2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
3RS5A 1YR8A 3EARA 1Q1EA 5FI1B 1ZNWA 1G7TA 2WWXA 5HR5A 3HR8A 2IF0A 5DI9A 2ZR7A 4C4PA 4HLQB 5L3SA 3K09C 5JHGB 3BWDD 1B23P 1U81A 1NJFA 3FHOA 4TL8A 2Q9CA 3KQNA 1FX0A 1PLLA 2VSFA 3KKQA 1HA3A 4JLJA 4DZZA 2W83A 3THYA 1F5NA 1G18A 4ZDKA 3THOA 3TW8B 2L0XA 1OXXK 1LVGA 4EDHA 3TGPA 4JBWA 3N2EA 2KB0A 1RRGA 3KTAA 4WZBE 1OB2A 3IBGA 1ZUIA 4CYMA 5JHHB 1FW6A 4KAXA 1KI9A 2W6ID 3Q85A 5E4FA 2JLVA 3DKVA 3RRZA 2AK2A 5E3HA 4C7OB 5JECA 4JZKA 4CDGA 2D06A 4RFSA 3EPHA 3BIFA 1W0JA 4TZ0A 1QZXA 2H16A 1MO5A 1US8B 1M1YE 2Q0HA 1Z6YA 4QGFA 1GAJA 3LVQE 4V0OA 2ZS7A 2OXRA 1E9CA 1KO4A 3D7MA 2ZVPX 4ARZA 4FCTA 2QGZA 3SFVA 4IVRA 2IWHA 2H8KA 4PAOA 3KJGA 2WOOA 3IIMA 3PVSA 3IBYA 1RIFA 3TKLA 3A6PC 4KSBA 2VF7A 3WY9A 1OFUX 1UF9A 1QHXA 5FUXA 4ZKEA 5TV2A 3OIYA 5DN6D 4DDVA 2ZJAA 1VG1A 1XDBA 1RRFA 1NVVR 3QKTA 3TE6A 1GFIA 3KXKA 3KB1A 4FN5A 4KFSA 3QKUA 3TBKA 1UKZA 5FBVB 1Z47A 1W44A 5LPNA 5AUNB 2QP4A 4Q1EA 5HZHA 5K8IA 3R8FA 1GL9B 1CLUA 5JFGA 4C2UA 1GKIA 4FXPA 3PIRA 4QHYA 1Z0FA 3R20A 3UG7A 5EUQB 3QY0A 4KI0A 5E7JA 4BFWA 4UXIA 3T06B 2WJHA 4QOSA 2FDCA 1UBEA 3BAFA 3CH5A 4WOPA 1KJWA 1BO6A 1JEEA 3A1VA 3QXSA 4K46A 5FPYA 1TMKA 3TVTA 4A8JA 4BFZA 1VMAA 5KYKA 2B7BA 3TAUA 1J8YF 4KVGA 4EFNA 2J3EA 4TYWA 5LB4A 4UNNA 4A0GA 1R0YA 1E0KA 4GSYA 1IY0A 2WPDD 3BB3A 5FOWA 4NCJA 1FTSA 3QKRA 4TSFD 5FOTA 1KO8A 1NKSA 1T4GA 4Z51A 1KI1A 1Z2AA 2IC5A 2J59A 4XSGA 3GJ0A 2EFHB 4C3ZA 1IXZA 3NH9A 5JS8A 1Z6TA 1KDTA 2JAQA 2R65A 4LC1A 4PPFA 3WHLA 1QRAA 4B2LA 3THWA 4OI4A 5CDFA 1AGPA 4NCNA 2Z43A 2W6IA 2VF8A 4P4SB 3RLFA 4LRWA 2DYKA 1KI6A 6Q21A 2G0NA 2HLDA 3RS7A 4ARZB 1OB5A 5HPYB 1Y3AA 3TR0A 4QJ5A 1LTQA 3NBZC 3GJ3A 2A3RA 2CLCX 2JLYA 2JIZA 1ONBA 4YONB 5A0FA 2IS6A 4ON9A 1KGDA 1AS3A 1KDPA 5FOUA 1NY6A 4LGMA 4MRPA 4BZQA 3VR1A 3B2EA 2HT6A 1ZMXA 1P62B 1UBCA 1HEIA 3FMPB 1YRBA 2PL3A 3K09A 2JDIA 3AGPA 1XPRA 1VPLA 5AWFC 3KJIA 4JT4A 2JLQA 3UK6A 1BMFA 3PR1A 5EJEA 2YVUA 1DVRA 4HB2A 2C8VA 2YNMA 4NCIA 5DGXA 2CDNA 5DYIA 1T3SA 4A2PA 5A5GA 4OK3A 4E09A 2J7KA 2ZUCA 2W2XA 3K53A 3VHXA 1GDDA 1RC8A 2GEDA 4A2QA 1BYIA 4YDHB 1NBMD 4XVQA 2QEQA 3ZIAA 1AZTA 2AD1A 1N3BA 3EXAA 1IY1A 1GTVA 1U2RA 2DR3A 5G53C 1KNQA 4QFMA 4N0EA 4TYNA 1VIAA 3CW2A 3IHLA 4C0HA 1EFRA 2ATXA 5UKDA 1D8TA 1XD2B 1K5DA 3P32A 4RD1A 3PUXA 1R5BA 3B85A 1QBKC 4TMWA 1NF3A 2R2AA 1X8JA 4Q9IA 2JLZA 1GOTA 2WWHA 3LQQA 4UJ5A 2QI9C 4LK2A 5L3SB 1E2HA 2DY1A 5LDDC 4FWTA 2FGKA 2FSIA 1W36D 3RRNA 1G3UA 2AXNA 1J90A 3LBHA 5DI3A 5JI2E 3H1TA 1ZP6A 2QMEA 1DO0A 4ZIRB 4S2EA 3RVBA 2QTHA 2UKDA 3C15C 1GZSA 4B2IA 4DSOA 3LDAA 4HATA 3CX7A 1J99A 1G7SA 2OV2A 2DWQA 1KKMA 1C9KA 4OQXA 4FIDA 3JZAA 5F3WB 4IEEA 4KVAA 1NVVQ 1VYUA 1F6BA 3ADKA 3M4YA 4DDWA 4OL0A 5FL7D 1YRAA 1Q21A 1MR3F 2ZRPA 3C16C 4HAYA 2J7PD 3U3OA 4DLWA 2QZ4A 2WAXA 1UM8A 3W6OA 3SDZA 4N3NA 2OEPA 2ZJYA 1P72A 4CZ2A 2ZI3A 3CF0A 2J87A 2ORVA 3UXMA 1EFTA 5KOYA 2OAP1 2RKOA 3VU9A 1TPZA 1ZM7A 2R6AA 2ZR9A 1IN5A 4LJYA 3ZYCA 1BMFD 3AVOA 1KIMA 1BOFA 1NLZA 2AX4A 1WB9A 3THXA 3SI7A 3I4LA 2ZREA 4TYYA 1C4OA 3QKRB 1EXMA 3HR7A 4YQFA 1D9XA 3CONA 4AC9A 4NCHA 4TL9A 1CJVC 4DLVA 2QMUA 1ELOA 3RHFA 1Z0JA 1NNEA 1IONA 1OXTA 1N0WA 2A5DA 2FPKA 1XMSA 1CRQA 2OLJA 4PXAA 5FTLA 1E98A 3BERA 1KMQA 3K0SA 1F2TB 2BBTA 1NSFA 1RFLA 4JLMA 4ACAA 5J4VA 5KSOA 3R9IA 1W4BA 1NL3A 3PG5A 1MABB 2AHOA 2I1QA 4KU4A 4DSTA 2QPOA 4HDOB 2OFWA 1E2GA 1U0JA 4MH0R 1FTNA 4NYIR 1E0AA 2O8DA 4HAXA 1A4RA 3A1UA 4EUNA 1YZKA 2ZJ2A 5CLQA 1CEEA 1JJ7A 2PH1A 3MWLA 2RGEA 5HKKA 3SBEA 1XD8A 4DCNA 5J4YA 2ECKA 4M1OA 2LKDA 2O0KA 1G3IA 2NPIA 5JBQA 1XTJA 5P21A 1FNNA 3KFXA 2IUSA 2J9RA 4PZZA 2F7SA 4UNPA 4A9AA 4C0SA 3QG1A 2C5LA 2R8RA 2YINC 2ZYVX 4FMCB 4Q66C 1QHIA 4MKIA 4PC2A 1FP6A 3VR5A 4BWYA 4AY2A 2P67A 3K9LA 4HUQB 1NIJA 3ZDQA 4FMDF 5D3QA 4LV5B 4WW0A 1KO7A 4A6PA 2O8BA 4UJ3A 2F1IA 4DCTA 2BCJQ 2V7QD 1MOZA 3QEJA 3DKPA 4LOAA 4Q19A 5CJ2A 1MV5A 1FPMA 4DDTA 1TX4B 4Q01A 1J8MF 2H57A 5D3MB 3JVUA 1X86B 1EGAA 3K0AB 3A1SA 2KSQA 4XVRA 5FOVA 1N6HA 4BFVA 4PAQA 2J1LA 2YKGA 1S8FA 1M6NA 3GLIA 2YOFA 5BN4A 1LF0A 1SHKA 5FPKA 5B64A 1XZQA 1PZNA 4PPQA 2VEDA 3EPKA 2C2HA 1OFHA 2X2EA 2ZE8A 1W48A 1RVDA 3W8RA 1KDOA 3IPXA 4EKDA 3QNUA 2OCYC 3T1TA 2CL0X 4NE2A 2CK3D 1IHUA 2O8FA 1X3SA 5J4HA 3QSYA 4NYJQ 1VTKA 1KY2A 1U9IA 2UVQA 1UKVY 3NC1C 4HZUA 3L0SA 2JCSA 3EC2A 4GL2A 3EX7C 2XX3A 2F1JA 1IAQA 4G5OA 4P4TA 4WAUA 1WBBA 2IYUA 2YC2C 1G3RA 4LJ6A 3SBDA 4ZIRA 3U7HB 3QF4A 4RY2A 2OXCA 3SFZA 2XGJA 3RSOA 4ESHA 1MO4A 4LJ5A 3MGCA 2XAUA 1I2DA 3A4MA 1UAAA 1E2LA 5JEDA 2A7QA 3LBIA 4LX0A 1Z63A 3B8HA 3RSLA 4BZPA 5EXTA 2OO7A 4P4SA 1ZD9A 3TJZA 4CEHA 1HTWA 3AH8A 3THWB 3GLFB 4MKFA 1GP2A 1G6HA 4M21A 4QRHA 3PJRA 1NN0A 2EYQA 1U99A 2ONKA 1Q12A 1RRCA 1XTKA 3K9GA 2PJRA 3I8XA 5CB8A 1HY3A 3HYRA 2AWOA 1XMIA 1NG1A 2ZQ5A 2IS1A 3IEVA 3CRQA 3PEYA 3U61B 4OHVA 5DHFA 4W9MC 2BJVA 3W34A 4POAA 3GEHA 1M34E 1L4UA 2P6UA 5BW8A 2QORA 3LRPA 2FEOA 1S0UA 3VR6A 1W5TA 4B6FA 3GEIA 1VCIA 3LBNA 2IYVA 1JXOA 5GADl 4M4SA 3CPJB 1KZ7B 3KKPA 5FR1A 4OHZA 3A8TA 4RZ2A 2QSZA 3H4MA 1KSJA 2ZROA 1NIPA 4IEIA 4IVQA 1G1MA 1GNRA 5TMPA 2NO0A 2FFQA 3NXSA 1G8YA 2HDNB 4JYBA 3T61A 1L2TA 5LD2C 1G8FA 2AWNA 3FB4A 2O0JA 2QPTA 1WA5A 1KZGB 2YWFA 3V00A 4YXWD 4TMVA 1OHHA 3B78A 4KFRA 3R9WA 3RNLA 2AR7A 4L4UA 3D31A 1JAIA 2R6CA 3ZQJA 1SVLA 1TEVA 3OESA 4U00A 3EZ9A 5EXPA 3ND9A 4C0LA 1OIVA 1JR6A 2GHIA 2O8EB 1FOEB 3O8BA 1AQYA 2ZI7A 2ZSFA 1T8UA 2GF0A 3P4YA 5BN3A 3RC3A 5EP1A 5AUPB 4QG7A 4GP7A 1JR3D 3LD9A 1AKYA 4PTLA 2VLIA 5TVKA 1ZYUA 2QT0A 3F8TA 4MA4A 1XD9A 3KQKA 1FQKA 1US8A 2ZRBA 5TARA 4N0DA 2R6DA 2V6IA 5JJLA 1A5TA 2QENA 5KPJA 5KPDA 2ZXUA 4A2WA 2W2TA 2OCPA 2IHYA 3CNLA 2P6NA 3ASYA 2GKSA 4OQFA 1YE8A 4UKDA 4H1VA 4MKGA 5DNYB 1E9AA 3GFTA 1WMSA 5DO9A 3TUJC 4BFSA 1P2SA 1QG2A 4DLSA 2WWYA 2FJUA 1WE2A 1Z07A 2QAGC 1U8YA 4QM7A 1VYTA 3WMEA 3ADDA 1AN0A 1H65A 4Q4AB 4Y0VA 3O47A 4D26A 2PT5A 4OBEA 3OEHA 1LS6A 2C77A 3FKQA 1OJLA 4PPGA 1JQLB 4LDJA 4TQ9A 1P75A 1EG7A 1KK0A 4HSEA 4XWOA 1ZUNB 4HB4A 821PA 3CPHA 3R7WB 4JBXA 4Q9HA 3CR8A 1AIPA 2CCKA 1UDWA 2CEAA 2V1XA 5ELXA 4TL6A 3LXRA 4YC7A 4I1OA 3CO5A 2JGNA 2FEMA 2WSSA 3F3YA 1E9BA 1ZU4A 4HZUB 5GJCA 2HF9A 3I5YA 2BCGY 5AK0A 1RKBA 1Z3IX 4TT3D 4LZZA 4CF7A 1UDXA 3BRWD 4TQAA 1NJGA 1KI8A 2E9SA 3WXMA 4D80A 1W36C 1RRPA 1G64A 2W0SA 4H9GA 2GA8A 2P5SA 2V6JA 2WKPA 4O0MA 3T1OA 5LB2A 3FHTA 3GLHE 2QL6A 1G20E 2ZUDA 2GCNA 3CWZA 1UKYA 4JL6A 2JLWA 4PC1A 2J41A 4PQRA 4GOXA 1XWIA 2FU5C 3DZDA 3OEED 1OXVA 1DAHA 3OIVA 5KSYA 2ODWA 3AVPA 1GKYA 2VQSA 3U5ZB 2OBMA 3VX4A 5C4GB 3GP8A 4M8NE 2O8BB 4YXWA 2NOAA 4IRUB 4QBGB 1W0KD 1Z6AA 2EVWX 4Q00A 4DLZA 4QHSA 1XXHB 3OIUA 1TU3A 4AIIA 5AJXA 1WXQA 1DAKA 2GEVA 2YV5A 1II0A 4HLCA 1IOZA 1WRBA 4F4IA 4DEYA 4YMTA 5DHAA 4EAQA 3IDQA 2A30A 2MMGA 4TYQA 1P60A 1P4SA 1U0HC 2BOVA 1XEXB 4OJQA 1RW4A 3LLMA 4LYFA 4OHXA 2QMHA 4PHHA 1TTTA 5FOSA 1FL9A 4EJSA 4Q1CA 2J0VA 1SULA 2JATA 3LA6A 4B3FX 4MUAA 1QVAA 4DC9A 1E0SA 1XTIA 1G8PA 1Q1QA 1P73A 4KLZA 1VECA 2ZAOA 2DFLA 3VR2A 4BLSA 4DJTA 4EPXA 2Q21A 1AS0A 2R6GA 4EQ6B 3SQXA 4JVLA 1Z6XA 4NMMA 5J4KA 3MWJA 2QP9X 4KYIB 1YZTA 1JQJC 3BE4A 3B13B 4LJ8A 4Q4AA 3SYNA 4A92A 2HJVA 3CUEF 4A36A 1OXSC 2GDJA 5SZKB 3FOZA 4DHEA 3WMGA 5F9FA 1ZW6A 2DB3A 4FI3C 3RS2A 2QBYA 1E9EA 1T6NA 5SZJA 3U6KA 2PBRA 2XSZD 2R44A 3BOSA 4GT1A 5JRZA 3U7GA 1P9WA 4NONA 4Q21A 1R5NA 4GZLA 1PJRA 4ZCIA 1M74A 3AUXA 4OI1A 4DIEA 3X1ZA 3GLGE 4B73A 1S3GA 5FL3A 2O5VA 3S1AB 1IXSB 1JPJA 2F1RA 2J46A 2ZI4A 1XP8A 2IXGA 4G5SA 2WJYA 1T0JB 4UXJA 1W1WA 2Q9AA 3PEVA 4GI7A 1YU9A 4LC0A 2C9YA 2OT3B 4RZXA 2WWGA 1JBKA 4B3CA 3NDPA 5KNDA 1N5IA 2BKUA 1DEKA 4D25A 3KUDA 4PSVA 3ZQ6A 4AG5A 3D6TB 3BBPA 4DUGD 1G4UR 1YZLA 4CEIB 2GAAA 1W4RA 3K0CA 2ODEA 3HPQA 2BBOA 4URWR 3AF3A 1OPXA 4LV8B 5SZHB 2IYZA 2NGRA 5JWOA 3KJEA 3B7GA 3WRXC 4AK9A 1E79D 2V3CC 3HP1A 1DG1G 4OK5A 1YZQA 2G0TA 2X1VA 3GLHA 5FUWA 1GRNA 2WV9A 3TK1A 2BMEA 4KHZA 1OF1A 4GOJA 2R6FA 4JLAA 3LLUA 5JCZA 1QHGA 2IEZA 4ITRC 1RZ3A 3I92A 3LQRA 3QPUA 3RDPA 2ZJOA 4AYTA 1FMJA 5JMTA 5EUMA 4TWZA 1HT2E 5KDDA 3ZVMA 3EZ6A 1KK1A 1K6MA 1KI2A 3D3QA 2CMKA 4NHOA 3I8SA 1XJCA 2W0MA 2G6BA 1RJ9A 5D3MA 3ZVRA 1KJYA 1SVWA 4LHYA 2HUPA 1Z83A 3SJAA 3ASZA 4M9XA 1II8B 2PT7A 3GJ7A 3QUSA 3T5GA 5GJWC 5KDLA 1CJTC 4BLTA 1VYVA 1OLOA 2GF9A 2ZI9A 1GVNB 4LJ7A 1Q20A 1Z6GA 3N2IA 2IYYA 2V55B 1G19A 1J2JA 1NY5A 2FFAA 1EWRA 5GJVC 4F4JA 4NYJR 5HTKA 4IOKA 3K8YA 2J5XA 3LW8A 4W5HA 3DVLA 4QNMA 4PANA 1E96A 2QQEA 2VH5R 4LJ9A 3AGQA 1G4AE 2JJ2D 3U3RA 3DM9B 4BEJA 3Q9LA 4RJLA 4M1TA 3DPUA 3QE0A 3KDSE 1ESMA 4L8GA 1HE8B 2AFHE 1OKKA 2H5EA 4QKQA 3AB3A 1KO1A 1ZD1A 3EPLA 2EFDB 2W00A 4QBFA 4XIGS 5KTYA 1ZC3A 2N46A 1U0LA 3LO5A 1SKYB 4R2HA 5FBLB 1IQPA 2GXAA 2J7PA 3L43A 3N5CA 4LBZA 4L9WA 1LB1B 5EZ6B 3BD9A 2HXSA 1XJQA 2GETA 2XITA 3QKSB 2CNWD 1BH2A 1JNYA 1KO5A 1R5OA 2IYTA 2NO7A 3NHBA 1W36B 3M0EA 4PPNA 3MSXA 2DFNA 2NO9A 4D0LB 3AM1A 3KB2A 4BRUA 4I1VA 4JJZA 1S96A 2WOJA 2ZU0C 3RS0A 2J0QA 4TL7A 1JB1A 1GWNA 1X1RA 3QENA 3U7FB 3WBJA 1D5CA 4B71A 1ZM2A 5EZ5A 2WMOB 1F60A 1SKQA 2FA9A 3MUFA 1AQUA 2ZYUX 4HZIA 2CCJA 5EE5B 1SXJD 1E4YA 3O8DA 4LWZA 1OXUA 4QGHA 4W5JA 4OJKA 4C7OA 4Q1BA 3RS3A 2CHVA 3OF5A 3P1JA 2BKEA 3CX6A 2FX3A 2A5JA 2ZJBA 5KSPA 4B33A 4FMDB 1NKTA 3V4FA 4B75A 1AA9A 5BYKA 3RC8A 3LX8A 1N0UA 2G9NA 4G5QA 4XTCS 1XTSA 2ANBA 4M22A 3FFBA 4M1WA 1S9DA 1XTRA 2ODNA 3ZZTA 4Q9KA 3BS4A 3C7KA 4IFEA 5E7MA 1RYFA 2PX0A 2QROA 2W2VA 3MFYA 3TIFA 2PCLA 4FW9A 4AURA 3AP1A 2WIAA 2P3SA 1GL7A 4C0JA 2IEYA 3B1VA 4TQUS 3BFVA 2G83A 4TLCA 5GVSA 5K8UA 5CITA 1F2TA 4DCSA 3W3ZB 3AVUA 4M9QA 5G40A 2ZEJA 3TNFA 5DN6A 4JBYA 4Q48A 1M7GA 1GILA 1OIWA 3PUZA 4AI6A 2H18A 1RYHA 1ZD8A 3O8RA 1G17A 4QNRA 3AEZA 3C14C 3B1YA 2QG6A 1NN1A 4GP6A 3D8BA 1KAOA 1W49A 4JKIA 1MRNA 1H8ED 2FNAA 2F1HA 4M0LA 4KXFB 5AUOB 4M1YA 2JA1A 4PO1A 3T34A 5J4LA 4I1SA 3ONWA 3KUCA 1E94E 1KOFA 2GNOA 3PEWA 2VTKA 2OCAA 4XWAA 4A4DA 3MCAA 2QMOA 2XNDA 1LY1A 2VHUA 3NVAA 3P26A 2XTZA 3V4RA 5DYGA 3ADBA 2OILA 4A15A 4JYCA 1D6JA 3WP1B 2VHQA 4KLNA 1T0HB 4II7A 3KXIA 3ECCA 5HKKD 3LH5A 4DLRA 5GVRA 3TSOA 3GPLA 1ODFA 4HDCA 5BXQC 2GESA 3EIHA 2BM1A 2SHKA 4KFUA 3REFA 2IL1A 2IYWA 3IIKA 1QF9A 2BEJA 3QIAA 4BFTA 4D4JA 5KO2A 5LBIA 2VPPA 5IT5A 2O8DB 2VHCA 3FYHA 1E2MA 3KJHA 1D2NA 2BC9A 1TQ2A 2WKQA 2XJ9A 4RD4A 3ZZUA 2OESA 1MH1A 1E4VA 3NWJA 4JSYA 4TMXA 5HZKA 4YMVA 2MSDB 3WRYC 2IUUA 5CB6A 3R9XA 1ZIOA 4Q5IA 4URYR 4NL4H 2IWRA 1CIPA 1HYQA 1I4LD 1CP2A 4HI0E 4HLUA 3EASA 5DH9A 3U4QB 4CT4B 4BFYA 2O8CB 2Y8EA 5F98A 4DLXA 4NU0A 2X19A 2WWFA 4Q47A 4Q4JB 1E9DA 3E5HA 4KBFA 4HUQA 3DDCA 2YOHA 4M1MA 4FWIB 4GRAA 1KDRA 1LV7A 5KU1A 2WKRA 3BH7A 4EPRA 4C0BA 3RRMA 2OCBA 1CS4C 3G5UA 2WWWA 4JIMA 2QRNA 1E1QA 2A2ZA 2ZRHA 4ZO4A 5M04A 1F2UB 1OE0A 4DCVA 5JSZB 1SZPA 3OFND 1XPOA 2B8TA 2BV3A 1KY3A 3BB4A 4RD6A 4EPYA 1DELA 3PUVA 4EPWA 4PZLA 2ZJ8A 1CJMA 3PCRB 4AKIA 3Q3JB 2F6RA 1E2NA 4QHTA 3T15A 3A36A 1XX6A 4YMWA 2O8EA 3Q5DA 1A1VA 1Z08A 3DZ8A 4TT3A 3K9NA 3ZVLA 5FPHA 2ORIA 2PMKA 4PZYA 2IHBA 2BBSA 4IOMA 1TNDA 2GK6A 3LWNA 4CEJA 4MDEA 2J0UB 5KNCA 2RGCA 4Z1MD 1II9A 3NBFA 4R71A 3AVXA 2RB4A 5J5CA 3TSZA 1L4YA 1C1YA 1HURA 1OIXA 4BQSA 3UMFA 2QSYA 1OSNA 1G9XA 1XCMA 1SXJC 3NIBA 4W5WA 5EE1A 2NO1A 4TMZA 5JJIA 1KSFX 3LXXA 3SE0A 2B8WA 5SZIA 4DDUA 1ZJ6A 1QG4A 4A82A 3CRRA 5GJBA 3A1WA 4MYCA 4L15A 3OFNA 3WMFA 1G41A 1G7RA 5TY0A 5B2ZA 4ASUA 2AD5A 3GJ6A 1KI4A 1TAGA 5FTMA 4HEJA 2NTYC 4A0HA 1ZIPA 4PSKA 2RGNC 4NYIQ 4ACBA 1YJ5A 3IEUA 4DVGA 5JEEA 3L2OB 3OHMA 3OZXA 3VKHA 1XRJA 2NO6A 4C9BA 4Z1MA 3MAAC 2B7CA 2CE7A 2VP4A 2WMNB 3RWOA 4DUGA 4Q7MB 1FUKA 2MMCA 3CB4A 1N6IA 4A8JB 4JJKA 4UNSA 3TUIC 3EZ2A 4TTQA 4QC2A 2BJWA 1KK2A 4ZCMA 4RD0A 1DE0A 3V9PA 2IYQA 1KI7A 1XD2A 3L82B 4QGGA 2NZJA 2ZRCA 3I1FA 3I5XA 3L0OA 4WXPA 3AVWA 2QE7A 5EE0A 1ZNYA 1R6BX 4Y0AA 3TLXA 3W9YA 4ZDJA 1GSIA 2P65A 5DI3B 1CF4A 4US0R 2CCGA 1AKEA 2YOGA 2KE5A 1RJ9B 1SVMA 1E2PA 2H1LA 3L8YA 1EX7A 2IF2A 1HH4A 2CBZA 2C04A 1A82A 2QP3A 4O25A 1MO3A 2GZHA 3C5HA 4V0KA 3DOEA 4AYWA 5B57C 2MSEB 4QL3A 1G291 2EFCB 2I4IA 4TYPA 3NKVA 2XNDD 2WJJA 2ZRIA 2XB4A 2KWIA 5DSZA 4EFMA 4H1UA 4JLBA 3U2QA 2VP9A 2IYLD 4OQNA 3H86A 4IKEA 1SKYE 1G7CA 1DPFA 3AKCA 4X8LA 3VKWA 521PA 4J0QA 2DFTA 3EWSA 3U4QA 1YZGA 4G3XA 2CHGA 2G77B 2XEXA 1O3YA 3CBQA 3U3JA 4CRWB 2ZS9A 3GCGA 1E99A 1NVWQ 2ERXA 2H17A 4EIWA 1GNQA 4PHTA 5FOXA 4D81A 3UIEA 1Z0KA 1E1RA 3WYFA 3NBYC 3E1SA 4F93B 2HEIA 2AN9A 3E70C 1VG0B 4U5XA 3IHWA 3AVTA 2BDTA 4IFBA 4OI2A 1GRQA 2IUTA 3A1TA 1BYUA 2Q3HA 1XJ0A 1E1RD 1UKEA 4ZCLA 1GM5A 2VSOA 2WTUA 4XD7A 2VRWA 2FWRA 3H84A 3UMSA 3NH6A 3PXGA 2UZ3A 4DBLC 5JWRA 3QXJA 4URZR 3OE7A 3VR4A 3M6AA 3QQ5A 2CHQA 5FTKA 1H8HD 3ICEA 3EIEA 3IIJA 4FMCF 4IDHA 4D0GA 4D6PA 4TTRA 3W5IA 2NZ8A 2EFEB 2WSMA 3U44A 4LHVA 4RCYA 4FCVA 1E2QA 2CJWB 3C8UA 5JWHA 3QBVA 1T8TA 2PLFA 2EU8A 4M9SA 5BYJA 3GFPA 1KI6B 4HLUC 1OYYA 4IDPA 3DMDA 1Q0UA 2FG5A 2ZRMA 5B30A 2A5YB 4V02A 1TL7C 3OEEA 4JT2A 4M2LA 1JALA 4Q7JB 4LYHA 1UJ2A 2BM0A 4JLNA 3MD0A 1WCV1 2ONJA 1QHHB 2GCOB 1DO2A 1UEJA 5E95A 2G88A 5J40A 5AJWA 1W2HA 4NP6A 5IRCD 4FD2A 4GZMA 4N1AA 4NPHA 1Q1ZA 3TH5A 2GBLA 3GD7A 3CH4B 1SGWA 4TSFA 4F7WA 1Z0DA 1P6XA 4RFSB 4PQYA 1G8HA 5JJKA 2FPLA 1VKJA 4Q7LA 4QXAA 2V1UA 4RD2A 3I61A 3RYTC 3GLFE 1EESA 3WYAA 1KMHB 3KXLA 1IXRC 3SHWA 2LWIA 4KCGA 2OFXA 721PA 4X8OA 2QTVB 3SNHA 3P4XA 4TTPA 2DFKB 1WF3A 4X8HA 3RS4A 4RSGA 1YR7A 2AL7A 3NEJA 2ERYA 2J0UA 3KQUA 3EWAA 4P0TA 1ZINA 3GMTA 4Q1DA 4TN1A 2PLRA 1NVUQ 4BRWA 1PVOA 4EJSB 1QHHA 2ZRKA 4MITA 2QRZA 3K0FB 5EQTA 4NBSA 3U60B 5AUQA 3NTUA 3UATA 2C98A 4PO8A 3KKOA 3LV8A 1XEWY 1M7BA 4XH9B 4XTRA 1TUIA 2H92A 1HV8A 1N0VC 4EQ6A 4MDFA 2P5TB 4DSUA 3VKGA 3X1WA 3IILA 3BJIC 2QQ0A 4WA7A 2WJVA 2CLDX 2XXAB 5BWMA 3EG5A 4IDQA 5JLJA 1OV4A 2RGXA 2Z0MA 2HV8A 3GJ4A 2WICA 1CXZA 3PFIA 3RABA 3CPEA 5A4JA 2QAGA 1CJKC 3B82A 2FFBA 2REXB 4JLPA 2BVNA 1XXHA 2HLDD 3FGNA 4LCBA 4W7SA 3IKJA 3DHWC 1KAGA 2VO1A 1Z0IA 2Q9BA 4PC7A 1DAGA 2CL6X 5EXSA 4BFXA 1TU4A 2F9LA 2D4HA 3W8NA 2JLXA 5L3VA 4AWXA 3W6PA 4RD3A 3CZQA 3BK7A 1KI3A 4DT1A 4U7DA 2WHXA 4DT1B 2RGAA 3ZJYA 1OFTA 3QPVA 3TSWA 4ESVA 1OH8A 2EWVA 1W7AA 2YWHA 1K8RA 2CJWA 3TRFA 3BGWA 5G3ZA 3AQ4A 4ZDIA 4BPBA 1R8SA 1R8QA 3VU9B 2ZRDA 1Q1BA 1KJZA 2WJGA 3AKDA 1JEDA 1XF9A 2FF7A 2WSSD 2XOKD 3VR3A 2Z5FA 1N5JA 1XEWX 4R9UC 3SYKA 1YR9A 3QF4B 2F3RA 3Q8XB 4HAVA 4Q1FA 1LFDB 3QXXA 3LX5A 4Z54A 1MT0A 1U9IC 2XSZA 3RWMB 1CRPA 4BE7B 3ZIAD 4B48A 1G8GA 3DMNA 4URUR 5IK2D 1SXJE 2CVFA 2GWHA 2YHSA 4BLOA 2FSGA 3A37A 1GNPA 1ZNXA 2OUKA 1FUUA 4L5BA 3ZLJA 1GG2A 4XJXA 1QHYA 4ZV4A 4CEIA 2FSFA 4DLYA 5CYPA 4NH0A 4B43A 3M1IA 2YYZA 1N6KA 3X1DA 4DKXA 1X8KA 2C95A 1NBME 3AUYA 5FI0B 3KQHA 3BFKA 1U90A 4LPKA 1CJUC 3VQTA 3SS8A 1T3LA 1G16A 4M1KA 2LCFA 4OKSA 1VCNA 4PHFA 2C99A 1BKDR 1YVDA 4FINA 4D4KA 4A1FA 4JLDA 3UWKA 2H7VA 5DLQC 3CKLA 2QE7D 3HJNA 1D2MA 4FCWA 4KITB 1M8PA 5KHOC 1T3HA 4MGZR 5DISB 1L8QA 5FBWB 4P4UA 1E2FA 2WVJA 4LY6A 2J45A 5FTJA 3W3AA 3TMKA 2Q3FA 1KTVA 3U3KA 2ZRAA 4PR0A 2OE2A 3AKEA 4ZI2A 3T5DA 2WZQA 1FFHA 1DG3A 4ZDWA 2WAYA 3K9HA 1U98A 5IDVA 4UNRA 4US1R 2EW1A 5FH9A 1JXMA 4IW3B 4PAMA 2FZLA 4WBSA 5C46F 5IHPA 3U6BA 4OQMA 4E22A 1GITA 2C96A 1CKEA 4Q9LA 4MGYR 4AYXA 1DARA 3F0TA 2A78A 3CF2A 2IX3A 2IW3A 4C2TA 2WPDA 1OHHD 2EFGA 4V0LA 4DLUA 1E9FA 3VMFA 3U44B 1HE1C 4DSNA 4Q1AA 3SHFA 2O52A 5CM9C 3ZGXA 4B3XA 4D2IA 1COWA 4HAUA 1TQDA 1KMHA 3UMRA 4GMXA 2VIIA 1E79A 1VCMA 4HAZA 1AZSC 5HCNA 3IQWA 3UKDA 3B1ZA 4Q9JA 1ZCBA 1IN4A 3CLVA 2GVZC 2HCJB 4QM6A 1HUQA 1N5KA 2ZSAA 4IDOA 1E2EA 3H0KA 2PJZA 3QEOA 3AP2A 1Z06A 2BEKA 3EA0A 4K81B 4XD7D 1XCPA 2P6RA 4LYJA 4G5RA 4O3MA 3RANA 4EJSC 2FGJA 2OG2A 2XNSA 1I2MA 1QHSA 2CL7X 2JLSA 4DIDA 2VSXA 2AFIE 2IS2A 2RAPA 4DCUA 4GPTA 2R62A 5C2JB 1SHZA 2ZE7A 2ZE6A 3LNCA 3SJCA 1KSGA 5C1BA 2N42A 4OK6A 1E6CA 3JVVA 2R9VA 3VAAA 2C03A 3FVQA 2JDID 3L0IB 4YDSA 3UANA 4AG6A 4CT5A 4ZI3A 4S35A 1ZRHA 1J70A 1WDTA 5FTNA 3SJZA 1DOAA 3GLGB 3BC1A 1I4DD 4DB4A 2CK3A 2CE2X 4PX9A 2AKAB 4Q4HB 3VX3A 5CIQA 3UPUA 1UFQA 4B2PA 4DRZA 3ZVNA 3THYB 2OM2A 1A2BA 4LV6A 1FX0B 4DXAA 3VFDA 1N25A 1OT3A 1E2DA 1TQ4A 4HB3A 4Q03A 4BZXA 3A4LA 3NDBB 1G5TA 221PA 2RGNA 4E03A 1G3QA 4DWJA 4HB0A 3I72A 1R4AA 4UXHA 5AJZA 1II8A 1CTQA 3ADCA 3A4NA 5DIFA 5TB5A 1JR3A 3TVDA 3R7WA 1VHLA 3EZFA 1T91A 5CDFE 2FE4A 4UQOA 3CRMA 4BASA 3ZD7A 2D7CA 1N6OA 2GZDA 4V0NA 1V43A 3MRSA 3KX2A 2VHJA 4Q18A 1N6RA 2ZM5A 1SVIA 3K70C 1E2JA 1NMZA 1R0ZA 4JS0A 4DB2A 1YKSA 3K1JA 4Q4HA 2JIZD 5ANRB 1QDEA 4PC6A 1ZM3A 2F9MA 3LAWA 2PZEA 1VG9B 2A5GA 2VP6A 1XMJA 3CRW1 4MKHA 2MSCB 1W5SA 2RMKA 3DO6A 4XOIA 4PQFA 3K0CC 3GLIB 5HE9A 3WNDA 1E9RA 1P61B 2NMVA 3GLHB 2RH5A 1TADA 2QAJA 2AK3A 5BQ5A 1BIFA 2CLSA 5KUTA 3AVVA 2RHDA 2QM8A 1ZBDA 4ILEA 5H68A 1IN7A 4L16A 4RKFA 5BN5A 1Q44A 3IO5A 4A0FA 5FPTA 2Z4SA 4B47A 1U94A 3KKMA 4G01B 2XXAA 1ANKA 1CR2A 1XFAA 3IGFA 2IYRA 2HF8A 1H8HA 1XBTA 1HQCA 2JEOA 2GJKA 4LYAA 1E2IA 2ZS8A 2CXXA 4LBYA 2BIFA 3IUYA 4XSHA 5CLLA 3CNNA 1I4TD 2W6JA 4UNQA 4ABYA 3QF7A 2X8AA 4JL8A 1EX6A 2B21A 1R0WA 2EQBA 4LSGA 2UZIR 4MYUA 4C0KA 4M9ZA 2A9KA 2V54A 4MGIR 2QGNA 2C9CA 1MO6A 3LW7A 4P33A 4AKGA 3Q7QA 4C0QC 3AVQA 3CM0A 1TF5A 3SN6A 2FV8A 1Z8FA 3IO3A 2ZVQX 4KODA 5FR2A 1G6OA 2QA5A 3SZRA 1W2GA 1XTQA 2IK8A 4BLQA 1AK2A 3KZ1E 1UBFA 1IN8A 2FPMA 5JZVA 1IY2A 2V7QA 1DBSA 1OW3B 1S3SA 2HYDA 2JJ1A 2C9OA 2QTFA 3MLEA 4F92B 4O2RA 2GILA 1YZUA 5TXGA 5AJYA 3S1AA 1OH6A 3EPJA 3C41J 1LF5A 1LNZA 2HXYA 2ZI5A 2DWPA 4A0RA 1KSHA 1O87A 2ATVA 2F55A 5JI3E 4ZPXA 2D3WA 2DHRA 2IBMA 2E87A 1N5LA 3REGA 3FFAA 5KDOA 2NQ2C 3T35A 5L3QA 1OKKD 3QKSA 1WBDA 4PC3A 4GDFA 5CK4A 4HLDA 2A5FA 3ZD6A 4CEHB 3TR5A 1NLFA 1B0UA 1NN5A 2PCJA 3PENA 4LJ4A 3O8CA 1E2KA 1ZU5A 1MABA 5F9HA 3QXHA 1E0JA 1VDZA 2YWGA 2ZAMA 4MYTA 2CVHA 1P9RA 2XJ4A 4C30A 4B44A 3FPAA 4B3GA 1JJVA 1J7KA 3K0FA 1E3MA 3QXCA 1XEFA 3N70A 2YJTD 2BHRA 4G0NA 1P5ZB 2BMFA 1NMXA 5FBRB 121PA 1COWD 5CJPA 5L3RA 2QUZA 3NBXX 3BORA 4GFDA 1KK3A 4JVNA 4BUJA 1T5IA 3TQFA 4KV9A 4TZ6A 1NI3A 4IXNA 3RAPR 1NP6A 3BFXA 2G1JA 4TMKA 2ZRNA 3CIOA 4ASUD 2ODBA 1DAMA 3C4JA 1AGRA 1S1CA 3VTKA 2YC4C 1NSTA 1F48A 3A58B 4MGKR 2KI5A 2D7DA 1CR0A 3NEYA 4P32A 3HYTA 2G1KA 2DWOA 2VBCA 2ZSEA 1OYWA 1IJFA 2GXUA 2W58A 1W0KA 1KYIA 2FN4A 3E2IA 1NLYA 3WBKA 3K0AA 2J0SA 4I1UA 3Q72A 3W90A 1DTSA 2ZUBA 3MJHA 5HE8A 3DM5A 3ZS8A 3I62A 4KJZA 2VP2A 3SC3A 1XZPA 1ZM9A 3SR0A 1HT1E 3GJXC 3MMPA 3JZMA 3QOFA 4IVPA 1EFUA 5CIWA 5G3YA 4D4MA 3QG5A 3BXZA 2Q6TA 3KKNA 2NPFA 4URXR 4OQLA 1S9HA 3QVUA 4U02A 4PSAA 1NVXQ 3L0PA 1F3OA 5EE3A 3UWOA 2QN6A 2ORWA 4EFLA 4R98A 1T5LA 1W47A 2P0EA 1WQ1R 1R10A 2HJGA 1YHNA 3P27A 5K8TA 3SJBA 1XMVA 1F2UA 5CM8B 5J47A 2V9PA 1WP9A 2XB2A 2ZPTX 2I1VB 1S2MA 3FE2A 3WYGA 4I4LA 1TF7A 1G21E 2ZRFA 4IDNA 1P9NA 3WHKA 4XWKA 1Z2CA 2DCUA 1RPZA 1ZCAA 1XU4A 1Q3TA 1JI0A 4JVSB 5EE9A 1VG8A 1S4QA 2FFHA 4R2IA 2F43A 2QNRA 4BFUA 3T1VA 3FMOB 4LHXA 5AJVB 2PZGA 2Z83A 1GKUB 1XPUA 5TDHA 3PV0A 1KKLA 3T12A 3ICQB 2XZPA 4MYHA 4AKEA 2KBFA 4DLTA 3HU2A 4F38A 2O0HA 1PUJA 3K70D 4V0ME 4HUTA 1JAHA 1L7VC 2ZJZA 2B6HA 4Z8XA 1EWQA 1KNXA 1BS1A 2IT1A 1XB2A 3J81k 2C78A 2GJ8A 4G5GA 3F5FA 3QPWA 4KBGA 2YZ2A 4K8OA 4Q7KA 5IK2A 3EW9A 2LKCA 1DAIA 4P31A 4KO8A 1X8LA 2Q3MA 5EP3A 4A8JC 1G5PA 3SYLA 3CX8A 1YR6A 3VNUA 3NHAA 2QBYB 3TAHA 1A7JA 3ND8A 2G3YA 2VP0A 4BECA 3HPRA 2JASA 2GAOA 3GLIE 3DL0A 3U7EB 4B6EA 1TF2A 5IF9A 2NIPA 3KFVA 2WIBA 3QVVA 2REBA 3AVYA 3MWYW 4CEJB 1RE0A 4G1UC 2D62A 3DOFA 2RGBA 3IQXA 1Q22A 4OHWA 1DADA 2B92A 3U3MA 4EPVA 4V0MA 4JVMA 1JPNA 1PUIA 2ZYTX 4JLVA 4LHZA 2GRJA 1EFHA 5B58C 3KL4A 3I73A 5JSZA 3SQWA 2GJAA 3L8ZA 4YMSA 2GEUA 4QJ4A 2GXQA 5C4MA 4IOJA 2GZAA 5FUYA 5K8LA 1SVOA 1S1MA 3EIQA 1DAEA 4NYMQ 3RRYA 1ZNZA 3PUWA 1CR1A 1W4AA 2WJIA 2ZRGA 1TEXA 4JKYA 5FPSA 4WVFA 4IJMA 4I81A 1AM4D 4F4CA 2ZSDA 4CW7A 5FBQB 4D4LA 4V03A 3ZZ0A 2O8CA 4IXMA 1YZNA 3I3SR 2HCBA 4PO9A 3OAAD 3NG1A 1E69A 3WP0A 1R0XA 1MRSA 2ASEA 5FUVA 1FNMA 3THXB 4US2R 5DE3A 1NMYA 3P20A 4LHWA 2ZU6A 3MG9A 4HYYA 5HCIA 5KSZA 1Z5ZA 3IPYA 2RHMA 1ZVQA 3SOPA 3EA5A 2GTPA 2IA5A 1XCGB 1JR3E 2GJSA 3B9QA 5LD2B 2NG1A 1Y63A 3PEUA 1X1SA 3H2YA 4BGDA 1TUEA 3DEFA 4E5UA 3BH6A 4MRRA 3K0EA 1Z29A 4TLEA 4NZYA 1G3MA 3K70B 2QY9A 4R7ZA 1Z22A 3SU8A 2P2LA 2FH5B 1PLKA 1FP7A 3AV0B 1P2TA 3B9PA 4WIAA 2JLUA 2O8FB 4Q02A 1IJEA 1X6VA 2ZANA 5H70A 4AD8A 5H1YA 1K5GA 4B74A 2HT1A 2IXFA 1R2QA 1SQ5A 2ZR0A 2X2FA 4B3BA 4TLDA 5CYOA 2AKYA 1R7RA 5H8WA 4FMBB 2ZI6A 4QJ3A 4L9SA 1SVSA 2X77A 3OE7D 4NCKA 3X1YA 3TQCA 4DEXA 4PFSA 5AR1A 1M7HA 1OH5A 4TLBA 2WWIA 3B1XA 3KTAB 2XTNA 2JLRA 3X2SA 4CIDA 3EZ7A 4GMDA 3B6EA 2IXEA 4TLAA 2RCNA 3EC1A 3Q5EA 4OYHA 4D0NA 2VA8A 4LI0A 3FMFA 2IYSA 4OI0A 2IS4A 1N6NA 1T9HA 4PHGA 4LJAA 3GFOA 3X1XA 3WNCA 4BLRA 4KSCA 3HDTA 3EAQA 3GLGA 1UEIA 1IBRA 1OFIA 2ZE5A 1H8EA 1CULC 1Z28A 2YWEA 4F91B 1UPTA 3HWSA 2PMDA 4BLPA 4QBHA 4IOLA 4EPTA 1D2EA 3W6NA 1UADA 2WM9B 1GUAA 3FKSD 3KQLA 2JJ2A 3FHCB 2D2EA 3OAAA 2FSHA 2F43B 3OEHD 2BMDA 4RZ3A 1AJEA 1VIYA 1E1QD 3LY5A 3PUYA 3VNVA 2OBLA 2XOKA 5G41A 3G0HA 1KHTA 1ZUHA 1ESNA 2VHTA 4GOKA 4ZKDA 2OBNA 3B5JA 4LUCA 4URVR 2ZETA 1PLJA 3B1WA 1EFRD 3NC0C 2D2FA 4A6XA 3CWQA 4JLKA 4RZUA 3AF4A 2OAQ1 2QPAA 3ZS9A 8OHMA 4I99A 2BWJA 2QM7A 4QGAA 3QI2A 3ETLA 1N6PA 3WNBA 1FQJA 2GBLC 4QBIA 3OIWA 4MRVA 4AKHA 2CNWA 2E1RA 2V8OA 3AF1A 3AKYA 3BB1A 3CZPA 2QT1A 2BMJA 4JL5A 4Q4LA 2PZFA 3QBTA 3FDIA 2JJ8A 3SEAA 3ZH9B 1M2OB 2ANCA 2DBYA 2N1BA 2EYUA 4YLGA 1ETUA 2EWWA 3GJ8A 4GNKA 4WXRA 1EK0A 2FMXA 3PITA 1UBGA 3FTQA 2ZTSA 2Z4RA 4MUBA 3I32A 3GEEA 2PEZA 4E07A 5L8VA 1XEXA 2GCPA 2GJ9A 5EXXA 4CVNA 5EP4A 1ZM4A 3MJRA 4HAWA 5E7IA 4LBVA 1GIAA 1QHNA 3W5JA 4M53A 2PEYA 1SXJA 1SXJB 4HDQB 2XZOA 1IM2A 2GXSA 4JSTA 1IN6A 5FFMA 1HQYE 2ZRJA 4RCZA 2QAGB 2K5UA 1Q57A 4RVCA 4MRNA 4B76A 5C18A 1NBMA 1U8ZA 2ZJ5A 2KJQA 3BH0A 4LBWA 2FZ4A 1GL6A 1W4CA 3LFUA 1LW7A 1P3JA 3PQCA 1P7CA 3GJ5A 3HU3A 2RGGA 4WZ6A 5JRJA 4RFVA 4OHYA 1ZAKA 5L3QB 3AF0A 2D74A 4NDZA 2VYFA 2ZYWX 1LS1A 3AF2A 1N2CE 4B35A 1TQ6A 3TUZC 5KNBA 5FL7A 4C0AC 4NTZA 2ZITA 4MQBA 1EFCA 1JECA 2BBWA 2JJ1D 1YQTA 3VHLB 5JS7A 2V4ZA 2KBEA 1U8AA 2TMKA 1DS6A 3UG6A 2GK7A 1W46A 4RKEA 5JCPA 1A2KC 3FKSA 1FMLA 2ZIAA 1NRJB 2GVDC 4IHQA 4JMPA 1XXHE 3GQBA 1FZQA 1DAFA 2FOLA 2VL7A 3T1QA 2OSBA 2OLKA 1V5WA 2AXPA 1W0JD 4NYMR 1CR4A 1Q3HA 4LPSA 4B32A 1SVKA 2XTMA 1NG9A 2I3BA 3AP3A 5F2EA 2W6JD 4B34A 4WZAE 1PV4A 5CK5A 3TW4A 4BEBA 2QU8A 1D9ZA 3HU1A 1MKYA 3LVRE 2ZSBA 4MRSA 1P2UA 5EP2A 4JLOA 1P2VA 4TMTA 3FWYA 2XZLA 1CU1A 4XVUA 3R8CA 2WBLC 1E32A 1G5RA 3G82C 1CBUA 4Z8YA 3GLFA 1VCOA 3Q7PA 3C5CA 2IYXA 2RGDA 1N6LA 3QJYA 2Z6VA 2HYIC 4ERNA 421PA 4GBMA 2GCOA 4M1SA 2REOA 4Q4JA 1VHTA 4KFTA 3FMIA 3MWKA 1Z0AA 1ZC4A 4X8MA 4D82A 3B60A 1E9SA 2OZEA 1GRRA 3CR7A 1NN3A 2ZRLA 3CRVA 4NKRA 1AS2A 3CF6R 2F3TA 4P3YA 4CGZA 4KYUA 621PA 2PX3A 4YMUA 2VP5A 1XNJA 2OHFA 4O2LA 2DPXA 4B3DA 3CNOA 1QVRA 1OH7A 2OFOA
chains in the Genus database with same CATH superfamily
3L84A 4RVDA 1THTA 2GYUA 1K27A 3DCYA 1YR8A 5MN5A 2AFIA 1FTQA 2Z9BA 4HLQB 4RHYA 2X1LA 1NUAA 3BWDD 4NQZA 4OX9Y 1U3VA 2BUAA 2FSVA 3E48A 3E9ZA 3EVFA 3FHOA 1A5BB 1HSOA 4F72A 2Q9CA 2NUTA 4FGWA 1H1DA 1IYZA 2KS6A 3KKQA 1WP4A 3D4LA 5JS2A 1KMNA 3THYA 1DKLA 2EHJA 3THOA 3WZLA 2QI9F 1O89A 1RLTA 2L0XA 3R3JA 4ZZ2A 1OXXK 1HDXA 1LVGA 1PF7E 2KW5A 1E6UA 2V7EA 3KE8A 4Z9XA 1ADBA 1TD1A 4ZVNA 1D4OA 1ZKDA 3HWX1 2CLLB 3N2EA 1RRGA 1FU7A 3KTAA 2HO4A 4KQ6A 4QRDA 3IBGA 3AEQA 3DZBA 4GYYA 5FLEX 5JHHB 1NW5A 4BX8A 3Q85A 5F52A 4XA8A 2JLVA 4EF5A 4M37A 2AK2A 3COPA 4G24A 2X7HA 1E3TA 1VJRA 4RFSA 5CB4B 4N3CA 2I2AA 3SXPA 1MO5A 4TGLA 1EQ2A 1RYBA 4DIKA 4RM2A 3CVXA 4YI5A 1F4LA 3MBOA 1H2HA 4ZVMA 3WZ2A 1EDBA 3LPNA 1VBMA 5HDQA 5CA1F 2PSHA 3LRXA 3DNPA 4MVYA 3ZCVA 4ARZA 3VH4A 4S1NA 2I6GA 2SICE 2H8KA 4ZD6A 5IJ9B 1OJ7A 1RIFA 3TKLA 1HNXB 4NE9A 3CNBA 5ES3A 1RXCA 4D02A 5TV2A 1XQ1A 3LXMA 4DDVA 1VG1A 1KA9H 1R5JA 3DDWA 2WVGA 1HDIA 4I2NA 1NVVR 3JD0A 4KH0A 4M8KA 4Z0NA 3TE6A 3T4EA 2W6ZA 1GFIA 2XCIA 3F78A 3KXKA 5IYZF 3IURA 3UGKA 5JATA 4UEOA 2JHGA 3Q2OA 1YB2A 3KAPA 5LPNA 2YW9A 3PXEA 1O4WA 2C57A 3AR9A 3ANXA 1GL9B 5C5EA 5TQ2A 3T0IA 2XD4A 5BNTA 5JO0A 1M8FA 3PIRA 3AFOA 3RQIA 3UG7A 4PRZA 1PL7A 1TVKA 2LUOA 4G4SP 5EUQB 3T3EA 1JDJA 1ZIXA 3QY0A 3SYRA 3RFCA 2VG8A 4UXIA 2D5IA 4X93A 5BUQA 2FDCA 1IATA 1XNQB 2B1RA 1U2QA 3OJEA 4J91A 1A77A 1TMKA 1GCOA 3NUGA 1VMAA 3NNDA 4M1ZA 2B7BA 2ZYRA 4N47A 3TAUA 1N2ZA 1RAHA 4EFNA 2IPAB 4ZVQA 2QLFA 2R85A 3ZPXA 3E7FA 1KE1A 3RB8A 3EGXA 3CW8X 3TF5A 1Y1QA 3QX3A 5A02A 1T9AA 2WPDD 1SIOA 4C7BA 2XRFA 3TDKA 3UYKA 4QPZA 2I0FA 1VKRA 3QE9Y 5FJJA 4RMGA 4KPFC 3VOSA 3HVIA 2J59A 3GJ0A 4C3ZA 1IXZA 1FP4A 3WGQA 4OUKX 1OASA 4WK0B 2R65A 2Z3WA 3H8SA 2CLKB 3T4XA 2R7MA 2FUG1 3C3JA 4GDMA 3VH1A 2JHCA 2VH2A 3HMKA 1LPSA 2UZAA 3CF4G 3VR4D 4CUJA 4TYMA 3OF2A 4WNYA 1DNPA 4LRWA 2DYKA 1H5NA 1ZLXA 5E9WA 4HQ6A 6Q21A 1DBWA 2G0NA 2HLDA 3PFFA 3RS7A 3NBUA 1OB5A 4FHEA 1IEVA 1Y3AA 2HJWA 2PFGA 2PS9A 3C1AA 3DDZX 3DR3A 1ADFA 1U7OA 3PRHA 4O4IB 1QOQB 4QJ5A 1XL1A 4R51A 1LTQA 3GJ3A 2CLCX 4PLYA 2NSDA 3RH0A 4G36A 4H1WA 3ZBUA 4YONB 2R7KA 1D4FA 3R6LA 4GVXA 2V5VA 4C04A 4EHKA 2J5BA 3FR8A 1NLMA 1KGDA 4DQXA 3NHJA 3DKRA 1KDPA 4BZQA 1GQFA 1U2GC 4HRVA 2ODAA 3WTBA 4F97A 5AW4A 2GKOA 2H1CA 3IIIA 3S8EA 1P62B 4L7VA 1HEIA 1WEHA 3QU5A 3FMPB 3VYTB 3AGPA 1CUEA 3T7IA 3WHPA 4OA8A 1F6WA 5IH7A 1XPRA 1USKA 2PKWA 2ZOSA 1SXQA 3UHJA 2XKJE 3BXHA 5BT8A 3KJIA 3UK6A 2JLQA 1BMFA 2BF4A 3PRKE 2WF7A 3IS3A 4J0DA 2I87A 4EECA 5IAEA 4Q4CA 2OVFA 5DGXA 5HM8A 1ZCZA 4G0OA 5DYIA 5IP5A 1ZL0A 2GYVA 3LT5A 4MV8A 1F9EA 4PGFA 2FWIA 4OK3A 4E09A 4E2ZA 2OCLA 2VBIA 3F7OA 1YASA 5EJ4A 5HW0A 4WNAB 2W2XA 3ZOZA 2AZXA 5KYYA 3H4IA 4IY1A 4LMPA 4A2QA 3GPCA 4YDHB 3AILA 3UNXA 2BFWA 1RLJA 3DFUA 3K9FC 3EXAA 4LISA 4DREA 1MF7A 3CEJA 1C7EA 3ITEA 2WF8A 2YZNA 5K6AA 1VIAA 3GUZA 4K9PA 3FUWA 4I50B 5UKDA 4RD1A 5LZ2A 4ZCPA 1KFEB 3ZTWA 1B00A 3MVEA 3Q0TA 1X8JA 4Q9IA 4AL4A 3JASA 5LQMA 2QI9C 3E82A 1Y7LA 3GEBA 2DP4E 4ZMSA 1C7FA 3L0YA 3ZEAA 4QT4A 2WTEA 3AFHA 4RJTA 1G3UA 2XH8A 2DTXA 2CXNA 1PW5A 3PS9A 2PQMA 1W5AA 1HE5A 1OFVA 1ISRA 4B6SA 4CMGA 4N48A 3TOSA 3FYUB 2J33A 3H1TA 3H5IA 1AU9A 2QMEA 3QGMA 5CVUA 4D4IA 4EBBA 5JROA 3TLJA 1Y7HA 3WWZA 5BSUA 3C15C 4UHHA 4GPZA 2W2KB 5AO9A 1WU7A 5HMLA 4RDHA 3LDAA 1G7SA 2B37A 2OV2A 2DWQA 1VC2A 2PUHA 3H17A 4HFJA 4RMJA 4FIDA 5A4FS 2HKIA 1S7CA 4X94A 3CVWA 1ZXBA 4U9UA 5I4CA 1MA3A 3FZEA 5IM5A 3SYTA 4DG9A 3Q3IA 3K15A 2G9ZA 1WZNA 4R2MA 3M4YA 3JAWB 3I6IA 2IYFA 3QELA 1XWFA 2BSAA 3Q7IA 4FYVA 1CS0B 4OL0A 1NUUA 4HGPA 4M88A 4OHOA 4LJKA 3ZWCA 2ZWIA 4OSPA 2ZJ3A 4RLHA 3SQMA 2YY5A 2JW5A 3SDZA 2OEPA 4PXSA 4EJ0A 2OL4A 3BXGA 1SRQA 3L18A 4L1KA 1OXBB 3CF0A 2J87A 2ORVA 2RH8A 5TF4A 3UXMA 1YIDA 1EDDA 5KOYA 1CHDA 2P6PA 3WLNA 3FN4A 1WXEA 2PTGA 3ONNA 4U2GA 3ZYCA 1JKXA 1KIMA 4U1RA 4WFKA 1EUYA 2WUEA 4MEBA 5IKXA 3PNOA 5HK8A 3SI7A 3I4LA 5B7QA 3AY3A 1GD1O 3BGOS 2WQ7A 3EBPA 2GS9A 1P80A 5ALRA 3HR7A 4YQFA 5K0JA 1REQA 2QTCA 1SHLA 3QU7A 4NCHA 1BGWA 4NC9A 1Y5IA 4NFSA 4KUEA 4NOLA 3RHFA 4DLVA 1Z0JA 2ZZNA 2FFJA 3HJHA 1N0WA 2FZ5A 1XA3A 1BGXT 4DMMA 5ALNA 2IP2A 1FTWA 2OLJA 4ZXPA 5FO0A 1E98A 4W8GA 5KQSA 1EFDN 3DNMA 4MS1B 4AF6A 5BNZA 1Z56C 2BBTA 1CUDA 2EKPA 2P90A 2HBRA 4AQYB 4YREA 1IN1A 2Q6KA 2XMRA 5FHQA 2ON6A 4UBJA 1W4BA 1IG3A 3AI7A 1MABB 1M1YB 2AHOA 3GLKA 1SKBA 3K32A 1T9DA 4KU4A 1R6DA 5IXJA 1P0QA 1AGYA 4HDOB 1RYEA 2OFWA 3C3WA 2B25A 2DPYA 1QX3A 2G9UA 4MH0R 1FTNA 4UUAA 4BKPA 4DYVA 1O95D 2Y9PB 3RT9A 1UJCA 4ND8A 4RNDB 3Q1KA 1FYDA 1KH1A 4GD3Q 4GKAA 1YZKA 1AHIA 1SA0A 4V24A 3GW8A 3F8WA 5F1KA 4DXDA 3SZUA 2RGEA 4WJKB 4Z99A 4EGAA 5HKKA 4UHKA 4F8YA 2ECKA 4KNWA 1NI4B 2P5UA 1I3NA 1MQ9A 1YUMA 2LKDA 4PX3A 2NPIA 1XKTA 3FGPA 5AK5A 1EZ1A 1UJ4A 3JQFA 4UQPA 3UH0A 4B3TB 1FNNA 4HADA 3LCVB 1Y42X 1BDHA 2J9RA 4W1PA 1X77A 2X2PA 3QG1A 1N7HA 5JOQA 2R8RA 5F5NA 1ECPA 1Z33A 2P0YA 4EVSA 2ZYVX 3F6PA 4FMCB 2AZDA 1RI1A 4L3OA 3VR5A 1FP6A 1JU4A 1PRYA 4BWYA 1N75A 1K98A 1YOVB 3GA7A 1WPQA 2PUVA 5K03A 2WJPA 1Z4JA 2M2IA 1KO7A 4J6EA 3RAGA 1T4DA 1LRKA 2W2LD 4UJ3A 5LYJB 4EF4A 4GIBA 2JGDA 3EBOA 5JV5A 1TX4B 2GF2A 1J8MF 3DYVA 3I30X 5K4GA 2LXNA 3ZEIA 1L5RA 3FNEA 1QYVA 3CNQS 4QUAA 1N6HA 2BGIA 3T9BA 1JEQA 4BFVA 4C5AA 2EQ5A 1G2PA 1LF0A 1TPYA 2VYVD 3CZAA 2G17A 3FYUC 1JQAA 2GD1O 3OWOA 5TNXA 3SKYA 1ZAYA 1XZQA 1QCZA 4FEYA 2H59A 1R50A 3OM9A 1EX9A 3A6GA 4JXXA 4V3BA 1OFHA 2JAOA 2GNAA 2HBYA 4FDVA 4EKDA 4ENVA 1YCHA 1LZLA 2ZK7A 3MTDA 4FEEA 4G1EB 3S5UA 3T1TA 2CK3D 3GPIA 1J2YA 1N9KA 4YRLA 2ZWAA 3MA0A 3WK6A 4EI7A 1KY2A 3I9NA 3U4MA 5CW1A 3TFQA 2V97A 1SWWA 3L0SA 4K9DA 4XWTA 4BQRA 2GZRA 4ZQEA 3ZE0B 2XX3A 2F1JA 2O3UA 4EATA 1DCTA 1QE0A 4LXHA 3CKMA 4ZIRA 3ZY4A 1NBHA 3QF4A 2VXCA 3F5MA 4MA5A 2GBIA 1J2TA 1FYEA 3FNHA 4NLLA 3WMWA 4ZI7B 2XGJA 3RSOA 3U48A 1MO4A 4HX5A 1L3CA 3HBAA 2JEYA 4E51A 1ZVJA 2B1GA 1BSVA 2ZJ7A 5ICFA 4F3KA 4UBNA 4WASA 2ACWA 3A4TA 1OZHA 2C2GA 3DP9A 3FROA 4RWZA 4X3CA 5JBNA 1Z63A 3B8HA 1GL3A 2Q3CA 3L1JA 3MS4A 3SXUA 1W75A 1USIA 5IWAB 3TJZA 1SXGA 4WFJA 5EIXA 1GPAA 3AUSA 3ZWAA 4IIVA 3THWB 3V8MA 4MKFA 1DC5A 1JFFB 1G6HA 1E3IA 1NN0A 2XNCA 4M21A 5J9FA 3S2ZA 3PJRA 3MJFA 1RRCA 4B7ZA 1F06A 3E9MA 1NQAO 3LOUA 3JQ9A 2AWOA 3FVTA 3SLKA 5AJTA 3WLJA 1EE9A 3WL3A 3JYLA 2HGZA 1FFEA 2J9FA 3IVMA 2Y1EA 4QDUA 3RK0A 2Q5FA 1Z4OA 4OHVA 3OLVA 5D8DA 1RKVA 3FMVA 2ETXA 3HI4A 1C30B 4WX2B 5CFLA 2UYCA 1MC4A 4BOYA 3W34A 3HLKA 4FM9A 1HC7A 2OM6A 3TXYA 4GW3A 3RTDA 2QORA 1E64A 1S0UA 1MB9A 2RG7A 2UV8A 4KIFA 2X5KO 3PFGA 4B6FA 1P44A 3GEIA 3ZZ1A 2J4CA 3H9EO 1VCIA 4YVFA 1W73A 2FYTA 2IYVA 3FPFA 2J8ZA 2OR3A 1N0IA 4MWGA 3TRDA 5F1YA 5FR1A 4OHZA 4RZ2A 4JBNA 1JPVA 1B3RA 2QN1A 4MP3A 3DLPX 3PJEA 4RQTA 4BNGA 2FCAA 1KQGA 4XE5A 3V6LA 2A8YA 3HUFA 3GA0A 4PYOA 3TL6A 4BLUA 2GO7A 2NO0A 1DAPA 2I3AA 4F4UA 5M3BA 3DKKA 4JYBA 1MIOA 3Q8LA 2CMFA 4C88A 4QXPA 4MUMA 4LF6B 2OTCA 4YGYA 3HVHA 4FOOA 1FYWA 2XWQA 4N5IX 4MRMB 4Q16A 3R9WA 1QH1B 1UK7A 3A0RB 4NWIA 2AR7A 3T41A 1Y33E 3UFXB 5TPZA 5A6VA 1VZ2A 1UPUA 3D31A 1JAIA 3ZQJA 3JAMA 4U00A 1JT2A 3EZ9A 3ND9A 3GDHA 3OQPA 3RUAA 3CUSA 1D2HA 3LT1A 3R5SA 2LDBA 1Y5MA 1I7NA 3Q3EA 5AI9A 1W0CA 2AG0A 2FMIA 1HLPA 3GLRA 3P4YA 4KAJA 5ALZA 4QG7A 3UC5A 3UICA 4GP7A 3LD9A 4CCSA 1KQPA 2GUWA 3G02A 3LUDA 4YP6A 1I10A 3AMVA 2R68A 3OPVA 4HAIA 1V6SA 5AXBA 4M7WA 1FQKA 1US8A 2WVAA 4MDYA 5TARA 4WXHA 1QU3A 4EFDA 4XR9A 1U6KA 2QENA 3UTDA 4ENUA 5AMXA 3FNBA 4P53A 5KPDA 2P1ZA 2DE0X 3WSTA 3PPVA 4LOLA 4TRJA 2RGWA 5E0OA 4LC9A 4A2WA 4GM4A 2OCXA 4IHJF 5DB4A 1O6ZA 3ENQA 3CNLA 3KB6A 4ZJPA 3D81A 1OBVA 1JH9A 3ESCA 3WGJA 3FWPA 3AONB 4E88A 1E9AA 3GFTA 5DO9A 4DLSA 3TLAA 3PFBA 3RIYA 1E7QA 4QLAA 4YQYA 2QAGC 4BU0A 1IM5A 5CVDA 5EHIA 3RI3A 3QFCA 4HD8A 4DIOA 1AN0A 1LBHA 4Q4AB 1U7TA 3VI3B 4ZOCA 1H6DA 2WU3A 2PT5A 1E3SA 2JFQA 4OBEA 4R1PA 4W8OA 3QV2A 1Q0TA 3FUCA 4CIVA 3FKQA 1SU6A 5DPMA 4LDJA 4J16C 5CDTA 3DXYA 1P75A 4HDSB 1JEAA 2C7BA 3AWDA 3EGCA 821PA 3GEPA 3GY0A 5A7GA 4K0KB 2Y0DA 4YR9A 4P6VF 3CR8A 4DV2B 3CBGA 1J2UA 1M2KA 1UDWA 3MRXA 4AZ0A 4IGKA 3LXRA 2JGNA 2NX2A 2KX7A 1G5FA 3L5OA 3P9PA 4UPVA 3WLTA 1TCUA 2H06A 2P78A 2R8XA 4TQAA 1DEXA 4EHJA 1NJGA 1XEAA 4D80A 1W19A 3MCVA 5H3LA 2MR5A 3CZRA 1RRPA 4NOMA 1G64A 2W0SA 4RESA 1C81A 2OMEA 5EQFA 2IVFA 1JHYA 1XZ8A 3PPWA 4YRIA 3L8EA 3FHTA 1QO0D 5LB2A 5AM1A 1ZO8A 2QL6A 1NNSA 4PZPA 2E4VA 2PX5A 4JL6A 4L9AA 1GTL1 4KQMA 3OOWA 5HFNA 3TBHA 3C5EA 4HV4A 3TNLA 1BFUA 4JJ4A 1XGKA 1XWIA 3DZDA 1NYTA 3ELYA 1RU3A 3SK0A 4QLBA 4M55A 3K30A 5P8WA 2MINA 2AG1A 3IJPA 1QK4A 4KMMA 4RPJA 2IV7A 1GKYA 4NZMA 4MNTA 4L4RA 3U5ZB 1HYEA 2O8BB 1JJBA 3DE6X 5BOSA 4QBGB 4CLRB 2ZDGA 4X44A 4B17A 1Z6AA 5LQKA 5K1ZA 2OQRA 2PNFA 3RVNA 3RSZA 3OY7A 2J5RA 3M9WA 1WPXA 1XU9A 1XV5A 3F90A 3WGHA 4QHSA 4AIIA 4P86A 4RDIA 3LPMA 3FOFC 1EEHA 1R0SA 2YV5A 4AZSA 4P3PA 3ZGLA 3WGIA 1OFUA 2XDQB 3OE1A 1XT6A 4K1XA 3TB4A 4RX1A 4F4IA 2AEFA 1VJTA 4W5QA 1BE8A 5DHAA 1ZFNA 2BFBA 1U7ZA 2OBXA 3VZDA 3EQ6A 1P31A 4II2A 1U0HC 1GTJ1 1P2BA 1XEXB 4LYFA 3LLMA 4U9HS 3SZLA 3W9BA 1BWQA 1X38A 3DL4A 5FOSA 3V5NA 2XNKA 4RLQA 4Q1CA 1SULA 4DNFA 1NR1A 1Y80A 2JATA 2ZXEA 1XZIA 2CLOB 3I1YA 1VPWA 1T5TA 3UAGA 4YRSA 4ND7A 5C3MA 2I4LA 1E0SA 1GZ3A 1RWXA 2H4ZA 4KVZA 4JXJA 1HM5A 1P73A 2R5WA 1YAJA 3MT7A 5T67A 4KLZA 4AX4A 2OGZA 1PSWA 4EQ6B 3OZWA 4FKZA 4X91A 4KYIB 1CB7A 1JSXA 3BE4A 2XCRB 4M9RA 5C0OE 1GUZA 3C7AA 4Q4AA 4W1SA 3SYNA 4BBJA 3L4JA 3JYPA 3LI2A 3CUEF 4MW0A 1H9AA 2XYPA 3HCFA 3ICOA 5LA6B 3R8XA 3UJHA 4RZIA 5REQB 4A36A 2GDJA 2ECQA 4U4AA 5JNTA 5SZKB 1LV8A 4DHEA 1ZD5A 4YIKA 1ZW6A 3UJCA 3L0BA 2Q1SA 3ROKA 2XZLA 1DZ3A 2R4QA 2G28A 3BXXA 5F4ZA 3NHWA 1VB3A 2PBRA 2QXYA 3DOHA 3GL9A 4H59A 4MB0A 4OM7A 4YAFA 4MUNA 1P9WA 4KOEC 5TQVA 2Q7OE 3G13A 3EEQA 1J56A 4ZCIA 1M74A 2N3ZA 3AUXA 4YP0A 4ZVPA 4DIEA 2C2MA 2HA7A 2X0EA 4QPPA 4B73A 4WBNA 3BJMA 1IXSB 1P5RA 2Q2WA 3SF0A 3W7BA 4UZEA 1M2OA 2GQ0A 3OFSA 3AUTA 4U7JA 2FP4B 4QATA 2BKXA 3H7AA 3HDJA 4KWCA 2Q9AA 3ONFA 2X5XA 3UJAA 3ZDCA 2I7XA 1DKQA 1YU9A 1JVBA 3MXOA 4JOSA 4AS1A 4O1HA 1K7SN 1UFRA 1PD1A 2XYRA 2H29A 5ALKA 1X2EA 5DX0A 2FR8A 2RSLA 1A8HA 3KUDA 5SY4A 5FX2A 1OVGA 3ZQ6A 5ETJA 5JAPA 3RKUA 3ZXSA 1G4UR 3UHOA 1QK5A 1FLDA 2JGJA 1NA5A 3WGYA 4J1TA 1GQQA 3DBHA 4DC0A 2GAAA 3NAQA 1KBOA 4CKWA 4I6GA 1T6BY 4ABTA 3OP1A 4F21A 5BSKA 3AF3A 2GTHA 2NNWB 1ADGA 1OPXA 5SZHB 2XCSB 2IPLA 2IYZA 3JWPA 5JCPA 3B7GA 5K20A 2PRSA 5CT5A 3OX1A 4YJDA 1DG1G 4NCAA 1TCVA 4AQDA 3ZNPA 2G0TA 3V7WA 4RIHA 1SH7A 4EWLA 3GLHA 1GRNA 3DO8A 3E9QA 1I6MA 1ZI6A 2HDWA 2HUNA 2R60A 2R6FA 1ACMA 1A7AA 3LLUA 3T7RA 4ZOEA 1SK8A 2JIRA 2JJMA 3ABQB 3KYDA 4EX7A 1R9GA 2PVPA 3ZDRA 3LQRA 2GD0A 3RDPA 3LYAA 1NATA 2J85A 5EUMA 2XY4A 2VDWB 3ESYA 4QTXA 2EL7A 3PXAA 1H2AS 2A35A 1JH8A 3EH1A 3NHPA 3M6UA 3HKEB 4M76B 1IUKA 4D79A 1G0OA 1TAQA 3KOYA 1PYDA 4Q7EA 4W9NC 1R3UA 2F62A 1C3VA 2NSYA 5D3MA 5FTWA 1MX9A 2A92A 5NLLA 3EULA 4YRTA 2PWBA 3JSAA 1Z83A 3SJAA 3ASZA 3PQ4A 4AS3A 2PT7A 5GAJA 4YX9A 4KREA 3I6YA 1OX4B 5KDLA 5JALA 1J7JA 1BE1A 2E3JA 2GF9A 4URHA 4S04A 3OH8A 4HK4A 3UGJA 4JZYA 4K6OA 4F2PA 2P4SA 1NY5A 1VPVA 2JD1A 1EWVA 3VM6A 2QWXA 3PIIA 2HT1A 4C1NA 2XUGA 1LX7A 3HCRA 1Z75A 4W5HA 3WNQA 4CM9D 1C14A 4OXNA 3KM0A 4PZ0A 2RK6A 2HFJA 1T6ZA 4FR0A 4I9UA 4LJ9A 3UB4A 3JWJA 8ADHA 5BSGA 2JJ2D 4MUJA 1Z0ZA 3DM9B 5CMLA 3ZNNA 1WXXA 3Q9LA 4BEJA 4EUKA 4RJLA 5GMOA 1CFJA 3RBXA 4ENWA 2HNKA 3RYCA 8GPBA 3HEBA 1FSPA 2AFRA 3LPLA 4NNOA 3AQIA 4ZVVA 1BTOA 3ECAA 2H5EA 5D5HA 5AM2A 4LFBB 2HQOA 1H4VB 1ZD1A 3C4QA 3WGKA 1WLYA 2W00A 4QBFA 3OTIA 3EVEA 4X3OA 2CBXA 2VQFB 2BTEA 2RKBA 5EYPB 3AJ9A 3T94A 2CXPA 3A3YA 2GYYA 3R0JA 5K3FA 3OURA 4WBXC 1IQPA 5FBLB 5HILA 4YROA 4RVGA 5J63A 3NKLA 3L43A 3X1MA 4L9WA 4LMRA 3BD9A 5K05A 3SIRA 2XMGA 3TB6A 1TAUA 3OQ6A 1NVTA 2Y27A 1KO5A 3E35A 1D1QA 1IOVA 3M0EA 3MSXA 1I2ZA 2Z2XA 2GOYA 2PX6A 4QODA 2Q41A 4PIMA 1JXQA 1ZOIA 3EIUA 1EUCB 5DYWA 4W5OA 4JJZA 1R6UA 2XRYA 2QRGA 4JR1A 4LJSA 4G2NA 2CKDA 4D41A 1KPHA 3U7FB 3STXA 3GGCA 1RKXA 3ZWDA 3HXTA 4FSXA 2DX7A 1F60A 4U0KA 2A3NA 2G7ZA 1DWOA 2YWJA 5TGDA 3TLMA 1LBIA 5IPFA 4DMUB 3RVMA 2ZYUX 2N47A 2XVYA 1ZUWA 2NW6A 4ND1A 3E03A 4DIFA 4W9RA 3DE2X 1QU2A 4LJLA 2DC1A 4C05A 3BL6A 4S1OA 3UN1A 1QFZA 3BIXA 4HUJA 2JFHA 3I42A 3ITDA 3P1JA 4CKEB 3CCBA 1L7MA 1HDCA 2PL5A 3CX6A 3B36A 2NADA 3FBTA 4LY9A 4MW9A 4B33A 5KSPA 4B75A 1HE3A 1AA9A 3CW9A 3JQAB 2BN4A 1N0UA 5AOCA 4RA6A 1OZFA 5C7LO 4XTCS 4YUYA 4RVSA 2P2YA 3LP6A 2B82A 4DBLE 1N1MA 1X1DA 3B9RA 4MQUA 4EZBA 5MDHA 4UE2A 3R6WA 2NPOA 3BS4A 1N9ZA 5E7MA 2A5LA 2QVYX 1KP9A 3MFYA 3QUTA 4D0SA 1VLZA 1QB8A 4QXQA 3OD1A 5HKOA 3AP1A 3IE1A 4NJMA 1VRWA 2P3SA 3R24A 3SR4A 5IYZA 4BKOA 1J39A 3B1VA 2X14A 3UOWA 4TLCA 3LYHA 1JYFA 5K8UA 4PCVA 4KL8S 1HDOA 3WYDA 2QIPA 4XM2A 5FBZA 3UENA 3AVUA 4KDCA 2ZEJA 4FUQA 3RSCA 4K05A 1IMOA 4HEA1 4XDGA 2Q50A 1WW2A 4IJWA 5ALQA 4C20A 5JYEA 2Q07A 4MV7A 4V0RA 3ZDXB 1JE0A 2IIPA 2YCBA 3RYFB 5B6IA 4CIBA 4KR3A 2H18A 2OSVA 2Q8PA 4G65A 3PJFA 4N5LA 5HFAA 1QTRA 5BMVA 1RQRA 4MJ3A 1NN1A 1OBCA 1U6IA 1YS6A 2GPYA 2QYSA 4QO8A 3KDPA 3HADA 1CYDA 2MIIA 1FJHA 1MRNA 1T4MA 4JKIA 1U2GA 4A6EA 1U0GA 3ZXUB 2BW0A 2OYCA 3W7VA 4KXFB 5AUOB 2VI5A 4FVTA 3C43A 5J4LA 3ONWA 1MW8X 1KR5A 5CEEA 4MPTA 5KJEA 1QWSA 2J3KA 4L51A 3UH1A 2GNOA 1QZUA 4RFLA 3KT8A 2QTWB 3WL7A 2OCAA 4XWAA 5KNLA 4L08A 4BKUA 3CJRA 2XNDA 1LY1A 2VHUA 4NBVA 2SNIE 5IJ0A 3P26A 2XTZA 3R9XB 4TXHA 4DWVA 4ZQCB 2BR5A 3HVJA 2BAGA 3G0GA 4CNBA 3VO1A 1GGFA 1W4ZA 1U9ZA 5IS2A 1T0HB 4Y2TA 2XGMA 3KXIA 1U1FA 5HKKD 4DLRA 1QH8A 1CIVA 3BA1A 5BXQC 2H2AA 5JDIC 2WABA 3GPLA 2OV4A 2SHKA 3REFA 4CKWB 2IL1A 1DKMA 4KTTE 3HFRA 1OWMA 3GA5A 1UOQA 3WTCA 1HQKA 1IZ8A 4O4LB 1UXJA 5HHTA 1RBZA 3EJ6A 4JEHA 2VHCA 1XLWA 5IT5A 2O8DB 1JHXA 4GMHA 4D9FA 5K8VA 2EBFX 3KJHA 4EB3A 4KMRA 2QJWA 2QMYA 3AOGA 4CQJA 3OPQA 4CKBA 1U8TA 4IV5A 4Y1FA 4J75A 4P81A 4QOHA 5KYTA 1X7XB 4RXTA 3D5TA 1MH1A 3DTVB 5G0WA 2FG6C 3PDIA 3ZGVA 4BVHA 1ORVA 1JSZA 2IUUA 1JHMA 1O95C 4H3VA 3IL2A 3X0DA 1K06A 4RK0A 4RXUA 2O2IA 1ACJA 3KKEA 3RYIA 5H9WA 1NJSA 1IPEA 2ZB8A 1N92A 2PIAA 3KOOA 4JC5A 4Y7DA 5DGIA 1CIPA 1HYQA 1HDGO 1PR0A 1I4LD 1T8PA 2ADOA 4UVIA 1JHOA 3V7YA 2PUEA 4BFYA 1JWBB 3ZDBA 2R6JA 4KR9A 1E5LA 2Y8EA 2R8EA 4DADA 3UV6A 1E9DA 3E5HA 3GFFA 2JHFA 3DW3X 4AP9A 4FWIB 4C89A 3Q8WA 2WYVA 3VJKA 2VTBB 3BH7A 2HM7A 3BQ9A 3MERA 4LCEA 4IX9A 2WI8A 1AUQA 4RVNA 4Z9AA 3RRMA 4C0BA 3G2IA 3GHYA 2CVZA 2JAUA 5AKHA 3IR5A 5EIOA 1ZMRA 4B84A 2O2CA 4IDEA 4AWBA 2ZRHA 4ZO4A 2HMUA 1F2UB 3NGLA 1OE0A 2W2QA 1SZPA 1ICEA 4MVJA 1KY3A 4JV5B 1MJNA 3JQBC 2OFFA 4B79A 3KZCA 1CG6A 2ZJ8A 2BR4A 2H3HA 2JAWA 3Q3JB 5F33A 3WNZA 2DPHA 3HCDA 2F6RA 4ENQA 2D8AA 1UWCA 2EKBA 5A03A 4TT3A 1GA4A 5FPHA 2PMKA 2W43A 2PT6A 3KZKA 2BBSA 2M6LA 3EEBA 4IRXA 4MUXA 1Z74A 1A69A 2J0UB 4OGKA 2V4UA 4Z4IA 4DNOA 3R5KA 3NPMA 1TFRA 1BXZA 4KQIA 4OBBA 4R71A 6REQA 1QKIA 2PK3A 1C1YA 1DLJA 1Z73A 4KN6A 3UMFA 2QSYA 3F6EX 4CMEA 2VCEA 4W5WA 4LAFA 2NO1A 4O4JA 2K2WA 4TMZA 4WNIA 3LXXA 2B8WA 1W9MA 5EZYF 3U7QA 1UKAA 1EJ0A 4E5YA 5GIPE 2IUYA 3CUYA 3OECA 1O6CA 3CRRA 4O4HA 5GJBA 1Y3BE 2O7VA 4WECA 2XUJA 4F9GA 2QX4A 5LYJF 4YJGB 4EF6A 5ALEA 1VE1A 2ACVA 5TY0A 1E8DA 1ZK1A 3ZWVA 4MI3A 4ASUA 5B4VA 2BF7A 2AD5A 5C8VA 1RMTA 2ZIVB 1TAGA 4JHLA 3ML1A 1PUXA 2AMVA 3D2LA 3UZUA 1WSWA 2JI6A 1UAGA 3E9NA 2OECA 5JDCA 4YJ2F 4CMKA 2HGSA 1ULBA 4CUKA 4MW6A 4PSKA 2RGNC 4I3FA 3VR5H 1YJ5A 4ACBA 5B3LA 3RT7A 5JCOA 2OYSA 4QXOA 1O5OA 3OZXA 4R1MA 4YTEA 3C45A 3EXG1 2JAPA 4HMQA 1VBFA 1WG8A 4TRMA 2OFPA 3EGXB 2GAJA 3E9CA 4NPCA 5HKLA 1TKRA 3QQPA 4C9BA 4IIBA 1B15A 5IMSA 5ALOA 1NVBA 1ZJ4A 3L8GA 5KI6A 3VV2A 2X5JO 1WO8A 1FUKA 4Q24A 2MMCA 3ZW9A 4CM4A 4CKXA 3IBSA 3UK1A 4A8JB 1L4BA 4Y6LA 3O4RA 1RNLA 2EJWA 3G23A 4L5YA 4RD0A 4HDRA 1DE0A 3V9PA 3GGGA 2A33A 1DC4A 3EMVA 2YIJA 3PFCA 1KI7A 4H7EA 3L82B 3W2HA 1BE6A 4N65A 3I1FA 1D8AA 2PWZA 1YVEI 4WXPA 2XDWA 3H2BA 3LIIA 1FDUA 3TVYA 4YBZA 3WQHA 2ZWMA 4ZN6A 1SR8A 3O84A 1K2WA 3K0HA 1QX4A 1Z45A 1R6BX 3NRJA 3V8NA 1MXFA 3KT0A 4MINA 3GP5A 3PWKA 4BV9A 5FV7A 4FZ3A 2J31A 3GNQA 2N9UA 1PWYE 1AKEA 1TK3A 1PGQA 2YOGA 3DVSX 3LC2O 4LVOA 4YJ2B 2DOKA 3M7IA 1A95A 1SVMA 4ZU3A 3ZHVA 2E0IA 2IF2A 3I23A 2CBZA 4E5PA 1XKQA 4DR6B 4O25A 3C5HA 2GZHA 3LT2A 4FFDA 1N3YA 2E21A 2MSEB 1V2HE 5IBPA 3UJBA 2B1QA 3COJA 2JRLA 3CEAA 1GGMA 1DJQA 4IIUA 3PVZA 3CZCA 2GEBA 4JLBA 2JCYA 3DF9A 3D59A 4MUYA 1CY7A 1O0CA 3MFQA 1SKYE 1V35A 4ZOLF 4CMHA 4B4KA 3S81A 2G1AA 3FUVA 5BYAA 3VKWA 5IDYA 4J0QA 5AKKA 2QM3A 2SKDA 2C9MA 3OQIA 2GBGA 5CTJA 3MLBA 4U7PB 4WPGA 4AN4A 1P74A 1E8NA 2VR1A 2G77B 2XEXA 2FCRA 1JG1A 2FZCA 3CBQA 4CRWB 3HUTA 2HX1A 1E99A 2C84A 2ERXA 2H17A 3LJKA 3P2MA 3PLAE 4BKMA 1GNQA 2QR2A 4PHTA 5IH3A 5TPZD 5LN1A 2OGWA 3OC6A 2ZTVA 4LDQA 3E1SA 1U8XX 3O1JC 2HEIA 1SUFA 1IIRA 3KUKA 2GJ4A 2BDTA 2I71A 3CA8A 4OI2A 2IUTA 1S3IA 5H81A 3UM9A 2R00A 4DF3A 5KTRA 1PQWA 2Q3HA 3HACA 5K5EA 1UK9A 3GGSA 4PGHA 5KNCH 1N33B 2FWRA 1J9EA 3KVVA 3JQ9C 2HU8A 3PXGA 3I05A 4DBLC 2WNSA 3AHJA 4XD2A 1KBQA 3QQ5A 4DIBA 3G79A 3N3BC 5FTKA 2PYIA 5DM0A 3GJQA 2AR0A 3N2LA 1UJNA 2XVZA 2NZ8A 3W5IA 5A0VA 1T3TA 4LHVA 4U3JB 2O07A 4FCVA 2ZSJA 3A9VA 1RLIA 5F23A 2OXTA 5BYJA 4YCJA 4QVIA 1G2QA 1IFXA 1KI6B 4NK5A 1JDUA 1H2BA 3DMDA 4MWBA 3UPDA 5B30A 1RZRD 1JALA 4XGIA 4O33A 1UJ2A 2A94A 3JALB 5KTTA 1K63A 3OC0A 2GCOB 3UUEA 1IY8A 1U9JA 3GARA 1EVEA 3SEFA 5CA0B 4MB2A 4GZMA 4AO7A 1RZRA 3WADA 1ZZEA 1OLUA 3TTYA 5I7VA 2X8JB 4NPHA 3PFNA 4TLMB 1M2VB 4WJLA 1KAMA 2XCUA 3MLAA 5EHQA 5LNK6 3L1HA 4H4DA 4RTOA 3V48A 1PR4A 1XC7A 3P9XA 3AYXB 3PDHA 1FNSA 4RFSB 3VSCA 5CB4A 5E8JA 3CLSC 3I61A 1R6VA 1ONOA 3UUWA 2V7VA 1IXRC 2OFXA 2OMKA 1LVHA 4X20A 4EY5A 3SNHA 4LVNA 2DFKB 1WF3A 4TTPA 4X8HA 3TN7A 4EDFA 3HXQA 2C2OA 4O4HF 5DNEA 4LZOA 2NUBA 3F9IA 4RHUA 1X19A 2J9GA 4OQDA 1RWPA 3GG2A 2QTAA 3QBEA 2J0UA 5JD5A 5JJBA 1DOHA 1LBTA 4Q3NA 3KQUA 3QEMA 4MQMA 1ZINA 3GMTA 2PLRA 1NVUQ 4BRWA 1OFGA 1N77A 5JLAA 2YWCA 3LE8A 3BEDA 1UJ6A 2ZRKA 3FVWA 1LGYA 4MITA 3U60B 4E15A 1BJRE 3L7LA 3NTUA 3UATA 3K1AA 1P6QA 1X7XA 3PQ7A 5ADHA 4PO8A 1T0IA 3P45A 4J8PA 5D87A 5LQCA 5BR8B 1WHTB 2WUDA 1J8FA 1M7BA 4XTRA 5AK6A 2H08A 3TL3A 1SXPA 1DX6A 1Q14A 1V3VA 4GM1A 1N0VC 5LMNB 2QDKA 3ZKWB 3SLRA 2ZM6B 1M73E 3SD7A 4DSUA 3VKGA 3L07A 5F77A 1CR6A 1YIAA 3DV0B