2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
1ZM3A 3X1YA 4JVSB 1EFTA 3PENA 4PXAA 2GEDA 3QIAA 1IJFA 2XSZA 4PR0A 3D7MA 4RJLA 4YC7A 5DLQC 4DEYA 2WPDA 1QVRA 1DPFA 2LKCA 2A7QA 2D74A 3A4NA 3B60A 2D2FA 2ZAOA 3MD0A 3B1YA 3U3JA 1G7CA 4P0TA 3VR5A 2IYTA 2QENA 3L0SA 3AUXA 4YONB 3CO5A 1KGDA 1FUKA 2E9SA 1FPMA 4Q19A 4QG7A 2OFOA 2DY1A 3TK1A 3B5JA 1MKYA 4I81A 5FL3A 4C30A 1Z22A 2ZR7A 2ZS7A 1NMZA 1UM8A 2A5JA 2P3SA 3U2QA 1R5NA 1IJEA 5L8VA 3HYTA 1NF3A 1NRJB 2HXSA 1XTQA 1JECA 2RKOA 5FTNA 4XVRA 4O25A 3AF1A 4G5RA 5IK2A 1T5IA 1DELA 2AFIE 4AI6A 1JPNA 3CPHA 1KAOA 4HSEA 1D9XA 4Q1FA 1KDOA 4X8HA 2AKAB 3FYHA 2IXEA 3DOFA 4FCVA 1FMJA 2XJ4A 1CBUA 1W2HA 5KYKA 2ODEA 4M1TA 3OZXA 4DRZA 1L8QA 3TQCA 3ZVMA 3WHKA 5FL7D 2A5GA 4JJKA 2LCFA 3CF6R 1WB9A 2JJ2A 4LYFA 2C95A 4DIEA 4HB0A 1UDXA 3ECCA 4H9GA 3W90A 3CRW1 4JVNA 1D2EA 2C99A 4AKGA 2DPXA 4D4JA 4GI7A 2ORWA 4HYYA 5JSZA 5AWFC 3GJ6A 2R9VA 3VQTA 3E5HA 3EZ6A 1JEDA 4H1VA 5CJ2A 3G0HA 4OKSA 1YKSA 2BOVA 1U0HC 4JLPA 4MYTA 1I4TD 1ZW6A 3S1AB 3DDCA 5LB4A 3EPJA 1KK1A 3MAAC 4CYMA 1UAAA 4DDUA 2QRZA 2H7VA 3EIEA 4LV6A 3RANA 3REFA 1CEEA 3X1XA 2CDNA 2QT0A 3U60B 5JEEA 4BFZA 4TMVA 4D81A 1WRBA 1G3IA 3CH5A 2P6RA 4OHZA 2ZRBA 3SU8A 2R44A 1W0JD 1ZNWA 3BD9A 4ILEA 1FOEB 4Z8XA 1CULC 1IY1A 4HATA 4PO9A 2LWIA 3SN6A 1P5ZB 1IXZA 4LPKA 4LZZA 5JMTA 2O5VA 4UJ3A 1E9SA 2SHKA 4BASA 5A5GA 1ZM2A 2IYSA 1EFRD 3GLHE 1CR0A 5DO9A 4B44A 3KDSE 1T9HA 2GK7A 2WJVA 1XMIA 3L2OB 2BV3A 2CJWA 4P31A 1ZCAA 2EFHB 4Q7LA 1XTRA 1EFCA 4IDOA 5KSZA 4BPBA 1NSFA 1YZQA 2YYZA 4HAYA 1DEKA 2ZI3A 2O0JA 2W6IA 4K46A 2ODNA 1G5RA 1OFTA 1FX0A 4Q66C 1GKIA 1KO7A 2QE7D 4MQBA 4B32A 2JATA 4GFDA 2WTUA 3BFXA 4B75A 4QM7A 3CWZA 1H8HA 1YR9A 2C9OA 1Z47A 3W3ZB 1G5PA 1N2CE 2YKGA 3PEYA 1TPZA 4M4SA 5B57C 4PSKA 4RSGA 4IOMA 3NEYA 4JLNA 2RGGA 4HB4A 4KFSA 4Q4HA 3PFIA 3WMGA 2R6DA 2AR7A 4W9MC 5FUXA 3UMSA 2R6CA 1HQCA 3IPXA 5K8IA 1F2TB 2VLIA 3K0FA 2HYIC 1A7JA 4HLQB 2WWXA 3A1TA 5FR2A 4AURA 4DXAA 3IBGA 1DE0A 4JSTA 4W5HA 1Y63A 4QJ4A 5K8UA 2IEZA 3PVSA 4G5QA 3ZVLA 5GJCA 3GD7A 4Q4AA 3BRWD 3N5CA 2ZAMA 3WY9A 3FPAA 3TLXA 3AM1A 3WYAA 3CX6A 2D7CA 2IT1A 2Z4RA 3QXJA 2IEYA 3QNUA 4EUNA 2JLVA 4F4IA 2A2ZA 4A82A 5E95A 3LX8A 2C96A 3NHAA 1E1RA 2JIZA 3B85A 1RZ3A 4MUBA 3T1QA 3ZIAA 4Q1BA 5DYGA 2WZQA 2HXYA 3Q3JB 4LK2A 1JR3D 1IOZA 3PEUA 4UXJA 1OFUX 1W7AA 1ZD9A 2FFBA 1HUQA 1Z6XA 3P1JA 5EXTA 1GTVA 3K0CA 1N6RA 3I1FA 2FPLA 2XB4A 4A0HA 4C0BA 4OI0A 3BXZA 3I73A 2O8DB 1W49A 2XNSA 4TYPA 3ZLJA 1QHYA 2VQSA 2QAGA 3JZMA 5GJWC 5JS7A 2Z83A 1XDBA 1CKEA 4U7DA 1S9DA 1OYWA 2OHFA 5JBQA 1SVKA 2XITA 3AF0A 3P20A 2FE4A 4CW7A 2ZJOA 2A3RA 1ZINA 1XZPA 4P33A 4LBYA 1A4RA 3H4MA 1ZD1A 3L0PA 2BVNA 1II0A 4DKXA 2VYFA 3HR8A 2ZUCA 3KQUA 4CZ2A 3KJHA 5FUYA 1EX7A 2CK3A 1G9XA 3I3SR 3R20A 2VSOA 2QMUA 3BORA 5G3YA 3R9WA 5CDFE 3CONA 4P4TA 4AWXA 1E6CA 4IOKA 4E5UA 3GJ5A 4BLOA 3MWYW 4WZBE 4A8JA 1XX6A 3TW8B 3NHBA 5FUVA 2QM7A 4UNPA 3X1WA 1YZKA 1NKTA 3O8BA 1P3JA 1R8SA 1W44A 1W4BA 2F1RA 2ZYTX 4ACAA 1MRNA 3THYA 2O8CA 2H1LA 1KTVA 2BMJA 3I5XA 2NGRA 2CVHA 4MDEA 1MO6A 2G1KA 2ZSFA 2NO0A 2CCGA 4S2EA 1CRPA 1E32A 3Q9LA 2EWVA 3MJRA 1E2KA 2BBWA 2JLZA 1H8ED 1II9A 1S1MA 1ZUNB 1DO2A 5DN6A 1TUEA 1TUIA 2FZLA 2GKSA 3TGPA 4YXWA 1AKYA 4B43A 3BJIC 3KKNA 4GOJA 3C5CA 3EPKA 4FN5A 4L5BA 4CGZA 1SVWA 1U9IA 1R10A 1O87A 4XJXA 4FD2A 4PC7A 1ZIOA 3GJ0A 3U3OA 3FHOA 3PUVA 4FMDF 3GLGB 4LJ7A 4BZPA 4DHEA 3LWNA 1CU1A 4PC6A 2OV2A 1GVNB 4QL3A 3TVTA 4KLNA 4NMMA 1ONBA 1P6XA 4ITRC 4S35A 2FOLA 3T61A 3SQWA 4NYMQ 1N25A 3KXIA 4OL0A 2Y8EA 3TQFA 3GLHA 1XCGB 1US8B 2X2FA 2HYDA 1M34E 4YMVA 1E1QD 1ELOA 3L8ZA 3GLFA 4JVMA 4QFMA 5HCIA 1MO3A 1U8AA 1YVDA 4KJZA 1XTIA 3BBPA 3QUSA 3AP1A 4UXHA 2YWEA 4JLKA 4IXNA 4QJ5A 1QHSA 1R0ZA 1E3MA 4IVQA 4HAVA 3SJCA 2GJ9A 2ORIA 4DLSA 1E2NA 4RFVA 2NMVA 3LBNA 2O8BB 1T0HB 3LXXA 2HV8A 4R2HA 1JEEA 1W1WA 5KU1A 1EXMA 1N6HA 4ZI2A 2QQEA 4MKGA 4B71A 1C1YA 4NHOA 3RRZA 1N6KA 1SXJA 2NTYC 3PUWA 2ZE8A 4RD3A 3PUZA 1Z0FA 2IUTA 4G5GA 1U0LA 2WWYA 2ZRKA 3A8TA 1KI1A 1MH1A 1NG9A 5EXPA 1ZCBA 1UJ2A 2WV9A 1XD2B 1CRQA 3FMPB 1P2SA 2C8VA 4AG5A 3HR7A 2GVZC 2DCUA 4AC9A 1G8FA 3M6AA 1Q21A 4Q03A 4B74A 2BC9A 3ADBA 5DNYB 1LNZA 1W4CA 3OEHA 4K8OA 2HCJB 3OF5A 3F8TA 2GEVA 1E2QA 2J0UB 3SS8A 1CJUC 4AIIA 1VCIA 4NCIA 1XWIA 3SBDA 2V7QA 1I4LD 1XPOA 1NN5A 5JS8A 1N0WA 1G3RA 3WYFA 1SHKA 4E03A 1ZAKA 3L8YA 2BM0A 3OIVA 1PZNA 4PPNA 4ABYA 4ZPXA 3AB3A 3SNHA 3VAAA 2CL6X 2QZ4A 3RRNA 1S1CA 4EIWA 5LB2A 4PQRA 3ASYA 2ANBA 5FFMA 3TIFA 1QHXA 1X8KA 2BKEA 3KQHA 5F9FA 1N6NA 3RC8A 1TQ2A 4KYIB 3FHTA 3KUCA 1GNRA 4TSFD 4CEIB 3HJNA 2OUKA 5AJVB 1WP9A 3VR1A 1AJEA 4CRWB 4M1SA 1OYYA 3R7WB 4EQ6A 3CBQA 2XZPA 1L2TA 3VU9A 1G8HA 2W0MA 4URYR 1IQPA 3AVVA 2GRJA 1TF5A 3WXMA 4C0AC 1YJ5A 4NZYA 3DL0A 4I1VA 4ZKDA 1OH8A 3NVAA 4XVUA 3IHWA 1OHHA 4IFEA 3CNNA 3TR0A 3ZH9B 1Z0KA 3CPEA 1MV5A 5BN3A 1U0JA 1T3LA 2GZAA 2ZRGA 2JDIA 1VECA 1COWD 1WCV1 2WOJA 4DVGA 2PCLA 5B2ZA 3C14C 2FSIA 3B82A 4D0LB 2RHMA 2CCJA 2ZE7A 3RSOA 5AJYA 5CDFA 3VFDA 4A9AA 2B21A 4ESVA 1IM2A 4Q7MB 4KBGA 1MR3F 5FOSA 2F1IA 2IYQA 5A0FA 1XRJA 2WIBA 3QE0A 4E07A 4B3GA 1S3GA 1XJ0A 2BBTA 3HPRA 1JR6A 3SZRA 4JLAA 1J90A 3GEIA 3IEVA 1AK2A 2F55A 2J41A 5EE0A 3TUZC 2ZSEA 2ZE6A 4JT4A 1ODFA 3TJZA 3B1ZA 4LHXA 1F2UB 2A78A 2C9CA 1NMXA 3K9NA 2WMNB 3QSYA 5KPDA 5KNDA 4TYWA 2DBYA 4OQFA 3AQ4A 4HLUC 4A0FA 1G64A 1Q3HA 2AD1A 4M21A 5LDDC 4PZYA 1PLLA 3MLEA 1RRPA 2RGAA 1E4YA 3SOPA 3TSZA 1JQJC 1W36B 3K09A 2J9RA 1OXVA 4C2TA 4ZDKA 2Z43A 1R7RA 1Q0UA 4QXAA 4JS0A 1XJCA 4C7OA 1NP6A 5KNBA 2F6RA 2HT6A 1EGAA 3VR6A 2J7PD 1PLJA 1ZP6A 2W2XA 2WWIA 3LX5A 4F93B 1DBSA 1S9HA 4M1MA 2C77A 4BRUA 4DUGD 3SFZA 3AP3A 1W0KA 1TQDA 3ZZ0A 1TU3A 2Z0MA 4CVNA 4JKIA 2QRNA 3VR4A 1Z6GA 1HE8B 4OHXA 1OLOA 4DLZA 4Z8YA 1XEXB 3RS0A 1Q12A 3MFYA 3SYNA 4LJ4A 4EFLA 5HKKA 5L3SA 2GCNA 3FB4A 1ESMA 5P21A 1G5TA 4G5OA 1ZRHA 1DOAA 4DSNA 2EYQA 2ONJA 3OAAD 4WAUA 3EZ2A 2C9YA 4Q9JA 3OE7A 3QF4A 2H92A 4JL6A 4BLQA 1G8PA 1YZNA 4NTZA 4QNRA 3GQBA 3A1VA 2QPAA 4GRAA 4N1AA 5FUWA 4XWAA 2GJAA 3HU2A 1ZNYA 4GT1A 3CR7A 1NIPA 1TNDA 4EPRA 5F9HA 3QXSA 2NPIA 4CEJA 1OKKD 4WBSA 1EG7A 1OH5A 1NY6A 3T5GA 4CDGA 3T06B 4EJSC 1HE1C 2RH5A 5KOYA 2GCOA 2WWWA 3DM5A 2D3WA 2VP9A 4IVRA 2P0EA 4M1WA 4QBHA 4YMTA 1TU4A 1RFLA 2WOOA 4L9SA 4MH0R 1OF1A 2FV8A 3I4LA 1ZMXA 2AD5A 2J3EA 5EP2A 5TY0A 1N6PA 1Q3TA 2HLDD 1FQKA 1DVRA 2CLSA 4KVGA 3KTAA 1XF9A 2W2TA 1AN0A 3ICEA 5G40A 2PMDA 1Q1EA 1GG2A 2CHGA 2WSSD 4KV9A 4D25A 4D4KA 4XTCS 2JJ1D 1XEFA 4TMWA 5TXGA 1P9RA 4AYWA 1TEXA 1XMJA 2FH5B 4B3FX 4DLWA 3K9LA 4F4JA 5JWHA 4HEJA 5JSZB 3TUJC 2VSFA 3V4FA 4F38A 4QRHA 1E9AA 4MRVA 1S0UA 3OFNA 4TL7A 4GZLA 2GK6A 3QBTA 1UDWA 5JCPA 1GSIA 2C5LA 4N0EA 1UBGA 1AIPA 3RSLA 5HR5A 1DAEA 2ZPTX 4DLXA 1WBDA 1ANKA 5HZKA 3AKDA 2WJIA 4NYIQ 2D4HA 4QGGA 5AJZA 3ZJYA 4BLTA 3W3AA 2Q9CA 2OFXA 3FMIA 3NG1A 4L15A 4Z54A 3T1TA 1PUIA 4MKHA 1NJFA 1A2BA 2WM9B 1NY5A 2HF8A 3CRQA 3GFTA 1NVVQ 3U7GA 2XOKA 3CX7A 1RJ9A 3NWJA 2CHQA 3H84A 2FSHA 5D3MA 4M9QA 4UKDA 2BHRA 1WE2A 1GILA 3CF2A 5FOUA 1E99A 3U3RA 4HAXA 4AD8A 1OW3B 3A1WA 3ZVNA 1E96A 2CMKA 1XJQA 1CR4A 1G16A 2CJWB 3CRMA 1E0AA 4AKIA 2QY9A 4HZIA 2XAUA 4MRPA 3RYTC 2A5FA 2FFQA 2XNDA 4A0RA 4XVQA 1N0UA 3MSXA 3P4YA 3DO6A 1DAHA 3CUEF 2IYRA 1N3BA 4NDZA 1QRAA 2FGJA 4U00A 1FX0B 1TQ6A 4DCSA 4DLRA 1JB1A 3FKSA 3AVTA 4O3MA 1GKUB 2UZ3A 3ZZUA 1ZIPA 1N5KA 1VCOA 4TN1A 2ONKA 3OEEA 3BH6A 1KO1A 4QBIA 1QG4A 1HA3A 5GJBA 1VG1A 1VG9B 2ZUBA 3BAFA 1JPJA 2BWJA 2NO1A 2WKPA 3WMEA 4C0HA 4DZZA 5EZ6B 4Q4HB 4CEHA 4O2LA 1GWNA 1E0SA 2ZRDA 3KFVA 5E7IA 3P4XA 1CR1A 2WIAA 5IF9A 2J0QA 4IDPA 5G53C 4UNRA 3KX2A 1OH6A 2NPFA 3LQRA 4X8LA 2LKDA 3CR8A 2RGNC 4JLBA 3K0FB 1XFAA 4GPTA 1ZM9A 2PBRA 1SGWA 4K81B 4PC2A 1Z8FA 2ZI6A 3SYLA 3EASA 1J7KA 5CB8A 5LD2C 4D0GA 3NH6A 4RCYA 3HDTA 2A5DA 4GOXA 1NLFA 4CIDA 4JIMA 2XJ9A 3EAQA 2CL0X 5IDVA 1KK0A 2BDTA 4Q4AB 4Q1DA 3TNFA 4NU0A 4URVR 1CF4A 3SQXA 4O2RA 3LW7A 3AKCA 4L9WA 5UKDA 2CLDX 1N5JA 2IHBA 4JBYA 2FZ4A 3OIWA 2PJZA 2ZRJA 4Q21A 1X1SA 3W5IA 3Q7PA 3U5ZB 1NVWQ 3LAWA 1RYHA 2VHQA 5TB5A 3QKSA 3BH7A 4TT3A 4KI0A 5DE3A 1KSHA 1GZSA 4DB2A 4PO8A 4TTPA 4D80A 4HAWA 1IN8A 1ZJ6A 4B33A 3K70B 3SHWA 4Z1MA 1WMSA 2ZRAA 4D6PA 1OXUA 4OHVA 1CJVC 2R6GA 4QM6A 3CIOA 2IYUA 4OK6A 4US0R 4OQXA 4ZCIA 1JAIA 3B1WA 4YLGA 4PQFA 4PANA 1ZNZA 2N42A 2BM1A 2WVJA 4BECA 2YWGA 3QVUA 1JNYA 3ICQB 4OHWA 2BMDA 2QAGB 1A1VA 4DB4A 2DWQA 2R8RA 1IBRA 4FINA 4EAQA 4LC0A 2OT3B 2IBMA 3LBHA 4IW3B 5GVRA 5ELXA 5FL7A 3GJ7A 2UKDA 1TQ4A 3A4MA 3K0AA 3WRXC 2NZJA 4RD1A 3WNBA 3T12A 4V0LA 1HY3A 4JZKA 4DSTA 3TKLA 4DDTA 2ZU0C 5C1BA 1LF0A 2GXAA 1NBMD 3SR0A 3IIKA 3LNCA 3TW4A 3FMFA 3TR5A 1KDTA 3E70C 1BYUA 2FEMA 3AP2A 4JVLA 1KOFA 1NN1A 2R6FA 4HAZA 3TSWA 5JJKA 2GNOA 2ZRIA 4PZZA 3GLFE 2XXAA 4PAQA 4A8JB 1GL7A 1P4SA 3RWOA 3W5JA 4DEXA 3C8UA 3FE2A 3NBZC 1U8ZA 2PT5A 4Q7JB 5E4FA 4QHTA 1RC8A 3THYB 2O8CB 3BFKA 4JLMA 2WWHA 4KFUA 4MYUA 5DISB 1GDDA 3K0EA 4KSCA 2VHUA 2DFKB 3AGQA 2ZRHA 4M8NE 5BW8A 3GJ8A 2Q3FA 3EZ9A 1SXJE 1W0JA 2YWFA 1EWRA 5HE9A 3EPLA 2JCSA 4C0QC 1VDZA 1WQ1R 4F4CA 4ZIRA 1E2JA 3RLFA 2VH5R 3U3MA 2QGNA 4LSGA 1J70A 4MGZR 2IYXA 2F3TA 2CLCX 2DYKA 1T5LA 3GLIE 1N6IA 3PUYA 2IX3A 1T6NA 1EFRA 4I1OA 4LJ9A 3WBKA 2X19A 5FPTA 4ZDJA 2NQ2C 3UATA 5J47A 4PFSA 1J8MF 1P9WA 4NKRA 1G19A 4TQAA 2IF0A 3ZD6A 4LHZA 5KHOC 2ERYA 2OO7A 4PC3A 2ZROA 1YU9A 1Z06A 2QMOA 3GCGA 4TYQA 4DDVA 3WYGA 3EWAA 4KAXA 1CS4C 1SHZA 3GEHA 3UG6A 3K70D 3GLHB 3VNUA 2ZSAA 1P73A 4FCTA 1NI3A 3IQXA 4Y0VA 3GLFB 2QE7A 1GITA 3LVRE 3LXRA 3K53A 3TAUA 2V1XA 2IXFA 2PEZA 3IO3A 1UPTA 3B13B 4UNNA 1OIWA 4A6XA 4HZUA 2P2LA 1FP7A 1FUUA 1AM4D 4HLDA 1P75A 4QNMA 3KJEA 2V6JA 2GBLC 1CJKC 4ZDIA 1KK3A 1VTKA 1BO6A 1PJRA 2B92A 4NBSA 1SXJB 1Z6TA 3EXAA 2IS2A 3LY5A 3PEWA 3EA5A 2HEIA 4DLYA 2IS4A 5EE9A 421PA 1Q1QA 1KI4A 2H8KA 4XTRA 1EX6A 1ZNXA 1LS6A 2MSDB 2Z4SA 4UQOA 2HUPA 2FPMA 2QAJA 3DZDA 1DS6A 2QG6A 1ZUHA 3WP1B 2PEYA 1YR8A 3NBXX 2OM2A 4V0KA 2OE2A 1AS0A 4ARZA 2EFCB 1ZM7A 1ZBDA 1KI6A 4D82A 4DLTA 3LLMA 4C0LA 4JYBA 4XH9B 4A2WA 4OI4A 3EX7C 1II8A 2DFNA 1LTQA 2GDJA 4OHYA 5CK5A 2G0TA 1F3OA 3HU3A 2F1JA 2QP4A 1F6BA 2IWRA 2IC5A 1XU4A 4BE7B 4BEBA 1D6JA 621PA 1VG0B 4JBXA 1G7TA 3RS5A 2UVQA 1KJYA 2V6IA 4KU4A 3ONWA 4YDHB 1G4AE 1JR3A 4Q7KA 1U99A 3IUYA 4LPSA 3PJRA 1FTNA 1OIVA 3B2EA 1DO0A 3T1OA 5DN6D 4DWJA 2X2EA 4B2LA 1C9KA 2VO1A 4W7SA 4N0DA 2Z5FA 4POAA 2AK2A 5B64A 5DI9A 2Q21A 5JEDA 3B1VA 1LV7A 3KUDA 2W6JD 1JAHA 4FXPA 3UG7A 2ZE5A 4PPQA 1BIFA 2OILA 2GJ8A 2J7KA 1SVSA 2CBZA 3LFUA 5FPYA 5KDOA 2QQ0A 1E79D 3P27A 1AS3A 5EXSA 3RVBA 2ZITA 2EFEB 4Q4LA 4EQ6B 2F9LA 2JJ8A 2VRWA 3LLUA 1KZGB 3QXHA 4LCBA 3VU9B 3SFVA 2ZJ8A 1VCMA 4FI3C 1XXHE 4LBVA 5JWOA 2OXRA 2QGZA 4DSUA 1LF5A 2OFWA 3B8HA 3EARA 5FPHA 2OCYC 1X1RA 1XTJA 2EFGA 5E7MA 4AYXA 4KVAA 1YHNA 2QT1A 4D4LA 1KJZA 5AUNB 4PSVA 1FFHA 1GRRA 1U8YA 2CNWA 4TL6A 4FMBB 5FOWA 3I92A 3QOFA 4XSHA 4ASUD 3MWKA 1UBEA 2MMCA 1ESNA 2GCPA 1M2OB 4R71A 1C4OA 5KTYA 2JLUA 4B6EA 1Z3IX 3ADKA 2H17A 2OAP1 1NLZA 1QDEA 5JZVA 1T91A 1F60A 4MGIR 3ZD7A 3UXMA 5FTLA 2V8OA 1UKVY 4FIDA 3NDPA 2EW1A 2ZXUA 1J99A 4PHFA 3THOA 2E1RA 4ESHA 1UBFA 1Q44A 2R2AA 5EP1A 1IN5A 3SC3A 3K70C 2GJKA 1E9RA 2XTNA 3KXLA 2NG1A 1E2MA 1K5GA 4X8OA 3VKWA 5J4LA 5EQTA 1XZQA 1VKJA 5K8TA 1VHLA 4R98A 1XEWX 3HPQA 4TWZA 4V02A 5KDDA 4BFTA 3SEAA 2FEOA 2ECKA 4OBEA 3AKEA 3CH4B 4IFBA 2D62A 4HDQB 3RNLA 4AG6A 3MGCA 4Q4JA 1R8QA 1YZGA 1KI9A 2DR3A 1Z5ZA 4LDJA 1CXZA 3L82B 2L0XA 1JJ7A 2PLRA 521PA 1MABA 1XPRA 4GOKA 4Q47A 1VG8A 2XZOA 3GLIA 3U7FB 4BZXA 4AK9A 5CM9C 2CHVA 3BIFA 3DKVA 3DHWC 3CZQA 3HWSA 4A6PA 1D9ZA 5GVSA 3DMNA 1KK2A 4C3ZA 5J4HA 2P6UA 2GTPA 1EESA 1E1QA 3R9XA 1QHGA 3NC0C 3NKVA 2ZR0A 4X8MA 1YZTA 1G3UA 4QOSA 1E2GA 3FDIA 3QKUA 4HLUA 4KHZA 4DCNA 1MO4A 3A4LA 3ADDA 2YV5A 2XB2A 4NH0A 2ZRNA 4AKEA 2W0SA 4LHYA 4EPVA 5JWRA 1DAMA 1DAGA 4XSGA 1GIAA 2OCBA 2FSGA 3EWSA 4UNQA 2RGBA 2ZYUX 3GMTA 4A8JC 2JAQA 4HUTA 3IEUA 4TYYA 4OI1A 4MKFA 5TV2A 4MRRA 1BOFA 4JJZA 3ZQ6A 4PPFA 3PEVA 5L3SB 121PA 2PZGA 4M53A 1ZU4A 2WAYA 2JEOA 3W6OA 1G4UR 1OJLA 3LD9A 2OZEA 2ZYWX 4Q01A 1NG1A 1Z2CA 3QF4B 4Q18A 3ZS8A 4M1YA 3W9YA 2OLKA 1OHHD 3IHLA 4ACBA 1OB5A 1AGPA 1P62B 4XD7D 3QQ5A 5DHAA 1P7CA 3U61B 4E09A 5EUQB 4XWKA 1LFDB 4CEJB 1OV4A 3RHFA 2PH1A 3OIUA 1KDRA 1R5OA 2BCJQ 2VBCA 4A0GA 1YZUA 1NMYA 2VF8A 1HYQA 1E94E 2QSZA 2REOA 5FBVB 3P32A 2ZRFA 1L7VC 2OXCA 2P67A 4RD4A 5JJLA 2WAXA 1VYTA 1UEIA 2QA5A 4XWOA 2GCOB 3I62A 1AKEA 3MG9A 3KJGA 1JALA 1W48A 2JLWA 3A58B 4JT2A 4KO8A 4P4SB 5L3QA 1GNQA 4FMCB 4WW0A 2ZI4A 3KJIA 2JASA 3CM0A 5ANRB 3IKJA 2YVUA 3KKQA 4B73A 3KTAB 4BFUA 1V5WA 1FW6A 1MOZA 4US1R 1R5BA 5AR1A 3U44A 2PX0A 2R65A 3SJZA 3FKQA 3T1VA 4EDHA 1KJWA 2CXXA 3Q7QA 4M0LA 1B23P 1M7GA 1G8GA 3K9GA 1IN4A 4NPHA 4EJSA 2GZHA 1U90A 4WXRA 4OYHA 4TSFA 4M9XA 4Y0AA 3X1DA 2FF7A 2I1QA 3CB4A 3BWDD 1ZM4A 1M74A 2CL7X 3NH9A 4LJ6A 5JLJA 3BE4A 1CR2A 3W8NA 4RFSA 3VHLB 2QM8A 1BMFA 3UMRA 6Q21A 2OBMA 4CT4B 3EZFA 4GDFA 5CLQA 2RCNA 1KDPA 2IYWA 5J40A 3UK6A 1EK0A 4JSYA 2DWPA 2IHYA 1KI3A 2WMOB 1X8LA 5FTKA 3DOEA 4TLDA 4JKYA 2WJYA 1OPXA 3CLVA 3I32A 1KKLA 1HQYE 1W0KD 1XXHA 1Z08A 4TQUS 4EFMA 2WJJA 4NYJR 3W34A 2X77A 4UXIA 1E9DA 4MYCA 1GP2A 4C0KA 8OHMA 4M22A 2Q9AA 2QPOA 4LBZA 4JLDA 2OBNA 1RIFA 5BWMA 5BQ5A 3K0SA 3SHFA 4F92B 1N6OA 2AL7A 2EU8A 1RJ9B 3G5UA 5D3MB 1WF3A 4QGAA 5SZKB 3UWKA 1YRAA 1XD9A 1GUAA 1L4YA 2A9KA 2PZFA 1GNPA 1SKQA 3ZS9A 4QGFA 2D2EA 5FH9A 5DSZA 2N46A 1MRSA 1W4AA 2IF2A 1I2MA 2BJWA 2ASEA 3M0EA 1QHHA 3H1TA 1XCPA 3ZDQA 5JRZA 4KBFA 3EW9A 2Q6TA 4KFTA 4BLPA 2ZM5A 1Z28A 3BOSA 3QF7A 4BFWA 4WA7A 3R9IA 4NYJQ 4ERNA 5KSOA 4LV8B 3B9QA 3C7KA 3LVQE 4EPTA 3QEOA 3MWLA 1LB1B 2GAAA 5EE1A 1PLKA 1DADA 1Q57A 1Z6YA 3W8RA 4G01B 2W83A 1SVIA 1YZLA 4Q02A 2FA9A 3OIYA 1NN3A 1G7SA 2ORVA 2ZI9A 2F7SA 3AVOA 4IEIA 2O8EA 1AQUA 4GP7A 4QHSA 5EE3A 4CT5A 2BMFA 4LI0A 1K8RA 1RYFA 4DUGA 3I72A 2QUZA 4CEHB 1V43A 4V0NA 1KI8A 1TEVA 4I1UA 2ATXA 2JLSA 3DMDA 1QF9A 2BIFA 4RD0A 4WXPA 2WKRA 3DVLA 4PTLA 4WZ6A 3QVVA 3IBYA 4LJYA 2GESA 3K8YA 2DHRA 4L4UA 3CZPA 2IXGA 2BCGY 3BB1A 3D6TB 3EIHA 4TMTA 3EA0A 4TMZA 2YWHA 3B6EA 3IPYA 3VR2A 2J59A 4Q1AA 3EC2A 4JBWA 3QPUA 4DIDA 5CIWA 5CJPA 1J8YF 2V1UA 4LGMA 1AGRA 1KSFX 1JXMA 2GF0A 2BEKA 1HEIA 4F91B 1TAGA 1OKKA 3QKSB 1W36D 4JL8A 4ZV4A 3ZZTA 5C2JB 2RGNA 1K5DA 2VP0A 4IRUB 4ON9A 5KSPA 4LOAA 1TF7A 2CE7A 2XOKD 3I61A 4D0NA 3T15A 3K09C 4DLVA 1M7HA 1W2GA 4GP6A 5J4YA 1W5SA 1HURA 3SE0A 3V00A 4QKQA 2J5XA 4BFVA 1N0VC 2HLDA 4L8GA 2OG2A 4U5XA 5CLLA 4KFRA 2I1VB 3SBEA 1OB2A 2VPPA 3T35A 2MMGA 3K0AB 3B7GA 4NP6A 1Z29A 3LH5A 1RPZA 1PUJA 1GAJA 2XSZD 2WICA 2JJ1A 2C2HA 4YDSA 2WPDD 2GF9A 2F1HA 3A36A 2GXUA 4ZI3A 2H57A 2F43A 2YZ2A 1CIPA 5AJXA 3PIRA 2WWGA 2RGEA 5HE8A 2IW3A 2QP3A 4QC2A 2ZTSA 2NOAA 2FU5C 1VHTA 3HYRA 4KODA 2W2VA 3BH0A 4G5SA 2XXAB 4LJAA 4GL2A 1D2NA 4LHWA 1KMQA 2RHDA 2HT1A 5B58C 2GZDA 2J1LA 1RW4A 5TVKA 4Q9LA 3U6KA 1G3QA 1XTSA 4LRWA 4LWZA 5IK2D 3BS4A 2ZJBA 2GXQA 5CYOA 4P4UA 1WA5A 4BLSA 2QBYA 4D4MA 2HJGA 2QROA 3BC1A 4DCTA 2B8TA 1A82A 1AA9A 1RRFA 3O8CA 1SULA 2ZR9A 2ZVQX 4B47A 2J46A 4LYJA 5FBLB 3A6PC 1QHIA 3UWOA 2IYZA 4ZIRB 3LQQA 3BB4A 1O3YA 1OFIA 1LY1A 3A37A 4EPYA 5C18A 3LW8A 3KXKA 3O8RA 1KY3A 2G3YA 2JJ2D 2VHTA 4TLAA 4PHGA 5DI3A 1XMSA 2AK3A 1E9CA 2QMHA 4WZAE 5CYPA 1J2JA 1KZ7B 3AEZA 4CF7A 2FDCA 3KKMA 3EPHA 2XGJA 3QKRA 1W4RA 2FG5A 2ZSDA 3QPWA 3TVDA 3QXCA 3THWA 1E2IA 4TT3D 4BGDA 2FX3A 1E0KA 3VX4A 4M9SA 5H70A 1MO5A 4Z1MD 3CX8A 4V0OA 1ZUIA 3IDQA 1YRBA 3NBYC 3U4QA 2IUSA 5IRCD 1P2VA 3AH8A 4BEJA 1XPUA 1JR3E 1R0YA 1CJMA 2G83A 3AVQA 4AYTA 1W46A 3F3YA 1KKMA 4OQLA 3KKOA 1OSNA 4GNKA 2KBEA 2ZJZA 3CRRA 4HZUB 3PR1A 4I99A 1KMHA 4TMKA 4D26A 4MUAA 3SJAA 4B3BA 4Q1EA 2O0KA 2BBSA 2RMKA 4LC1A 3ASZA 3F0TA 2VTKA 2FSFA 1S96A 4HUQA 4LJ5A 3KZ1E 4DT1A 1QBKC 3VNVA 1Q20A 1W36C 3MMPA 3N2EA 4MRSA 1OE0A 3N70A 2AXPA 3PV0A 4TTQA 3Q5EA 2WBLC 2ZRCA 1NVUQ 4JMPA 3PITA 3REGA 4URUR 4JL5A 2GILA 3QBVA 1Z6AA 5BN4A 3TMKA 4A4DA 3CWQA 4ARZB 4GZMA 4TLEA 4BLRA 3TUIC 5F2EA 2BBOA 2GWHA 1E9BA 1KI6B 3MWJA 4PHHA 1NN0A 1G7RA 2JA1A 3VKHA 5EJEA 4W5JA 2HCBA 1II8B 3RS7A 3AVXA 2EWWA 2GBLA 2W6ID 4U02A 1XD8A 3RAPR 1VYUA 1E2PA 2P5TB 721PA 1M1YE 1Q22A 2H18A 3UIEA 3THXA 2O8FA 1KIMA 1RKBA 821PA 5GADl 2GXSA 2V4ZA 4QGHA 5FI0B 5EXXA 1YQTA 3NIBA 1H8HD 5JFGA 4RY2A 4URWR 1KO4A 2A5YB 3LRPA 4IVPA 5JRJA 5KO2A 1DG1G 2FGKA 1ZU5A 1U2RA 4JLOA 3AVWA 1CTQA 2EQBA 5H68A 1L4UA 4EKDA 4Q5IA 2UZIR 1QHNA 3AVPA 1W5TA 1UEJA 2BJVA 4P3YA 4PC1A 1FTSA 1FNNA 1G8YA 3SYKA 4IDQA 4JYCA 2PX3A 2VP2A 2XX3A 3IIJA 4NCKA 1RVDA 2QN6A 3LBIA 3K9HA 3H86A 1NBMA 2GA8A 3MUFA 4I1SA 1G6HA 1HT2E 1M7BA 4KLZA 4M9ZA 4OI2A 4YMWA 4B6FA 4HDCA 2QL6A 1IAQA 1MT0A 2V3CC 1N5LA 3OESA 2PZEA 2G77B 5M04A 4LUCA 1E1RD 2JIZD 5TDHA 2HJVA 1OFHA 2KJQA 3VTKA 3ZIAD 4B48A 3FVQA 2CEAA 3T5DA 4TYNA 5IHPA 1U81A 1GL6A 4OJQA 5L3RA 4IHQA 1OXSC 3IO5A 2VP6A 3L43A 4B76A 4XOIA 2IS1A 4UJ5A 4KXFB 5BN5A 3GPLA 3C15C 3FMOB 3H2YA 2K5UA 4HAUA 5C46F 4IJMA 3NDBB 2WSMA 2ZREA 2QSYA 2REXB 4PO1A 1PVOA 4HLCA 1ZVQA 3AVUA 2YOHA 1VPLA 1NVXQ 3KQNA 1U94A 4DDWA 1X86B 4PHTA 4B3CA 2AWNA 2V54A 2ZJ2A 3VMFA 3L0OA 1FL9A 2V55B 2J45A 3RRMA 2X8AA 1JQLB 2OCAA 3NC1C 2WJGA 5EZ5A 4US2R 1T8UA 1GOTA 2QEQA 1LW7A 2TMKA 4Q4JB 4GMDA 2R6AA 2YINC 2CK3D 3T34A 1P72A 4HDOB 4LX0A 1MABB 4FMCF 3R8FA 5IT5A 1IN6A 3GLIB 5B30A 2ANCA 3AVYA 3C4JA 1E69A 4NCHA 4TL9A 5J4KA 2REBA 2G1JA 4RD2A 4AY2A 3CNLA 3S1AA 3FHCB 1IXSB 1I4DD 3G82C 1IY0A 2ZRLA 3QENA 1KHTA 4LBWA 3BK7A 4PQYA 1Z83A 1KO5A 1GKYA 3IGFA 1W47A 2JLQA 3E2IA 3P26A 1UBCA 2RB4A 2IUUA 3I8SA 4RZXA 2PCJA 2VP4A 3QI2A 4UNSA 1NIJA 1SVLA 2ERXA 1DAFA 4FWIB 2JGNA 3Q8XB 2NO6A 3CPJB 2O0HA 4YXWD 3M4YA 1WDTA 4RZ3A 1OIXA 5C4MA 2KI5A 3QEJA 1GRNA 4PSAA 3GLGE 5AK0A 1S4QA 2C98A 5FBQB 1RE0A 5CK4A 5SZIA 5KSYA 1ZD8A 1G3MA 1VIYA 5FR1A 5HPYB 1BKDR 1KO8A 1T8TA 3EIQA 4LYAA 1KI7A 5C4GB 1FP6A 1X8JA 1T4GA 2PLFA 3D31A 4RKFA 2CNWD 2IYLD 1NL3A 2AX4A 4A15A 3LDAA 2X1VA 5G41A 3OHMA 4C4PA 2QTFA 4EPXA 1M8PA 1OT3A 3GEEA 3C5HA 4M1OA 1BH2A 1XMVA 1T3HA 2NO7A 2HF9A 2JLXA 3FWYA 4KSBA 4NYMR 2ZEJA 2OEPA 2W00A 3U7HB 1P2TA 1P2UA 3AF3A 1E2HA 4TLBA 2VSXA 1VYVA 3RDPA 3B78A 1ZYUA 2ZS9A 5L3QB 3DPUA 2ZYVX 4O0MA 3V4RA 1IY2A 2PL3A 4G0NA 4NONA 3KQKA 3FOZA 1R0WA 2E87A 2FN4A 4A2QA 4I4LA 4MGYR 3U44B 2AFHE 4TMXA 3GP8A 1YR7A 4TZ0A 2OCPA 3TBKA 1SXJD 4PAMA 2W6JA 1Q1BA 1HTWA 3DM9B 3J81k 4EJSB 2DB3A 1A5TA 2DFLA 2P5SA 3E1SA 3ZYCA 1F2TA 4G3XA 1E79A 5EE5B 2IA5A 2QI9C 3TAHA 3QG5A 3RWMB 1H8EA 2Q9BA 4RFSB 4ZO4A 5FOVA 3RRYA 3UPUA 2FFHA 2J0VA 3K0CC 5FBRB 4Q9KA 1TX4B 4LV5B 4IKEA 5F98A 3U7EB 2QU8A 4IDNA 1AS2A 3LV8A 3KB2A 2ODBA 3OEHD 5EP4A 1KYIA 5AUQA 2QAGC 3NBFA 4Q9HA 2QTVB 5KNCA 1YE8A 1VIAA 1XXHB 4B2IA 3HU1A 3GFPA 4TL8A 5FOXA 5K8LA 4A1FA 5J5CA 4EFNA 4IEEA 5JECA 4Z51A 2EFDB 2CCKA 2V7QD 3D8BA 4ASUA 1HH4A 4NE2A 1UF9A 4Q9IA 4QJ3A 5CM8B 4RVCA 2O52A 1ZC4A 2NZ8A 4PAOA 4C7OB 1EFHA 1TADA 2WKQA 1Z0DA 3AF4A 3EZ7A 4C0SA 1QG2A 1D8TA 5FI1B 1JI0A 2G6BA 3CKLA 4DBLC 4FCWA 1XTKA 3RABA 2H5EA 1E9EA 2N1BA 1HV8A 3Q85A 3SJBA 4KITB 4A36A 4RKEA 1T0JB 3VR3A 2O8DA 2D06A 2Q0HA 3IQWA 3Q72A 3QJYA 1ETUA 2ZQ5A 3BGWA 5JHGB 4R2IA 3LO5A 2IL1A 3F5FA 1G20E 2JLRA 1G291 4G1UC 1R6BX 4QBGB 3A1UA 1QHHB 4GBMA 2ZI5A 4Q1CA 3LA6A 3FFAA 4Q00A 4P32A 4KYUA 2VIIA 2YC2C 3ZVRA 3TSOA 3U6BA 1LS1A 4V0ME 3GJ4A 1D5CA 2FMXA 2Q3MA 1IN7A 1G21E 4B2PA 1X6VA 2AN9A 2GETA 2NIPA 1B0UA 2P65A 1DAKA 221PA 1XBTA 2KWIA 1JJVA 5KDLA 3V9PA 2YOGA 3H0KA 4OJKA 4BUJA 3C16C 1Q1ZA 1PV4A 3PXGA 2JDID 4HB2A 4LJ8A 5DYIA 3UANA 5KPJA 1P9NA 1QVAA 4MKIA 2FWRA 5TMPA 1DAIA 1ZC3A 3RS2A 3CRVA 1G41A 1TL7C 5AUPB 1Z2AA 5CITA 2O8EB 1NSTA 2VA8A 1U9IC 3AV0B 4OK3A 1TMKA 3DEFA 2P6NA 1XNJA 4PZLA 2J0SA 4ZCMA 1E9FA 1E0JA 3KB1A 4PX9A 2B6HA 5JI2E 2DWOA 5F3WB 2IYVA 1F48A 2YOFA 2IYYA 2RAPA 5DGXA 1E2EA 2QNRA 2ZETA 2KSQA 4RZ2A 4BWYA 1AZSC 1SKYE 3RC3A 1YR6A 5DHFA 3I8XA 1BMFD 1G18A 3ZGXA 1NNEA 4NCJA 4MITA 4KCGA 2IK8A 4GSYA 1U98A 2ZVPX 3MCAA 2Q3HA 4MGKR 2VF7A 4RD6A 1P60A 4M2LA 4JLJA 2FFAA 2QPTA 3AKYA 1XEWY 3PQCA 2MSCB 1WBBA 5LBIA 2ZRPA 3DZ8A 1DG3A 1Z0AA 4XD7A 2ZRMA 2OESA 3WNCA 5LPNA 3GLGA 4D2IA 1JXOA 3ND8A 5AJWA 1S3SA 3TRFA 1SXJC 2B7CA 3AGPA 2QORA 4C9BA 5CIQA 1FQJA 1SZPA 2F3RA 2IWHA 5LD2B 1US8A 2ZJAA 2ATVA 2RGXA 2OLJA 4R9UC 1GFIA 1N5IA 2C78A 5E3HA 2GEUA 4YMSA 5GJVC 2A30A 2PT7A 3C41J 3QG1A 4IOLA 4M1KA 4WVFA 2AXNA 2ZI7A 1K6MA 4DJTA 3KQLA 1VMAA 1COWA 5D3QA 1R2QA 1UKZA 2VHJA 2O8BA 1SQ5A 2VHCA 1KSGA 1BS1A 3B1XA 3BFVA 4Q48A 2ZJ5A 5FTJA 1KSJA 2OAQ1 3IILA 3CNOA 3W6NA 4B3XA 4B35A 4WOPA 2XTMA 4V03A 3RS3A 5BXQC 2F9MA 5HKKD 5J4VA 2KBFA 2ZANA 4E22A 4MDFA 1HT1E 3ETLA 1SKYB 3NXSA 4BZQA 2Z6VA 2G0NA 1TF2A 1F5NA 5FTMA 3OE7D 3UMFA 2I4IA 2YNMA 2F43B 1KNQA 3QY0A 2ZUDA 2G88A 3VX3A 1H65A 2ZSBA 4A2PA 1BYIA 2C04A 3SDZA 3MRSA 2D7DA 4ZKEA 4H1UA 4GMXA 1XD2A 4YQFA 4DSOA 2JLYA 4LYHA 1UKEA 2B7BA 2I3BA 3FTQA 2W58A 3PG5A 1NLYA 5SZJA 2IS6A 1AZTA 3WP0A 4DCVA 2HDNB 3KFXA 4DLUA 5SZHB 3ND9A 1KY2A 5G3ZA 2J0UA 4BQSA 4TQ9A 4II7A 3JVUA 4F7WA 5HCNA 4OQMA 2B8WA 4MYHA 3CF0A 2EYUA 3WMFA 1OXTA 2BKUA 3KKPA 3BERA 4BFXA 2KB0A 4JLVA 3WNDA 1Z07A 2R62A 2PMKA 3EC1A 2QBYB 3NTUA 4FMDB 1RRCA 5H8WA 5AUOB 1LVGA 1NKSA 2H16A 2V9PA 1IXRC 1KAGA 1T3SA 5CB6A 1OXXK 1S8FA 1EFUA 1G6OA 2VP5A 2WJHA 2J7PA 4B3DA 3HP1A 1GL9B 5EP3A 4A92A 2VL7A 1G17A 3RS4A 1KI2A 3WHLA 4W5WA 5JJIA 1E98A 5DI3B 1E4VA 5FBWB 5EUMA 2C03A 2YJTD 5DIFA 2QTHA 4QBFA 4CEIA 3KL4A 3WBJA 3QKRB 4DCUA 5A4JA 2CVFA 3THWB 3JVVA 3R8CA 2FNAA 1GRQA 3R7WA 4RCZA 3I5YA 4IDHA 4C2UA 4LY6A 2CE2X 4N3NA 1IONA 3O47A 3OAAA 3OFND 3VKGA 5H1YA 3IIMA 1R4AA 1Z0JA 4EPWA 1P61B 3M1IA 3GJ3A 3U3KA 1UFQA 3U4QB 3JZAA 1AQYA 4WIAA 2YC4C 2RGDA 2BMEA 2AWOA 1QZXA 2ODWA 4V0MA 2G9NA 5TARA 5JCZA 4P4SA 5HZHA 3D3QA 1DTSA 3MJHA 2GJSA 4MA4A 4NYIR 4R7ZA 1CJTC 4PPGA 1TTTA 1KMHB 2WWFA 4QHYA 4J0QA 1Z0IA 3O8DA 1FMLA 4L16A 4RZUA 4URXR 2GVDC 1G1MA 4YMUA 2XTZA 3ADCA 1OH7A 5E7JA 4HUQB 1IHUA 1CLUA 4DT1B 1SVOA 5FOTA 3K1JA 3VHXA 2QMEA 2PJRA 1NVVR 3A1SA 3TE6A 2VEDA 2EVWX 1GM5A 2FPKA 4TTRA 3PUXA 4BFYA 1KNXA 3GJXC 3AUYA 2BEJA 1F2UA 2ZIAA 3NEJA 4ZDWA 5FPKA 3DKPA 1WXQA 2GHIA 5FPSA 1A2KC 4OQNA 1E2DA 2NO9A 3UKDA 4BFSA 1NBME 5BYJA 1UADA 3FGNA 4HI0E 3CW2A 2MSEB 4URZR 5L3VA 3TH5A 3WRYC 5JI3E 3QKTA 2WSSA 4IOJA 3SI7A 2XNDD 4MRNA 3L0IB 2KE5A 3B9PA 4DC9A 1CP2A 2RGCA 3N2IA 1FNMA 2AHOA 3X1ZA 1D2MA 3W6PA 1Y3AA 2AKYA 2YHSA 1EWQA 4HB3A 3THXB 4NL4H 1JBKA 5JHHB 2O8FB 3GFOA 3BB3A 1E2FA 2FJUA 3QXXA 1Z63A 4NCNA 3FKSD 1N6LA 3X2SA 5BYKA 2OSBA 4XIGS 2XEXA 1X3SA 1E2LA 1NJGA 2ZU6A 3OEED 2ZJYA 1VCNA 3FFBA 1S2MA 5KUTA 2ZS8A 4BRWA 4TLCA 2WHXA 4IXMA 4B34A 1M6NA 1FZQA 3EG5A 3ZQJA 5DH9A 1UKYA 4FW9A 2OBLA 3PCRB 1SVMA 1RRGA 1XCMA 3QPVA 4OK5A 5HTKA 4AKHA 3AF2A 4C0JA 1DARA 4FWTA 4TZ6A 2QP9X 2XZLA 1XP8A 2J87A 1XEXA 3Q5DA 1XB2A 2GAOA 4LHVA 1R0XA 4ZCLA 2DFTA 1I2DA
chains in the Genus database with same CATH superfamily
1WXHA 1ZM3A 2J8ZA 3N05A 5FO1A 3ZE0B 5BP7A 1ISFA 3TWOA 2R87A 4PXAA 2O2XA 2E55A 4EQZA 1Q0RA 1V5GA 2E18A 2GEDA 2XGSA 1TXGA 4RJLA 1HLPA 1OXBB 3ABZA 1YJXA 4UCFA 5DLQC 4BBZA 2WPDA 4DEYA 1H2FA 2LKCA 1LKZA 2D2FA 2ZAOA 3MD0A 5IAGA 4D43A 4ZYXA 3B8EA 2QENA 2OBYA 1UT5A 2EW8A 1U0GA 3AUXA 3IIEA 3JW8A 4GF5A 1FSFA 4OFZA 3TJMA 2GI4A 2CZQA 4AMYA 4WBNA 2DY1A 2I8LA 3B5JA 1MKYA 4I55A 5FL3A 3O26A 1PQ4A 2OPHA 3JATB 1NI5A 1NMZA 3PPIA 5ESXA 2RI6A 1LLDA 5E8RA 3QU5A 3UAXA 3ZHYA 1HYGA 4OMFG 1NF3A 2LIVA 4OM8A 3R9KA 4BATA 4ZMRA 4F9TA 4W9NA 3U4AA 4MWZA 4CKEA 1P81A 2PGLA 3I42A 1N9ZA 2XNCA 3PA6A 2Q1XA 3RADC 4RDCA 4XVRA 3SZMA 2ZBUA 2EJUA 4PQEA 4QDUA 2VNSA 2HTEA 2QD3A 2GN0A 3JQGB 3ZY4A 4ZCPA 1KAOA 3EAGA 5BN5B 2OHJA 1L7NA 1B8OA 3HL0A 2AKAB 1ULZA 2IXEA 3DOFA 3FM9A 5JVDB 1KDZA 1FMJA 3IQDB 4WJKB 3L7YA 1YRLA 3QX7A 4K9KA 4M1TA 3D5QA 4YCJA 3S68A 3OZXA 5HIAA 2R00C 1W9HA 2IUFA 5CDUA 2SBTA 4MUGA 3TQCA 4L7VA 3U62A 3WKBA 2XHZA 3I0ZA 3GDFA 2B4AA 4G1FA 4MJ3A 4Y2JA 5H5JA 3HM2A 4JJKA 1AH2A 3PQ5A 4ID3A 3FWHA 1WB9A 4PINA 3BA6A 3QU7A 3DKRA 4A5OA 4LYFA 5HQ3A 2WHPB 2XUPA 4MCIA 3IUSA 2B99A 4HB0A 1NUQA 5EPUA 4B6RA 4AAYA 1BXRB 2BH2A 4TYMA 4W8OA 1QZUA 3W90A 4KXMA 3ZY5A 2DRIA 4X64B 1U7PA 1O9GA 1PJ8A 2QTTA 3DV2A 3CRW1 4D6XA 2CLHB 4AKGA 1W6UA 1ZVKA 3GUUA 2YMLA 5H3HA 3EIWA 2ZTVA 5TQVA 4B6QA 5A5FA 3CNQS 5A62A 5JSZA 4HLNA 1RM0A 3GJ6A 3VQTA 4C2AA 3L7CA 1JEDA 1FP2A 2MSWA 2YQ4A 4D9JA 1ADGA 1SIOA 3LHKA 3HB7A 3G0HA 5GOTA 5U9CA 3ZWYA 1YKSA 2BOVA 4G1BA 5FB3A 2C88A 2C58A 2WU1A 1JR2A 1VOTA 3PQ6A 5COAA 1ZW6A 4KQJA 4JI5B 5LB4A 1B1AA 4CFZA 3H11A 3WQBA 4DM7A 4F9FA 2PD6A 1Y5RA 3TN7A 7MDHA 1UAAA 3JQ9C 4HNUA 1V4BA 1JFRA 4LV6A 1CQJB 3ZZ1A 2P2NA 5CA0A 4RY8A 3X1XA 4J0DA 1CEEA 3L04A 3H8VA 3EYWA 4TMVA 1E7RA 1YFZA 1XV5A 4OHZA 3DNMA 5TMBA 4B4DA 4YT2A 3OUTA 2Y6VA 3RYIA 4CLDA 4RLFA 3T3MB 3OZRA 5DNAA 4IHJA 3GX1A 4MVWA 1SBYA 4Z8XA 1CULC 4GM4A 3MTBA 2LWIA 5B3LA 3SN6A 1HKHA 1UAYA 2RJNA 3ZUPA 1EFVA 2ZBQA 4IH1A 1I7DA 2FWPA 4LZZA 5JMTA 4MR9A 2QVGA 4Z0NA 3GNSA 4XYLA 1E9SA 2SHKA 1DKLA 1LBEA 3JQDA 4PONA 4I3HA 5A5GA 2IYSA 1UH5A 1CR0A 3QLTA 5DO9A 1H2RS 1NOJA 4IXDA 5KCMA 3ZWPA 5JYEA 5MDHA 4JJGA 3WSVA 2BV3A 2CJWA 1TMGE 3Q2OA 4Q7LA 2HHAA 4XB2A 1PRYA 3TW0A 1S8AA 2ACVA 1VSVA 1JFFB 1I51A 2IEAA 2PL1A 1HZJA 3V8PA 4JUFA 1RWOA 2NUAA 1YZQA 2YYZA 2WAMA 2ZI3A 3D59A 4G37A 5AVZA 3CSUA 4R9NA 2O0JA 2DXIA 3QTBA 3IVXA 2BGJA 2QVYX 3GP3A 4IH9A 4C06A 2ONZA 1U5CA 2LBPA 2VPTA 3GZJA 3E2MA 4Z7OB 1HKUA 2QE7D 5ENVA 4B32A 4F96A 5CB0A 1FXUA 2JATA 1CY6A 3O1IC 3I1YA 2RHLA 4O0LA 1LSJA 3CWZA 4TVSA 2XYHA 3DUWA 1Y7LA 3W3ZB 3ZOKA 4FNGA 4ER5A 2POCA 1SC9A 4PSCA 2C00A 2G63A 3PNPA 5LA6B 1WP4A 3NEYA 1V7QA 3F8WA 1QUFA 2A0YA 4HB4A 3DBLB 2QTMA 1YSCA 3WMGA 3QE9Y 1C3EA 4OOFA 3HZRA 4RVHA 1XZJA 1EQ2A 1GO2A 1C5KA 2OV8A 3NIDB 3ESRA 3OCZA 5FUXA 3TBHA 3U49A 3UMSA 4DWWA 4J03A 4YT8A 1N77A 3EB9A 4WV3A 5D7BA 5GTDA 3BTVA 2VLIA 3GRKA 3R74A 3C7DB 4U9HS 4H17A 4TVBA 1MIHA 4GM0A 3ONFA 4X41A 5CT5A 1A88A 1G2IA 1SUSA 4DXAA 2IKQA 4MQMA 3IBGA 3OJXA 4JU8A 3T6KA 3U4HA 4MR8A 4QJ4A 4W5HA 4AWBA 2DHQA 8LDHA 1IHYA 4G5QA 1J20A 3GD7A 3S4YA 2B1QA 3L7AA 4X1OA 4AJ2A 1FFYA 2JIPA 4TLLB 4WN9A 3WY9A 3T4UA 3AM1A 1YS9A 2H1RA 3BWVA 4R3NA 3ROZA 2EP7A 3EC7A 3ZPXA 4EUNA 3GT0A 2JLVA 3OZSA 2FG6C 3LX8A 2C96A 5AVOA 4XUGB 5JARA 3B85A 3Q0TA 3UH0A 2V03A 3FAZA 1Z0ZA 4INJA 2H1HA 4N3CA 5IS2A 1VGRA 3Q3JB 1JR3D 4D57A 2CDRA 3RC7A 1OFUX 2D0IA 4JN6B 4M88A 3U0VA 2IUYA 1CZKA 1NVBA 1FFEA 1FSZA 3IA7A 1W7AA 4XW2A 2C97A 3EQ2A 1PWZA 3QTLA 4OSEA 5FHQA 1HUQA 1Z6XA 4CDNA 1GTVA 3HO1A 4KYVA 2XB4A 4QWWA 3WGGA 5CYGA 3I73A 1QRDA 2RARA 2WZBA 3HVUA 3LG2A 4TYPA 3MD9A 1U7HA 3CJRA 3A9UA 1IQUA 4IIHA 2QAGA 3KYCA 2CFOA 3QYFA 1JLMA 3P52A 2I6TA 2J9GA 3C70A 2Z83A 2J5QA 2PY6A 1Q0ZA 3CN9A 5D86A 5TMDA 3R7LA 2HCTA 2ZR8A 4O1IA 4P3KA 3SC4A 5JBQA 2R8OA 3AF0A 4OLAA 5F7XA 1TO1E 5JJ5A 4OLFA 9LDBA 3IAS1 4FT4A 4UOQA 3VI3B 4LBYA 3H4MA 3X1MA 3L0PA 2BVNA 1II0A 4AMUA 2NU7A 4Y30A 4CZ2A 4DV7B 4JJ6A 2BGRA 1B8NA 5JTUA 2QMUA 1R3DA 3IMKA 1YT5A 3CUVA 4P4TA 3D1LA 1N9GA 4ZZ0A 3QK7A 1E6CA 2YWXA 4GP9A 4ID9A 1CSEE 3MYYA 4EA8A 4HBZA 4E5UA 4L9RA 1XOIA 1OVMA 5A4DA 1EU1A 2D2XA 1K3UB 2W6PA 3NHBA 2ZBDA 4IV0A 2HRZA 1IPEA 1CHNA 2QM7A 2B5WA 1RRVA 2RJOA 3GNQA 5C7IO 4FEYA 1NR7A 3OCCA 2I3DA 3FRJA 1W4BA 1V37A 4D96A 1WDMA 2BH9A 4KPUB 3G8CA 5G1NA 4ACAA 1RP7A 2JFNA 3THYA 4J1QA 1M2NA 2O8CA 3ZOZA 3A2LA 4C5CA 1YA4A 5I9SA 3AJDA 1Z75A 2CVHA 1GGFA 2G1KA 2ZATA 1OA1A 2LVBA 1NUPA 2X6RA 3CE6A 3K2IA 4GUAA 5C5CA 1CRPA 3LQYA 5F73A 4EA6A 3MJRA 1E2KA 4D4IA 5AIBA 4L02A 5FNVA 1BJRE 1JSXA 3O4IA 5I7VA 3KQSA 1GZVA 1AK1A 5B6JA 5M29A 3QVKA 3QI7A 2IYEA 1NDHA 1QIHA 4EITA 3ET5A 3EBPA 1Y3IA 3AEYA 4AM8A 5FQNA 5LBUA 4ARAA 2I7DA 3GLIB 3EPKA 3IC5A 4HMQA 4CGZA 3HKDB 1QRRA 4B4UA 1R10A 1PAUA 3UEOA 4XJXA 4FD2A 1VM6A 3VDMA 4JBIA 4CR6A 1ZIOA 4UM5A 1FJ2A 3FHOA 1VHWA 3GUHA 3H4VA 4OLHA 4WK6A 2OVFA 4FDTA 4LJ7A 5IM5A 4L8YA 4Q3LA 5L95A 2OV2A 1M72A 3KHTA 4NAHA 4V3CA 3UAVA 2R1UA 1SBZA 2BHTA 2QNBA 3K6SB 3FW1A 1ONBA 1UXHA 2PXHA 4ITRC 4YBRA 2MWMA 3C3JA 2Y8EA 3B20A 1SRQA 1IHPA 3UG6A 1DCMA 1EAYA 1KXJA 5JNLA 5G02A 4BO0A 1SCQA 3QLEA 1BNCA 5JDCA 4E14A 1U8AA 5JCOC 2C2YA 4UPVA 2ZWVA 1PJCA 2YIMA 1TM2A 4GC9A 4MB0A 3AP1A 5I7HA 1J1IA 2YWEA 1QQ7A 2GBCA 5FQOA 3FUUA 2GJ9A 5HMMA 2ORIA 3GAMA 1E2NA 1D4OA 4RFVA 2EC5A 2NMVA 2HMUA 3E4DA 1T0HB 3LXXA 3R6GA 2JW5A 3DD1A 1FYDA 1SC4A 4NCXA 1JEEA 1W1WA 3WK5A 3OLVA 1EXMA 1KEKA 3VPXA 2Y76A 5B3KA 2QQEA 3IDAA 4A73A 4B71A 1C1YA 1IBKB 2ZSHA 2A4MA 4NHOA 1N6KA 2B4TO 3DZFA 5AW6A 2ZE8A 1URPA 4RD3A 1NNUA 1QKJA 3KQQA 1R64A 2AOTB 3VZDA 3WB0A 4ZI7F 1ZEMA 1LVHA 1Z0FA 1EJ2A 2JI8A 1MVNA 1D7OA 1LLUA 2PWBA 2X9VA 4ND7A 4G5GA 5K0LA 2P7IA 4F1KA 5IT9A 1V11B 2RD2A 3FJOA 4O08A 4D79A 4O63O 3ZU6A 1BAPA 1QYWA 4X1YB 3ONVA 5FYQA 1Z2NX 3KZKA 4I14A 3GHYA 2Z9CA 3DDNA 4WESA 4AG5A 1J0AA 1A7KA 3HR7A 2GVZC 5FRDA 2NV0A 4IICA 4NICA 1G8FA 5EKTA 4IX9A 3JAWB 3SXUA 4FDUA 3OQJA 2W22A 3BILA 3UA3A 3KJQA 1NYRA 3B9BA 3OEHA 4K8OA 1J9ZA 4Y9UA 1F1BA 1RVV1 2X9NA 3IYLW 3ON5A 5K0TA 2CLOB 2B0CA 1XWIA 2BTQA 4XQEA 1YCGA 4R2WA 5L7YA 3REQA 1I4LD 1DWOA 4BX2A 1DRUA 1WW3A 1XXLA 1G3RA 1J1UA 3BMQB 1I1HA 1SHKA 1U80A 1ZAKA 3BWCA 3E7XA 3EK2A 2BI7A 5GGYA 5IT4A 1YR3A 1N4DA 3RVLA 3C87A 2VFAA 4LY9A 2DJ5A 5JO9A 3RUAA 4FCCA 1H5NA 4EIWA 5EWLB 5LB2A 3RREA 3NWPA 4PQRA 4KUEA 3U17A 1NBEA 4IWNA 5FFMA 4OHRA 5KVVA 7ABPA 2VSQA 3DXXA 1PJ2A 3KCNA 4MB2A 5F9FA 1N6NA 4HVAA 3OIGA 4YH1A 3TOSA 3WGJA 1PEDA 2OO5C 3K31A 4CEIB 5G4KA 2OD9A 2OUKA 2OZVA 4IIJB 1WP9A 4J6FA 5ALQA 1U4SA 3RUCA 3UJHA 4J0EA 3W77A 3NPAA 4M1SA 3NHSA 1GGJA 1EP1B 4FYJA 4BYGA 4Z6KA 2F4NA 2XZPA 1L2TA 3CT4A 1M5RA 2PM8A 3LKBA 1IQPA 2H2DA 4DA4A 2GRJA 4R1UA 1TF5A 2ZJ6A 5EVJA 3WXMA 5AW4A 3AVVA 3DL0A 5BR7A 2OGWA 1OFVA 3VPDA 3IBSA 3GJYA 4AUMA 3FFXA 2BFOA 2WW8A 4JBHA 3CNNA 4YJKA 3HVRA 1GPLA 5BN3A 1GT91 2YS6A 4IV5A 4RVOA 1GAWA 3WWOA 2YASA 1VECA 5KYGA 1JIXA 1G21B 2ZBPA 1COWD 1WCV1 4IYRA 5EHNA 5J2TB 2PE5A 2H5IA 1BX1A 1XTBA 1LSOA 4K5QA 3FIUA 3AT1A 2FSIA 4RPHA 1L8LA 2Z3ZA 1O1YA 2W2KA 5CDFA 3RSOA 3I01M 4A9AA 1ML4A 1ZJYA 1KGSA 1IM2A 2PT6A 1RADA 4KZKA 4ESVA 4AJIA 3IQHX 1XRJA 1R6TA 3KEFA 3EY9A 5A0FA 4DY4A 2UYYA 4XIYA 5BY2A 4MRMB 3WL5A 1OMOA 3DCYA 2QRLA 1RKQA 4L75A 3P9CA 3H5IA 3HCNA 4WKOA 1JR4A 1ZK1A 3QLJA 3GEIA 4IQGA 1AK2A 4MV3A 4DV6B 2VYQA 2F55A 3TUZC 2ZSEA 2MYPA 5AM3A 3H1BA 4OU4A 1DJNA 2AV6A 3RVDA 4JT4A 4LHXA 2A9VA 1XKLA 3H8JA 4CETA 5B2EA 3NV7A 1NMXA 4CKWA 3K9NA 5I6DA 3CVUA 3WV5A 4INPA 1KQPA 4J1TA 1U2PA 2GZSA 3H6HA 1IN1A 1I5RA 1SAYA 3ZE8A 3N8NA 2XUQA 1KRHA 1V1MA 2XCIA 1ES9A 1Q3HA 1W88A 2AD1A 2ZJ7A 4OO3A 2QZZA 5EMHA 1PFQA 2R48A 4HC4A 3S5UA 3CKMA 2Z5VA 5FI3A 2GUWA 3WYCA 1USKA 4ZHQB 3BX1A 4NOKA 1RRPA 2J6CA 3A4YA 4HGOA 1DCKA 4X92A 2OK8A 5HGXA 5I9NA 3WKCA 1W36B 1OROA 2J9RA 2J33A 1LCIA 1PEAA 4C2TA 4ZDKA 1NHWA 3KBBA 3LM8A 4MWBA 1R7RA 5FLXA 1EP2B 3C4QA 5BRJA 2IHNA 2NP6A 3BWYA 3A7DA 5JS2A 1ENZA 1VKNA 4ZD6A 1NP6A 3SM3A 3C3KA 2HT6A 4RAQA 3VR6A 2J7PD 2W2XA 1L4GA 2WWIA 2ZVDA 4M8KA 3VOTA 1DBSA 4M1MA 3ZC3A 1Q1NA 5KZMB 4PYNA 2RB5A 4BRUA 3QEAZ 1L4LA 5M5BA 4DUGD 2R7LA 1ULTA 4BKPA 1BFKA 3CUUA 3SFZA 4U0JA 1TQDA 3ZZ0A 2OP1A 1JLRA 1M1UA 3FHJA 1B6GA 1JSRA 2QWXA 4OHXA 2WSLA 3MTGA 1Y1RA 2SKCA 1FLNA 4RADA 4Z8YA 3T7AA 3CLRC 3ZWDA 1Q12A 2ID4A 2VNHA 1UBUS 3A9TA 2ECQA 4UVHA 1AU9A 3SYNA 3RASA 3ZX4A 3HBMA 3LPDA 2GCNA 3FB4A 4KR9A 1ESMA 5P21A 4DSNA 1RTTA 5TMEA 1IRIA 3OZCA 2C9YA 5BV8A 2GBFA 1DJLA 2V7UA 2CUZA 2H92A 4G8BA 3B1KA 4P0QB 4EGCB 2ZYGA 1JU9A 3KOZA 1PS8A 4NTZA 4G1EB 4C43A 2F3UA 4QNRA 4QTYA 1RXEA 4F8EA 2HW8A 2I4OA 4WBNB 2RCYA 1ZDMA 3GFVA 3WL3A 3H3JA 3PTLA 5F9HA 3QXSA 1EWVA 4I55B 1R8JA 1O97D 1VKOA 4BC0A 4K2HA 1A76A 3EVAA 4WBSA 1P2FA 3OMWA 3TBFA 5I9LA 3IV6A 2PFKA 1G9TA 1OBCA 4Q3NA 5DGIA 3MEQA 1HE1C 4CKEB 3ERCA 4RS3A 3CTPA 4ZZ1A 1SZDA 5KIAA 3KT8A 3WGOA 2OHGA 4PY2A 4IUCS 2WWWA 3HJHA 3PDUA 3T5MA 2D3WA 2VP9A 3UWPA 1JX6A 2GJ4A 3CVXA 1BOOA 1CDDA 4M1WA 4QBHA 1LK5A 1ISJA 1RFLA 2WOOA 1O94A 3EVFA 3HFSA 5EMJA 4ARUA 3UFBA 1T5HX 3URKA 4YCCA 5KNCH 1O8CA 3VSDA 2DBZA 4RM2A 3O95A 3ZE2B 1Y9JA 1EVQA 1TOAA 2CLSA 3ETNA 3BIXA 4N0QA 1VMEA 3KTAA 5GPBA 4IH4A 4KWHA 2BSAA 3ZHZA 5G40A 2PMDA 1GSHA 1K9VF 2A88A 2FWIA 1QYXA 2RK4A 1EH5A 4OAOA 4QE3A 4D25A 1GLNA 5A02A 5AVYA 5HQ3B 5KKCA 5DTJA 3JQPA 2JJ1D 4O33A 1DXOA 3MILA 3A0UA 2FH5B 1XMJA 2JD2A 4DA8A 2I03A 1TMYA 1U1IA 3K9LA 2V7GA 4FZVA 4ECEA 3RSQA 5JSZB 1ZD4A 1FFWA 3FA2A 3V4FA 4F38A 1GNSA 2R85A 1GCIA 1OVGA 5F21A 4AJ9A 3UMMA 3EIFA 4PRZA 1N33B 4HYEA 1S0UA 3VNQA 4GG1A 5LIRA 5JCPA 4QYIA 1GSIA 2GZRA 4TS4A 3ZZNA 3I6BA 2EKPA 3BE5A 5IG2A 3U16A 3CV3A 3H11B 1C0PA 5AT1A 4F85A 1PKXA 4FW8A 3T7EA 5T5QA 2XKJE 1IU9A 1AG9A 1TIKA 2P77A 2XWJI 3IQFA 5CA0B 1BHSA 3W3AA 1ETHA 2L69A 3FMIA 3NG1A 3H6KA 4Z54A 1YAHA 3H17A 3AR8A 4DUZB 1PUIA 5EJ2A 4JIGA 4WOJA 3AUJB 1I3OA 1Y33E 4X00A 5IJWA 3FH0A 4LMRA 1YUMA 2CY0A 3L3BA 4PNZA 1HF3A 4RZSA 4HL6A 4U8HA 3CRQA 3E3NA 5EESA 5E38A 3NMUF 1NVVQ 4IHJB 4JX8A 2B1RA 3KPUA 3NWJA 2QXUA 5D3MA 3HM9A 1GGKA 4M9QA 3OG9A 1YUNA 2BHRA 1QIKA 3KHUA 4RQBA 3SQMA 1EFVB 4J4TA 2BRUA 1QLJA 3I6MA 2ZSJA 3SF8A 4MR9B 1UZAA 1A69A 4HAXA 3QMVA 1OW3B 4N5DA 4KQ9A 3UTCA 4AD8A 4J7XA 1ZQ1A 3LBYA 2FPOA 1ZA2A 1SZCA 1TM3E 3QUQA 1PJ3A 3B89A 4Z9FA 1RQXA 2CJWB 1CR4A 1G16A 1QJ4A 1QLHA 2CNNA 1UK6A 2O3RA 3CUWA 3E6AA 1CK4A 3MXTA 1N9KA 4L3VA 3UXEA 2NUAB 4OF4A 1QORA 1N0UA 3PXDA 3EAFA 4DFDA 4MR7B 1K0UA 3IURA 2C7OA 4LDNA 2AF4C 2IYRA 1N3BA 5CAEA 1QRAA 3H9JA 4KBYA 1MU0A 3Q6MA 4RMGA 5ADHA 2YY5A 1PJAA 2ZWPA 4DCSA 4DLRA 1QP7A 2R1TA 2DERA 3RYFA 1LV8A 1GKUB 4AU1A 1ZIPA 3KBOA 4YMLA 5CRIA 4KN9S 4GSKA 5LQSA 3LT5A 2QL7A 2Q2WA 3ZI4A 1Q7EA 3OWHA 2JFXA 4OREX 1P5RA 1VG1A 1VG9B 3OY2A 5EXDA 4DNXA 4CKZA 2I6QA 3ZWNA 1JPJA 3RV4A 2NO1A 1N2IA 1VIVA 2WKPA 3JWIA 3KQVA 3DOIA 1DEOA 3M6LA 1DZ3A 3JWGA 4XCVA 2WUDA 3TB6A 4DZZA 3V80A 1TD9A 3I12A 4I3GA 5KBYA 3F73A 3WBBA 3WAKA 3D4BA 1JIVA 1VXOA 2EKLA 3KFVA 4I5FA 3P4XA 2NU9A 4LOHA 5E7IA 4KH0A 1A8UA 2WIAA 5DTIA 3TOZA 5EAIA 5G53C 4UNRA 1XGKA 4FQ7A 2NPFA 3LQRA 5FYDA 2LKDA 1LW6E 2WM2A 3TO5A 3UJ8A 1XFAA 4K81B 1R74A 1SGWA 2ZI6A 5LD2C 1JHVA 2VA9A 3EASA 1UPFA 5EKDA 4PN7A 4PFKA 4D0GA 2PUCA 2C3OA 1NLFA 4CIDA 1W87A 5AKHA 2XJ9A 4MR8B 1WQ4A 1QZTA 2DAPA 1DSSG 4J1SA 2A58A 2H06A 1NVDA 4WN9B 4PBRA 3RIMA 2E4YA 3CTMA 4O2RA 1L5RA 1MX9A 4DOMA 3PNVA 4KWIA 4NPAA 2FZ4A 4G8CA 5G0SA 3GDHA 2ZRJA 1NYQA 4Q21A 3D8NA 2PANA 2OK7A 1ZI6A 2VXBA 1YOVA 3GZTB 3I5UA 1NVWQ 3B9RA 2VHQA 3LAWA 1RSZA 5MFZA 3IE0A 3BH7A 5CFMA 1KSHA 2OQ2A 3X43A 1T34A 3HZOA 5CBPA 4DB2A 1JPUA 1J49A 1IN8A 4B33A 1GJRA 4DJAA 3K70B 1GTZA 3CINA 1LK0A 2IZ1A 2RDMA 4D6PA 3QMMA 1T6YA 1WR8A 2VHWA 5KNBH 4Z4GA 3QVOA 4PZCA 2R6GA 1WTAA 3FHLA 3CIOA 1Q77A 4OK6A 3H9EO 4TXLA 1JP7A 2HWXA 1MXFA 4WMLA 2XEDA 4Q9DA 4ZCIA 2PPVA 3R6TA 2PZAA 3ZBPA 1XN1A 3W2EA 3ZN2A 3WGUA 1FY2A 1XZEA 2Q1TA 3PNSA 1L3IA 4YB8A 4R3WA 5JZMA 2QAGB 3G2QA 1V4NA 2ACEA 2Z1DA 3ELDA 3KYCB 3OKCA 3DAGA 2R8RA 3VR4H 4DB4A 2OT3B 2IBMA 3QOWA 2EAUA 5GVRA 3ABRB 3RS9A 3VYTB 5IFKA 1NQOA 1ESZA 4GO1A 4XIJA 4LF5B 2UKDA 2QIPA 1QO0A 5CR9A 3S3TA 1MZPA 3K0AA 4JB2A 1BG6A 1FS5A 4FVTA 1K2WA 2PPLA 3TDNA 4V0LA 3C24A 4UFOA 2GWRA 3KAKA 4PAGA 2B36A 1KBQA 2NU7B 5I9MA 3QWFA 1NBMD 5DLDA 4OIFA 2V45A 3S40A 4HN9A 2IEBA 4BMXA 1K7XB 4JXZA 4FOSA 2CD7A 3MBKA 3P5SA 1N9GB 1RI2A 2ZOSA 1O7JA 5CLIA 4BMOB 4N54A 4U9UA 9ATCA 4OKIA 1KOFA 3TSWA 2GNOA 1ULAA 4Q9NA 4EFDA 4PZZA 2Y1EA 4GGPA 2XXAA 2NVWA 1HTBA 1V25A 4WNCA 4CKBA 4DEXA 2H0AA 1X9HA 1UBOS 4CQNA 3A3KA 3C8UA 3FE2A 4HXEB 3YASA 3NBZC 1CDEA 2RI1A 2Q8QA 4XKJA 7ADHA 1F6WA 5E4FA 3C8DA 3THYB 2O8CB 2Y77A 4MYUA 1JVSA 3F96A 3TGWA 2DQYA 3FWZA 3IQGX 1GDDA 1ZBQA 4IX1A 2WUGA 3PQ8A 5JANA 3RE1A 1BMDA 1VSUA 1QIMA 4QU8A 3STHA 3L05A 5I7UA 4RE6A 4KOEC 2EKQA 5LQUA 5A03A 3FOEC 3EZ9A 4WDRA 1PG0A 1A04A 4CKYA 5FNVB 2JCSA 4EENA 4C0QC 4QYMA 1VDZA 2QMZA 3RLFA 1O95A 1PF7E 5EI5A 3ZUGA 3RVPA 1SUPA 4JR0A 4DSAA 1KARA 2RONA 3LDUA 3TLKA 4E5NA 2JFGA 4ZRMA 2F3TA 2NV2B 2CLCX 1I7LA 1T5LA 3OUUA 1YJBA 3IP1A 2ATIA 3V7WA 3V8BA 4ZDJA 3ZJTA 3E5RA 4Y8VA 1ID8A 1QYVA 1J8MF 1YO6A 3QBEA 4XGKA 4DZTA 3OTWA 1HE3A 2OO7A 4TS1A 2ZROA 1YU9A 3UJCA 1V8BA 3HYCA 5AIAA 2YX1A 2PGAA 4RSRA 2G9RA 2PS0A 3K70D 4ZTZB 1JJIA 2CN1A 2ZSAA 2DHCA 1NDUA 5JSQA 3QNWA 2Q62A 2FW1A 1V45E 3WLRA 2A67A 2X2PA 4AJHA 2ILVA 5AK6A 2YXDA 1ODSA 4JQYA 2H8GA 2R1ZA 4P92A 4JNKA 5I8PA 1CIVA 4D9HA 1HR0B 3H9QA 3TAUA 2IHJA 3S27A 1D0VA 2IXFA 1FLDA 2PEZA 3OPMA 3RJMA 1EAMA 4Q24A 2VZ0A 3E82A 4L8LA 4TV9A 3B13B 4OOEA 1XQYA 5F4BA 1NI4A 2XB2A 2QTZA 2VYCA 2BDEA 4REQA 1XA3A 3DJFA 4LGVA 1Z4NA 5IXSA 1LC3A 1FUUA 1AM4D 3VDNB 2OSVA 3FBTA 2J3JA 2SKDA 1C0IA 1W85A 2WFLA 1RZUA 2J4DA 1H2AS 3SSMA 1ULBA 3IE1A 2C7RA 4V1CA 4NBSA 5BWBA 3EA5A 1GA4A 2I7VA 1ODJA 3JXEA 4MAFA 5I9BA 5AHOA 1WTCA 3PUKA 4I50F 2H8KA 2I6XA 3COVA 1LS6A 1KU6A 4PZAA 5EHIA 2AC4A 1JG6A 5L3ZA 3RR2A 1LRJA 3IP9A 4YA6A 3ONDA 3UNXA 4MSUA 3NYQA 2ILTA 3WP1B 1F12A 4YRFA 1H6BA 2PEYA 3NBXX 4JCCA 4J0JA 4GGOA 3H42B 4V0KA 1P1FA 4WESB 4ZT3A 4CUZA 2OE2A 5DNDA 4RTPA 2E4XA 1NQVA 1QQTA 1KI6A 4L3WA 5JMPA 2XCRB 3SXUB 2CJXA 4XH9B 4DQVA 2OO3A 4OI4A 2IX9A 3LP5A 1OBOA 1CRLA 4QSMA 6PFKA 1C9JA 4RK4A 4NDAA 1LTQA 4JR1A 4OHYA 5FF9A 3IOCA 3CLKA 5CVUA 2HRCA 2IWRA 3PSHA 1PR1A 2IC5A 1XU4A 3G2JA 4FJ0A 2XODA 3RIYA 5F5LA 4JBXA 2BTQB 4WSOA 4BE7B 3REQB 3RS5A 1GFSA 2UVQA 4KU4A 1KQNA 4EHJA 3ONWA 5I47A 1ZK4A 5EWJA 4JELA 4F4DA 1U99A 3FFWA 1UM9B 1YL7A 2C4KA 3P0EA 4C3VA 1P8AA 4UUBA 1V9LA 1OIVA 2C82A 1DEHA 3PJRA 4RGQA 3T7JA 4P6VF 2C2ZA 4BQFA 3PZRA 4KWCA 2VO1A 1K5PA 1P8JA 4CF5A 4RANA 3ZCRA 3HJUA 4XJTA 4GZ3A 4UTZA 4YNBA 1EEHA 5JEDA 3B1VA 4PLFA 1AK9A 1QK3A 3KUDA 3IX7A 2PUGA 2RBEA 1I30A 2I87A 4UFPA 3FJYA 1I01A 1I3LA 3W5SA 2CBZA 3H9BA 3LFUA 3NHFA 4FC7A 4XGIA 5FPYA 3SVZA 4RIHA 5G4KB 4JC8A 3ST7A 5BW4A 1ENYA 2HZ7A 4I19A 3RVBA 2Z3WA 4YRBA 2GFQA 1W93A 2HPAA 2EFEB 3ACCA 5AXBA 2P0AA 5EHGA 2G72A 1RWNA 1ESDA 2KYRA 3QXHA 1N7IA 2AEFA 5AI6A 3LTNC 4D5GA 2ZJ8A 1T2AA 1QGUA 4JFAA 3W8DA 1VCMA 3BAZA 3RIGA 4B31A 3N2ZB 5JWOA 2G67A 3O91A 2OXRA 4P4LA 2BY4A 2QGZA 4TKLA 4DSUA 5F33A 2XBMA 4RDHA 3HK2A 5FPHA 1RQ7A 2DR0A 2E6UX 4IQ4A 4KVAA 5H4HA 2IXAA 3UJ9A 5DNCA 1RKXA 2QT1A 1K89A 4D4LA 4D3YA 4F1JA 2JFQA 4K6GA 3T94A 3U9LA 4F86A 5AUNB 5BN3B 1NJ8A 1GPAA 1FFHA 1UJBA 1U8YA 2CNWA 4TL6A 1EK6A 1K08A 4W7IA 5FOWA 3UK1A 3I92A 3FCYA 2JFFA 2AN5A 1XTVA 4HGQA 1ESNA 1JU4A 2GCPA 2JS7A 2W2KB 4INOA 3HH8A 4M0FA 3FCXA 2JLUA 3DE4X 1YA6A 1JQ3A 2C92A 1Z3IX 2O0LA 2H17A 2OAP1 1NLZA 3PXCX 2QLFA 5EJGA 3DMPA 3V1NA 1G4HA 1SD2A 1E6EA 3EF0A 3RAGA 4ETWA 3M6XA 4LGYA 1NT2A 4XYMA 5FTLA 4FIDA 1IZ0A 1GZHB 1J99A 4WA8A 1IMOA 4M0EA 2X2OA 1UBFA 3E22B 4XM1A 2FXIA 5EP1A 4ZYZA 1IE3A 3FLBA 1BRMA 1PJBA 1XJWA 3SS7X 1NLMA 3HO8A 3KXLA 4YCMA 4WJLA 4CKWB 1E2MA 2HCRA 4TX1A 4YACA 2VTBA 3U1VA 1XZQA 5F7ZA 1UOOA 5K8TA 4LXQA 1KFBB 4HNRA 3V4SA 3P71T 1HORA 1XEWX 4CQMD 4V02A 5KDDA 2ZSUA 1CR6A 3RTDA 4W8GA 3UJ7A 1V1MB 2H7XA 1GQYA 2AMJA 1WZ2A 1VJRA 4XIIA 1W88B 3N3BC 1I2BA 3T9FA 2GM5A 3AM5A 2D62A 4HDQB 5K4AA 3E9ZA 2QB5A 4XDZA 3HFJA 1ZK0A 3UC5A 4JH0A 1Z5ZA 1CXZA 1U11A 2L0XA 1JJ7A 3DEYX 3EXEA 521PA 4BO2A 1L4NA 4E70A 1MABA 3ML1A 2CMFA 4GOKA 1RXYA 3DLPX 3VH2A 4X20A 4BKOA 3GLIA 1ZH2A 1SXPA 3QE3A 4HDKA 3JQFA 5CM9C 3DKVA 3HWSA 4A6PA 1D9ZA 4EG8A 3WJAA 1KK2A 4C3ZA 2WFMA 3PNMA 3UUFA 2VDPB 3OX3A 4LE2A 1TZJA 3E9CA 3VPGA 4UUPA 5J4HA 4X65B 4OG2A 3NKVA 1KDYA 2J3DA 4IUBS 4PQGA 5JPDA 4X8MA 3EXHA 1VRWA 1WMAA 3ISJA 4GPAA 4DIKA 2HA2A 3ADDA 1YNSA 4HLUA 2CV2A 1IEQA 1MO4A 4U7FA 4NH0A 2OCXA 4AKEA 4C0WA 1TU0A 1GIAA 2WR8A 2RGBA 2ZYUX 2IVZA 4HUTA 2B3DA 1JLSA 5JNSA 5KC8A 3D4NA 3DT8A 4DXDA 5LQJA 1JE1A 2GQ0A 1BMQA 2PRKA 2Q5QA 4I6GA 4DMGA 3N2YA 3PS9A 1ZN9A 1L8AA 3ND6A 4C1NA 1ZU4A 1N2OA 2WAYA 2W43A 2Y0EA 3AWDA 3DE0X 4MRAA 4DNQA 3VH4A 3DFIA 3JQCA 3R5JA 2P4HX 1AKRA 4HWPA 4R2MA 1OJLA 4D8XA 1FTYA 1M5UA 4LVCA 4UAVA 4KRXA 1Z2CA 4OX9Y 2QKYA 1KZ9A 1I7SB 2GYUA 3I0MA 1SC3A 2JLAA 4H60A 3W9YA 4Z4HA 4TUYF 4ZCSA 4PS0A 1N78A 2PQMA 1MOSA 4L95C 5FP0A 1SCKA 4BKUA 1OB5A 3ULKA 3ONEA 4CQLA 3R3ZA 1LPBB 4C7JA 1LFDB 3LC0A 4KR6A 1NTOA 3OIUA 3HA7A 1E5TA 2Q4TA 3IAAA 3QVGA 5LMUB 5FOQA 1NMYA 3SBOA 2GT1A 3AEUA 2VYVA 5LN1A 4ARCA 3L8DA 2M98A 1PR5A 2FAXA 3EZYA 5JVDA 1QH9A 4HG2A 1TA0A 2WAXA 4EF4A 2B25A 4W63A 3M4NA 3SQDA 1EZZA 5E1BA 3MG9A 4DQ0A 3HYLA 1AUOA 3O38A 3KJGA 1I24A 1G5HA 3A26A 2HFJA 3GGOA 1Z5PA 2XUIA 4WW0A 1V3UA 3KJIA 2W93A 4GIBA 2AHRA 4UZSA 5BSGA 1POXA 2YVUA 4B73A 1Y6FA 1L7OA 3KTAB 2YV2A 1RQ2A 1V5WA 3KFLA 1MLDA 4RMJA 1U3GA 1E4OA 4XGNA 4LMBA 2DU8A 3T1VA 4FKZA 2NYUA 3WQSB 4CLOA 3Q7QA 5T4BA 3QVMA 1SCAA 2IOYA 1MTOA 3E81A 4KO3S 1RLOA 4LRYA 1Z62A 1CZNA 1LWNA 4X85A 4EJSA 4OYHA 4GYKA 4M9XA 5COBA 4B80A 1K5HA 4RHYA 1RI5A 3F6BX 4LJ6A 3BWDD 1ZM4A 3STYA 5IZCA 4S05A 5JLJA 4E21A 4RFSA 3VHLB 1VPDA 3LWZA 1VJ0A 4PZ9A 3EZFA 2PFGA 4FFOA 4AS3A 3DBHA 2RCNA 5H7XA 3P9RA 3DB2A 3HFGA 4JP3A 3UK6A 4JSYA 1M8GA 1JIKA 3AG5A 2COUA 4S1PA 2Y66A 3DOHA 4QYIB 5DP2A 2Z2YA 4G0PA 4BVGA 1X8LA 1E2UA 4TLDA 1RQRA 5HZGA 4FLMA 4GI5A 2J30A 1C9YA 1QB7A 1KKLA 1HQYE 1Z08A 2XYQA 4NYJR 1N36B 3GDWA 4MYCA 4ZO9A 4C0KA 1ONPA