2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
2WIBA 4WW0A 3KXIA 3F8TA 3F5FA 3GFTA 2CNWA 2CEAA 1DAIA 2IL1A 2FFBA 1TUEA 3TGPA 3ECCA 1EFUA 1JR3A 3UWOA 5HZHA 3EPKA 3UWKA 1W48A 4KVGA 3R7WB 4HAZA 4GFDA 2CCJA 1VCIA 2JJ1A 1NG1A 1OF1A 1LNZA 1G7CA 1OFTA 1CR2A 5FPTA 5AJYA 2AR7A 1I2MA 4PZZA 2XAUA 3CM0A 2JASA 3C16C 5B58C 2WSMA 4ZV4A 3K9HA 3EXAA 4A2WA 1F60A 4Q7KA 2CLCX 1JPJA 4PO1A 4W5HA 3KTAA 2P2LA 1E2JA 2VTKA 4JVMA 4OL0A 4RD6A 1GKYA 1Z63A 1US8B 1ZVQA 1UADA 2BMEA 3PIRA 4D0NA 3T35A 3HU2A 5GJCA 1X3SA 4R2IA 4K46A 1XTJA 1WA5A 1C1YA 3ASZA 3IBYA 4TQ9A 4D4KA 2DY1A 2JJ2D 3K09C 4G5GA 4YDHB 4A1FA 4B3CA 2PT7A 2ZYVX 2IYQA 1NNEA 3K0EA 1KI6B 2IUUA 3MMPA 4ZI3A 2V1UA 2IT1A 3CRMA 4QFMA 2YOFA 2A9KA 2ZJBA 3AKYA 3EA0A 2C98A 3WMEA 3PENA 2N1BA 1MV5A 2P3SA 4I1OA 4KBGA 3THYA 1IOZA 2QP9X 4QHSA 2OFOA 3RRMA 5P21A 3U2QA 1SXJC 1XTIA 3LV8A 3R8FA 1XTRA 1EFTA 2ZI9A 4HAVA 3FTQA 1R10A 2BV3A 4MYHA 1Q1EA 2R9VA 4MKFA 3H84A 1S4QA 3T06B 1QG4A 1KY2A 2PLFA 3FKSD 3Q9LA 3OE7A 3QIAA 2QZ4A 3QUSA 1YJ5A 2GA8A 2QUZA 1RJ9B 3IIMA 4XOIA 3CR8A 1SKQA 2WOOA 2ONKA 3NHAA 3AVXA 1T91A 3WRXC 4E22A 3BC1A 2FPKA 1D2EA 2BEKA 1E69A 3SEAA 3TVDA 2ZI3A 4HAWA 3X2SA 1Q1ZA 5JBQA 1EK0A 2Q3MA 4IDNA 1VYUA 3MFYA 5EUQB 2TMKA 3LQRA 2ORWA 3I8XA 2X2EA 2BCGY 1KO5A 1E2HA 3B1WA 3E1SA 4GOJA 5HCNA 3IO5A 1OFHA 3TLXA 5EE9A 4D6PA 1KI9A 2AFIE 2AD5A 4B35A 4Q4HA 5J4KA 1Q21A 4DIEA 3EA5A 1TUIA 1HUQA 1YZGA 4IJMA 1OB5A 1YR9A 4Q48A 3PUVA 5EUMA 4M2LA 3GMTA 2CNWD 4DSOA 3SFVA 1P3JA 1JR3D 2OFWA 2OEPA 3EW9A 1MO4A 4JZKA 5TB5A 2JA1A 3UKDA 2F55A 4RD3A 1HV8A 4MUBA 4LPKA 4TMZA 3WNDA 5G3ZA 4C30A 4DLUA 1Z07A 4GOXA 1WMSA 4CVNA 3C5CA 2JJ1D 3LW7A 3QF4A 3BH6A 2VHJA 3QBVA 4NYJR 1YKSA 5KSYA 2P6UA 1ODFA 1E79A 1U9IA 2QPTA 4LV8B 3B9PA 4Q7JB 3NHBA 3AB3A 5G40A 2QP3A 2V4ZA 3IEUA 4TYPA 2A30A 5F98A 5EP4A 2WMNB 1XD9A 3PQCA 4M9ZA 4CZ2A 1ZMXA 1WQ1R 2HCBA 4PR0A 1DO0A 1D2MA 4Q9KA 3HR8A 4RKFA 3UG6A 3U4QA 1TL7C 4AG6A 1LFDB 4DLZA 2YNMA 4L9SA 2JATA 1YE8A 4EPWA 5CB6A 4H9GA 4HLUA 1KMQA 2ZSEA 3IPYA 3AM1A 1RZ3A 4PX9A 5DE3A 1BMFA 3GQBA 4V03A 3F3YA 3VFDA 3MWLA 1G8GA 4P3YA 1AIPA 3OF5A 4K8OA 4YXWA 4ZKEA 5FH9A 1YVDA 4OJQA 1GDDA 2QTFA 5KPDA 4WA7A 4NPHA 3LD9A 1LW7A 3FHTA 1NBMA 2RGGA 2J7PA 2ANCA 4XTRA 3FMOB 2FFAA 2W0SA 2W2XA 3IHWA 1XJCA 2QM8A 4TMKA 1RC8A 2W58A 3RNLA 8OHMA 3KX2A 2REOA 2YYZA 4QL3A 5BXQC 4NCKA 2YC4C 4JMPA 3BFKA 4N3NA 1IN4A 1XEXB 2K5UA 5EXSA 2YC2C 5F2EA 1KJZA 4IDQA 4V0LA 2WWXA 3I1FA 2LCFA 3SYNA 1DADA 1GIAA 1KDPA 2H5EA 1P2SA 5JHGB 1K6MA 4TQAA 3EC2A 2HEIA 4GBMA 4RKEA 3AVWA 3A1TA 5KUTA 3OE7D 2QY9A 2BHRA 1MO5A 2ZRIA 3QKUA 1KDOA 3LVRE 4M1MA 1ZNYA 2ODWA 2RAPA 1GM5A 4M9SA 2GCOB 1U98A 2WWHA 1TF5A 4GMDA 3T5GA 4URVR 2LKDA 2W6IA 2ZIAA 4RCYA 2ZS8A 3A58B 3B1ZA 3CB4A 4JJKA 2YOHA 3C5HA 4TL7A 1E3MA 3TK1A 4DIDA 4LHZA 2X19A 3MWKA 4UQOA 1G18A 3TW4A 3BWDD 2FEMA 2PZEA 1DAKA 2GCPA 2H18A 1P9RA 5FUXA 3CLVA 3MWJA 1YQTA 3OHMA 4OHVA 3U7FB 2QQ0A 4QC2A 4DCTA 1X6VA 3TUZC 1E9RA 3PUYA 1JECA 2F9LA 2JDIA 2QT1A 2G88A 4A0RA 5FBVB 2IS1A 1TQ6A 2VYFA 4YMSA 5TY0A 3QF4B 1VKJA 2ODBA 1RFLA 1G1MA 3K53A 1TF7A 4MRRA 1A1VA 1IN7A 5H8WA 1S3SA 3OZXA 4EJSB 1Z0KA 4B76A 3CZPA 3QI2A 1R7RA 4YDSA 1P4SA 2IHBA 2J0UB 4IKEA 3KKQA 4OQFA 4QKQA 2IK8A 4TWZA 5JCPA 3MLEA 5L3SB 3AP1A 2E1RA 2W0MA 3CUEF 1VCOA 1E9DA 2ZRJA 4RCZA 4D81A 5J4HA 3VR2A 1QHNA 4AC9A 1XZQA 3U4QB 2HDNB 4IW3B 3CPJB 2IBMA 1E79D 2VP4A 1T4GA 4KYUA 2QA5A 5FBWB 2WKQA 1EWRA 4B3GA 1UDXA 3QKRB 4QGFA 2CJWB 2FFQA 4JS0A 4MGIR 4OHXA 3PUZA 1DPFA 3PXGA 1KI4A 2HUPA 2WWWA 3ZS9A 2IS4A 1NVVQ 2JLVA 3WNBA 3BFXA 5JRZA 2O8EA 4QGAA 3C41J 3TSZA 4Z8YA 4A0GA 4BLOA 3WYGA 1G19A 3TBKA 521PA 1BMFD 1CRQA 4US1R 4TYYA 4A8JB 1OXUA 3A4MA 3VU9A 3CX6A 4TMXA 2ZXUA 3KXLA 4LC1A 2OBLA 1KAGA 4TQUS 4YXWD 1SKYB 3PFIA 1M2OB 3ADKA 2AL7A 3U6BA 2CHQA 2ZREA 1CLUA 2D7CA 2D4HA 3UIEA 2ZRHA 3GFOA 3CBQA 2EU8A 5FPHA 2ZI7A 2IYTA 5CLLA 1MO3A 4IDPA 4V02A 1M7HA 3CW2A 3SFZA 2WZQA 1GL7A 3LXXA 4G1UC 4IVQA 5JFGA 1XJ0A 1ZINA 2ORVA 2JLWA 1ZUHA 1IN5A 1FW6A 1Z8FA 4IOMA 4DSUA 1GRQA 4OQMA 3P20A 1SGWA 1KI3A 1D9XA 2GJAA 3D7MA 3NBFA 5C2JB 4PQFA 1D6JA 1MR3F 1TQDA 1N5KA 3GJ5A 1G3RA 3L0PA 5FOSA 2C95A 1MOZA 1Z22A 4B32A 3BB1A 3RLFA 2C8VA 3AVPA 4WIAA 2D3WA 2NO6A 4PAOA 2WAXA 1JPNA 4CRWB 2J9RA 4BZQA 2W6ID 5EQTA 1JNYA 2OCBA 4V0ME 3CH4B 4HAUA 2VP9A 5A0FA 4GL2A 4IEIA 4URZR 1T0HB 3K1JA 2NOAA 2ZITA 5H70A 2Q21A 1I4DD 2HV8A 1R6BX 3A1VA 4PC3A 2A5JA 3GFPA 4ESHA 2FN4A 3EWAA 1NY5A 2FZLA 2J87A 2V6JA 3B2EA 4QNRA 2JDID 3HPQA 5AUPB 4DBLC 2WMOB 2FH5B 1IM2A 5ANRB 2CL6X 4MDEA 3IDQA 2DWPA 1YR8A 3LFUA 5FUWA 4KVAA 5IHPA 5FOTA 4MRNA 2G1KA 2ODNA 1ZCBA 2OAQ1 4LHVA 4ESVA 3WRYC 1M74A 5JS7A 3HYTA 2HXYA 4XVUA 4B44A 1SVSA 5EE5B 1DAEA 3CRW1 4KO8A 1P75A 1WBBA 2GF0A 3TH5A 3AVTA 2C2HA 3VX3A 4ARZA 4IFEA 1ZM2A 4LJ6A 2CL7X 5FL7A 1ELOA 3W3AA 1ZM7A 4URXR 2B8TA 3VNVA 5EP1A 3LY5A 2REXB 4B3DA 5L3QB 3WY9A 4EPTA 1E0SA 4RZUA 1E4YA 5HE9A 3K0CC 3QY0A 1FFHA 3LW8A 2OAP1 4RFSB 3V4FA 2IXFA 2Z83A 3U60B 2DHRA 1OB2A 4JKYA 4G01B 3AGQA 3ADBA 1E2GA 1Z3IX 2A3RA 4A2PA 2O0JA 2EFDB 3HR7A 4IXMA 2Q9BA 4NMMA 1SKYE 3RRYA 1UAAA 1KI8A 2ERXA 1XF9A 5CIQA 4A9AA 3NVAA 3CNLA 3AUXA 5CYOA 1PUIA 2WVJA 4OI0A 1H8EA 1E2EA 2PMDA 1TMKA 1E2IA 2GESA 3LBHA 5E4FA 1BKDR 2ZE6A 2ZSBA 4HDOB 3SHWA 1W4AA 4QJ5A 2VIIA 2IYSA 3LA6A 4LPSA 2WPDA 1Z29A 4JLOA 1NKTA 4G0NA 3K9NA 5GJBA 1I4LD 4IFBA 4Q21A 5E3HA 1ZU4A 3NC1C 2VRWA 4Q00A 3I72A 3ND8A 3O47A 3Q5EA 3CRRA 4R98A 4A0HA 1E32A 2VSFA 4CIDA 3K0AA 3VHLB 1UKEA 2OE2A 2QRZA 2CE7A 3KQHA 1OH7A 4L8GA 3PJRA 1NIJA 1CR0A 5TDHA 1XPRA 1YR7A 1DEKA 1XDBA 3DOEA 1F2TA 3MJRA 4MGZR 1CJUC 3UK6A 2GXSA 2CCGA 1X86B 1XD2B 2ZYWX 3OESA 2ERYA 2FSIA 4DDTA 1MT0A 5D3MB 4ACBA 1HURA 3ADCA 3NTUA 5J40A 2X77A 1KK2A 2QE7A 4DCUA 5FTMA 2XXAB 1E1RA 5KNCA 2L0XA 3OIVA 2IYLD 4EFLA 2GWHA 1U8YA 1SVIA 1G8HA 1TNDA 5F3WB 4LBWA 4NYIR 1Z0JA 1CF4A 1JJVA 1B0UA 1SVOA 2BJVA 2OG2A 2QMHA 2QSYA 5AUOB 1ESNA 2KB0A 4I1UA 1U0LA 3MJHA 5DISB 4TL9A 3T1OA 2AK2A 1P60A 2R6AA 3A37A 1SXJB 2XOKD 2ZI6A 4URWR 3TJZA 4BZPA 5AJVB 3CF0A 3DDCA 3RS7A 1XD8A 2O0KA 2KBEA 3B1YA 3ZVNA 1KSJA 3AKEA 2BEJA 3W5IA 3D6TB 5HPYB 1SHZA 2O8FB 3IILA 5LPNA 3A4NA 3PEUA 4HB0A 3ZD7A 4A82A 2PJZA 3BGWA 1LF5A 2QTVB 3Q7QA 4A6XA 1OH8A 1OE0A 2A78A 1S2MA 1T3LA 2RGNC 4Q1EA 5FBLB 5GVSA 4NL4H 4FMDF 2Z5FA 2ORIA 1KSFX 1W0JA 2IF0A 4ZI2A 5FL7D 3PUXA 1T8UA 2QSZA 3B78A 1I4TD 2CVFA 4Q4AB 3P4YA 2FWRA 2YKGA 2WWYA 2B6HA 5DN6A 2CVHA 1AZTA 3PEWA 3QXCA 2R6GA 1M1YE 1W36C 5EE0A 1D5CA 3U44B 4UXIA 4OHZA 4RD0A 1E1QA 1A4RA 2MMGA 2P6NA 3KKNA 1ZM4A 3NEYA 4NYMR 2IYWA 5AR1A 1EGAA 1IXSB 1HT1E 2PEYA 4F38A 2H17A 3B9QA 4DDUA 2WTUA 2AD1A 1Z6XA 2VHCA 4CEHA 2PCJA 5C18A 1E98A 3RS3A 3ZZUA 1US8A 1D9ZA 4D2IA 2F1HA 3KJHA 4HLDA 1G8FA 1G21E 2ZR7A 5A5GA 2HJVA 2CBZA 1EG7A 2OO7A 3THXA 3VR5A 4ZDJA 1H8ED 2BMJA 3DVLA 4US0R 2WSSA 2WWFA 1Q1BA 1Z28A 1X1RA 1G6HA 1KI6A 3K0AB 3U3MA 4DXAA 2BDTA 2WPDD 2ZROA 4NP6A 3EC1A 1F48A 2WM9B 1QVRA 2XNDD 2J59A 5EZ6B 5EXTA 2OZEA 1Q57A 2RGEA 3BXZA 3OFNA 4CGZA 3ZS8A 4DC9A 1U0HC 5A4JA 1N6IA 4GI7A 5H1YA 3Q7PA 1E9AA 4P31A 2QBYB 1G16A 1J8MF 5KPJA 1Z06A 4PAMA 2W2VA 1QBKC 2J0QA 2ZJZA 4G5QA 4YQFA 4J0QA 1D8TA 2NO1A 1ZCAA 3NWJA 2EWVA 5JJIA 4D0LB 4F93B 4AI6A 4LZZA 1KZ7B 4OK6A 4S35A 1AS2A 5FTLA 3W90A 2A5DA 3P26A 4C0BA 1SQ5A 3SJAA 1RJ9A 1G17A 4DLTA 1Q12A 2IUSA 3DZDA 3KUCA 2G9NA 2QE7D 2EW1A 1E1RD 2KJQA 3QOFA 4JLKA 2OHFA 2Q9AA 2ZEJA 2BVNA 1H8HA 3KFXA 4RJLA 3J81k 3PCRB 2P6RA 2XZPA 2BMFA 4HEJA 4L9WA 3SBEA 4X8HA 4ITRC 4D4JA 1FQKA 4HUQA 4O25A 5JHHB 4A92A 1IN6A 4ILEA 4BQSA 1E96A 1P2UA 5KSOA 2BMDA 4ASUA 2ZJ5A 2ZS9A 1SXJE 1JALA 2CXXA 4DCNA 1II0A 4PC1A 2BM1A 5FOVA 3TQCA 3TR5A 2FMXA 3DM5A 1WRBA 4OHYA 3CF6R 2FEOA 1IJFA 2BJWA 1N6KA 4M8NE 1G64A 4LI0A 2XNSA 4Q7LA 4DRZA 4CT4B 2C78A 3ZVLA 1U81A 2JGNA 2YWGA 1MABB 3N2EA 3B85A 1YZUA 4DB4A 3IPXA 1W0JD 4QBFA 2AWNA 2IXEA 2GVDC 5CK5A 4P4SB 1TTTA 3TUJC 1FMJA 1TADA 3IO3A 1X8JA 5FPKA 3SBDA 3UPUA 4NBSA 5DN6D 4EPVA 3H4MA 3BRWD 4DZZA 4CEHB 1IXZA 2UVQA 4EPXA 4FD2A 2HT1A 3KQKA 2REBA 5FI0B 1G4UR 1NP6A 2ZUBA 4IDOA 1E1QD 2BC9A 4QXAA 2H1LA 1R8SA 2ZRPA 1YRAA 4LYFA 4TLAA 2ZS7A 4EPYA 3THXB 5GADl 1SHKA 3QPVA 1N0UA 3EWSA 1XCPA 1UKVY 3THOA 1KOFA 1OYYA 2OILA 3CZQA 4OYHA 1T3HA 5JMTA 2FA9A 4C7OB 2H92A 4JLPA 5SZKB 3FE2A 4IEEA 5FPYA 3I62A 2NO7A 1OIVA 2WSSD 2EYQA 1CU1A 1JXOA 1FZQA 2H16A 1NL3A 3UMSA 1N5JA 4M1KA 1CKEA 4TLBA 1UBFA 2ZVPX 4AIIA 1C9KA 5EP2A 4EFMA 4M4SA 3EPLA 2GAOA 3OFND 4LJ5A 1N5LA 2FX3A 4DLRA 3BJIC 3AKCA 4I1VA 4I4LA 2A5GA 4PC6A 4OQLA 5JEEA 4BLRA 1LTQA 4JKIA 2ANBA 1LF0A 1XEXA 3KFVA 4Q4JB 4PQRA 1OH5A 2FPMA 3EIEA 2AKAB 3H1TA 1N2CE 2RGXA 1QDEA 2R62A 4B74A 3VKHA 2EQBA 3NXSA 2DR3A 4BFSA 1R5OA 2BCJQ 3JZMA 2D74A 4A2QA 5G41A 1KKLA 3W8RA 2AK3A 2C96A 2GCOA 2ZE7A 4O0MA 1YHNA 1IY2A 4HUQB 4Z51A 5CDFE 2QROA 3U3RA 2JLUA 4P32A 1BYIA 2YHSA 3TRFA 4V0MA 2WHXA 1H8HD 1FNMA 3C4JA 1S3GA 4KHZA 3EZ7A 2FSGA 4ZO4A 5TARA 3CO5A 1JEDA 4LJ9A 3GJ4A 3LX5A 2Y8EA 2RGBA 5FTKA 4PHHA 4CEJA 1E94E 4DDWA 3KQUA 3FFBA 2A5YB 4QJ3A 1G6OA 1XJQA 2F9MA 4ASUD 4EAQA 3TVTA 4DB2A 3SOPA 4ZPXA 4XVRA 4Q1AA 4KSCA 1E2QA 1NG9A 4P0TA 2VH5R 4JL6A 2GBLA 3K70C 4OBEA 3QPWA 1TEXA 4Q9JA 1XZPA 4FN5A 1XTKA 2ZI5A 4EJSA 1Q44A 3FMIA 3QNUA 4Q19A 1WB9A 1VYVA 1Y63A 4BEJA 2J0UA 2QEQA 3HYRA 4TLDA 3O8CA 4YMUA 2MMCA 5AK0A 1M8PA 5L3SA 2KBFA 1RE0A 2B7BA 1W2HA 3ZZTA 3FWYA 1GITA 3W5JA 3QPUA 4GSYA 2VQSA 5B30A 2XTMA 3KKOA 4CYMA 1G5TA 1Z6GA 2G0TA 2J41A 4KFRA 3T61A 2HLDA 2WWIA 1L7VC 1FL9A 1PZNA 4BWYA 4Y0AA 2KWIA 3QKRA 3PR1A 2CJWA 3WYFA 1TQ2A 5FUVA 5BN3A 1KI7A 2D2EA 3OIWA 4LJ7A 2FSHA 2PZFA 4M22A 2GXQA 1E2LA 3IGFA 1OXSC 2VF7A 3PEYA 1IHUA 1ZD1A 3H86A 1IONA 1XPOA 4Q02A 4A8JA 4HZIA 2NPFA 3EARA 3LDAA 1TU3A 2NO0A 4L4UA 1CXZA 1PLLA 4PHFA 3TR0A 2OCYC 1U8AA 5LBIA 4QHTA 4Q18A 2QT0A 2PT5A 1XEWX 1KK0A 1OLOA 1RYFA 1YU9A 2FOLA 5HCIA 2VSOA 4E09A 1VG9B 3GLIB 1LS1A 2JLRA 4JSTA 4KI0A 1XMJA 2GXUA 1XWIA 3UXMA 2VSXA 4F7WA 2VLIA 3ETLA 1ZUIA 1JI0A 2HT6A 4HZUB 5L8VA 2PLRA 1XCMA 1OIWA 4FXPA 2BWJA 2F7SA 1BYUA 2FZ4A 3D8BA 4V0OA 4AKIA 4NHOA 3ZGXA 1VMAA 4NTZA 3T34A 2XB4A 3I5XA 3GEIA 1PUJA 4HUTA 4M53A 2NIPA 4R9UC 2PJRA 2FG5A 3QEJA 3T15A 2D62A 1UKYA 4DEYA 3A4LA 2ZJ2A 3T1TA 2WBLC 4CEJB 5IDVA 2YINC 1FX0A 1YZNA 3WP1B 2B8WA 5DNYB 2DYKA 1NN0A 1W47A 3UANA 1YRBA 1VIYA 3HU3A 3VHXA 2V55B 1J70A 2GAAA 3QKSB 3KQLA 3IKJA 1R4AA 1KJYA 1GKUB 4PSKA 4GP6A 1KI1A 4KYIB 1II8B 3AP3A 1E2FA 3QEOA 1R5NA 3E5HA 4B75A 4WVFA 4HATA 3U3KA 1CJTC 2MSCB 1HA3A 3WHKA 4E5UA 3SJBA 3KZ1E 3G82C 2E87A 1ZIOA 1ZNWA 3B1XA 5KDLA 1R2QA 3O8DA 3LVQE 4HI0E 4ERNA 1B23P 4JLAA 1DG1G 4F91B 2ZPTX 1IBRA 2V8OA 4JVSB 2BIFA 3K0SA 4KBFA 4AD8A 4TMVA 2G83A 3A1UA 5L3VA 4AYXA 2FNAA 3EASA 1RW4A 2ZUDA 1F6BA 5AWFC 4KFTA 2QG6A 5DI3B 1G3QA 3RANA 1TPZA 3LH5A 2IXGA 5M04A 2PEZA 1I2DA 1ANKA 2VF8A 3B7GA 1X8LA 4A4DA 3CNNA 4BFYA 1OPXA 1XFAA 1NF3A 2ZRGA 2O5VA 4MKGA 3DZ8A 4WXRA 4B3XA 2G77B 1XMSA 1OHHA 2GJ9A 2OBNA 2J46A 5J4LA 4FMCB 5L3QA 4Z54A 2SHKA 4U02A 5C46F 3AVQA 3R9XA 4RVCA 5AUNB 4KV9A 4C0AC 5TXGA 1Z0IA 4RFSA 1QRAA 3K8YA 1NBMD 1V5WA 4TLEA 4MH0R 2I4IA 5B64A 2NZJA 2J7PD 5DHFA 2H57A 3KXKA 4IXNA 4KLZA 5FBQB 3K9GA 1Q20A 3QKTA 1QHHB 3NIBA 4PSVA 5DYGA 5BQ5A 4EQ6B 1XEWY 2X2FA 4C0HA 1T3SA 1AJEA 2ZI4A 3EPJA 1F3OA 2X1VA 1OKKA 4M1OA 4XWAA 6Q21A 3GLFB 4BFXA 1NVUQ 3C7KA 1U0JA 1P5ZB 5K8TA 4RSGA 2GRJA 4LV6A 3GJXC 1R0YA 2CL0X 1XMIA 3AUYA 2QAJA 1G8PA 1KI2A 4JYCA 2IYXA 2QI9C 2QNRA 4Q9LA 3CX8A 3IIKA 3GLIE 4LYHA 1E6CA 4LV5B 4OKSA 5DHAA 4C9BA 5DSZA 5JLJA 2UZIR 1M34E 5IRCD 3A8TA 4IRUB 1E2DA 3CIOA 4ACAA 2OV2A 3L0OA 1X1SA 4TTRA 4DDVA 3BH7A 1FX0B 1IXRC 4Q1FA 4KJZA 5AJZA 2FF7A 1T8TA 2GJ8A 2DWOA 3KKMA 1HEIA 2ZRAA 3U6KA 4XD7A 4UKDA 4XIGS 1G5PA 2DFNA 3RSOA 1W36B 2OBMA 2RH5A 1G5RA 3AVYA 1JB1A 1JAIA 1AGPA 3EAQA 1E9SA 2ZR0A 2GVZC 3BD9A 1GRRA 4HDCA 4TL6A 1ZBDA 4MRSA 2O8CB 3U5ZB 3EG5A 3FDIA 1GTVA 4Q5IA 4B47A 1CR1A 4IVRA 1W1WA 1XD2A 4RZ2A 2IYYA 4A6PA 2R8RA 4QG7A 3GEHA 5D3MA 1GNRA 3THWA 2B92A 3ONWA 4PPGA 5J5CA 1KSGA 3K09A 2XXAA 3OEEA 2ZRMA 3UATA 3RRZA 2BOVA 2FGKA 2AHOA 4PTLA 2Q3HA 1VPLA 3TUIC 3LLUA 3LX8A 5KNDA 2ZR9A 2ZJYA 5B57C 3QE0A 3AH8A 1DARA 5CK4A 3MD0A 1MH1A 1ZW6A 2ODEA 1QHXA 1ZJ6A 2EFEB 2IC5A 4JBXA 1BOFA 1FNNA 3MGCA 4IVPA 4MA4A 1KO1A 1ESMA 3TAUA 3KB1A 3VR4A 3DO6A 1SXJA 3G5UA 4TYQA 2QP4A 2P65A 4DLSA 2O8BB 1A7JA 4UNQA 4URYR 1U2RA 3TKLA 1N25A 2P67A 1X8KA 4YMWA 2VP6A 4C2UA 4B34A 1RYHA 4TT3A 2CDNA 2CMKA 4D4LA 2QAGC 2G6BA 1G7TA 4NE2A 5FOUA 3VAAA 4GDFA 4X8LA 4LJYA 2R6FA 2O8FA 1DAHA 3V4RA 4M1SA 1T6NA 1CP2A 2XEXA 4QBHA 1W49A 2R65A 3VX4A 1LV7A 2QPOA 3RSLA 5DH9A 4GOKA 5BWMA 1FOEB 4PO8A 3DKPA 4HAXA 5DIFA 3MRSA 3RS4A 4C2TA 3IEVA 4BFUA 4F4CA 2QGNA 4US2R 1NY6A 1UFQA 3N5CA 1GFIA 4PANA 3VKWA 4Q4AA 1HQYE 5FTJA 4EIWA 2ZRCA 3AF0A 3FKQA 4B71A 1OFIA 4E07A 2OESA 4KCGA 2V7QA 1E2KA 5CIWA 3U44A 5FUYA 5DYIA 3UMFA 4KLNA 2GHIA 4AYWA 3U7EB 3LXRA 3GLHB 3MUFA 4TYNA 1E2NA 4OQXA 1Q1QA 5FI1B 5C1BA 1OKKD 4LYAA 4MITA 1XU4A 1E0KA 5SZIA 4B3FX 1O3YA 1LY1A 3QG1A 1E2PA 3M4YA 3IQXA 4C4PA 3GLFE 1AQYA 2CE2X 3EX7C 1HT2E 2HJGA 1TQ4A 5EXPA 4DSTA 4C0SA 1GG2A 5JRJA 1VG8A 2JLSA 3G0HA 3RWOA 3Q8XB 1VG0B 1G4AE 1OT3A 2J1LA 3C14C 1ZIPA 3QG5A 1SVMA 1OYWA 3I61A 2DB3A 3A6PC 4HSEA 2ZRFA 4HB3A 5DGXA 3T12A 1GVNB 1A2KC 3NG1A 4FW9A 1U9IC 3AF1A 2QBYA 1IJEA 4FIDA 2XTNA 1IN8A 3KJEA 1PVOA 3VMFA 1FTNA 1W44A 4XD7D 3CR7A 1W0KA 4YMTA 1NMYA 3NH9A 2C5LA 3RS0A 4PHGA 3V00A 3FMFA 1QF9A 4UJ5A 2ZRBA 3THWB 2J0SA 3LAWA 4H1UA 3HPRA 4WZ6A 2FSFA 1AZSC 4F4JA 4QNMA 1EX6A 2BBOA 3VNUA 1ZD9A 1BO6A 721PA 5FTNA 3L2OB 3DPUA 4HLUC 3SQXA 4MYCA 2J3EA 1UKZA 3AP2A 3GEEA 5CDFA 4M9QA 5CM9C 2ZM5A 1UEJA 1L2TA 4PXAA 2ZTSA 1N0VC 3OEED 1XX6A 2ZSAA 1QZXA 4LOAA 3QXXA 1S9HA 2IX3A 1TX4B 2A7QA 1XTSA 4GPTA 4IDHA 2ZRLA 4XWOA 5AJXA 1QHGA 3IHLA 4ZKDA 3IUYA 2FDCA 2VP5A 2VPPA 1CJKC 1VDZA 2GNOA 4JLJA 4OI2A 4A0FA 1SXJD 2IF2A 2R44A 3BOSA 2OM2A 4TN1A 1HE8B 5JJKA 2GK7A 2ONJA 2HCJB 2GZAA 4A15A 4TT3D 5L3RA 1R5BA 1YZQA 3OEHA 4GZMA 3RRNA 2KSQA 3NDPA 4CT5A 5J4VA 2NMVA 1W5SA 1S1MA 1ZC4A 1E0AA 1T5LA 1HYQA 5CM8B 4JVLA 3PEVA 1SVWA 3LQQA 1KIMA 4LY6A 4LK2A 2JLYA 4LC0A 1MABA 1J7KA 1OJLA 4DCVA 1N6HA 4OI1A 3LLMA 1PLKA 2F1JA 2WJIA 5LB2A 4P4SA 2QMEA 1DOAA 3QSYA 1P61B 4LCBA 5JI3E 3VKGA 3ND9A 3SR0A 4CDGA 2V7QD 1IAQA 4QOSA 4RD1A 1HY3A 3BB4A 4B33A 2V3CC 4QGHA 3TAHA 1DBSA 2DFKB 1KO4A 3FYHA 1DO2A 3NC0C 4D26A 1OFUX 3CRVA 2AWOA 3PV0A 2O8DB 3GLHE 4LBVA 4JT2A 3DKVA 3EPHA 3W6OA 2GK6A 3K70B 5E7MA 4C7OA 4PAQA 2AFHE 1KZGB 1DG3A 1VG1A 2N46A 4DLYA 3REFA 4URUR 4WOPA 3SS8A 3WXMA 4QHYA 5IF9A 3T5DA 1GUAA 3EZ2A 2AXPA 2D7DA 3PUWA 3NBYC 1P7CA 1GILA 1ZRHA 3RAPR 4JLMA 4AKHA 4DT1A 1RRPA 2LKCA 3K9LA 4C0KA 1OSNA 1Q3HA 1UPTA 4C0LA 1JEEA 1FMLA 4EUNA 4UNPA 2IYUA 4Q9IA 1W0KD 3U7HB 3GJ6A 3GCGA 3TIFA 3NKVA 4M1TA 5KSZA 4Q4JA 1KY3A 3ZDQA 2XJ9A 2VBCA 4ON9A 4ZCIA 3TNFA 3U7GA 3S1AB 1S9DA 3FOZA 3KJIA 4IHQA 1FPMA 3CWQA 2XB2A 5KU1A 5KNBA 1QHIA 3ZVMA 3DMNA 3EIQA 4TMTA 3ICQB 5LB4A 4BFTA 2F6RA 3QVUA 2PMKA 3LBNA 1N6RA 2C99A 3FB4A 4PSAA 1GNPA 3P4XA 4ABYA 2CLSA 3L0IB 4DVGA 1GRNA 2EYUA 3T1QA 2ATXA 1EFCA 4B3BA 3VTKA 2BKEA 1XXHB 1EX7A 1A2BA 5AJWA 1R0XA 4UXHA 2OXCA 4IOJA 5E7JA 2JLQA 3RS5A 4MQBA 1TEVA 5KDDA 4II7A 4W7SA 1FP6A 3GLGE 2OLJA 3SYLA 3QXSA 3L8YA 4PPFA 4AY2A 4HAYA 4XSGA 4ZCLA 2W2TA 5HTKA 2G3YA 4KFUA 4BFZA 2IS2A 4EPRA 4YLGA 3SNHA 3OEHD 2I1QA 3V9PA 2O0HA 2JCSA 1JJ7A 3Q5DA 1N3BA 4D80A 4B73A 2CK3A 3RYTC 4U7DA 1E9BA 3K0FB 1AK2A 4HYYA 4NCNA 4Q1DA 4AURA 3HWSA 5BW8A 3EZFA 4QGGA 1OXTA 3QBTA 2O52A 3KB2A 2DBYA 2BBWA 2J5XA 5K8IA 4F92B 2HXSA 4LHXA 1LVGA 4NCIA 3A36A 5F9HA 2W83A 3M6AA 3CPEA 2ZRDA 4KITB 2DPXA 1MRSA 5EXXA 4FCVA 2E9SA 5JSZB 2IYZA 4AG5A 3I5YA 2QL6A 1DAFA 5KSPA 1KNXA 4OHWA 1DAGA 3P1JA 2GJKA 4MUAA 2ZRKA 4UNSA 3SI7A 421PA 4BLTA 4FWIB 3F0TA 1NVVR 1YZLA 3ZYCA 3B6EA 4DT1B 4UJ3A 3PITA 4WZBE 4TYWA 1KSHA 2WAYA 4OJKA 3UG7A 1G9XA 1NMZA 4LYJA 4TLCA 4WZAE 4XTCS 1JBKA 2QORA 1N6PA 4GZLA 2ZVQX 2ZU0C 4RD2A 4AK9A 1QVAA 1Z08A 5JWRA 4MKIA 4JLVA 3GLIA 3KDSE 3B60A 1AS3A 5LDDC 1FUKA 1QHYA 2HF9A 4NYIQ 1G3MA 4KSBA 1AKYA 3R9IA 1AA9A 4HZUA 4LWZA 4DLXA 3R9WA 2XITA 2KE5A 2ZRNA 1RRGA 1Z0DA 2F43B 4OI4A 1KJWA 2QAGA 1RPZA 4ZIRA 2GJSA 2FGJA 2WV9A 3TSOA 2IEZA 1FQJA 3SZRA 2JLZA 4HB4A 1P6XA 1BS1A 1R0ZA 3HDTA 1N6LA 5DI9A 1F2UA 2IWRA 4P33A 2RGAA 3L82B 1E4VA 4CF7A 4DWJA 3K0CA 3W3ZB 4G3XA 2HF8A 3Q3JB 2ZJ8A 2GTPA 2X8AA 3WBKA 2C9CA 3RC3A 3CRQA 4TMWA 1J99A 4I1SA 1ZM3A 3WP0A 4A36A 3DEFA 1Z0FA 3W6PA 1IY0A 1L4YA 1R8QA 3CNOA 3OIYA 1KAOA 3P32A 1Q0UA 4NU0A 1SVLA 2VO1A 1MRNA 3QKSA 2EFHB 1XTQA 4TZ0A 1M7BA 1NKSA 1II8A 1P73A 2Q6TA 4FINA 5G3YA 3IQWA 1S0UA 2WJVA 1XXHE 2EVWX 3BS4A 5IK2A 1TF2A 4LBYA 3KJGA 4N1AA 4G5OA 2EWWA 5JS8A 3AVVA 2OLKA 1OXVA 2WWGA 3RWMB 2ZAMA 4DCSA 1CJVC 3SU8A 5CJ2A 1KGDA 2VHQA 4NYMQ 3FGNA 3N2IA 1DS6A 3NDBB 2XX3A 4RD4A 3MAAC 1P9NA 4POAA 4YC7A 4LHYA 1IY1A 4BE7B 4QRHA 5LD2C 3D31A 3AF2A 4JBYA 4M1YA 4G5SA 4I81A 4RFVA 2CK3D 2WIAA 4O3MA 1CIPA 1KO8A 4JLNA 3KTAB 4UXJA 3SJZA 3PG5A 4M9XA 3HJNA 5EE3A 1QG2A 1U99A 3PVSA 1VTKA 3GJ8A 4JSYA 5DI3A 1WBDA 2RHDA 2H7VA 3IBGA 1CULC 1VHLA 1WXQA 1DTSA 2NTYC 1ONBA 1RVDA 4JJZA 5KO2A 1A5TA 1RIFA 4PFSA 1KYIA 2ZJOA 1BH2A 3VQTA 1ZM9A 4C0JA 4Q47A 4X8MA 5DO9A 3FVQA 1EFRA 2NZ8A 2ZETA 4X8OA 5J4YA 4NKRA 3LRPA 3H0KA 1XEFA 2W6JA 1ZP6A 3HP1A 3THYB 3U61B 3GJ3A 1YZTA 4XJXA 3SC3A 2FPLA 4B2LA 2KI5A 3EZ6A 4M21A 4EQ6A 2C03A 1QHHA 4XVQA 1U8ZA 1ZU5A 1K5GA 1HE1C 1GL9B 3GLFA 2D2FA 3U3OA 4JLDA 2QAGB 2OXRA 3AF4A 3KL4A 1XB2A 4ZIRB 2FU5C 2ZU6A 4KFSA 2HYIC 3KUDA 4ZDKA 5TVKA 1WDTA 4E03A 4PZLA 3QQ5A 3T1VA 1NLFA 1F2UB 2XGJA 2RGNA 4LUCA 3I4LA 3ADDA 4JL5A 4BFWA 1PJRA 3AGPA 2QPAA 1P9WA 5CLQA 2XJ4A 3M1IA 2WJHA 4UNNA 1NRJB 4B43A 5KOYA 2G1JA 3RS2A 5HZKA 5UKDA 2WJGA 3B1VA 4JBWA 2YJTD 5GJWC 1CEEA 3CPHA 1K8RA 1L4UA 3A1SA 2JJ8A 2PX0A 1AM4D 3ZZ0A 5TMPA 1VIAA 3JVVA 4KU4A 5CJPA 1NVWQ 4B2PA 3OIUA 3BE4A 2MSDB 3REGA 4XSHA 4WXPA 1GL6A 3ZH9B 1D2NA 2Z4RA 4AKGA 3QJYA 4Q4HB 1T5IA 2O8CA 3W9YA 1AS0A 2ZE5A 2GCNA 3TE6A 3W6NA 1UEIA 1GSIA 3O8RA 1G7SA 5JWHA 1GNQA 4PC7A 3U3JA 3VR3A 2JLXA 821PA 1XPUA 1T9HA 2OUKA 2P5SA 2XTZA 4ZCMA 4W9MC 4DKXA 5IK2D 2FV8A 1GZSA 1CTQA 4PPQA 5FPSA 3LO5A 3ZIAA 1JR3E 2CLDX 4Q1CA 2Q0HA 3D3QA 4Q66C 5FBRB 1U94A 4B6EA 1HQCA 3Q85A 2C77A 1CR4A 2ZYTX 2XZOA 4L5BA 3TSWA 3NH6A 1ZNXA 3TW8B 2B21A 4BEBA 3AVOA 4AYTA 5KYKA 4FMBB 4QBGB 4BGDA 3QF7A 1NJFA 4C3ZA 4FMCF 3GJ0A 1IQPA 2HLDD 2B7CA 4EFNA 3B13B 2O8BA 3A1WA 2VP0A 1OH6A 1J8YF 3I73A 4U00A 2A5FA 4MGYR 2JIZA 1COWA 4MYTA 1W2GA 3FFAA 1RKBA 1SULA 2N42A 1VCMA 3X1WA 2OCPA 5CYPA 1A82A 3CWZA 1W4RA 621PA 1EESA 2WJYA 1N5IA 1EFHA 3P27A 3C8UA 3QXHA 4LBZA 1NI3A 1E99A 5EZ5A 1E0JA 4W5JA 1LS6A 1EFRD 1GKIA 4V0NA 1CBUA 3DHWC 2W6JD 1NLZA 1N6NA 1MKYA 3BBPA 4B2IA 3MCAA 1G3IA 2GILA 4HLQB 3ZLJA 3BORA 2PX3A 4P4UA 1NSFA 2QQEA 1G20E 2GEDA 4N0EA 3GLHA 4OK5A 4B6FA 2W00A 3DM9B 3SE0A 2DFLA 2P0EA 4BLPA 5JCZA 1LB1B 3ASYA 2OFXA 4DLVA 2VL7A 3BERA 1JR6A 5JEDA 5HKKA 1HTWA 1NVXQ 5FR1A 5GJVC 4LHWA 3GP8A 4D82A 1PV4A 4NDZA 5HE8A 4LGMA 2PL3A 3L0SA 1ZD8A 2C9YA 2WOJA 4AKEA 4Z1MA 1JQLB 4Q7MB 3ZQJA 4NZYA 2ZANA 2IW3A 5EE1A 2LWIA 2IEYA 4G5RA 3GJ7A 3SDZA 2NO9A 4R71A 1G7RA 4ZDWA 4TZ6A 4BRWA 2V1XA 4CW7A 1UBCA 1UJ2A 1GAJA 2BKUA 3AF3A 4MYUA 4RZ3A 2GZHA 3ZD6A 3N70A 3MG9A 4Q1BA 4GMXA 4O2RA 2PBRA 2GDJA 1W36D 2F3TA 1KMHA 3LWNA 3X1XA 4NYJQ 4UNRA 2QTHA 1E9EA 5G53C 3E2IA 4DJTA 1P2TA 1S96A 1XNJA 4JYBA 4OK3A 1W4BA 3W34A 2Q3FA 4YMVA 2ASEA 5FR2A 1DAMA 2D06A 5FOWA 3R20A 4DLWA 1KKMA 3L43A 1OV4A 1L8QA 1KO7A 2P5TB 2GF9A 1ETUA 2AXNA 2BBTA 1II9A 1E9CA 2AN9A 1WF3A 2DCUA 2ZAOA 1Z5ZA 1N6OA 2J7KA 1ZAKA 2FFHA 1M6NA 2QN6A 2ZSDA 3AEZA 2BM0A 2IYRA 4HB2A 3I92A 3ZIAD 5E95A 3ZQ6A 1JQJC 1W4CA 4MKHA 4BUJA 5JECA 3ICEA 5BN4A 2CHGA 2PCLA 2QMUA 2Z0MA 2GKSA 1PLJA 1VCNA 2RKOA 5EP3A 3WMFA 3BH0A 2NPIA 2Z43A 2OCAA 5IT5A 2VEDA 4IOLA 2XOKA 3GLGA 5JZVA 2WICA 2RB4A 4LJ8A 3B5JA 2OT3B 3WMGA 4GT1A 5DLQC 4DHEA 2PH1A 2F3RA 1DE0A 4W5WA 3BB3A 1Z83A 1F5NA 4PPNA 5SZJA 1QHSA 3QENA 2V54A 1ZYUA 2O8EB 2IS6A 1KTVA 2JIZD 1KK1A 5F9FA 1DVRA 1COWD 5BN5A 5J47A 4CEIA 4JL8A 1P72A 1NN1A 2V6IA 3ZVRA 2C04A 1OHHD 2GZDA 2GEVA 3TMKA 1Z6YA 1W5TA 3DOFA 3CX7A 3VU9B 1SZPA 3I8SA 4D4MA 4JVNA 1GWNA 3MSXA 5BYJA 5HR5A 1NN5A 1XP8A 1G3UA 1KNQA 4BZXA 4HDQB 4JIMA 4B48A 1XMVA 1W7AA 4LX0A 4PC2A 4QM6A 1CRPA 1R0WA 2QM7A 1NBME 4D25A 2C9OA 4RZXA 4FWTA 2GETA 3UMRA 5KDOA 4XH9B 1OIXA 1XBTA 4MRVA 2J45A 5JI2E 1UBEA 4O2LA 5C4MA 3AQ4A 3I32A 3EIHA 3W8NA 3TQFA 3WBJA 5K8UA 2O8DA 1FP7A 1UM8A 4LSGA 3ZJYA 1WE2A 2EFCB 3M0EA 4Y0VA 2GBLC 5HKKD 4FI3C 2QGZA 2NGRA 3Q72A 4EJSC 2DFTA 1J2JA 2ECKA 4Z1MD 3KKPA 4XWKA 1TU4A 3RVBA 2XNDA 2RGCA 2IYVA 3QVVA 5FOXA 1KMHB 3QXJA 1WCV1 4TL8A 3VR6A 5ELXA 2F1RA 2YOGA 1Y3AA 4H1VA 4NCHA 3VR1A 1GOTA 2BBSA 2DWQA 121PA 4PZYA 1CJMA 4KXFB 5H68A 2RMKA 1WP9A 3CF2A 3WHLA 2G0NA 2ZSFA 2MSEB 5B2ZA 3X1YA 2VA8A 4RY2A 1Z2CA 2EFGA 1AN0A 3NEJA 4YONB 5FL3A 2FJUA 2UZ3A 3B8HA 2QU8A 2H8KA 2YWEA 3JVUA 4TSFA 3KQNA 3S1AA 4ZDIA 1VECA 1U90A 2IHYA 2R6DA 2R6CA 2WKPA 4LDJA 4EDHA 2AX4A 4Q4LA 2CHVA 3HU1A 1FUUA 2J0VA 3SN6A 1ZUNB 4Q9HA 4A8JC 4DUGA 3EZ9A 1EWQA 2I1VB 1G8YA 3DL0A 3GLGB 4K81B 3GPLA 2XSZA 2ZQ5A 2XZLA 4GRAA 1DELA 4BASA 4JLBA 5JJLA 2A2ZA 3OAAA 1J90A 4QM7A 3R8CA 1NLYA 2UKDA 4D0GA 1XXHA 1CS4C 1Z6TA 4L16A 1GP2A 1AKEA 2ZE8A 3LBIA 4CEIB 4GNKA 1OW3B 3I3SR 5TV2A 4BFVA 2YWHA 3AV0B 3O8BA 4ARZB 2ZYUX 2AKYA 1NN3A 2YV5A 3CONA 1S8FA 5BYKA 2YZ2A 1VHTA 1ZNZA 3JZAA 3NBZC 1Z47A 1Q22A 3B82A 4KODA 2IWHA 2WKRA 1P2VA 3E70C 4NCJA 3RC8A 4M1WA 4PO9A 3IIJA 2I3BA 3R7WA 1UF9A 2GEUA 4QBIA 2JEOA 4IOKA 4AWXA 2FE4A 2HYDA 4NH0A 3RABA 1JAHA 4BPBA 4FCTA 3FMPB 2Z6VA 2NG1A 2RCNA 3K0FA 2Q9CA 4PQYA 1K5DA 5FFMA 3BFVA 4WAUA 1FTSA 5SZHB 2IUTA 3GD7A 3SHFA 2F1IA 1V43A 5JWOA 2VHTA 4BLSA 4C0QC 1KHTA 1EXMA 1AGRA 4FMDB 1Z6AA 2YWFA 1KDTA 4JT4A 2QMOA 5AUQA 5GVRA 4L15A 4MGKR 2JJ2A 2PZGA 1W46A 3BIFA 5CITA 4TTQA 2RHMA 4DSNA 3SQWA 3X1DA 1YZKA 4TTPA 4OQNA 1G41A 5CB8A 4Z8XA 2NQ2C 5JSZA 1N0WA 2QENA 1Z0AA 2ZJAA 3FPAA 3RHFA 1UBGA 3K70D 4Q03A 4LRWA 4MRPA 3CH5A 2Z4SA 221PA 2ATVA 1E2MA 1H65A 3AKDA 3LNCA 3MWYW 4HLCA 5LD2B 1OXXK 3SJCA 4GP7A 1NJGA 1UDWA 1KDRA 4R7ZA 4Q01A 5EJEA 4BECA 2QRNA 4P4TA 3FHOA 1AQUA 2R2AA 2WJJA 3RDPA 4I99A 3WNCA 3AVUA 2OSBA 3FKSA 4DEXA 1JXMA 4NONA 1F2TB 1YR6A 4N0DA 5D3QA 2GXAA 3BK7A 1ZC3A 3L8ZA 1BIFA 2V9PA 4KAXA 4PHTA 2IA5A 3BAFA 4S2EA 4R2HA 1E9FA 1NMXA 2F43A 1S1CA 3FHCB 1T0JB 2RGDA 2ZUCA 4F4IA 3NBXX 4LJAA 1HH4A 4M0LA 4TSFD 3X1ZA 1MO6A 2CCKA 4EKDA 1KK3A 1VYTA 2JAQA 1O87A 2YVUA 1XCGB 3H2YA 3WYAA 4BLQA 4MDFA 4LJ4A 4V0KA 2VP2A 1RRCA 4U5XA 1M7GA 4WBSA 4BRUA 1Z2AA 3CKLA 5KHOC 1NIPA 1NSTA 4DUGD 5C4GB 1C4OA 1G291 5E7IA 1XRJA 1Q3TA 3SYKA 2VHUA 5KTYA 1P62B 2XSZD 4QJ4A 5K8LA 1TAGA 3C15C 3DMDA 1RRFA 1SVKA 4FCWA 3OAAD
chains in the Genus database with same CATH superfamily
4LEIA 3SY8A 1ZSVA 2UV8A 3F5FA 1U02A 1WV0A 3GFTA 3KXIA 4ITUA 2CNWA 4YRKA 2CEAA 2AEFA 4QU5A 5GPBA 1L7NA 1Q3KA 3DOHA 3HKCA 1Q7EA 5ALTA 3UWOA 2BUAA 3NVDA 4KV7A 4ENRA 3QGMA 4DUYB 4HPXB 4KVGA 1UT6A 5DTJA 3MHTA 1OWPA 2HHLA 1ENPA 3A6HA 4HAZA 2CCJA 4MYRA 2DTEA 1VCIA 2JJ1A 2Q6IA 4AMYA 4EUKA 3T7SA 1CVLA 1CR2A 2ZB4A 3EMBA 4W1QA 4QIHA 7AT1A 3JW8A 1EVLA 3EYAA 5LWQA 1NP3A 2AR7A 1QH0A 5ALNA 4FB4A 4DQ0A 4HRXA 3PEFA 4WKOA 3LT5A 3DZJA 3ITDA 4KLCA 5TQJA 2DRIA 3TB6A 2V3WA 4BL5A 5B58C 3FYSA 1XZ8A 1GT6A 3K9HA 1UK7A 1O08A 1JH8A 1L8XA 3NHRA 1F60A 2EX1A 4JJIA 4L4SA 4UHCA 5I9SA 3MW8A 3V33A 2VATA 1YOVA 3GDGA 4QO8A 4HV4A 3EODA 3KTAA 2OUIA 5JYBA 3NRCA 2VG8A 5A3RA 2J9GA 4DMLA 1RHUA 3LPNA 2G4CA 2WUDA 1R37A 3IDAA 4XUCA 4N9QA 3W9BA 1UJ4A 4CMBA 1O0BA 4KGVA 2LDBA 1MDFA 1FFXB 2RI0A 4CIXA 3GWGA 5GJCA 3UMBA 1X3SA 4R2IA 4XWGA 3U62A 4I1RA 1D2RA 3A3PA 1AUXA 1A8IA 2JJ2D 3T1YB 4B79A 4RVFA 3IUEA 4P08A 1QGYA 2RDMA 3MMPA 3COZA 3CRMA 1RPAA 2VRCA 4RLHA 3AKYA 3EA0A 1T4CB 3L7NA 5K05A 5FCDA 3T4EA 1E5QA 2PKEA 2AOVA 4WFQA 1QC5A 3THYA 1IOZA 3OJFA 2QP9X 3E7FA 1JJFA 4WNIA 3TTXA 1GZVA 3LCJA 5KTMA 1VB5A 3QWIA 1KE2A 3U2QA 4ZGBA 2DFDA 3WGZA 2GT1A 1IMJA 1SXJC 2DEUA 1Y9EA 3PDCA 3C97A 4RIGA 1NZJA 3NO4A 4HAVA 3DWIA 1DJOA 4EG4A 3K73O 1MFZA 4FEAA 4LRTB 4MYHA 3K9QO 4Q3AA 1N9GB 1T2DA 1IZ9A 3A6EA 1DUVG 3MIIA 4C2BA 2Y6UA 3Q9LA 5FRDA 2PLFA 1ZJ5A 4FBMA 5E4JA 3T06B 2OPHA 3AWDA 2P9YA 2QZ4A 3IPLA 3OE7A 3QIAA 5JMPA 3QUSA 2GA8A 2QUZA 5TGTA 3RJ9A 2H85A 3VR4H 1ZRNA 3RFUA 4XOIA 3ME5A 3L8DA 4DF3A 3AVXA 2P7IA 2QDKA 5DFAA 5ALSA 1SXIA 3MVEA 1RYMA 5EZSA 1AU9A 5I45A 3VJLA 1Z0SA 3SHQA 1N2EA 2J0EA 2BEKA 2BFBA 4PHCA 5K3FA 3SEAA 1VMEA 4FNMA 4BNDB 1A9ZA 3GRFA 3ESQA 1JDJA 1W8IA 1Q1ZA 5KJ6A 3F5QA 2X13A 3DDUA 5L7YA 3Q9SA 3MTDA 2Q3MA 3A9SA 4CJXA 2BSQA 1AMUA 3UMVA 3MFYA 2JBHA 1NXOA 2BCGY 1KO5A 1XRPA 1VLLA 1TM1E 3B1WA 3E1SA 3P9PA 4GOJA 3DW3X 1NLUA 1WW8A 3E3AA 4A8PA 1NXTA 1QKJA 5EE9A 2XHZA 4YPVA 2OHHA 1XZKA 3AFIA 4I50F 4B35A 1W581 1PX0A 5J4KA 5FXMA 1F14A 3EA5A 1CDEA 1HUQA 1TUIA 3JARB 4HOYA 3D7NA 4IF4A 3HY3A 3ZHCA 2ZUTA 5IHXA 2XCQA 4D9FA 3H16A 1VKHA 2CNWD 1DQPA 2C7BA 5EKTA 1F8GA 3SFVA 4LYEA 2H2GA 4MCHA 4H3SA 2JG3A 2OEPA 4AM8A 3O8QA 3DNPA 1X7XB 2XY4A 1U9JA 1MO4A 4JZKA 3RPEA 5TB5A 2JA1A 2PU7A 5K0LA 4EGAA 3QMVA 2F55A 1U6JA 3E9RA 3HUUA 1YRQA 4KRXA 5TC4A 3STXA 1S2NA 1SG9A 4KIFA 4Y6SA 4LGYA 4CVNA 2JJ1D 5JASA 5G4KB 3HGQA 2B30A 3BH6A 4PNPA 1UEXC 1YKSA 2ZIEA 1JUDA 1O0SA 4PIMA 4D92A 5K20A 2NU8B 1U9IA 4LV8B 4Q7JB 3NHBA 4D8XA 1JIKA 3K5IA 2V4ZA 4RMJA 4FB5A 2I7CA 1XD9A 1E92A 4LDPA 4CZ2A 1ZMXA 4L95C 2JLUA 1WQ1R 1YIAA 1L8AA 1LGYA 2JFNA 3BZUA 3E22A 3HR8A 1T15A 1ODTC 3B7PA 3OQOA 3FLMA 4C03A 3VH2A 1ND5A 2X5NA 4HN9A 3GPIA 1WTCA 2H1CA 1GDTA 2ZSEA 4KQ9A 3HCFA 1T9CA 1OBHA 4PX9A 2RIPA 2WFLB 2WJ6A 3LG2A 3ZOZA 2PRKA 4YAWA 3YASA 3WX0A 1F7VA 4MQLA 2PR7A 1XYGA 4P3YA 1AIPA 5BSWA 4GPBA 1W5EA 5EJFA 1KQNA 4GX5A 4FVTA 1VE7A 1VXOA 1YVDA 4GWGA 1GDDA 2ISSD 1MQ8B 3QX3A 2VPXA 1ATZA 1RHRA 3BTVA 4X63A 4JKOA 4FHEA 2VRCD 3KWLA 5CA1B 4LXHA 2I2WA 3VZBA 4DM4A 1A5BB 2BTOA 2J7PA 4HS9A 4RGVA 4DLBA 2I8AA 4CV2A 2W2XA 4DV1B 3EG9B 1RC8A 3H2HA 1L8OA 2W58A 2YS7A 1O7JA 3HI4A 2REOA 2OZKA 3FR7A 4NNJA 1R4ZA 2BEUB 2YC4C 2IEBA 4PONA 4AS3A 4N3NA 2BYTA 1IN4A 1QE3A 2WLTA 4IDQA 4N48A 3AX6A 1KDPA 2OHGA 2H5EA 4GMGA 4YCBA 3LUAA 3EC2A 1TGVA 1BHJA 4HVLA 1QYRA 2BFCB 1XRMA 2GTHA 2X5JO 3IPCA 3OE7D 1MO5A 1YJCA 2HX1A 3N76A 4NBKA 1U0EA 2ODWA 1GM5A 4CKYA 4ENQA 2B2CA 1CDZA 1IFXA 1UK8A 5LNK1 5JTTA 1M6HA 4F5DA 3ESZA 2UZ1B 3OO0A 1BS9A 4URVR 4BOYA 4LY0A 4FIZA 5CBPB 2ZIAA 2ZS8A 5BV2P 2YXNA 3NIFB 1ZOPA 3LUKA 3CB4A 3RC2A 2YOHA 3ZWNA 1E3MA 3TK1A 2WF6A 4RHYA 1CNEA 3B6IA 4MOWA 4X61A 3VTAA 3P9NA 3GZJA 4FILA 1YRHA 5EINA 3MLAA 3DVQX 3UJ9A 3GRUA 3EBPA 2XVXA 5FUXA 1LA2A 2BFNA 5J23A 5CT4A 4DCOA 1UJ6A 1GQYA 3K4QA 5KVCA 1X74A 2C4UA 1E9RA 2CLEB 5LQKA 4EG6A 1JECA 2HK8A 4M6WA 3U49A 2H1RA 3T5BA 1Y5NA 4A0RA 3I12A 4J03A 3Q88A 2VYFA 4ZXPA 5FBVB 1W4LA 2HA0A 3W2IA 5HVNA 1DBVO 5IWCA 3DEJA 3J7AC 3R3ZA 1FUEA 4R0NA 1E77A 1A1VA 4IGIA 3MC1A 1S3SA 1ST3A 1UDBA 1T5SA 1C41A 2WM3A 1CY1A 3Q1LA 1R7RA 2CMDA 4KN6A 2QN8A 1P4SA 2J0UB 3H7AA 3K3PA 4IKEA 1DV1A 2HA7A 4FR2A 2R7AA 4RLFA 4TWZA 1PGJA 2C9BA 3QJGA 4PYIA 2DGDA 5F9MA 4F5YA 3PXXA 4ZJPA 1VCOA 1E9DA 2ZRJA 1P1IA 4RCZA 3VR2A 5HBRA 3IPRA 2GN9A 3KTOA 3E9QA 3T7RA 4D3XA 4U0KA 4WK0B 1GYQA 2IBMA 5I4KA 5L95A 4PLZA 2Z2KA 1T4GA 1LJUA 1SQSA 5FBWB 5H83A 3HR4A 3HA5A 2ARKA 1UDXA 2CFIA 4ERXA 3QEAZ 3AEYA 2EZUA 2CJWB 1NWCA 4JS0A 1CUAA 1ZH4A 2YMQA 5BN3B 3EUWA 4MWSA 4G1MB 4RPIA 1UK6A 7REQB 4DA4A 3OU2A 3R6LA 1NVVQ 1V11B 3ELBA 4HDNB 4CCWA 4ZD6A 3KELA 4XWYA 1E6LA 5LP6F 3N87A 2OLEA 3PNKA 4Z8YA 4A0GA 4BLOA 1SXHA 3PD0A 1YL7A 3WIEA 1JR2A 3SZLA 3RK0A 4UTRA 1GKLA 4B2YA 3TBKA 3Q3VA 4H6VA 1DWQA 1ZI6A 1NR7A 3PI7A 4US1R 3TI7A 2Y92A 2QVGA 4YLEA 4A8JB 1MVLA 4F6RB 3NVKI 1M8FA 3TLJA 1BXRB 5L7WA 1NW7A 2OBLA 4AROA 5TPZA 1BQ3A 1KAGA 4GYYA 1R6XA 4RMHA 3FPJA 3HEMA 3P0JA 4LZJA 1SKYB 3NGXA 4U7TB 4WY8A 1N4AA 3CS3A 1BMQA 2JHCA 1SCAA 5EKDA 3U6BA 3NWEA 1T2UA 1O1YA 3HABA 1AG9A 2TRSB 3GFOA 1F4LA 1GZDA 2A35A 1OILA 2EU8A 3BMXA 2ZI7A 5AOVA 1LBQA 3IP5A 4U2FA 5CVCA 2XRYA 1B0ZA 2NM0A 4IXTA 3RG2A 4JJFA 4RSHA 3FROA 3CW2A 5DKFA 3SFZA 4DR4B 1GL7A 1X7WB 3LXXA 4DMGA 1ZINA 1UOEA 1D3AA 3EVEA 3BUSA 3FVVA 2DVMA 1Z8FA 4IOMA 3SHOA 4BFCA 1ZD5A 4HDSB 3P20A 1XC7A 3C70A 1UDRA 1D9XA 1V8OA 3F97A 2ZVDA 4WCVA 4ZWNA 4CM1A 4PQFA 1D6JA 3L0PA 3IOMA 1UWKA 4I1IA 3ER9A 1IAVA 1OASA 3EFBA 1QIGA 5M29A 1Z22A 1O95C 3ADOA 2GSWA 3AUAA 5B1HA 1LPBB 5DK6A 5DEOA 1JPVA 2C8VA 4FFSA 3AVPA 2RAUA 2D3WA 3RUFA 3DF7A 1WL8A 2GLXA 1JPNA 2WFMA 2JGRA 3L7OA 1XL1A 4QULA 4RF4A 5KWJA 4KQGA 4BZQA 2VDKB 3AU8A 5EJ5A 5K45A 1YGYA 4NJEB 5EQTA 4IL5A 2VCHA 5A7HA 3S2GA 1WXHA 4LZLA 4HAUA 4W8GA 5A0FA 1DXOA 2QLBA 4NDAA 4AFNA 4OHCA 3RSZA 3ZDYB 8ABPA 2JFVA 4JJAA 2J6BA 3ROTA 1EXWA 2HV8A 5BRJA 2WE8A 1EVQA 4D4HA 1OXMA 4QPJC 3EWAA 2V6JA 2VJLA 1QWOA 2A92A 1MJFA 5CT8A 4DBLC 3KSBC 2F8TA 2WIFA 3HFRA 5ANRB 4QELA 3QLVA 4G24A 4E5YA 4MDEA 5F21A 1T6ZA 3JQ7B 1DJMA 3F6EX 5ALQA 2PTGA 5HDQA 4UBLA 3EWNA 3U5TA 3T4XA 1N8TA 3Q9UA 1C4XA 2ODNA 1DX6A 3WLLA 4C4AA 2M98A 4CIVA 1EVKA 4ESVA 4OP2A 3H13A 1M74A 3VR2D 3EMVA 1REQA 4XVUA 1SVSA 4AWAA 5CG2A 1K66A 1WZNA 2H2FA 1UBOS 2I3AA 4LZAA 4OP1A 4L85A 3L7CA 4JLWA 3QBDA 1OMOA 4KO8A 3I1YA 4ZVRA 1J2YA 1VPVA 3SJ7A 3ZCQA 4EO7A 3EJWA 3L4BC 4NHEA 4EYSA 5I8PA 4X85A 2C8LA 5SV2A 5BQ3A 2RD2A 5FYDA 3ZNPA 4I55F 2HBZA 4LJ6A 4DC0A 4R1UA 5FL7A 2P62A 2H2DA 3KTDA 4EY8A 2PAFA 3WQBA 2FOIA 2B8TA 4ZP1A 2DLCX 5EP1A 5K2MA 1D0SA 3U7RA 4ARUA 2QVXX 3C4VA 3UXEA 2BTEA 5M7EA 1E4YA 1XQ6A 1NXVA 3A1CA 4QBKA 1V25A 5CHYA 4G0VA 1UT5A 1A9RA 3EGCA 3K0CC 5HE9A 1DT5A 1Z5WA 3LW8A 5IYZB 2PX6A 3H3JA 3O1JC 1C81A 1A27A 2NAPA 2XE6A 1G8JA 4JAVC 5GONF 2R1TB 5B1SA 5JW6A 4EUEA 4MUIA 3U60B 5TPZD 4ZQBA 1GLGA 1GQOA 3VPSA 5BUQA 2XWJI 1TLLA 2A84A 2J6CA 1Y81A 3A3KA 5ALIA 5HKOA 4A2PA 1B41A 2O0JA 5D1HA 2EFDB 4IXMA 4P92A 4NMMA 2PGJA 1I3CA 3RRYA 4JGIA 3SMVA 1KI8A 1XYYA 5EJIA 2Q5EA 4QO7A 5D5QA 4I5EA 5JCZA 3OM9A 2WVJA 1E2EA 3GUZA 1TMKA 4OXRA 4F06A 4YUZA 1YZFA 2C57A 1BKDR 4D43A 5WRFA 2COUA 1E7WA 1QQAA 1KU0A 3IJPA 1Q7CA 4LPSA 3FYCA 4G0NA 4M88A 3RYCA 1ZU4A 3U48A 3VO2A 2NNLD 1D5WA 3RFVA 4HDRA 1RIIA 2AC7A 1Z0UA 2EJVA 1ZLXA 3H5WA 4C4TA 1DFIA 1BDMA 4XASA 2A7XA 1JB9A 2CXOA 3CRRA 5IVDA 1VRCA 1ZVKA 3IALA 2VT2A 1KEEA 3ELWA 2HLNA 3VHLB 4UHKA 3DWFA 1M73E 2AXQA 2CE7A 2IV7A 2YTZA 3NIGB 1EQUA 1HORA 4L8GA 1TJYA 1CR0A 1JP7A 2Z58A 1XPRA 3EEIA 2Q6OA 1YR7A 4HJXA 4O4LA 1XDBA 2WJAA 3QITA 4TXJA 5BNWA 4MR9A 1YE3A 2ZYIA 1E3WB 4QUIA 1CJUC 3AHCA 3DLIA 2CCGA 2DT8A 2V8BA 3FZGA 2NX2A 4B4WA 2GM9A 2WFAA 5D3MB 1JLRA 3BMQA 3DMFA 4N4AA 1HURA 3DEKA 3GNQA 5EPUA 3E7PA 2HA6A 2PX2A 1KK2A 4E31A 2ZIFA 4G0OA 4J90A 1PZXA 5KNCA 5HNKA 3PUIA 2L0XA 2LDXA 1WWKA 4EG5A 4N41A 3W79A 2R1VA 2Y2UA 4MI3A 4RZSA 3CO0S 5SICE 4NEHB 1QB7A 1TNDA 5F3WB 4IHJB 4LBWA 2V9ZA 4E5PA 1AQNA 1CF4A 3BGIA 4FGUA 2BJVA 2QSYA 2QMHA 1ESNA 1NX9A 4ECAA 2KB0A 2OG1A 4LXUA 3RB8A 1R8YA 4GE3A 3MJHA 5DISB 2VYQA 4D96A 1WU8A 3VV2A 1KYYA 1NTOA 2HMVA 2QRKA 2R6AA 2SKDA 3OZAA 3HYCA 3KHTA 2ZI6A 4DE5A 4M0PA 1V8PA 5HG0A 3KLBA 3BXHA 4BP1A 1ZO8A 1Y3BE 1E8DA 2OXFA 3E9ZA 3RKUA 2DF8A 3Q0TA 1KSJA 3R7FA 4CKBB 3SMQA 5DTMA 3W4KA 2G63A 2AMJA 3IILA 4DGSA 1VRWA 4HB0A 4HN4B 4JZYA 2Z2ZA 2PJZA 1YFKA 4BMOB 1RD4A 2QXYA 5JBNA 2VBIA 5KYTA 3KG2A 2A78A 2QD1A 1NYTA 1C8KA 3P0IA 1T5BA 3CCFA 1SUAA 2PL9A 4MQMA 1JU9A 3DT9A 2ORIA 1LK0A 2IF0A 4ZI2A 3PQ6A 4U7HA 5FL7D 5BR7A 1AGNA 2FSVC 5L7TA 5HIKA 1FS4A 1J6UA 3HEBA 3B78A 4MWGA 4RY9A 2PGLA 3DAPA 1HEYA 4Q4AB 3OJCA 1DX4A 3X0DA 3R5KA 3O0TA 5DN6A 4DMFA 3UVEA 3I04M 3KVOA 1G1AA 1M1YE 1W36C 3KYDA 2QTTA 1QQ5A 2NTVA 4IDEA 4BNKA 4UXIA 3IUQA 4HXEB 1Q0RA 4RD0A 1E1QA 4OHZA 1A4RA 2P6NA 3C3KA 4EKEA 3NEYA 4NYMR 1BFKA 3JQFC 1ISSA 1HT1E 3RVPA 1ZGZA 2WTUA 5JZMA 1BCRB 3P9IA 1E3LA 4FYVA 4HXFB 4CEHA 3CUSA 1ZVJA 2I6QA 1E98A 5EA2A 3RS3A 3TRJA 2F1HA 4B6SA 4HLDA 3RUCA 1NSYA 1NC3A 2P9BA 1RQGA 2ZTUA 1YCFA 1G21E 1RWPA 2Q3EA 4O5AA 3JPYA 4BGEA 1LSJA 1O94A 2CBZA 2E4WA 4HXYA 1EG7A 4ZZ2A 4UVIA 2O9JA 4I36A 2I9PA 5KI6A 2BMJA 2RJ3A 5IJ0B 1OZ0A 4UOQA 1JYSA 1XQYA 1Q1BA 1Z28A 1IUNA 1ZRSA 4UCFA 2PZJA 5ALMA 5AKZA 3TIVA 3SVLA 1U7PA 3A0UA 4L1KA 4UEJA 5CFOA 1CUWA 1F48A 1R0LA 1T4CA 2C3PA 2WIJA 1QNLA 2WM9B 1KGSA 2XDQB 2XNCA 2XNDD 3NWPA 4MUNA 4WUVA 4X65B 3TXYA 1WUJS 3BEDA 4CGZA 1JQAA 2C31A 3EXHC 3GU3A 3OZUA 1L1EA 4DC9A 5FPPA 4EG3A 1YVPA 1LBEA 1LX6A 5TPWB 1J8MF 4IMPA 3NB0A 4QFDA 2ALJA 2VJNA 4MW7A 3H5TA 4PAMA 3WGVA 2X4GA 2XPCA 2ZJZA 4G5QA 5KYGA 1D8TA 4ITVA 2NO1A 2EJTA 4CLDA 4ZCQA 1ZCAA 4YRSA 5EJ6A 1N9GA 2M6RA 4F93B 1KZ7B 2J32A 4IIEA 4Y30A 2Y66A 1AS2A 2WT4A 2QTMA 2R8EA 4XQ9A 5TIIA 2BHNA 5IKMA 1FFYA 1FNCA 2FUG6 2C0QA 3D02A 3EQ9A 4XFJA 1SC3A 1THMA 3BDIA 4XJTA 1G17A 2X0EA 3HJRA 3DZDA 4JQZA 4AWBA 3TIXB 4Y6LA 1JS1X 2Z9CA 3TQRA 5FX2A 5KNCD 3PPVA 1ZIYA 3WJ1A 1A9YA 3SKXA 1GTMA 3SX0A 1YS4A 2I2XB 2X9NA 5BPFA 2ZKLA 2NO5A 3T5MA 3U4MA 1WKVA 3K30A 5KQLA 3DGEC 1WDLA 3TVYA 4D4JA 2HD4A 1C4KA 3IVRA 3IV9A 5HZMA 1FQKA 2EQAA 3HS3A 3KT3A 1A72A 1YNOA 4QVKA 1APBA 2D00A 5DN9A 3ZGZA 1FQOA 1MIHA 4ASUA 3L0ZA 4UHFA 1C5KA 4MV5A 1E1YA 3ULKA 3WLFA 1NXWA 3EE6A 3JARA 4MPRA 3DAGA 3VDQA 1BMDA 1K1EA 4MS3B 4AMGA 1X0XA 2C7QA 3BSWA 3VBEA 4K88A 3UJ6A 1QIFA 3ZKWB 2Y9PB 2R60A 1O9BA 2FMXA 3ZWPA 3DD1A 3Q41A 1FDOA 2X1MA 1IDN1 3DM5A 3MCWA 5EXEA 1JHVA 1X7XA 2H4HA 3I52A 4YYZA 4RL6A 1WB4A 3HVHA 1H0RA 4LI0A 4LRUA 4IZOA 1MQSA 1XDDA 1XHFA 2C78A 1YRWA 2JGNA 2K2QB 2YWGA 4PYOA 4F6CA 4H0FA 5IU6A 1G38A 3AHJA 2XE4A 3RVOA 1E60A 1K3UB 4BB0A 5G4KA 1I24A 2O23A 1BX1A 1ULUA 3LQYA 4QBFA 2YHBA 1TTTA 5I4BA 3EN0A 3M4NA 1ORVA 3TSCA 1SAYA 3SBDA 3ZXIA 5DN6D 3LC1O 3JTMA 4EI9A 2VPZA 3O9VA 5IDWA 3TRHA 2PO5A 5K3DA 4CF3A 3KQKA 3GJQA 1T26A 4KX3A 5GONB 3WG9A 4OX9Y 1E1QD 4UAUA 3V7FA 4MB2A 1EE1A 1BVRA 1R8SA 2ZRPA 1YRAA 2WILA 2ZSIA 3BXPA 1WCYA 4QXAA 3WWYA 1Z8NA 1PJ8A 4X5OA 1X87A 3EWSA 5IARA 3O2SB 1OYYA 3CZQA 4OYHA 2WFLA 3QKWA 2DSNA 4U7FA 1T3HA 5JMTA 5CNJA 2FA9A 4EGJA 1YJXA 3P2OA 2Q5FA 4R1PA 3HYSA 3T41A 3R44A 3MJCA 1O94D 3AM4A 4PEVA 1QV6A 2NO7A 1Y6JA 3M49A 2CJYA 4NV0A 3GBVA 1H66A 1A71A 1I3LA 2EYQA 3BTUA 2OFFA 3MEQA 3AT1A 3UMSA 1NJ5A 4KXMA 4M1KA 1Y8QB 2Z57A 1CKEA 2FTKE 2HLHA 2QLTA 2XGMA 4MVXA 4R8VA 2FEXA 5CA1A 5ICSA 5K8VA 4QARA 4DV3B 3LL7A 4M4SA 2GAOA 3RHTA 1JX6A 4I4TB 1W9MA 1ABBA 3EDOA 3NHSA 5BUCA 1YO6A 1L0BA 1T4MA 3EG9A 3FWKA 3SYTA 4Q4CA 3BJIC 3AONB 5CDGA 5IT0A 2OCDA 2VSYA 3OF2A 2W90A 3UAWA 3O1LA 1LTQA 1PJ2A 3DLHA 5JCJA 2H4FA 3PL5A 3F7MA 3QRWA 2W70A 3H1TA 3QQPA 3O90A 3HCOA 3IAUA 1AHPA 2RGXA 1U28C 4J7AA 3RROA 1QDEA 2BGTA 2R62A 2YJ6A 4NMHA 1I10A 1XE3A 3CEMA 2EQBA 4PXSA 1HFKA 2BFCA 3GGOA 3QYAA 4N0QA 3ZHVA 1RI3A 4A2QA 2SECE 3ND5A 3ANMA 4L57A 5HF6A 5M3BA 4BXOB 2H63A 1Z4QA 1SIOA 2C97A 3CLHA 4Q82A 1QCDA 4HUQB 4LXYA 3V1UA 2QROA 2UZ1A 3Q7TA 4QYIB 2WSIA 5EHQA 4RNDB 3U3RA 3HJUA 2H51A 1UMDB 1BYIA 4P32A 3TRFA 4CF4A 2QY6A 3JVEA 3C4JA 1S3GA 4AECA 5K0FA 2QRMA 3E9EA 3NOQA 4ZODA 1C3EA 1DOZA 5E9QA 4EKGA 1XKTA 5TARA 2Y2VA 2O2GA 3CO5A 1PGQA 1RXCA 4ZAFA 4IUCS 4Q34A 2Y8EA 2JRLA 2RGBA 4PLYA 4CEJA 4BGIA 2EG5A 4KQEA 1GPMA 1H3FA 2NUBA 1I4OA 4DG8A 1N2HA 1I14A 2WF8A 3STWA 3UYLA 3WGTA 1XJQA 2ZULA 2KS6A 4ASUD 4EAQA 5TQ2B 1ISMA 5A4AA 1M75A 3SOPA 4KSCA 3I45A 1E2QA 1NQWA 2BEWB 5G4LA 1WETA 3D0RA 1V6SA 2VH5R 3ANNA 3D0KA 3D8HA 5F7JA 3TEJA 4TKMA 3K70C 2IS4A 1SHTX 1J56A 5BYBA 4Q9JA 3RW9A 1H6CA 2FK7A 1DTWB 4JYZA 4F5ZA 3ZR4B 4EJSA 1T8RA 3FMIA 4R2WA 4R3NA 4YJGB 3UPDA 2FETA 2J0UA 3ET5A 1NR5A 2D2XA 3FMVA 2MMCA 4RE6A 4KNYA 3A2KA 1UBMS 4PICA 3FWYA 1EX1A 4GSYA 1C0EA 3T4UA 3BXOA 4C20A 4P7JA 4UUAA 5B30A 4OQPA 4B6RA 4JC5A 2FR8A 2FPPA 1OQAA 1Z6GA 1CX9B 1WD7A 2J41A 1U11A 1DUIA 1RYYA 2QN3A 2V5VA 3FDZB 1ESCA 1L7VC 1FL9A 1PZNA 2JGKA 3PGLA 5DBOA 1TMYA 2HBRA 4UTVA 4C3UA 1RWXA 2CJWA 1T8WA 3WYFA 5IXJA 5BN3A 3EQ2A 2J3JA 3INRA 2D2EA 3OIWA 3KWFA 4XZ3A 4YN3A 7REQA 4HDNA 1V11A 4K6OA 3GO4A 5AMXA 5JNRA 3JAMA 1BJTA 3E05A 4AJEA 2CBXA 3BA1A 3DE4X 3IGFA 5T3YA 2QZSA 3CZRA 3F67A 3PEYA 5HJ7A 3NJRA 1IONA 1XZBA 3ZQUA 5THKA 2XA1A 2JAPA 1GKKA 4A8JA 4F6RA 2NPFA 1BXRA 2CXTA 1Y1TA 1DBWA 2NO0A 3AR3A 1AUOA 4KVFA 1M6VB 3CJTA 4L4UA 4TS1A 4W82A 3WNZA 3ZBUA 4MO2A 1ZNQO 1U8AA 2XCTB 3UH1A 2PT5A 3TJMA 3M9WA 1TIBA 1OLOA 1RYFA 1YU9A 4BNZA 5I7RA 5G0TA 1DZ3A 3H04A 4P58A 3KLOA 5DM60 5JAIA 2EJUA 4WKBA 3GLIB 4TWRA 3T7EA 5EMMA 1PZEA 4KI0A 5JFOA 1YK1A 1XMJA 2EL9A 2GXUA 2VSXA 1GPYA 2EG9A 1VL2A 1JI0A 1FYXA 1Z6ZA 5KAMA 2XBUA 2C8JA 2IXTA 1XCMA 1Z0ZA 3BICA 4Q7QA 3IUPA 3H65A 1LRJA 3D8BA 4V0OA 1CUIA 1QORA 4HDSA 3VPAA 3OPYB 3ZGXA 5JCJD 1VMAA 4NTZA 3T34A 1XJWA 2AF4C 2HIGA 4NEGA 1PFQA 1FYFA 3OZBA 2HJWA 1TRHA 2JCXA 3ZE9A 5A3QA 2FG5A 3J7TA 3T15A 5LYYA 1HG1A 1UKYA 4BVFA 4EA7A 3A4LA 4KPUB 3T1TA 2FSPA 2QLFA 4YRCA 3Q98A 5GV7A 1CE8B 3LNTA 3PWKA 4YROA 2AUNA 5BV7A 1B6SA 3NTLA 4FI3F 3QE9Y 4R01A 3SC2B 1C30B 2Y05A 1RJGA 2DYKA 1D1SA 3UANA 3QTBA 1ULZA 4Z9FA 2X5OA 1C9JA 1E6WA 3KQLA 1P3DA 4MKXA 3DAYA 4P5DA 4TTAA 1TIKA 1C14A 3EF3A 4J4BA 1E3DA 4YCAA 4XVCA 5LQCA 1O58A 1GKUB 1CETA 4GP6A 1KI1A 1RMQA 4LRQA 4JA0A 2XTJA 4U2DA 3SQLA 1LD3A 2G04A 1E2FA 1SUBA 2Q2OA 1ZD3A 5ICFA 1TYCA 3TL2A 4F84A 2ZIVB 3VAYA 3P97A 1YRYE 1EEHA 3BGDA 3PFKA 1HA3A 2BTQB 3WHKA 4E5UA 2RHJA 3SJBA 4EGFA 2VUUA 2GZRA 2A57A 5HQ3B 1W88B 3L7KA 3QE2A 3E1GA 4JXJA 3HXLA 5KQGA 3OZSA 3MWDA 2E87A 1TECE 2EEZA 2ZYGA 1KERA 1BROA 4GWKA 3QWHA 5KDLA 3LVQE 4A6DA 5AIBA 4MJLA 4C6HA 3JQ7A 3UHPA 1B74A 4JVSB 1TJ4A 3LOQA 1ZMRA 2BIFA 4LKOA 4ZEVA 4TMVA 5IULC 3MT0A 3QOWA 2G9RA 1HXHA 4JX8A 1J8DA 1T6BY 1JDVA 2GDZA 4RZQA 3ROPA 1LQUA 1QOQB 1VJCA 3EXHA 4FCCA 5L3VA 1H6AA 1PN3A 2IKSA 5FO1A 3H2KA 3WGGA 3FUTA 1O6GA 4KK4A 3PDIB 2QRPA 2Q99A 5AWFC 3ENWA 4QRDA 2O2DA 2R4UA 1TPZA 3LH5A 2E89A 3MJFA 4B17A 4HRVA 1PRYA 1STOA 3P0FA 2R4TA 1TYZA 4A4DA 4XRRA 1U1DA 3NUGA 4J29A 3D8NA 4X71A 4UC0A 3TZCA 4CQLB 4N3GA 4Q3CA 1DWPA 2OTCA 3I6IA 4WXRA 3PQEA 2B6NA 2WSLA 3H5VA 4PZ9A 2W22A 1XMSA 3BF7A 2M6LA 1X77A 3HL4A 4FMCB 4FFVA 4UPDA 4JU9A 2VWQA 2SHKA 4IH1A 4U02A 4Z54A 3NS7A 4ZHQF 3R9XA 3D5TA 1UJCA 4EM6A 5AUNB 2RHTA 5IYZA 2C2KA 1QRAA 1RSZA 1SWVA 1WPGA 2OVBA 2FEWB 3D7RA 1XN1A 3I9FA 3K8YA 5E2IA 3CPSA 5B6PA 5DHFA 2R1TA 4L9RA 5E4TA 2CV0A 2WMDA 4IXNA 4I3HA 2FZ5A 1PJAA 4GM0A 2AJBA 4OIFA 5FBQB 2V3CC 4L72A 3EBLA 3QX9A 1V95A 1AJEA 2A88A 5HFNA 4U6QA 1F3OA 6Q21A 5JISA 1OU0A 5K8TA 5LP6B 1YDWA 2XMDA 3BD6A 4LDAA 4RHXA 2Q5QA 4GMKA 4ZTUB 1M54A 2Y4NA 2QAJA 3BZWA 2IYXA 1R88A 2QNRA 1IRXA 3QW4B 3TECE 3NYQA 3PNBA 3WFIA 5AW4A 6YASA 3OCWA 1E4EB 3A8TA 1E2DA 3BXFA 1JZSA 2CVPA 2OV2A 3CIOA 4FOSA 1XKXA 3U7QA 1GADO 1LFAA 4HGNA 4P81A 5LWHA 1Q6ZA 4R5HA 2JI6A 2FUCA 3NZEA 1DG9A 3OZCA 1FX0B 4MS1B 1HMYA 5AJZA 4Y9UA 4KJZA 4DHWA 4OB6A 2CT8A 3GEMA 3TZ6A 2C7GA 4WOBA 2D0IA 3RASA 4CMJA 1YJAA 1AO3A 5BXYA 3E8SA 2DFNA 1UKBA 2LR0A 4BB6A 5HGXA 1N1MA 1KRXA 4ANFA 4D8UA 3S27A 1EUQA 4MROA 3MB5A 1JB1A 3EAQA 1X1BA 2ZB2A 2O7SA 3WB0A 5IH7A 4DQLA 1S3IA 2X1HA 3RIYA 2C5SA 1UBJS 1VIVA 3TPZA 2C1ZA 3U5ZB 1E3WA 1EBUA 2IYPA 4B47A 5DMXA 4RZ2A 4E70A 1T0UA 3CVXA 1GPWB 3KEOA 5D3MA 1RBQA 2ZWAA 4U8GA 4YV7A 3QVLA 2YASA 2CXQA 3N8HA 3D54D 1CY0A 2WVAA 3JATA 3LCRA 1SNYA 1Y9DA 5F1KA 3OECA 4XEHA 4X7MA 3RRZA 3WGNA 4P0QB 1USGA 3FSJX 4M7RA 4U7PB 5E3IA 1ZHHA 3G49A 4PTLA 1E1DA 1VPLA 3AMVA 4MJ7A 1DCMA 4RK6A 1L5KA 3I9V6 4IHJA 1AQJA 5KNDA 1SIBE 4N47A 5IKEA 3NQ41 2ZJYA 3F6SA 5CPBA 3EXG1 4KNVA 5CK4A 1JFSA 4R54A 1MH1A 3F4KA 1ZW6A 1ZJ6A 2IC5A 2J3KA 2TS1A 2Y1LA 4NOJA 4X1KB 4OF4A 4RA6B 1L5LA 3TAUA 3KQYA 1BX3A 1DNPA 5FUMA 4IQFA 5JBIA 4DMCA 2QP4A 1NPTO 4GUDA 4C1NA 1H2WA 1T36A 2DHEA 3E61A 1AK9A 1BXKA 1G4HA 2FFJA 4P3XA 4YMWA 2VWHA 2O2ZA 3O31A 3PHBE 1CWUA 4MW6A 4BV3A 4NE2A 4CKBA 1KZYC 1W5AA 3IRUA 1IBSA 4MXDA 4X8LA 5FOUA 5H4HA 2Z6AA 4PN7A 3V4RA 3NBMA 4M1SA 5AIAA 1T6NA 1KVRA 2XEXA 4FYKA 1A7UA 4ZFNA 4NMLA 2IKQA 3VX4A 3RSLA 2G25A 3DV9A 1UJBA 3KD2A 3N3AC 3PD1A 4DMMA 4GOKA 3K71B 2C4NA 3LX6A 5BWMA 1V7ZA 2E4UA 2K4MA 4BCDA 2XYHA 4W5OA 3GGDA 3RS4A 4CMAA 5JARA 3ZV6A 4US2R 2PSHA 2XUDA 1XV5A 4E6EA 1GFIA 1YI0A 2OAEA 1H23A 5CH3A 2BEVB 1K75A 4Q4AA 1HQYE 4Y18A 4DJJA 1XPJA 1WUKS 2RK3A 3FKQA 5JO0A 1A7KA 1Y0BA 2EZ8A 4CG2A 5FWXB 1H2FA 2E7ZA 1G8SA 3M6VA 1MNQA 4I5DA 5DYIA 1L3CA 3USZA 1MT3A 5ESDA 4KLNA 3LHIA 1GN8A 1ORHA 3G9XA 4G9BA 3UXYA 3V8MA 4CLHA 5ALYA 5JALA 1YDMA 4TYNA 4X44A 3ZWYA 1Q0QA 1BCRA 1K27A 2JK1A 4ODIA 1J9EA 1L7AA 2QV7A 1PL0A 3FSEA 1XU4A 4LYAA 4MITA 3UNXA 3ZE2B 1HNZB 3S81A 5E1OA 3MQ4A 1MZPA 1WPXA 1W19A 4LECA 3DBRB 4C4PA 3JZIA 2R6HA 3EX7C 3VTFA 5KNLA 1TM2A 3V2UA 1ORWA 1GG2A 3QLEA 5EI5A 1VG8A 4BTLA 1LSOA 3GPCA 3N0RA 3CVYA 2PX4A 3KPYA 3SZGA 3VPDA 3GCWA 3LYAA 4IJQA 1WXFA 5H0IA 4UMFA 3RAJA 2HOQA 1NP7A 4AZ3A 1KWGA 4Y0NA 4PGAA 1OYWA 2XDQA 3A6PC 2RGWA 4YAUA 1KC3A 1SD5A 3T12A 2O07A 4F5EA 2Z95A 1BA2A 2P9ZA 4FW9A 3AF1A 4N5LA 4Z2YA 2FPIB 2RIRA 3E9MA 1IN8A 2QJRA 3KJEA 5TPWA 4R1TA 4W63A 2NN3C 1T8SA 2H07A 3WSVA 1W0KA 2RGUA 3ZLTA 1JEYB 1GNVA 3N86A 2C88A 3R09A 4ZTBA 2P40A 2RI1A 4ND1A 3HPRA 3UKJA 1ZX1A 1YS6A 1AZSC 2FSFA