2O50A 2DHEA 4KACA 1ADGA 3QG5A 3ENVA 3LLSA 4IDOA 2E48A 4PX3A 3L7JA 3IUJA 4YAJA 1MJGM 3DWFA 3JD0A 5DE3A 5CAEA 5H9WA 4PBSA 2ZJ3A 1Z37A 3ZE8A 2O57A 2YHIB 4XD7D 3WLMA 3GEIA 5ICEA 3D9QX 2OM2A 3LX8A 4GD3Q 4IKOA 4R2LA 2KLBA 2JPDA 2OXCA 3CZ9A 4DLXA 1C4KA 4EMBA 5K8IA 2I7VA 4ZCRA 4FTWA 2D74A 3BJMA 4DWVA 4EQZA 5IWCA 2ZQZA 2I6FA 2AK3A 1F8XA 4LZNA 3O8RA 4HGZA 4R1SA 2XUAA 1KAHA 4UARA 4WXMA 1SUWA 4X63A 3FXAA 1XP5A 3KAKA 1E2DA 3DMDA 5DW3A 3TG8A 4FHDA 5D6OA 3FNEA 2YC4C 3C5VA 3MJVA 3OCCA 1LZLA 3WLRA 4KR6A 2DHDA 4LSZA 5AO9A 1OSNA 3UQYS 1R4NA 4PNZA 5PNTA 1ACJA 5JAQA 1PLKA 3ZH9B 3HNPA 4FS8A 1P2GA 3GDHA 3TI7A 6PFKA 1FDVA 3D3QA 4WFQA 2YWDA 5E95A 3HCEA 4WFKA 3IP7A 4TKUB 1OFUA 3T34A 3SF8A 1GU0A 5KX5B 4ZAVA 1CY0A 2ALJA 3JQ7A 4M8IA 4TT3A 3INYA 1VQ1A 3E7XA 1DJMA 1W4CA 1GFIA 5GV7A 4IJVA 5GINE 5AKJA 1E9RA 4HO1X 2AFVA 2Y93A 5CFMA 1L7AA 1S2NA 2G88A 4QU8A 3TLCA 2ZWAA 2WYVA 5WRFA 3SR0A 4EKNB 3GUZA 4RVFA 1JGTA 4H3VA 3KRTA 1VPLA 2GTPA 1V25A 2QJFA 2LTAA 2Y99A 1EH5A 2Z5LA 3PNSA 3QVGA 4MQ6A 3LVBA 3U80A 4L3VA 5ER6A 4A5OA 4IHJB 1T4GA 3IUSA 1PZGA 3VNRA 2VQ3A 3CLSD 5CT9A 3LUKA 5J4YA 3S6JA 3U1TA 3BIXA 1Q14A 5B6IA 1IZ0A 4EW1A 1LNQA 1GN8A 3QX3A 2R8BA 1XDBA 3D0QA 3DTVD 2J32A 4CKYA 3B5IA 4TQAA 1XMXA 1V16A 1QYWA 4IX1A 3H7AA 1IRIA 1HT1E 2XW6A 3IGFA 2B4RO 1Q84A 4MGIR 4MQFB 4NNJA 1X8LA 3AF2A 2WA2A 3L9WA 5AI5A 2H1HA 1YH3A 4X8MA 4OHYA 4WVFA 3RD5A 5B55A 5J1TB 1ORIA 2Q50A 4RQTA 4N5MA 4V0LA 5D84A 5BR7A 4CKWA 1YE3A 4GX1A 3UM9A 2Q29A 2JVJA 1U1GA 1T5TA 2WMNB 1D4AA 3BTUA 2YYYA 4B83A 4MRRA 4FKMA 3ETLA 4EX7A 3HM2A 4AF8A 1Z6QA 2G07A 3FPJA 4PZ0A 4ZOLF 1LU9A 2QRGA 5CLFA 2YIDA 1NN0A 3D6AA 4CLOA 1Z8FA 4RMGA 3OE7D 1AF7A 2NYUA 5AW0A 3R7DA 2VQEB 1E6CA 1QVZA 2WFLB 4RKFA 4RORA 3VUFA 1ESDA 1Y8AA 4F12A 2VNIA 4PC3A 3T7EA 2P1ZA 4M9RA 2NTVA 2QRKA 4ZZ0A 5KQSA 3B9BA 3QYPA 4Q66C 4KXNA 1OZHA 1HEIA 1ZSVA 1OGYA 2IDJA 2M6KA 3ONNA 4X85A 1OFIA 5HCUA 3E2IA 4PRZA 1IWPB 2P77A 4YRRA 1EX9A 3W6UA 3HSKA 3JQBA 3N2NA 2X1MA 4RHFA 4W5WA 5HW0A 1NVEA 3I9LA 3OLVA 1V2HE 3QWFA 4ARCA 1JAXA 2PWZA 3BERA 3QVJA 1E6EA 1XAIA 2FQYA 4LWOA 1K75A 2NWQA 4XSHA 3RF6A 5FWXA 3I2GA 1KYZA 1PJSA 1ZK0A 3BE4A 4HFMA 4E5VA 1Y48E 1JQBA 1ZP6A 1K89A 2I2AA 1TJYA 2W6QA 3VNSA 2GK4A 1GAXA 4LVNA 1R5OA 2WUWE 3ZWXA 4RH1A 4KQMA 4PLWA 3AF3A 3C3AA 3UJAA 2VDRB 2BTQB 3EXHA 4BCCA 4FPXA 2B69A 1LBQA 1U0TA 4QYIA 6Q21A 2QRNA 3ODGA 1X94A 1AX9A 4IIDA 4E5MA 2YQZA 3G7NA 4MMZB 2R44A 4B33A 4L4RA 3U3XA 1LPAB 3JAMA 4P1ZA 1FX1A 5AK5A 1UODA 3LLMA 1C8KA 3NOVA 4YP0A 5K8CA 2W2LA 1YHNA 3BUSA 2QYTA 2XVMA 1G8PA 3H16A 3FPBA 1PR9A 2IYWA 3NB0A 3IE2A 3NO4A 4BVEA 3OPYA 4Z7QB 4TZKA 3V7NA 3OEHD 5BQ5A 3RSOA 5F51A 5F9MA 1A8UA 4F6LA 1GZDA 4ITVA 1S96A 2BLLA 3QHAA 1XJ0A 2LP4Y 2Q21A 5LB2A 5H70A 3ZJ5A 4KK4A 1T3HA 2Q2OA 2QTRA 4MQBA 2HADA 3BT7A 5DTIA 2C7BA 5FH9A 3QMWA 3RSFA 3QX8A 5L7TA 5LU9A 5JNLA 1YD7A 3O2QB 4L1KA 1SIBE 2JJ1D 3GJSA 1NBME 4OXQA 4X95A 3K0SA 3TJMA 5L7WA 2Q6OA 4P0QB 1KJZA 4YR9A 5CNJA 1WTCA 2QAGC 1UZLA 2BFMA 3KTOA 1F17A 2CJXA 3HEBA 3ZJTA 2Z5GA 3L49A 1D7OA 1H6CA 2PZFA 3R6TA 1NNI1 2ZT7A 1C81A 4GOND 4M46A 4OB8A 3F5DA 5EKSA 5EXTA 2HQBA 2AOTB 3RYHA 2G70A 4AUMA 1TJ3A 2GAOA 1L6RA 3A7DA 3BH7A 1IN8A 3IDSA 3L0OA 4A2PA 8LDHA 5HF6A 4ITRC 3AIIA 4YJFA 4M1ZA 1XU9A 5TVGA 1JJBA 1SFRA 1A5TA 4QIHA 2J41A 2V55B 1C7ZA 1G5TA 1P1KA 2OPHA 3A25A 5DBEX 2G0TA 3HBFA 3C3WA 4MDHA 5FBKA 3LC7O 4R9RA 1VXOA 1E7YA 1CVRA 1X87A 4FR0A 1PI3A 2ZWMA 3G2LA 4TQUS 2AS0A 4ZC8A 3GEPA 3BMOA 3O8QA 2JAXA 2Q1SA 4KQWA 3HU5A 2C5GA 3RHTA 4Y2XA 2WG2A 5IK2A 4FSXA 4CF5A 4ZYUA 5KVCA 1M0WA 4UNQA 3O3MB 5ABPA 1CUJA 3NM5A 1NG1A 4O1HA 5A5VA 4PR0A 3ZCVA 3INRA 1BAPA 3D4BA 3FIJA 2DQSA 4F9FA 3S27A 3EODA 3B52X 1OT5A 1HDIA 1Y5MA 4EW2A 1YDMA 3IS3A 1QH8A 4YRJA 1DV1A 2B4YA 4FR2A 2GJSA 2HT6A 3C8UA 2AZTA 1LWNA 5IJ0A 4XQEA 3F5QA 2PS0A 1V7CA 4TLEA 4U7PB 3ZZMA 4COKA 1RZRD 3UCXA 2D1SA 1KQ3A 1MJNA 2RG7A 4KWTA 1EJ6A 1L2TA 2Z43A 5ESRA 4BFYA 1KJWA 3U60B 2EZ4A 1JZTA 1H1TA 2NTJA 2NO1A 3ITKA 1E2MA 3MQ4A 4AK9A 3IELA 4YDRA 1RYNA 1BXRA 2PSFA 4ZOAA 5HKLA 4Z3DA 3TZHA 1Q1QA 2R6GA 1SU4A 1HSZA 1IM5A 3PIRA 4JQSA 2WYOA 4IIVA 3JZDA 4LXGA 1IBMB 2HW8A 3F8TA 3WY9A 2XIJA 2ACVA 2V4UA 3LVRE 4QO7A 2ECPA 2CNOA 4WZAE 1GQSA 5T4EA 5J47A 2ZZMA 1M6VA 2FLVA 2WWXA 2ZRBA 5FCDA 4R81A 4Z9YA 3ECAA 2ZJYA 2RAFA 4EGSA 2H4ZA 3M1YA 2FE1A 4NG5A 1IWBB 3VNAA 1M73E 3OCJA 4B8ZA 2HEIA 4PLTA 2PJZA 2VNSA 3C3EA 2E1RA 5TRTA 1FU7A 1V3TA 1U7ZA 4ARVA 3KT0A 2GPYA 2NGRA 4E21A 3U9SA 3BHMA 3MYYA 3WC4A 4AJPA 4MWEA 2H1RA 4QTXA 1ZJJA 2GBLC 4EAAA 4POAA 1OVGA 3G5TA 5TGZA 2I1LA 3VU9B 4QVKA 3JQAD 1C0PA 2COKA 4MULA 4DCPA 3MCTA 4YREA 3G68A 4EHJA 4A91A 1PT8A 1KMCA 1P72A 2AVNA 2WVGA 5TJHA 3ZNNA 1QB8A 2PK3A 4HLUC 5AMXA 1RQ7A 2AN9A 3QHQA 3BFJA 2G1PA 1U7HA 3B1VA 3LC2O 1BGVA 4MYTA 4NH4A 2IOHA 4I8XA 4BIIA 5IT5A 5KYUB 5JAPA 1AZLA 4JXKA 1T4CA 4O2AA 4GLLA 3WLIA 1SCKA 1M0TA 2H5LA 2QVLA 3LA8A 4Q3BA 3NYWA 1P7YA 4YBZA 4LVUA 4NZ9A 1FJGB 5DMXA 3I0MA 4FJ0A 4M9SA 1IG0A 4LYAA 2X77A 2OL4A 4NESA 1V8DA 4OGWA 5E6RA 1AC5A 4MVJD 2FMTA 2M9MA 3FW1A 4OYRA 1VMIA 4B0PA 4CR7A 5JMTA 2ZSFA 3K0FA 3GRRA 1U7XA 3FWNA 2EAUA 2ZOSA 3Q8MA 3GMDA 4HY3A 2ZZNA 2BFFB 3GZNB 3Q6MA 1RXCA 2GCIA 3A6JA 2LDBA 3UA4A 1RJFA 2UUBB 4OK3A 4RTKA 2VBFA 3QI2A 2R8YA 2ID4A 3TW8A 1RJWA 1P81A 1YUNA 4PHHA 1JR3A 1FYXA 1T0PA 3ME5A 3GN2A 4XLZA 4LY0A 4LOLA 2CFOA 3RYTC 2R6HA 5HHTA 3IDOA 2HD4A 3DMGA 2BSQA 3RTEA 4TQGA 3LCJA 4WZZA 4ENUA 3VX4A 5BSVA 1E3IA 5IC6A 4HPXB 1QBKC 3ONVA 4RPGA 1DQYA 1AS3A 3I9V1 4QRIA 2IV2X 3O82A 3DEZA 3JATB 1BEUB 1QP4A 1FDWA 2I91A 2VDOB 3UAOA 2GKOA 3ORRA 3P9QA 3L7IA 4MV9A 4P0PB 3USCS 3RVRA 3VPDA 4TPKA 2WKSA 1UBLS 1QDEA 2CFCA 2MYPA 1X7HA 3BEDA 3O94A 1F2UA 2O6HA 3OE4A 4Q0MA 4ZYVA 5C52B 4B73A 2H16A 4QSMA 4TXMA 4DVJA 1QRUA 4URVR 2B82A 3RWOA 3ZZNA 5JRZA 1IUPA 2AQKA 3FVQA 1RJDA 3MT7A 2YV2A 3GC6A 1A5ZA 4DIDA 4ILKA 5TNXA 4AJ4A 1KFBB 4V0MA 4UNRA 1FNSA 1CUXA 3WJ1A 5AUOB 1FQWA 1AZSC 2QM3A 3KZ1E 4NJEA 4BJ3A 2QRMA 3AHEA 4C21A 3AW8A 2NAFA 2BMDA 2OHIA 1XRPA 2R9VA 1ZOLA 2ODQA 2AMYA 3L05A 4O59O 3OPXA 4ID3A 2N3ZA 3GRVA 1SXPA 3KJQA 2PT6A 1IBSA 2PQ0A 2Y0CA 3EBOA 4B6QA 3WMXA 4E7OA 4JOCA 4ZO4A 5B1EA 4JOQA 5HWSA 1ONNA 2W0SA 5HDBB 3OJ0A 5CB0A 3KUUA 4V0OA 2FF5A 2R66A 1Q95A 1FDSA 4BAZA 4XRGA 3KVYA 3W4KA 3A1FA 1F5NA 2FJUA 1WHTA 3HGTA 2KB0A 3AHIA 1DL5A 3RYIA 3FHCB 4OKNA 4A15A 1BMDA 4HAUA 3EIHA 1XAJA 2MMCA 3GF4A 3ZI0A 4ABTA 2W71A 1KAOA 1DP4A 2DG2A 4ON9A 1LLUA 1HNZB 1EK6A 3IMFA 4TYMA 3ZWAA 3O3CA 1L7PA 2XSZD 2G82A 1D0VA 1XZQA 2ZS8A 1SH7A 3EGEA 3NONA 4NBLA 3SEQA 4E2XA 3U4QB 2GWRA 1CIPA 2H6EA 3PP8A 1ZY2A 1RWXA 1I8TA 4UCQA 1H1LB 3SLRA 4ALIA 5JSUA 3GVHA 2VYNA 4S1PA 1JU3A 1GCGA 1WRBA 2XYRA 1BHQ1 4OHKA 1FVXA 4PAGA 2WB4A 1NE2A 4NMHA 3LPLA 2JD0A 2R84A 1QBGA 1JTVA 4LQ4A 3JALB 3S5UA 5KVVA 3BXGA 1E4VA 2VEOA 3DHEA 4OK6A 3LIPA 4B81A 3NBMA 2YH2A 4EZIA 5FQNA 3AL2A 4GC5A 3ZX5A 3FPLA 1VLHA 2WHYA 4DARA 3CKYA 1SA0B 3A1UA 3KOXA 3RT9A 1N5OX 1BOFA 3FJOA 4G0PA 5ALRA 3P32A 5HIIA 1FMJA 1QGZA 4HDMB 1LTQA 2X0FA 5CPBA 4CGYA 3HDHA 1DAMA 2QIOA 3D81A 4BQOA 4ZI2A 1JWAB 3EGCA 1ML3A 3IR5A 3JS5A 4NLLA 2FQWA 5DNDA 3TNLA 4EHBA 4OLAA 3A58B 2QX9A 4UVHA 3O92A 4GXQA 4JFRA 5CK4A 2Z6VA 3CG4A 3Q7RA 3G0GA 2ISCA 3LCMA 2AFHE 2FJ0A 1WQ1R 4JHLA 1LF0A 1VFPA 3LY5A 4MS4A 4CTJA 1RHJA 3ZWNA 5A1TA 3SZOA 3OD5A 3ICQB 4N47A 1KGDA 4MJ3A 4D3DA 1I10A 1GPUA 4KXMA 4L2IA 3QKTA 4G6ZA 4QTUB 1PGQA 4A8PA 2G1AA 4GOLD 5SYNA 2IHUA 3AERB 5JWRA 2HMWA 2XT0A 1POWA 2C77A 5IVIA 4W5NA 2D54A 4NAHA 2HL6A 4JLSA 1DXHA 3LUBA 2QMYA 5TX7A 1MG5A 1XE3A 3O47A 1AKTA 1JAHA 2H9IA 3UY4A 1M7HA 2OCPA 4MKXA 3KQNA 2Q6LA 2N46A 2RK6A 4IIXA 2NSJA 3HABA 2WHEA 2BEKA 4C7VA 1PD1A 4OJTA 5JJIA 1V6AA 2AG5A 4DLBA 3BXEA 1KVUA 1I0IA 1U3DA 4QASA 5JDCC 3QX9A 1LBTA 3V1UA 4NWIA 4LG1A 3VR2A 1QE5A 2VLBA 3RKSA 3VTKA 3HDVA 1E2IA 2KQUA 2E4WA 2HK8A 3MCUA 3PEYA 3MJSA 1PR5A 3ZGLA 5F35A 2C8JA 4WN9A 4D0LB 4EDHA 4WXPA 3ZDXB 3P0HA 1P7WA 4MKZA 1KI9A 1OKKA 4F9GA 5CT6A 2I4IA 5DF1A 3M6XA 5FBQB 1W8IA 1ZCJA 4ZEVA 1NMQA 3OX3A 2JFOA 1Z4NA 2Q3JA 5D87A 1HORA 3QVWA 3HGMA 4IQ8A 4KMOA 4XAQA 3S2YA 3VISA 5BV0A 4C7MA 1B6TA 5JS1A 2H2DA 1UJ6A 2XNDD 3E3AA 4IO1A 4RVUA 1JG6A 1FLNA 2ET6A 2P0EA 5G40A 3G79A 4UM8B 1X8JA 1SC1A 1GGNA 1V5EA 3ZIAD 2G9RA 1ORVA 4URXR 1KY2A 1J9GA 1Z4MA 3D8TA 1C7FA 1MUUA 5AI4A 1EWQA 2YCBA 5EUBA 1MLDA 3FBGA 4HN2A 2ZETA 2RGRA 2K2QB 2OAGA 3MJFA 1TD9A 2JGIA 3LC1O 4K6CA 2PX3A 4WHMA 4JLBA 2G5CA 4LPSA 4Q34A 4F06A 5HJ7A 2FW7A 1DIGA 2J9FA 1N34B 2XMZA 3B82A 3R6LA 2OZLB 2BONA 1JRLA 2ZYDA 2ZXEA 2OP1A 3RODA 4FGKA 3TEMA 1MOPA 1NONA 3CCFA 2QP3A 3NHYA 1SBNE 5DI9A 3ZCTA 1CZUA 1M54A 2JH9A 1HM5A 1LV8A 1X42A 3A2MA 4JR0A 4XGIA 3EFBA 3SZRA 4TTRA 4XPIB 4C4TA 2BI8A 1XJQA 5HBGA 4U7TB 3OJWA 5DNAA 4PSUA 2FI1A 4R2XA 4M7RA 4D57A 1L7OA 3Q3GE 3JD2A 1T91A 2HY7A 3DE5X 4BFSA 4ZHQA 3PFWO 4M9QA 4TTAA 3UQZA 1E1QD 5TSDA 3TB6A 1M8GA 1OFVA 2JKVA 3MJEA 8ADHA 1LRKA 4LRUA 2ESRA 4G0VA 4IHAA 3ITEA 3KVRA 3RLFA 1ZU4A 4WNAB 1PJTA 1LRJA 1WMSA 1ZOPA 2BHSA 4QULA 5FLEX 2BTEA 4KQ2A 1M2OA 1QWSA 4GMGA 1IBRA 3THSA 2ZJ2A 2BI4A 3H2JA 4J3FA 4QL3A 2GN9A 4DQXA 2CC2A 3V6LA 3VNQA 3GUVA 1K6MA 2JLZA 4H3SA 5KINB 3RIMA 1RFLA 1VBFA 1I2ZA 1NLZA 1DWUA 1T5BA 1VYVA 1KGSA 1M9NA 2P75A 3CR8A 2NMVA 2L42A 3E5HA 1P2BA 4PCVA 3UW1A 4LWZA 8GPBA 5FV4A 4KO2S 1FMLA 3P2EA 5JAZA 1SKUA 4QVIA 5DP2A 1RCUA 521PA 1T2UA 1ZSNA 2ZTVA 1MIOB 5D01A 1EI9A 1E9AA 1V6SA 4D98A 2DQZA 1WSWA 5IDYA 1K2WA 1NPTO 5B7QA 1Y3BE 4WIAA 3TRFA 3A4IA 1U2DA 4FWBA 4LSMA 1ZOIA 3RC2A 2A30A 1PJLA 3LY8A 4FYWA 4JC0A 1ZK3A 3K0CC 4LS3A 3BBLA 1XV5A 2IKQA 1SNYA 2ATVA 3MJ4A 5CYOA 3RREA 4DHEA 3TR0A