3H19A

Crystal structure of este5, was soaked by methyl alcohol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
296
structure length
293
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 101
structure length 293
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h19A00
4FDMA 4X6XA 2WG1A 2YASA 4CIBA 3OOSA 2W22A 1EXWA 2WHPB 5KWIA 3ESCA 5HF6A 3DL7A 4FKBA 1MO2A 2RAUA 3F97A 5FRDA 2O7VA 5HKAA 3AINA 3L1IA 3WIOA 5AM1A 2I3ZA 3G02A 3WK9A 1QIGA 5AICA 3WYDA 4HAIA 2C7BA 3C45A 2XLCA 2BUAA 2XUDA 1XQVA 5T4HA 3WA6A 2WUDA 2P8SA 5EIAA 1E89A 3K6KA 3I1IA 1PFQA 1ACLA 4F0JA 3H2GA 4EA6A 2BGNA 3FYTA 2W6CX 5LZ7A 3LP5A 1JFRA 3DJYA 5ESRA 1BEZA 1MAAA 1HDEA 4C4YA 1NX9A 5JARA 1CUIA 3JW8A 5HF9A 4N8DA 3ANSA 4RE5A 1ZJ5A 1K8QA 4Y2XA 4C87A 5DNVA 3IVMA 1YAJA 1XZMA 4P9NA 1ZD3A 1QIDA 2Y2VA 4CFSA 2Z3WA 3HYSA 4ZXFA 3G0GA 3AJAA 1MX9A 2HADA 2XMDA 2GYVA 3FLEA 4OPMA 3ZLTA 2HA5A 7YASA 4LXHA 4KEAA 2WUEA 2WJ6A 3AUKA 4Q34A 2FJ0A 2YH2A 1TRHA 5CW2A 4Y2PA 1DTEA 2DCMA 4C6HA 5JALA 1THTA 4QWWA 2PL5A 3C5WP 4ROTA 3C8DA 4LXIA 1XZEA 3WKAA 4B6GA 2XMGA 1EK1A 2HHAA 4AX4A 2XMQA 2ONCA 1R9MA 5DNUA 4AO8A 3F9CA 2B9VA 3FYUB 5FUMA 4OYLA 3MUOA 4L3WA 2OGSA 3FOBA 4QWMA 1WPXA 1XFDA 3WKCA 3C6ZA 4FOLA 4IH9A 5D7BA 2JEZA 3WKDA 5FXMA 2YXPX 1CIJA 3WI7A 3F8SA 3RK4A 1UK6A 1GZ7A 3LIIA 1DWQA 4FBMA 5D6OA 1U65A 2OCIA 5A71A 5AIAA 2PSDA 3QH4A 1CUWA 4J0JA 3AZOA 2R11A 5AKJA 4LYEA 1Q0ZA 1H2YA 3I1YA 3WWOA 2XLBA 1WB6A 2X8BA 3EQ8A 4QLOA 3WKBA 3O9MA 5AK3A 3BE8A 4U2GA 5K3EA 5BWCA 1OXMA 4P92A 4DNQA 2PU5A 3F98A 2H9YA 1LPOA 5HCUA 1WCYA 5EIEA 3F67A 3HACA 2ACEA 3T4UA 2ZSHA 4Y7DA 1DQYA 5AI4A 4FFWA 2DR0A 3WL6A 4IQ4A 1D07A 2JGKA 3CXUA 2QT9A 3G8YA 2Y2UA 4DMFA 6YASA 2XMZA 4P08A 1ACJA 2QRUA 4W63A 4WDRA 2CZQA 2RIPA 1CLEA 3WQHA 2V97A 2XUJA 1VZ3A 3PF8A 4UHBA 4MQMA 4D9JA 1LPAB 1LPMA 2XQFA 3PFCA 4EUSA 4PNZA 4CCYA 4FNMA 4EB0A 1TAHA 2AJBA 1DWOA 5AOCA 2G5PA 1CUXA 1FFCA 1ZIXA 1EH5A 2BFNA 2BCEA 1XRMA 4XIIA 4DNFA 4WJLA 4GECA 4G4IA 2WFLB 4MJ3A 3FCYA 2XUKA 4UFPA 1MTZA 2WHPA 4FLMA 5FLKA 3O4GA 1EA5A 3DD5A 4BVKA 1IZ8A 4G4JA 2WLSA 3GBSA 3D2AA 1MU0A 3VDXA 4N8EA 3C5VA 3BF8A 1QFMA 1CVLA 2JIDA 5J3JA 5CT8A 5DWDA 4OB8A 1EDDA 4J0IA 5ALHA 5AM5A 1Y7IA 1O6GA 5ALKA 4FFVA 4H7JA 5A7HA 4BDSA 1GPNA 3QMVA 2DHDA 4RGYA 1TK3A 1XZAA 3QBJA 5LIPA 1C4XA 2V96A 3WK4A 5CH5A 3BJRA 1ZD2P 4F60A 2Y6VA 2B20A 1I6WA 2NW6A 2Y1KA 1LZKA 1UK8A 1LPBB 1FFBA 4ARBA 2O7RA 4KE6A 5AIBA 3PF9A 2OGTA 3D0KA 4N5HX 5CBKA 3W05A 5K5EA 3IB3A 4I19A 4DMCA 4OUKX 1ODCA 3BIWA 5EHNA 3QMWA 5HK9A 5I7UA 2HU5A 4IH1A 2V98A 3A6ZA 4J0KA 1GGVA 4HXFB 2BAGA 4UFOA 4KAAA 5LKAA 2Q0XA 3ED1A 2HM7A 2X76A 3AILA 4FMPA 5ALYA 1BCRA 1Q84A 3NUZA 4B82A 4MWSA 4H7FA 1IMJA 4X94A 3WK6A 4DIUA 2XQIA 4I3FA 1XRNA 3FYUA 4QDXA 1YR2A 1VOTA 2J4FA 3ILSA 4XJVA 2QVBA 3G9UA 2OAEA 4UUQA 5LZ2A 5HFNA 3D5EA 3L1HA 1C7IA 2R8BA 1FSSA 3IULA 1WHTA 1UFOA 2OQIA 3DYIA 1GPLA 2ZSIA 3KWJA 2OG1A 1QZ3A 3WK7A 2HA0A 3MVEA 5ALWA 1XRRA 2HA2A 4MQLA 1DQZA 2WU4A 1CUVA 2CEKA 1EINA 1UOOA 2AXEA 3H04A 1SCQA 3CN9A 4GDMA 4ZI5A 3WK5A 2OCLA 3DEAA 2JGFA 1BE0A 2WIKA 5DJ5A 2ACKA 4BYMA 2PUHA 2WFMA 1G66A 4G1FA 1MX5A 2ZVDA 2WIDA 3DKKA 4BAGA 1QIHA 3WJ2A 1QIIA 1K5PA 5AK4A 3GA7A 3S2ZA 2IIVA 4Z49A 1B6GA 1NU8A 1CUFA 1LGYA 4W1PA 1OCEA 3D2BA 4AQDA 4N8SA 1QIKA 4Y2RA 4U2CA 2D0DA 1VA5A 3DYVA 2VJCA 2IITA 1G4HA 1AURA 4PSDA 4ARAA 4BDTA 4HXGA 1P0QA 5HFAA 4Y2SA 3WWEA 1JI3A 1CFJA 3BDVA 3ZWQA 4BAZA 4W1RA 3C87A 1N1MA 5IVIA 2GZSA 4AN1A 1ZI8A 4MYSA 2WKWA 4KYVA 4IH4A 1AZWA 1RYYA 4O08A 3OPMA 4OD0A 5DLPA 5ALTA 2PVSA 2XMSA 2PSJA 2QUAA 3E1GA 3H2HA 1BCSA 3RARA 4AZ3A 4ITVA 5E4JA 1ZD4A 5T4BA 3O9VA 4OU4A 4CI9A 2DHEA 2OAGA 2WQZA 3HZOA 1YA4A 3VVMA 1ZOIA 4GEGA 4BZWA 4KR0A 1QFSA 2CMFA 1GQSA 5K3BA 1DX4A 2WIJA 1P0MA 1LPSA 3QMMA 2PSHA 5ALVA 3S8YA 3C43A 5E2IA 1DINA 1XROA 5AK5A 5C7YA 2BJHA 4OCZA 1C7JA 5FP0A 1K4YA 5FDFA 5DYWA 1SC9A 3HLKA 3PUHA 3I6MA 3IIIA 4J3JA 3P2MA 1QONA 2I78A 1O6FA 1CUBA 3WL7A 3O4JA 2H1IA 1BN7A 1CV2A 4U2EA 3C70A 5ALNA 1LPPA 1CUJA 3BJMA 5JAPA 1UOPA 4PW0A 4G9EA 3BF7A 4XVCA 4YASA 1YSCA 2RGUA 1W75A 2XMBA 4ETWA 4EY6A 1Q0RA 4JEIA 1EI9A 2QM0A 3LLCA 4KACA 1MPXA 4S0XA 3M82A 4X92A 5KWJA 3AIMA 4B83A 1YA8A 1GKKA 3DOIA 4C89A 4CG2A 4KAFA 4E14A 5AKYA 2HU7A 4QDZA 2WIFA 5D3KA 1ZJ4A 2RONA 3DDUA 4BCCA 3I2IA 3W9UA 4E15A 1TIBA 2WSLA 1A88A 1QIJA 1HL7A 1QIEA 4KE8A 4HVTA 3ESAA 2C5GA 3B12A 2AJLI 5AI5A 1R3DA 1CUAA 2VQ6A 4AXBA 5FPQA 3G9XA 3H2KA 3V1NA 1XQWA 3AZPA 3N2ZB 4ZV9A 3Q8WA 1EB8A 1QLWA 3G9ZA 4EY7A 1OILA 3EQ9A 4JNCA 1SCKA 5ALOA 4BBZA 3K9BA 2WILA 5AK6A 1AUOA 3QVMA 1THGA 3C6YA 3FNBA 3STUA 4LIPD 5EFZA 5LYYA 4MEAA 2WFZA 5CH8A 2JGIA 3WWCA 1XZCA 4PO3X 5JZSA 4K6GA 4Y2UA 3R3ZA 2CBGA 3UUEA 1XLUA 4F5ZA 1EVQA 4AB1A 1UZAA 5D3ZA 3VISA 3IA2A 1ORVA 2ZJ6A 5LZ4A 1MX1A 4PSUA 4A16A 2J3QA 3H19A 1N8SA 5JAHA 2VTVA 1J2EA 2JGJA 1A8QA 1XZLA 2PSEA 4WCVA 4BE9A 4J0HA 5CURA 5HK8A 1VE6A 2GBIA 1VKHA 1XQXA 2PKYX 1VXRA 3I2GA 3M3DA 1WHSA 1XZKA 4E46A 3GELA 5SYMA 1KU6A 2D5LA 1XQYA 1DX6A 3VXKA 5ALJA 4DLNA 3WZMA 5AKIA 2WTNA 4RE6A 2JGMA 3ICVA 3G7NA 1U2EA 2ZYRA 2VSQA 1WM1A 3ZLUA 2QOEA 1CR6A 1AC5A 1YAHA 4E11A 5JIBA 5JADA 4W1QA 1X2EA 5BV7A 2GBGA 3FVTA 3H2IA 4Q3LA 3D7RA 3STXA 3GROA 1J1IA 1LLFA 2HIHA 1XRLA 3O95A 3E0XA 2XT0A 5BWBA 4A5SA 5HQ3B 4RPCA 4BE4A 4C4XA 4TVKA 1QGED 2EDAA 2QJWA 5K3AA 1E5TA 5JZ9A 3OC0A 2XQJA 3AIKA 1QOZA 2LIPA 2ROQA 4DMHA 1W4LA 4Y2JA 3CCBA 2DHCA 1MAHA 1ODSA 2EDCA 2RHWA 4LXGA 2XUOA 1E8MA 4PV7A 4WY5A 3D59A 3QZUA 4CG1A 2VT7A 1U8EA 2QZPA 1R50A 4X90A 4QDUA 5AM3A 1TQHA 2VJDA 1JJFA 4M0EA 1E8NA 1GKLA 2XQKA 3N0TA 3A2MA 2OCGA 2X5XA 1XZHA 3R0VA 4QDOA 4FLEA 3DNMA 4U2BA 1L7RA 2QMQA 2WTMA 1F8UA 4HRYA 4WDQA 1XKTA 2DSNA 1RP1A 3E3AA 1F0PA 2VF2A 1G5FA 1T4MA 1XLVA 1KEZA 4Q1VA 3VVLA 5DTJA 4LHEA 1QIMA 5CXUA 4X97A 4EY8A 1ZGBA 2VT6A 5ALFA 1H2ZA 2VEOA 4Y2QA 2CUTA 4G4GA 4HTAA 3QITA 1P0IA 2J3DA 5A7GA 1GQRA 3H2JA 4G9GA 2OPHA 5JANA 4ZRDA 2I3DA 3V1KA 3WLAA 5A6VA 1XLWA 2DQZA 4FNGA 5F4ZA 1IUOA 5I8PA 2XE4A 5K3CA 4AO6A 3W06A 1VZ2A 5AKKA 1FJ2A 1ZD5A 5AM2A 4MEBA 1EX9A 4H0CA 4OYYA 2UZ0A 4K2AA 5EHZA 4H7EA 1VA4A 4J7AA 1L7AA 3R3YA 3NOXA 1FFDA 5JASA 2GBCA 4GWLA 1XZIA 3BL8A 3V1LA 3MGAA 4QLAA 4CIAA 1EK2A 1LPNA 3WL8A 3DLTA 3KDAA 1P0PA 2B4KA 3U0VA 4DNOA 3TJMA 4G5XA 1Z68A 2BUCA 3OTQA 5ALPA 3K2IA 4X95A 4KE7A 4PSCA 1XRPA 1UK9A 1EHYA 2BKLA 2YYSA 1ZI9A 5AH0A 2HFKA 4INZA 4QEKA 4J0GA 3H17A 1QIFA 3SC2A 3KXPA 3BXPA 3H18A 3DS8A 1EDBA 1UK7A 2HA7A 4EZIA 5IVHA 3ICWA 1LZLA 3KSRA 4QDTA 2IX9A 2C0PA 5DYTA 4Y2YA 3R40A 1H23A 1F0NA 3FCXA 3H1AA 1UXOA 1XKLA 4AO7A 2FX5A 2WUGA 1FFAA 5LZ5A 1WB5A 2VA9A 3G0CA 5ALXA 1VE7A 4H7HA 4Y9SA 4DSZA 2CB9A 4BCBA 2BUBA 3ZLVA 1MJ5A 5A7FA 4NS4A 3AZQA 1AX9A 4J03A 3IBTA 3FLBA 1W76A 1CUUA 3HSSA 3O0DA 4DM7A 4IHAA 1MNQA 1GPKA 4BC0A 4DSAA 5C8VA 4KE9A 1MNAA 2HRRA 4DMKA 2PPLA 5ALGA 1WB4A 4H77A 1CEXA 2QR5A 2QXTA 1PV1A 2FUKA 5HF8A 3TRDA 4Y2TA 1YCDA 1HPLA 3GZJA 3LIPA 5JD6A 5ALMA 1U4NA 3ZPXA 1QO9A 3EF3A 2OLEA 3FSGA 1ORWA 5HQ3A 4X71A 3YASA 4DNPA 1XZJA 3OG9A 4BATA 3ZV7A 4XX1A 2WHRA 4MYDA 4X3CA 5EGNA 2WG0A 3KWFA 1JU4A 3EIOA 5HF5A 3TEJA 4B84A 1QE3A 1K63A 1JMKC 5AM4A 4HS9A 2WHQA 3RLIA 4JYPA 5K3FB 4GXNA 1JKMA 1CUCA 5AI0A 4X85A 4UBNA 1AMNA 4L9AA 1JMYA 2E3JA 3R41A 1YB6A 5AHXA 2JBWA 3SK0A 4K6KA 1VXOA 3WWDA 2J4CA 3ESBA 4M0MA 4FBLA 4CCWA 1E3QA 3FWHA 4X91A 3UUFA 3D2CA 4GHWA 1GXSA 2WJ3A 2JGLA 2XUHA 5E4TA 3OM8A 5C8XA 2DQYA 5ALSA 5YASA 2O2GA 3IUMA 3NWOA 4BRSA 3B5EA 3PDCA 2G63A 2B61A 1CQWA 4PF1A 1N5RA 5LZ9A 2H7YA 2GYUA 2AJ8A 2JEYA 3H1BA 3CCCA 2GZRA 1EDEA 5H3HA 5ALZA 4ZGBA 1CRLA 2O2HA 3PUIA 1XZGA 5AO9A 1ODTC 4TGLA 4DGQA 1FFEA 3LCRA 3WWPA 2C0QA 1CPYA 2WJ4A 2VJAA 4JUIA 2OXEA 4UBJA 4FWBA 4BZZA 1S8OA 3KOOA 3W2TA 2ECFA 3BWXA 3JYHA 5AOBA 3RM3A 4A23A 1LBSA 4BB0A 1DWPA 1VLQA 1SCIA 3H0CA 2O2IA 5AI8A 4GBGA 3W04A 3QM1A 2VATA 4KRXA 1H2XA 4UBMA 4UHDA 5FOQA 1CUZA 4FTWA 5IKXA 4H35A 4G8DA 3V9AA 2GYWA 3STYA 5EI5A 5AKLA 4OB6A 1EB9A 1L7QA 5CT4A 1XZBA 3DQZA 5SYNA 4BVJA 4BP9A 2WM2A 5CT9A 1F6WA 1AQLA 4UBKA 2WU3A 2JF0A 5JZBA 4B0PA 1X2BA 4K5QA 4ZV7A 1NU6A 2QJRA 1R88A 5ISMA 1TCBA 4Q3KA 4EBBA 3BDIA 3C6BA 3G9TA 1WOMA 4NVRA 1QJ4A 5FV4A 5BOVA 1R1DA 3WZLA 5LZ8A 1K6EA 1UWCA 4PQEA 5HZGA 3QYJA 1JU3A 3QPDA 4G8CA 4V2IA 2V9ZA 1QTRA 2Z8ZA 3DOHA 1A8UA 3I6YA 3W9BA 1VJ5A 1UKBA 4UHEA 1E8DA 3VJLA 4L0CA 2PUJA 4WFJA 2QTBA 4OB7A 1J06A 3JWEA 4EHBA 4GI1A 4X6UA 4WFKA 3FBWA 5ALLA 1GT6A 4X6YA 5AKEA 1ZIYA 1PJAA 3AIOA 3HRHA 4H7KA 2HL6A 2ZYHA 1A7UA 3V48A 1W1IA 3WA7A 3QPAA 5AM0A 1WPRA 2VJBA 4KJXA 3ZI7A 1JT2A 2ZYIA 3IUQA 5ALEA 4YPVA 3WYNA 3D3NA 3O4IA 2RHTA 4J0CA 3WIBA 2OCKA 2QXUA 5ALDA 4JYMA 5ALRA 1B41A 3I28A 5FKJA 3HEAA 2EEPA 5K3FA 1CQZA 4EY5A 2PM8A 3NGMA 4X93A 1MN6A 3E4DA 4Q05A 3HC7A 4ZWNA 5T4FA 3C8HA 2QS9A 3PICA 2VAXA 5AKHA 2HU8A 3TGLA 5AI6A 4B85A 1YB7A 4QA9A 1CUSA 2XI4A 3I2JA 5C8ZA 4FLFA 1UKAA 5E4YA 1R4ZA 1XRQA 5CMLA 4UBIA 1J07A 3ANTA 4GW3A 4QZVA 4CG3A 3X3HA 5ALIA 4XWGA 4BAUA 1R9NA 3R3XA 4BC1A 4HRXA 1IUPA 1CUDA 1BRTA 3OURA 2BGRA 2XUAA 4W9RA 2XUQA 5CT5A 4X7BA 3LS2A 2WG2A 4UHCA 1Y37A 2PU7A 1HKHA 4UPDA 5ALQA 3HXKA 4AMYA 1N5MA 3C6XA 4B7ZA 3G0BA 1T2NA 4ZREA 3F96A 3AFIA 1MT3A 1SOMA 4QNNA 1ZI6A 2AJCA 4I4CA 1CUEA 4LKOA 1Y7HA 4KAJA 1AGYA 1DU4A 1H22A 2JGEA 1W52X 3ESDA 4H7IA 2G4LA 5CXXA 1BN6A 2QUBA 4B0OA 3DL4A 4J0DA 3M83A 3CN7A 3WL5A 3Q0TA 2WIGA 2H7XA 2HRQA 1M33A 2PBLA 1BEEA 3STVA 5JD5A 3MUNA 3WJ1A 4X00A 4UHHA 4DTCA 5AOAA 4BVLA 5I9IA 1HLGA 5IVDA 4MWTA 1HQDA 3I6ZA 2C5FA 3FVRA 5AP9A 1JJBA 2G5TA 3UMJA 4NMWA 2XDWA 3B3QA 2PX6A 5EIHA 2XMRA 3A70A 3KD2A 2OQVA 2RI6A 4Q82A 1AKNA 5ALUA 2HA6A 5C81A 5JAUA 3G0DA 3U1TA 4W1SA 5EHXA 5EHQA 4U2FA 2OGZA 2HFJA 5DYYA 1CUYA 3HABA 4UFNA 4HXEB 3DCNA 3O4HA 4U2DA 4EY4A 5T4EA 2XMCA 4IO0A 2PSFA 2XB6A 3WK8A 4BRZA 4F21A 3L1JA 1YS1X 1E66A 3I2FA 5A2GA 4UBOA 1KU0A 2AJDA 4FHZA 4OSEA 4RNCA 5AKXA 3M81A 2FJPA 3PE6A 5DTIA 1CUGA 4AN0A 2XUGA 4L72A 3HJUA 3RKSA 1W6RA 1CUHA 4DYHA 4GLBA 3IURA 4K6HA 1SFRA 1TKRA 2C58A 4N5IX 5AI9A 2K2QB 4MXDA 3EQ7A 4B81A 4P93A 2Z3ZA 4JH0A 5KREA 1XZFA 1BS9A 4H18A 1Q83A 1YASA 1XZDA 2CKMA 5CH3A 3IDAA 3WKEA 4WY8A 4M0FA 5JD4A 5IVKA 3IUNA 4B9AA 5KBYA 2C4HA 4AZ0A 4KRYA 3GUUA 1H2WA 3QPCA 5DNWA 2VAVA 3D4LA 4C88A 2H7CA 1ZICA 2HDWA 1LNSA 1QTIA 2XQGA 4Y2VA 1DT3A 3T52A 4BTLA 3STTA 1ISPA 1ETHA 5FPPA 1ZGCA 4YK7A 2XUFA 5IH7A 2WUFA 4B9EA 2HA3A 4UBLA 1TCAA 3FLAA 5CTAA 4LYDA 4UHFA 1IUNA 3R3VA 3A2NA 1UT6A 4B80A 4QE3A 5CT6A 3GFFA 2I03A 2ORYA 4Q3OA 3G0IA 3PI6A 2Y6UA 3WMRA 4HZGA 3FYUC 4H7DA 3I2HA 5AKGA 2HA4A 4TPKA 1QO7A 5AKZA 5LKRA 3VKFA 1LBTA 5HKBA 3BIXA 3R3WA 3R3UA 4YX9A 3I2KA 4G8BA 5A62A 5JATA 1IVYA 3IUJA 5AJHA 2QKYA 3HI4A 2ZJ7A 4BP8A 2Z8XA 1YS2X 4BCDA 1EVEA 4OU5A 2ES4A 4C01A 5CRIA 4C4ZA 3PFBA 3VJMA 1RWQA 1UKCA 3SX4A 3EBLA 3FSGD 2WFLA 3FAKA 1BROA 1DT5A 1USWA 2Z5GA 2ZJFA 1IZ7A 5JAOA 3A2LA 3SWWA 2ZYSA 2GBFA 1JJIA 4AMZA 1TCCA 2DFPA 2XUPA 3DKRA 5LP1A 1A8SA 4BTVA 3V1MA 1HBJA 5K3DA 1G42A 1BU8A 2CJPA 4CCYB 4WFIA 1UOQA 3STWA 5JYCA 1X70A 3VJKA 2XUIA 4NZZA 5LLSA
chains in the Genus database with same CATH superfamily
4RKRA 3R5FA 1AXEA 4L57A 2JW5A 4U7TB 2WG1A 1SRQA 4X6XA 2F1JA 2J6CA 4HEA1 3NHYA 2O7SA 5F1YA 5FNVF 4YJ2B 1N6OA 2W22A 2YS7A 1KI8A 1FSPA 3FLMA 2Q46A 3EASA 2WTUA 1PFKA 4N0PA 3N8IA 2C7VA 2PKCA 4JX8A 2C9BA 1X9HA 1U0HC 3F97A 1GADO 4FX2A 2CMKA 1D4FA 2H2FA 3TZEA 2IYFA 4DHWA 4OJTA 5HKAA 3AINA 5E38A 5CX1B 1OMOA 1FMJA 3WIOA 4I14A 2GCEA 3IMEA 5B1HA 2REBA 1U04A 3WK9A 4ADSG 1T2EA 5AICA 3WYDA 4PVDA 4HDMB 5H16A 3NFRA 1DJLA 1J8DA 1V7CA 5HJ2A 2XLCA 4EMSA 4O2AF 3E48A 5KDLA 4WK6A 5T4HA 4B31A 1MJHA 3SFTA 3T35A 4BE7B 4MNTA 1UMBB 3VDRA 3WA6A 1GTJ1 3W8DA 1QG6A 2WUDA 2XSZD 5KAPA 4CFYA 1G8AA 1TF2A 3KLMX 1X3SA 4RL4A 4DA4A 1E89A 2PLRA 3H5NA 3QVGB 4GYKA 3IRUA 4U5QA 3L4BA 2XQVA 2VJNA 4G1CA 2ATIA 2ZIGA 3MPOA 1DZIA 1R0LA 4L7VA 4EA6A 1WZUA 3LM8A 5KQSA 2OD2A 2BGNA 4XUGB 1WCWA 1R7RA 2E9SA 2R3SA 1YD7A 3LKBA 3OU2A 4JIMA 5LZ7A 2I7VA 4P36A 1VLLA 2Y0EA 4R2MA 1ZQ1A 2P1ZA 1Y8CA 3L7YA 5IUNC 1CRWG 3PS9A 3U3KA 3S7TA 4O6VA 1O97C 3CUKA 4YREA 121PA 1Z2PX 3KQVA 4II2A 1QHXA 5EQFA 2OSBA 1E1QD 2ZJ2A 1A98A 1LWOA 2R0QC 5B12A 1CVIA 1VRWA 2DUWA 2RIRA 2VYFA 3P2OA 4Z9YA 3UHPA 1NNSA 3K0FA 3TKAA 2GTIA 4DMMA 3I62A 3JW8A 1NN0A 5H9VA 2D0OB 2E49A 3AHDA 3BTSA 3H1PA 2HDHA 5HF9A 5JLJA 4YH1A 3ANSA 2AYXA 4EHAA 3UT5A 3BMQB 5IZCC 1CJSA 4HDSA 4G2NA 2PJDA 2IKSA 2OXFA 4CKWA 1OUMA 2D1SA 3L6RA 4HP8A 5CX4A 3G1TA 3O3OB 3ZGNA 5HS4A 2CT8A 2IGBA 1Z0AA 2IY7A 4HHEA 4UTPA 1RBYA 4BXOA 2CXQA 2ZDGA 5DNVA 1KXZA 3IVMA 1YAJA 3TW8A 2O0LA 1F3LA 2OKCA 3HA3A 2ZS7A 2PS1A 2FW0A 2W6MA 2AC7A 2EKLA 4JN6B 3H5LA 3AJAA 3VAZA 1Z9BA 4B6PA 2IZ0A 5GTDA 4F06A 4Q12A 1DEXA 2BFEA 3H9QA 4JLSA 2BHLA 2IYVA 2O5RA 2FXVA 2ZRHA 3AB3A 1QBGA 1JG6A 3TOXA 2XCTB 4Q4JB 1H4VB 2PL9A 4JP2A 4N40A 3NBAA 1P3JA 2Y1DA 3ZLTA 1W7AA 4UQPA 4QSHA 4DEXA 4LXHA 2M9MA 2ZUVA 4S3MA 4Q03A 5CPFA 2Q07A 3NBYC 3FYDA 1B8NA 4NJEA 1JYEA 1T5IA 3ZXIA 5HSGA 5I4BA 4ALNA 1FDVA 2QPTA 3AG6A 1Y1LA 4P38A 1TRHA 3EA5A 4HAYA 4N6OA 4WJKB 1GOTA 3VR6H 1W47A 5DPMA 1N5LA 2IEGA 3FN4A 2D62A 4P8RA 4AIIA 1HNNA 3EQ6A 3OT4A 4RVOA 4XVQA 5JY1A 1UFQA 2FN9A 2BJVA 2CCGA 3H13A 4WXRA 2Z04A 4HMPA 4PG8A 3FMPB 2FW9A 2H31A 1BZYA 1UDAA 5J43A 5LIRA 4NK5A 4LXIA 2DWPA 3ITEA 3C85A 3VH1A 3W7VA 4ZT5A 5ITSA 1DV2A 3P5BA 1YTUA 4IKOA 5KS2A 1WA5A 3O8LA 4GM0A 2FLVA 3OICA 4TSFA 1R9MA 2NT4A 1GR0A 2PMFA 3EXIB 2B9VA 3F9CA 3L1UA 1HQYE 2RCNA 2Q4OA 4I5EA 5EMMA 3JAKA 4HAVA 5ERXA 3X1JA 4GM1A 3PLAE 3L4BC 1PDWA 1P1JA 2PE5A 2E82A 1N7HA 1JWAB 3UGTA 1YQXA 4DDUA 1U0EA 4R69A 3WKCA 3JRWA 1NKVA 3C6ZA 4R31A 1B2RA 3NJ8A 4HNUA 5G0SA 4IH9A 1P4AA 1V1JA 2YINC 1DAFA 3WKDA 5FXMA 1WHTB 2FB9A 3E5RA 3GVHA 3WI7A 3BHIA 4NZPA 1JL3A 1K8RA 2O1SA 4MCJA 3RKUA 3R09A 4H6PA 5KNCH 3SX0A 1EUQA 4NV0A 4PZYA 4Q4AB 4LXTA 1GM5A 3GL9A 3ZD7A 2B37A 5JR3A 5FORA 4PYOA 4PIMA 3SSAA 1AZLA 1R0BA 3KQWA 4EDHA 3FE2A 3HCEA 2B8NA 4KQIA 3KT8A 4MB6A 5JSQA 3VSCA 3TQQA 1D0IA 3I01M 3ON5A 3IFSA 1AJEA 2FQQA 1S8FA 3C0KA 4EITA 3EVDA 3MBKA 2XTAA 3KZKA 1ZNQO 4F45A 3GCWA 2CWDA 2CFSA 3I1YA 1LSUA 4BP1A 2D3WA 4MVYA 4FT4A 1O5OA 1WB6A 3A3PA 3A8TA 3VR3A 5JS1A 3JYQA 3T7IA 2JH3A 4AYWA 1XIVA 3LVRE 3A2KA 2QYHA 2B9EA 4I6EA 3T7SA 4GUDA 3F1LA 3FTQA 1P80A 3GP3A 4B4UA 3R9IA 4HUTA 1MFZA 3P27A 2QN6A 5BWCA 1UT8A 1QK5A 1W1UA 5J5CA 1KFEB 4P92A 1JHYA 4DNQA 2PX3A 3D5TA 3EOBI 4ALKA 221PA 1LPOA 4ZA2A 4NYIR 4IGEA 3PHLA 1Z5NA 5ESWA 5IW8A 1KFCB 1PD0A 1O5TA 2ZSHA 3P9SA 4TTRA 1FJGB 1IQ0A 4DBLC 4J1QA 4J94A 3PFWO 1NWHA 4M9ZA 4FFWA 2WSSD 3FPFA 1ISSA 4OGFA 4ZO6A 1SC6A 2GN6A 4HGRA 2IYRA 3VH4A 4PRYA 2FN4A 2XB9A 3HCNA 3MS2A 3RI3A 4N0MA 4V2UA 4R9RA 1JQ3A 3DMNA 4I1YA 5COQA 3RC7A 3IILA 4JJ4A 4LXQA 4B76A 4K6FA 1M7GA 1W48A 3EEIA 1LB1B 3NKFA 2OQRA 2XMZA 4ZJZA 3OPYA 1WE2A 5FFMA 3VQTA 3K0BA 2YWFA 2GKGA 5T41A 3I52A 2MR6A 1X92A 1ACJA 1BA2A 2QRUA 3C4VA 2BM1A 3FYSA 4JXJA 4YRKA 4TV9F 8MHTA 5L9AA 4CU2A 1TB4A 2J45A 4W63A 3PPIA 5AQEA 5KO2A 1Z8NA 1VI5A 3Q2OA 4M99A 3PPXA 4WY2A 5CIWA 3KXIA 4MIEA 3TTUA 5A4MS 2ZJ8A 3OU6A 2QG9A 2R44A 4K9DA 3BH6A 3THXA 3EMKA 1P1FA 1DAOA 1G7SA 2QPOA 3HDQA 2X8JA 2V97A 2D5BA 2HMYB 4GPEA 4IVPA 4NFYA 5E1DA 3S40A 4ALJA 1D6NA 2JLWA 1OVGA 10MHA 4IL5A 5DH9A 3AUUA 1E1LA 2NUBA 3ORRA 4O1HA 3SGLA 1JXAA 3CX8A 2FFHA 3B85A 1ZCAA 4AL4A 1KY2A 1Z7EA 2IEBA 1SXIA 2QW0X 3NXKA 1KE1A 2X0RA 3VX3A 4TKUB 4XB1A 4ER5A 3GLRA 3TW0A 1P18A 1ITZA 4FYMA 3D4NA 3RASA 1SHTX 3CM0A 3P9RA 3ZQUA 4Q4CA 2J0QA 3WHLA 4G5SA 2XF2A 3I72A 3DTVA 2GHIA 1KI2A 3PC7A 4FI3C 4ZO9A 4HPJB 1GILA 1CNFA 1J25A 4Q66C 2G5PA 2O2XA 3DEZA 2AN5A 1ZIXA 1D1SA 5EHGA 4M86A 1YOBA 1KWGA 5I8ZA 1EG2A 4GOJA 3LUGA 2DERA 3UW3A 1NF2A 1GTMA 3F46A 4RHUA 5LQAA 4F84A 3ROPA 1ANKA 1MEOA 5M29A 2IXAA 2R1TA 1UXIA 1K06A 2VXBA 4KX5A 1XZNA 3FCYA 4MJ3A 2Q5CA 1MTZA 4ZQCB 3EDCA 4C0BA 2IP4A 4KHZA 4MWEA 1GNSA 2WHPA 3TVYA 4DHEA 4FLMA 1T36B 5BN1A 2WYUA 3OM1A 3RKRA 1SVIA 5JEDA 2Q29A 5A5FA 3TMYA 4IILA 3PJFA 4TS3A 2X58A 3ML1A 1H5UA 2WLSA 1MENA 1S3SA 2PGOA 4XE5A 1IB0A 2JBAB 2FOLA 1DSSG 2XB8A 3D7KA 4I66A 4TN5A 2GZ2A 5LA6A 4CWAA 4F3NA 3GAFA 4HWOA 4DIFA 3T38A 2IIQA 1ISJA 2OZLA 4A6PA 5BSVA 2X9QA 2IS6A 1LDNA 1FMTA 1Q77A 2PFKA 4L8YA 2QD5A 3H9GA 3LMKA 4QUEA 1KMCA 2VWHA 5EMHA 1ULUA 1QF7A 1JVNA 4WESA 5J3JA 1YONA 1C3VA 2A7XA 2P5SA 3NRBA 2GDJA 2W4IA 2AI2A 4RGBA 3DD1A 2GJSA 2X9LA 2ZRGA 3BRWD 5CLIA 1P1CA 2B8WA 3I42A 4X7MA 3RNOA 3TDNA 2IQ5A 1IDOA 3NYQA 2HMTA 2REQB 3FDJA 3L7JA 5EKTA 2V3WA 1AD2A 2BVNA 4FFVA 4H7JA 4BNZA 4MUXA 1OR8A 5BW5A 1CBUA 4R9NA 4XQ9A 1BEUB 3ZHBA 4DIMA 4LPKA 1PF7E 4DQKA 3MS7A 3QMVA 3WGGA 2O8CA 2YJGA 3DE1X 4MK4A 2GMWA 2FP3A 5FTNA 3UV7A 1IIRA 2OOSA 1FTYA 1TE2A 1TK3A 1XZAA 1PJRA 3QBJA 4R0NA 4RMHA 3VKUA 4AJHA 1T5BA 1XVTA 3G2QA 4F9GA 3B89A 3HA7A 1P7CA 3OIYA 4RMGA 5CH5A 4BJ6A 3FSEA 1CQIB 1SD1A 5DSXA 3SJUA 3CVVA 1T4DA 1KORA 3CE9A 1FLAA 3GARA 4CT5A 4IHQA 4XARA 3CX7A 4Z6KA 4C14A 2IU0A 3BWBA 2Y1KA 4DMGA 1GG8A 3EY9A 4O4JB 4QUAA 3NT4A 3LBIA 4XYBA 1LZKA 2TMGA 4M8SA 2P6OA 2VRCD 4G5YA 2H29A 3HUTA 1LPBB 1RKVA 3TVDA 3WO0A 1FMFA 3TZQA 1Y7PA 4K88A 1NZFA 5TGZA 5JJLA 2B6NA 2O7RA 3FWPA 2GBPA 5AIBA 2OT3B 1XL1A 4TLMB 1NKTA 5LBIA 1QFZA 1Y6ZA 5IBCA 5DM70 4EUNA 1H9AA 2BDUA 2BGJA 1Q2UA 4UOZA 2E87A 4PU0A 5K5EA 3DE5X 4QVIA 5T6BA 4U7DA 4W8OA 4DMCA 3KTAB 1IN7A 2NTNA 4YAIA 3VR5D 3MINB 2CF6A 2GD0A 3ETJA 4HFJA 1IRIA 1U81A 1T1GA 1XZ8A 2F17A 1ZK4A 2I4RA 3QMWA 2PUBA 4U6QA 2IYEA 2DTDA 3QA9A 4Y1EA 1L5QA 2P6NA 3FR8A 5JTTA 1E1KA 2Q9AA 3LVBA 2HU5A 3CUYA 1EQAA 1GA1A 2XKBA 2YXLA 4J0KA 3QWAA 4MICA 1DJQA 4YJ3F 4HXFB 2FMKA 3OLYA 2VLBA 4HJRA 2ZTHA 4KAAA 5EIBC 5JSYA 2I62A 2Q0XA 3MTDA 2FKNA 3WRYA 5L3SB 5JC8A 5LKAA 1NJ5A 3VC3A 4NYJR 1QG4A 2X76A 1LLQA 1PT8A 3QVVA 4NECA 1BCRA 4N03A 4ZQHA 3NUZA 5H8WA 2WLTA 3K6SB 3M2PA 4MQFA 1T9ZA 4A91A 4TYWA 1BAPA 3KFVA 2BN4A 2XQIA 1Q74A 3DDOA 2OBXA 3INGA 4I3FA 3VYWA 1PE0A 3KQKA 3AUTA 1XRNA 4NBLA 1SH7A 4LXXA 1E2LA 3AVWA 4BN4A 3MT7A 1FTSA 5J4HA 3K1AB 4QDXA 4UCXA 1YR2A 5HILA 2VNHA 2Y77A 4DM4A 4AY6A 4G25A 1I6MA 2CD9A 3ILSA 2IUUA 1VIYA 1SQ0A 1Y9ZA 2W00A 5JAIA 4RWEA 3ERCA 4UUQA 2Z56A 4Q9IA 3WSTA 2H9AA 3T0GA 2JJMA 3FNHA 2ECQA 3BTVA 4LRYA 4ACAA 1LNZA 1Q3KA 1IHOA 1IBMB 3IULA 2OEPA 3AHEA 3S44A 3PPYA 3I09A 3E7WA 1QG2A 1IONA 3HA2A 2H4JA 4TTQA 3S70A 4NK4A 2ZITA 3AWIA 4CLRA 3KO8A 1H93A 1UFOA 3TQOA 2RGDA 4QUBA 3NFYA 3QKWA 1Q57A 3G82C 3KWJA 3NKVA 4N6NA 2YDYA 1BS2A 1Y3CE 5AVTA 5KMGA 3HXMA 1YZNA 1PFUA 2FWRA 2IZ6A 3LCVB 1U9JA 1CQJA 4QC2A 4EZEA 1H2EA 2HV8A 3BE5A 3WYGA 2G06A 1LLUA 4QYIA 1G3MA 1DQZA 4EG1A 1HXHA 1ZH8A 3FIJA 2J09A 1Q44A 5LXTB 1CUVA 3CMMA 5CA0A 2WD7A 3LBYA 4FJ0A 6Q21A 5KB3A 3QJYA 5EE5B 1YGPA 4M55A 5I7SA 4WKBA 3KKLA 4C4PA 2AXEA 1YJQA 1RQGA 1H8HA 1ZGAA 1X38A 1FDSA 2W93A 4P5DA 4F04A 4JB0A 2VHQA 4YMLA 2VJQA 2VTEA 1Q50A 1XCPA 2I29A 4GGOA 3MIIA 4PEVA 3GPDG 4Q3BA 3FRJA 3WK5A 3C3XA 1I4TD 3DEAA 3ETDA 1IXZA 1RPAA 3U3ZA 1QPZA 3TQTA 2DPGA 3V33A 2MCFA 3WLRA 1SBZA 3L7KA 5AW7A 4A9AA 5DBGA 2Y1FA 1DG9A 3MHPA 1FUIA 4LQLA 2OYRA 3Q7QA 4NEQA 4JJGA 2QN2A 3DT8A 4OOEA 4CKCB 4O63O 5JHHB 3TF5A 2PMKA 1XAIA 3T6KA 1UJ6A 3WMEA 3SHOA 3OEED 1UBJS 2ZVDA 1M34E 4WXYB 1GAEO 2UZ1B 3VYUB 3L6OO 2ZBPA 3DKKA 3ABRB 3WE7A 3TX6A 1QDLB 3O9ZA 1QIIA 3V8MA 3X2SA 2XZTA 5AK4A 1WB9A 2WJWA 3RC8A 3WRYC 1IDN1 1K0UA 3ZK8A 4FWTA 4JT4A 3L18A 4YRIA 3A4YA 3QFFA 4YEDA 2KI5A 4FC7A 4FXOA 3PD7A 4QFMA 1A9TA 1LH0A 5FBRB 3ZXXA 3T9DA 4PHGA 1GUYA 4KUEA 1OCEA 4E3ZA 1HE5A 1X1SA 1BHJA 1GP2A 4N8SA 4XQCA 4O2BA 4RTMA 2TS1A 2D0DA 4R1QA 3GLUA 4RK7A 3CX6A 3NALA 1P4SA 4GKBA 4LY0A 4QVKA 4X44A 1VA5A 3OFSA 1UH5A 4GX0A 5LD2C 2HXSA 5FOVA 5EUMA 1MJFA 4BDTA 3OMXA 1QGDA 2H8KA 4R2IA 3WQRA 1QGYA 1U6IA 2BEVB 3DF9A 3QX9A 1C3OB 5HFAA 3OQIB 4P5PA 5I9LA 5AVOA 1HTBA 1JI3A 1UJNA 3I30X 1KTVA 2DP4E 1VIDA 3BDVA 4PGHA 5G3ZA 5J4LA 2BTOA 5GIOE 1Z38A 2C2OA 3I83A 1TAGA 4BAZA 1JPJA 4W1RA 1OH8A 1N1MA 1FFXA 5JS8A 4I2VA 4PYQA 1KEEB 1M2NA 4HBZA 1IYZA 3AUAA 5B1YA 1OFVA 2GZSA 3O92A 2BBWA 1YFLA 1C1YA 1IEVA 4YQZA 2PD6A 1ZA1A 4XPIA 3K16A 3W6ZA 2H00A 3CT4A 4ALLA 5HHTA 3OZWA 1I32A 4IH4A 4DR6B 2QTNA 3IEKA 1S6YA 2ZRCA 2EWMA 4LV6A 4X1IB 5HKLA 3DLHA 4A0GA 4OD0A 1FNMA 5DLPA 2HMAA 1YS7A 4OQNA 1FP4A 3L0OA 3KUUA 5ALTA 3D9QX 5LB2A 4DR2B 1XZQA 3GVXA 3LOQA 2PMEA 3LLVA 2HQ1A 2FFRA 1WX1A 3MWJA 4EO9A 4CE6A 2QUAA 1YB1A 1W87A 4OSPA 1LQTA 4FQ5A 4K9OA 1UF9A 1FUYB 3GMIA 3HI6A 4LY3A 4B3SB 4NAHA 2HGZA 2P1RA 4XB2A 4GZMA 4U2KA 4U7GA 4ZVLA 2V7WA 2I2WA 3K9QO 1KQGA 2BM8A 4IDQA 4EENA 2QX6A 3FPHA 4FOSA 1Z06A 4H9GA 1N6KA 2B35A 4G24A 3CONA 4MKRA 1HLDA 5KC9A 2JASA 5EJ8A 2JKYA 2JIPA 4GWKA 4FR2A 1X80B 4JWTA 4KK3A 1O1YA 2WQZA 1YA4A 2Z4TA 4HWTA 1ZOIA 2V4UA 3DWGA 4RNDB 3VVMA 4BZWA 3EMBA 3R3SA 4R6XA 2DR3A 4LRTB 1FPMA 3E53A 5DGCA 2G25A 3VOSA 2VDWA 1GQSA 1C4OA 4HNRA 3PGKA 4NG5A 2FHPA 2AEFA 2PWZA 4HDRA 4KH1A 1EVYA 1P0MA 2IA5A 3HWSA 3KLOA 3INRA 3QUBA 4WADA 3RIEA 4C7KA 2PSHA 4FPXA 1JKXA 1QDEA 1QO0A 2FQ1A 2X3UA 3USES 3S8YA 3U7GA 2Z0MA 1GKUB 4HGNA 2JANA 5E2IA 1LS1A 2IF0A 2JLBA 1XROA 5AK5A 3CBQA 3JWPA 3HBAA 3TUIC 5JSUA 4Z5XA 3WYCA 3I37X 1UPUA 1EP2B 3GNTA 4MUBA 4WASA 2GXQA 1Y6FA 2EBWA 4NJMA 4FHGA 4D8WA 3P7MA 4TMYA 4HLCA 2AG8A 4NU8X 4OJQA 1YF3A 3HJAA 2HU2A 1KQOA 2JCYA 3EZFA 5GONB 5ITVA 4QBGB 2QL5A 3Q3VA 3DVRX 3E5MA 2J9YB 3NHKA 3SVLA 3K9NA 3RSQA 3AU8A 4M0DA 4X24A 5IMBA 3HM2A 3W7AA 5FDFA 1KZ6A 5A5EA 4BTEA 2Z58A 3KK0A 3EIFA 3N0VA 5EHXA 2EX4A 3HDJA 3ONDA 1ATZA 1ESDA 1PQUA 1QONA 1RYFA 4KNVA 4MIOA 2CMGA 2FEAA 4PHCA 3WBJA 1CF9A 3DBHB 4CHGA 3ER6A 2H2HA 3HCCA 4S2UA 4AY4A 1R4AA 2H11A 1UL1X 2D5AA 2MSCB 1W4BA 2NSYA 2Q6KA 2XYQA 4LFAB 3O4JA 1BN7A 1CV2A 4JBYA 4U2EA 3WMFA 3C70A 4M36A 3LUCA 3GFTA 3ZE2B 3BJMA 4HDNB 2O52A 3KT6A 2NPIA 3UATA 4ZZ1A 4CQLB 4MVJI 5EJ9A 1QFYA 1MC1A 2XY4A 1WG8A 2ASVA 4LN1A 4EGSA 1WWKA 1E1CB 1YBMA 3BFXA 3IR7A 4IEFB 4XGKA 3MJFA 1E2FA 1ECPA 3RJ9A 2PRZA 1EMDA 2O48X 2QYTA 1G63A 4YASA 4XVCA 3BMXA 3QUCA 4EHNA 2DJIA 3ZHOA 1EE2A 2BY4A 3SU8A 4QT4A 2LD4A 2Y9MB 2XMBA 1E9BA 1NVVR 4XSGA 3VPBA 4BO2A 1G9SA 1NUPA 2GK6A 3EG9B 2QUKA 4N3BA 5L45A 4XX0B 3LLCA 1G8SA 3R75A 1HLFA 1ZK3A 1DVRA 3C74A 1RXWA 1Q22A 1RD4A 1D8AA 1EWYA 1G21E 3MCVA 3MXOA 1UDBA 2AG6A 2Y0CA 4IIEA 3KJNA 4YFYA 1KI9A 2E4AA 2OCPA 3IPXA 5AJTA 3V4FA 4R1TA 1BXGA 2XVZA 3LL7A 3HLTA 4EX6A 1M0EA 1MGPA 4MPJA 1JDVA 2EW8A 4B83A 5LN1A 5B6PA 1TO6A 3BJIC 2Q41A 4KLAA 4LUCA 5K8CA 2JATA 1XGKA 4IMRA 4RZIA 2AFIA 4D8UA 2PLNA 4RO0A 1ABBA 2B6HA 4E14A 3E81A 3IMCA 3PC8A 3KZMA 5TR9A 3JD0A 2HXGA 2DBVO 4OXRA 1JSRA 4BNLA 1ZJ4A 1U8FO 5E9JA 4TOIA 1FYXA 2OV4A 3KV3O 2W2KB 3DMDA 4ZMRA 3AI7A 1PX0A 3RADC 3U17A 3CUTA 1NXXA 3A11A 3F7MA 3IAXA 4L6CA 2O5VA 5DW3A 4ZT6A 5LC1A 4AN4A 4F2GA 4JLBA 4DLSA 1I24A 3AM3A 3SZGA 4WBNA 4KR7A 4K1XA 3PUZA 5TY0A 1ZRMA 1FRFS 1A88A 1W46A 3JYNA 1UT5A 1QH1B 4MULA 2DPMA 4D43A 2AB0A 4JBWA 5K0EA 5REQA 4CM9D 2BFDB 3IAAA 3QOXA 1JW9B 2BHRA 5JXWA 1QIEA 3HSYA 3AP2A 2GA9A 4JA2A 1R37A 2ZIZA 5KYTA 4CF5A 3PFNA 5LSAA 5LQRA 4E2WA 1V2HE 1IY2A 1FU8A 1L1RA 4PLHA 1UC4B 1OIVA 3H2KA 5DX8A 3WLPA 2W2LA 1LJ8A 2PDAA 2X8WA 3CNEA 3I04A 3AZPA 4DMLA 3VPFA 2ZWAA 3LGAA 4QODA 3VC7A 3NDIA 4DREA 6REQB 5GZ3A 2G9NA 3G7UA 4HB3A 3U4AA 4ITUA 3VR2D 3ZDAA 1T8YA 5I51A 3THWB 2JRLA 2NU6B 3G9ZA 1XN1A 3P9YA 1PDOA 3AYZB 3RJTA 2WKRA 2O3QA 1O96A 2HC9A 5IJWA 1FFYA 1SCKA 3BQNB 3UWSA 5I3ZA 1T2VA 1IAVA 2B94A 5FOWA 3ZU5A 3IO5A 1IHPA 1X7HA 1XDZA 2PYDA 5JJIA 4BBZA 1VYUA 4LMPA 3GLFA 3OZVA 4PX5A 2G40A 3W5UA 4QYSA 3CZPA 1YZFA 2C3OA 4FMCB 1AUOA 4R7TA 2O6HA 5BT9A 3M89A 3WTBA 3ZGLA 2D7DA 4N12A 5EKUA 2CFRA 5KNDA 3B82A 3V7WA 2ADMA 3ZVRA 3C6YA 3OX3A 5B36A 1Z62A 3G2KA 5AW0A 4CG0A 1VFNA 2QTVA 3KEQA 1P4GA 1TZCA 3C3DA 5EFZA 5DM0A 3D6TB 3I01A 4ZT7A 3EXHA 3N5KA 1XYYA 3QFCA 2WFZA 5CH8A 4BMSA 1M1UA 4EF6A 3EIQA 1T8SA 4C6SA 3FDZA 4DV2B 5BQXA 1PVVA 4K6GA 4UJ5A 1TA9A 5HE9A 3FGZA 1E9EA 2CBGA 3R9XB 2E7ZA 2H17A 4TWAA 3NYIA 2H1HA 4DDHA 4MDEA 1RADA 1STOA 1U3UA 3ROTA 4D8XA 4D9GA 4W7IA 4A6EA 5D3ZA 3G8DA 5JSFA 1Z0KA 2XTMA 4B4VA 3U81A 1ULTA 1NP7A 3IA2A 1ORVA 2ZJ6A 4BWYA 4YCCA 4PSUA 2OFWA 2APJA 2WTEA 3WLNA 5LZ4A 4E12A 2C03A 5IFKA 5FPYA 4ON9A 1HNXB 3H19A 2VHYA 3HY3A 4FILA 2OG2A 4FUQA 4JFAA 4V0QA 1PKXA 2UVPB 3NO4A 3JVVA 1Y1KE 2ZYWX 3EUWA 3C8ZA 5JLAA 3R7BA 2ICAA 2JZOA 1C2YA 3FHLA 2XRYA 2GN0A 3E9EA 3PC8C 4O4IA 4UE3S 4AXXA 4CTOA 4LZOA 1V8BA 5F78A 4AVYA 1NN5A 4GD3Q 1VE6A 3FUXA 2RKWA 4HNAA 4I1PA 3QI2A 1RS0A 2EJBA 2JAPA 4A0SA 1Z2AA 1PI3A 1PP4A 2CUZA 4QPJC 2CGEA 3QBDA 1E2MA 1N75A 2I65A 1EE1A 1BGXT 1I7NA 4ND8A 2OZPA 4AP6A 5C32A 2YTZA 1WHSA 5BR8B 5K0TA 3RLFA 3CZMA 3ZWOA 4RPIA 2NTYC 5FPTA 4BMNA 3PGLA 1SVKA 1VHWA 1Y8AA 2D5LA 1WMFA 4BNDB 3VXKA 5DHAA 1MVLA 4DLNA 1E64A 1YRYE 2H18A 1SEVA 4P7FA 1GA4A 3AHFA 2NQTA 4MA0A 3WZMA 1AK1A 3HO1A 2WTNA 4EHLA 3DCYA 5EPOA 2HF7A 1JIQA 1QC5A 2WNSA 3ITKA 5JYEA 3G7NA 1O7JA 1WM1A 4AWAA 1I0ZA 2ZRQA 2GTHA 3D3JA 4EUEA 4MDYA 2LIVA 2B3DA 3EUAA 4NHEA 2R8YA 1WPQA 3RF7A 3D4PA 4HS4A 1E7YA 3OCUA 4E11A 5B1SA 4KN9S 1D6SA 3T9AA 5JADA 3W3AA 4LRQA 4MUJA 4XQ0A 5JH7B 4QQKA 3ZBUA 3AL0C 5JPDA 4PQGA 1IPFA 4BYGA 3U3RA 3M4NA 1YJXA 3K8QA 4CDGA 3FVTA 3PHGA 1D8TA 1GCUA 2V6BA 4DV5B 2BIFA 2FUNB 1PW7A 1EGVB 2IXTA 2HPVA 4KFSA 1WW2A 5AVXA 3E82A 1LLFA 3IPRA 4KPFC 2HIAA 3GLGE 5AXAA 3M6AA 3HWRA 3OTGA 2GJ4A 4KN8A 3KZCA 1YR7A 1H0HA 1JH8A 4MMYB 4L4SA 4B4WA 2NWQA 3DJFA 1SUAA 4BE4A 5DN6D 5ILOA 5BORA 3IVXA 1KAQA 4ITRC 4RSGA 4G65A 3EXHC 1WBJB 2VHUA 3R7WB 5JCXA 5E6SB 3QEKA 3R2JA 4UAUA 1GFWA 2AFHB 2XQJA 1BE8A 3O73A 3A4VA 3PI7A 2XKAA 3D0RA 3I9NA 2LIPA 4HNVA 4ZP1A 3C8UA 5BV0A 3V6LA 3ZBTA 3V8BA 3ROZA 4Y2JA 7REQA 2DPXA 4IDEA 1KBOA 3HVIA 4W99A 5KINB 1T8WA 1E0SA 3DYBA 2G9UA 2NO4A 2V8OA 3RRNA 2JJ2A 3F5SA 4KDCA 3VJRA 4DV0B 3PCRB 2P65A 3EXFA 5DCWA 1GG5A 5B3AA 1R0YA 2PBRA 1ODSA 3FB4A 1SKYE 1NDHA 2C98A 2V03A 4EECA 3CRRA 3TSWA 1DEAA 2VDQB 1IJEA 1M0SA 3F6RA 5LM3A 5LWQA 3M6MD 1A9QA 3L49A 4CVNA 3GVPA 1E8MA 3OT1A 4G09A 2IYXA 1D2AA 3FMIA 1ZRNA 5TJ9A 5CXQA 1QHEA 1A7KA 2EP5A 1VPLA 2QRMA 3V00A 1Q1BA 1LY1A 1UMCB 1P1RA 4MZXA 1GZVA 4JVMA 3UEOA 1U8EA 1NP3A 3AEQB 4D2IA 4QTYA 3RG2A 3ABOB 2CVOA 3O8RA 2O0JA 3CKKA 4QDUA 4YONB 4KGVA 4LSMA 3C4QA 3DUWA 4ZOLF 2CHVA 2F48A 2PVPA 3U40A 5AM3A 1TQHA 3ZVMA 1T0UA 1S2NA 2VJDA 4C03A 1HUQA 2DB3A 5A9TA 3S0JA 5JI3E 3KDPA 4L27A 3QHAA 2PX0A 4ZYZA 2G6BA 4RETA 4NARA 3ZZUA 4Q3AA 1LRLA 1E8NA 2BE9A 1BWQA 1KI1A 2XQKA 4F1KA 4F3CA 2AKYA 1PR1A 4OX9B 3RYHB 1XZHA 4D9IA 3V8EA 1L5YA 1GRRA 3DZDA 3R0VA 3V4PB 5HPYB 5I3CA 3L8FA 2FMFA 4QDOA 3EC1A 4UMEA 4TQ9A 1KWKA 1CJCA 1K7CA 3D02A 3LV8A 5DM4A 5FV7A 3UCEA 2EGUA 2OWEA 3JQ8A 3K53A 3FMVA 3OCYA 3MAGA 3NAZA 4U2BA 3S81A 2ANBA 2JC3A 3IAEA 4FEYA 4EB6B 3SLRA 4P4SA 1PAUA 4QOEA 1I3OA 3S5UA 3WGZA 1MORA 2Z2JA 2V7EA 1SVMA 1N1GA 1HA3A 1MW9X 1S01A 3VR5A 1KJZA 5KOHA 3ZI4A 1J6UA 2YXBA 1AG9A 1M3SA 5EERA 3R3JA 5C0OE 2JLZA 4GPZA 4JXXA 2ZUWA 4ZKEA 5EIXA 1KEZA 4ARZB 2QUJA 3H8VA 3B7WA 3T4XA 4R98A 1AXGA 5DTJA 4CV3A 1AMOA 4D8VA 1M66A 1Z4OA 3LY9A 4MGKR 4GT1A 2L18A 4N5DA 4Y0NA 3R7SA 2WT9A 4ZDIA 4KWHA 3QWIA 4PHHA 2P6UA 1JHVA 1EJBA 1JYFA 2CJYA 2EXXA 2QY6A 2YWBA 3U4IA 4I50F 4IXMA 3J81A 1A9PA 5JRZA 1UJBA 1HG1A 2CUTA 3LHDA 3UVEA 1WDMA 3EQZA 1N2CE 2X6TA 3DBOB 5GJWC 4YQEA 4RLQA 1BC5A 3T1TA 5JS7A 3MTQA 4FFBA 4XSHA 1JHAA 1GAXA 3Q7IA 5BPFA 4WL0A 1MEEA 1NC3A 3H2JA 3KZVA 4G9GA 1SC4A 2OPHA 4Y6GB 3VU9B 3E5HA 3WDKA 1MAVA 2I3DA 4OOFA 4TTVA 3PTAA 1VLMA 1E2DA 4XWTA 3SM3A 1X1RA 1H6AA 3DEKA 3OJEA 3W2EA 4FNGA 4WZ6A 1KJ9A 4QBIA 1IUOA 1S4MA 2QZ9A 2ZAOA 5I8PA 1V43A 3CZRA 3O84A 3DT9A 3F3YA 4WERA 4L5AA 3QVUA 4DWJA 1T8TA 3DTTA 3NTUA 5E6RA 3S2FA 5BMVB 4N3CA 4HQFA 1L5OA 4RY2A 3ZHRA 1T0IA 1ZD5A 1X7GA 2R7AA 3M1YA 3OI7A 4KO1S 2VDRB 4N0QA 5BR4A 1XYVA 3GI1A 1UWVA 3PQ4A 3M6VA 3KU4A 1ULZA 4UMFA 3KB8A 4F91B 1UFRA 2FJUA 4GOKA 4H0CA 4OYYA 4Q24A 3RAGA 3WRWA 3EXEB 2CSUA 5CFNA 1J70A 3IJPA 4J7AA 4PZZA 5HCNA 3NOXA 3CIFA 1E79D 5BWOA 2XMPA 4RFSA 1XZIA 3BL8A 1A9YA 1NQVA 5TGTA 1ZESA 3NWBA 1Z26A 4R4JA 4QBTA 5H3CA 2YFQA 3SIPA 2CNNA 1Q0SA 3ELBA 1EK2A 2P90A 3AM1A 3QF4B 4IHJA 1TQ2A 4TROA 5DSTA 3WGMA 2V9CA 3M5PA 3OOWA 4QQRA 4UDYX 4RL6A 3GJTA 3AJ9A 4PLYA 4L3OA 4KLRA 4HFNA 3C7DB 4V3BA 2FX3A 2G09A 5FULA 1OI7A 4LJ5A 1AZSC 3ENZA 3ND7A 1AQYA 5ALPA 5FLYA 5TMPA 2Z43A 3TPZA 3LZ6A 4PSCA 1XRPA 4Z7QB 4RTKA 1WZIA 2DUJA 2YYSA 3QA3E 1ZI9A 3QWHA 4U6SA 5G0WA 4BN0A 1HOTA 2HFKA 2CJFA 3Q40A 3JYOA 2ZKLA 4WV3A 4NPHA 3PL1A 3WJ7A 3EA4A 3GVIA 3B9BA 1LDBA 3ZJ5A 1HZZA 1E7WA 2DHRA 4GSKA 1NV9A 1V95A 1DHTA 4TZ0A 1PL8A 3H17A 2GK3A 2ZULA 1QIFA 8OHMA 1JR6A 2WE7A 3KXPA 1LC3A 3T54A 3L1VA 4JGIA 1W4CA 2Y4OA 3HSKA 3V9AA 3I0MA 2VJMB 4HI0E 2NNWB 4A8HA 5KUTA 1PV2A 2QLLA 2BPOA 3FMFA 1LZLA 1JE0A 1JFFA 4B6RA 4BN5A 4ENUA 1QE5A 1QNLA 4MP3A 3JQAA 3SDZA 3ENQA 2P79A 4H4CA 4RD3A 2FA9A 2C0PA 2DECA 2ILTA 1CC1S 1Z4PX 4MVJD 5E6UB 3GY0A 5H83A 2OBLA 3ZD9A 1UUFA 5C51B 1IHUA 4HQ0A 3WGLA 2D00A 3R40A 1YZVA 1F0NA 3H1AA 1U5BB 4L4RA 4A6DA 3B78A 1UXOA 5JROA 5CHEA 1HH4A 4MA4A 1FZTA 3PUJA 1FXUA 5TEVA 2QGZA 2VYVA 5J1TB 1RYBA 4DB2A 1U1EA 3G0CA 3WY9A 4KIGA 3N2YA 4CYMA 1UKYA 2XHZA 4C76A 1J9EA 1S8NA 1CTQA 3C7CB 3LNTA 5K0CA 4B75A 1A9XA 4D92A 3TYXA 1GNVA 3JYPA 3WBBA 4HDKA 1SCNE 1L4FA 2GRJA 3F73A 1E3DA 1FSZA 1RZUA 3ABSB 1SZPA 2AYYA 3W5VA 1SWWA 2RHRA 3ZV6A 2EG5A 3BSYA 3IBTA 1A76A 2DFVA 1W76A 4O2AA 2QD3A 1XYGA 1YRLA 3WGYA 4BLTA 3CH7A 5JQWA 4YUWA 1CRPA 2GGSA 4D96A 2QD2A 5I7EA 3FPKA 2IIPA 3GT0A 5IKMA 2P2GA 4M9UA 2ZRMA 4PXAA 2QGFA 2GR9A 4HTFB 2O8EA 4IHAA 5SY4A 1GPKA 2VZ8A 3VNAA 2HRRA 2J5BA 4IICA 3TQFA 3ZE0B 5AVSA 1E0DA 2DTEA 2O9JA 1PFGA 1WB4A 4PCLA 4P6VF 1OHHD 4YQYA 2Q0HA 2TECE 3NVDA 1F3OA 2QXTA 3G2HA 1JDZA 1AF7A 1PV1A 1NOIA 1YZYA 5HF8A 1IZ9A 3TRDA 1YMQA 2W2PA 5IC6A 3VPAA 5JCZA 3FZYA 1VTKA 4TTJA 2R60A 3I6QA 1V3VA 4US0R 4Y1FA 1X6VA 2F1IA 5B55A 2JFPA 2RGWA 3DXXA 3PNYA 1BYUA 2IJGX 4EW1A 3ZJVA 4LF8B 2GWHA 3ENWA 2OLEA 5A4JA 2ISQA 3KZNA 1G8JA 1H9BA 3HN6A 5HQ3A 1C0EA 3HKDA 2F59A 4L73A 4L6IA 4CQMB 3W6NA 3PRKE 3BORA 1F7UA 5IF3A 2QN7A 1WXDA 4FBGA 3OD1A 2VDUE 1X8JA 1YQUA 3ZV7A 2PUTA 1YHZA 1SIUA 2C2MA 2H6EA 3LHFA 1ZK2A 3T8YA 4UU7A 5IDXA 1NBHA 1YR6A 5KHLB 5EGNA 1R9JA 1I4DD 2JIMA 2WG0A 3L05A 4QO7A 3H6KA 3WLKX 1BJKA 4JI4B 3R0JA 3N59A 1DUIA 1ZXLA 4FE3A 4C4SA 2IH4A 5HF5A 4PG7A 3KLPX 1SIOA 3AQIA 4QARA 3KBBA 1DBVO 4B84A 1QE3A 3PNVA 4F4FA 3ZOKA 1EAYA 1JMKC 5AM4A 4DRXA 9GPBA 2PA0A 1LV7A 2J30A 4RSRA 4TXJA 4GXNA 1JAYA 2GUWA 3OPNA 5IJ9A 5C7OO 4DG5A 2V8BA 3WWZA 4X85A 2X13A 2C4TA 2A3RA 2J6IA 4URFA 2BGWA 4OLHA 1CE8B 1E1YA 3ZJYA 1L8AA 5C7LO 2VFAA 4EI9A 1J56A 2GERA 2ISSD 4Q39A 5LFAA 3OE5A 1PJ2A 2ZIXA 2IW3A 1UPXA 2O14A 3DMFA 4XA8A 5J2UB 5J2TA 3CF0A 3MXTA 5BSUA 2QTHA 2WV9A 5FYQA 3LHKA 2GSDA 5BSEA 1Q0TA 2QF7A 4G23A 4ZODA 5EP4A 2IYLD 1GZ4A 4CMAA 5GVRA 1P72A 1SBHA 1Y98A 2DQ4A 2FPXA 3VZQA 5A3SA 1T0JB 1G6OA 1YA6A 3K0CA 1PZMA 4L07A 5C8YB 2A9OA 4YRDA 3ECSA 4FBLA 3CIOA 1I0IA 1M8KA 1QZZA 2GKOA 2PTGA 4I1SA 3VPSA 4J07A 2XCSB 1PJ3A 3D2CA 1Z37A 2HR1A 5ICEA 2PUGA 2H51A 1AUVA 1TC2A 4C3OB 4L74A 2Q1XA 3QOWA 1VL8A 4IGAA 2DFNA 5BN4A 1YWGO 5E4TA 1F17A 2WAAA 5C8XA 4GZLA 3JD1A 5YASA 3A1TA 4EFDA 2X9NA 2DUMA 3L8ZA 4N5LA 3RTBA 5DNAA 1SZCA 1VE1A 3KKMA 4E31A 2J3EA 2WQ7A 3UWDA 4QOHA 1NMSA 2W11A 1U1GA 3OAAA 1GRVA 3TDKA 2HRDA 2GAAA 2UZIR 3F7OA 4WPGA 2EF1A 3VC1A 1SB9A 3UG7A 2XB2A 4K87A 1JQKA 3IIMA 4AKIA 3CLVA 4PAGA 4L8VA 1B1AA 5EKSA 1DIOB 2G63A 2B61A 2V6GA 2ZJZA 3LOUA 1P44A 4HLQB 4Q16A 5GM2A 3TL6A 4DCSA 5JPCA 3KVVA 2AXNA 1N5RA 1GAQA 1THZA 2AN1A 3NOQA 3QQ5A 4PF1A 1IK4A 1JKJA 1GDHA 4E5DA 1ABEA 2A1TR 5FYDA 1WXQA 3BC1A 1P9WA 2BEKA 4NJOA 4KBGA 4OL9A 5KX5B 2IYSA 1D0SA 3CLUD 1DIHA 1ZMXA 4AY3A 4FB4A 4PBTA 4I2NA 3B1JA 2PUAA 1AT1A 2REXB 3BMOA 4J4TA 3U44A 3KVNA 2ZI4A 1ODTC 3HUUA 3DEFA 4G5OA 4KPUA 4TGLA 1NUTA 5K3SA 4DGQA 4IMPA 4K05A 1FFEA 5EN4A 2RH4A 2BEUA 3VR6D 5DWQA 1IAQA 4QD3A 1T1IA 1QQ6A 1VMAA 2LUOA 3TIFA 3IMKA 3WWPA 5JOQA 3OUZA 4WACA 3ZHVA 3SQDA 1W0JA 4ZN6A 3PXXA 4DR3B 3CF2A 2Y9PB 4JUIA 2A78A 2ZRFA 4TMTA 4ASUA 4HZUB 2W48A 4LJKA 3KOOA 4BKOA 3GUCA 4RVUA 4B73A 1JEYB 4C2UA 2J67A 2VVTA 1KVQA 1NBME 2W43A 2E5FA 4Q02A 5FBKA 5LDDC 1KYVA 2NT3A 4ALMA 1J7JA 1S2IA 3OQHA 1HK7A 2ECFA 3IV9A 3BWXA 4JHXA 4EG6A 2IBTA 3VNQA 3RM3A 1XA3A 1JDPA 4PCAA 3WGJA 4ZK2A 1ZRSA 2BZ1A 2G76A 2ZK7A 3LLMA 1TZ2A 4A23A 1LBSA 5A04A 1UM8A 1H9CA 4Y9UA 1E5QA 1DWPA 4FGUA 4RSHA 1SCIA 4R7GA 1HTTA 3RTEA 3SIWA 5FPKA 3C1AA 4G0PA 2RJ3A 3VR2A 1SCJA 2O2IA 4H3SA 2JZNA 3P9PA 3JASA 4ND1A 4ROSA 3RR2A 3K0CC 3X43A 1D6MA 4QQFA 4I1IA 2GZAA 2MOKA 1M1YE 3NAQA 4NOKA 3ZDXB 1KZ1A 4BMDA 4BHTA 3UKJA 2OZEA 3DCIA 5FPHA 3D8BA 1H2XA 1I4EB 1UZLA 4UHDA 3DDZX 5KNCD 1H2RS 3DFMA 1RBQA 2QW8A 4COOA 4RTSA 2HT1A 2K2WA 4DABA 1K86A 3NR2A 3A1DA 2PYIA 1QCCA 1B26A 2P4SA 4GP7A 4YCNA 1HLPA 3LA8A 5CAEA 4P98A 2DULA 2Z9DA 4F4HA 2AV6A 3VNBA 3OC6A 1RXEA 4IDBA 4KQ6A 3BWCA 3HZHA 1R74A 1E2GA 2A4KA 4MUMA 3TBKA 1JHQA 3STYA 3C7KA 1DQSA 1YR8A 1GPWB 3K09A 4TYPA 3GQBA 1T5HX 4EJSB 3JATA 1E3MA 1IWPB 3SLGA 4KX3A 3COSA 2WM8A 1B8PA 2FPIB 5NULA 4J0QA 2BKUA 3RODA 4RGVA 4QQ8A 2CVQA 2BFCB 4HFMA 5CT4A 3U9TA 1TMGE 5SYNA 2PK3A 5G3YA 2NU8A 3RSGA 2SECE 5JYDA 3NV9A 4PIVA 2Q1WA 4KOEC 2WM2A 5IJ0B 1NJ6A 2LRHA 1QU3A 4BWGA 2XCLA 3JQ7A 2AOXA 4O1MA 1LNQA 3G1UA 4AJEA 3IAS6 4ZD6A 2N1BA 5F64A 2JF0A 5BXQC 4YB8A 3I5XA 4K5QA 4ZV7A 5DIZA 3AY3A 5I4IA 5ISMA 5KVQA 1SKQA 2ZYTX 1WXEA 2P9TA 1X19A 4EBBA 4CIDA 1R8XA 1Y7LA 1S9DA 4CL8A 4F85A 1VKNA 1OXUA 1SXHA 4IFIA 4OI2A 4XLLA 2R5NA 5FV4A 4UQOA 4F7WA 1TJ3A 5FTWA 2ZTLA 3ANYB 4EEXA 3HGMA 1GN9A 4RTQA 3OY7A 4QX6A 1MW8X 5BOVA 1Q95A 4ND4A 2AA3A 1K6EA 3W2HA 1RE1A 1HF3A 3BA1A 1NGSA 5HQJA 5JYBA 4MS3B 3KJIA 2V9ZA 3GYGA 3SHFA 3KKNA 1GTRA 1HYQA 3W9YA 1QTRA 2QMUA 3BYZA 4U5XA 3I6YA 3VDQA 1UKBA 2JFZA 4UHEA 4MW6A 1QNFA 1E8DA 1UBUS 2GESA 4YR9A 3T9BA 2H1LA 3VJLA 5DF1A 1DRKA 1FF9A 1SOAA 2ORWA 1ZVQA 2FPPB 2PUJA 4FN5A 2C9CA 3Q10A 4GH5A 1E61A 2L42A 3INYA 3N8DA 3JTEA 3H83A 1SXGA 2PZLA 1J06A 2J3LA 3T1QA 3HU5A 1COZA 3RK0A 3JWEA 3LP6A 1PCXA 3F6CA 1VHTA 1TOAA 2V3VA 1K4MA 4WFKA 3T7TA 5B7GA 2KLHA 4CKZA 2ZYAA 1GT6A 3IODA 1JG1A 1G5IA 3R7FA 2JHFA 1ZIYA 4BMOB 1R4MA 1ZINA 2QI9F 5C18A 1IOLA 1VJ0A 2YHSA 5BYBA 4B5LA 2E6UX 2PX8A 1WJGA 1XNGA 2B4AA 3KYCB 4LOJA 4HQLA 3Q9SA 2RKBA 3WA7A 1C9KA 5K0GA 3EBPA 4EG4A 2ZE8A 4C2TA 3BERA 1BW9A 4KQWA 3KSDO 1AKTA 2I6FA 2JGNA 1L4BA 1J5PA 2V6JA 3K09C 4FUTA 1DL5A 2VJBA 1Z8FA 2ZDQA 4KJXA 1P7VA 3ZI7A 3P19A 2ZYIA 3UMVA 1C4WA 2DY1A 2ZUUA 2HRBA 2QM3A 5ALEA 1OBVA 5DXJA 3RIXA 4YPVA 5D3MA 2P0EA 3FPSA 2JVIA 3P9IA 3PHHA 4FHCA 4R9UC 2X0FA 3O4IA 4B40A 2AZXA 4D4HA 3DBLA 2R6DA 4ZAYA 4CLOA 3ZDCA 3UMFA 1Z5WA 3AONB 2QX8A 3G23A 4FINA 2WTXA 3ZR4B 3ZYZA 1RKXA 4MI1A 3ZTTA 1LK0A 4MR7B 2G5GX 5ALDA 3CLTC 4UEOA 3UXEA 4JI1B 1R5NA 3ZCTA 4E09A 2EQ5A 3PUXA 3SFVA 1GG2A 1WD7A 3MHTA 1DMRA 3GEEA 4TKVB 4AF7A 2GS9A 1EBUA 1EJ2A 3BB1A 4TMXA 5KPJA 1KY3A 4OAQA 4I5GA 1M2OB 4LHXA 3FPGA 2EEPA 1U4SA 1Y1SA 4GI7A 4H15A 4C0AC 3CO0S 3F3SA 1DADA 2CNBA 1ZXBA 4EHHA 1WDKA 3CVXA 1ZUNB 3PLRA 3R9WA 1W0KA 2R47A 4UASA 4BEJA 1CZRA 4X93A 1MOSA 1LBIA 1XOIA 4WX2B 1XU4A 2X1VA 1P0FA 3D8RA 4ESOA 3FMGA 5E9WA 3P71T 3HC7A 4M1QA 5AD1A 5L8VA 2V0NA 3KSZO 3CZQA 2EWVA 1ZHOA 4DBLE 5T4FA 4TL8A 4NYIQ 1OFGA 2H92A 3PICA 4WN9A 4NRDA 3ZWXA 4B6FA 5KYXA 4ZHSA 1EX1A 3KG2A 4NC9A 2QDXA 2UUOA 3PUVA 3TGLA 3F3MA 4ZXPA 1XVAA 1TZJA 4NBKA 1UWKA 3IQXA 3MGBA 3QBVA 4W9MC 1GPUA 4Q1AA 3X0DA 1N2ZA 1CUSA 3DC2A 4II3A 3I2JA 5ECWA 2P9YA 1RKQA 4BKMA 4H2DA 5K0FA 4P84A 4FLFA 5IHPA 4OLBA 1MO4A 4M6WA 5E1OA 4G6ZA 2WF9A 4Q9HA 1L5LA 4TWIA 1Q14A 2XD4A 2MYUA 5EC8A 4UBIA 4I6GA 3O2SB 2O3UA 3WIVA 4ZEVA 3X1MA 3HXTA 1J49A 3NVKI 5GQSA 3ANTA 1ZVJA 1KAOA 3EH1A 4XYMA 1QP4A 3EIWA 4HG2A 2WE8A 3N05A 3HCPA 1AKUA 3RH0A 1QM5A 1P17A 1KSJA 4XWGA 5MN4A 2FEWB 1UDWA 3ETNA 3D4BA 4IWNA 2JCSA 2X1LA 1NRJB 3SXUB 4F4UA 2EG9A 1EFCA 3Q3EA 4H4EA 3IPCA 5LQSA 1DX9A 3DLPX 2RHOA 4P4TA 1CUDA 1VBKA 4A27A 1BRTA 3ZJTA 1WXXA 3T3GA 2C99A 4KN6A 1SXQA 5ITZA 4UJ3A 1N2EA 1UODA 4BFZA 4RENA 2NO6A 1ZL2A 2MWMA 1X7ZB 3CBGA 1PT6A 5KYUA 3BJZA 3BXEA 2W2NA 5EKXA 4BZPA 1KZYC 2PGJA 1GHTA 1I7PA 2BSAA 2QMHA 1TF7A 1MZPA 3P9QA 1M6VB 4AY2A 1SUSA 2ZB2A 3NWPA 5EFOA 1VJDA 2EAUA 2D74A 5FOTA 1LA2A 3ODGA 1VJRA 4LJ6A 1HKHA 3D1LA 4H4DA 5ALQA 5F12A 3ZGYA 3HXKA 4AMYA 5K03A 3ELUA 3B20A 1N33B 2LWIA 2P3OA 3A25A 3OWXA 2ZI7A 4EEKA 4C05A 4IEIA 4V1CI 3ZZTA 2YJ6A 2X2OA 3F96A 5A5GA 1NRIA 4O4HB 5ERGB 1SCDA 4TLCA 3RO7A 3TCKA 5JMTA 2X15A 2XZLA 1E1MA 1PWHA 2A0KA 1S02A 4V0NA 2XT9A 2QRZA 1ZI6A 3K0HA 1I2CA 4M9CA 4MUNA 2AVNA 1QZXA 2OENG 5JSHA 1RXYA 1KDPA 2PANA 4R3WA 5CA1A 4UTNA 4COKA 1RAFA 2A1UA 1YE8A 3KQOA 3CSUA 3HFGA 3HTXA 3W5AA 5EL0A 4QTTB 4ZZ3A 3KXKA 4M46A 4W5HA 4JKOA 1IOVA 3GOQA 1DU4A 1CR0A 3TIVA 1OGYA 5KI6A 1H22A 2PZFA 5BNTA 3ESDA 3W34A 3AX6A 2QUBA 4B0OA 4O5OA 1VIMA 5AVQA 4S1NA 3M6XA 1F2TB 2DWOA 2NNLD 1M33A 4ZV4A 3OIFA 2XAUA 1GEEA 1YNOA 2P3LA 2NZXA 1YRHA 2EGHA 2P4EA 3B7PA 3LNCA 3ZN2A 1B8OA 1QUFA 6LDHA 1DELA 1XTQA 2I2CA 2QE7D 3ZY3A 3V7NA 3ZW7A 4LX0A 4LK2A 5AOAA 1VYVA 1QQ5A 3OQNA 4BVLA 4BNIA 5FHQA 5L3QB 1I9CA 1IPHA 1HLGA 3DSRA 5JQGB 4UM5A 5IVDA 1UBEA 1KIMA 1M67A 2F8LA 1M8FA 3A4NA 3HYCA 3IEXA 3COPA 1HQDA 4UTXA 1LQUA 1NBEA 1DP4A 2AXPA 3AJ8A 1L4GA 3UB2A 3D1VA 4AX8A 2QNRA 4YCAA 3A7DA 4Z4FA 1KK0A 3L9WA 3D7NA 4JJIA 3OKAA 4YDRA 4B8WA 4CMJA 2CWWA 1PT5A 2QZ4A 1R0SA 2XDWA 4N3NA 2C00A 3FFWA 3K9WA 5B2EA 1JFTA 4DA0A 2PX6A 4C43A 4LJRA 3ZQKA 4QJBA 4E03A 5DM1A 4QAQA 2I2BA 2C82A 5FTKA 5DISB 3GO4A 4HH0A 1JHOA 2AE1A 2D1QA 2FTKE 3O90A 5HTOA 3B6JA 2B34A 2RI6A 4MGIR 4NS1A 5DASA 1WXHA 1TTPB 1XP5A 2ODNA 3CLSD 1TFUA 3OLXA 4TXHA 2EJUA 4BQPA 5IWCA 1HO3A 5C81A 3C8MA 3G0DA 1C9NA 4ZMSA 2IXEA 1WZEA 4RTPA 3G85A 1VB3A 3SEZA 3GJ5A 3FPBA 4PFQA 1PLLA 1DJNA 1PQ4A 1ZSYA 2R97A 1K97A 2Q0QA 3G59A 4X9XA 3EISA 3BMQA 2BZ0A 3AFOA 5E2AA 4FIDA 1ZGJA 3ET5A 2IVFA 4BNKA 5BNFA 4LVUA 4IMIB 2BGKA 3SAJA 1SPBS 2GNPA 3D7SA 4OH7A 2VYQA 4TSKA 4WLUA 5SY9A 3T5DA 4DLVA 5I01A 5K4GA 2JHPA 3LYLA 3VHLB 3K70D 4Y67A 3RFFA 4UUMA 3B3FA 3LCCA 2ZT6A 4E2ZA 3QW2A 3TXYA 4DCGA 1AN9A 1ZD8A 2Q99A 5T4EA 2R65A 3VO1A 4X8HA 1AKVA 4IIJA 2PSFA 2I1QA 3FDXA 4QUDA 1R16A 2AX3A 4F21A 2NUAA 5L51A 3L1JA 3F8TA 3M5CA 4FFDA 1JLLA 4KB5A 1KYQA 2PV7A 2FSIA 2V9PA 4P5EA 5BUSA 5KSOA 1NXWA 4ODIA 5B7NA 3Q8KA 3QV1A 3LE8A 1G4AE 4MVWA 3JQGA 5ECYA 3VV2A 3UC9A 3VKHA 3N87A 2OV2A 3EAQA 1GCAA 1IN4A 1N8KA 2Q9UA 4H60A 5CCDA 4ZQEA 4AN0A 4JLWA 1U9ZA 1JQLB 2W6ID 1TAQA 3A6JA 3KXDA 4WINA 4LTDA 1I2DA 2E18A 3K0FB 5FR2A 5LQDA 4JUAA 4NYJQ 1RWMA 2W58A 4JLAA 3EDQA 3ZGXA 4Q0MA 5ANRB 4M21A 2R48A 4ZAFA 1OIWA 1R5JA 1LVUA 1KI6A 3U7QB 4HDSB 1WQ1R 1YK1A 3ZVKA 2ZCVA 4CKWB 2Q45A 1SFRA 2ZI9A 3H2BA 1DKUA 2IOFK 1U0JA 1BMFD 5F21A 4BXOB 4MXDA 3C14C 4P3NA 4EGJA 1T10A 1VE3A 2H4YA 5KHAA 3TW8B 4TQUS 2Z3ZA 5HYVA 1B23P 2VJKA 3TFOA 2B1RA 5AXCA 2VDVE 1R6UA 3PZBA 4LYFA 1ZX1A 4ZZ2A 4F5WA 5KREA 2BFEB 4I36A 3WV4A 2R8OA 1XWWA 5CNJA 5DK4A 1WU7A 4HWSA 1FDIA 1FTQA 1JG4A 4EG3A 5BNWA 5CCEA 3VHRA 1YASA 2HDOA 5WRFA 3D3EA 3IDAA 1MIHA 2OILA 3ME5A 4HAZA 2X4LA 3CLRC 3OHPA 1W0CA 2WTBA 4CF6A 1ZH0A 1ST3A 2OXRA 2B21A 1AE1A 1PHPA 2IEZA 5GMOA 3LECA 3ZWVA 5JS6A 4NJEB 2CXUA 3UF0A 4PTYA 3TUZC 3S55A 5BN5A 1ZM9A 2IPLA 1P7PA 1SBYA 3ID6C 3UENA 4AJNA 1GUBA 2QSYA 2HJRA 3E2MA 1YVUA 1LRKA 1KH1A 3OZTA 4YIHA 3REFA 3Q87B 4ZVNA 3H05A 4MJ7A 1N0HA 4LBZA 3RVRA 5L4LA 4QM7A 4HEQA 4RVNA 1J42A 1P91A 1X1QA 2DPHA 3A1EA 3DHYA 3F5MA 3EK2A 3P9ZA 2J87A 3I39X 3N58A 4YJ2F 1X8LA 4J49A 1YZQA 2AWNA 2N9UA 2PT9A 4MJLA 1Y3BE 1ZICA 1RLIA 4HRAA 2Z83A 1NW3A 3DPUA 3JZMA 1H69A 2NXEA 1YR1A 1P0CA 3JAKB 2HOQA 2YV4A 1E58A 1TJNA 3OSUA 4LSZA 5FIUA 4ZVSA 4CCSA 1XSEA 4LNAA 4JI0B 2YRXA 3EPLA 4C0HA 1MABA 3ACDA 4WSOA 4F3YA 4OX9Y 2ZRDA 3OWOA 2FE1A 2AZTA 2HYIC 2Q4EA 3AIIA 3UG6A 1QYIA 3MT8A 4Q3DA 3V4ZA 1X42A 1FNNA 2WFAA 1R12A 4E5VA 2WWVD 3T4PA 1TM2A 1RHUA 1RI4A 4YK7A 5I6DA 3S1LA 1XALA 1GGMA 3DCJA 1E4VA 1CHNA 2VO1A 5BSTA 1V37A 2C5BA 1KOLA 1ZHHA 5AJWA 4BLSA 1QRUA 3MCZA 4UBLA 4DA6A 1BNCA 2FWPA 2QP4A 3H5IA 2FSUA 5KWVA 2FDXA 1U2GA 2GEKA 2Z57A 1Z08A 1ICIA 4Y9DA 4YP6A 4CRWB 4F3RA 4B2YA 1BRMA 5TPZD 4ZYWA 3MZ0A 3H1EA 1UT6A 4Q7QA 5EJAA 2WJGA 4GSLA 4URXR 1Q92A 1UP4A 1PD1A 1N5JA 2W70A 3GFFA 1C7EA 2I03A 3OPXA 1YL5A 5BW8A 1XAJA 4G5QA 1ZH2A 2WPNA 3O2NA 2Y6UA 2BMVA 3R9KA 3KWMA 1SVUA 4HZGA 4XASA 4DA7A 3RSFA 1QWOA 3O8OA 4EPRA 3AF5A 4EVSA 4TLAA 3TE7A 1UBOS 1QO7A 1RHRA 4ZTBA 4M2LA 4ZCQA 1GN8A 1NLMA 3DP9A 3LSTA 5A05A 1OLUA 5HKBA 1DFHA 1U2RA 3CNQS 4WBXC 4A2PA 4BU1A 5G4LA 3R3WA 1NNI1 4MVJF 4ISCA 2Q2WA 1V45E 3RYIA 1JPVA 1Z4MA 1OI4A 2Y99A 1JIIA 1DAHA 2KMLA 4Q4DA 2G7MC 1N5OX 3A10A 3U5TA 2GF9A 3TPCA 4UPEA 3G0HA 1T8RA 1EVJA 1FW6A 5JATA 1AA9A 3LX8A 3VR6A 1KPIA 3BXGA 2ODBA 4Y6PA 2IPNA 1W9HA 5B7PA 3PDJA 2G9ZA 3I5YA 3PQFA 4TKUA 4E2YA 1TM1E 5AXDA 4R9VA 5F7JA 2OZKA 2QKYA 3RRYA 4ISBA 1U8YA 3A04A 4GRAA 3OLZA 4R2LA 4ME6A 5JVDF 1GSAA 2ZJ7A 1KPGA 1WQ4A 3KHTA 3OQOA 3AMVA 4BP8A 2IPXA 5FT9A 1E62A 1AUXA 1ZGZA 3EB9A 3SIRA 2EYQA 2HYDA 3F9RA 4BNYA 4Q3EA 4QTUB 1U0RA 3I0NA 1EVEA 1RVDA 4CBVA 3OPYB 3EWAA 3F1KA 2ES4A 2PD3A 4LNUA 4C01A 1O3YA 1QX3A 1K68A 2DUNA 2H85A 3D0QA 4NBUA 3I9KA 1SCUA 1ENYA 3OE7A 4YCSA 3X1KA 1TZKA 1XQ6A 4P4UA 5MDHA 3DZHA 1RWQA 1UKCA 1YO6A 1GEGA 2I4OA 3FSGD 1TQ4A 3KR9A 2E5LB 3E84A 2ADOA 3GRZA 2EBUA 4LDNA 3PTZA 1DT5A 2XWPA 1T36A 3IPAA