2LCFA

Solution structure of gppnhp-bound h-rast35s mutant protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Solution structure of the state 1 conformer of GTP-bound H-Ras protein and distinct dynamic properties between the State 1 and state 2 conformers
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lcfA00
4NTZA 3SQWA 3OIVA 1NY5A 2QA5A 5M04A 1P5ZB 1SVIA 1J2JA 1BKDR 1ZBDA 3OE7D 1T0HB 3QJYA 3G82C 1DELA 2OV2A 2YOFA 3B78A 2IYXA 4PXAA 4UQOA 2Z0MA 3EPJA 1XD9A 1MO5A 5CM9C 1UF9A 3KJGA 2AN9A 1A4RA 1X8JA 4RZ2A 1DAEA 2WJJA 1JECA 1Y3AA 1EXMA 4QNRA 4V03A 1E2KA 3WBKA 1N0UA 1SKYE 3HR8A 2FPMA 1LFDB 2FOLA 4EUNA 1MKYA 5DLQC 3BORA 2FEMA 1TQDA 3ASYA 4B33A 2WPDD 5CIQA 4RZ3A 2JLUA 2BJVA 3KFXA 3MUFA 4JVLA 4W5JA 1N6PA 5JWRA 5GJBA 3BFKA 2CE2X 4OBEA 4Q1FA 2QT1A 3RANA 2BMDA 1RIFA 4DHEA 4OI0A 1SVSA 1DEKA 1ZMXA 1LW7A 1UBFA 3UKDA 2JA1A 5E7JA 4TZ0A 4MITA 4ZI2A 5FPYA 5KDOA 3IKJA 1U9IA 1GP2A 4BWYA 1W2GA 4TMTA 1XD2A 2VBCA 2XJ4A 3LLUA 4RKFA 3GJ7A 1BH2A 3QNUA 5FBWB 3GP8A 3AVWA 2FFHA 4N3NA 3UWOA 1XJCA 1T5LA 5FBVB 4MKGA 2D06A 2HXSA 5H8WA 1X3SA 3IPXA 3QBTA 2ODBA 1Y63A 4F4CA 3CF2A 5KDLA 3RDPA 2GXUA 2W6JA 2Q6TA 2WMOB 4LOAA 4URZR 1VG0B 3HPRA 2OT3B 4NDZA 3LVRE 3A8TA 4PO9A 4DT1A 3VX3A 3FYHA 3SYLA 1U81A 5EUMA 1XNJA 2IUSA 1G3UA 2B8WA 1I4DD 2QAGB 4PQRA 1UEJA 5LB2A 2ZI7A 4D2IA 1S4QA 3CH5A 2ERXA 3QENA 1CLUA 3TQCA 4JMPA 1KSFX 4V0MA 4QM7A 4DUGA 1K5GA 2PZGA 4TSFA 2KI5A 5K8LA 2DBYA 4HAUA 3B1WA 4Q18A 3NTUA 1XZPA 4NCKA 3RRZA 3UPUA 4EDHA 3B1ZA 4UXHA 4QFMA 3IIKA 2J0QA 3EC2A 1AZTA 4LBZA 2ZI4A 2O0JA 1GVNB 3AVVA 4LV6A 2ZU0C 4PQFA 2J1LA 1CBUA 3MWYW 5CYOA 4EFLA 4LJ5A 4U02A 1JEEA 4JJKA 1F5NA 2W83A 1MRNA 2OFWA 1TADA 4LJYA 4QGGA 1HA3A 3ZVNA 3P4XA 3IILA 4DCUA 3W3ZB 4CEIB 1HT1E 1ETUA 3U7HB 2VYFA 3LLMA 4LYFA 1IY1A 3QG5A 4K81B 1AGRA 1D9ZA 3GLHB 4YDHB 3CF6R 2MSCB 3GLHE 1ZC4A 3I4LA 1NKTA 2G0TA 2JAQA 4JVSB 2NGRA 2RGCA 5B2ZA 3TNFA 3KQLA 1K8RA 2QT0A 1Z07A 2GCNA 4MRNA 1V43A 4Y0VA 1KKMA 2JDIA 1VG8A 4TTQA 4UJ3A 1COWD 1G5PA 2EW1A 4MDEA 2P2LA 3AB3A 4OQMA 1OKKD 1QVRA 3UWKA 3M4YA 1Z0FA 5KPJA 1W4RA 1XEXB 1W36C 3AKCA 1IBRA 4PHTA 4DCNA 2XB4A 5AR1A 2UZIR 4TTRA 4XJXA 4TN1A 2OBMA 2GKSA 5KSZA 3R9WA 4RJLA 3IDQA 2ZAOA 4DDWA 4YC7A 3B9QA 2PT7A 1T8UA 2FSFA 4TYPA 1EGAA 1N25A 1X1RA 3FKSD 3GLFE 2ZS9A 5F3WB 4ACBA 2QAGA 2MMCA 4NL4H 5JZVA 5HZHA 5JECA 4WAUA 1NSTA 4ZKEA 2QP3A 2CE7A 2A78A 3LW7A 5L3RA 3T12A 4G5SA 1TF5A 5KSPA 1KI3A 3VR1A 3AF2A 2ZJ2A 2W2TA 5JEEA 2R44A 1G5RA 3UG6A 1Q1ZA 1DO2A 4IJMA 1Z3IX 3PUYA 5EE9A 1DG1G 4IXNA 3U7EB 3KJEA 4JS0A 1ZNWA 4HB0A 4WXPA 3HU2A 1E0SA 4E22A 3AVUA 3NEYA 1G64A 2IHBA 1GZSA 2IT1A 3A36A 1GDDA 1Q1QA 2DFLA 1OXSC 1U8YA 1Z0JA 3P20A 1Q12A 4LBVA 4B3DA 3CRRA 1KAGA 3MJHA 3V00A 4C0QC 3OHMA 2QGZA 4P4SB 2VO1A 4EJSB 4ERNA 5FH9A 1J7KA 2WJVA 1UDWA 2H16A 1X8LA 3QKTA 4CEIA 2RGGA 4FMDB 3ZVMA 4CIDA 2PCJA 1AN0A 4IEIA 2N46A 3R9XA 2FPLA 3BFXA 3IHWA 4M0LA 1G8YA 4TYWA 3EZ9A 1M7HA 2Q3FA 3BC1A 3GLHA 2WIAA 4FCWA 4AIIA 1SVKA 2ZANA 4OJQA 4OQXA 3MGCA 5BYJA 1ZD9A 5SZKB 1IY0A 3B1YA 5BWMA 4A1FA 4IHQA 3CR8A 1Z28A 1CU1A 2W2XA 3K9LA 3QXJA 4V0ME 3SHWA 1FFHA 4OQFA 1MV5A 4PX9A 1NBMD 1VPLA 2WIBA 3SFVA 3G0HA 2C98A 2OHFA 1K6MA 1OH8A 2GBLC 2GESA 4KODA 3QPWA 2AK3A 3W3AA 3SBEA 4P4UA 4TLCA 1P7CA 2QRZA 2ZRPA 1R5OA 4EQ6B 3UATA 4Q4AB 5FL3A 4C4PA 4OI2A 4GP7A 1XEXA 2A5YB 3L0PA 4TYQA 4D0NA 1E69A 2ONKA 3CPJB 5EJEA 2PH1A 4NBSA 5D3MB 1OJLA 4XVUA 2FZ4A 2J46A 1W5SA 4B35A 1UKVY 3K0SA 1E2JA 3I8SA 4OL0A 1G8HA 4B3BA 3FVQA 4F91B 2BBWA 3LO5A 3PIRA 3HU3A 3WBJA 2A9KA 2W0SA 5EZ5A 4DLUA 3DKVA 1P2TA 4PSAA 5EXPA 3R8FA 2Q21A 4IVRA 2I3BA 4JLAA 1DBSA 4Q9JA 5L3SB 1E3MA 4YMVA 1BS1A 4KLZA 1ZUNB 4B6EA 2NTYC 3QEOA 2EQBA 2OBNA 1KK0A 1OIVA 4URVR 5LB4A 4AKGA 1IXSB 1LS6A 2ZRAA 2IYVA 3JVUA 2MSEB 4U5XA 1VG1A 4PPNA 4I1VA 2WSSA 4Q9LA 4X8HA 4C2TA 2QM8A 4UNRA 4YXWD 4LUCA 3ZDQA 2GZHA 1CS4C 3Q3JB 2IEYA 1ZM3A 1G41A 3CNOA 2XOKD 1L7VC 1ZIPA 1YZLA 1ESNA 5BQ5A 4IDNA 5EE0A 5FTMA 1QHSA 2IA5A 4J0QA 2VSOA 2EFHB 3LXXA 1UAAA 1VHLA 2ANBA 3IO5A 2YWFA 3TSZA 4P4SA 3HDTA 3UXMA 3E1SA 4EJSA 2OFOA 3TAUA 1DG3A 3QXSA 2E87A 2QI9C 4OI1A 2RGXA 2HJGA 3KZ1E 2H8KA 3OZXA 1XZQA 2ORWA 1R0WA 1YVDA 2MSDB 3MFYA 2GXSA 2OM2A 2FFBA 5EE1A 3FHOA 2IXGA 4PTLA 3FMIA 1DADA 1NLZA 3AKEA 2YC4C 1L2TA 1OT3A 4H1VA 4RD6A 3LH5A 3ND8A 3AVPA 5LBIA 1CR1A 2OCBA 3PUXA 1U94A 4ESHA 1WBDA 4LRWA 1R6BX 4HDCA 4XTCS 3THYB 1VCOA 4RD3A 2OG2A 5KUTA 3VKHA 1TF2A 4G0NA 4EQ6A 4Q4AA 4DC9A 2GK6A 2XAUA 4RVCA 2ZRFA 3KXKA 3MLEA 1VIYA 5CIWA 2GXAA 3VMFA 3BH7A 3ETLA 2UKDA 2HYDA 4XTRA 3U5ZB 1U90A 5D3MA 3U61B 4JBWA 5E7MA 2RAPA 1Z5ZA 4XH9B 4C0SA 3OAAA 1TUIA 2NO6A 3TQFA 4F38A 1N0VC 3TVTA 4PO8A 3SU8A 3TR0A 3UIEA 4ZKDA 5JJKA 1E0AA 4DIEA 3IUYA 3PEYA 3QQ5A 2ZR7A 2ZJYA 2XEXA 2VF8A 3IIJA 3TRFA 4BLRA 2GZDA 1F2UB 1N0WA 2LKDA 3DMNA 1Q20A 5BN4A 4URUR 4JLPA 1D8TA 3FFBA 4FIDA 3U60B 4BFZA 2G1JA 5L3SA 2LWIA 1XTIA 3FMFA 3F0TA 2B21A 4M1SA 1KDPA 2Z83A 2ZREA 5JLJA 3KUCA 3RS5A 4DLXA 4TQ9A 2ZAMA 5IT5A 3ZH9B 4C0AC 1WDTA 2DY1A 1SKQA 2HCJB 2R65A 3K9NA 4WW0A 2ZE8A 3AVOA 3T34A 2Y8EA 4KXFB 1LF5A 1DAIA 1D2EA 4PZYA 4I1UA 1OFIA 2QEQA 2ZI6A 5J4VA 5KHOC 3ICQB 1WB9A 2B92A 121PA 4BRUA 3EZFA 1RRFA 2VHJA 1YRAA 3I8XA 4FMCB 5UKDA 1DAMA 4KFUA 3V4FA 4AYTA 2C77A 2H1LA 1XPUA 3EWAA 3W34A 1T3LA 4DCTA 2CK3D 3BS4A 3X1WA 2G1KA 2C78A 1ZINA 1NJFA 3ZZ0A 3I72A 1CJMA 5TXGA 3UMRA 1XEWX 1PUIA 2XSZD 2WWIA 3WP1B 3WXMA 1OFHA 4OHWA 1D2NA 2OILA 2RCNA 4ZDKA 4CRWB 4Q03A 2BWJA 1J70A 1E98A 4BEBA 1D6JA 3VR4A 2FN4A 5G3YA 1G19A 2W6ID 2YOHA 3NDBB 3THYA 1OH5A 2X77A 4IFEA 5KNDA 5KNBA 1RRGA 3NXSA 1NVVQ 2XNDA 4US1R 5AUQA 1N5JA 3MD0A 4UNSA 2OLKA 1XDBA 3FTQA 4A82A 4DSTA 2XZLA 3X1ZA 3PUVA 3LQRA 3AF1A 1KI7A 1KI8A 2VPPA 2O0KA 2ZJOA 4ZV4A 3I5XA 1E96A 2ASEA 3B9PA 4NH0A 1Q21A 2RGNC 4DVGA 4AURA 1XBTA 2FFQA 4UKDA 1IN8A 5J40A 1XCPA 1RYHA 1QHHB 1KO7A 3P32A 1ZM7A 2NPIA 1F2UA 2A5DA 3K53A 3I1FA 4KI0A 4XSHA 5AJYA 1FUKA 1OXVA 5IDVA 3RRMA 5KO2A 4NYMQ 1U0JA 2WJGA 3M1IA 2ZPTX 4HB4A 4Q9KA 1KO5A 1GKUB 2AFIE 4IDOA 1MRSA 4IKEA 2ZRCA 5EXSA 1F6BA 3CUEF 1PLKA 2R62A 4GOJA 3VR5A 3VNUA 3FHCB 2ZJBA 4LX0A 3W9YA 1F2TB 4PR0A 2IYYA 2P0EA 1W4CA 4HLDA 2ZSFA 1SGWA 2FH5B 4KCGA 5DI9A 2YJTD 4URYR 1YZQA 3RVBA 4L16A 1JXMA 1XTRA 3D6TB 4PC1A 3OEED 4V02A 4IDHA 3C16C 4M53A 2QNRA 1ZVQA 5B57C 2F9LA 2FDCA 1CR2A 4POAA 1KO1A 1EFTA 5P21A 3Q7QA 1II9A 4QC2A 3IEUA 4BRWA 1OW3B 3KL4A 1Z6GA 2ZRHA 2ZRIA 3GJXC 4H9GA 3CLVA 1Z8FA 5CYPA 4XWKA 3REFA 2ZYTX 2ZIAA 3GJ6A 2VSXA 4TT3A 1ZRHA 1G1MA 1TEVA 4W9MC 2QAJA 4A8JC 3F3YA 1GITA 1PLLA 1CTQA 4JT2A 1FP6A 3W5JA 4S2EA 1ZW6A 5G53C 2RMKA 1VCIA 3AVXA 1R2QA 5HE8A 2KSQA 1YR7A 3A37A 1AS3A 5DI3B 1Z2AA 2QRNA 1UKEA 1WQ1R 3VX4A 4LBYA 2IF0A 4MGKR 1E2MA 4V0NA 3EASA 1G7TA 1HQCA 2AKYA 4TL6A 4CT4B 2YNMA 2YWEA 5J4HA 2ZVQX 1AJEA 1N6NA 3D8BA 4DZZA 3TGPA 3C4JA 2R8RA 3S1AB 5EP4A 3R9IA 1HV8A 2YINC 3VQTA 5FUWA 5TMPA 1VCNA 4LI0A 1E4YA 3TVDA 1FP7A 1PLJA 2JJ2D 5E3HA 1E2QA 2WPDA 4BFTA 2C9OA 4MYCA 5GJWC 2MMGA 5FUVA 1Q3TA 1QHHA 1SXJD 5H70A 1WBBA 4FI3C 4F92B 4DB4A 2J7PA 2DWQA 2RB4A 1DAHA 4D82A 2V6JA 3U3KA 1PUJA 2GVDC 5C18A 1OFUX 2WJYA 4M2LA 2JEOA 1IN6A 1QVAA 3OFND 1T6NA 2C5LA 4YMTA 4DIDA 5FFMA 2BKUA 3WP0A 3EW9A 2BOVA 3CONA 1DAGA 3TUZC 2OUKA 5AUOB 3OIYA 2WKRA 5FOSA 2W00A 1F2TA 5B64A 1WE2A 1YJ5A 4PAOA 1R8SA 1W2HA 1A2BA 4MA4A 2HUPA 5F2EA 3WNDA 1U8AA 3J81k 2GEUA 2FNAA 3OESA 3K0CA 3VTKA 1NLFA 1Q57A 1Z29A 3ZZTA 3AVYA 1KO8A 3SJZA 1XMSA 2V7QD 4R98A 5IHPA 4MGZR 3W8NA 1XXHE 4C2UA 2F3TA 4PANA 1UPTA 4BPBA 1M8PA 4DDVA 1S1MA 1WMSA 4K46A 3WHLA 4HB3A 1FOEB 1YHNA 3UMSA 2D62A 2GEDA 5KSOA 4CZ2A 1WCV1 4ASUA 5KSYA 4KLNA 1OV4A 2F7SA 1P73A 2ZRNA 3RAPR 3K8YA 3T61A 3OIWA 3U6KA 3LBNA 4C0LA 3BIFA 1IXZA 1US8B 3EPKA 1T8TA 2D74A 2VP2A 3KQHA 3QXXA 1KJYA 2FEOA 3AM1A 4CEHB 3A1TA 3TR5A 3GFPA 3QKUA 5EXXA 3A1WA 4XD7D 3S1AA 1SHZA 3BK7A 1G5TA 4HLUC 1KGDA 4CT5A 3K70B 2Q9AA 3VFDA 4WZAE 2IL1A 2QY9A 2GJ9A 1KIMA 2E9SA 2OBLA 3DKPA 1ZJ6A 2CLSA 2EFDB 3EZ6A 5FTNA 5LDDC 3IO3A 2HCBA 2WWYA 5AUNB 3KX2A 4ILEA 4LHVA 3KUDA 4A9AA 1IN4A 2EFEB 3HR7A 3KKNA 3SS8A 3VHLB 2ZUBA 2AWOA 2X19A 3BWDD 4JBXA 4Q4LA 2BBOA 4GNKA 4MRVA 4AC9A 3B60A 3VR2A 2WZQA 4UXIA 1NBME 1IN7A 2ZSDA 3CR7A 1COWA 3ND9A 3B7GA 4KBFA 1MR3F 1KHTA 1L4YA 4QNMA 5C4GB 3ZQ6A 1OKKA 4A4DA 2QPTA 4Q48A 1ELOA 1UBCA 1CP2A 2PT5A 2JLYA 4QHTA 3CX7A 4DLRA 2IHYA 2ZTSA 4B3FX 3REGA 4DEYA 2G88A 3IIMA 3LVQE 5LPNA 4QM6A 4CEJB 4B43A 4XSGA 3LA6A 5GJVC 1KJZA 1QHYA 2FGJA 1YZGA 2JLQA 3CZPA 3PQCA 3EPLA 2REBA 1VKJA 4KSBA 4ZCMA 2BCGY 3FKSA 4PAQA 1XXHA 3THWB 2JJ8A 3BH0A 4F7WA 2JGNA 1IJFA 1E9AA 2RHMA 1QF9A 2QSZA 1E1QD 3B13B 2CJWB 3RSOA 2IX3A 1E2LA 1JPNA 2JJ1D 4G5QA 2B7BA 2J7KA 1IN5A 4NKRA 4W7SA 1E99A 3NC1C 4KFTA 1QHNA 4OKSA 4OK6A 4LPSA 4B3XA 5DHAA 1TUEA 1G7RA 5GVSA 4A15A 1D5CA 4OQLA 1ZNYA 2C2HA 2CXXA 3TAHA 4BFXA 1E32A 2OXRA 1US8A 1W36D 1RYFA 4IFBA 3EWSA 3ICEA 4CEHA 1HQYE 3NBXX 4JSTA 1BMFD 1NSFA 3NBYC 4DSUA 4V0OA 1GFIA 4Q1EA 5FR1A 1HYQA 3DM5A 4DWJA 4F4IA 4ZCIA 3GCGA 4BZPA 2IS1A 1KI6B 2AD1A 1OHHD 4GL2A 5JEDA 1JI0A 3P4YA 4N0EA 3Q7PA 5C2JB 4B6FA 3RWOA 4FXPA 1A7JA 1S1CA 1YZNA 4Q1AA 4TL9A 1ZP6A 2IXEA 1AK2A 5CB8A 3GJ4A 1CJUC 4W5WA 3L0OA 4MRRA 5EP2A 1XEFA 4L15A 4ZDJA 3PJRA 1Z06A 4Q7MB 1GNPA 1KI4A 1Z0KA 3I73A 2V9PA 1NBMA 1CJTC 4YONB 4U7DA 4IDPA 5FUYA 4E07A 2PLRA 3QEJA 2ODWA 1H8HD 1SVOA 1LNZA 2GAOA 2UVQA 2CHQA 3Q5EA 1T3HA 3GJ3A 4AD8A 5DNYB 1J99A 4MYTA 5J4YA 3BB3A 4A36A 1TU4A 3C5HA 2OXCA 4JBYA 4JLDA 3K0FB 4TZ6A 2ZJZA 2JLSA 3L82B 4I1SA 2PMDA 2PMKA 4PAMA 1E2IA 3BXZA 3E70C 4CEJA 1KDTA 4L9SA 1I4TD 3WYFA 1OXUA 1NF3A 4LYAA 2BMEA 2ZEJA 5IK2D 1K5DA 5JCPA 5LD2C 3DDCA 4FWTA 1TX4B 2Q0HA 2GHIA 3THWA 1NVUQ 1SZPA 3NKVA 2FWRA 1W44A 4LJ7A 2WSMA 4I81A 2OCPA 4E09A 2CJWA 4TL7A 2HYIC 3JZAA 4NONA 4CVNA 1P75A 2D2EA 2J3EA 1E2FA 1AQYA 5KDDA 2OEPA 2QG6A 1AKEA 4A0FA 2RH5A 5C4MA 4RCYA 4M4SA 2ZRGA 3M6AA 4IVPA 4YXWA 1ZC3A 2GJAA 4HB2A 1T9HA 3TKLA 3K0AB 4ACAA 3THXB 2XOKA 4PC7A 3SJCA 2FV8A 3GFOA 1Q1EA 1CXZA 1J8MF 2DHRA 2IEZA 1EX6A 2ZE5A 3BERA 3AGPA 5HPYB 4B2PA 3BD9A 4A2PA 1SVMA 1NY6A 1KI9A 3DOEA 1KI6A 3FKQA 2JCSA 4LV8B 2GCOB 5JRZA 4JLKA 4PO1A 3IPYA 3L2OB 1XWIA 1A82A 4BUJA 1TQ2A 5CDFE 4BLSA 2ZR9A 1Z0AA 2QTFA 1G7CA 4KV9A 4GZMA 1ZU4A 2YV5A 3Q72A 5JFGA 2ZUCA 4PPGA 4P0TA 1H8ED 3NDPA 4QBFA 4HAXA 4LHWA 3TUIC 3DEFA 1BO6A 3CBQA 4QGHA 1NMXA 4EPRA 3BOSA 1P9RA 4ZIRB 4GMXA 4Z1MA 3X1YA 3JZMA 5J47A 1XMJA 2R6DA 5JHGB 3B2EA 4L5BA 1E9EA 2NOAA 3RRYA 4A6XA 1R4AA 3QF4B 4JL8A 4JLOA 1HEIA 1LB1B 1L8QA 1NIJA 1YZKA 3B82A 1VHTA 3A4NA 3H0KA 4P4TA 1YR9A 2GEVA 1LVGA 2Q9CA 3K0FA 1Z2CA 2F1HA 3AV0B 4G1UC 1G18A 2REXB 2OSBA 1ZM4A 3JVVA 4NCIA 4TTPA 3OF5A 1U9IC 2WWGA 1TAGA 4RZXA 1IAQA 5HE9A 1TF7A 3IBGA 2QQ0A 3E5HA 1HT2E 2J41A 5EE3A 1GL6A 1KMQA 4LK2A 3T1VA 4G5OA 1W0KD 1KY2A 3AUXA 4DDUA 1OXTA 2YVUA 2H18A 4TMXA 3VNVA 2FA9A 1Z08A 4LY6A 2R6GA 1H65A 3LV8A 1E94E 1OB5A 4ARZB 4C0HA 3KQUA 2FSGA 3WMEA 1JAIA 4MKIA 5DYGA 1E2EA 4Q5IA 1ESMA 1SVLA 2WOOA 3EZ2A 3K09A 2NO1A 2ZS8A 1KK3A 3K0AA 1FPMA 521PA 1R10A 2JDID 3HPQA 4US2R 3THXA 1DS6A 4JYCA 3FWYA 2UZ3A 4KHZA 1XP8A 4RFVA 1E2GA 3KTAB 5E7IA 4RFSB 1Z6AA 1GOTA 3NBZC 4BZQA 3TH5A 4M1OA 2ZVPX 2ORVA 2X2FA 1OPXA 2H5EA 4LWZA 3U3OA 2R6CA 3GJ8A 3H1TA 2GCOA 3SOPA 2AFHE 5CDFA 1XMIA 2QPOA 4OHVA 4RCZA 3FHTA 2CK3A 2C9YA 2RHDA 4JL5A 1ODFA 5GVRA 2WVJA 1KK2A 3GD7A 2YWHA 4NMMA 4QJ3A 2XSZA 1X1SA 1R7RA 3ZIAA 2D2FA 4LJ9A 1UFQA 1VIAA 1JPJA 4G01B 3W8RA 3RYTC 4LJ8A 3WYAA 1YR8A 1KKLA 4OYHA 1PJRA 4AWXA 4JKYA 1NLYA 4PPQA 5JSZB 4ZIRA 1FTNA 2H92A 4XVQA 2FFAA 5HKKD 4MYHA 2IWRA 3SN6A 4E5UA 1FQKA 3MJRA 4E03A 1JXOA 3QF4A 4AG6A 1NVVR 4QXAA 1CEEA 3NWJA 2IS6A 2BMJA 4X8OA 3MAAC 2WKPA 3FB4A 4B32A 5HZKA 4BFVA 3MWLA 1Z0IA 2FX3A 1EK0A 2ZSEA 3I3SR 2JLWA 1G3MA 4NCHA 4RY2A 5G40A 4AK9A 4HLCA 1GUAA 1OXXK 5J5CA 4B74A 1MABB 3CZQA 4QBGB 1J8YF 2HT6A 4WBSA 1JR3E 2IF2A 2V55B 1JQLB 4G3XA 1S0UA 421PA 3EC1A 3U3RA 1II8B 1KMHB 4L9WA 2PLFA 2BCJQ 1SXJB 5H68A 3C41J 1SXJE 1R0YA 2RKOA 1N5LA 4QL3A 3BFVA 5G3ZA 3WHKA 4EAQA 4QGAA 3ZD7A 1EWQA 3AEZA 3CH4B 1KK1A 3NBFA 4LSGA 3ZS9A 2JIZD 2O0HA 1O87A 4A92A 3P1JA 4AKEA 1KSGA 3LX5A 3Q5DA 2XX3A 4ARZA 2BV3A 4IVQA 4DLVA 2ZM5A 2QQEA 4GBMA 3T15A 1T0JB 4PHGA 1S9HA 2VSFA 4NCNA 1M34E 3ADDA 3PEWA 3TSOA 2XGJA 4B73A 5DHFA 2XITA 1W0JD 4MGYR 5AUPB 1GILA 2JLXA 2QAGC 2QTHA 5JMTA 3KTAA 2W58A 4RFSA 3DZDA 3OEEA 1R5BA 3CF0A 2N42A 2F9MA 4QGFA 4JLVA 1SVWA 4WVFA 4XOIA 1XTQA 1XCGB 5KPDA 3CRW1 3CRQA 4GT1A 4IRUB 5ANRB 2C9CA 3SJBA 1NG1A 1HE1C 1CJVC 3LDAA 2BKEA 2X1VA 5HTKA 2ATXA 1FUUA 2G6BA 5FBLB 3CPEA 1QRAA 2ZE6A 3QPUA 4XWAA 3QXHA 3C8UA 3DL0A 3EXAA 1VG9B 1YQTA 1L4UA 2EWVA 4X8MA 5JSZA 4FW9A 2QL6A 4UNPA 4L8GA 2CL7X 4B44A 4ITRC 4D4JA 1S3SA 3KQNA 4P33A 1JJ7A 4OHXA 1P2UA 2QUZA 4H1UA 4JKIA 4PHFA 1MT0A 821PA 1XU4A 4ON9A 3GJ0A 1EG7A 1QBKC 2BBSA 5SZJA 2PZFA 5CM8B 5FL7D 1AS2A 4URXR 5EXTA 4AY2A 3QI2A 3U4QB 1Z22A 2ZRKA 4JLMA 1MABA 621PA 1TQ6A 2IYLD 1JR3A 1G291 1RZ3A 1P6XA 4HAZA 4W5HA 5DH9A 2JJ2A 5KYKA 1W4BA 3WMGA 5FI0B 1II8A 1KMHA 2BM1A 1TQ4A 2C99A 2XZPA 1SXJA 4LJAA 1FMLA 3D7MA 3SYNA 3VHXA 2YWGA 3N2IA 5FPKA 2EYUA 1EFRD 1E1RD 2ANCA 4B2IA 2F55A 1G3QA 4IW3B 2CNWD 4BFYA 4M1MA 3LXRA 4GSYA 3I61A 1UADA 2Z4SA 1U0HC 3N2EA 1XFAA 2A2ZA 3F8TA 2IYWA 2BMFA 5CJ2A 5CITA 2DWOA 4UNQA 2DFTA 4JVNA 2FU5C 2OFXA 4HLQB 4FMDF 1JQJC 1E9DA 1PZNA 5FTKA 1IJEA 2JLRA 3L8YA 3IHLA 3RNLA 1XF9A 3FE2A 5F9FA 2QE7A 4TL8A 3SC3A 4K8OA 1P60A 2JASA 3U44B 2KE5A 4XWOA 3KJIA 4O2RA 1T3SA 2A5GA 2CMKA 4HI0E 5DN6D 2QM7A 1ZCAA 3PEUA 2IBMA 3C5CA 2HLDA 1ZD1A 3CB4A 4IOLA 3ZJYA 4B3CA 1A5TA 2V7QA 1S9DA 2QGNA 3QXCA 5CJPA 3RLFA 3VR3A 2AL7A 1G8PA 1ZAKA 3MMPA 3SE0A 4A0RA 1KJWA 1NIPA 4LHZA 2FPKA 4M1YA 4O3MA 1UJ2A 4QHYA 2RGAA 4M1KA 2B6HA 4CW7A 3AP1A 4B47A 1LY1A 1CR0A 4Q7KA 5DYIA 4C0KA 1OFTA 4EJSC 1CULC 3ONWA 1SQ5A 2O8EB 2BEKA 2GWHA 3LFUA 1E79D 4RD1A 4DLYA 2O52A 1N6RA 4BZXA 3O8RA 1W36B 2NMVA 4B75A 1NKSA 1OH7A 1GL7A 2OCYC 1XD8A 4PZLA 3CIOA 3U4QA 3HWSA 3T1TA 2B7CA 4LHXA 4CF7A 4AYXA 721PA 4B2LA 1DARA 3FFAA 3OE7A 4Z8YA 2P3SA 1E0KA 3W5IA 1RE0A 1E9BA 1UM8A 1W49A 2VA8A 2F1RA 1GTVA 4D81A 4YQFA 3KJHA 2NO9A 1E4VA 2WBLC 4NCJA 5ELXA 2PJZA 3FMOB 1M7BA 4HUQB 2A5FA 3GMTA 1QG4A 3UMFA 5JI3E 3BE4A 3PV0A 3SEAA 3FOZA 3NEJA 3T1QA 4Q9HA 3QG1A 4MH0R 3AUYA 1X8KA 1DO0A 1QDEA 4JYBA 4YDSA 1KAOA 3CNNA 1QHIA 2IUUA 221PA 4KVAA 3GLIB 2YZ2A 4WZ6A 1IXRC 3GLIE 1T5IA 4TWZA 1E9SA 4BECA 1AKYA 4P32A 4M21A 2ODNA 4R2HA 3KKPA 2FE4A 2WM9B 3V4RA 4AG5A 3LAWA 3K9GA 4QHSA 4DLWA 1WXQA 1G8GA 4D6PA 5AK0A 2Q3HA 1P9NA 4IEEA 3RRNA 2E1RA 2XNDD 3TIFA 3U44A 1G3IA 3GLGB 1RW4A 3RHFA 4ZI3A 1E6CA 1CIPA 2HXYA 3AF4A 1KNQA 3R8CA 1G21E 3QSYA 1M1YE 2GCPA 1AQUA 1NN0A 2GK7A 4B34A 1ONBA 2WOJA 1NI3A 4TQAA 2WAXA 1UBEA 3GJ5A 3EPHA 1ZCBA 2P6NA 4MYUA 5DSZA 2RGEA 3EZ7A 1VYUA 2ECKA 1RFLA 3P26A 1E1QA 1KYIA 2CVHA 4A2QA 5BYKA 2ZSAA 1E2PA 3H84A 2JJ1A 2OESA 4Q9IA 3CX6A 3P27A 1RJ9B 5CK4A 2ZSBA 5TARA 1OIXA 5FBQB 4EPWA 3TBKA 2CLCX 3LY5A 1KDOA 2DB3A 4IOMA 4KYUA 5TVKA 5JI2E 3N70A 3CW2A 3IQWA 2QMEA 3GEEA 5AJXA 2HF9A 4BE7B 2O8EA 2ZRJA 3DMDA 3KKOA 2IWHA 1R8QA 4A2WA 1PVOA 4KAXA 3QPVA 3MWJA 3W90A 1Z0DA 1Q0UA 2X8AA 2GXQA 2IYTA 2F43B 2PZEA 4MGIR 4US0R 5DI3A 1BMFA 1TEXA 5EE5B 2A7QA 2CEAA 3DO6A 4QJ5A 1XJQA 3GEHA 2PEYA 4LC0A 4M9ZA 4C7OB 1EFUA 1N5IA 2HV8A 2OZEA 4Q21A 1OHHA 3EARA 1ZNZA 2KBEA 4PFSA 4OK5A 2GNOA 1CF4A 2XTNA 3H86A 1TTTA 4JSYA 4G5GA 4D4MA 1S96A 4HUQA 4QBIA 3X1XA 1VECA 4PZZA 1QHGA 1TMKA 3G5UA 3BJIC 2FJUA 3NC0C 2CL0X 3ADBA 1G3RA 1XCMA 1OE0A 1J90A 1XJ0A 1B0UA 3MRSA 4RD2A 1FZQA 2HJVA 4R9UC 1CKEA 4EPVA 3BRWD 2ZRLA 4BLQA 2EFCB 1TNDA 1KSHA 2VF7A 4LJ4A 3GLIA 4FMCF 2XJ9A 2I1QA 5JHHB 1HH4A 2NZJA 2C04A 4GDFA 4KO8A 3FDIA 2J0SA 4FN5A 5BN3A 5JCZA 3MG9A 4F4JA 4G5RA 4EFNA 3WRYC 5FOXA 3W6NA 3Q8XB 4A6PA 3U7GA 1ZM9A 4Q7JB 4KSCA 3GLGA 1UDXA 1NN5A 1JB1A 2AD5A 4II7A 4KU4A 2G77B 3PITA 4NYIQ 2G9NA 4IXMA 4NHOA 4NYJQ 1AZSC 1JAHA 1FTSA 2JLVA 4LV5B 5DE3A 2IS2A 4MKHA 1SKYB 5IK2A 5HR5A 3Q85A 4JIMA 1G6HA 3SFZA 1MO4A 2IC5A 3SR0A 5FPHA 4O0MA 4C0BA 3IEVA 3QOFA 1TL7C 2HF8A 4EPXA 4NE2A 5FPTA 3FMPB 1U0LA 2OLJA 5JJLA 1G17A 2J7PD 2W2VA 1T91A 1RJ9A 2GBLA 1LTQA 1NMZA 2L0XA 1SULA 4GRAA 2XZOA 1I2DA 4ZDWA 5FPSA 4C30A 3A1SA 1E9CA 4JVMA 3AVTA 1CRQA 1MO3A 4ZDIA 5C1BA 2VHQA 2YHSA 4B3GA 3SI7A 3EAQA 3KKQA 5JWHA 3TJZA 2J0VA 3BB1A 2BHRA 2CDNA 3CPHA 3T1OA 4QRHA 2YC2C 5DISB 2F43A 2GF0A 4I4LA 4V0LA 4C0JA 1NP6A 4JZKA 2YKGA 2NG1A 4OJKA 1JALA 3RC3A 1KZ7B 4C7OA 1GKIA 1JR6A 1RC8A 4BFUA 1N5KA 4Q4HB 2VP0A 1XPOA 1NVWQ 1GAJA 3B5JA 5TDHA 4C9BA 4QKQA 3CRVA 4OK3A 1GSIA 3DZ8A 2PJRA 2V6IA 1OH6A 2Z43A 4BASA 4HATA 3AH8A 2Q9BA 1H8EA 5DGXA 4YMWA 1LF0A 5EQTA 3AKDA 1YKSA 1G8FA 3EG5A 1DAKA 4NU0A 3HU1A 3LRPA 1D2MA 1XTJA 4CDGA 4PSKA 1FX0B 3OEHD 2C96A 2O8BB 3GFTA 1U99A 4AI6A 3RS0A 3C14C 4TLEA 1UKZA 4GZLA 4D4LA 2OAP1 4FCVA 4Q02A 5C46F 1P62B 1GKYA 1M7GA 1EFCA 2KJQA 4TMWA 5FOUA 4UJ5A 4ASUD 3D31A 3IQXA 1E2HA 1P61B 1OIWA 3QY0A 1QZXA 4S35A 5SZHB 2WHXA 3SNHA 4KFRA 3NIBA 4DDTA 2VLIA 4ZPXA 3EIHA 1XPRA 4WZBE 4M1TA 3RS4A 2EYQA 2J87A 3X2SA 2P5SA 4XIGS 5A5GA 2V8OA 3TUJC 3ZVRA 4I1OA 5IRCD 5E95A 4JT4A 5B30A 2J59A 3NH9A 2BJWA 5E4FA 1JBKA 2GTPA 2NZ8A 3VAAA 1W0KA 3RS7A 4Q1CA 1U8ZA 1A2KC 2G83A 3AF3A 5JWOA 3ZLJA 4Q1BA 4N1AA 3RABA 2ZRDA 3QIAA 1Z6TA 2W0MA 3N5CA 4DLZA 3O8BA 3TLXA 3L0IB 5BW8A 5JBQA 2O8CB 2V4ZA 3LW8A 3BAFA 3K0CC 2CHVA 3AQ4A 3FGNA 1GM5A 8OHMA 2HT1A 1C4OA 2ZROA 2PBRA 2BC9A 2ATVA 4WXRA 2EVWX 2BIFA 3H2YA 1N6LA 1W4AA 1Z47A 1TPZA 4GOXA 4BEJA 1GNRA 2XNSA 4JLNA 2WTUA 4HYYA 1YZTA 2D7DA 4TYYA 1GRRA 2XTZA 1BYUA 3D3QA 4DKXA 2WWFA 5EP1A 1HE8B 1OF1A 4HAYA 2G3YA 1T4GA 2QMOA 4Q4HA 5D3QA 3VR6A 3QBVA 2BBTA 4MDFA 2GRJA 4PPFA 1GL9B 2KB0A 2CCGA 3ASZA 4TLDA 2ZU6A 3L0SA 4WA7A 2AKAB 3A6PC 1VMAA 4M8NE 3R20A 1YZUA 2QMUA 4C3ZA 3GLFB 2IW3A 4LPKA 1S8FA 2R6AA 3R7WB 4LCBA 4OHYA 3GQBA 1E0JA 2W6JD 5AJZA 1FX0A 2XXAB 3VKGA 5HKKA 3K1JA 3PFIA 2O8BA 5HCNA 1WF3A 3TE6A 2R2AA 3CKLA 2LKCA 1CRPA 5KNCA 1HURA 1KO4A 1NN1A 3DHWC 5F98A 4FINA 2FF7A 1W46A 1WA5A 1OB2A 1LV7A 4QOSA 3LBHA 4DBLC 2ZRBA 3TK1A 2OAQ1 1AS0A 1G9XA 1VCMA 1ZUIA 4EIWA 3CO5A 4DUGD 2CCKA 4TSFD 5BXQC 4BFSA 4LZZA 2NO7A 5GADl 2ZJAA 3IGFA 3NVAA 4LJ6A 1SHKA 5CLLA 2A5JA 2GA8A 2ONJA 3K70D 3U3MA 1N6KA 1O3YA 2REOA 3QKRB 3KB2A 4A8JB 3WMFA 2DCUA 1NN3A 2QN6A 2PX0A 3PVSA 1KZGB 3QKSB 4UNNA 1N3BA 3PXGA 3ZVLA 1R0XA 1AGPA 1N6HA 2IYQA 2OE2A 2VP5A 2WWXA 4BLTA 3EX7C 4GP6A 2D3WA 2WWHA 3BGWA 4F93B 2JIZA 4HUTA 4PC2A 4Q1DA 2O8CA 4GFDA 1W47A 4U00A 3SDZA 4DCVA 4Q19A 4HAVA 4URWR 4MRPA 1G16A 2CBZA 1IM2A 4B76A 4DJTA 3SHFA 2DFKB 2QROA 3PEVA 2B8TA 3QVVA 4FMBB 1W0JA 4LYJA 5CB6A 5JS7A 4EPTA 1QG2A 4HZUB 2QP4A 1Z6XA 2V3CC 2D4HA 2RGNA 2QMHA 1NNEA 1RPZA 4ESVA 3V9PA 1EX7A 1ZYUA 4XVRA 5B58C 2C95A 4KVGA 2K5UA 5FR2A 2FSIA 1OYYA 2ZUDA 1M2OB 1I2MA 1IONA 1JEDA 4MKFA 4PSVA 2KBFA 3O8DA 3PUZA 2RGBA 3SYKA 2P67A 1A1VA 3ADKA 5H1YA 4FWIB 3CNLA 3GLFA 3GEIA 4KBGA 2FSHA 3R7WA 1LS1A 1KOFA 3FPAA 4QJ4A 3KXIA 2XXAA 4RKEA 4MRSA 1AA9A 1QHXA 4JL6A 3T06B 1HTWA 4AYWA 3K70C 1FQJA 4AKIA 2ORIA 1W5TA 2IXFA 1W48A 3T5GA 2P6UA 4Q4JB 2X2EA 2VQSA 3GPLA 1FW6A 2FMXA 3AP3A 1NVXQ 2AK2A 5HCIA 4DLTA 2W6IA 5J4KA 5FL7A 3EA5A 2F6RA 1CR4A 3PUWA 3QF7A 2ZYWX 2F1IA 3TSWA 1P72A 1X6VA 4DXAA 2DFNA 3SJAA 4PC3A 1VDZA 2ZI9A 4TMKA 4L4UA 3NHBA 1P9WA 3QKRA 4YLGA 4A8JA 1UKYA 2Q3MA 3THOA 3A58B 1CJKC 1S2MA 4P31A 1B23P 3LD9A 3QKSA 1EFRA 1E1RA 4RD4A 3U6BA 1W1WA 4RZUA 3MWKA 2CNWA 2XTMA 1ZD8A 4A0HA 2JLZA 1FMJA 1AIPA 4Q00A 2VHUA 2AXPA 1ZU5A 4MUAA 2IUTA 1IY2A 2IYSA 3EIQA 4NYMR 2WV9A 2VRWA 4D0GA 1R0ZA 2PCLA 1E9FA 2AX4A 4GI7A 4Z1MD 2VHCA 2ZQ5A 4GOKA 3TMKA 2WMNB 1XRJA 1Z6YA 3IBYA 3LWNA 2CCJA 3U3JA 2IS4A 4HZUA 3HJNA 3ZS8A 1FNNA 1E2NA 1XEWY 4A0GA 2J45A 4M9QA 4DRZA 3B6EA 1RRCA 4TMVA 3O8CA 5DN6A 5FTJA 5K8IA 2OCAA 5TB5A 2QBYB 1JNYA 3LX8A 4O25A 3RSLA 1E2DA 1UEIA 3H4MA 2GJSA 1FL9A 1OSNA 2IYRA 2OO7A 2R6FA 2ZYUX 4AKHA 4D4KA 3PENA 3SZRA 4ZCLA 1GNQA 2EU8A 1II0A 1UBGA 5FTLA 2WAYA 4UXJA 1P4SA 3TW4A 5CK5A 2VL7A 4KJZA 1X86B 3WYGA 1Q3HA 3I5YA 1YE8A 1P2VA 1C9KA 1VYVA 4B71A 4CYMA 2GJ8A 1D9XA 1JJVA 3UANA 3L8ZA 4PQYA 3QVUA 2Z4RA 3O47A 1DOAA 1HY3A 1ZUHA 5A0FA 4Q4JA 1E79A 4RD0A 4HDQB 5A4JA 5KOYA 1KNXA 3WNBA 1M6NA 2CVFA 1G7SA 3DOFA 2VP4A 2VP9A 1TU3A 3CM0A 3CX8A 2D7CA 2VTKA 5KTYA 4KFSA 5AJWA 5JJIA 3DM9B 1G20E 1Q44A 4JLJA 1GRNA 2TMKA 3NH6A 2WSSD 1N6OA 3C7KA 5K8UA 1DE0A 1DTSA 2GAAA 4M9XA 1Z63A 2VP6A 4ZO4A 1Q22A 3W6PA 2C8VA 4D0LB 2CLDX 5BN5A 4HZIA 3EIEA 2CL6X 3U2QA 2AR7A 3KQKA 3ZIAD 2GVZC 4JJZA 3AGQA 1DPFA 4LGMA 4R7ZA 4LBWA 3HYRA 1NL3A 2BEJA 4R71A 2V1UA 4IOKA 2J0UB 3B1VA 1G6OA 3MSXA 4V0KA 4BLPA 2NO0A 3OFNA 2V54A 3PCRB 2PX3A 3T5DA 3Q9LA 2QORA 5FOWA 1Z83A 1V5WA 2ZRMA 3KXLA 4HLUA 4D80A 1NG9A 2LCFA 4Q01A 1BIFA 4NP6A 2YOGA 4BQSA 2N1BA 2NIPA 4HEJA 2ZXUA 3A4MA 1F3OA 4LDJA 2HEIA 4HDOB 4BFWA 2QBYA 3B8HA 1IQPA 4KYIB 5G41A 3SBDA 1KTVA 5FI1B 3NHAA 4NZYA 3UK6A 1F48A 1XTKA 4QG7A 5KU1A 2DPXA 2QTVB 2NQ2C 2P6RA 3K09C 4TQUS 1N2CE 5SZIA 2O5VA 3CWZA 2V1XA 3BH6A 3ZGXA 1YU9A 1KDRA 1DAFA 2ZITA 3OAAD 3K0EA 1ZM2A 3U7FB 4EKDA 4Q7LA 3UG7A 2P65A 2A3RA 2ODEA 3KFVA 2ZR0A 4JLBA 1FNMA 3AKYA 4WOPA 1DVRA 5AWFC 1F60A 2FZLA 4DEXA 1EESA 1ZIOA 2WWWA 1VYTA 2WKQA 2VHTA 3BB4A 4M9SA 3AP2A 5FUXA 4LC1A 1W7AA 2H57A 2QENA 1XMVA 2ERYA 2ZYVX 3PR1A 4Y0AA 4I99A 2DYKA 2AXNA 5L3QB 3LBIA 4DSOA 5F9HA 2XB2A 2GILA 2PEZA 2GF9A 4OI4A 5LD2B 4LYHA 3B1XA 2RGDA 1GWNA 2O8DB 4HAWA 5DIFA 1ANKA 5EUQB 1RVDA 5AJVB 3C15C 2VEDA 4MUBA 4XD7A 3ZZUA 2ZETA 1G4AE 1GIAA 1KI1A 3X1DA 2HDNB 3E2IA 1MH1A 1RRPA 2Z6VA 2A30A 3RS2A 4OHZA 4BGDA 5JS8A 4EFMA 2DR3A 2GZAA 2SHKA 2GDJA 1EFHA 2CHGA 4Z54A 2F3RA 2YYZA 5TY0A 5GJCA 1OLOA 2NPFA 1YRBA 5L8VA 2Z5FA 4O2LA 2J0UA 1XX6A 1N6IA 3VKWA 3I62A 3OIUA 2O8FB 1WP9A 2IYUA 4HSEA 1P3JA 1XTSA 2QP9X 3B85A 3MCAA 3WRXC 4FCTA 1GRQA 3T35A 5FOTA 3AF0A 2AWNA 4D25A 3VU9B 3DVLA 1BYIA 4P3YA 1P2SA 1M74A 1Q1BA 4R2IA 2BM0A 5EZ6B 4NYIR 2VIIA 2H17A 2R9VA 4NYJR 1C1YA 2F1JA 5L3VA 3LNCA 3A4LA 3I32A 3CRMA 1MO6A 1RKBA 2FGKA 1JR3D 3RS3A 3ADCA 2ZI3A 2ZJ5A 3HYTA 3A1VA 1AM4D 3BBPA 2ZI5A 3GLGE 5IF9A 1E9RA 2J5XA 1YR6A 3CWQA 4QBHA 2I1VB 5JRJA 4IOJA 3HP1A 3EA0A 1KI2A 1PV4A 2QSYA 1S3GA 4IDQA 3ECCA 1VTKA 4Q66C 5TV2A 4B48A 1GG2A 3KB1A 4TYNA 2ZS7A 2QU8A 1IHUA 3NG1A 1OYWA 2G0NA 4Z8XA 1NJGA 4MQBA 4YMSA 2BDTA 4Q47A 1EWRA 4DB2A 4DCSA 3KKMA 4PC6A 3PG5A 2VH5R 3TW8B 3ZYCA 4NPHA 3ZD6A 2JATA 4BLOA 5L3QA 4KITB 3QE0A 1U98A 4GMDA 2KWIA 2QE7D 4PHHA 5FOVA 1KSJA 2QPAA 2O8DA 1BOFA 5FBRB 3I92A 1XD2B 4FD2A 1R5NA 2WJHA 4M22A 2QZ4A 1MOZA 3QUSA 2H7VA 3ZQJA 3LQQA 1HUQA 3A1UA 1NRJB 4M1WA 4TLBA 1IOZA 2I4IA 2HLDD 3SQXA 4X8LA 3WY9A 1NMYA 3KDSE 1ZNXA 3W6OA 4TMZA 4D26A 4RSGA 1XXHB 2EFGA 3M0EA 4EPYA 4N0DA 2PL3A 2IYZA 2C03A 2P5TB 3OEHA 2ZJ8A 3RWMB 3AVQA 3F5FA 2DWPA 2BVNA 2GETA 4DLSA 2J9RA 3WNCA 4DT1B 1U2RA 2AHOA 5J4LA 2FG5A 4YMUA 4Z51A 2O8FA 1KY3A 4LHYA 4TT3D 1SXJC 2IK8A 3L43A 1XB2A 2GJKA 5DO9A 6Q21A 2EWWA 2WICA 4DSNA 4OQNA 2WJIA 1G4UR 3K9HA 5CLQA 3VU9A 5EP3A 3RC8A 5K8TA 4WIAA 3DPUA 1WRBA 4GPTA 1I4LD 2ZE7A 4CGZA 4ABYA 4TLAA 1H8HA
chains in the Genus database with same CATH superfamily
4GQIA 3VPFA 1T2NA 2P90A 3HYCA 4B2LA 1BKDR 1CYDA 5HQTA 1ZBDA 3QJYA 1PN3A 4S12A 3G82C 3GDOA 5CDGA 1LWNA 2OV2A 3PD7A 2IYXA 4PXAA 4UQOA 2Z0MA 4AMVA 4FYWA 4HNHA 3AWDA 4R69A 2YNMD 1A4RA 3AJ8A 2IXDA 3NR2A 3OU2A 5G02A 3MLBA 1KYWA 2H2GA 1EXMA 1C14A 2CY0A 1E18A 3KK0A 1QYRA 1IMOA 4DCGA 5KQPA 3NGMA 3E0QA 3F2IA 1BOOA 1MKYA 3JYNA 4EUNA 2PKQO 3A28A 3ASYA 3HCBA 2WPDD 3LOQA 3AI2A 2XCTB 4S2UA 4FNOA 2G9ZA 4L4ZA 4W5JA 5GJBA 4LF5B 1UBUS 4KQKA 1DEXA 3P0FA 4WE3A 2B8NA 3E7DA 1EBBA 4JMLA 2OC9A 4Y0NA 1R0BA 3GGGA 2ZYDA 4O4HB 1AB6A 1U7UA 3CS3A 4OI0A 5FI5A 2AEEA 2BMVA 5KYYA 2P0AA 2XF2A 3UHAA 4AMYA 1RI1A 4EL0A 4IVNA 1QORA 1C8KA 3VYWA 1GZ5A 1BS2A 1QYCA 1RMQA 1Q77A 3W5HA 2G1UA 2JKVA 4ZI2A 4TZ0A 1IMJA 5FPYA 3DXYA 4C14A 2NADA 3IKJA 4H1WA 4KO3S 4Q3DA 1QNFA 1RM4A 5HFJA 3R5FA 3ZBUA 3MA0A 1GT91 4M54A 2XJ4A 1MU0A 5LP6A 3LLUA 4UCQA 1X7XA 1T8RA 2IHUA 2Z9BA 3AVWA 5IAOA 2NU9A 1A72A 2IODA 4AZ0B 3UWOA 1T5LA 5FBVB 4MKGA 2HXSA 3IMKA 2ZWOA 4YEDA 1WW8A 1FNSA 4IIDA 5TR9A 4GDMA 5KDLA 3MWGA 3BFPA 3GUVA 4GECA 3OEYA 1VMDA 4ZMSA 4KN8A 2WMOB 2JCGA 4DIOA 1VG0B 3A6GA 3KQOA 3OTIA 5E7QA 1TGYA 3A8TA 4CL3A 5IXJA 3DLAA 2G72A 2BEVB 5TQ2A 3SYLA 4FEEA 4JI3B 1OLUA 3JYQA 2IUSA 4BB5A 1V4BA 1I7SB 4O63O 3GHHA 3KE9A 4AT1A 2ZI7A 4ZT4A 4D2IA 4RQAA 2CVOA 3OLVA 2ERXA 3Q7TA 4Q1VA 2WZDA 3PB3A 3PFBA 2XD4A 3TJRA 4R8LA 2P68A 5HZGA 3O8NA 1YULA 1LDNA 5F1KA 1XQWA 2HJ9A 3Q41A 3UJHA 4QM7A 2CNDA 2PZGA 4J0FA 3TRHA 1C3OA 1ZMBA 2FAXA 3DCYA 1XZDA 4BYMA 2DBYA 2X0NA 3MYYA 3T4PA 1XZPA 4ETNA 1E6MA 1KEVA 3RRZA 4EDHA 5ICEA 3U09A 3KLBA 2O2XA 3FWPA 5F5XA 3VBEA 3DULA 1XAHA 4WBXC 4XX1A 2VWQA 1B76A 3WHPA 1NQVA 1TXGA 8ATCA 3AVVA 1LBIA 1ISRA 4ZREA 2D13A 2J1LA 4IV0A 4YQEA 4EFLA 2I6QA 2E1PA 1N2BA 1UK9A 2YBDA 3JYLA 4LJKA 4PR3A 2QLFA 2FZ5A 1F5NA 3Q7IA 4JJKA 4XIYA 5D1HA 5D7NA 2E4YA 4D97A 1Q7CA 4D44A 2R6HA 2C7PA 3GDWA 4X6XA 2HIGA 3IILA 1V95A 3F6YA 3P4XA 4HYQA 4I3HA 3KPYA 7REQB 1ETUA 1JIVA 3W05A 4CEIB 2IXAA 3VZPA 4FFVA 4ZYVA 4YQYA 3LLMA 1D7AA 4QU8A 2JIMA 1XDGA 4EEXA 2J08A 2RONA 2XLCA 1IOVA 4O4HA 3RVRA 3GLHE 5CP8A 3RKSA 2XUAA 4C0WA 4ZOBA 1GZUA 1WTCA 4HV4A 4ECAA 3SKYA 2G0TA 4QPZA 5B2ZA 2RGCA 2Q2NA 2JI9A 3I12A 1D3AA 1QDLB 4P8RA 5DIZA 3STHA 4AQYB 5EMKA 2VZEA 2GCNA 3I23A 3B9RA 1DJLA 4FKMA 3RRXA 1KKMA 3AOEA 1OBHA 3FI9A 3HV0A 2XNCA 1G5PA 1KRHA 3DNPA 2X0EA 2EW1A 2FSVC 3F73A 4M3NA 5L7YA 4AZ0A 5TJHA 4OQMA 3KSAC 1FA9A 3WS7A 1NHWA 1QVRA 4NWIA 4BNTA 1VIMA 5JG7A 3TPFA 2JIDA 2BISA 2FZVA 3V8RA 4UHFA 1W36C 1Q14A 1UJ4A 4R6WA 2OECA 2O7SA 4GLJA 4YJDA 4DCNA 3U4HA 1N8NA 3QE9Y 3L0DA 4ZCRA 4ZJUA 8ADHA 4NZZA 1A95A 2P40A 4ZOLB 2OBMA 1EXNA 4FN4A 5IUJC 3LBYA 2ZAOA 4A7PA 2HN9A 3AQIA 3B9QA 3JQAD 4CQMD 1I24A 5BNTA 2BEVA 4TYPA 1Y5NA 3FKSD 2OA0A 2XMQA 3GLFE 3SFTA 1WKVA 4NL4H 4XRRA 5JZVA 2D1FA 3EY4A 1GPKA 5JECA 1Z2PX 2VDQB 2Q99A 1O94D 2I3ZA 4QU9A 4WAUA 4BNJA 3F8SA 1AOXA 4RDCA 6AT1A 2ZWPA 5L3RA 5HSGA 3QU5A 4C6TB 3IS3A 1AHIA 2AT1A 4UD6A 3MB5A 2QW8A 4X62B 2W2TA 4R5MA 3TPCA 1DLIA 2R44A 4YT8A 4MGHA 4GWKA 4YCAA 3AZQA 2Z2YA 1Z3IX 3RTDA 1QONA 3NWEA 1VSUA 3C74A 1DG1G 4IXNA 5F7XA 1XZJA 1UPCA 1JAYA 3U7EB 4JS0A 2ZP1A 2IGBA 1ZNWA 1XC7A 2Q4OA 1MENA 2WJ4A 3COVA 4WXPA 4JN6B 3HZRA 3T38A 3NEYA 3PC4A 3OJEA 2IHBA 1GZSA 4HPWA 1TTTA 1NASA 4LBVA 1OXSC 3P20A 3RVPA 4FYJA 1E77A 4OGWA 1DP4A 1MD9A 1RWKA 4JJ6A 3H05A 4O4LB 2V7TA 1XO1A 4G8BA 2P6PA 1MTZA 3K16A 2H16A 7REQA 4CEIA 4R31A 4CIYA 1QCZA 2PCJA 1GFSA 1E58A 1BE1A 3ZTTA 1JVSA 3D4PA 3W78A 2QS9A 3BFXA 5J2UF 4TYWA 3BHIA 3BN3A 2Q3FA 2ZJ1A 4HL6A 1B4DA 3QPBA 5MHTA 3IEKA 4Z9XA 4ZT3A 4AIIA 3EQZA 2IH2A 3FX2A 3KHTA 3EFOB 2I3DA 4OQXA 3MXTA 3B1YA 4RHXA 2WAMA 3D54D 3K4PA 2FDXA 2WDPA 3NAGA 1Y42X 2W2XA 3QXJA 1V4NA 3KDPA 2CDAA 4AFNA 5IVKA 2I7TA 4OQFA 5IFKA 5BWMA 4KGVA 5HM8A 1K6MA 1YQQA 4YIHA 2GESA 2BFAA 3SBEA 1EQ2A 4P4UA 2OC4A 2QRZA 4ZHSA 4INAA 2HH9A 4UOQA 4BATA 3UATA 4Q4AB 3WMWA 4LYEA 4EO9A 2I78A 4P22A 1YRWA 5FNVF 4TT8A 1BFDA 1C0IA 1MHTA 1DX6A 3ET4A 2FEWB 2RK4A 1PBTA 2WSIA 3KZCA 2PH1A 4DCOA 3FNEA 3QX7A 1LFAA 2W8ZA 5DVZA 1KAQA 5AW0A 1NW5A 4ZOLA 4B35A 3V1UA 3I8SA 4OL0A 2ERCA 1JFTA 2QI9F 2OPHA 1IHOA 3FVQA 1KY5A 2BBWA 3N86A 1CZRA 3LO5A 3PIRA 3MQ2A 3WBJA 4DYVA 1G98A 5EZ5A 1E6UA 1M33A 1GQSA 3M89A 2RC5A 1VJ0A 5BN4B 4JI7B 1HMYA 4R3WA 3HGTA 2WJWA 2Y0DA 1IVSA 2BGRA 4QO8A 1GZ7A 3PPIA 1DBSA 4KB5A 1XLWA 1E3MA 2UUOA 1AK9A 1EDZA 4C6TA 1QU2A 4KLZA 3DYBA 1QIJA 4BP1A 4QBKA 2ZIUB 4EKGA 2BY4A 3ELBA 2DY0A 1UFOA 2EQBA 3G3EA 1KK0A 1OIVA 3L46A 3LL4A 4MW5A 5T6BA 4BO5A 5BWLA 3OQOA 1IXSB 2ZRAA 1FJGB 2QVLA 1WXEA 2ZT8A 4BKRA 1UBMS 4U5XA 4PPNA 1U8EA 4K9OA 2I6TA 2WSSA 3OPNA 4G63A 4X8HA 5DEOA 4WLVA 3SM3A 4KLCA 3V80A 3Q3JB 1CS4C 3ZDQA 2DU8A 4YO8A 2EJWA 2YN4A 4PV7A 4I46A 1L3CA 5BQ5A 1JHYA 5EE0A 4DA0A 5FTMA 1WIWA 4CG2A 2PFSA 4R05A 4DG9A 2CNNA 4L95C 2EEZA 3DUFB 4GL4A 3OJ0A 4EGAA 4O4LA 2PUGA 2OMEA 2F3PA 2NVWA 1L7PA 1PTJC 3HDTA 5GPBA 5ARBA 1EJ6A 2BI4A 1YQXA 2NYVA 1USWA 1EXWA 2QI9C 4OI1A 3TZLA 2HJGA 1LLQA 2H8KA 1SCUB 1VSVA 2K4MA 3KZ1E 3VOSA 1EA5A 3H5AA 3WIBA 2RE8A 3BXPA 1G2OA 4UMDA 1FYEA 3EFOA 3FHOA 3MLAA 4PTLA 1YCDA 1FC0A 3D2BA 4R2LA 3MZ0A 1PJCA 3U9TA 2PZJA 3GH3A 1V6SA 1L5LA 3AVPA 1Y4UA 3N0TA 5GV8A 3RU3A 3FXAA 5K20A 1U94A 2E18A 1R6BX 1CFZA 1T0UA 2Z98A 4HDCA 5E1OA 5KTOA 1GGNA 2JCBA 4X63A 1RPAA 3TW0A 4P3KA 3M2PA 1TCBA 2OG2A 3K1ZA 1NBIA 5GM1A 1WEKA 3LC0A 3LSYA 2YQ4A 3QX9A 4Q4AA 5HUHA 3EGXB 4KQMA 4RVCA 3GFSA 3B1FA 3M9XA 3C6KA 2WSLA 3MLEA 4HAIA 3GPIA 4NI5A 3FLEA 4J1TA 3NS7A 4XTRA 1QVVA 1U90A 2D2VA 5JPCA 5DGIA 3U61B 4KAJA 4EB8A 2IYPA 2I3GA 3NAMA 2UXCB 3ILHA 3VU8A 1JIKA 2BL4A 2D2IA 1RWBA 2RH9B 4MZDA 3FDXA 3QQ5A 2ZR7A 3EXEB 2XEXA 2GZDA 2ZJFA 2Y2UA 2ZIGA 4JU9A 4Q12A 3DMNA 5BN4A 1XMQB 1AKVA 2RJNA 1I7QB 4NIMA 3U60B 4D9MA 1KMNA 2LWIA 4EFDA 3FPBA 4MLPA 1ADFA 2BI8A 3I0NA 4TMYA 4GE3A 4BE4A 5IASA 4X00A 3SSMA 2A84A 5A03A 4BDTA 2YVLA 4TQ9A 1SUBA 1Y89A 3ZH9B 5BUCA 3BXFA 2FW6A 2CWWA 4WW0A 2H4XA 3G2NA 3Q11A 2PNFA 1J23A 2TYSB 3LC7O 3T34A 3LDGA 4WOJA 1DAIA 2ARKA 3V42A 3WK6A 1D2EA 1E1YA 4LTMA 1DC7A 5COQA 3QA9A 4HFNA 2YJNA 2QEQA 1KVRA 4MUGA 2P4EA 4U5QA 1WB9A 2B92A 1OWPA 1PDOA 1R6DA 1L5SA 3DUFA 3EZFA 3F9RA 2VHJA 3GVHA 1H1DA 2XYQA 3Q8KA 1YRAA 1CVIA 1PR4A 1X74A 4DW8A 1T9GS 4OQQA 1XPUA 2BGWA 2KQUA 3QLVA 1XRRA 5LJIA 2NZVG 4O4JB 2F48A 3CSDA 1SCUA 3EGOA 2C78A 3ZZ0A 1JHZA 4M7PA 4RJ2A 5BPFA 1WQ3A 3DE3X 5EMNA 2NZUG 4BVFA 4EWLA 1MQSA 2XCLA 1OQAA 1JDJA 4G25A 5C35A 1A2OA 4HGNA 1J70A 3FUVA 5DHPA 3TOVA 1D6JA 3ER9A 5G3YA 5CVEA 1G19A 2BFEB 2W6ID 4D9IA 4MV7A 1OH5A 4WXYB 3GFQA 3FNHA 4PM4A 1L4LA 3IIEA 3L3BA 4FKZA 2G0AA 1LQTA 4UAUA 5KNBA 1RRGA 2RJOA 2Q28A 3L0ZA 1WV1A 3O74A 4J2TA 5TLSA 2WD7B 4QTZA 3GRZA 3EGXA 1CUIA 5LQUA 1N5JA 3PDIB 2W71A 1Z13A 1XDBA 1YFKA 1WLYA 3IVRA 4DSTA 1BN6A 3X1ZA 5CURA 1B6SA 1ODIA 5AW2A 2EATA 3TI7A 2ZJOA 1RAHA 3KRTA 1Z8HA 1E96A 2ASEA 4RV5A 3B2QA 1DKUA 2R7AA 2RGNC 2GYWA 3OQJA 4NBWA 4AURA 1XBTA 3W5CA 1C50A 3D6VA 3PBKA 4HF7A 4L28A 3VR6H 2GH1A 1S3FA 3EXEA 4CIBA 4K2AA 2JHAA 1XQ1A 2QVXX 3D4LA 3I1FA 3EQ7A 3U49A 1OXVA 5FOQA 2BSAA 1G42A 1OTHA 3RRMA 2FPSA 3E15A 4HGQA 2OORA 4RSRA 1HT3A 3IAM6 3WGZA 2GB4A 2WJGA 4KDRA 4C03A 4Q9KA 4G24A 4CM4B 2AFIE 4UBKA 4BFLA 5IH3A 3VHQA 1MRSA 4IFIA 1GTZA 2ZRCA 4OHBA 1CYEA 1F6BA 5JBIA 4B2YA 1LBSA 4LVNA 5L53A 3NRBA 1PLKA 2E37A 3IT0A 2PMEA 3R74A 2AC4A 2E89A 3W5UA 2R62A 5K3DA 2XW6A 1RBMA 5J3JA 1OWLA 4B83A 3AFHA 4PLFA 3GRYA 2IYYA 2P0EA 1IOWA 1SGWA 1ZXLA 2A9RA 1VJ5A 2O1XA 5ALLA 5B6PA 3BVPA 3DEZA 4AMZA 3ZE8A 4EF4A 3ADOA 1JXMA 1KJQA 3G2HA 5ETJA 1TCCA 3IH5A 3ZNNA 2WF7A 4IDHA 5DXFA 2RK3A 4GOND 4B8ZA 2F9LA 5CVUA 4MS3B 3K4QA 4NV0A 3H3XA 4POAA 1KO1A 1EFTA 3T8YA 1VMKA 1QYWA 1YFZA 2BHLA 4M0PA 4QC2A 5K4GA 4JXZA 4GKKB 4BRWA 2VPXA 2OKGA 1VJDA 3RTAA 2JEZA 4RABA 2ZRHA 2ZRIA 3GJXC 4UD2A 1HMPA 3AYXB 3GXBA 4O4JA 4D3DA 1WUHS 4XZ3A 4L6AA 3ZCPA 4AJ9A 2HFJA 2VSXA 3A9SA 3KWMA 1KWGA 4UVDA 1XNRB 3I8OA 2XADA 3VYTB 1T10A 1NV8A 1PLLA 2B4KA 1SKMA 1B74A 4JT2A 2OGTA 2YUTA 1Y9DA 3SEFA 2RSLA 2VOEA 3LKZA 5G53C 2IYEA 3W5JA 2ST1A 1VCIA 2GK4A 3H13A 4V39A 5K8VA 2B4TO 3T3DA 2BFEA 2QRLA 4JK3A 4WL0A 2FFJA 1RHKA 4C21A 3FFWA 3IXQA 1Z2AA 2P6MA 2PSDA 3CJTA 1UKEA 2GCGA 2Q8PA 1U3FA 2V5UA 2RIRA 3ER6A 3QE4A 4LBYA 1OGJA 1P5HA 1VKNA 3VX4A 4D3YA 2I9KA 4BNLA 4KR7A 3L05A 4MGKR 2EX1A 5KCZA 1MEJA 2WD7A 1GAWA 1PK9A 3I2IA 4G1CA 3UJ7A 1HQCA 2FQYA 3PDIA 4KWIA 2E21A 1GPUA 4OLJA 2PKXA 4OHPA 5JCJD 2IZ6A 4DCJA 3C4JA 3S1AB 2BGGA 3R9IA 1RIIA 1HV8A 1R0SA 4A10A 3Q8WA 2EJTA 5CDUA 1SUIA 1FP7A 1RWNA 4C1NA 2B3TA 1ULBA 2XUPA 5E0KB 3WGOA 2LIPA 5IT0A 3ESYA 1IC6A 1Q3TA 2BEWB 2HSZA 2FY8A 4OUDB 3IP1A 4U2KA 1FFAA 2ZUVA 3HEBA 3I1JA 4PGMA 3MJFA 4YO7A 1K6EA 2IY7A 2XIQA 4DCPA 4L75A 1GPAA 3GEGA 5I7RA 4D82A 3EPPA 4BVJA 1ORDA 2YFQA 2GVDC 4N5NA 4ITVA 1MAWA 1IU9A 2HK9A 3O4HA 4LX8A 3KR0A 4CM4A 2P3QA 2C5LA 1ZN2A 4UPVA 3W8DA 4YRNA 1FNCA 3UWPA 4FONA 4CG1A 3PUHA 2IZ1A 1WP4A 2HL6A 3EW9A 2BOVA 4OXRA 2OXTA 4KVFA 2PFGA 5C8YB 2OB1A 1KEWA 4HH3C 2R25B 3BL8A 3OT4A 4DTIA 3WISA 3GRFA 3EF0A 4M1QA 1DBWA 1LC0A 3OIYA 2WKRA 5IXSA 3W2EA 1P31A 4R83A 5AKGA 3MS2A 1WE2A 3O1LA 3W5VA 3LBFA 3T9EA 3ZGNA 4F5DA 3O93A 3UV3A 1P4HA 2NUPB 4DM3A 1KH2A 2IEAA 3DO8A 3LKDA 5AKKA 4EUEA 5K6AA 3HK2A 3J81k 2D3TA 1YAJA 4MS3A 2FNAA 2JZNA 1LJUA 3GAZA 3T9AA 4DYDA 2Z5GA 2Q5QA 1XTUA 1NBAA 2PTGA 2VK1A 3AJDA 4MR8B 2X15A 1KO8A 1YUBA 1XMSA 5K3FB 4R98A 5F3RA 5A1JA 1E1LA 2NU7B 1PL7A 4BC1A 2O48X 4C2UA 4OUKX 4MW4A 1T15A 2X2OA 4PANA 4Q3LA 3TOSA 4BPBA 3HXQA 1JTEA 4FK8A 3RR2A 5JE8A 2CNKA 3GWZA 4QYIB 4GUDA 3UCEA 1P8JA 1KFBB 3Q40A 4HB3A 3WHLA 1FOEB 3L6DA 1YHNA 3UMSA 1SIBE 2GEDA 5JJ5A 5I9MA 4ZYZA 1L5FA 4ASUA 4ZTZB 3OOYA 1K8YB 4KLNA 4LNHA 3VNRA 3ZGVA 2BZ0A 1FU8A 1VSBA 1P0MA 4NAVA 3KQWA 1US8B 4BTEA 2VP2A 4Z4QA 5A6SB 2A58A 4DG5A 3GFPA 3IQDB 4G0ZA 3S1AA 5AQEA 1M6VB 1G5TA 1CFJA 1KGDA 4ZOAA 1WZIA 2GPNA 3OFVA 5EPEA 3Q3CA 3VFDA 4CT5A 5JASA 1UOEA 1FFWA 2IL1A 4RLQA 2O8NA 2QY9A 4MULA 3BSYA 2GJ9A 1KIMA 4RK1A 4L50A 2FJPA 1HNZB 2BEWA 5JAZA 3D59A 4I1RA 4OUDA 4XLZA 3PPYA 1I51A 1NNLA 2QB5A 4AUKA 4CKWB 1LSJA 1WDWB 3ACBA 4FR2A 4FOSA 5DTQA 4JR1A 4DEXA 5AUNB 3UBTA 3H5TA 4TM8A 4A9AA 5CPFA 4CR6A 2EFEB 4H7FA 2MOKA 3C6MA 3SS8A 4LDAA 1UKBA 1U28C 2FUG1 2E2WA 1MJGA 1THMA 4GNKA 4V1CB 2PWYA 2PZKA 1MCZA 2Q2VA 2QUJA 4AC9A 3B60A 4OBXA 4X5OA 2IOFA 1U5AA 1W9HA 2WZQA 3PJGA 5C8YA 3RVKA 1WMBA 1AUVA 4X54A 1BDMA 1COWA 3B7GA 1MR3F 5GMOA 2FG7C 4RMJA 4DR5B 4LF6B 4EHLA 2Y1OA 2NUPA 3BX1A 2ZUTA 2PRYA 3RTEA 1ELOA 5B7NA 4IH9A 4DMUB 4MIOA 4DIUA 1P80A 2QTGA 3V32A 3HM9A 2P2GA 1EJBA 3REGA 4DEYA 3NUGA 3ZDRA 1ZOIA 3EQ2A 3Q2KA 1J97A 5BW6B 2G40A 5GJVC 4Q3CA 1YRHA 4OAQA 5AM5A 3D8UA 1K0UA 4XGIA 3K6JA 3JQBA 2OVBA 4MR8A 5A0TA 1GPLA 3BFJA 3GLQA 1FSPA 1M72A 2ZB8A 5K3FA 4LG1A 1UZMA 1XXHA 2NU7A 3CZ9A 1C4KA 2DULA 4JLWA 1MJNA 3BH0A 4PYQA 4D5EA 4F7WA 3ZU4A 2LIVA 1E9AA 1YONA 2NX2A 1WMFA 3B13B 3WAJA 2CJWB 3OHPA 4HVCA 1ZX1A 2E4AA 1E2LA 4KWEA 4ZU3A 2EGGA 4UU8A 5AK4A 4L9AA 2B7BA 4QYIA 4Z9FA 4D46A 1S02A 4NKRA 3OKPA 1PSWA 2PYZA 1Y6JA 2D2XA 3EZNA 1D5CA 3NASA 1TZJA 3KPJA 1QE5A 3S28A 1UK7A 2AOTB 3TFOA 1J0CA 2GPSA 2J5RA 3AINA 1CWUA 1ZNYA 2C2HA 1SOWA 4ND8B 3VPGA 4NFHA 3TAHA 4BFXA 3H9JA 1US8A 2AH5A 3LQ4A 4RL4A 1W36D 1G8SA 3KZOA 3WGJA 5A6SA 3FNFA 1TRHA 4JWKA 1R00A 4J7CA 5CDHA 2FZKA 3NIGB 3ZK7A 2XUKA 1M6VA 4V0OA 4DSUA 4F5ZA 1GFIA 2R79A 4Q1EA 4XB2A 4ZCIA 1JDPA 1NMSA 4BZPA 2IS1A 3G02A 3ICCA 1B1CA 2AA3A 4IDAA 3NKFA 2AQKA 4AMBA 1RQNA 3O8LA 5K0BA 4CKWA 1ZGCA 1VE7A 2AG8A 4X3OA 3WGNA 5EJ4A 1W5AA 2I7DA 2XQFA 3QU9A 4FDLA 4JOSA 4B6FA 1A7JA 1RZUA 1TYCA 4Q1AA 4FE7A 4RJIA 1FTGA 1YQEA 2QRQA 3VKFA 1AK2A 5CB8A 4FX2A 4W5WA 1H2HA 1VL1A 4CI9A 5EP2A 1XEFA 2RHLA 3PJRA 3M6UA 4YPVA 1KI4A 4V1CA 1V5EA 2PGNA 3I73A 1HEUA 1XDSA 4ED9A 2XWSA 4NG4A 3FNGA 2NP6A 4YONB 4FU0A 4D9CA 5CBKA 3BSFA 4DIKA 4ZVVA 2PLRA 3WLIA 2ODWA 1Y6QA 4ARAA 3K0HA 3LY7A 1NQTA 1LNZA 1NWCA 2GAOA 3KZNA 1UAYA 1ZI8A 4OHUA 1NQAO 5ALNA 2C2KA 4AD8A 1KF0A 4EARA 4JV5B 1J99A 1FPQA 1FW8A 4XXHA 3KEFA 4YGXB 2XMDA 3B7WA 4HMPA 3ZGYA 3BHMA 3C5HA 4JBYA 4TZ6A 5EEGA 4FFOA 2ZJZA 3L82B 1YDGA 1FSGA 4PSUA 1E2IA 3BXZA 3E70C 3OCUA 2G9VA 2XUDA 3S2ZA 4L9SA 5FX2A 2PRJA 1I4TD 4G5XA 3WYFA 1OZAA 3OQ1A 2CJFA 2ZEJA 5EVJA 5E1MA 2Q1UA 1ATIA 5T41A 4MJ3A 4G4SP 5CNIA 4ESOA 1CUEA 2BGLA 1QFXA 2GHIA 1BX3A 4LJ7A 4FFPA 2M9MA 1G5QA 1W44A 2B78A 5I7SA 2WEKA 3AILA 4I81A 5K03A 2AN3A 1K3TA 2CBXA 2Z2JA 5DW0A 4MCHA 4E09A 2CJWA 3UY4A 2BDEA 2I80A 2WY2D 3CZAA 4RMHA 4CVNA 1P75A 2D2EA 2ENWA 5KDDA 1QR6A 3PT9A 2VZ0A 4JQSA 1J9EA 1AGXA 2CXHA 1PV2A 2PRKA 3LPMA 3N0WA 5EMHA 4ICIA 1XAJA 4WLOA 2AOTA 2RG1A 3GAFA 4CMGA 5H16A 4M4SA 2JIOA 2RGUA 3W5DA 5MN5A 4ND8A 4YXWA 1ZC3A 2GJAA 4ERXA 2BKLA 3THXB 4RK6A 2X41A 2Z5VA 1T5TA 3PSAA 2XZTA 1GV1A 2DHRA 2Q1WA 3BERA 4V0RA 2H0RA 1C5KA 3K7EA 3NRCA 4K40A 1OBFO 4M9CA 4NFYA 3ESDA 3PA8A 4FYMA 4IEFB 4KH1A 5AICA 3MT9A 1U1FA 3KL2A 1H23A 4FR0A 3H5NA 4JA2A 5AIAA 5CXSA 1M2EA 2IV2X 3UB4A 4AF8A 3DT8A 2JCSA 4G41A 5I3ZA 4PYMA 3H9CA 4EGFA 1TQ2A 1DJPA 3HWRA 1SXGA 2ZR9A 3EODA 3QFRA 4BGEA 5GIPE 1XN4A 4R0VA 2QTFA 1R16A 1DFGA 3AK4A 3OJLA 1BRMA 4L0MA 2A3NA 5F12A 3JTEA 3UJ8A 3ZDDA 3O3MB 4PPGA 3CZRA 4C5AA 1T8SA 2YBEA 2XMPA 2HMVA 1EX9A 1QHEA 1YQUA 2DH6A 3H65A 4HAXA 4QBFA 3WV5A 4L9RA 1LA2A 4PFKA 4NNJA 4UVEA 5JPDA 5KOIA 2DUNA 1NMXA 4EPRA 1PRYA 2V4MA 1P9RA 4IY1A 2C42A 4GNRA 3FD8A 3X1YA 2W2LA 1C0LA 4F6RB 5J47A 4QUJA 4L5BA 2R84A 4OP2A 4V24A 4Z4EA 2NOAA 3QF4B 3QVKA 4YWHA 2A5LA 3PGVA 3TMAA 1G0OA 3OIFA 1BWQA 2O1EA 2DPHA 3S3TA 3D4BA 5IHPA 4LXTA 3LIPA 5AOVA 1VKHA 4J4TA 1FFDA 1RHMA 2WQZA 4C4XA 2PWBA 3V8QA 5ISMA 1E6KA 1NIJA 1NZDA 1YZKA 1VHTA 3AY7A 3H0KA 4HMOA 4C3OB 3BJRA 3QE2A 1N4AA 2Q9CA 5EIHA 1J8VA 4ZANA 5JAMA 3ZY3A 1C3VA 3LC2O 4MNTA 1DIOB 1NXWA 4MHSA 5CW2A 2REXB 1DKOA 5E2IA 5IEJA 1I3OA 3JVVA 3SSOA 4BMVA 5A3JA 1Z5GA 2WT9A 3IBGA 3U3DA 2WDZA 5ESWA 4CNQA 1GD1O 5EE3A 1QGYA 3GGDA 1UMKA 5WRFA 1MEEA 3SP1A 3T1VA 2IH5A 1YS2X 1W0KD 1UOPA 1I8TA 2Z9DA 2YVUA 4V0SA 1N8SA 5EIXA 4YRFA 4RZQA 3MJVA 4LY6A 4L0DA 1DKQA 1T8WA 2FX2A 4KL8S 1TC1A 1SHUX 3MUNA 3J7TA 3LPLA 1JDBB 1NATA 4WPGA 4ODIA 1MDBA 1Z7GA 2FSGA 3E7XA 4IZ6A 3SHQA 3T0GA 4EVIA 3KQUA 1JAIA 3KSUA 3EGVA 4U0JA 1LPSA 1SVLA 2WOOA 3AR7A 1JXAA 3E5RA 4PG7A 4Q5IA 5DTJA 3U17A 3ZLTA 5CD1A 4HPJB 1KK3A 2GYVA 1KE2A 3THXA 2DPLA 2I1WA 1PJQA 4QFBA 1SD2A 4TWRA 1HRDA 1OYVA 1XP8A 1ORWA 4QTTB 4X85A 3RTBA 3TRKA 3WLEA 4MPDA 2WWTA 1PKXA 3CYFA 4JU8A 3TH5A 2ORVA 4QNNA 3VUFA 2X58A 4E5KA 2X2FA 2RH8A 4WEOA 4CIAA 1IZ0A 3WRWA 3VR6D 2Q49A 2AFHE 3LT5A 3HY4A 3O82A 3AONB 1HBJA 3QOXA 4FCCA 1S4MA 2XRFA 2YWHA 2VJCA 1N2XA 2ZJ7A 1KL7A 3Q12A 3ZK8A 3UV6A 5ALXA 2XSZA 5BSWA 4ZAXA 3L8FA 4PW0A 1TOAA 5EJIA 1WW3A 5KVCA 1C7JA 1YFJA 1R9MA 2RHHA 4WXHA 4G01B 1JPJA 1AQLA 2OV4A 1ODSA 2OHVA 4MI3A 1KKLA 3H1AA 1EM8B 3LM8A 1N36B 4HRVA 2H0AA 3PQDA 4EL5A 2H92A 5HKKD 2FFAA 4I19A 4F6RA 4ER7A 1O6FA 2WNIA 3GO4A 1RWXA 3PDHA 3BQ9A 4GLLA 4NOLA 2IP2A 3Q98A 3TLBA 4DLLA 4RTMA 3QF4A 1NVVR 1CEEA 4FQ7A 4RQTA 3OMLA 3NWJA 1N9KA 3FCSB 3RBXA 3LQFA 5B3KA 1JEOA 3EVNA 1SIOA 1L5YA 3AJEA 3R6LA 5AI9A 3I3SR 1C30B 2ZSEA 2B34A 3RS8A 1J2UA 4NCHA 5CFQA 4HLCA 4LXUA 4ZVPA 3OQBA 4TWAA 3IKLA 1MABB 2RBEA 4LZWA 1B14A 3HXMA 4D74A 1BDBA 1YC5A 2GN0A 5IAEA 2IF2A 1V8FA 2IZ5A 2YXLA 2Q1YA 1S0UA 4G3XA 4MVCA 4Q15A 5DT2A 3E2MA 1II8B 2O3UA 2YJ3A 2PLFA 5CAEB 4AAYA 5H68A 3T4EA 4PRZA 5AVSA 4D9GA 1R0YA 1M54A 4IWYA 3K4HA 4BHTA 4M98A 2OCGA 4QGAA 1G2PA 1M6HA 3ELYA 3AEZA 3QPAA 3BEOA 3ZD7A 3JZDA 3EFHA 1EWQA 4ZQBA 1Z4LA 4WI1A 1KK1A 3OBBA 2R4QA 4LSGA 4BVLA 1Z7YA 5TEVA 1HEYA 4ZZ3A 3P1JA 2NT4A 2BEUB 1A9TA 1N3LA 2BV3A 1E6WA 1JJAA 1HFJA 2WSYB 16PKA 1OJ7A 1ZQ9A 2R86A 3IVAA 4QZVA 3T15A 5JTTA 1S9HA 5A71A 1XCBA 2WUFA 3U31A 2YN2A 1V9CA 2Q5FA 3C43A 1L4KA 5ITZB 5DHFA 5AVQA 3L07A 1GILA 3UOAB 4MPPA 3II6X 5HFAA 1QOQB 4J90A 4YH1A 5KTKA 2W4IA 4GOOD 3RVMA 2DJIA 2COEA 1ZCZA 2H07A 4KTTE 3WSTA 3WDSA 3MQ4A 1OGYA 3HI6A 2OYCA 1DEOA 1PNOA 1CUAA 3CRW1 5AIBA 3CRQA 4Y98A 4B3IA 5ANRB 1FFBA 1NG1A 1TO2E 2Q7DA 2BR5A 5KYNA 4EHFA 3I2KA 2X1VA 5HTKA 1ONOA 3RUFA 4BNZA 1BE8A 3EK2A 5K6TA 1ISPA 3T7RA 5I7OA 2EP5A 2L17A 3G8YA 3GNSA 2VYVA 4L5CA 3AFOA 4QUDA 3KTOA 3QPUA 2JIPA 2H48A 3TEMA 5BUSA 4FD3A 3GW8A 2Q6KA 5B36A 1TLTA 2L19A 1E3EA 1EM8A 2VKTA 1WMDA 4DLKA 2PV7A 2EWVA 4OX9Y 2A67A 1DIRA 4FW9A 2QL6A 4UNPA 1XMPA 5HDQA 4D6XA 2CL7X 5C53B 4YRRA 5AM3A 4BBAA 2PUAA 1HG0A 5IC6A 1EMDA 1H5UA 1JB9A 1A2QA 3DPIA 4KOAA 3KQNA 1JJ7A 2OL4A 2NTEA 3ND6A 1MT0A 4UEOA 1S8OA 4ON9A 1PZMA 3KQSA 1U02A 2ZB7A 1QBKC 1V5GA 2DP4E 1C30A 1QXSA 5FL7D 4AY2A 4URXR 2B4QA 3FROA 5EXTA 1W88B 1QGUB 1Z22A 4IGFA 5ECDA 1MABA 3CTPA 4JI2B 1YASA 4NCBA 621PA 4EI8A 5DH9A 4ZAVA 3OECA 3C3WA 1YS7A 3V48A 1II8A 2BM1A 2LCIA 3JV7A 3JQ7B 4LJAA 2ZYHA 1FFSA 1FMLA 1FDVA 2FCAA 3UNXA 3UQZA 3FBGA 4X6YA 5IAKA 4C4TA 3E81A 3ETHA 2C7GA 4GGPA 4PZEA 1J20A 1RYDA 2MINB 1P17A 2EYUA 3V34A 7MDHA 5FPKA 2JD1A 1N78A 1PU2A 4EAAA 3V5NA 2ANCA 5FUVA 3EEIA 4C6HA 4RDHA 2AUNA 1G3QA 2JFQA 3QWAA 3M8KA 4IW3B 5H3CA 1GGMA 1MPTA 3CFYA 4JLUA 4M1MA 1V1JA 1EWKA 4YJKA 4GP9A 3LXRA 3D5TA 3QPCA 3ZDBA 3EVCA 1Z12A 4FYHA 2BEUA 1UADA 2HMYB 2CBGA 3TOZA 4JP3A 2ZYIA 3P5BA 5CJ2A 5CITA 1LTHR 3QOYA 2TMYA 4HLQB 4JVNA 4FGZA 3HNPA 4QUGA 4WUVA 1E9DA 4WY8A 1REQB 4MA0A 3V7WA 3GK3A 5ITZA 4KGXA 2HD4A 5TJ9A 3RNLA 1XF9A 3FE2A 1J0AA 1QK3A 1V2HE 2EBFX 3BGSA 3IRUA 4TL8A 5AHOA 2GFIA 4CMKA 3OUZA 4DR3B 3HMKA 2EBUA 2CLLB 5EJ8A 2CMKA 4ZQFA 4HI0E 1FSFA 2QM7A 2BZ1A 2LE0A 1ZS9A 4Z53A 3KJZA 3O4RA 1MTOA 4CUJA 4DAEA 5C37A 1ZD1A 4RKYA 1NW6A 3GCDA 4IOLA 1R50A 3ZJYA 4O6VA 4E5PA 1U2GC 1T1GA 4QT4A 1AZWA 3L18A 2PD4A 4WGFA 1UCFA 2ZWAA 3QXCA 2MSWA 5CJPA 3AYZB 4CZ2A 2GPJA 2V45A 4QULA 2AL7A 2WHQA 1ZAKA 4OMDA 4A0RA 2C5BA 4LHZA 4C04A 3WSWA 3D5QA 2IOHA 1IL0A 3P0HA 1JP7A 3TZEA 3IVMA 1Q7EA 4QEKA 3A2KA 3KB8A 5LFAA 2OHHA 4QSHA 2HR1A 2PLWA 4AP5A 5DYNA 1J42A 1QPBA 2B6HA 3O2JA 1FCJA 4RK5A 4FFRA 1PQUA 4ZVRA 4B47A 1LY1A 5JXHA 1GPMA 1UPBA 3BWVA 2Q5LA 1XV5A 3MMNA 1W59A 4JX9A 4DZTA 3T3GA 1MFPA 2CMFA 2GVNA 1E79D 3I45A 1N6RA 1RAFA 5JADA 2IGTA 2P9EA 1AMUA 2QLJA 1XD8A 4PZLA 4LWQA 1W88A 5DYYA 4K9MA 4P5DA 1QGUA 1FVHA 2B4RO 2VFAA 1SWWA 2HGSA 3I37X