3H19A

Crystal structure of este5, was soaked by methyl alcohol
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 101
structure length 293
sequence length 296
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h19A00
3ZWQA 5IKXA 2DCMA 5ALNA 3BJMA 1Q83A 1VA5A 4J03A 5AI9A 4GXNA 1BCSA 1VE7A 1DT5A 4P9NA 4G9EA 1FJ2A 5FXMA 2HA5A 5K5EA 4M0MA 2QTBA 4G4IA 2PX6A 4Q05A 4C6HA 2VSQA 3WIOA 4E11A 4WDQA 4Y7DA 4C4YA 4HXEB 3HYSA 1IMJA 4X71A 3F9CA 3G0BA 1CPYA 2EDAA 1UFOA 4G8BA 4BCBA 4DNQA 3ED1A 4HZGA 1XZBA 4WFJA 1X2BA 3E0XA 4EBBA 3OOSA 3R3ZA 5DYWA 1Q0ZA 3LCRA 3KWJA 3SK0A 4QDUA 1E66A 2WHRA 1R3DA 4P08A 3G9XA 5DLPA 2QXTA 3VJMA 5ALEA 3AILA 3DYIA 2WFLA 3I2KA 2HU8A 1IZ7A 4Q3LA 5EHNA 2QUAA 3DQZA 2ZYHA 3DL7A 1BN7A 1IZ8A 1YS1X 4BVLA 2AJDA 4JEIA 2JF0A 2V9ZA 5IVDA 2OCIA 3P2MA 2PSJA 3PE6A 4J0HA 3ICWA 1LBTA 3D59A 3E3AA 2CUTA 4ZI5A 4J0JA 4BE9A 3FLEA 1Y7IA 2VAXA 5AM4A 1FFEA 1H2XA 2G63A 5FOQA 4HRXA 3EF3A 1XRPA 4ZGBA 1DQZA 5ALPA 2WUEA 2GYWA 2VJBA 1JJBA 1G66A 1LZLA 3W9UA 4AO7A 4DNPA 5CURA 1YAJA 1A8QA 5AKIA 4FHZA 2AXEA 2CKMA 4HTAA 1ODTC 1CEXA 4B82A 1GKKA 4BCDA 4RNCA 3DYVA 1IUNA 2WFZA 3I2IA 2OG1A 1W52X 3BJRA 4PSUA 4UBKA 5DTIA 2HA6A 3IUMA 1XZEA 4B84A 1XZDA 2ZJFA 3QMWA 1UWCA 1CUJA 3C6XA 4YX9A 3G9TA 3GBSA 1HQDA 4M0EA 4N5HX 3BE8A 3AZQA 3O4GA 4UFPA 3LIIA 4MYDA 1C7IA 2O2IA 1MTZA 1SCQA 4UHBA 1OILA 4BDSA 3M3DA 1JJFA 2J4FA 3GELA 1H23A 1ZIXA 4F60A 1TCBA 2I03A 4OYYA 1WHTA 3WIBA 2PUJA 2OAGA 3GUUA 3W9BA 4BVKA 3B12A 2WSLA 4ZXFA 3HZOA 3D5EA 3R41A 5EHQA 1JJIA 4MJ3A 3QZUA 4IO0A 3STWA 5EI5A 1XLUA 4K6HA 2PSEA 1R9MA 1CR6A 4B83A 4OD0A 1DX4A 4BCCA 1UXOA 3I2FA 1JKMA 1KU6A 2XQIA 1XQWA 3FCXA 1R1DA 2ZVDA 3ESAA 1LGYA 4P93A 2BUAA 4TGLA 3IIIA 2W6CX 1TKRA 1JFRA 5LZ7A 1AMNA 4IHAA 1TK3A 4HAIA 4ARBA 1FFDA 5CW2A 1E5TA 4HRYA 4K2AA 4EA6A 1BRTA 2HRQA 2DHEA 1BEEA 2RGUA 2ORYA 1LPAB 2XUJA 4DMCA 3GZJA 1MJ5A 1ZD5A 5AKKA 2ZJ7A 3AJAA 3YASA 2ACEA 4GHWA 1ZJ5A 2LIPA 5DNVA 1QZ3A 3WLAA 3H2HA 1H2WA 1MX1A 1VZ2A 2XLBA 5HF6A 2ZYRA 5ALVA 3TRDA 1WB6A 3M81A 1ACLA 3STXA 4BC1A 5SYMA 2HHAA 4FLMA 1J07A 4BDTA 4H0CA 4CFSA 2QJWA 3C87A 2YXPX 4QDTA 2JGEA 4LXIA 3T4UA 4Y2SA 5C81A 1LPPA 5D7BA 4X6XA 2O7RA 4CCYA 5HQ3A 3VJLA 3DLTA 3QPCA 1KU0A 2C5GA 3IUJA 4J0CA 2HU7A 1FFBA 1AQLA 1R4ZA 2JIDA 3F67A 3R40A 5CT6A 2HRRA 5E2IA 1D07A 1XROA 4W1SA 1XRNA 2XQFA 3C43A 4HS9A 4Y2UA 3VVMA 4U2CA 3F98A 3C5VA 1DU4A 3CCBA 4UBIA 3TGLA 5JADA 1O6FA 1WB4A 2WIDA 1R9NA 1YB7A 4X94A 2PSFA 5IH7A 2OGZA 4B9AA 1CUSA 2XMBA 3HI4A 5JZSA 5AICA 4L0CA 4JUIA 4U2FA 3WWEA 1VA4A 4F21A 3BIWA 4CIAA 4UBJA 1SCKA 3STUA 3I2GA 4H7IA 4BRSA 1ZI9A 3AIMA 1EDEA 2XMZA 5DTJA 4G1FA 1CUCA 3SC2A 2XI4A 1WPXA 5AM1A 4EB0A 3JW8A 4PF1A 2I78A 1MX5A 2Z3ZA 4Y2TA 2GYUA 5AI5A 4BZZA 4JYPA 1YSCA 5AKHA 3CN7A 2HA3A 5ALMA 4MXDA 5JYCA 4FBMA 5AK6A 4N8EA 1B41A 2OCGA 2P8SA 2XMCA 1CQZA 4U2DA 3BDIA 5F4ZA 2B9VA 3PDCA 1K4YA 2BAGA 2YH2A 3C8HA 1EX9A 1HDEA 5EIHA 2BUBA 1HPLA 5HF9A 2ZSIA 2QMQA 4LIPD 5AM2A 5JIBA 1XZCA 1YAHA 1K6EA 4MEAA 1BU8A 3WKCA 3OURA 3FOBA 4Y2JA 2I3DA 1GPKA 2K2QB 5HCUA 2BKLA 2RONA 5AO9A 2PUHA 2R11A 4X95A 4JYMA 3TEJA 1QIHA 1QIIA 5CXXA 1CQWA 2WU4A 1TCAA 5A6VA 3QPAA 4GEGA 4CIBA 4BAGA 5AJHA 4QWMA 1SOMA 1G42A 3K6KA 4DM7A 3VVLA 5K3FA 3ICVA 3K9BA 5A7FA 2H9YA 1ZGCA 2VAVA 4OB7A 3PI6A 1XZLA 3HRHA 1UT6A 5DYYA 2C5FA 1CUGA 4YPVA 1CUXA 4OCZA 3H2GA 2QR5A 1LPBB 4A5SA 3WKEA 1XKLA 1RP1A 2JEYA 4J3JA 5ALIA 5FP0A 4X90A 1CUDA 2VT6A 4KE7A 1XRLA 2WHQA 1QO7A 5CT4A 4C89A 5JAUA 2OAEA 2WUFA 4B81A 5ALYA 1JU4A 1EK1A 4DLNA 4KACA 2XMQA 3QH4A 4ZREA 4LHEA 4GWLA 4UPDA 4I4CA 3I2HA 2CJPA 2JGJA 5YASA 2DHDA 1HLGA 2G5PA 3MGAA 2CEKA 1MNAA 2B4KA 1ETHA 4KAJA 6YASA 3DS8A 3O4IA 1B6GA 3EQ8A 2HA2A 3PICA 3EQ7A 1YS2X 1YA4A 4Y2VA 1JT2A 1MO2A 4EZIA 4XX1A 2PU5A 1N5MA 4QWWA 4N8DA 1JU3A 3FLBA 4W63A 2Y2VA 5LKRA 2O7VA 3ESDA 2Y2UA 1P0MA 5HFAA 1VLQA 3R3WA 1AUOA 1WOMA 3OC0A 4UHDA 5AI0A 5LZ5A 3WA6A 4BZWA 4Q3OA 5CMLA 1CRLA 2C4HA 1YB6A 1QGED 1BN6A 4UFNA 4F5ZA 3WZMA 3PUIA 3ILSA 3A2LA 2V98A 2WIFA 3QITA 5DNWA 2PSDA 2OQVA 3ZPXA 1GPLA 3CN9A 4FOLA 5ALLA 4V2IA 2AJ8A 2V96A 3RARA 2VEOA 3B5EA 2WKWA 5AOBA 1CV2A 2GYVA 3OM8A 1LPSA 3UUFA 2YYSA 4LXHA 2PPLA 5EHZA 1VXOA 4CG3A 3DL4A 2NW6A 3DDUA 3O9MA 2PBLA 5LZ2A 5AKLA 5AM5A 4G5XA 2VJDA 5JASA 1UK8A 4BP9A 1LBSA 5H3HA 2Z8XA 3KXPA 3H2JA 5AKZA 1TCCA 1AZWA 5KWJA 3DCNA 5AI4A 5AHXA 2QJRA 1EHYA 4BE4A 4UHEA 5AKEA 1JMYA 2AJLI 3QMMA 4IH4A 2R8BA 4EHBA 1QTIA 4E46A 2PSHA 2D0DA 3L1JA 2VJAA 1ZD2P 2XUHA 3GFFA 4M0FA 3U0VA 1CUUA 5HK9A 1XLVA 1CVLA 5AP9A 1R50A 1QJ4A 2WHPB 1XZHA 3O4HA 1XQVA 5HKBA 2EDCA 4KE6A 5AH0A 1N1MA 1LLFA 1IUOA 1TQHA 1XZKA 2VQ6A 2ZSHA 3HEAA 4KJXA 3OG9A 3RM3A 3WL5A 3FYUA 1IVYA 3V9AA 3H2IA 5ISMA 2VTVA 2VATA 1EVQA 2WLSA 4PO3X 3FCYA 1N5RA 3PF9A 3L1IA 2XQKA 3AZPA 4Y2QA 1ZI8A 4KE9A 4TPKA 1E8DA 4WDRA 3HJUA 1W76A 2QKYA 1KEZA 3C6ZA 3WJ1A 4C01A 1Q84A 3WWPA 2WG2A 5T4HA 4EY5A 3H19A 4H7HA 3IB3A 2BFNA 5ALXA 3NGMA 4L9AA 2DQYA 3EIOA 2V97A 5FKJA 5K3FB 4QLOA 2PL5A 4A16A 1XRMA 3WK6A 4UBMA 3F8SA 4JNCA 2Q0XA 4BB0A 1P0PA 3QBJA 4MQMA 3D0KA 4KRYA 2WM2A 2RI6A 4IH9A 4BBZA 1XKTA 3STVA 2IITA 4INZA 5AKYA 5BWBA 4H77A 4YASA 2QM0A 1X2EA 3G0DA 4K6GA 2EEPA 1EVEA 4AN1A 2XMDA 4KYVA 1L7AA 4OB6A 5HK8A 1MAHA 1F0PA 2XQJA 1TAHA 2HA4A 3ESCA 2XUOA 3KDAA 4MWTA 2OCKA 1AC5A 3R3UA 5FLKA 3STYA 1DT3A 1THGA 4B0OA 1JMKC 1UKBA 5AOCA 3NWOA 1QIMA 3FSGD 5CT8A 5CRIA 3IBTA 3WL6A 3I6YA 1CUAA 2Y1KA 2Y6UA 5K3CA 2OQIA 5K3BA 2HFKA 1H22A 3VXKA 4RGYA 2CB9A 1XQXA 3VKFA 1ACJA 4FMPA 1GGVA 3ZLUA 4B0PA 4D9JA 3WJ2A 2O2HA 1ISPA 4ARAA 3A2NA 1RWQA 4UFOA 3V1NA 4DIUA 5ALRA 4Q1VA 2PKYX 4CCWA 4ZWNA 3X3HA 3LLCA 5AKGA 2GZSA 3IURA 4EY6A 2WJ6A 3D4LA 5SYNA 1H2ZA 1R88A 1WHSA 3WK7A 5ESRA 4BP8A 3D3NA 2PU7A 2FUKA 1CIJA 3G02A 4X93A 4EY8A 5T4EA 2WTMA 4QA9A 1HL7A 4LYEA 4WY8A 4Q82A 2WFLB 1WM1A 2X8BA 1GPNA 3FBWA 1CUYA 1JI3A 2OGSA 3BF8A 3I6ZA 4B6GA 3JYHA 4DTCA 5I7UA 1W1IA 2IX9A 3FYTA 3GROA 4E14A 5HF5A 5T4FA 4FFVA 1HBJA 4DNOA 4C87A 3C45A 3EBLA 2H7YA 3H2KA 4LKOA 5AK3A 2XUKA 4X91A 4U2BA 3WA7A 4C88A 3IA2A 2H1IA 4QNNA 2PVSA 2AJCA 4AO8A 4NMWA 2CMFA 5E4TA 3WKDA 1QONA 1UKAA 4MYSA 5LZ4A 3PUHA 2W22A 2XMRA 1XZIA 3A70A 3S8YA 4DYHA 3G8YA 3G0CA 4CG1A 2O2GA 1VKHA 1OXMA 3IDAA 3OTQA 1HKHA 4U2EA 3V1MA 3O0DA 1TRHA 3ZLTA 5A71A 1A8SA 2RHWA 5EGNA 1J2EA 4F0JA 1YA8A 3R3VA 4HXGA 4XIIA 1LPNA 5EIAA 5HF8A 2XMGA 3HABA 4B80A 4BAZA 4X6UA 5JD5A 2WIKA 5I8PA 5FV4A 5AKJA 1BS9A 5JD6A 3BL8A 5DJ5A 1ZJ4A 1XZMA 5IVKA 1BE0A 1M33A 4GW3A 4LXGA 3UUEA 2WFMA 3R0VA 1U8EA 4Y2YA 5LKAA 3O4JA 4WCVA 3KOOA 1W75A 1QFSA 3AINA 5AIAA 2JGKA 2VA9A 1G5FA 3F96A 1F8UA 3Q0TA 5ALJA 1E89A 4L3WA 1EINA 5AIBA 4JH0A 5EFZA 2XT0A 2GBCA 4W1RA 1EA5A 2OGTA 4WFKA 4GDMA 4Y9SA 4W1PA 4GI1A 3N2ZB 1AGYA 4QDZA 5AK4A 5LIPA 3W06A 1PV1A 2ROQA 3FYUC 5HZGA 3C6YA 3DD5A 5C8VA 1QIGA 4G8DA 3DOHA 5EHXA 2ES4A 1ZD4A 2QXUA 1XFDA 4OYLA 3Q8WA 4PSCA 3S2ZA 1PFQA 3T52A 4UBLA 5LZ9A 5JATA 3ESBA 2XUGA 1OCEA 4J7AA 2XB6A 1XZGA 1QIEA 4L72A 4BVJA 2QRUA 1UK7A 1XZAA 2G4LA 1XZJA 4XWGA 5LLSA 2FX5A 1SFRA 2H7XA 3U1TA 4FWBA 1LNSA 1NX9A 2XQGA 3UMJA 1G4HA 3G9ZA 4CI9A 3MVEA 4B85A 1C7JA 1EK2A 4K6KA 4WFIA 1Y37A 5DNUA 1QTRA 1GZ7A 1C4XA 4GBGA 3G9UA 1L7QA 1CUZA 4X3CA 5D3ZA 1ZOIA 5AOAA 3I6MA 4B9EA 5DWDA 2FJ0A 1CUFA 4CCYB 4N5IX 5JARA 3FWHA 5HQ3B 1DINA 3O95A 1P0IA 4G9GA 3WYDA 4QDXA 4QEKA 1ZGBA 5K3EA 2QT9A 4OSEA 5CT5A 3AIKA 4Y2RA 1CUIA 2C7BA 2VJCA 3R3XA 2X5XA 4QZVA 1T4MA 4DSZA 2QZPA 4QDOA 1FFCA 3D2AA 3TJMA 2ZYSA 4XVCA 5HKAA 1UK6A 3GA7A 3W04A 3M82A 4AX4A 1U2EA 3FSGA 3ZV7A 1AKNA 4EY7A 4GLBA 3G0GA 4UHCA 4DMFA 4G4GA 4C4ZA 4DSAA 4DMHA 3IUNA 2HDWA 3QMVA 5I9IA 4LYDA 3A2MA 3DNMA 5AI6A 1Y7HA 2CBGA 4ETWA 1K5PA 1CUBA 2ACKA 2DFPA 5CBKA 4KEAA 3C8DA 3H17A 5ALWA 4HVTA 3WI7A 1ZIYA 2VT7A 4FBLA 3HC7A 2XUFA 5AK5A 1UKCA 1BEZA 5IVHA 3KD2A 3K2IA 1UZAA 4AZ0A 2XUAA 3R3YA 5CH5A 7YASA 4TVKA 4H35A 2HU5A 3FLAA 2H7CA 4FTWA 1MN6A 2HL6A 1K8QA 3I1YA 1K63A 2UZ0A 5KWIA 1ORVA 4DGQA 4BRZA 5A62A 5FPPA 3E1GA 2JGFA 5CH3A 1J06A 4AN0A 4WJLA 3BDVA 1Q0RA 1W4LA 2WU3A 5C8ZA 3WL8A 5ALZA 4FLEA 1RYYA 1GKLA 3H1AA 5K3AA 3AFIA 4N8SA 3H0CA 1MX9A 5ALDA 2JEZA 3FAKA 5LZ8A 2WG1A 1X70A 3WK8A 1DWQA 4PQEA 4KE8A 1MAAA 4X97A 1DX6A 2XDWA 2WUDA 4H7JA 3E4DA 1A7UA 3RKSA 4QLAA 4P92A 4MWSA 4H7KA 1GXSA 2OCLA 1FSSA 4BYMA 1ODSA 2XE4A 1UOPA 3IVMA 2X76A 1QIKA 2GBGA 1L7RA 1UOOA 1CLEA 1QE3A 1VXRA 2Y6VA 1ZICA 4Y2XA 1EDDA 2XMSA 3WQHA 3H04A 4OU5A 3WK5A 2GBIA 5D6OA 4PW0A 3H1BA 5ALHA 3F97A 2JGIA 2DSNA 2BUCA 1J1IA 1VOTA 2XUPA 5FPQA 4PNZA 1UOQA 1QOZA 1CUVA 4W1QA 1CUHA 4KAAA 2BJHA 1IUPA 2C58A 3WK4A 3QM1A 3ZI7A 1XRQA 4A23A 2BGRA 3AUKA 4FDMA 2VF2A 4OU4A 2FJPA 2WTNA 4IQ4A 2J3QA 2CZQA 4ZRDA 2RAUA 5E4JA 3W05A 4BTLA 3LP5A 4UHHA 4FNGA 2WJ3A 5C8XA 4J0GA 5JAHA 1U4NA 3L1HA 3WMRA 1U65A 1WCYA 3NUZA 1GQSA 2DR0A 5ALQA 2QOEA 5A7HA 4X92A 4H7EA 3MUNA 5D3KA 1TIBA 4Q34A 1GT6A 1QFMA 3D7RA 5JZBA 3FVRA 1DWPA 1EXWA 1T2NA 1YCDA 1DQYA 4UBNA 1LPMA 2Z8ZA 4RE6A 1N8SA 1MU0A 2WJ4A 4I19A 4OB8A 1EB8A 1VJ5A 3W2TA 1CFJA 4ZV9A 4AXBA 1W6RA 4ZV7A 5JANA 3B3QA 1SCIA 4FFWA 3VISA 3DKKA 1QIJA 1CUEA 1GQRA 5KREA 3RK4A 4EY4A 3WK9A 5CXUA 4O08A 4W9RA 1SC9A 3STTA 4B7ZA 4I3FA 2BCEA 2WUGA 4ITVA 2GZRA 1FFAA 3HSSA 1ORWA 1MT3A 3NOXA 1F0NA 1DTEA 2DHCA 2Z5GA 2ONCA 4DNFA 2YASA 4KR0A 5IVIA 1E3QA 3JWEA 2OLEA 4BC0A 2C0PA 4FNMA 3LS2A 5AKXA 2QS9A 1E8MA 3V48A 3QVMA 1QO9A 3KWFA 4H7FA 3AZOA 1EH5A 3MUOA 5FRDA 2JGMA 4Y2PA 3WKBA 5KBYA 4H7DA 1UK9A 2B20A 3WYNA 3A6ZA 3BF7A 1A8UA 4NVRA 3WZLA 3WKAA 2HM7A 4E15A 3PFCA 4G4JA 3AIOA 5ALFA 1H2YA 1WPRA 4BAUA 1DWOA 2XUQA 3C6BA 1I6WA 4X85A 3IULA 4S0XA 4U2GA 4PSDA 3ZLVA 2WIGA 4YK7A 2XLCA 4UBOA 3M83A 4WY5A 4Q3KA 1ZI6A 2JGLA 3D2CA 2B61A 4X7BA 1YR2A 1ODCA 1F6WA 3D2BA 2ZYIA 4PV7A 2HIHA 5FUMA 1THTA 3ANTA 3G7NA 4KAFA 3WWOA 4CG2A 3KSRA 3G0IA 4X6YA 5A2GA 3O9VA 1PJAA 4MEBA 5LYYA 3PFBA 5CH8A 3FNBA 5ALKA 1ZD3A 1XQYA 4AB1A 1E8NA 4AQDA 5BOVA 2AJBA 1VZ3A 2IIVA 2WG0A 3ANSA 5JZ9A 3I2JA 3QYJA 2G5TA 3WL7A 1Z68A 5J3JA 1VE6A 2DQZA 4FLFA 4HXFB 3I28A 1EB9A 2BGNA 1S8OA 2HA0A 2WHPA 3N0TA 3FYUB 2GBFA 4NS4A 1EDBA 4EUSA 4ROTA 1BCRA 5FDFA 4AMYA 3SWWA 5ALTA 3WWDA 1QLWA 1NU6A 2Z3WA 5HFNA 5CTAA 1A88A 5AI8A 3HXKA 4GECA 3SX4A 5ALOA 4UUQA 3FVTA 2PM8A 5LP1A 2ZJ6A 4AMZA 5BWCA 5K3DA 3C70A 4NZZA 3DEAA 1CUWA 2JBWA 3BWXA 3V1KA 3BXPA 3V1LA 4AZ3A 4UHFA 1QIDA 1MPXA 3DOIA 3HLKA 1USWA 2HFJA 5AM3A 3H18A 5ALSA 3OPMA 3VJKA 4BTVA 5JALA 3LIPA 5DYTA 4C4XA 3BIXA 1P0QA 1YASA 5BV7A 5JAOA 1WB5A 4G8CA 3EQ9A 1LZKA 2E3JA 1AX9A 4DMKA 4H18A 1O6GA 2HA7A 3CXUA 3C5WP 3RLIA 2WQZA 2WIJA 1MNQA 3DJYA 3WWCA 2RIPA 5JAPA 4J0KA 4OUKX 4BATA 4X00A 4RE5A 4K5QA 4RPCA 1XRRA 1QIFA 5ALUA 2I3ZA 4FKBA 5ALGA 3VDXA 5JD4A 2XUDA 4OPMA 1AURA 4KRXA 2WILA 3PF8A 1XZFA 4J0IA 2ECFA 4AO6A 5CT9A 2QUBA 1LPOA 1XLWA 5EIEA 2D5LA 2OPHA 2QVBA 1BROA 1NU8A 5T4BA 3HACA 1EI9A 5E4YA 3DKRA 2C0QA 3IUQA 5C7YA 4Z49A 2J4CA 3QPDA 5AM0A 2RHTA 2XUIA 4J0DA 5A7GA 4QE3A 2OXEA 2HADA 3I1IA 2J3DA 4IH1A 4XJVA 3CCCA 4MQLA
chains in the Genus database with same CATH superfamily
3BVPA 2N1MA 1SO8A 1O8BA 2XPCA 3LHIA 2Z4TA 4GUDA 4N0QA 3PCXA 3OP1A 4Q9DA 5IKXA 4YHHB 1NBIA 2YWXA 4F06A 1X9IA 4ZYYA 3BJMA 4QG7A 3OE7A 1Q83A 4J03A 3OX1A 4MV4A 1O58A 4R1TA 3U9LA 1IDOA 4AF7A 1GNSA 3E05A 2GWRA 3Q9NA 1Y98A 2PZEA 4KREA 1VE7A 5H0IA 1PSWA 3H5RA 3AWDA 1CULC 4P7BA 5DASA 4H2DA 2D0OB 2NSLA 4P9NA 4X8OA 2GM4A 1XU7A 2WYVA 1SQFA 4J90A 4RK7A 3SIRA 3WQBA 3ZHQA 3EMKA 3CNQS 4AP9A 4CM5A 3ABRB 2R6DA 2ZB7A 3NM5A 5TEWA 3G3EA 2Q5HA 4FNOA 4G4IA 4RF3A 5TC4A 3UMRA 2DUWA 2PX6A 1XD2A 3UY4A 2I29A 3V7WA 4C6HA 3WIOA 2QRHA 4WDQA 1WHSB 1E7WA 4KN9S 5C1OA 2CHGA 4GPZA 1NRIA 1I2AA 1NM5A 2FWNA 4NQRA 4ZVVA 4ATNA 1N2CB 2BR3A 2BFCB 2C9CA 3QUBA 4FFSA 3IMEA 5IDXA 1WO8A 4QOEA 3E81A 4NG5A 3HYSA 3LT5A 1L6RA 3I8OA 1Y4DE 1RJ9A 2BF4A 3M2PA 1LNZA 1TF2A 2WSSD 3G0BA 3PDWA 4MOWA 1QGUA 3TNFA 4BGIA 1MJFA 2FZ4A 2GEFA 1M6WA 2MTBA 3F5SA 1X2BA 1ZGJA 1WKCA 2OD9A 3EW7A 2GZ1A 4FHEA 4YVFA 1QFJA 3W3AH 3DFIA 3R3ZA 3NIGB 5E6RA 1U2DC 4JJIA 4KDFA 4Q47A 1KDPA 4W7HA 2NZUG 3THXA 4OMDA 4ZMSA 4Z1MA 4AMVA 4CIVA 1T6YA 421PA 2BTQB 1GZUA 2IP2A 3HEMA 3ZYCA 4NK5A 3UH1A 3ZJ4A 4PANA 3PRHA 2PQ0A 4IV5A 2ZWMA 3UHJA 3OM0A 3G9XA 5DLPA 2QQ5A 2JFHA 2CLDX 1F60A 2G36A 2WD7B 3AILA 3OWOA 1W2WB 2YXBA 3DYIA 3RVNA 3VKVA 1T34A 1V16A 2D5BA 2WFLA 2HU8A 2Z2IA 3Q6NA 4TS4A 3SHVA 3T38A 2NTVA 2CY0A 4LFBB 3ZGOA 1CC1S 4IIVA 2ZE5A 4INPA 5IKOA 1MUUA 3IKLA 3ZE9A 4BMVA 4DPMA 4ZCIA 3UBMA 2HMAA 1FNCA 5ICFA 1YH3A 4ALNA 3H8JA 1GAJA 2RBEA 3CLRD 2GFHA 1TU0A 3DXYA 1V71A 3HVIA 4LRWA 4NKRA 1U5AA 3ZCQA 2RG7A 2RI1A 4P4LA 4YAKA 4Z4HA 1CY7A 2WE7A 4QXRA 1T2FA 2FN3A 1QHFA 2IUYA 2NZ2A 1Q0TA 4HAUA 2D1QA 2VPIA 4H0NA 4II7A 2AJDA 1VSTA 4B6JA 2AF3C 1E3JA 2A57A 3O3MB 2V9ZA 4F45A 3GU3A 5BNFA 2OCIA 5EVJA 5TPZD 3ZXYA 1J0XO 3ICWA 2W5UA 1W0KA 3KFVA 4C21A 5FL7A 1AG9A 3IQXA 4JZYA 1EP3B 1QS0B 2Q4RA 1L5VA 5AUNB 4BE9A 5KOHA 1IEVA 4DLRA 4EJ6A 3JQ8B 1I13A 3LL7A 4ZPJA 3SKVA 3VZCA 1M1NB 2CHFA 2XCLA 2DP4E 2JIPA 4FT2A 4HZUA 1Z0KA 2G63A 2XYPA 2X2EA 3KKOA 5EQTA 5HG0A 3TPCA 2HIGA 1OWMA 4EHNA 3R24A 2P0AA 5DGDA 4KIGA 4LQ4A 3RREA 3B6ZA 4JJ7A 1XRPA 4ZGBA 5AVSA 4YP1A 3SZMA 2WAAA 3QXSA 2SKCA 3LK6A 1U5BA 1L1RA 1GUZA 1LRLA 1M1YA 2WB4A 1OHHD 3NHMA 4I6EA 4Z9FA 5HIMA 4EFDA 4EYOA 4ZANA 1ZR2A 3HJNA 3KKZA 4AY3A 4MHTA 4JNKA 4RY0A 3NNSA 1J0DA 1ESNA 2ZJBA 4N3CA 4PX9A 3AFGA 2AOTB 1NW8A 2I3AA 5IDQA 2F64A 3J7AC 2ZJ4A 1A8QA 1CY8A 3NNNA 5AKIA 1IZZA 3CH5A 2QAGC 4FHZA 4OX9Y 2FX2A 3VHRA 2B8EA 1CJCA 2O3RA 3O2NA 2CKMA 1BD3A 1W2HA 2FR0A 2AA3A 4FI3F 2IOYA 4HTAA 1KH3A 4Y67A 3ZNQA 5I6DA 3QJ5A 4RYDA 3U3ZA 4MRPA 4TVOA 1GKKA 3AHHA 3U4IA 4ICIA 1YR3A 2FXVA 4YAOA 5ED0A 2QDXA 3LFTA 4TT3A 3H99A 4MS3B 1ZQ9A 5LP6F 1QB8A 2Z9DA 2EL9A 3A7DA 3CMCO 3F3MA 1W47A 2A5DA 1WD7A 4FMDB 4TV9F 4PXSA 2OG1A 4FBGA 4X8LA 4BKRA 1XWWA 4JI6B 4A8HA 5B64A 2BI4A 2E55A 3LDHA 1V48A 3TBHA 1QVAA 2W42A 4N7JA 3L93A 4B84A 3JARA 5B7QA 2I6XA 1SUFA 4KXMA 5LA6B 3WLEA 1C30B 1CUJA 2ZDHA 1G2PA 1YDFA 2FSHA 4JX9A 1QPGA 2OFXA 3B6IA 4YX9A 1QU3A 1P3Y1 1E1LA 4L22A 4TWZA 4DEXA 5HW0A 1HT2E 1HQDA 1K6XA 1LF0A 4OBXA 4N5HX 2WJHA 2PD6A 2UV8A 2I7CA 5E0OA 3TE6A 4NBTA 2WQ7A 2R8EA 3FJOA 3AZQA 3K5PA 3OZTA 3AO0B 3O4GA 1U1DA 4MS4B 3HV0A 5ED4A 3LIIA 1Z2CA 3VGJA 2VYVD 4MYDA 1UPFA 2LE0A 1DKMA 3GDGA 3N2KB 4Q16A 5D87A 5GQSA 4F11A 1QH1A 4X65B 2YWHA 1CZOA 1DBSA 4NMMA 3OF2A 4CIDA 1W4BA 1SCQA 4LISA 1BWQA 4LNAA 4L78A 1SMKA 3T1OA 5EINA 4F5EA 1USKA 2KWIA 2Q99A 4IFEA 5DV9A 4WLNA 1W88B 1JJFA 3H86A 1GQOA 1P39A 4YRTA 3HPQA 2PZ8A 3EY4A 2QE7A 4OM8A 3EXHB 3IAEA 3IQZA 4BX0A 1ES9A 4F60A 1GPUA 1R8QA 2YHAA 4M46A 1W0JA 1TCBA 3LLVA 3NCTA 4G4SP 1YONA 5K01A 1VL2A 1MEEA 2QRJA 2CF5A 3S1LA 3LCVB 3OEEA 1WHTA 2C3OA 3WISA 3ZCSA 4F8EA 4UARA 3SDSA 4Q4AB 2NYUA 3GUUA 5AW9A 4EDHA 4MRVA 4KO8A 3AFHA 1NNI1 2PKWA 3D1JA 4L5CA 2ZJOA 4YDHB 2QUKA 1E99A 1RM0A 3CNOA 3GLHB 4HX9A 2J59A 2OK7A 3O90A 4MO9A 5IJWA 3LC1O 3E7XA 4OOFA 5J40A 4JL8A 1O4WA 2OY0A 3ER9A 2WWVD 5F2EA 4EAAA 3R9IA 4P53A 4AJ9A 5K7SA 5DLYA 4IO0A 3SEZA 3SZGA 1GEGA 3FFXA 1JFVA 2YFHA 2B0JA 2F4NA 2QTVA 3OFSA 4YFVA 3LQYA 3CWZA 4QEZA 2A3RA 1XEFA 4B3BA 1GTJ1 1R9MA 1CR6A 4EL0A 1DO8A 3IOBA 3LHDA 2IH4A 5A5DA 1PTJA 5DWQA 3IL2A 3A8TA 2HWKA 2YHSA 1RBMA 3U13A 3ENWA 2FJUA 1JKMA 2H0AA 2YIJA 1SXIA 3F7MA 4RZXA 4XGIA 1RQLA 4KQMA 4ZVQA 4NJOA 4TKVA 1R1DA 3USCS 4JL6A 3KSAC 2ZVDA 3RUAA 4CF7A 1N36B 3T4PA 3SHTA 3TL6A 2G1KA 1TD9A 3B36A 3G8DA 3DF7A 4P93A 3Q40A 2C9BA 4D6YA 1R0YA 4OQMA 3RNLA 3EQZA 2ZBRA 1K08A 1M6NA 1J8VA 1Y3AA 1ZZGA 3HN6A 4C7MA 1AMNA 1PQYA 4JEMA 2WW8A 4L5AA 2J3HA 4DDMA 4ISBA 5DB4A 5KOIA 2DBQA 1NQTA 2XB8A 3R20A 1GYRA 4GOXA 3I6BA 4HLUC 4DDTA 5B6IA 2GPJA 4K2AA 2AOUA 3R3JA 4LMRA 4TKUA 2C5HA 4TXNA 4YDQA 5CA0B 2QTRA 1Q0UA 4ZVPA 3RSSA 3IQHX 2J9FA 1BRTA 3QWHA 1HZZC 2HRQA 5SY9A 2PRZA 1XG5A 3C6KA 1BEEA 1UAYA 1DC7A 4Z0TA 5DGXA 3O84A 3F1KA 4TMKA 1LC3A 2D1TA 1SZDA 1LPAB 3WGOA 3PC7A 5BN1A 2C7PA 4DMCA 1RXVA 3GZJA 1V3QE 4XVUA 2XH8A 2WYOA 4XYLA 1DHRA 1SUDA 2F3TA 2GTIA 3JYLA 3O0TA 4GHWA 3ZW8A 4TTJA 4BQRA 4BRUA 2PEZA 2FZLA 1QZ3A 4D5GA 2ZFUA 5KINB 1KOFA 2J41A 3BE4A 4FZ5A 1G21B 5EPOA 4CTNA 5BSHA 2P6MA 3Q3CA 3ZV5A 4O5AA 2NUPA 1V39A 3N8IA 1PQUA 1EFVB 4IIJA 4PYKA 4JI4B 1TE2A 3GLQA 3DM5A 2YIMA 1UBJS 3MWGA 3QY9A 1WB6A 4LJ5A 4BC1A 1SIBE 4U6QA 2JFWA 1QCDA 4FLMA 3P9IA 5A9SB 1QLJA 1ZSVA 3BA6A 3CXRA 3OSUA 5J5AA 3W2FA 1LRKA 5AVRA 3SXUB 3HUFA 4V0OA 1YRLA 4CFSA 2QJWA 5JXIA 1JNYA 16PKA 1YWGO 2OV8A 3GNLA 4LXIA 3TW8B 2ERCA 1TKAA 1ZNWA 1IM8A 3CRMA 3L8CA 3OOYA 4HP8A 3T4UA 2AOVA 1LPPA 4WT7A 3L77A 1YQXA 1QAOA 3SJ7A 3UVEA 4BGVA 3I73A 4KQEA 1T6ZA 2CLFB 4GXRA 1XR3A 5CA1F 1ZNXA 1RCUA 3B82A 1QSGA 5B57C 3DLTA 4WZAE 4PPGA 1EWYA 2C5GA 2R4QA 5DTEA 3U7JA 4BQPA 5FYDA 2QTTA 4ARVA 5KHLB 5CVCA 4K9RA 2HN9A 3JATB 1XJCA 4MVCA 5E6SA 5G4KA 3QU7A 3B8EA 1VHLA 1RJFA 1W9HA 3V8VA 1YB5A 2BFAA 5E2IA 2C9MA 4NZ9A 2B7BA 1XROA 1NVAA 2GT1A 2P35A 2ZR7A 3FZNA 1Z88A 1O08A 3K35A 3SI7A 3I61A 3CISA 1FDOA 1WUTA 3VX4A 1ZUWA 1XRNA 3DKPA 2P2ZA 2I2XB 3TUIC 4RPJA 2HMWA 1NYRA 1RXUA 4HS9A 3GG2A 2FR8C 3OZ7A 1V8DA 1XMJA 1MIOB 3GGPA 3QVJA 4DLLA 5AHOA 5BQ3A 1LJUA 4JYBA 2ACVA 4TMWA 4MUGA 5IXYA 5HZKA 2C4NA 2HDOA 2YXDA 1E1CA 1O87A 1UXIA 4UBIA 3VV2A 2BCJQ 4R0MA 4Z4CA 5JADA 3TGLA 3KQKA 4XARA 4FC7A 5CHYA 2IV3A 1JMVA 1KNXA 5A4DA 4HQRA 3Q3JB 2WVAA 4KZKA 3OQ6A 2PMDA 3R3SA 3U4AA 3DBVO 5FD8A 5HKKD 4DR3B 2WU8A 4Q6BA 4FYXA 3PCTA 2PL9A 2RH4A 3QRWA 3A4IA 2OGZA 2PGIA 1PYGA 1YA6A 4WCFC 3OH8A 4K28A 4URXR 3THYB 3MS7A 4N03A 1LFAA 2DT5A 4KV7A 4BKUA 3LPCA 2B83A 4M1WA 1HC7A 5JZSA 1ID8A 4PTZA 4RORA 3D8NA 1K86A 2EBHX 4L0CA 4B5KA 4Z0NA 1IRIA 3DA8A 1V4BA 4U2FA 2MSDB 4CL2A 3CJRA 3VJRA 2A86A 1GKUB 5F23A 5FR2A 4RTKA 1NRXA 4L8VA 2J5XA 1N5KA 4DJTA 4AZ0B 3TG8A 2X5JO 4QHYA 1KF0A 3DHNA 1VBKA 2ZWAA 1D6NA 4G0PA 4C9BA 1TJ5A 3NTXA 3OY2A 4DA9A 1SRRA 1E2GA 1U2ZA 5AFSA 4H59A 3R3HA 1FPQA 3OC6A 3ZCXA 4B3CA 4WNIA 2Q62A 2XVZA 1KMHB 1W36D 3UAGA 4EFMA 2CXNA 1AF4A 2W6PA 4HQFA 5DTJA 5FX2A 4D4LA 3SC2A 2O20A 2W6IA 2XI4A 1WPXA 1E3EA 5AM1A 1ETUA 1JEQA 3CUVA 1Z08A 2C9OA 3I45A 3I92A 5C0OE 2DQSA 1B26A 1NGSA 2XADA 1V7QA 3MCZA 4HFMA 4JGIA 4R8RA 5JCJA 1AN9A 3V9PA 4OQNA 3CGGA 5DN6A 2O2ZA 1VG9B 4TM8A 4WVLA 2I78A 1UBSB 1YQWA 3RQSA 1RC8A 1XXHE 1MX5A 2Z3ZA 5EKUA 4YP6A 2B92A 3TBFA 4FB4A 1BH2A 1PGPA 2GAIA 4FE4A 4BZZA 1RJDA 3OLVA 1WETA 5DKFA 3VGPA 2O54A 1Y9EA 3DFMA 3D6TB 2PS3A 1KPGA 1T6NA 2IEGA 3MQFA 1NYQA 5AKHA 2C4UA 2JLBA 4NAUA 2IS4A 2J9RA 1S2IA 3H1FA 4AIIA 4C4PA 4FR0A 1NMSA 4OHXA 3R7FA 4BEJA 5C80A 1F5SA 4R2HA 2AG5A 3H11A 5E9JA 3NETA 3S1AB 3FTNA 3IH5A 3K0CC 4J29A 3ONNA 1M1ZA 5DYIA 3VR3A 4R98A 5JNSA 1KAEA 2KSQA 3F9RA 4ZTUB 3ADDA 4CM4B 5KJFA 1Z4KA 3N76A 1B41A 4W8HA 2OCGA 4UAJA 4E2WA 1X86B 1A4UA 5JNRA 1ISGA 1HYHA 1MG5A 4ZU6X 2XMCA 3FZGA 3WBBA 3THOA 5E1DA 4JLKA 1W2GA 3E27A 3MJCA 1C4KA 3M49A 3QX7A 2P9EA 1E7QA 3OJ0A 3PC6A 4MIKA 3BDAA 3ZH2A 4ACAA 5HDQA 4JXZA 2Z30A 4ZAXA 1A7JA 3OUTA 4MPRA 1FXWF 2IY9A 3HJAA 3C8HA 1PWXA 2AFIB 4GP7A 1GXSB 5I4CA 2BH9A 3HKBB 3IXMA 4S0ZA 3ZHUA 4M89A 4JXXA 1PG2A 1XMXA 1M5RA 3S5JA 3I9NA 3ND5A 5IFLA 3OE4A 2CDNA 1Z8FA 1RT9A 2ZUCA 5JDIA 1W1UA 1OZFA 1NP7A 5LR6A 3FNEA 4RADA 1PD1A 1H6CA 5EIWA 4QM6A 1E6EA 3K1JA 3FGPA 4WKBA 3MC1A 3EGVA 1K6EA 3PXAA 5J63A 1JQAA 2C1ZA 4OATA 5AJXA 1QXSA 1V1JA 1EZ4A 4PWZA 3W5JA 4CM1A 4MEAA 3CUEF 3Q2OA 3WKCA 3HS3A 1NC1A 3FOBA 1F38A 2E4YA 4NPCA 3AERA 4NJMB 4Y2JA 1DMSA 2GCGA 1GADO 2MR5A 4EGFA 2BGKA 3DF9A 2DHRA 5JCPA 1K27A 4QECA 5BRJA 3NHYA 2PBFA 3CZQA 2NV0A 1R74A 2EZ9A 2HGZA 3F6RA 3NT2A 5TS3A 3S44A 4LQCA 5IWAB 2ZT7A 1V7ZA 4X95A 5GJCA 3NV7A 3OKPA 4B74A 4D41A 4F2DA 3PD7A 1BOOA 2I55A 2VUTA 2X9GA 3ASYA 1QIIA 3S2YA 3UWPA 3HV2A 1G8JA 1ZIPA 1C0EA 2W2KA 5CXXA 1KSGA 1I7LA 1CNFA 4ZI7A 1Z5PA 1HF3A 5FPHA 5L4NA 1T15A 1RAFA 5A6VA 5FUXA 3Q4GA 3V4PB 1NMQA 1E1MA 3H9BA 3JQFC 4GEGA 3O7MA 3A4TA 4HDSB 5AJHA 2DWQA 4PFSA 4BAGA 4QWMA 1XIVA 1ZRSA 3LF2A 4IDBA 4S2UA 4TQ9A 4S04A 3JCZA 4ZRMA 4LMAA 1HL3A 3ZH9B 4QQNA 1DJMA 1MZVA 2BGLA 4NCXA 3CFYA 2RKBA 2FMFA 4I1VA 2O52A 5HMLA 3PDIB 2BRUC 1UFRA 3K9BA 3TJRA 5A7FA 2H9YA 1D03A 3TS1A 4QARA 5TGDA 1EXNA 1FMTA 1IHPA 2C9DA 2VAVA 3AU8A 3ORFA 4Q5IA 5F9HA 4HAVA 4PLWA 5BN4B 3UANA 2QRVA 1WF6A 1Z37A 3RVSA 5HE8A 4GOMD 2H11A 3DBHA 3UWDA 2IBTA 4BV9A 5DYYA 2XYQA 1ML3A 1P7YA 1PUIA 2F3RA 2JIOA 4MR8B 1SU7A 3INRA 1CUGA 3F2IA 1XMSA 2VQ3A 3AKYA 4G89A 4S1OA 1DUVG 3LVQE 2CXQA 2OENG 2XNCA 3CZRA 1JQ3A 4QDKA 2CYCA 3KB2A 3MNFA 1WR8A 2PZLA 3C3DA 3H2GA 3RNOA 3VAAA 3E8SA 3I52A 5IF9A 2J08A 4DBZA 4YRIA 1EK0A 1Q1QA 1RI3A 2IYEA 4A5SA 2YR0A 4R41A 2YINC 3JX9A 2JEYA 3TRKA 4N5LA 2FPSA 4RKEA 2Q9CA 4XUEA 3B89A 2PE5A 2WYHA 4OGLA 1DAGA 1N6KA 3QYAA 4GX2A 5KI6A 4IHJA 3NXKA 4JITA 3M5PA 3UQYS 1I2DA 3AR6A 2VT6A 3LW8A 1ADJA 2AG6A 3PZBA 4X7RA 4KE7A 4HVLA 4CUKA 3BSYA 2Q4TA 1NXVA 4YMWA 3VU9A 1BKDR 1R37A 4AC9A 4DILA 3ZVKA 5CT4A 1Z6XA 1IHUA 4R69A 3U49A 4KDRA 3SF8A 5AVWA 3DDWA 3HCAA 4NG4A 1NQ5A 1I3OA 1JDNA 1JU4A 4QATA 4UTZA 5K8TA 2YWJA 4LF6B 3TTVA 1QYWA 1P0CA 2OBYA 3DFKA 1QYCA 4O2RA 4Q3NA 1F06A 2R25B 4DLNA 4Q00A 4TM7A 3HL4A 1PGQA 2R8YA 2QYOA 3EEYA 3NWEA 2VF7A 3QH4A 1EGMB 1B74A 2IXFA 2VFAA 4H3HB 1U7HA 4GWLA 2YOHA 1OFHA 3FFTA 2XNJA 3I2HA 3RUIA 2JGJA 3ZTTA 2DHDA 4UEWA 4MMXB 1UH5A 2IYNA 3MGAA 1KOGA 1NUQA 5P8WA 4HGZA 2VDKB 5CFRA 1R8YA 3LO8A 1FDWA 1ETHA 2W6OA 3DPUA 4KAJA 2F8TA 3BM5A 1B1AA 4IY1A 2YHIA 3WY9A 4KNWA 3GP3A 4F1KA 2R4UA 3EQ8A 1HEIA 3WLPA 4EJSB 2VF5X 4TTIA 3KSZO 4FT4A 5KYYB 5KNBD 4DV5B 3HZRA 3ZCRA 5EE5B 1BW9A 2XXAA 4FQ8A 2PU5A 4QWWA 1BXGA 4N7MA 4OI2A 2B8WA 4N8DA 3ZI0A 3UZUA 5FTWA 4W63A 5JFTA 4KR3A 4JN6B 1VBFA 2O3UA 2ZYDA 4C0XA 4E2FA 2Q2NA 1AGRA 1UUFA 2W43A 1OBOA 2I1QA 2JLSA 4QTZA 4QYIA 4GOKA 4OF4A 4MLZA 3GZNB 1VLQA 3R3WA 3LM8A 5DRTA 1GLNA 1UPAA 1YCHA 2VDQB 1XKXA 2ZTVA 3OO0A 1QE5A 2A3NA 4LJYA 4PGGA 3PGJA 4D4MA 3AUSA 5AI0A 2HK8A 1HDRA 1ORIA 2SECE 3MWYW 2W2QA 4LCBA 3ETEA 4B3JA 3U4HA 1JG3A 2Z43A 3UYLA 3L7YA 4MUIA 1D2MA 3WA6A 2QVXX 2VNHA 1KTVA 2F3QA 1CR4A 3H1PA 4P7FA 1GAWA 5GGXA 1EDOA 1ONOA 4CMCA 4EW2A 2HREA 2WWGA 4YCLA 3TX6A 2ZI6A 3WMWA 1M8KA 2NTEA 5TSDA 1P1KA 4IHQA 4HDNB 2EXXA 1Q95A 1BN6A 1E3WB 3WWZA 3M6VA 1YRYE 1Z63A 2CFTA 2IEDA 4IR7A 4MV9A 3S4YA 1QP7A 1G60A 5K0LA 4F5ZA 2XWQA 1Q2UA 1J49A 2D54A 4HGQA 1T3GA 2B7LA 5AVXA 1TZJA 2ERXA 1GO2A 2HEGA 3F73A 1ADCA 4RFVA 4BXOA 1G9XA 3RTBA 3UATA 1NBMA 1VGQA 3QITA 4BFSA 3KPVA 2PSDA 2OQVA 5MN6A 1UMCB 1GPLA 4IDHA 1O9HA 5CLLA 1V2HE 5ALLA 5H81A 4BB6A 2V7GA 4P1ZA 3G1TA 1KQPA 2UUPA 4XI9A 3LBFA 3EN0A 1G5QA 3RARA 1Y8QB 2XKBA 3GAMA 3KQVA 3ABIA 1M72A 2KQUA 5FI1B 2WKWA 1N2BA 3GJTA 1KETA 4RD1A 5AOBA 4J2OA 1CV2A 2WNSA 3AGPA 4XYGA 4B6EA 4FEYA 4I2VA 1N77A 2JARA 3ONVA 3ZY3A 1LPSA 1Z0JA 2Q1XA 1JX6A 3L8FA 2O3JA 2YYSA 3S2SA 4OK5A 4HS4A 2PPLA 3GLTA 4FX2A 1VXOA 4QRDA 1M54A 4TVBA 4CMEA 2YRFA 3GT7A 2QMOA 2C59A 1S0UA 1YBMA 3RAEC 5AKLA 5AM5A 2V7QA 2H4HA 2ZYGA 1DO2A 4BP9A 3E1KA 2H1VA 4NYMQ 3EAFA 1O94A 4YJHB 3IESA 4IZIA 3ZZUA 4FN5A 1YI1A 2NXNA 3KXPA 2X5KO 2YWCA 1TYDE 4YP5A 4FJ2A 2M1ZA 4M0DA 3QEBZ 4QYXA 1EMDA 3RBAA 3GO4A 5KYGA 2ZUTA 3U3MA 5E9AA 1BMFD 2ZIUB 1SB9A 4KR2A 3M4JA 3UM9A 1X1RA 3WLRA 3TCNA 3Q15C 5AI4A 4ER0A 1P31A 2MSKA 4KNVA 5BMOA 4ZVTA 2YHUA 1MENA 4J07A 2R751 1ZXXA 4ZQCB 4LJ4A 3W8RA 1OIWA 5JCXA 2M1XA 1K1EA 4ZEVA 1Z2PX 3M33A 2LTAA 2QPOA 4PLVA 1UXKA 5CB0A 4WLEA 1U0TA 1VBNA 4DJEC 3MEQA 4UHEA 4KO4S 1S2LA 1RU3A 1K7EB 3LWBA 2TMYA 4CMAA 2X0NA 4UM5A 1G20E 4MV3A 1S2GA 2R8BA 3SQDA 2XRZA 1NIJA 1QTIA 3COYA 5COQA 4MVWA 1TM1E 4E46A 3BE6A 1O95D 1E5DA 1G63A 2PSHA 4FFOA 3DSRA 3WGUA 3B2NA 3CH4B 2VJAA 4NH0A 4I6JA 4XJSA 2I4LA 1NVUQ 2TS1A 4DANA 5KTYA 3QX3A 2H57A 3R7DA 3RIGA 3COZA 4ZP1A 3GFFA 3VPAA 5EKSA 4KVFA 5CX1B 3BL6A 3AEUB 5ENZA 1AA6A 3U5ZB 1PI3A 4XGNA 5B58C 2WB2A 3FPCA 1FX1A 2IIQA 3LGAA 3DZGA 3DVAB 1JHZA 2IZZA 1QJ4A 4ZHSA 4Q39A 1NA5A 2IUEA 2QIOA 1XZHA 3VR1A 4B6QA 3LECA 3ADCA 2IOHA 1TYEB 2FPUA 1RI1A 3FHOA 4MLCA 1LV8A 3VR6H 1AMOA 5AH0A 5EUBA 4DR7B 3EWSA 1C50A 4PHTA 3LC0A 1KC3A 4JQSA 1L4HA 1LLFA 3I34X 3ZXXA 1E62A 1TQHA 2AVNA 1Y5NA 4MSUA 1JDSA 1ZJZA 3Q1LA 1CR2A 4PQGA 3RDPA 3LUHA 3HEAA 3FI0A 4K9PA 2CV0A 2VDOB 3VO2A 1XA4A 4XRGA 1ND6A 1XEAA 4A6XA 2GF2A 3W0LB 1KK3A 2GBLA 4U7WA 1EP2B 1L4YA 3ABZA 2Q5IA 5EWLB 1X7ZA 1Q1ZA 3TR5A 2B3TA 3H2IA 4Y6PA 3EPJA 1GTVA 3RYFA 1RLTA 5DBOA 3FYDA 4E70A 5TQJA 1R16A 2VJKA 2IXDA 1UEXC 3R77A 1IPFA 1FDSA 1O0SA 1PT6A 2RBGA 1W46A 4IYJA 5EVCA 3CUSA 1C2YA 2PHZA 4X3OA 3NYWA 3ZHXA 4JB3A 5CYPA 2N0SA 4Q03A 3OQHA 1YQ9A 3DZJA 1X7WA 3L1IA 3AUAA 4JLAA 2O0LA 2XQKA 2ZCUA 3FDZB 1EK6A 2ZTUA 3MLAA 3AZPA 2J7KA 3JQQA 4IXTA 2QN7A 2ODPA 2XF8A 1ONPA 4OIFA 1B6TA 4KMMA 1FRZA 4NAVA 1Q74A 3HJRA 4R2LA 4HX2A 3SYMA 4BNDA 1Z06A 3ZTWA 1XF1A 1V26A 2W8ZA 3L7CA 1UR5A 5LDGA 1KEZA 4LBVA 3SZUA 3C8UA 1MOQA 3K53A 2QRMA 2BVNA 3E7FA 1QWSA 3BJZA 3BL5A 2I4TA 4TMYA 2RC6A 1OI3A 4AZ3B 1Z73A 1GVHA 1U3FA 4A92A 2ZXUA 5HP4A 3PGKA 1EGHA 1XLTA 2BFEA 2BGJA 3DBRB 4KOAA 4RH3A 4ESEA 1KO8A 2VAWA 1AF7A 4IUDS 4YT2A 1R4NA 3E5MA 4ZICA 1PT7A 1GTSA 2XAAA 4I66A 5I47A 4JT8A 1UIMA 4A2PA 1US8A 4JOCA 3RC9A 1PVVA 2Q9AA 3E9QA 4PYJA 4B73A 3V97A 4HNHA 2BP7A 2JJ2D 5KQGA 3GLGE 4RKFA 5HILA 4ECAA 1HG1A 2GRUA 4QLOA 4XQGA 1BDMA 2PL5A 2R7MA 4O3MA 4FGJA 4RA6A 4BNNA 1XRMA 4YCBA 1U2TA 3E03A 1XYYA 3TLEA 5ADUS 3S81A 5ICMA 1Q16A 2O8EA 4NR0A 3CLTD 3NPMA 2JJ1A 4GAEA 4D5EA 5IJ9A 2QSJA 3T6KA 2R5WA 3MWJA 4EG4A 5JWOA 3EEOA 4F3KA 3G2MA 5L4SA 4UC0A 1PNVA 1K7SN 4Q93A 2J3LA 1NQVA 1ZUD1 2FUG6 5TVKA 2UYYA 4C08A 5JCOC 4EO4A 4A0SA 3H0EA 1RLMA 4RIGA 2GB4A 3HWSA 3HO1A 1E4VA 2GVDC 4M1KA 1DG3A 1ZVKA 3FPAA 3H4VA 5HBRA 3S0JA 5JE8A 2YZKA 4ZOQI 4Z0HO 3LY5A 2OA0A 3MTDA 3MMNA 4UHKA 3UMBA 4MDEA 2BN4A 3L0CA 3PYLA 4A36A 1E2BA 1JHXA 1QKJA 1VPLA 2DZDA 2P3QA 4R3NA 5SZKB 4RULA 4ZCTA 3RV3A 1QK4A 1R3UA 3NB0A 4HAZA 2CVPA 4KPFC 4HMPA 2C57A 2GRAA 1GGHA 1JR3D 4INZA 1Q44A 3NZEA 3WBJA 3L07A 3TEFA 3V7UA 4XVRA 5BWBA 3LGSA 3GH3A 4H77A 1O2DA 2HRBA 1GNQA 1OX4A 4QU0A 5CAEA 4NXNB 4FE7A 4EYSA 4YJ3A 3G0DA 4K6GA 1E94E 1P2BA 2FZ5A 2ETVA 2V7TA 2VPYA 4CCSA 2PX5A 3L0IB 4G0YA 3WB0A 1EVEA 2FWMX 1NQXA 1VDMA 3FW1A 2E82A 2XMDA 3D43A 4KYVA 3TSOA 3WJ7A 5HK8A 3F6CA 1JIXA 3C1OA 1Z4MA 3EISA 5FNZA 2REBA 3ZK8A 2ZEJA 1GFIA 4JWTA 4M86A 1P6UA 3KDAA 4TXMA 3C24A 4FHGA 4UMVA 2XXJA 4QUIA 1Z6ZA 1AC5A 3R3UA 1SKYE 4TKLA 4JSTA 1PUXA 2EFGA 1JE1A 4XPIA 5EHGA 1LC0A 3RFVA 3TZCA 5KTMA 1PO7A 1AGPA 5JSZA 4QOHA 1NSFA 4C6RA 2Y8EA 4G9BA 3ADOA 4QUEA 2DTEA 1QIMA 3LY7A 1CIVA 1XTSA 3JQPA 5CT8A 4JGBA 4PINA 2AMVA 3MUEA 3GUHA 1FYWA 1OI2A 4Q3BA 1N2SA 4R9SA 5CVJA 2DLCX 4O4HF 3I6YA 4BNIA 1E3TA 2YV1A 3KNZA 1ODKA 2R7AA 3FNQA 4INOA 1XTJA 1UBUS 3UFXB 4KBYA 4MWEA 3FUXA 1JH9A 2OQIA 3A3KA 5B53A 4EO9A 4IVRA 3AB8A 1H22A 4RD3A 4RH0A 1KBQA 2IOFK 2JKZA 1WSAA 3ZNOA 4EW1A 2WIBA 2YJZA 3PNQA 3OTHA 1BSVA 2UAGA 2NPIA 3PDHA 4L15A 4WBXC 1Y8ZA 4Q48A 1KMCA 4CF6A 1NBOA 3HBNA 4NHEA 2NV2B 5IBQA 3BMNB 1GGVA 4GSLA 2GN2A 5TQ2A 4F4FA 2E49A 2ZM5A 1FFYA 1B6RA 3I4LA 3GI1A 4G85A 1YL6A 2VBIA 4PEVA 2X0DA 3TIIA 4H1TA 1SUPA 1ISPA 2O2HA 2QX8A 2DWPA 4JLNA 3X1WA 1RWQA 4ARAA 1KI6A 2GUWA 2HMVA 1N7IA 4WJZA 3V1NA 4DCTA 2FE1A 4LV6A 3RHZA 1LK0A 2CHUA 2FRVA 3KKKA 3MWEB 4G23A 4EP1A 5MFZA 3AEXA 1NMEA 4GNKA 1QG0A 3UG7A 4DLKA 4TT8A 1NXTA 1Q7BA 3W8EA 1QDLB 1V1RB 2EFDB 1E4EA 2QT1A 3KXKA 3X3HA 2BTEA 1CZKA 1YFJA 3AVOA 1IC6A 4F6LA 4OGKA 3BERA 4RMNA 3LDAA 4FXOA 1JQ5A 1EVLA 2J09A 3E9CA 3NYRA 1DI0A 3BSFA 2VTDA 4J1QA 4TSRA 3P2IA 1ENOA 4AY4A 4HN4B 5SYNA 1HR0B 3VO1A 2QPAA 1WHSA 3OCYA 4BHTA 4RPKA 4W5RA 3U4QB 5EKDA 4DL9A 2PU7A 1WVIA 1N2CA 2BFCA 1SBNE 3N53A 3AHCA 3O8QA 4KN6A 3JALB 1E9AA 2XOXA 3CZAA 4REOA 1MAUA 4ZYLA 2PX8A 1YF3A 3M6IA 5JI3E 1G6Q1 1MGPA 1RQRA 1TC2A 2BM0A 3SYKA 4DSUA 3QTBA 2HQ1A 4LYEA 1U6IA 3Q3GE 5ITVA 1B0AA 2ETXA 1TLTA 2O8VA 4HD8A 4IUBS 4XX0B 2VSXA 4D4HA 1T3LA 4Q82A 3VSDA 2Y1DA 4XD7A 4LZJA 3RS3A 5HRAA 3GXBA 3PUWA 1NQAO 4ESVA 4ZQHA 2HJ9A 3KTOA 4MI9A 5D3MB 4PX3A 1JVSA 2AI3A 1DC6A 3IEKA 4XSGA 1PLLA 2C7RA 3UK1A 3T1YB 1U5CA 1MFZA 2OO7A 3LUGA 4Q3DA 1NJ6A 2WD7A 1XPRA 1ATZA 3TECE 5HF5A 2FFJA 3T7JA 1I1OA 4AZWA 5I9NA 4YV7A 1TIPA 2WKQA 3ANLA 4FFVA 4DNOA 3JD2A 4OMCA 4C87A 4JYZA 4H3KB 1POXA 1WX1A 3GEHA 4R9VA 3EZ6A 2X8AA 3EEQA 4RF2A 1Z45A 3EBLA 4LC9A 2Q9BA 1EFPB 1IXKA 1ZUNB 2QTZA 2YVAA 1F8GA 1UZLA 2FSVC 3OUUA 4LC0A 3UF0A 3P9QA 3T9CA 4TYYA 3RJMA 5G3ZA 3OOHA 4LZZA 3PR3A 3VDMA 4C7BA 4F96A 4TMXA 3HTXA 3OICA 2B1JA 5KTSA 5AJZA 1AQNA 2F7SA 2H1IA 3AJDA 3COVA 1UPBA 1VI6A 4L08A 1XRSB 1DG1G 3BK2A 3QI7A 2BMFA 3ROKA 5JS2A 4CRWB 4NMWA 4DDHA 2CMFA 5HS4A 5M04A 1K5GA 1T0JB 4LV5B 3WKDA 4DUPA 5SZIA 3IPCA 2DMRA 1AM4D 5BW8A 4M1TA 4FE3A 1QS0A 1RLJA 1YJCA 2B94A 2AI2A 1RI2A 1GN8A 4NV3A 2UU9B 3RWMB 4DYHA 1N5IA 1ZIOA 3F7TA 2VHCA 3HE3A 3Q8XB 1TT5B 1M1NA 2HK6A 5FL3A 4JFAA 3U60B 2XYVA 2O2GA 4I50F 4TYWA 3IP9A 5FWYA 3R0JA 4OHKA 4QREA 1GG2A 2ZPAA 4QJ4A 4R2IA 4N01A 3I30X 4KSYA 3IDAA 1PFGA 3VZQA 4Z6KA 1HKHA 1SXJC 2FKNA 4U2EA 4MGHA 5DEOA 2RHRA 3L4SO 4CMEC 1AV6A 3N6RA 3CZ5A 4MV1A 1P5HA 2Z3VA 1YHZA 3ELUA 4RH1A 2YJ6A 3WFIA 1NV8A 3VVCA 3CONA 3NXSA 2RHWA 3OLZA 3WGHA 2C7OA 2XZLA 3OZBA 2WSMA 1YA8A 1E60A 3QXHA 4MS1B 2XE8A 3CC8A 1O94C 4HEHA 1GV0A 3TF5A 2UYCA 5D2CA 1COZA 4PLYA 1WXQA 4ZJYA 1WOYA 3LT0A 4XIIA 1OJLA 4NC9A 4AJ2A 2CMKA 3FFBA 2AS0A 4C7OB 3OAAA 4ZVSA 3L0BA 2P9CA 4L16A 3ZDQA 1L4EA 1LQTA 3K9GA 4PN3A 2HW8A 3HABA 3FTFA 1KPIA 3F7NA 1E69A 1Y42X 2ODEA 3W5HA 1MB3A 4B80A 3P27A 4X6UA 4KKVA 3FPSA 5I8PA 1OVGA 1ESCA 3QLUA 4PNHA 5PNTA 3L8GA 5HVNA 4G0VA 3D3JA 2F67A 5FFFA 5B1DA 3BL8A 4HLCA 2J31A 1WAMA 4IDDA 4BLWA 4MKHA 1ORTA 3LBAA 1XZMA 4JLVA 4MDYA 4TWRA 3BXHA 1UODA 3DAHA 3HBFA 5F98A 3TLYA 2YNMD 1Y3IA 3TX2A 1E3SA 3AF0A 3SFVA 2VSYA 2VJMB 2Z56A 2DKNA 3R0VA 1YMQA 2VC2B 3UUEA 1PQ4A 3G68A 1V8OA 4K3UA 4LZAA 2C9ZA 4CM8A 3O4JA 1RWPA 1JYSA 3OZGA 1MBZA 3UAOA 4F0JA 1W75A 3C98A 3AINA 1C30A 2GMWA 4B2PA 2R4TA 4L4XA 2FMHA 1Q0LA 3G9QA 1G5FA 1EVJA 3ME5A 4ALJA 2ZXFA 5H80A 3T0IA 3QF7A 2X19A 3ED5A 3KALA 1U80A 3W4KA 1Z8HA 4B7CA 1TX4B 3H9EO 2ZSAA 3EOZA 1R0RE 3KWMA 1ESMA 4MS4A 1GZVA 1YS4A 3EXG1 4UJ3A 2CLHB 3COSA 3TQTA 1OXBB 1CJKC 3RTEA 1JPVA 1WDKA 2XT0A 1H4VB 4D7AA 3FXAA 1P18A 4NNOA 5CCBA 3L0SA 5TGZA 1GPJA 2DECA 4O8ZA 1QU2A 3L8EA 4IQ0A 1JQKA 4HGPA 4QUBA 2QL6A 3ORYA 4W1PA 4CVNA 2ZQZA 4AXXA 1HH4A 3AI3A 3N2ZB 1W88A 4QDZA 3K70D 1RMYA 4ND7A 1S2NA 4US1R 4RAOA 4YRMA 1X7DA 3EXHA 3IHTA 4HDMB 4KU4A 5FFMA 1PFWA 3GD7A 2ORIA 3EG9A 2GBLC 1U94A 3WE7A 5CDUA 5HZGA 3ZE8A 5AVKA 3DD5A 1NT4A 4JC4A 1LCIA 2VT3A 1S6YA 2E48A 3MJSA 1M34E 3QPWA 3T1HB 3L7BA 1NJ1A 4F4DA 1RZ3A 3SNHA 1M2VB 3UK7A 1OFVA 3FSEA 4Q4AA 1UIRA 5K0JA 4NZNA 2IUTA 3NJ4A 4B3FX 4TTQA 2QW8A 4GX1A 1AHHA 2O5VA 3ND9A 1A69A 1TUBA 1Z0FA 3DTVB 4GRDA 4HWGA 2D4AA 2QXUA 2AMJA 4FYWA 3OCXA 3AJEA 3IAHA 3ICPA 4HQLA 4MQEB 2PR2A 2C97A 4NZMA 4JVLA 4GLFA 5CFNA 3J81A 1J70A 2QP9X 1OQAA 4UTNA 4D0RA 5KC9A 3T52A 4EABA 4TQAA 4QFCA 5LZ9A 1VL1A 1SUIA 1L5ZA 2R62A 1P8JA 4TRMA 3W1EA 3KQTA 2ADOA 3ES9A 4DR5B 3SEFA 3JZMA 1VFPA 2VBFA 4GOLD 4DCCA 1JFFB 3VR4D 3MCVA 1XNHA 3HHPA 4CMHA 2O59A 2IZ1A 4S35A 3CEAA 1OX5A 5REQA 3GHHA 2VDWB 2YN0A 2IW1A 1RD4A 1NHGA 4S2EA 4YBZA 3TO5A 3H5TA 1UFQA 4PPFA 5JRDS 4Z4GA 4G41A 1WEKA 1H1LB 3HSYA 4QUAA 2X9LA 1WPGA 3NOOA 4PC1A 3IIEA 5FAKA 2X4LA 2QRUA 2WWWA 4IMJB 1KJZA 4IMPA 1QX4A 1ZPDA 4MVXA 5BV8A 4GG1A 1XZJA 4TUYB 4XTCS 3RVPA 1MOZA 1Y6JA 2O8FB 2NN3C 3L46A 1SFRA 4ND1A 2H1CA 2R6FA 3LC7O 4LF5B 1QBKC 3K09A 1C5KA 3FI9A 5L3QA 1FTGA 1ZOOA 2HD4A 1IDN1 5AW7A 4P80A 1LNSA 4GVPA 1NX9A 2HMSA 3KJIA 3AI1A 4TWJA 4AG6A 4ESHA 3HADA 2Q3MA 3HPRA 3V8RA 3DP7A 4LDRA 1JAYA 5KYKA 3UMJA 2ZKLA 1G4HA 1UMDA 2P1DA 1T9DA 4HN9A 1YJAA 3OVMA 1RM3A 4WKNA 1R66A 4LE2A 5ENDA 4DXAA 3ZY6A 5BQXA 1Z7BA 2PXAA 3H1TA 5EZYF 2BI8A 3LDUA 4K6KA 4WFIA 5ADVA 2H8KA 1Y37A 3DYBA 4O4HB 3OA2A 4GU5A 5K0GA 4ZOBA 2ANBA 5KZMB 4YTEA 4NDAA 5E3JA 1PJBA 3JQBC 2BE9A 5DLQC 1OJ7A 3RVDA 4YAFA 2MU1A 4PSVA 4GBGA 1XVIA 2H4FA 2P11A 4R83A 2BGIA 3MINB 4IQFA 1J23A 4KVAA 4LW8A 1WQ1R 4OSOA 5THQA 2FW1A 3LWNA 1I7SB 1L7QA 4X3CA 3ZWWA 1YCFA 3I0ZA 1UJBA 1VJDA 1XCLA 1B14A 1G21A 1QZTA 2DWUA 2ZB8A 3F6YA 3GGCA 4XUGB 5D3ZA 5AOAA 3WSTA 1M66A 3AVWA 1LVUA 2A5GA 1UXHA 2KLBA 2WJZB 4JXKA 4M9UA 3LOQA 4BX8A 4CCYB 4E6EA 3EXFB 3T9BA 4CLXA 2G6BA 1DINA 5A9SA 4YP9A 3T1TA 3HBMA 3SXUA 4YI3A 1P0IA 2BISA 3DDHA 3R6TA 3R8FA 1P9NA 4FDLA 3VNAA 5HM8A 2Q1WA 3S55A 2OUIA 3QF4B 4LDPA 2FPOA 3R0XA 3WNVA 5TR9A 4A2CA 3LP6A 4G8JA 4OM7A 1EGAA 1M2EA 3KQWA 3QFCA 1ZGBA 1C7FA 4I5FA 3PQ3A 4N3NA 2O5CA 3H16A 4OSEA 3C5EA 1I3KA 1BXKA 2WT4A 4LJAA 3TOSA 3WB1A 3ZUPA 2IE8A 2R60A 3OOWA 3JQ6A 3PS9A 1X7HA 4JQZA 2X5XA 3ZHCA 4K6OA 4XSVA 5GV7A 3BWEA 3OJLA 5LQSA 2Y77A 5BXQC 3D2AA 4XASA 5KYNA 5EGSA 1ILEA 1F6DA 5HKAA 4G1BA 3GA7A 2ZI5A 5GAJA 4K8OA 4OXKA 2ONJA 1OH8A 3OJEA 1GNLA 2GO7A 5JJCA 1S8NA 2XTAA 2Q6OA 3EYAA 3QKSB 1H3NA 4G1MB 4JP3A 2F3UA 1XDSA 2DLDA 4TMTA 3H05A 3VVBA 1JB9A 1NOKA 1R8XA 4ARZB 1KO7A 1EFUA 4HH3C 3RVBA 3K73O 4C4ZA 4QVIA 4UCFA 4DSAA 4DMHA 1ESZA 2DEUA 3OI7A 3R7NA 3TRFA 1CYEA 2PGJA 3IUNA 2IL1A 2WHEA 4BFVA 4J3FA 2PA0A 2V6FA 3MJTA 4RANA 2GF9A 1XMQB 5AI6A 4KWCA 1IVSA 4UHJA 3QX9A 2G3YA 4V0RA 2AZMA 5KJEA 5BSGA 4FW8A 4OYRA 1OV4A 1PEAA 4BEBA 4EPVA 3QLEA 4QU8A 3H5NA 4EKNB 3O73A 1NDQA 1SXJE 4KIWA 2ZRCA 2ZJ5A 5KAMA 4JVNA 121PA 2E5FA 5DHAA 4KQ1A 1W25A 5KNDH 4I5IA 2QJFA 3UMFA 1CNMA 1XTUA 4G63A 3THYA 4CEHB 4KEAA 1ZSYA 2XZTA 2GSDA 3IQIX 5LVAA 1UPXA 1NG9A 1UBFA 2P65A 4MI3A 5ER9A 2H51A 2QVLA 1RLUA 4UTXA 1L3CA 1Z7WA 3WI7A 5JQGF 2GPYA 3LBHA 3HC7A 4MRAA 3GUVA 3RJZA 1N9GB 3WLOA 3TDKA 1FL9A 3W5BA 2XUFA 4AZ0A 1UZAA 2B2CA 2JATA 3C15C 1DQPA 3RVLA 3PX2A 2GJAA 3HCOA 2ESRA 3PFWO 2GTPA 4OHVA 1G20A 1ZSNA 7YASA 2FA9A 1ISFA 3N39C 5JLJA 1FUIA 3IERA 2ATEA 3MT8A 5DOVA 2EARA 2OB2A 5I9TA 3HVUA 1K8QA 1QYIA 1KYXA 1KMHA 1JIJA 2QHXA 3F2VA 1TGVA 4I7EA 3Q98A 4P31A 1SCUA 3HKEB 4CKWB 3I5MA 4E5UA 1DRVA 3CLHA 2UZ0A 2M6KA 4ZYZA 5KWIA 5G3YA 4HWRA 1C8LA 2H5EA 3HJGA 4N49A 1XCJA 1ORVA 3V4FA 2XVMA 2ZYAA 1VSUA 2VK4A 3QEJA 5B2ZA 4CQNA 4UTPA 2JGFA 2BGTA 4AN0A 3H2ZA 4CMKA 1HQKA 1NTOA 1SKAA 4QD3A 2DYKA 1Q0RA 2WU3A 1Z4LA 3O83A 5FULA 3CRVA 4CUJA 2VO1A 4PZCA 1L4BA 3UJBA 1VP9A 2ZIFA 1GKLA 3GFOA 1PP4A 5KOJB 2ZAOA 3N0WA 3F6SA 2ORED 4MUFA 3RE1A 4A73A 4CM9A 4GEKA 1UDWA 3GJ4A 4E6PA 4RHFA 3AOEA 1G7CA 5M7EA 1BDJA 3IEUA 3PPYA 4F4JA 1QKKA 3L4KA 1SQ5A 1PJLA 2H1LA 2ZWPA 1JAHA 1Z7YA 5COBA 5FOSA 1WKBA 4CM4A 1E9FA 2R6ZA 3RSLA 4MVJH 3ISJA 4PIMA 3WK8A 3L4JA 4E5YA 1R6TA 4KIUA 1QF9A 5LP6A 2BFDB 4X97A 2J67A 1G6HA 3H5LA 3VR5H 4V0ME 5FWAA 3COWA 4K9MA 3BCRA 3TRHA 4KVZA 3IOCA 3CO0S 3SE7A 2PWYA 4ZEXA 4QUJA 3QX8A 3GA0A 3A10A 4B76A 4MROA 1RRGA 1VCMA 4MICA 2AFIA 1IOWA 1GXSA 2DKFA 3HKBA 3P0EA 4GOJA 4J1TA 1Y5MA 1P2DA 1FSSA 2ISCA 3RS9A 3HDJA 5B1YA 2QVZX 3SGLA 1FQJA 2VWQA 4JT4A 3OEHA 3RUDA 1XFAA 3D7LA 1JZSA 4LNUB 4M60A 3TZQA 1UOPA 2G9NA 4NCIA 4X1YB 1OFIA 3RO7A 3S5UA 2GAJA 1TZKA 1DRJA 1DAIA 1JIUA 4MZXA 5C8YB 1GZHB 3V55A 1Q5PA 1QC5B 2ZZMA 4C0QC 3EUFA 1DUIA 1YU6A 2P77A 3N05A 1E92A 3ON5A 2Y6VA 2GUGA 3INTA 1ZICA 3R0ZA 4NJMA 5ETJA 2Q21A 4RKRA 1MW9X 2NACA 3RFFA 3UAYA 1EUCB 2PQ6A 3EW9A 3WQHA 1JHOA 1C8VB 3H04A 1XK7A 4OU5A 2FRDA 4JHLA 3HVKA 3DFZA 3W6NA 1MOPA 7MHTA 4EKYA 1ANKA 1A95A 1OPXA 2AMLA 1VB3A 3A32A 3LT1A 3OJFA 3OD5A 3SX2A 1ZN2A 1XB2A 1ZMRA 5INTA 2RJ3A 1VOTA 1YRQA 2XUPA 3AHIA 5EMHA 4P0PB 4PBSA 4PWYA 3D0OA 5EZ6B 2NZYA 2CNWD 3T0GA 3UKDA 3ETDA 1QOZA 2VCYA 3QLUC 3QP9A 3T06B 5CFQA 1CUVA 5KMGB 1CQJB 1Y48E 2F1HA 1AKQA 1CUHA 4KAAA 3H5VA 3DO8A 2C58A 3GB9A 1KFCB 2FEXA 2GZMA 1QCYA 3ONEA 1NUSA 4HDSA 3AONB 3OFJA 2ADMA 2V65A 1N8TA 3GRYA 4OGGA 5B7PA 2N75A 3TZHA 2E6UX 4ZVNA 4A23A 4BUJA 5JPCA 2B0CA 4F91B 2BGRA 1E2PA 1GP2A 3F49S 3CNEA 1R9GA 2ZAIA 3G7SA 3NHUA 4RCVA 4UASA 1Y6RA 3GH1A 1M5UA 4OU4A 5CJ2A 2FJPA 1I10A 1TDJA 4KPUB 1Q0SA 2WTNA 1U8YA 2Z6AA 3IIKA 1PQWA 1QF7A 4CF5A 3U44B 3D6AA 1RP7A 1ESEA 3TM4A 1T4CB 2P9HA 5BN4A 3LZCA 3FIUA 4BTLA 1O3YA 1QCZA 3BKXA 4FINA 1JQBA 3K0FB 3NALA 3OQPA 1D6JA 2VHUA 2QROA 3GHYA 3E9MA 3N6VA 3OZEA 2I62A 3E9EA 1U9YA 4PTYA 1CRPA 1NP6A 4N41A 3VU1A 2J6CA 1OMOA 4P3YA 4PN7A 2D7CA 5JAHA 2O5EA 3O8OB 1QHXA 5JY6A 1NJ5A 2CD7A 2XGSA 2F00A 2O6HA 1F48A 1SG6A 3NUZA 2PMFA 4B48A 1GQSA 3OE7D 4DA8A 2DR0A 2PFSA 3L49A 4O25A 4EA8A 5BN3A 2OMEA 2FVXA 1DRWA 4YLGA 1NUHA 4PZUA 3GGGA 1OC2A 1M1XB 1JLMA 2OHGA 2V9PA 4LEIA 4RPIA 4H7EA 4DIMA 2NUBA 3BFXA 1J5PA 4GI3A 4JMLA 4UDNA 4DLZA 3SBEA 2XR1A 2I6UA 5D3KA 1CEEA 5JVDF 1EXWA 3HP4A 1YVEI 3GVHA 1DQYA 1H93A 1OKKA 1T5OA 3EXHC 3PKZA 3HRKA 3B3GA 4FS8A 3GEGA 2GXUA 1KK1A 3KFXA 1RBYA 5DGHA 2YYZA 1A8HA 1IB0A 1IBRA 1L7VC 1MU0A 1TIKA 3CVOA 1G4UR 3BAFA 4O63O 4YQZA 1LVGA 4YQYA 1Z56C 5KCZA 1V11A 5M29A 3ZXIA 2IH2A 1FDVA 3D6VA 4JMPA 1HGXA 5DM4A 4AXBA 1E2KA 5CPBA 2VJQA 3V2UA 2FWJA 2V6IA 2GPNA 4Q3AA 2BJWA 2R8ZA 3PNMA 4OA5A 1SCIA 3IO3A 3DH0A 4Q02A 3PHHA 3RK0A 3VISA 3EVEA 3UPUA 5EZYB 5JI2E 2IPAB 1ISRA 4OXXA 2PIDA 1C1YA 1Q3HA 2RI0A 3IVCA 4G5YA 2ZREA 5KREA 1J21A 1JHMA 4EY4A 2QTLA 2D06A 1WDWB 4FCVA 2AYXA 3C5HA 1MRZA 3BYZA 3ESYA 1G8MA 3GRUA 5EJEA 4MQ4A 4Z1MD 3FETA 3KU1A 1I8TA 3KS9A 3L0ZA 4CWAA 2KBEA 3N7UA 2GXSA 3EF1A 4MMYB 5GV8A 3IMKA 4I3FA 2BCEA 1XMOB 2GZAA 2GZRA 1L7MA 4EJSA 4NU0A 1D2HA 5FWDA 3GVIA 5JC8A 1E9DA 2FFBA 1KY2A 2FUEA 3GJZA 3H0KA 5C5DA 1F0NA 4W5TA 3G2KA 3UK2A 1JS1X 1BVYF 2PO7A 3HB1A 1JRLA 4WKGA 4LTMA 5I8ZA 1QK3A 1FVHA 1XAGA 2ONCA 4AG3A 4Z2YA 5IVIA 2JLXA 3MPUA 1WBJB 2C4VA 2HY7A 2KHZA 2V54A 4BC0A 2Z2XA 4M8KA 1UWVA 1PR9A 2BMJA 1JHUA 3LS2A 2FWPA 1RHMA 1PL0A 4ITRC 2QS9A 1E8MA 1TZ2A 1PHRA 5KVQA 4PZPA 4DC0A 5CA1A 4JEHA 3GLIB 1QO9A 3FPFA 3HKDB 2YC4C 3ZV3A 3RFXA 3P5BA 5FRDA 3JQCA 3PBKA 5FF9A 4D9NA 3ZU6A 5KBYA 3UENA 2NZVG 3DMNA 2H00A 4JAVC 1W0KD 3R8XA 2AG1A 5FL7D 3I01A 3WC4A 2QZ9A 3A6ZA 3QA3E 5HXAA 3HFRA 4HDNA 4ECEA 3UV6A 3ESRA 4X20A 1P7VA 4QAQA 1XDUA 1E3WA 4MV7A 1A8UA 5F3DA 1X94A 3C2QA 3CX6A 5E0KB 3EF0A 2HMUA 3R4CA 4WLVA 5BYBA 2FQ1A 5EJ7A 4LXTA 5KX5B 3WZLA 4U2KA 3WKAA 2H4WA 6GPBA 4NESA 5AJVB 3CH7A 2B37A 3UOAB 3QLJA 3ANMA 5ALFA 3L7MA 3E7WA 2ZE7A 2OYCA 5CLFA 5FWXB 4LUCA 1NMYA 4KDEA 4X85A 4QFBA 3VU0A 2ZSJA 1UMCA 3OLYA 1P9RA 3CR3C 2C2GA 4W5OA 4MV0A 3OPXA 3PUZA 4EA9A 2FFAA 1PWZA 2ID7A 4RIEA 1NVGA 4UPEA 4I55B 1Y8QA 4X61A 1FIUA 3PUXA 3ZLVA 1IIRA 2FPGB 1VTKA 3OCZA 1Y33E 5EEHA 2IHVA 3GVXA 4YK7A 4C7XA 4IDFA 2QQ0A 4Z5XA 3K92A 5DMXA 4DB2A 5LBIA 4LI3X 1DC4A 2I8LA 2X5NA 5I4BA 2B61A 1N78A 1OXKB 4FONA 1ODCA 5JQGB 4MVJE 4EBFA 3L05A 3K6RA 2DUMA 4NCNA 5IMSA 4GR5A 3R7LA 2E6KA 3BGWA 2YYYA 4INAA 3JQGB 4TT3D 3Q85A 3LD9A 3NP7A 4MGKR 5KNCH 5CNMA 1T0UA 4YHBA 4YJHA 5FUMA 4F84A 3A58B 3G7NA 5D1HA 4D02A 1K3FA 2GHIA 2HLNA 4PQRA 1FLAA 5I7RA 3K6SB 1GPBA 3E3NA 4ZAGA 3T9FA 4CG2A 3K0BA 2YVKA 2JIQA 3KSRA 3G0IA 3L01A 1QGAA 1NJ8A 3QGMA 1URPA 2EX1A 4HNGA 4IEEA 4P34A 4TLDA 4WNYA 5A05A 1K7YA 2O06A 2W2TA 3W5IA 4E2YA 1U3CA 4EW6A 2ALJA 3PNSA 4YNBA 3EC7A 1AVTA 5LYYA 3DULA 1ID1A 5EQDA 2G0AA 2ICAA 3D7SA 1IK4A 4W7IA 1BJTA 1RPTA 1X77A 3RASA 1EDZA 1G8YA 3PHIA 4DM3A 3ZDCA 3NHKA 2HJSA 2AZ4A 2X8JB 1ZD3A 1QFXA 4XQEA 5FUQA 1BX0A 2WSSA 4N1AA 1Z22A 3CIOA 1NF9A 1XQYA 1E8NA 1YIAA 3G49A 4AB1A 3BGIA 1KP3A 2F90A 2AK2A 4HWKA 2AJBA 3H8SA 2F1OA 4ZCPA 4Y1RB 2WG0A 5DK4A 2GNPA 1IE3A 1CDEA 4KWTA 2F1IA 3OPNA 1GPAA 2RGCA 4EEKA 3ANSA 4Q6WA 3WSWA 3KLNA 4GPBA 1ITZA 1RS0A 1XTRA 4RM2A 1JDBB 5JZ9A 3H9UA 4JJ4A 3WL7A 4YMGA 5K6AC 2FNAA 1E2LA 2QE7D 3DUWA 3PNBA 5IAGA 2QLLA 4J4BA 1Y8CA 1RAEA 5CX1A 4Z7OB 1HDIA 3AEUA 1W0JD 1D4ZA 1J8FA 3QV1A 1EB9A 4RYLA 4BFWA 1AK9A 1FJHA 3PSHA 3ILVA 3BTUA 2X2FA 4AL4A 3OEED 4DHWA 4WWHA 4RZSA 3EIQA 3BXOA 5BQ5A 4NS4A 4UTVA 1EDBA 1IRXA 3EDOA 4NBKA 4AMBA 1WCIB 5TNXA 1V6AA 1YRHA 4TROA 4X5OA 3EWNA 4KFCA 3EPHA 3A37A 5IT4A 3HDYA 1XTPA 2IH5A 4H4EA 4JJ8A 3RABA 3I3OA 4HNQA 1LS6A 3HY6A 1YHYA 3IAS6 1G19A 3FMPB 1FXWA 3NJ8A 3QOWA 4A8JB 3CSDA 1ONSA 3M1IA 4D3SA 3KC2A 1Q1EA 4IKOA 1OLXA 1AY0A 4D82A 1CY1A 3QKRB 1BH6A 4WGGA 4RV5A 2EWWA 3NNDA 5BV2P 1DADA 4KR6A 5EWLA 1DKOA 1R7RA 5HFNA 3G13A 3T4XA 5EXPA 5BVHB 1A88A 3X44A 4M7PA 5AI8A 2BEWB 3ZWBA 4QBTA 3EE6A 4ENTA 5JNTA 3GLSA 4KWHA 1FPMA 2Y1EA 4K05A 4TX1A 5HCNA 3ACDA 2V7VA 3BMQB 1FDTA 3WIEA 3LPDA 3G5AA 4LPKA 5LP1A 2ZJ6A 5BNZA 5BWCA 5K2MA 3ANNA 5EA2A 4YROA 3FDZA 5K3DA 3EYWA 1LXCA 4WHMA 5DHSA 1KERA 4CCAA 4FHDA 4RLSA 3A3OA 2R2AA 3NQ41 2WE8A 3VNRA 2SCUB 4BFLA 3H2SA 3BWXA 2WM3A 1ICEA 1QFYA 3SR3A 3TTYA 4E03A 3COPA 4HQ6A 4L6CA 3Q1KA 3RCBA 1WUKS 4QU5A 1ZMOA 1T5HX 4AZ3A 1QIDA 3HLKA 4A7PA 4CKEB 1O97D 3AOEC 3DZCA 3LX6A 4I4TF 3GFPA 2ZBFA 4KG7A 5DTMA 3MHTA 1FRNA 3OPMA 1C2TA 2G9QA 4MUMA 2VEDA 2OBMA 1WW2A 4UZEA 3SZLA 3TLJA 5C8DA 3IAM6 2Y9MB 2YW9A 5GZ3A 2FCRA 1T2AA 4EUHA 2JBHA 1VQ1A 2BL4A 1WP9A 2RGGA 4G0NA 2GSWA 2CBZA 2HXYA 3NEJA 3T7SA 3FOWA 3IBFA 4GX5A 1ARZA 5GWXA 1RSZA 1V8BA 2P4SA 4NE7A 4R1OA 5E7IA 4F3NA 2JI9A 3HCWA 4JU9A 3I83A 2HRZA 3AL3A 1K5HA 1M2KA 1XMIA 2HZ7A 3C7CB 1E2NA 3RVKA 5KKCA 4CEIA 1U7XA 2D1RA 2MSEB 2VRWA 2WJAA 4HDAA 1O6GA 1L4KA 1LKZA 4TMZA 4LTDA 3TDNA 1Z38A 1UBGA 4UCQA 5AW8A 1JDJA 4DCOA 5JLAA 2PXCA 4D1YA 1SBCA 3VNQA 1GUAA 1MRSA 3VDRA 2AE1A 2WIJA 3DJYA 5IARA 3AF6A 4Z3DA 5DM1A 2Z09A 3FJ1A 1U99A 1LWOA 1E1QA 3AHJA 4ZN6A 1LTQA 4X00A 4RE5A 1DJLA 1QG6A 1Y5RA 4ESOA 2D1FA