3H19A

Crystal structure of este5, was soaked by methyl alcohol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
total genus 101
structure length 293
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h19A00
4QA9A 5LKRA 1UFOA 1WB4A 2V97A 4Y2VA 3WIBA 4J0CA 3IIIA 1JU3A 4U2FA 4Y2YA 1CUEA 2ZJ7A 5A6VA 3UUEA 4X93A 2WG2A 2HA7A 3C5WP 4PSUA 5AK3A 1CRLA 2ZSHA 3I1YA 3PUIA 4Y2QA 1WPRA 4B84A 1BN6A 1CUCA 2V98A 5AIBA 3ZV7A 5IKXA 5D3ZA 5JAPA 3UMJA 3ILSA 5KWIA 3DKRA 2NW6A 1HKHA 2QOEA 4EY5A 4MXDA 1JFRA 5JYCA 3QPAA 1MPXA 4J0HA 2PSFA 5FDFA 3LIIA 5LYYA 3VVLA 2PPLA 4UPDA 1Y7HA 2XB6A 3H2HA 1A8QA 2O7VA 1EDBA 1NU6A 3C6ZA 2J3DA 1ZI8A 4MQMA 2AJLI 1H2WA 1XROA 4CCWA 5A7GA 2JGFA 2O7RA 5ISMA 2QRUA 3LIPA 3WLAA 4GI1A 1R50A 4AXBA 5AKIA 2O2GA 5FUMA 4P9NA 3QMMA 1CR6A 3JWEA 4C6HA 1G42A 3C8DA 3IULA 1QFSA 2PKYX 4Y2PA 3G7NA 1PFQA 2DSNA 4RPCA 2QTBA 2VEOA 3IA2A 5ALNA 4GLBA 3O9MA 2DQZA 3HACA 3AIKA 3V1KA 1XQWA 3SX4A 4L72A 2PBLA 3ICVA 1VLQA 4Y7DA 2WUGA 2WSLA 4UHEA 2WG0A 5ALOA 5AM0A 1QONA 4Q3LA 1ACLA 1DT5A 2DHDA 4KE7A 4AZ3A 5DTJA 4KAJA 4Q82A 4JUIA 5KWJA 1R9MA 1UK9A 3O0DA 1A88A 4N8DA 4X92A 4B9AA 4AB1A 3E3AA 3QH4A 4CG3A 5BWBA 3Q0TA 4EA6A 4ZGBA 2ZSIA 1H2ZA 4UHBA 4G4GA 3WWCA 3ESAA 4AN0A 4FTWA 4BCBA 4FOLA 5JADA 2XUGA 4BC1A 2XMDA 5JZSA 4GDMA 1O6GA 5CT5A 3ANSA 2WIDA 3JW8A 5JD5A 1MJ5A 1JMKC 4BZWA 3C45A 3C8HA 1SCIA 3G02A 2PSDA 4C89A 3I2KA 1GKLA 1ZGCA 3O4JA 1BE0A 4C4YA 2Y2VA 3P2MA 1EX9A 5EHQA 2HU8A 3U0VA 5CTAA 1H22A 3VJKA 3PI6A 3IUJA 2PVSA 3A2NA 4W1SA 3A2LA 1ZOIA 3WMRA 5AI8A 1TIBA 3DYVA 4GWLA 2W22A 5HF6A 3W04A 2BUAA 3IUMA 1P0QA 2ONCA 2WU3A 4PSDA 4OYLA 2OAEA 5A71A 3AJAA 3H17A 1D07A 2GYUA 4IHAA 2LIPA 3ZPXA 5D6OA 4ZI5A 5T4BA 2C0PA 3WA7A 3AZOA 1QJ4A 4CI9A 5E4YA 4AO8A 4EY8A 4OYYA 1KEZA 1F0PA 5FP0A 4PQEA 2JGEA 1XZFA 1YB6A 4U2GA 2FX5A 3NGMA 3FNBA 2WUFA 4UBOA 1E89A 1CQZA 5C8XA 3F96A 1A8UA 3H1BA 3RKSA 4OU5A 5BV7A 4HXGA 3V9AA 5ALWA 4X95A 1UK7A 2XUPA 4QDTA 5AM2A 3KD2A 5EGNA 1L7QA 3YASA 4HAIA 2XQKA 3IB3A 3DEAA 1QIGA 2VT7A 2WJ6A 4NS4A 1MNAA 1YSCA 2QZPA 5DLPA 3DD5A 4LXGA 1XZLA 2C5FA 1ZI6A 3E4DA 1MX1A 5CMLA 1Q83A 3STVA 1U4NA 2QJWA 2XQFA 4Q1VA 2G5PA 3R3WA 4UFNA 5AM4A 3WL8A 4NVRA 3IVMA 5HZGA 4BDTA 1JJBA 1HDEA 1QE3A 2I78A 3D2BA 4FFWA 4WY5A 4BVJA 4W1QA 2GYVA 1WHTA 1QIIA 3EQ9A 1NU8A 2QUBA 4YASA 4UBIA 3OURA 1GZ7A 3I2HA 1QFMA 1HQDA 2OGSA 4M0FA 2XE4A 4EUSA 4MEAA 3WI7A 1SFRA 1VA4A 3FVRA 4G8BA 3WKEA 3LP5A 4X94A 2QJRA 3AIOA 3WJ1A 2VAVA 1MT3A 3S2ZA 1EDEA 2O2HA 4MQLA 3X3HA 5AOAA 3TRDA 4UFOA 3HRHA 2J3QA 3CCBA 4OPMA 3DQZA 1QO9A 1EI9A 3KXPA 3EQ8A 3STYA 5ALYA 4CG1A 2CEKA 5IVDA 5JAOA 1XRQA 4KAFA 5HF8A 1FSSA 1OILA 2HL6A 1E66A 2XUFA 1EA5A 1WB6A 2PSHA 2B9VA 3BF7A 4QDOA 1TKRA 3G0CA 3ZWQA 2QMQA 4YPVA 4X91A 5DNUA 2QM0A 4FKBA 4DTCA 2XMSA 2XUQA 4J0KA 2JF0A 3BDVA 1CUAA 1EB9A 1N5MA 1ZD3A 2YH2A 5K3EA 4G4IA 1IVYA 1A7UA 3ZLTA 4PF1A 1QGED 1SOMA 3K6KA 4B82A 2WUDA 2OGZA 5HKBA 4ROTA 5AI5A 3EF3A 5LZ9A 3I28A 1ODSA 4OUKX 3WK8A 3F9CA 4JYMA 1XRMA 1FFBA 2HDWA 4P92A 3W2TA 1XZBA 5BOVA 1J2EA 1XZCA 1AX9A 2GBGA 3BWXA 4FNMA 2BGRA 2D0DA 2RONA 1TCAA 1MX9A 2XLCA 4H18A 4AQDA 2WUEA 4AMYA 2D5LA 5K3FB 3PFBA 2HA2A 5I8PA 1AC5A 4DNQA 1HBJA 5JAHA 5AM3A 4CCYA 5AKEA 1IUOA 4U2BA 4X6YA 5AM1A 1H23A 5SYNA 5EIHA 3O4GA 5EFZA 5AJHA 1U65A 2BKLA 2XMZA 3OG9A 3DNMA 1XQYA 2WIFA 3WK7A 3E0XA 1AUOA 1FFCA 3WWOA 2OGTA 2PSEA 3F98A 5ALIA 3AZQA 1WCYA 1VZ3A 1PJAA 4KACA 2QR5A 3OOSA 2VJCA 4X85A 1E3QA 3V1LA 3ZI7A 1QIDA 2OAGA 2XMQA 4DYHA 1X2BA 4N5HX 4P93A 2ZYHA 4J0GA 4D9JA 5LZ2A 4DSZA 3N0TA 3K9BA 2BUCA 1E8MA 4ZRDA 1ZD2P 3FYUC 2XUDA 4KEAA 4RE6A 4BP9A 2RAUA 3G9TA 3LS2A 5ALDA 2JGMA 2FUKA 2WHPB 3GFFA 5DNWA 3AUKA 4WFIA 1EB8A 5AKLA 3HXKA 1ZD4A 5LKAA 4C4XA 5LZ8A 3MUNA 4QNNA 1XQXA 1Q0RA 1GXSA 1GKKA 4MYSA 4U2DA 2W6CX 4UBLA 1ZIYA 3R40A 3WWDA 5JZBA 2JGKA 1F0NA 1BEEA 3WZLA 1S8OA 4AZ0A 5AI0A 3WYNA 3G0BA 3L1JA 5AI9A 2OLEA 1Q84A 5K3BA 1Z68A 1I6WA 1EHYA 3DOIA 2PU7A 3LCRA 1VE6A 4Q05A 1XRPA 1U8EA 1CPYA 1G66A 1W75A 3QZUA 4B7ZA 3I6ZA 1K5PA 2QXTA 2WTMA 4TVKA 4B83A 3UUFA 2B61A 3H2GA 4OB8A 4QZVA 5IVHA 5A2GA 3AINA 3FYTA 3WYDA 2WFMA 1YB7A 4ZV9A 5K3CA 3G8YA 1QIFA 4WFKA 4AO7A 1AMNA 1TRHA 4XJVA 4FNGA 4HTAA 3WIOA 4J0DA 3QMWA 5KBYA 5AP9A 5LIPA 1MTZA 1N8SA 1LPOA 1J07A 3SC2A 3SK0A 3HSSA 1AURA 1DINA 1C7IA 4ARAA 3E1GA 1GPKA 3BJMA 1VJ5A 1LPPA 4RE5A 5F4ZA 1O6FA 1AZWA 5ALTA 4UHHA 3W05A 1JKMA 5JD4A 1ISPA 1SCQA 1C7JA 4YK7A 4P08A 3IUQA 1TCBA 2J4CA 3W9BA 3WWEA 5JAUA 5AOBA 1GQSA 4BCDA 1LLFA 4BAUA 2HA3A 1QO7A 5FV4A 1W6RA 1HL7A 4H7KA 4H77A 2RHTA 5JIBA 1CQWA 5AK5A 1MU0A 4E46A 3WKAA 4K6GA 3Q8WA 3WKBA 3QVMA 2XUOA 5JASA 2XUKA 3C6YA 1UK6A 3L1IA 4B6GA 3IBTA 2BCEA 2ZJFA 2BJHA 1YCDA 4UFPA 1Y37A 2AJBA 1CIJA 2V9ZA 2VAXA 4QDXA 1BEZA 5AKJA 4ZREA 4KAAA 1QTRA 3PF9A 1AKNA 5AI4A 1THGA 4L0CA 1EDDA 2G4LA 4QDZA 4XIIA 4ZV7A 4EY7A 4LYDA 4PSCA 3DYIA 1DTEA 4H0CA 1OXMA 3FSGD 2GYWA 4EY6A 3K2IA 2XUHA 2DHEA 5A7HA 5E4TA 1IUPA 2AJCA 1R88A 4TGLA 2VSQA 3OM8A 4OSEA 2YASA 4OB7A 1XFDA 4IH9A 2HA6A 3R3UA 4J0IA 3A2MA 1J06A 1UKCA 3BJRA 4C01A 7YASA 5J3JA 3MGAA 4KE6A 3VISA 1R1DA 4BDSA 2WHRA 3JYHA 4QWWA 1EVQA 4MYDA 2HIHA 2IX9A 5CURA 1KU6A 1W4LA 1MAAA 5AKYA 3DKKA 1XZJA 5LZ5A 4WDRA 3AIMA 3M82A 5CT4A 3D0KA 1R4ZA 2XDWA 3M83A 3V48A 1YS1X 5C81A 4IO0A 2CBGA 3D7RA 1XRLA 4G8CA 2ZYRA 3CXUA 2Z3WA 4GHWA 5D3KA 1K6EA 5EHZA 1DWPA 5AKXA 4Y2XA 4K6HA 1QIKA 1IUNA 2RIPA 1B6GA 4A5SA 2X76A 4BP8A 4QDUA 2QUAA 3WKCA 2XLBA 1WPXA 3I6MA 4X3CA 1QTIA 3OTQA 4WDQA 1YA4A 4AO6A 3HC7A 1CUJA 3CN7A 4DMHA 4EBBA 1MAHA 2HA5A 4BCCA 4Y2TA 3EQ7A 3CCCA 1XKTA 3R0VA 4W63A 2YYSA 5AM5A 2BAGA 5ALVA 4FLFA 3WJ2A 3D59A 4QE3A 2HHAA 4FMPA 5LZ4A 1EK2A 1GPNA 1K63A 3I1IA 4F0JA 2R8BA 3C70A 1ZIXA 1CLEA 1XZGA 4LYEA 3FYUB 1W1IA 4X00A 1CUSA 4B80A 4LHEA 1JT2A 2GZRA 1W52X 3D4LA 4XX1A 3DJYA 2OQIA 3DOHA 1CUVA 2I03A 4F5ZA 3F67A 3HYSA 3DLTA 3SWWA 4CFSA 3GELA 3KWFA 3EIOA 2XMGA 3QBJA 2BUBA 2GBCA 4WJLA 3PE6A 1LZLA 3PDCA 3VJMA 3WZMA 4HS9A 2HFKA 4BYMA 4U2EA 4QEKA 4X71A 2OXEA 2DQYA 4I19A 4DM7A 5T4EA 1AGYA 2PUHA 4BTLA 2XMBA 2FJ0A 4DNFA 1WB5A 5KREA 3R41A 1UOPA 5ALEA 4EZIA 1B41A 4FBMA 3WL7A 3BXPA 2HFJA 4W1PA 3H2IA 1XRRA 2XMRA 3O95A 2BFNA 1E5TA 2Q0XA 4DGQA 1GQRA 3ZLUA 3WL5A 2ZVDA 2RHWA 4BVLA 4LXHA 2VJAA 1ORWA 4BZZA 1MX5A 4INZA 1CUIA 1YA8A 1EINA 5ALUA 2Z8XA 5ALJA 5D7BA 2V96A 2I3ZA 1K8QA 2VT6A 4XVCA 2XUJA 3FLEA 5EI5A 2EDCA 4ETWA 2JGJA 1DU4A 4LKOA 1L7AA 4J3JA 4X97A 5IH7A 1LNSA 5ALSA 4K6KA 4L3WA 1XZDA 1ZD5A 4WCVA 1J1IA 4UUQA 4H7EA 2WJ4A 3PFCA 4EY4A 4CIAA 5HFAA 1QIMA 1M33A 2HA4A 3R3VA 4NZZA 5DYWA 1BU8A 1C4XA 3HZOA 4DMFA 1G5FA 1MO2A 1OCEA 4FLMA 2QVBA 1N1MA 1XKLA 1XQVA 2ECFA 4E14A 5BWCA 1YASA 2JEYA 4H7HA 4DMCA 4Y9SA 3MUOA 4UBNA 2CKMA 5HFNA 3C5VA 1VA5A 3TEJA 2WHQA 4B9EA 4H7IA 1BS9A 5ALFA 1WM1A 4RNCA 2WFLA 5CH8A 3FBWA 4BRSA 2JEZA 2OCIA 3H04A 5C8VA 5FPPA 4K2AA 2WM2A 4X6XA 1JJIA 3H1AA 4NMWA 2HRRA 4FDMA 3OC0A 4ITVA 4BE9A 3A6ZA 3O4HA 2VTVA 2XI4A 4BB0A 1QIEA 4IH4A 1CUFA 1G4HA 2OPHA 1HLGA 3NUZA 2DR0A 3R3XA 4UBKA 1X2EA 4G1FA 4AX4A 3VVMA 1UKBA 1CUYA 4MJ3A 5EHXA 4BATA 2WIJA 3ESBA 5AKKA 4I3FA 3G9ZA 5ALRA 4EB0A 3STWA 3VKFA 5FRDA 1CFJA 1WHSA 4OB6A 1THTA 1U2EA 3RLIA 3ESCA 1SCKA 3O4IA 5CT8A 4QLAA 3DCNA 5CW2A 4BBZA 5FPQA 3PUHA 1XLWA 4X7BA 5AKZA 4KE9A 1LBTA 1LPMA 1QOZA 2OCKA 3ED1A 1CUZA 1CUDA 4GBGA 5I7UA 2FJPA 1LBSA 4I4CA 1L7RA 3F8SA 5DWDA 4HXEB 4TPKA 3W9UA 2VJBA 5HQ3A 1ODCA 3L1HA 1XZMA 3F97A 1FFEA 2BGNA 3RK4A 1GT6A 5HCUA 1JJFA 5HF9A 5FOQA 1E8DA 4FHZA 2XUAA 4DSAA 3DS8A 3C6BA 4BVKA 2WHPA 3STXA 3BL8A 1RYYA 4XWGA 3B3QA 4MEBA 3A70A 3HLKA 3DDUA 5ALLA 4YX9A 1YS2X 5HK8A 3TGLA 1P0MA 2CB9A 2DHCA 2CJPA 2XT0A 3FOBA 4W1RA 2H7XA 4N8EA 1H2YA 3NOXA 3GROA 2Z5GA 4Z49A 5FXMA 3STTA 1FFAA 4L9AA 1QIHA 5ALHA 5HK9A 1BCRA 6YASA 1ZI9A 2J4FA 3FWHA 2C58A 3WA6A 2XQGA 5JZ9A 4BE4A 4UHDA 2YXPX 4JYPA 1RP1A 4KJXA 3ANTA 5AH0A 1EVEA 2PSJA 5YASA 4OU4A 4KYVA 1UWCA 5E2IA 3I2GA 4G4JA 1QZ3A 2WIKA 2HM7A 3I6YA 4GEGA 2Y6VA 4H7JA 5CBKA 1DQYA 4FWBA 2EEPA 2B20A 2JGIA 2Y1KA 1Y7IA 3G0GA 4DMKA 3STUA 1BRTA 3D2AA 2XMCA 3FLAA 4X90A 4Y2SA 1YR2A 5AIAA 3G0DA 4BAZA 3BIXA 1CUGA 3KDAA 1ODTC 3ICWA 1XZAA 4LIPD 4H7DA 1X70A 4W9RA 3GA7A 2WFZA 4RGYA 1K4YA 2I3DA 3B12A 2QXUA 4FBLA 3I2IA 1CUBA 2R11A 5ALMA 1LPSA 5LP1A 3O9VA 2XQJA 2AJDA 1UOQA 5LLSA 3MVEA 3NWOA 2WLSA 2PL5A 1EXWA 1GGVA 4G9GA 4H35A 3KWJA 2E3JA 4ARBA 3EBLA 3H0CA 3R3ZA 1LZKA 1VE7A 1ORVA 4C4ZA 1YAJA 4JEIA 2P8SA 4B81A 4N8SA 3M81A 2UZ0A 5ALPA 1WOMA 3HJUA 1CVLA 2RGUA 1EK1A 3FAKA 4ZWNA 1DWQA 2ZYSA 3RM3A 2WG1A 5SYMA 4F21A 4G8DA 2GBFA 4IH1A 4IQ4A 4DLNA 5AO9A 4J03A 4UBMA 4F60A 3CN9A 2Y6UA 3QPCA 5ALKA 2JIDA 2JBWA 3IUNA 2HA0A 3FLBA 2X5XA 2XUIA 3D3NA 5ALZA 5IVIA 4E15A 3HI4A 3FSGA 2WIGA 5DYTA 5ESRA 3VJLA 1UOOA 1DX4A 4Q3OA 4PV7A 3D2CA 5C7YA 2ZYIA 3AZPA 4HRYA 1VXRA 4KRXA 2ACKA 5E4JA 3T4UA 3QITA 4CG2A 2RI6A 3S8YA 2ACEA 4C87A 3WWPA 3IDAA 4UHFA 3H2KA 1CUXA 3FCYA 1BN7A 2WTNA 3C6XA 1NX9A 5EIEA 4HZGA 4GECA 5AK4A 3AILA 1F8UA 4EHBA 3VXKA 3WK5A 4HVTA 1Q0ZA 3GUUA 1CUHA 1W76A 3QM1A 2O2IA 3ZLVA 1DX6A 4AMZA 4S0XA 4PO3X 2G5TA 3WK9A 4CIBA 3PICA 4G9EA 4ZXFA 2CZQA 1JU4A 4JH0A 2WJ3A 4FFVA 2PX6A 3HEAA 5K5EA 4A23A 1CV2A 1XZHA 1XZEA 4Q34A 1JMYA 3GBSA 4N5IX 5CRIA 2AJ8A 5K3AA 3H18A 1VZ2A 3GZJA 3WL6A 3R3YA 5AI6A 5AOCA 3VDXA 4HXFB 4UHCA 3QMVA 2WKWA 5CXUA 4Y2JA 5EHNA 2VA9A 2B4KA 5CT9A 5DNVA 2QKYA 5JARA 4E11A 3AFIA 4X6UA 1BCSA 1ZGBA 1VOTA 4KRYA 4MWSA 4KE8A 5AK6A 2HADA 1FJ2A 4QWMA 3U1TA 3PF8A 4UBJA 4JNCA 2C5GA 2ZJ6A 3BIWA 5JANA 2HU5A 5T4FA 2H1IA 1LPAB 2VJDA 2QT9A 5HF5A 1F6WA 3D5EA 5AKHA 1CUWA 1AQLA 2VQ6A 2Z8ZA 3C43A 1E8NA 1A8SA 4KR0A 1UXOA 3WKDA 3OPMA 1LGYA 2WILA 2OQVA 1R9NA 1YAHA 2DCMA 5AKGA 1CEXA 1T4MA 4CCYB 3KOOA 4Y2UA 2CUTA 5CH3A 5AHXA 5EIAA 1IMJA 1VXOA 4M0MA 1XZIA 3FYUA 2JGLA 3FVTA 5K3DA 3I2FA 1USWA 4B0PA 3G9UA 1FFDA 4OD0A 1PV1A 5DTIA 4DNOA 2WU4A 4WY8A 3TJMA 5JD6A 1EH5A 4PNZA 1H2XA 4BC0A 5JALA 4V2IA 2WFLB 1R3DA 2ROQA 1BROA 3G9XA 2H7YA 5CH5A 1VKHA 2X8BA 5AICA 2G63A 1MNQA 3QPDA 1TCCA 2H7CA 1JI3A 1DQZA 5DJ5A 5DYYA 5JATA 3WK4A 4FLEA 1DWOA 4AN1A 2WQZA 2CMFA 3B5EA 2Z3ZA 2ES4A 4LXIA 1P0PA 5T4HA 4GW3A 5LZ7A 2HRQA 3QYJA 1DT3A 1KU0A 1TAHA 3C87A 3W06A 2OCGA 2C0QA 2OCLA 1GPLA 2Y2UA 4B85A 1QLWA 4MWTA 2PM8A 2GBIA 3LLCA 2C4HA 1ETHA 1ZICA 3RARA 4DNPA 4Y2RA 3H2JA 3FCXA 3IURA 4U2CA 1UK8A 2EDAA 1CUUA 3WQHA 2PUJA 2IITA 2AXEA 3HABA 1UKAA 1XRNA 3I2JA 1HPLA 1UT6A 1ZJ5A 5A7FA 5IVKA 4BAGA 1MN6A 1UZAA 4GXNA 4A16A 1QIJA 2OG1A 1N5RA 2DFPA 5C8ZA 1XLUA 1ZJ4A 3BE8A 3DL7A 5FKJA 3DL4A 5ALQA 3T52A 4G5XA 5A62A 4OCZA 2K2QB 3V1NA 1SC9A 5HQ3B 4J0JA 4BRZA 2VF2A 3WK6A 2XQIA 4HRXA 2HU7A 1IZ8A 1TQHA 3ESDA 4DIUA 2VATA 3KSRA 4J7AA 2PU5A 3BDIA 2C7BA 2H9YA 5ALGA 2IIVA 5H3HA 1XLVA 3V1MA 3BF8A 5HKAA 5K3FA 5CT6A 1P0IA 4C88A 4BTVA 4WFJA 5FLKA 3H19A 5CXXA 4Q3KA 3G0IA 5ALXA 1TK3A 4B0OA 1RWQA 1ACJA 2GZSA 2QS9A 1XZKA 1T2NA 2ORYA 1LPNA 4M0EA 5I9IA 4H7FA 4O08A 3N2ZB 3M3DA 4QLOA 4PW0A 1IZ7A 1LPBB 4K5QA
chains in the Genus database with same CATH superfamily
1W88B 4MW4A 1BFKA 2Z9DA 4RBNA 4XD7A 1UFOA 3EZ2A 4MV3A 1WB4A 3WIBA 1JHOA 1QHEA 5IC4A 2GAJA 3MLEA 1M54A 5KSYA 3E05A 4H27A 4MKHA 2WMYA 4LQ4A 1EJ6A 1C80A 1Z6ZA 2PV7A 2PRJA 2OHIA 3TOZA 4DZZA 2Q2WA 4F38A 4YAKA 4ZMSA 3RYIB 3DZKA 1HKUA 2VXBA 4IFBA 1YZYA 5HDQA 4DWJA 4IJUA 5A6VA 1GU7A 2B8JA 1ESNA 3QX7A 2JFQA 1H5NA 4HDNB 4GPBA 2DQSA 2I7DA 4RLFA 3BWMA 4WNIA 4ZT4A 5IYZF 3ZBUA 2QENA 5L7TA 3ME5A 3ZW9A 3AL2A 3WNBA 4YV7A 4L95C 3GZNA 2JLRA 2VHEA 3IOYA 2ZSHA 3LZ6A 2QRGA 3PUIA 4O4JA 1DAFA 2GJ4A 2KJQA 2BBOA 4BQOA 5B55A 5C7OO 4NG5A 2A1UA 2JH8A 1BCRB 1CUCA 1QP8A 5K8TA 5EQTA 3MIIA 2GT1A 3A28A 2HJGA 4YRZA 3QKUA 4IVNA 2D5IA 3EQ6A 3LY5A 4UARA 3ZYCA 4WTOA 4AJOA 5HIKA 2CB0A 3K9WA 5COAA 2IYFA 1JN0A 1B3RA 1UBMS 3RC1A 5IJ9B 5FNVF 2PSSA 1XNQB 2C0CA 4C06A 3UHJA 1G5TA 2DJ5A 3CR7A 2QOEA 1Z4NA 5LJIA 1E3WA 4Y6SA 1U28A 2O1XA 4JLJA 5IDYA 1REQA 4D25A 3SR4A 1T6XA 2BMDA 8ABPA 2XT9A 2FVYA 2X4DA 4IQ0A 4LYGA 4X44A 2WWYA 3EZXA 3QPAA 5G3ZA 1J1ZA 1CJMA 4KVFA 4YY3B 3LRPA 3PX3A 4EJMA 1D2GA 3ENKA 4OI2A 1B8PA 3H8VA 2E5WA 1M34A 3MRXA 3F74A 2G7MC 5H59A 2FZEA 4IIEA 4IG4A 4NOLA 4TZTA 3W9YA 2AA3A 2F8LA 3Q5DA 2ONKA 5DM0A 4MKGA 1WMEA 4UPDA 3HCBA 5CVVA 3UK1A 5BMVA 4CMKA 5G0VA 3QFTA 3H2HA 1WABA 4RKRA 2UYCA 2O7VA 4HQFA 1H6DA 4TKVA 4UULA 1WVMA 5I7VA 3C6ZA 2DX7A 5IARA 5F1OA 4DZRA 4Z4CA 3WGVA 4CMAA 2F8SA 2AJLI 1H2WA 3PR3A 4IYRA 2J1LA 4XYGA 4ZXPA 3WNVA 4CUZA 1XROA 3DA8A 3U3RA 3SVTA 2NUAA 3C1AA 4MGYR 5CLLA 2JHAA 4AYTA 3MD0A 5ISMA 2C98A 4ZT7A 3CZ5A 1HEYA 4YLGA 4TMYA 2DU8A 5AW9A 1F2VA 3L0OA 1R8XA 1U4SA 3U39A 4ND5A 1TJYA 4QIHA 5TNXA 3QMMA 1NF8A 2WPDD 4TKUA 5FPSA 1CR6A 1U7PA 3RC3A 4JLAA 2E48A 2QL6A 2HXYA 2YHIA 4I9GA 2Q3EA 2MYPA 3UT5B 3F4LA 4G56A 2PKYX 1CLUA 1Q1AA 3NETA 1QH0A 4Y2PA 4B17A 3G7NA 3H65A 3LWBA 2C2XA 2V03A 1KWGA 1TD1A 1UBEA 5F7XA 3I76A 2H2FA 1YBFA 4TWZA 5LU9A 5ALNA 3WQQA 4Z1MA 3E3OA 2REBA 4G3XA 4J2TA 4M6WB 3WGTA 1QZZA 2UVDA 2DQZA 1YZLA 4V38A 1G8PA 4CLOB 1XAHA 2V3VA 2Q6LA 4OP1A 3LPLA 3P5SA 4IDEA 2XOKD 3FKQA 1HH4A 3ELDA 2FSGA 2C2MA 2IHUA 3SX4A 2QLNA 3LUHA 4IDAA 3WZ2A 5CIQA 4L72A 1DZ3A 2PBLA 1DC4A 3MQ4A 1SBYA 3RYHA 2BE7A 1DHTA 1N75A 3V8RA 1A4RA 2MSLA 1HDIA 3N70A 4CF7A 4NZMA 3EPLA 4NZ9A 4MIOA 2Q7DA 1J0XO 2I7XA 5HIIA 1XTQA 1JIXA 4GS5A 1QBKC 1QONA 3AXTA 2FPGA 1Z5UA 1UJNA 2XRZA 2JIOA 4KE7A 1JG1A 4Z86A 5DTJA 3S44A 1JLLA 1M0SA 1KZ4A 3GWZA 1E1YA 3HUFA 4EF6A 2CGEA 1NNEA 1BTOA 2E4VA 4OQYA 3T7CA 5EINA 1G98A 4KO2S 4JUIA 1R9MA 1E6WA 2IXAA 1E7QA 2AFIA 3B2QA 4N8DA 4QXQA 2CXUA 5FV4A 2EKLA 1M3SA 2QVZX 3E3AA 5L95A 4OMFG 3B13B 5K20A 1V1RA 3LQYA 2CXTA 1FSPA 4DR7B 4ZOQI 2ZSIA 3QXCA 1I5EA 4HH3C 2XYRA 1XTZA 4PG5A 1UKYA 4FR5A 4G4GA 5TEWA 2GF0A 1Z2OX 4DJFC 3EDRA 1PR1A 3SQNA 1B0PA 2VDWA 3RVMA 4KITB 4HATA 2XUGA 2A14A 5THXA 3DVRX 2J5BA 2A7XA 1M1NB 3GT3A 2OL4A 3NHSA 5KJEA 5JCZA 2YUTA 1IQRA 4F71A 1DAHA 3PLNA 2OENG 3DAGA 4BL5A 2GKGA 2WYUA 2XOEA 3NDPA 2OFOA 2WD9A 1BW9B 1YVPA 1G8YA 2XTJA 3ANSA 3JW8A 1UBOS 4P98A 4PHTA 4W8HA 1JSXA 2PMFA 4YN3A 1VRVA 1YMQA 4FU0A 2Y0EA 1SKYB 1NYLA 3UY4A 4BZWA 3ZTTA 2WE7A 4TZ0A 4C43A 4QBHA 4TQGA 3CPJB 1JT9A 2RGBA 2C20A 2PHZA 4UQOA 4D5EA 1XMQB 1RQNA 4XUDA 3ZV6A 4F7DA 1J7JA 3GIDA 4C4RA 2AZMA 1HNZB 5KTSA 1ISGA 2X7XA 5G0WA 3I58A 3KAJA 1TJ4A 1TQ6A 4AJHA 2QMYA 3QLVC 1BE0A 2CL6X 4FHGA 4B3CA 2Y2VA 1IPFA 1A8PA 4C4YA 1TYEB 4DR4B 3IQGX 3B1ZA 4XR9A 1MOPA 2AQHA 4KSCA 5IHXA 1T2EA 4MRRA 1E59A 2WJGA 3BXEA 2CXXA 3PPVA 2OBLA 2RAVA 4Q7LA 3IE2A 5CYOA 4HFNA 4AL4A 3OCUA 3RABA 3ZGYA 3IBYA 2X8LA 1ZSNA 1NVWQ 3U0VA 5CTAA 4ZVSA 3RHTA 5HWSA 4ZYZA 2FUG6 1P91A 1LJLA 1LDEA 3IUJA 2JRCA 5BW6B 3ZWKA 3BH0A 4MIKA 2A30A 2P7IA 2PVSA 3IAAA 1T5HX 3AEKB 4JI3B 5B6IA 1XPJA 1N4DA 2B98A 3OD1A 3EZFA 1KDZA 3THYB 1OU4A 1R16A 2UVPB 4Q9DA 3ZH2A 4CQLA 2W22A 1WOYA 5EIBD 1DWUA 2WF5A 2HK7A 2IA5A 2VPWA 1L7VC 4II2A 4OYLA 4X7PA 4BXOA 4GPAA 3KTDA 2QTAA 1U7DA 4NBWA 4YROA 2WSIA 4C0XA 4F9GA 3AJAA 2FUNB 4TVBA 5HM6A 3BHMA 3OIGA 2OBXA 4KPUB 4PTZA 1G2PA 4IHAA 2AZDA 3ZPXA 5D6OA 4ZI5A 5TJHA 3T15A 2C0PA 2ZUBA 5HOQA 3WA7A 1BA3A 3GDFA 1M0TA 4HVLA 2G80A 2H08A 1STOA 3F5MA 5DASA 3TLJA 1ZS9A 3SQXA 1W96A 1PZHA 3IRVA 4CM1A 5MFZA 3SM3A 5C37A 2FPPB 5A5GA 1F0PA 2C2OA 3CF4A 3H1PA 4FFOA 4KKXB 2L69A 3G49A 1UXJA 3HBJA 4PQEA 1K75A 5L4NA 4KPYA 2V6GA 1ELOA 5DBOA 4TLCA 2O57A 2FX5A 4YCBA 4NCIA 2YWGA 2J41A 1F6DA 1RI1A 4L76A 3HCAA 3VPGA 4FMBB 3ETHA 2JIPA 1YR1A 1ETUA 1CQIA 1CQZA 2PKEA 2RFLA 3OWXA 1ZRHA 4I08A 4QUKA 5FHQA 3U44A 1A8UA 1E0JA 4DA4A 1NE7A 4OI0A 4HB4A 4M9QA 2IOFK 1NKVA 4CMIA 3IUBA 2XA2A 5EIFA 5IABA 3V9AA 5KQRA 1GM5A 2XXAB 2P2LA 3MMZA 2YV3A 4D56A 2XUPA 1UK7A 3P97A 4QDTA 4X95A 5AM2A 2LDXA 2AK2A 4LHWA 5FNZA 2ZBEA 1L7QA 3JYNA 3VU3A 1AUXA 1ONBA 3IIKA 3B6MA 1QG2A 1R66A 3DEAA 1GUYA 3LLSA 4ZRMA 3R7DA 3HVUA 1QIGA 3O90A 5BOSB 2P6UA 4JBNA 5I51A 1L8XA 2QRZA 1UBRS 1MNAA 4HHEA 1JR4A 3UOWA 2WPNA 4G1VA 1RCTE 2P9YA 1F20A 2NUPA 4IP0A 4JMLA 5FL3A 1R6AA 3Q85A 5CYGA 3GLHB 2WV9A 4FFLA 4Y1EA 3HDJA 1TIPA 1QAQA 2DFNA 2WUWE 3EASA 3GEPA 2VS1A 2Y1EA 4KTVE 4M8KA 2CNWD 4NBRA 4BOYA 4EIWA 4ENUA 3OUZA 2J0SA 5ITZA 2PGNA 4KLRA 4PEVA 1TEHA 2P75A 4IICA 1YE5A 1QF7A 2OSBA 5P21A 4B46A 1U4NA 1TT5B 3R7LA 2NOAA 1ONPA 2ZYAA 3AHIA 3IHKA 3OY7A 4Q1VA 3GLUA 5KVSA 4JV5B 4N39A 1GZ6A 4OL9A 5MDHA 4WESA 3LVFO 1WB9A 5AM4A 3SX2A 4WOCA 2NSJA 4FC7A 3SCZA 4BBAA 1MEOA 1FX1A 4URWR 4S0ZA 4ZDKA 2R5NA 1E9SA 3EZ9A 4A9AA 1TJNA 4EDHA 1HDEA 4IMJB 2YMLA 3EIEA 1IRXA 2EXXA 4BQFA 3UWOA 1S6YA 2HCFA 5CEFA 4FFWA 4WY5A 1MJGM 4NU5A 4IIBA 5CLIA 5K8LA 5GQSA 2VP5A 1N5LA 4AC9A 4BVJA 3L8MA 1LDMA 2ASVA 3SYMA 2FP4A 4E32A 4FDAA 4D8TA 1RE0A 2P5TB 4JLKA 1NU8A 3GAFA 4KVZA 3NKLA 4KG7A 2MSWA 1H6CA 2P9EA 2WD8A 5JXWA 9ATCA 2VL7A 4UAVA 3OURA 5EZSA 4BKUA 3LK7A 3FYDA 3F6CA 4ECAA 3TIFA 1GAEO 1I9CA 3EIHA 3KDPA 1NXSA 3DOUA 2XE4A 1B6RA 1OLUB 3G89A 3FW1A 5F12A 1DNPA 4C7OA 4ITUA 5ELXA 3E8XA 2C2BA 3OJ0A 1A76A 1U11A 2WKQA 3LP5A 3FJ1A 3AGPA 1G0OA 3L6DA 5FBKA 4LSZA 3O74A 2VAVA 1NP3A 2E2WA 3QQ5A 4DLWA 3CISA 3IT3A 4K6CA 5MN4A 3RR2A 1C8LA 2AKYA 4YRRA 2RAPA 1EDEA 4CKWA 3P2YA 1I3NA 1EFRA 4DXDA 2KSQA 3KUKA 4Q15A 2GR9A 4L5YA 1XJ5A 4BKRA 3JATB 4KH1A 4TL8A 1AHHA 3N8NA 4RJTA 3QG5A 5JEEA 1TI7A 4ZODA 3HVKA 2NXWA 4OH1A 3B70A 4S12A 2RHOA 5EMKA 1YUBA 3PDUA 3IKTA 1OE0A 3DQZA 3Q3IA 4YCNA 2QYSA 4JLOA 3R9KA 3BILA 1N2JA 5J2UA 3IE0A 3WLHA 2G5GX 1SUIA 3BMCA 1E7YA 1PI3A 4GD3Q 3QOFA 5HIAA 1G55A 2BSXA 4F6RA 3P0RA 1YVDA 1PFKA 1A27A 2C2KA 1E1RA 5IVDA 2AOTA 2H63A 4KAFA 3TPZA 1OLSA 4JBIA 1CX9B 1FSSA 2C78A 4R5MA 1URPA 1E66A 2D1SA 4J7UA 4K7JA 1M1YE 2PA0A 1P31A 3EC7A 4OAOA 3RNLA 3BF7A 2V9CA 5K7SA 4UEWA 1N7JA 3EVBA 1UKZA 2FR8C 3VO2A 4OM7A 3V3KA 4UM8B 3NCHA 4M55A 4NYMQ 2ZETA 2BVNA 3IV9A 3EVFA 2Z9CA 4YQEA 2V55B 1ZSVA 3KJHA 1CIPA 1GN9A 4RZ2A 4JI4B 2ZVPX 4JOBA 2QMQA 5ER6A 3GCDA 4JT9A 4RZSA 1YL7A 5DNUA 3ZU4A 2ORIA 2PKQP 3U7IA 4UXHA 4CV1A 2QM0A 2QV0A 4G09A 4HKTA 3FVWA 5J40A 1EFKA 1E5VA 1GYQA 3NIWA 1U5CA 4BECA 1A82A 4J0KA 5DLDA 4Q7QA 3JZIA 4LJYA 3BDVA 3OQIA 4XJSA 2FZ4A 2QRLA 2NQ2C 2X19A 2GN9A 2NXNA 1BXGA 1RADA 1VIVA 2IYOA 3PUXA 2CE2X 4M0DA 5JY1A 1KDRA 4M54A 4EGFA 5LP6A 1ZD3A 2AMFA 4TV9B 2EEZA 3PI7A 1MC5A 2QR3A 2HDOA 2IELA 3FWZA 3CONA 2OMEA 1K8ZB 2XIQA 1ZM9A 1C30A 4A73A 1NBME 2POQX 3IIMA 5DEOA 4Y6RA 1U0HC 3ILXA 1PTJA 2W8ZA 1XRSB 2WJVA 3F9IA 4M8SA 1QQTA 3ZE0B 1R15A 4KNYA 1MEJA 4P4LA 1TKCA 3KT8A 2ADMA 3IAS6 3QKSB 1L1FA 4OJTA 1OUMA 1KQPA 2HI0A 3HB0A 2KB0A 3PDIB 2ECOA 4F4IA 1NUUA 4GT1A 4WVLA 4BX8A 4EMSA 5A1TA 5JTUA 3F9CA 1UDCA 4HAUA 2F9FA 1FXWA 4FPXA 4JLMA 4OUDA 3E48A 4JJFA 3A9SA 4YUZA 4RPLA 3CV3A 3RWBA 3ZKAA 4P5PA 4IWXA 4P92A 1M2OB 4IAOA 1A77A 3Q88A 3QY0A 3ZJVA 3CUEF 3I9MA 4C3VA 1UDWA 4WERA 4GUDA 1C50A 2YBEA 3VH1A 5KU1A 4PVDA 5BV2P 1RXVA 1PFYA 2HWUA 4EG3A 1Q1QA 1J2EA 3WFZA 4KR2A 1WULS 3MWGA 5ILQA 3JARB 4MS3A 3THXB 2R1ZA 1YS6A 3KTAB 3NGLA 4FINA 4JHXA 3KEMA 3QTLA 1AGRA 4ZQBA 1VCOA 2VJMB 2F1HA 1AF4A 1NKTA 2FPIA 4R8SA 4KQEA 3LT1A 1I30A 4JBWA 5CLFA 1SIUA 1V4NA 1XD9A 3NW9A 3P4UA 5CHYA 1T4GA 2ZROA 2BGGA 1YDMA 2HDNB 4ZQFA 1FFHA 4BRUA 4CHGA 5A2GA 1O9GA 1FDSA 3L0BA 4H18A 1N6HA 1MABB 4P84A 4RACA 3U48A 4AMYA 2IYRA 2HA2A 3LW8A 2SKEA 1CERA 1HXHA 4WXRA 1AC5A 1XVIA 1EP2B 2WLTA 4L5JA 5IC5A 5KX5B 4CMHA 3AP3A 1H1LB 3MD9A 1IUOA 4ZPXA 5KKAA 5D84A 1ML4A 2RG1A 3W78A 1Z3IX 3IT2A 4AXXA 3OJOA 3AY0A 4X8LA 5EIHA 1R6TA 2HJ9A 4GZLA 5DT2A 1YFKA 3TVTA 5AJHA 3NV9A 4C4OA 4MWEA 2NP7A 4EX6A 2LW7A 4O6VA 3TF5A 5CR9A 4QPPA 3I3SR 1IE3A 3E15A 1T8PA 2PQ0A 4QJIA 3TGWA 5JEDA 4HNAA 10MHA 1T1EA 5F73A 3R4CA 3DR5A 4JEHA 3WK7A 4A8JB 5B3LA 1ABBA 3HBMA 3T7IA 4NOJA 1SHKA 2AW3A 5FOVA 1AUOA 2C9ZA 4ZDWA 4ZZ0A 3TGLA 1FFCA 3WWOA 2JATA 1N4AA 3LC1O 3KLBA 3LUDA 4HWRA 1Y7TA 3VPBA 3U4DA 3U60B 2FOIA 5DIZA 1PFWA 1MRSA 1VZ3A 3BULA 5F4BA 4BY9E 3AKEA 2QZZA 3GD7A 1MCZA 4MO2A 4P7GA 4JBXA 4RGVA 1QH1B 1OHHD 4DWWA 4MP8A 1ZD8A 3OOSA 4RDCA 5L3SA 2XCIA 1P5HA 1Q44A 3A1EA 2OWEA 4M0CA 4FHFA 3ANMA 3V1LA 2DLDA 2G1AA 1Z7YA 2CHFA 4KGZA 1Q19A 2EFJA 4R84A 2WHEA 3NV7A 2QVCA 1EFDN 1XQ6A 1IY1A 2NX2A 2YZKA 3ABQB 3CZ4A 3QXSA 5F78A 3S40A 3N6VA 2FSHA 5ICEA 4M9CA 3W90A 4LV5B 4QSMA 4H6WA 3FMFA 4G1EB 4YRIA 2VVTA 4FYWA 2IEGA 4J0GA 4D9JA 1WJGA 5KC9A 2P5SA 4Y2GA 2PZAA 3LFTA 4O2LA 4RETA 1RBYA 4XQEA 1FDUA 5F1PA 1HV8A 1ILWA 1ZUNA 1Y7LA 3TM4A 1GO2A 3AOGA 2CLSA 2Y67A 1KEVA 2BUCA 3K9BA 3N76A 4M1EA 4BWFB 1RWWA 4LY6A 4F4FA 1OH7A 1TGYA 4BLQA 1Z18A 1NGSA 2FQQA 2JZCA 1XRJA 1ZD2P 3FYUC 4BX0A 4KEAA 3UAOA 2W48A 4PX3A 4BP9A 1J5EB 2G7ZA 4FMCB 4PHCA 5CFMA 2AXQA 3LS2A 5E2AA 4P35A 3EAGA 2WHPB 1U7ZA 4B4UA 1NJ2A 1RZVA 2AF3C 1DC5A 1N0HA 2AZTA 3GFFA 3SC4A 3AUKA 3B2EA 3O3OB 4Q12A 4QYXA 2WUVA 3BA1A 5CCDA 1ZD4A 1DMSA 1IB6A 1RABA 2VJLA 4MR9B 3ZHSA 3C7AA 5DXFA 4P7JA 4E88A 2Z2YA 3EGWA 4X0EA 2PYIA 4QU5A 3BYZA 4PLHA 3A1WA 2P1ZA 1HI9A 1SVOA 1YZQA 2JI6A 1M1ZA 4EFLA 3QU9A 3A6KA 2ANBA 2FRVA 3EXG2 3OIFA 1UBSB 4YRFA 1KRWA 3GRAA 2C7RA 5A3QA 4L8YA 2B94A 4UBLA 1JLKA 3ONEA 2Z09A 3HDGA 4BWVA 4ETIA 2QAGA 3ZWBA 1DXHA 3WGMA 5AVWA 3MWLA 1EE9A 3WWDA 2OZLB 2JFFA 1Z0ZA 2A5DA 1EZ1A 3BH7A 1N8TA 5A3JA 5EXEA 3TRHA 3AL0C 3THSA 2ZXFA 3HZRA 1WU7A 1QRRA 1ZCJA 2BFFA 4NICA 3C0KA 3LH5A 1BFUA 1KR2A 4AZ0A 1MJFA 1RM0A 1V3TA 1ZYUA 1HT0A 2YZ7A 3NO4A 1VYHA 3OOHA 4EBFA 1A2QA 4L3VA 4UNPA 1VI2A 4QICA 3M5WA 1Z68A 2BFEB 4B7UA 2B37A 3F4BA 3Q7QA 2QHXA 3Q6MA 3GPCA 3K1JA 3M2TA 3ZZ0A 1JDNA 4BIMA 4NKRA 5A3VA 1OFVA 4OFBA 2PU7A 1F17A 2NZ2A 1SC3A 1VE6A 2VJNA 4Q05A 1C9YA 3GJ4A 3WLEA 1I4TD 2X14A 4HDMB 5FWYB 3FDZB 5BSHA 1VG0B 1E79D 1SXJB 1FUUA 4EJSC 2CWDA 3JQFA 1WKCA 5FJIA 4PHFA 1CEQA 2VPXA 3A1FA 1AMOA 1M6WA 4LZZA 1K5PA 4CUJA 1OAAA 1O5IA 3LQFA 3H9QA 5TRTA 2JJ2A 2I1LA 1VHTA 3X1KA 5IYZB 4L6IA 2OCPA 2FPMA 2P8JA 1KO8A 4YQFA 4OB8A 3B89A 5CB6A 3FG9A 3S99A 2PMCA 5K9ZA 2BF4A 3NWPA 4MQBA 5HBRA 1YNSA 4IIJF 2C8LA 3EXFB 3AINA 1TAUA 3QG1A 2W00A 3FUVA 4GE0A 4OMCA 4P2BA 4C3ZA 3ORHA 3HM2A 2FK7A 3LK6A 3OF5A 4XVHA 2IU4A 3SD7A 4KV7A 5DLYA 4ZV9A 1C3XA 3GY0A 1G64A 3IUSA 1RQGA 3W7BA 4ENTA 3IQIX 2AFHB 3UK0A 1QIFA 4I5EA 3X1MA 1O95A 1H3EA 1TEXA 4E2ZA 5FNVB 4J2OA 1US8A 3K09A 1UP6A 5FJJA 2ZJBA 1K97A 2OZEA 5A4IS 4ESEA 1K88A 2EF1A 3O91A 3GNSA 3WIOA 3VSEA 2JFUA 2VTBA 4FD3A 4XJXA 3KP1A 1KYTA 5DBFA 5EFOA 1QHXA 5GV7A 3D6HA 5KNBH 5KBYA 2ODTX 3WC4A 3Q9LA 1R8SA 1XTSA 2EKQA 4FXOA 3SC2A 3CBGA 2FN7A 2Y4OA 2QX6A 3BSSA 3QLJA 3G6KA 1AB6A 3HSSA 1AURA 4XDGA 5C51B 1DINA 2I3BA 4C5BA 4G2NA 4ARAA 4MUMA 2G1JA 3L0YA 1PAUA 2FLVA 2AUNA 2CVZA 4AQ7A 4AVYA 2O0JA 1FP7A 1JXAA 3BJMA 2IOYA 2B2NA 2O59A 1GA1A 2X0NA 1VJ5A 2A35A 5UKDA 4JR2A 4ODIA 4RE5A 4Q19A 4ASUA 2BFBA 1BJRE 5IAOA 4PPQA 5ALTA 4ARZA 1SN7A 1KY2A 5CVJA 1WMSA 1JKMA 1T1IA 2XE8A 2Y1OA 3W05A 4IJWA 4Q1FA 2ETXA 3JU3A 4EHFA 2AKEA 3U4QA 4QEZA 1M2NA 2FK8A 1P2VA 1ISPA 5KYXA 2GDJA 1GPMA 1VP9A 3TG8A 1XF9A 4W7SA 2EIHA 1ZINA 3GMDA 4Y67A 1OXBB 4WL0A 16PKA 5CM2Z 4YK7A 5AOVA 2DT8A 2N1BA 4W5JA 4E6PA 5JQGA 3HKEA 1DO8A 4ZU1X 1T9GS 1UC4B 1XJ0A 3MLAA 5I8WA 1QHHB 4Q1DA 3PA8A 1DZIA 3ZE9A 4F5EA 2AI1A 5DHSA 3W9BA 3H5IA 2PMEA 3I0MA 4IJQA 4ZOLF 3WWEA 3MAAC 1XXHE 5JJIA 5AOBA 1W5EA 1ZA1A 3RVBA 3T54A 3H2BA 3R7WA 3KEFA 4MVXA 5F64A 1TNDA 2PS1A 4BAUA 1TYBE 4D6YA 4KPFC 1QO7A 3VRHA 1FLNA 1IH8A 4YYZA 5LNK6 1UMBA 3KKEA 1BWSA 1EEXB 1UIMA 2EQAA 1UZMA 2YWHA 1U0FA 3I9NA 4FEGA 4JR1A 4RA9B 1IY2A 4RZHA 3TGPA 3ID6C 4YRJA 3NEYA 1X8XA 3DB2A 2NUTA 1IXSB 5JIBA 1II8B 5MN6A 1DPFA 1G0NA 2H0QA 1PP4A 1W8DA 4RY2A 1MU0A 3WKAA 2CEAA 1SNYA 2PXXA 1X1BA 2GPJA 1W2GA 2QIOA 3O94A 2DMRA 3AEUB 2CNLA 3C3CA 3ADKA 3WKBA 4CM8B 1I94B 4R2KA 4Z54A 5DBEX 4B09A 2Q0QA 1XWWA 2EYQA 2KBFA 1AIPA 2ISSD 3MWYW 3PFKA 3QVMA 4GEKA 4MLDA 4MMYB 2XUOA 2Y1XA 3IMEA 1JLHA 4HWPA 5JASA 1E2DA 2OB2A 3QFCA 4OA5A 1S7CA 3A9RA 3R5TA 4XCVA 2NTEA 3L1IA 3IS3A 1XTPA 3I5AA 1UBUS 3TJRA 4W5OA 1CS4C 2XPCA 3HWWA 5F33A 1YBVA 3EDMA 4B2YA 3FTNA 3OF2A 3GXOA 3AF1A 4D79A 1X39A 4F5YA 1Y37A 4MVJP 4Q0MA 1I13A 2Q4EA 3KQTA 4NDNE 2AJBA 1EUQA 3HN2A 4TLAA 4PX2A 3U40A 3V7FA 1PLKA 4YAOA 2XTMA 1U9JA 4P81A 2XF8A 1ZZGA 1EX7A 4PAGA 4UEKA 5G3YA 5IVHA 1QCCA 2RH5A 3EXIB 3HP4A 2C3MA 2NYVA 3VHXB 1TC2A 1YV9A 3CLSC 1BEUB 4NPHA 5AXAA 1UUFA 3G2KA 3QVKA 2LVBA 5JMPA 1WUYA 1Z06A 5LDGA 3WL3A 4E08A 1HDCA 4F2WA 3U5TA 1THGA 1U28C 3F6SA 1JH8A 1B7GO 4TXLA 4KR7A 4YP9A 4ILKA 4PO9A 1MT0A 4EY7A 3V97A 2IPOA 2QL7A 5E95A 4C2BA 3DYIA 3C1UA 3RU2A 1WQ4A 2FPRA 5FLYA 6ABPA 4EGQA 3EEIA 4B6JA 2IVFA 4Q03A 2OOSA 3D7NA 4LHZA 4QBGB 4HMPA 3PKIA 2JLQA 2XRFA 4EY6A 4RTPA 2W6NA 3K2IA 4YXFA 2XUHA 4V1CB 5E4TA 5ED0A 4QHSA 3ROTA 3QEAZ 1H5UA 2MSKA 2XY4A 1FQWA 1Z34A 2AJCA 1R88A 3DF7A 4NAHA 3LBAA 3PV0A 4TGLA 1W5FA 2Y68A 3KQWA 3AC0A 3KWMA 2I4NA 3LHFA 4C6TB 3UMMA 3ELUA 3QFHA 4IDQA 3K20A 4QASA 4BFVA 4L74A 1TPZA 4XVQA 4LGMA 4UMFA 3B9QA 3ZEAA 1SCUA 2JZNA 1KMHB 4MQ5A 1GTVA 3PUWA 4YGXB 3U7EB 3V7YA 3N7UA 2FDCA 1XDDA 4CKXA 2O8EA 2VHJA 4LRXA 1J06A 4OQPA 3BJRA 4JEMA 1CJTC 2WJHA 2XSZA 3DQQA 4JJKA 3KYJB 1ODIA 4JKYA 4MHSA 3SZRA 3OESA 4L51A 2HU2A 4C01A 2FN9A 2R6ZA 3KYCB 5J2TA 1L8OA 5JC8A 3VISA 1YACA 3EVAA 1YDFA 3R1IA 4M36A 4Z4GA 1XQ9A 3BMXA 3N2KA 3AUFA 4TLBA 4DARA 4EL5A 2W6PA 4QWWA 1EVQA 5ENDA 1P45A 1IOZA 2HIHA 3DEFA 1D9XA 2X9QA 4ZQGA 3QWIA 1KR5A 3T0GA 5I7RA 2C54A 2FG7C 3F7NA 1MXFA 1YK0A 4Q93A 3G23A 3GGOA 4UD2A 3LP8A 1MAAA 5DGHA 4YH1A 5AKYA 4CQMA 1OFTA 4M1OA 1XZJA 2GWHA 4DRXA 2AZXA 4HO1X 3Q1LA 3R5SA 4DHWA 3FCUB 3X2FA 5CT4A 4ALNA 3B53X 2AIRA 3D0KA 3AERA 5F23A 4PIVA 4FIZA 4XSGA 3NTUA 2N42A 3F2IA 1HZZA 3REGA 1AHIA 4PG8A 4DLSA 4LECA 1QNFA 1RRFA 5CVDA 3IPCA 4FGLA 5IKOA 3ZXXA 5AJUA 3W2HA 4RY0A 4FB4A 1MB4A 1DLJA 3LKBA 621PA 4IO0A 5C8DA 4MX8A 5AW5A 2FN3A 5KCZA 2QMEA 1H2FA 4JI6B 3PHGA 5EWMB 3EMVA 4JP1A 5CVTA 2ZBQA 5D51S 1NZJA 1E94E 4MUJA 2Q9UA 3L6UA 4GUAA 4LAFA 4Q4LA 4WXHA 1AKWA 4JL5A 2VP6A 3OX1A 5JHHB 3U7HB 1OVMA 3ZJ5A 1CF9A 5DP1A 3AR4A 4BJ3A 4Z0PA 4IIHA 1THMA 1C4KA 3GDHA 4HS4A 5DCLA 1GNSA 3DQPA 5AKXA 1OBHA 4QXPA 1LSSA 1SGWA 4Z7JA 2PUFA 4Q4AA 1H4QA 1QP4A 2O4UX 3IXQA 5AXBA 3VR3A 4Z7NB 3PVSA 3BRSA 3OE7D 4FSXA 1H66A 2QBYA 5IHPA 5L7YA 4CVNA 4JT2A 1OXSC 3RVNA 4BQQA 5KMGA 1W49A 3M9XA 1GGNA 2QT0A 3GV0A 2HXGA 4RZUA 4EFNA 4A5SA 4RABA 4S1VA 3IIJA 3CW8X 3KPUA 3U3XA 5DGIA 4BP8A 1EUDB 1RLJA 2OBNA 4ALIA 2I91A 1DXOA 1BE8A 4N0PA 3WKCA 2XLBA 2ZQYA 1ZMRA 3JAKA 1WPXA 2PMBA 1FSGA 2ZJ5A 2OD7A 3PGMA 2FW0A 3UEOA 1PJ2A 1DUSA 2O8VA 2RJOA 3MQFA 4OXRA 4Q00A 3WGJA 5C7YA 5J43A 1FYWA 1ID8A 1QGYA 1VFNA 4N6NA 1UDAA 2I6TA 3CN7A 3HC7A 1F3LA 1B8UA 4HNSA 4L5BA 5AESA 1Y48E 2WWHA 4ZZIA 2NVOA 1QQ5A 3IXMA 4Y2TA 2GS9A 1EE1A 1SCBA 1YL5A 2XNKA 2ZR9A 4AAYA 4BP3A 2W6MA 1H2AS 4TS9A 5JH7F 4B3TB 1DARA 2A9RA 2FUG1 4M9RA 1V8OA 2W83A 1U2GA 1G8FA 1V39A 1P7VA 1CE8B 3BMNA 2ZTUA 5G0UA 5ALVA 3M2PA 2XYVA 4L2IB 5D87A 4GQBA 3D59A 2B34A 3IELA 1J39A 2DZDA 1E2MA 3V6MA 2J9FB 1EK2A 2WMDA 1ISRA 1GPNA 2C04A 3I1IA 2QB5A 3OCZA 4B7AA 4BKMA 4F0JA 1L9KA 1BVRA 4M76B 2ODNA 4OK5A 1GTJ1 2PH3A 1RXIA 2VTKA 2OORC 3NONA 3OEYA 4HTFA 4HEA1 1DRWA 2C4MA 1JDBC 1TK2A 3WXMA 1Y6FA 3JQCA 4UD6A 4GKBA 4E5DA 1M2EA 3KC2A 4KDCA 4LYEA 2YWJA 3ZZTA 4GM1A 1RP7A 3N8DA 1H3FA 2EFEB 1OFGA 4TXJA 4OGWA 2J5XA 5ARCA 2O8FB 4NFHA 4ZCMA 3AF4A 1KQ3A 1ZM2A 2PY6A 1W5BA 3SS8A 2G6BA 3DO8A 3TCNA 4OHKA 1ZOSA 4XI9A 4C7XA 5DGTA 1MW8X 3HCCA 1Q14A 4C1NA 4KYIB 4RDIA 2YJ4A 3DZFA 5C2JB 4X00A 3EEYA 2P3OA 1GUFA 1P9LA 1IZYA 1PG2A 2VBFA 1U5AA 3AEYA 1WUKS 5JR3A 2ZIEA 1JT2A 4UTVA 1SAYA 5JQWA 4PFKA 4LZNA 4JP3A 2DPXA 3COJA 4OIFA 3HDTA 4MW1A 3Q8KA 1CHNA 2PANA 3TLBA 5JJCA 4L8FA 5HMMA 5BRJA 3R0ZA 4MI1A 1TYAE 2Q9AA 1O6CA 3DLTA 4F4CA 1FQOA 4O4HA 3CS3A 4R2IA 3HR8A 2PNFA 1XAJA 3DVAA 2JKYA 4TL7A 1KEWA 3DE7X 2PBRA 1G6HA 2AEEA 3V8BA 3N5CA 4EVQA 1A72A 2DTXA 2M6LA 3PE6A 3K0HA 2R5FA 3AEQA 4KQCA 1LZLA 4E70A 1Z5GA 1P3DA 2B7BA 3DM9B 3PBKA 3PDCA 4OREX 3AQ4A 3UH1A 4KMOA 4R8KA 3VJMA 1N32B 5M29A 2CK3D 2AL7A 4BX3A 1MEEA 4QEKA 2Z0MA 2XDYA 1RJWA 2QVYX 4KBYA 4DWOA 3PVCA 4X71A 1D2NA 2RCYA 1Y3HA 2DHQA 2Q6OA 2QRVB 3IHWA 2OXEA 2SNIE 4DM7A 2J30A 4X45A 3ROZA 4WVFA 3DF9A 1QU2A 3QTTA 1U9YA 3C3XA 3E9NA 4A2WA 2O8CA 1TLLA 1F2UA 4KLAA 3OZFA 3W9SA 1ULHA 4AZTA 5KPDA 3DFMA 4JKOA 5EN4A 5JRJA 1UQUA 2EQ5A 1FRZA 3JYPA 4P7BA 2YHAA 1M76A 1UOPA 3KTFA 1T3LA 3T7DA 4EW1A 2B7LA 2UZAA 4L02A 2C94A 4U39A 1B00A 3LY8A 2GK6A 4FBMA 3WL7A 3UK7A 3HKCB 1B16A 2HCTA 3PFWO 1E2PA 2AFRA 4W1PA 3W2EA 2Z4RA 4WOBA 5DEIA 4OLAA 1L4GA 1V9CA 1E5TA 3D64A 2X0DA 3VI3B 1QK5A 5G4LA 3QELB 2ZDHA 4EITA 3DE6X 1KI6A 4K40A 3FGPA 2PO7A 3ZLUA 3UJ6A 1AJEA 2ZVDA 1N8NA 2RHWA 4LXHA 4UXJA 2VJAA 4G5QA 1ORWA 1VKOA 4L57A 1MX5A 2N75A 1Q1ZA 2QYTA 3FM9A 4INZA 3SHOA 4E4RA 5JE8A 2C3PA 1YA8A 2LP4Y 1EINA 4RVDA 2P68A 3S7ZA 2Z8XA 3C39A 2XW6A 4Z9FA 3W77A 4AZVA 3WJ7A 5BN5B 4CU2A 1E6CA 2J9RA 4PAMA 2AG1A 3CINA 3HA7A 1EUCB 2LTAA 2X0RA 3PQFA 4XSHA 3NWBA 4XVCA 3IVXA 1L7BA 4PFQA 4DV3B 1ZM3A 3UJHA 2B8TA 2N1MA 1Z5OA 3LA8A 5BSKA 1VPLA 1X7HA 3CLTC 4NESA 5IWCA 3FLEA 5CCBA 5EI5A 3H3JA 1Y3AA 3GLGE 1SBCA 4QC2A 5C32A 4H3SA 5G41A 5CA0A 3F6PA 1C1YA 3NATA 4JFAA 3VUFA 4YRDA 4C0HA 1E1CB 1YWGO 2A5JA 2JGJA 1U3VA 5DZSA 1M1YB 1DU4A 1D8AA 1MO5A 1O08A 5EXDA 1WBJB 3X44A 4CKYA 5CD1A 1DFGA 1KF0A 5HA5A 3ZUGA 5IH7A 4K6KA 3EW9A 2RB4A 3B82A 5B1SA 1XMSA 5DFAA 3HUDA 1EGMB 4JLNA 3DW3X 1ZD5A 3NHYA 4FC6A 4UUQA 1RZRD 2PVCA 3CKYA 4A4DA 4LQLA 1XVVA 1NASA 1PGQA 4M1KA 3KU1A 1ZGGA 3QHAA 2HSWA 1QIMA 3EF1A 3EZNA 4I5GA 1KAGA 4GX1A 3CRZA 4IUDS 1QF9A 3FTDA 2HLDD 1V7QA 3R3VA 4NZZA 4CTOA 4TYNA 3A1NA 4JT4A 4WN3A 2FMXA 4YRCA 1F5SA 2FDRA 4DZTA 4K03A 1XDGA 3CMCO 1SWVA 5FB3A 3UG6A 4HQNA 4B3IA 2QAJA 1OTHA 1N9KA 3UJPA 5AW1A 4S05A 3C3MA 4M0KA 1OCEA 1NFFA 1N1MA 2GASA 2HNAA 4TROA 4JX9A 4L8WB 5EZYF 1XQVA 4BMNA 3DEIA 1YQEA 2JK0A 4WOKA 1G5IA 1GXSB 4DQKA 5SZHB 4AUEA 2JI4A 3T5GA 2JPDA 1TJ5A 4PIPA 3WLMA 4EUKA 1X1SA 2JI9A 3MUOA 1MF7A 5BQPA 2CKMA 5HFNA 1WY5A 1VA5A 4EPRA 4QFBA 4B9EA 1NY6A 3U7FB 2G72A 1MV5A 2FH5B 2R1VB 4E1AA 4KMSA 4DANA 3BERA 5ALFA 3T6KA 3L7IA 4YS6A 4RNCA 2P6RA 4LXUA 3B6EA 1OZAA 3KV1A 5FBQB 1ZMXA 2HYDA 2JEZA 4NPCA 3TD9A 3UKOA 4N3AA 4P0PB 5BNIA 3TSOA 1UBKS 5FPPA 1MQ9A 3W2GA 1HZJA 2WM2A 3C74A 4Y7CA 4UTNA 5FULA 2NYAA 1MOZA 3AJDA 2HC9A 4R16A 3RK1A 2ZS7A 2CCKA 4B6PA 1BXRA 4NMWA 2Z4TA 3NIGB 1X1RA 5EJEA 2B6HA 1SR8A 4MJLA 1YI1A 5L7WA 5IM4F 2REQB 3IAS1 4RK0A 1JILA 3JVEA 3VDRA 1OPRA 1QE0A 1VYTA 1Y8QA 2G28A 2IZOA 3AX6A 3C85A 3O4HA 3ZCUA 3S81A 3K0SA 1RHKA 2MIIA 3NBAA 3QHQA 1AO0A 4XD7D 4FCWA 2ZVJA 3ON5A 2VTVA 3WDLA 2P0YA 4BB0A 2WC1A 1CR2A 3HNPA 5KOHA 3KSMA 4IH4A 4BJ1A 4Y2HA 3M5CA 1G9TA 1CUFA 1G4HA 1LVGA 2J6CA 3HRKA 4HP8A 3PXGA 1DV1A 4LRSB 2XXJA 2WP0A 4YRQA 1HLGA 2NU8A 2HQOA 2KBEA 1DDOA 5TARA 1QP7A 4YJ2A 3ETCA 3LUKA 1GZDA 1UKEA 4P3NA 1X2EA 4Y30A 5BWNA 4G1FA 4RNDB 2EJUA 1E64A 1WCV1 4FT2A 5MFPA 3COYA 1XEXA 3MGCA 3ETEA 4MKXA 1CUYA 3FTQA 3FTFA 5CDFE 3HNOA 4BATA 3EYAA 2EBFX 5LP6C 4D8VA 1MW9X 3RU3A 3W3AA 2NVUA 4TXMA 2AMVA 5AKKA 4ZT6A 2YRWA 1ZNXA 2JCBA 4Z7OB 1IVNA 3FRJA 3KJIA 1L4HA 1Y6GA 2XGJA 1H2RS 3BC1A 3VKFA 4PS0A 1PTJC 2IL1A 1NYRA 3LL4A 3IHTA 3VKUA 3AF3A 4OB6A 2I3GA 5EC8A 1UZLA 1U3FA 3CLSD 1PG0A 1THTA 1VI6A 2OZPA 3UGJA 2HHHB 2CXQA 1IONA 3Q9UA 3W8DA 5H83A 3ICOA 4Z51A 4G8JA 1Y3CE 1O9HA 1SCKA 4QGHA 4COOA 2RK3A 5KYYA 1GZVA 2DPLA 2PGOA 3LP6A 2PUVA 2COEA 2W6OA 3T1OA 4CWAA 4QLAA 3KVVA 1T2VA 3WLIA 4EH1A 1XCLA 2O23A 1EVLA 1JVBA 1N78A 1SO8A 1XI2A 3P0EA 3U7QA 4LOLA 4ESHA 3D9QX 3OZSA 4NCKA 4IDCA 3EEQA 3PIDA 1B23P 2A88A 4DQ0A 3KSDO 3GLIE 4LE0A 4NXMB 1A5AB 5AUPB 1NF2A 1XLWA 4QXRA 4QYIA 3HU2A 5KHAA 2P2DA 4KOAA 3H16A 5DBIA 5IH3A 4NECA 3GRKA 3AGQA 3V3TA 3VYTB 1O97C 2XJ9A 3ED1A 3TTXA 4B8YA 5C4MA 5IT0A 2H2GA 2GKOA 3AR5A 1YRLA 4I4CA 2EZ9A 4MVYA 3O2QB 3L4SO 3ZS9A 3GRPA 3F8SA 3L41A 5AJZA 3X1ZA 1XCGB 4RSRA 3NUGA 3LQKA 3W9UA 4NAVA 2WZCA 4XUGB 1ODCA 3Q11A 2QN2A 4CF3A 4O5OA 4UJ3A 5DHTA 4BGDA 3WV4A 5KNDA 2C9BA 1UDBA 1X7YB 2IGTA 3JZMA 4FKZA 3QKIA 4YV2A 2P77A 5FFMA 5T64A 3RAPR 2C5SA 3OWOA 2V3WA 2CUZA 4DQUA 1GT6A 2D1RA 2CD9A 1JJFA 1SUDA 1DIBA 3P32A 1YJ5A 1IXRC 1NT4A 2R6JA 3SF8A 1QC5A 3QX9A 5SY9A 1UBLS 1P77A 1YZNA 3L7BA 1FRNA 4JYAB 5LR6A 3OC6A 4Q24A 1QFXA 3UAZA 3DZGA 3Q9NA 4FHZA 4V0OA 4ZQIA 5G0TA 5A9RA 1NXOA 3N74A 3U1VA 4DSAA 3GDOA 3QA3E 3OLYA 3FMIA 1DCMA 4U7FA 1Z4PX 1HR0B 2QX9A 1Q7CA 3CX7A 4ZALA 1XK7A 2Q50A 4ZKDA 1A9ZA 1DQRA 2JJMA 3N0XA 4J7XA 2H1WA 2M6SA 1SCNE 2ZWVA 3IVRA 3L0ZA 3QF4B 5KTKA 4DE5A 1Z29A 2BISA 2GHQA 2XB2A 1T2FA 4Z1MD 5ALLA 2XNDA 4XGQA 1WD5A 3AI3A 3QVOA 3FI9A 4ND7A 3ZY5A 4ML3A 4UTXA 2OEPA 2B25A 2BMAA 3C98A 3CUWA 3OJWA 2O19A 4IIJB 2O1WA 3GMTA 3PD0A 4B4KA 2R5WA 3SYLA 9LDTA 3GPLA 4KFCA 4DUPA 2PJRA 1DOAA 2PZLA 1CDEA 3T0FA 4DJAA 4BEWA 4D0RA 3CWZA 1W88A 3N3AC 4GPTA 5F2OA 2FMKA 3GH3A 4E5MA 5LXTA 3ONFA 1R0YA 2GEJA 2H7XA 1P1KA 4N8EA 4HB0A 3ZX5A 2B4RO 4OYHA 1LF0A 3BA6A 1X77A 3QE9Y 3WLOA 1A9OA 2ATXA 4XPZA 3L8CA 3GROA 1LLQA 3RYIA 5DK6A 1XLTA 1KH1A 2VR1A 5DK4A 4Z49A 1MFZA 3OQOA 4ZEVA 3PEEA 9LDBA 1VGQA 4UM5A 4YMVA 1ZRNA 3KVNA 4WNCA 4G0UA 5I9LA 3VC7A 3D3EA 4UUOA 2ZSKA 3T61A 3ZU6A 4DV7B 3CU5A 2NP6A 1QIHA 1U8XX 5C3MA 2AI2A 1VKJA 3K92A 3LUCA 1BCRA 1W0JA 4EG6A 2I4IA 1BAPA 1UPUA 3IDQA 3GN1A 4U02A 5FO0A 3WGQA 4DSOA 3ZD6A 2VUSA 4ARVA 1OLXB 1ZI9A 2I4RA 2GDZA 4XVRA 2ZI5A 4EEXA 5IJ9A 1NDHA 1VLZA 2ZXEA 5NULA 4N49A 3KBOA 2XQGA 5KIAA 4BE4A 2P9JA 3PG5A 4UHDA 4XFJA 2R9VA 1A2BA 2PO5A 2Z83A 4Y1GA 3QE0A 4HVAA 2A5FA 1KQFA 2QZJA 1ECJA 3A06A 5BQOA 4CKEB 5AH0A 1HT3A 1OY1A 1QB7A 3A9WA 4RTRA 1I9GA 4DMGA 2V0NA 3HUUA 2WQ6A 2ZUDA 4LCBA 4LPSA 1Y1LA 5CVUA 2H3HA 5YASA 3ZGLA 1Q0LA 3LHIA 2FMUA 1UT8A 1UWCA 1F4PA 1EXNA 2P5UA 3I2GA 3KHTA 4YO8A 4ZOLB 4NH0A 1X94A 4X8OA 2Y1DA 4YMUA 1QZ3A 3ENVA 2HM7A 4YJGB 1Z75A 1AS0A 4RVHA 4HB3A 4QUIA 3LWNA 3MS7A 4WNYA 2IY7A 2PQ6A 2QD3A 5CBKA 1QV6A 4L27A 3DAOA 1DQYA 4MP3A 1BE6A 3HXLA 3EVTA 2I5PO 2FR1A 2PWAA 1E1MA 2B20A 3OT1B 3EPKA 3UMBA 5KOIA 1FK8A 2XKKA 3SHVA 4B31A 2Y1KA 1Y7IA 3DTNA 3IQFA 5L9AA 3QVVA 3BFPA 2HPHA 2SHKA 3F3MA 4QREA 5K8IA 1FE8A 2ZYWX 2AVDA 3AFGA 4TSKA 1JIKA 3D2AA 3BK7A 4X90A 5A4AA 1I3LA 4B7XA 1JIVA 1SXPA 1H9CA 3EZ7A 3QFSA 2JD0A 5A0FA 3M1AA 2JI8A 4NIMA 1QPZA 1BQ4A 4UASA 1C14A 5JOQA 1PEAA 3E35A 4GRAA 1ODTC 4WINA 4BMYA 2A3RA 4MULA 5LJLA 2QORA 3JQFC 1G8AA 3P8ZA 5G02A 2HO4A 2Q1SA 3RSGA 1KAMA 1WMDA 2Q5FA 2WFZA 1Y63A 2QXYA 2CLKB 3GCZA 4RGYA 3V8MA 1K4YA 1R10A 3QSGA 4FS3A 4Y3UA 5EQFA 2BFOA 4DLXA 4UW9A 4QGAA 2IEBA 2JARA 2WWGA 3EK2A 3ASUA 3I2IA 4FBLA 2RGCA 3N2EA 4PYOA 1U81A 4E4TA 1WUIS 2IZ6A 1HQYE 3AJ9A 2AJDA 1UOQA 1XXHB 4P53A 3MQ2A 3TBFA 3HO1A 4DIBA 5ERYA 3T8YA 5CNMA 3VKHA 1C4WA 3BRWA 1GGVA 5HGJA 3UT5A 3V4PB 3HB9A 2O20A 4F6CA 1MJHA 3KR0A 2G4VA 3EGDA 5E7QA 4NR0A 5HSGA 1S3FA 3R3ZA 1A98A 2ZBDA 4L07A 2YWDA 4O33A 2VQFB 2B8EA 1O95C 4BUCA 3P9ZA 1XNRB 1JEJA 1ORVA 3QPWA 4WLOA 4LZOA 1B76A 1PZMA 4PLGA 1YAJA 1TJPB 2P8SA 3K09C 3TW0A 4W5RA 4MMXB 3MERA 1H94A 4RSGA 1KMMA 2UZ0A 3ABIA 1CCWA 3HV0A 4MDHA 1IZ9A 4LYFA 4CLOA 2J85A 4H7PA 4CM3A 4KQGA 1CNFA 2BM0A 2NXJA 3BGSA 3I9V6 1LX6A 1RJEA 1GVHA 2WWXA 2BLNA 4ZQHA 1E3IA 5DDIP 5CFRA 3WRXC 4EGCB 3DWEX 3RHZA 2ODBA 2VP9A 3E9DA 1PLLA 2MINB 2QGFA 4YP0A 2ZS9A 2X8AA 1PEDA 1ZH8A 1YCHA 1S2MA 2VI5A 4I4TF 4FE4A 2WG1A 1SM4A 2QLBA 3KXDA 4OY3A 2OHJA 4G8DA 5GIOE 4KQIA 4IQ4A 1K7XB 4UU8A 5AO9A 4J03A 4CIYA 2P1RA 2DWQA 3M33A 5EP4A 4F60A 4X7RA 1GGEA 3BE6A 3CN9A 3HP7A 4DG9A 4W5NA 4AG5A 4FMDF 1PK8A 1DAIA 2OKGA 1WSAA 2OP1A 2UUOA 3CH4B 4U9UA 1FRFS 4UDOA 2QUIA 3TXYA 4F96A 5A04A 1X0VA 2O6HA 5I47A 5I9TA 3MT7A 4HT3B 3IQWA 1OGYA 1ZEMA 2GFIA 3H11B 3TQSA 5DM4A 2MJLA 2FE4A 1V45E 2H07A 1ZONA 2HSZA 2VSOA 1K6JA 3AJEA 3JQAB 4ZCPA 2WIGA 2G8LA 1GILA 5ESRA 2OAQ1 2QSYA 1UOOA 1WQ3A 4YCLA 5LYJF 1Z62A 2PKQO 4CLDA 2QPAA 2ZYIA 1KH2A 1XTRA 521PA 4EHNA 1WPQA 5ARBA 1M1NA 3SXUB 1P61B 4PYMA 5KEIA 3K73O 2Q21A 3SOZA 4ABYA 2XTNA 1FFSA 4D4IA 2ZULA 5E4JA 1KVQA 4FONA 1CYDA 1I7NA 4F4DA 1BW9A 3TDKA 4DIMA 1DOHA 2Q2OA 3BWBA 1YFLA 4C87A 1DUIA 3MOIA 1YQDA 4LX0A 3IDAA 4MW6A 1HORA 4RF4A 1R27A 1B93A 4UHFA 4B32A 3H2KA 1XTBA 3KOYA 4JJ6A 4LTDA 2GGSA 1TB4A 3RT9A 3FCYA 1J49A 4HDRB 5REQB 1BN7A 5IAEA 4XLTA 5CK5A 3H7IA 1R8QA 1E7RA 5EIEA 5F1KA 1KO5A 4GECA 1OZHA 1TU3A 5ERXA 4W6QA 1RI2A 3AILA 1C0KA 1F8UA 1U0LA 4WEOA 2V0GA 3RSCA 2NO1A 1SU6A 3VXKA 1CK4A 1FVXA 3L8ZA 4FFMA 1N3YA 3SIPA 1CY1A 1EXDA 4B4OA 2D0IA 3L0CA 4D1YA 5EAIA 1CETA 4KR6A 2N47A 3PWKA 4BVEA 2IYTA 1Q0ZA 4YC7A 2MCFA 3GUUA 4KL8S 3MBOA 3EDOA 3HYRA 3GVCA 2C99A 1YRAA 2FEMA 2RGRA 3LUFA 5DRTA 1XEWY 4PAWA 1N2XA 3NP9A 4M87A 4ZPJA 2L19A 1W0KA 5BSVA 3AEKA 3G1UA 3I53A 4CQJA 1K1EA 2CCJA 2EZ8A 2P2NA 4RF5A 3HPRA 3Q87B 3UKDA 3LQ2A 1DVRA 4PYJA 5IPFA 4NBUA 4LJ9A 3THYA 2R25B 2BR5A 2UVPA 4XB2A 3OU7A 1XOIA 4RL4A 2ZUTA 3EGOA 3AM3A 3H1GA 2IS1A 4MUBA 3S55A 2Y8EA 5D1NA 3UA3A 3Q7IA 3ENWA 4JH0A 1Q20A 2O52A 2WJ3A 1RAFA 5F2EA 4XWAA 3VAYA 5K5EA 4KODA 4H17A 3QUSA 4DIOA 1EFRD 3NRBA 4LISA 5DLEA 4KPUA 3V4LA 4TTRA 3W5UA 3NVKI 2NG1A 3GBSA 4L85A 4LVOA 4OH7A 1CF2O 1IBKB 4I1OA 3NHJA 4P80A 5CRIA 5JPCA 1U98A 4CXMA 1M6HA 2TMYA 1Z2EA 1E9BA 5IT4A 3N59A 1SHUX 1LWOA 3DO5A 2OV6A 5JH7B 1Z7WA 4J4BA 5F3DA 2ASEA 1HNXB 1BHSA 1LTKA 2FPPA 4BFTA 1C29B 1HL3A 2BDEA 5AOCA 1Y9JA 3PHJA 1YB1A 1E1RD 1U2PA 3VDXA 2C9DA 2PBZA 5CGQB 1GNRA 4NHEA 2I62A 1VE1A 3SR3A 4XKJA 3ZE6A 1PQYA 1D8TA 3CH6A 3E5NA 3MB8A 5EA2A 3P2KA 4PLYA 1XJWA 1TGVA 3LPMA 5CT9A 4WI1A 4KMMA 3WLRA 1AKUA 2QKYA 4I9NA 5JARA 3KQNA 2PT6A 1PHPA 2Z2XA 2FMHA 4YFVA 4C08A 2QLFA 2GVNA 4RK5A 3SZ3A 4TTIA 4E5PA 3K8OE 1CRWG 5AK6A 3FR7A 3B85A 2JLBA 3CLVA 3FB1A 2PJDA 4AJIA 2XXAA 2HWYA 3TDMA 3DSRA 1TVMA 4OXQA 1L6RA 2KE5A 2NSYA 2ZT8A 5KNLA 3KSAC 1OBVA 3GBVA 1KY5A 4HEQA 2XVAA 1JECA 1NVEA 2FY8A 3RH0A 1R7RA 1NI4B 2ISCA 5KTOA 2FCRA 3OQPA 3P2OA 3C41J 3CYFA 4UBJA 2IUUA 4MI3A 1IHPA 1WZ2A 1G5PA 4FDTA 3KZCA 2DR3A 5BOSA 5HJ2A 5H02A 2EX0A 2HU5A 1K7EB 1YFZA 4D0NA 1E4EB 5TJ9A 1DC6A 2RIRA 1HZZC 2PZJA 4G63A 1KKUA 4IJMA 1LVHA 4Y6OA 1ZKDA 1CRQA 3GLHA 3IAFA 3ZIAA 4BO7A 7GPBA 1C0LA 1LDYA 5LOVA 3KUDA 4JI2B 3TW4A 1VSBA 1FNNA 1S2DA 1YTUA 3MGKA 3OIUA 1Y4DE 4XCQA 3CGWA 3S2IA 3IPYA 4YHBA 2VQ6A 4HUQB 5HUQA 1TT5A 1EYZA 1HDXA 2BEUB 3PQ3A 2XV1A 1V3QE 3DMYA 3C1OA 4J1SA 4JUCA 4Q4DA 1WDWB 3A0UA 5BQFA 3COSA 4FW8A 4EKGA 1PSDA 3Q7SA 1L7PA 5C5IA 2WABA 1B4DA 5TX7A 4MVJA 1VECA 2OQVA 2XAUA 3D43A 2ZUEA 5KJ1A 1KDOA 1JLRA 4G01B 1NG1A 4BNWA 1NUTA 2J6HA 3IT1A 2CC2A 2I87A 3T7RA 2EJBA 4KR3A 4GYKA 1YAHA 1N36B 2C5BA 1IEXA 3ZQKA 2YOFA 4ZVMA 4RIHA 2GRJA 1CEXA 4H4DA 4Y98A 3TLXA 2B99A 2ADFA 2PKCA 3Q2KA 3TIIA 3FWKA 3KSBC 2X4IA 2FEAA 5AHXA 1OLOA 1TF2A 3CRVA 4OGFA 1CU1A 3H5RA 3N39C 1O97D 2ODAA 3GLKA 2POCA 3GVPA 4M0MA 3TZ6A 2RD2A 2Y0DA 4BO3A 1D4AA 1GPUA 4B73A 5HPYB 4ZVUA 3FVTA 1ES9A 1J90A 4OJYA 4XARA 1HMPA 1G16A 4MV5A 3OWHA 4CV3A 9ABPA 1EP1B 3NH6A 1QP0A 4PAQA 2W8BB 1WXQA 4WKCA 4TMXA 5JYDA 5J23A 1OLUA 3G9UA 2PIDA 3RC2A 4BU0A 2Q27A 3KPYA 2GZAA 3HL4A 5G53C 1PV1A 4E4YA 4ZDJA 1GFIA 3O38A 5DTIA 3JD4A 4BZXA 2WU4A 2RHCA 5FR1A 4FVTA 3AP1A 4DNOA 1XZ8A 4BN0A 1XZNA 3AUYA 3OJXA 4V03A 2BGTA 1YMVA 2FW6A 1WXDA 3S70A 1LQUA 4BJ5A 1VGVA 3QIVA 5FUVA 1JYSA 3KE8A 4KQ2A 4QOGA 3K6SB 4DLZA 5L40A 2H2HA 2ROQA 3G9XA 3NVAA 1E9AA 1UC9A 2ZUVA 5BSFA 3JATA 1I4EB 5COBA 5BR7A 3OZ7A 3RIGA 5TPZD 1V7PC 3K31A 2W7TA 3M6MD 4RCZA 1MNQA 4O2BF 4WZBE 2P6OA 1TCCA 3OBBA 1J8YF 3R6WA 1SUCA 3I45A 4QJ3A 4A2PA 2CF5A 5FAKA 5L4SA 4B5LA 4ITRC 5JATA 3DPSA 1CNEA 2C4KA 3RAFC 1ECCA 3FBTA 5JS1A 4AN1A 2R00C 4ZEMA 1KJ8A 3FXAA 1Y1SA 1OX5A 2J87A 5LN1A 1ACMA 1E9CA 2FTKE 4H4CA 1A0OA 3T1NA 3FPKA 4M1TA 5NLLA 2QSUA 1ZMTA 4LS3A 4D3SA 4UPEA 3DONA 4GOJA 5TQ0B 3PUKA 2F59A 3QYJA 1DT3A 2C4WA 3A32A 2WSMA 4RZIA 1OH6A 1HLDA 3KT6A 4O4IF 4QBKA 3C6MA 3S2YA 1Q1NA 1QLJA 1VLMA 2C0QA 4DJ5X 1GPLA 2B1JA 1ND6A 4B85A 4I81A 1QLWA 1VJ0A 2PM8A 3VNSA 2A9QA 1YIOA 3NANA 5E9JA 1LRLA 4J90A 1HQCA 2PX4A 2DE0X 1E2FA 3LLCA 1HT2E 2C4HA 3FDIA 3H75A 3IAM6 3A1UA 5DSZA 1FJGB 1EUZA 4D0GA 3BB3A 2QVLA 4Y2RA 4CW7A 3OCWA 2GA9A 1XXLA 3CCFA 1EVZA 3F2VA 3P4YA 1FZQA 5J5AA 4U2CA 4DG5A 1K9VF 3E82A 4OM8A 5FQNA 1RS0A 2WJJA 3GEMA 2JVIA 3R3SA 5F3RA 1ZDMA 3VDQA 3VZPA 3E3NA 2PUJA 1FJXA 3PJFA 2BW0A 4TV9A 3HABA 1UKAA 1XRNA 3E1SA 3I2JA 2P40A 5JU6A 5H8WA 3WGOA 4QD3A 2JJ1A 2O2CA 1KVTA 3VVCA 5IVKA 1XPUA 4RVNA 1QGDA 4JHLA 3EJ6A 4OGLA 4L9RA 4FEEA 2R96A 1UP7A 1BZYA 5EZYB 3QKSA 3F8WA 4C0AC 4RLQA 3GLGB 5ADUS 2FRXA 4KYTA 4UMVA 3WHLA 4D9GA 3PDIA 5AVRA 4A1OA 1NFRA 2QV7A 3IP3A 4PC1A 4L9SA 5FA5A 1P7CA 1J00A 1O8BA 1UWKA 2HTFA 3KXLA 2CJXA 2PAFA 1G38A 1ZO8A 1FVOA 3ETDA 3T52A 1M2OA 4JZKA 4KXQA 5A62A 5BPHA 1JDVA 4B3SB 2Y4NA 3N3BC 3GW8A 2JCYA 3ZV3A 1PR9A 3MF4A 5ECYA 5HQ3B 3KLOA 4J0QA 5JS7A 3WTBA 1L4FA 1ZK0A 1OV4A 3MOGA 4PYRA 5KHOC 3ISJA 1FDVA 4I1VA 3GEGA 1L3IA 3IALA 3JARA 4HRXA 4ZC8A 2VAPA 5B2FA 3BDAA 5J5VA 1IZ8A 3THXA 5B57C 1E9EA 1J1UA 4K88A 3DOFA 2VJMA 2CVOA 5CJJA 4C4PA 3GJYA 3HADA 3BDIA 1E77A 4NMLA 2JLXA 1P2FA 4TMTA 3DR3A 5H3HA 4Z3OA 3THWB 2GM5A 3CY6A 3ZC3A 2M32A 2BI7A 2JAUA 3CE9A 4EUEA 2Z98A 5ADVA 1KTVA 1Q57A 4NE7A 3V1MA 5HKAA 2VUIB 1MABA 5CT6A 4A3SA 4II7A 2BGKA 3GJSA 1FLAA 1CW2B 3DVLA 3IIEA 3GEEA 1JHVA 3O1HB 4WFJA 2JIMA 4ID3A 5FLKA 5KX5A 1XG5A 5CXXA 1H1LA 4KQMA 2XB4A 4P33A 1QJCA 3QRWA 3G0IA 1L5HB 1WXGA 2RGWA 5ALXA 4JGIA 4MKIA 3LKDA 4F3YA 2O3QA 4HXYA 2C2GA 1M6Y