5CM8B

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
169
Chain Sequence
GPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
total genus 35
structure length 169
sequence length 172
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm8B00
1KHTA 3DDCA 3WXMA 3AEZA 4YDHB 3OIUA 5F3WB 4LHZA 2JDIA 2F43A 4RCZA 1UBFA 1YR7A 3D7MA 3DMNA 4J0QA 4LX0A 1FW6A 1N6IA 2ZSDA 2BKUA 2MSEB 4PFSA 3RC8A 3DKVA 3W8NA 3A58B 1S2MA 2F1IA 4ZO4A 2D3WA 5FUVA 3RDPA 1KMHA 1ZD8A 2BMEA 3DKPA 3B9QA 3WP1B 3FYHA 1U0LA 1OXXK 4DEXA 1GM5A 3EC1A 1C1YA 2IUSA 2YVUA 4C0HA 3GLFB 5FBQB 1NVVQ 2NZ8A 3BE4A 1SULA 1G64A 2JLUA 3SOPA 1E2EA 3WYAA 2R9VA 2OCPA 2KE5A 2V8OA 3LW7A 3UANA 3U7EB 3QXXA 2W58A 1G5RA 3ZGXA 2ZVPX 1CJUC 3L0OA 4Q4JB 4DLTA 2WHXA 1GAJA 1BS1A 1FQKA 4Q1FA 3BB3A 3MCAA 2Q3MA 1W4CA 4AC9A 4XIGS 5G53C 3U6BA 4UXIA 5C46F 3T5DA 4DCNA 3GLHB 1XXHB 2BVNA 1OKKD 3RS4A 4ZIRB 1TUEA 3NEYA 2GA8A 2IYRA 1ZBDA 3MD0A 1VPLA 1KK1A 2A78A 3QBTA 3M4YA 1WBDA 4NCIA 1R8QA 3ZVLA 4YMTA 1Z0FA 4ZKEA 2CNWA 1AZSC 4QM7A 121PA 3BGWA 4HSEA 4QNRA 5JWRA 1MRNA 3MRSA 1TL7C 3CH5A 4XSGA 2EU8A 1T3HA 1ANKA 2KWIA 2PZGA 3O8DA 3VX3A 1G5TA 4KYUA 1OYYA 1DAEA 4F7WA 4KVGA 2CVFA 3QG1A 4JLBA 2QT0A 4F91B 4B3GA 3EWAA 3VTKA 2BOVA 5B58C 4TLAA 5BWMA 2XZLA 3IDQA 4BLSA 3VHLB 2F43B 4QHSA 2EFHB 2YWFA 2ZREA 3KJHA 2RGEA 3OEEA 5AUNB 1KO5A 2O8DB 4JBXA 2XNDD 3P26A 3ZZUA 4DDUA 4CW7A 6Q21A 5JJLA 3ONWA 3R7WA 3TSOA 1KK2A 2EWVA 1ZRHA 1SKQA 3FOZA 1YJ5A 2ZI7A 1OJLA 3UXMA 1FTNA 1U0HC 4NYIR 2SHKA 3QQ5A 2F1HA 2UKDA 3B1VA 1CBUA 1L4UA 1UPTA 2ZETA 3MLEA 2V1XA 4DEYA 4XVQA 1JB1A 3K8YA 1R6BX 2RGNC 3ASZA 2PEZA 1BMFD 3GFTA 5BN3A 1ZU5A 4R2HA 2FGKA 1XPOA 4C2UA 1XTQA 3OIVA 3TUJC 1ZP6A 3K53A 2CJWA 3QNUA 4IXMA 2B8WA 1G8YA 1OFIA 4A36A 4C7OB 3OFND 4AKGA 4HLQB 1NIJA 3FFBA 1SKYE 3MWJA 1Z8FA 2JLQA 2ZSFA 5CLLA 3ZS9A 5JHGB 4IOJA 3EZ7A 4C0BA 3BORA 4YXWD 3I72A 4DCUA 2NMVA 2H18A 4FMDB 1AQUA 2FZ4A 2NO9A 4QNMA 2X2FA 4OHVA 1KY2A 1ZNZA 2ZRNA 3EA5A 3CX7A 3TKLA 1OXTA 3KX2A 4FN5A 4BPBA 4A0GA 2QSZA 2WIBA 2AK3A 5H8WA 4QOSA 1KSGA 1Z07A 1AKEA 1RPZA 1E2IA 3TR0A 3VR6A 3CRMA 5CM8B 3T06B 5FUYA 4ZPXA 3ND8A 2V6JA 2HT6A 1TMKA 4TLDA 2ECKA 3VKGA 2IXEA 2ZPTX 2E9SA 2OFWA 4D80A 2FSIA 1MH1A 4RZ3A 3A4LA 1SHZA 3QPUA 3TRFA 1EFHA 2G0TA 4Z1MA 4BFUA 3CZPA 4I4LA 1VCIA 721PA 3VR5A 3LLUA 1E2NA 1JEDA 5JS7A 2O8CA 1T5IA 2EWWA 1OV4A 1NNEA 3KL4A 4A1FA 3L8YA 3IILA 4MITA 2BBTA 5KTYA 4A0HA 2O0HA 4BRUA 5DIFA 3GFOA 2O52A 1IY2A 1E32A 5CIQA 2PMKA 4CEJA 2GHIA 1U8ZA 2QGNA 1K5DA 1OFUX 2IK8A 4ZDJA 1JR3E 4GNKA 1WA5A 2P67A 2KSQA 2DFLA 2H57A 3QF7A 2NG1A 4E09A 2IEYA 2FJUA 1I4LD 4PPQA 1T8UA 1BH2A 1W4RA 3FDIA 4NL4H 4M9QA 1KI6A 3BFVA 3FMPB 4EPXA 3AVWA 2DB3A 1LF0A 3M0EA 4IHQA 5FOSA 4DLZA 3H1TA 2GDJA 5CYPA 1Q3TA 1FNMA 4D82A 3QBVA 1R0XA 4X8HA 1NSFA 1G291 1II8B 1HT2E 1OHHD 2ZI9A 2FH5B 3EA0A 1QDEA 2O8EB 2JCSA 2R44A 1E2GA 4MRRA 4DT1A 3SEAA 3FE2A 3GJ4A 2BMDA 2PLRA 2ZE6A 1NJFA 5KO2A 2ONJA 1XNJA 4TSFA 2NO1A 4X8MA 4Q4AA 4BZQA 5SZJA 1NLFA 2DWQA 5A0FA 1U99A 3BAFA 4TL8A 4G3XA 3UG6A 3CIOA 2XZOA 3U7FB 2W6JA 4US1R 2O8FA 1XMSA 3V4RA 2QAGA 3T5GA 2IS2A 3NBYC 2GJSA 4EJSA 5CB6A 3DOFA 1XF9A 3RWMB 3PV0A 2HCJB 3P4XA 4JLAA 5DH9A 4Z1MD 4IKEA 3W8RA 4B47A 2GK7A 4NYIQ 4RY2A 5GJBA 2GXAA 3RRZA 1XEWY 1XD9A 2GTPA 5JWHA 3U3RA 2GETA 2JIZD 3FHCB 1PVOA 3GEIA 1T0JB 1FFHA 3TVTA 3NC1C 4G5QA 1II0A 4O2LA 1KMHB 4M9XA 4WIAA 1W44A 2AXPA 3WNCA 5IK2D 3SQXA 2BKEA 1RZ3A 3IQXA 1DOAA 2P2LA 4JYCA 1QHSA 2FWRA 2BM0A 2GJ9A 4NKRA 2C03A 5AJZA 1DAKA 4KODA 4N0DA 4GDFA 1OFHA 1YZGA 2OXCA 4II7A 3EASA 4JYBA 4PX9A 1VCMA 2CK3D 4PAOA 2ZRMA 2QNRA 1SHKA 2MSDB 5KDDA 5B2ZA 2GXQA 1P4SA 1HURA 4HDQB 1P5ZB 1NN3A 3I5YA 3TAHA 1U98A 3U3JA 2H17A 5HCNA 3C5CA 1OE0A 4DUGD 1FTSA 1QHHB 1W0JD 1WF3A 1ZNXA 2CLCX 2ERYA 3K0FA 3AF1A 2VIIA 4JLOA 2ZU6A 4XD7D 3U3MA 5HZHA 1E2MA 1ZNYA 1VKJA 3IIMA 2G1JA 1SVMA 5EZ6B 4TYYA 1OHHA 1QRAA 2HCBA 1E2FA 1E2HA 1W48A 2AL7A 2D06A 2I1VB 2ODBA 5EE9A 3KQLA 4AY2A 2YWGA 1ZM9A 2B21A 4CT4B 3G0HA 4DSUA 1G20E 1BO6A 1SKYB 1TNDA 2WWFA 3LA6A 3BFXA 2P6NA 2OILA 1XEWX 2PX3A 4FXPA 3AP2A 4NHOA 1GP2A 2BMJA 2CLSA 4M9SA 5FL7D 3B1YA 3SYLA 4TTPA 1MO5A 2B7CA 3H84A 1VG9B 2QENA 3C7KA 4PXAA 2J3EA 5EXPA 3ZVMA 4YMVA 4NCHA 2ZRCA 2X77A 2OBNA 5FTJA 3QE0A 4Q4LA 4OJKA 2YWEA 4QGAA 3MMPA 1XPRA 2AD5A 2GCNA 4HAXA 2H7VA 4PAQA 3R7WB 5FPYA 2RH5A 3GMTA 1KI8A 4CRWB 4RD6A 1EFTA 2LWIA 2WBLC 4HB3A 1Q20A 1KDOA 4I1SA 4IVRA 3S1AA 3UMRA 2G83A 3UPUA 3B8HA 1X8JA 1US8B 4IFBA 4V0NA 4AIIA 2GEUA 5CB8A 4EPVA 3VKHA 1R7RA 4G5OA 2QM7A 4B43A 5KPDA 2G3YA 3A1VA 3HU2A 2PL3A 4JJZA 4TT3A 3A1WA 4YMWA 4KITB 2XOKA 2K5UA 3CNNA 2Z5FA 1II8A 5E7JA 2ZJOA 1ZAKA 5HCIA 1H65A 1TQ4A 4Y0AA 2RHMA 1E1QA 3OF5A 4LCBA 2F9MA 1VHTA 3QF4A 1UEJA 1E9BA 1N6PA 1G8PA 2D2EA 3CPEA 1PUIA 3B1XA 3SHWA 1XJQA 3TSWA 4KAXA 3HU1A 4JKIA 3FPAA 2R8RA 3REGA 4ZCLA 1LTQA 1X6VA 1M74A 3GJ5A 1G1MA 4FW9A 2BBSA 4AKIA 4D0NA 3K0EA 1ESNA 2HDNB 1PUJA 1CRPA 2KBEA 4LBVA 1D8TA 4DJTA 4B3CA 3EPJA 3MWKA 2H16A 2EFGA 2J0UA 4LGMA 3HPQA 3ZD7A 2WJIA 1LF5A 1XX6A 2ZI5A 2BBOA 4C30A 3PEYA 2ODEA 4QRHA 1AGPA 1DPFA 4XH9B 5GVSA 4KBGA 2DFKB 2OCAA 4CIDA 1BMFA 2WM9B 3PG5A 3CX6A 2VEDA 1DG3A 3OIYA 4I1UA 4YMSA 1E9RA 2IUTA 1RRPA 4KI0A 1G3IA 3AV0B 5DN6A 1EWRA 3K9NA 4I1VA 5EUMA 2QUZA 2KB0A 2REXB 5JCPA 3B1ZA 2QAGC 1OH7A 5JSZB 2ORIA 3M1IA 4WBSA 4UNRA 3B9PA 3U44B 1FX0B 4TZ6A 4IDQA 2FSHA 1N6NA 2IX3A 3X1WA 5JBQA 3KKPA 4C0SA 5JJIA 2EFDB 1MT0A 1KOFA 4OJQA 1AJEA 1IN7A 1EX7A 2VHUA 1ZUIA 3WHLA 1NL3A 2CHQA 4X8LA 3SYNA 3AF4A 1ZIPA 5GADl 4M1SA 3HYRA 4ZCMA 1XCPA 1SVKA 4EUNA 3LXRA 4JL6A 1E79D 1NVWQ 1J99A 5F9FA 1TQ6A 3RSLA 2ORVA 1QVRA 1H8HA 2J87A 2ZE8A 3RS0A 1XTJA 5HKKA 1G17A 3KB2A 2ZTSA 4WVFA 5F98A 4E07A 1HQCA 1WB9A 2QG6A 3U7HB 2QORA 4JLPA 2WV9A 5EP3A 1NLZA 3UWKA 3CF2A 5TMPA 2QA5A 2AWNA 2G6BA 2AK2A 4HEJA 1IXRC 2WSMA 1GWNA 2C99A 3SJAA 2WMOB 1KDRA 2GWHA 4S2EA 2GXUA 3SR0A 5KSOA 2OLJA 1AQYA 4BLRA 4BEJA 5J47A 2VHTA 3VX4A 1WXQA 3WP0A 2Z4RA 4M1MA 4M0LA 3GJ6A 4IFEA 4HLCA 2LKDA 1W47A 1BKDR 3VNVA 5AWFC 1G4AE 1S1CA 4JLDA 3U5ZB 1JEEA 2IYLD 2CHGA 5TVKA 1XB2A 2YYZA 2IF0A 3ZZTA 2RAPA 2GBLA 3IGFA 4GI7A 3QG5A 1U8AA 3VR2A 2GVDC 2V9PA 5KSYA 3BJIC 3CW2A 4GMXA 5CM9C 1E69A 3GLGB 3CPHA 4LV6A 4IOMA 1J8MF 2OUKA 2V54A 4DC9A 3VQTA 4PSKA 1E2JA 1XEFA 4N1AA 4EQ6B 3I1FA 2ZRGA 4IEIA 3ECCA 1VYUA 4HATA 1RE0A 3W6OA 2VP0A 1P9NA 3I62A 3A8TA 4BFXA 4YXWA 4RFVA 1G8FA 4WZBE 2ZAMA 3CNOA 3QENA 5JI2E 5JWOA 3LW8A 1XXHA 2ZUBA 2Z83A 4PO8A 3AM1A 4JLMA 1N0WA 221PA 1P72A 4G5RA 3ADKA 2IYWA 1CR0A 1ELOA 3F8TA 3R20A 4HB4A 1T5LA 3NXSA 3QUSA 3ZD6A 4HLUA 4RKEA 1Z0JA 3RABA 1H8ED 1NIPA 4GRAA 1G8HA 1CKEA 1HT1E 1XMVA 3SZRA 1QG2A 3RRNA 3GJXC 3TUIC 2J46A 4BASA 1E99A 4G5SA 4P0TA 1KI7A 4LSGA 1A1VA 2HT1A 3OZXA 621PA 4BFVA 3X2SA 2WIAA 3QPWA 1YVDA 3X1ZA 2KI5A 3J81k 421PA 1R0YA 2KJQA 4OBEA 3T1VA 1KSFX 3Q85A 3WYGA 3UWOA 1T91A 3DM9B 2ODNA 3UMFA 1KAGA 3P1JA 5B57C 4Q47A 1SXJC 1HH4A 1Z63A 1N0VC 2BHRA 2V7QA 2BDTA 1E0AA 2X8AA 2IWHA 4JL5A 3OE7D 5G3ZA 1U81A 1KSHA 2B6HA 1W0KA 1U2RA 5M04A 5DISB 1DG1G 2WICA 2ZI4A 3P20A 3SBEA 3BS4A 3L2OB 3BK7A 2ZRKA 4KYIB 2JDID 2FA9A 3FVQA 4DLSA 5SZHB 1CLUA 1F2UA 3N70A 4KBFA 4D81A 4ZDIA 5TXGA 4DIDA 3VR3A 1Y3AA 2JJ1D 2C98A 3A6PC 2O8BB 3IBGA 2ZE5A 1EFUA 1CF4A 4DIEA 1JQLB 1IN5A 1K6MA 3AGQA 4LV5B 2G0NA 1AKYA 1E2DA 1Z47A 3LQRA 3T1OA 2AKAB 4Q66C 5JMTA 4JKYA 4PPGA 4Q1AA 2RGBA 5HE8A 3WMEA 2QU8A 5C4GB 1G3RA 1V5WA 2FFQA 4XWAA 2IL1A 3DVLA 3NBXX 1LW7A 1AZTA 3WHKA 2LCFA 4KFUA 3Q7PA 5EE5B 3KFXA 2PZFA 1RJ9B 2VPPA 3U7GA 2I3BA 1Z6TA 4NYJR 1RYHA 4HAWA 1KI2A 5K8LA 1KNQA 2C04A 3CX8A 3RYTC 5J4VA 1R0ZA 3IKJA 5FPSA 3LD9A 5FBWB 3BH6A 4US2R 3FWYA 1PJRA 2CDNA 2G88A 4A15A 4YC7A 4B34A 1GNRA 4Z8XA 3RAPR 2DFTA 2LKCA 1UDXA 5F9HA 2REOA 3GEHA 3T15A 1XFAA 2GVZC 3DPUA 2NO6A 1MV5A 1VCNA 5KHOC 1G3QA 2Q9AA 3CRQA 5G40A 5G41A 5J4KA 4V0OA 5FUXA 4Q19A 3KQHA 4LRWA 1CJKC 4UXHA 4F92B 1NG1A 2F1JA 1NVUQ 4HAUA 1PV4A 4US0R 3OE7A 1EWQA 4PHGA 4V03A 3IHWA 5FOUA 4U7DA 2QBYA 3MAAC 3MUFA 4A6PA 1SXJA 3AQ4A 1BOFA 3LY5A 2Q9CA 2JA1A 3QVUA 4LJ9A 3QVVA 1SVIA 2NGRA 4ZKDA 2DWOA 3PEVA 4K81B 3T35A 2V6IA 1KNXA 1L2TA 5AJVB 3TW8B 1S8FA 3OIWA 1PLKA 4LYFA 3FB4A 5CJ2A 5KNBA 521PA 4R98A 2P5TB 1G18A 5LD2C 3QKRB 4TMKA 1OH6A 4DLWA 4MDEA 1P2VA 4CT5A 4KLNA 3ZYCA 3OEED 4HAYA 4WW0A 3WRXC 4EPWA 1Q21A 1Z6XA 4Q21A 4RD0A 5K8IA 2CL6X 1JECA 3G5UA 3BB1A 3JVVA 4PO9A 1AS2A 2IYSA 2CCJA 4JSYA 5FL3A 4BGDA 5L3QA 3R8FA 1ZUNB 1M6NA 4LBYA 4NPHA 2ZAOA 1X1SA 4Q9HA 1D9XA 1J7KA 4G5GA 3SC3A 3PUXA 2XNSA 1NVXQ 2GAOA 3OEHA 1JAHA 1NBMA 4B35A 4WZAE 2VHJA 3P27A 2IBMA 4DLVA 4V0KA 2CL0X 2FG5A 4R71A 3L0IB 3BWDD 4QXAA 1G7TA 3FTQA 4D4JA 4QGHA 5CIWA 2VP9A 3KUDA 4LHYA 3QXJA 4W5JA 5EZ5A 2FSFA 3SJCA 4URXR 4M22A 4OKSA 2MMCA 4D0GA 2BJVA 2R62A 3AKYA 4M1TA 4ZDKA 1AM4D 3DM5A 3K70D 1XP8A 3RNLA 4QGFA 5FR2A 2HLDD 2I1QA 3A1UA 1NMYA 3CR7A 4OK3A 1COWA 2XZPA 2GBLC 1XD8A 3OAAA 5AJXA 5FH9A 2YINC 4C0LA 2IT1A 3VFDA 4MGKR 1FX0A 3CNLA 1YQTA 3CM0A 2C96A 1OT3A 4G01B 5FPHA 3ZQ6A 2C5LA 2CLDX 4Z54A 4WZ6A 2WTUA 1RIFA 3KXIA 4AWXA 2HUPA 1SQ5A 1UAAA 4QBFA 2ANBA 1ZJ6A 2VHCA 3EPHA 1KK0A 1Z6YA 3A4NA 3R9XA 1ZIOA 1P62B 4OI2A 3EX7C 1A5TA 1E2PA 1EFRA 1VG0B 4YLGA 2QE7D 4KSCA 3ZDQA 1G41A 4MRNA 4DB2A 1ESMA 2FN4A 2VO1A 4OI4A 4LJ6A 1HY3A 4LHXA 4M4SA 2W6IA 5DI9A 3IIKA 4GOJA 5J4HA 2F6RA 3RHFA 4B6EA 4MYCA 5JSZA 5KUTA 1ZD9A 4Q1DA 1XEXB 3KQKA 4TYNA 1TADA 3LH5A 3SQWA 1E0KA 3FFAA 1WQ1R 5AUPB 2ZUCA 4IOKA 3KQUA 3K70C 4ZV4A 2IYTA 5SZIA 4B3XA 4BECA 3P4YA 4AKEA 2Z4SA 1O3YA 1VYVA 2ZANA 3Q9LA 1WE2A 3TW4A 3K0SA 2IEZA 2Q0HA 1AA9A 4CDGA 4B3BA 3U3KA 3CRRA 3LQQA 3QXHA 3TJZA 1HV8A 2FGJA 4DRZA 1IJFA 2OG2A 1Q1BA 4GZLA 4NYMQ 5KOYA 3CUEF 5JECA 1T9HA 1GFIA 1XRJA 3SE0A 2NTYC 2XEXA 2J7KA 4IVPA 2GF0A 1GDDA 3K0AA 3WNDA 4DLRA 3AVOA 1WDTA 8OHMA 3B85A 3EW9A 3RRYA 2VLIA 1XTSA 2B7BA 1E9DA 2FFAA 2MMGA 4JIMA 1VHLA 4QHTA 1CR4A 2ZSEA 5C18A 4OQFA 2Q21A 4HLUC 1BYIA 4MQBA 1UDWA 3DO6A 4TQ9A 1DAGA 4GFDA 2IYUA 3VHXA 4XVUA 1G7SA 1HUQA 2ATXA 3KUCA 4ITRC 5FOXA 5FOVA 2PT5A 2HLDA 2RGDA 4XTRA 3AVYA 1DELA 2JIZA 1EFCA 1EK0A 2DPXA 4GL2A 3W9YA 2QTVB 3U44A 4EQ6A 4HUQA 2QTHA 1Q12A 1QF9A 1Z06A 1R5NA 2BWJA 1ZU4A 4O0MA 4M53A 4WXRA 4YQFA 2JLWA 2IWRA 4B2IA 4JZKA 4PQRA 3X1DA 4M1KA 2RGGA 4JLNA 5FBRB 1DADA 1U94A 4WA7A 5CK4A 2WVJA 3QY0A 3IUYA 2VP6A 2VYFA 1VYTA 3DL0A 3DZ8A 2D2FA 4KV9A 3IEUA 2HV8A 3LVRE 3ZVNA 1TTTA 2OBMA 4CEHA 1M2OB 2W2VA 3D6TB 3LFUA 4NTZA 3UATA 3FHTA 2NPIA 5CLQA 4BFWA 2RCNA 3SFZA 2GAAA 1SVOA 2IA5A 4JVLA 2Z0MA 3DZDA 1P7CA 2XJ4A 4Q03A 4OHZA 3PXGA 2WJJA 3LO5A 4XJXA 3BERA 2CE7A 2WKPA 5TY0A 3Q5EA 4ZI3A 1XJ0A 5HE9A 1FP7A 4K8OA 4F93B 4XD7A 2C9CA 2CK3A 4AG5A 4A4DA 4DSOA 5IHPA 3L0SA 5KSPA 1WCV1 3B60A 3CF0A 3K9GA 2GKSA 4P4SB 4MRVA 2ORWA 1N25A 1JAIA 2J0UB 3OESA 2NIPA 4XOIA 4LPSA 1JPNA 5CDFA 1M7HA 2ZRHA 4E22A 4LI0A 4LPKA 2YC2C 2J1LA 5K8TA 2I4IA 1NBMD 3JZMA 3R9WA 1ODFA 4PO1A 2JAQA 4TQAA 1TUIA 4NP6A 2FZLA 2VF7A 4V0MA 4M8NE 4OI1A 4DDVA 2ZYVX 2OXRA 1QVAA 4TMXA 3KTAB 2P65A 1E2KA 2D74A 3NH6A 2IHYA 1NKSA 4HZUB 4IEEA 2OCBA 3CR8A 4HAZA 1UKVY 2IUUA 1F2TB 1N5KA 4ILEA 1GL9B 3PJRA 4ON9A 5EXXA 2W6JD 5DN6D 5J5CA 3OAAD 2WWIA 3A1TA 1X8KA 4BEBA 4GOXA 4Q00A 4BQSA 4C2TA 1Z29A 2OBLA 2QI9C 1EESA 1GITA 1DAIA 1L8QA 1RW4A 4XTCS 2JLYA 4WXPA 1LVGA 5B30A 1OYWA 1XZPA 1ZM3A 5EJEA 2AFHE 4DKXA 1D6JA 2J0VA 4JLKA 3V00A 1DTSA 1E0SA 2DR3A 1HQYE 4PC7A 1E6CA 5D3MA 4NE2A 5LDDC 4KO8A 4UQOA 4LJ5A 1AN0A 3IO3A 1E3MA 1E2LA 1W5TA 1KYIA 2RHDA 2RGXA 1QHGA 3AUYA 4DLUA 4JT4A 4QJ4A 1SVWA 2XOKD 1N3BA 2BEKA 3A1SA 3CONA 2ZJZA 3C8UA 5D3QA 2ZRPA 2YHSA 1RFLA 1XXHE 3B1WA 4Q9IA 2FEOA 3B5JA 5DHFA 1Q1QA 2A5YB 4C0KA 4LYHA 2CL7X 1P73A 2L0XA 2N1BA 1FP6A 2ZRFA 2O8DA 3FMFA 2DY1A 2WOJA 4O25A 1KI4A 2IYXA 2BJWA 3LRPA 3L82B 3WMFA 4QGGA 2GXSA 1TU3A 3HP1A 1BIFA 3KB1A 3QEJA 1NBME 1I2MA 3QPVA 3VU9A 1CEEA 4FMDF 2XNDA 1XTRA 3AP3A 1TQDA 3VMFA 1RRFA 1CJTC 1GRNA 5E7IA 1Z08A 1JJVA 1FPMA 4PC1A 5AUOB 3C4JA 5E95A 4BFZA 2ZS9A 2YJTD 1J70A 2PMDA 3K1JA 4HB0A 4HB2A 4HDOB 1OFTA 3AKDA 3OFNA 4KVAA 5L3QB 2H5EA 3AKCA 3K09A 1P75A 2B92A 2Q6TA 1Z6AA 2RMKA 5DI3B 2AWOA 1YE8A 3HYTA 4ESVA 1XZQA 2OSBA 4FIDA 1KZ7B 4L15A 2E87A 5TB5A 1DBSA 1O87A 1IHUA 3PENA 3NBFA 1TX4B 3GEEA 5FUWA 1NSTA 1JNYA 1MR3F 1OW3B 4DCSA 4Z51A 5BN5A 1G7RA 4D4MA 2DCUA 2XXAB 3TUZC 1IONA 1N6HA 4QKQA 2ZE7A 3T1QA 4DLXA 1KKLA 4TL7A 1V43A 2GEVA 4LHVA 1IN4A 2TMKA 3MG9A 1SZPA 1N5IA 3I61A 5LB4A 1N6OA 2Q3FA 3QF4B 2OEPA 5H1YA 3I5XA 2J9RA 5CJPA 4BUJA 3A4MA 4Q7KA 3THYA 3K0CA 5FBVB 5E4FA 3SI7A 1P9WA 1CXZA 1T6NA 1UBEA 5CITA 3CLVA 4DZZA 3MJRA 4ARZA 2QAJA 3NDPA 2Z6VA 3TMKA 5FI0B 4NZYA 2XITA 1GVNB 3I3SR 2DYKA 1QHNA 1DVRA 4MUAA 1E98A 2GZDA 3TLXA 1SGWA 3R9IA 1OH5A 4UNNA 4A8JC 2QP9X 2JJ1A 4HYYA 1KGDA 1GG2A 4R2IA 4RZXA 3RSOA 5LPNA 1F6BA 4FMCF 1J90A 4C7OA 2RKOA 1UKYA 4PC6A 4BLQA 5EQTA 3REFA 3ICQB 4JLVA 4CGZA 3BC1A 1G3MA 1Z22A 1LFDB 2BMFA 4PHHA 4Q1BA 2G1KA 2D4HA 1HEIA 1CRQA 1CR1A 2QPAA 3AKEA 2PT7A 2CMKA 1U8YA 1UADA 2N46A 3I32A 4JBWA 1B0UA 1JPJA 4MKHA 3W3ZB 4B2LA 2ZYUX 2ZR7A 4OQLA 2IS6A 4OYHA 2ZR0A 3I4LA 1QHXA 2JLSA 2XB2A 1D2MA 1EXMA 1T3SA 3TK1A 4EFMA 2QMOA 1UF9A 5EUQB 2HEIA 5JZVA 2J7PD 4IDPA 4EJSC 1D9ZA 4RD4A 2BCJQ 1ZINA 3CWZA 4JT2A 4PHTA 3K0AB 3CWQA 2VP4A 2O8EA 3GLGE 2ZI3A 5BYJA 4OHYA 4UNQA 1S4QA 2AX4A 1KO7A 3EXAA 4C9BA 4LY6A 4JJKA 2AFIE 1ZCBA 2UVQA 3GLIB 1CP2A 2AD1A 2WWHA 1T0HB 3GP8A 1L7VC 1T4GA 2A7QA 3KKMA 2O5VA 5BW8A 4TWZA 1OIVA 3GPLA 3TBKA 4F4CA 1MO3A 1RRCA 4TMZA 4LJ8A 2F9LA 3K9HA 1OSNA 4A0RA 1Z0IA 2IC5A 1D2NA 1Z28A 3AB3A 1VIAA 4RD3A 4POAA 4LUCA 1KZGB 3T34A 2WJVA 3HU3A 4B33A 1GILA 5EXSA 1FQJA 3NBZC 5DO9A 3C16C 2FPMA 1U9IC 1IAQA 3C14C 1UM8A 2FX3A 5L8VA 1WRBA 1FUUA 3LBIA 1M7GA 1X8LA 2AKYA 3BOSA 2FEMA 3UK6A 5H68A 2VP5A 1KJZA 3RS3A 2FFBA 4L5BA 2R65A 1NN0A 1P2UA 2BV3A 3ETLA 4FCTA 5SZKB 3U2QA 4DHEA 1K5GA 1W0KD 5J4LA 5DYIA 3ADDA 1W2GA 2J41A 4PQYA 4TMVA 4D26A 1W5SA 3BH0A 1F60A 4A0FA 4MDFA 2XSZA 4W5WA 2P5SA 5G3YA 4RD1A 4MKFA 4A9AA 2O8CB 3VKWA 3KKNA 3LNCA 4AI6A 4DDWA 3AVVA 1YR8A 2EFCB 4AURA 4A8JA 5C2JB 3C15C 3VNUA 2CE2X 2DBYA 1RKBA 4PSVA 1RYFA 2F1RA 2H92A 1NRJB 4V0ME 5FOWA 1DAHA 1P60A 3QKRA 3V9PA 2OHFA 3N5CA 1IY0A 4KHZA 4TMWA 3C5HA 4EPTA 4QL3A 2EYQA 3UMSA 4P4UA 3SFVA 2BC9A 1A82A 4AKHA 3PUWA 5CDFE 2KBFA 2GZHA 5HPYB 1DS6A 1W36D 4KFTA 3KKOA 1S1MA 5EE1A 3EIEA 4QBHA 4Q1CA 2VQSA 3EG5A 4F4IA 1E4VA 2YOHA 3DMDA 4D4LA 4TSFD 3ZJYA 1DO0A 1LS1A 4GZMA 1Z2CA 3LAWA 3QI2A 3W5IA 1LY1A 2V3CC 2A3RA 3K70B 3TNFA 4M2LA 1K8RA 1N5JA 3TAUA 2R6CA 2PBRA 3NKVA 3NWJA 2X1VA 2PLFA 4LWZA 2JEOA 4LBZA 3AUXA 3TR5A 1Q57A 4PAMA 5FL7A 2F3TA 1HTWA 1XTKA 2VA8A 2AR7A 4HAVA 4TL6A 1NJGA 821PA 1Q1ZA 4NONA 3TGPA 5DNYB 1OIXA 3FMIA 3LBHA 1GL7A 2OM2A 4N0EA 5IK2A 4YMUA 2CEAA 1II9A 2HYIC 4BLOA 1F5NA 2GILA 1E9AA 2P6UA 2QTFA 1SVSA 3E1SA 3EARA 3EIQA 3LV8A 3PEWA 2A9KA 2P3SA 2ZJ2A 5K8UA 3VU9B 2IYYA 1ZMXA 3I8XA 1AS3A 5EP2A 1NG9A 3NH9A 1EFRD 2C78A 1QHHA 2YOGA 3HWSA 2CJWB 1RRGA 2Q3HA 2JJ2A 2WSSA 4OL0A 2WKRA 4CVNA 3NC0C 2DFNA 1Z0DA 1GNPA 4D4KA 5L3VA 1CU1A 4KLZA 4RFSA 2OAP1 4TMTA 1NMXA 4M1WA 2QMUA 4PC2A 4FCVA 2FFHA 1P3JA 3THWA 4QHYA 2JASA 4A6XA 4B3FX 2GCOA 2NZJA 3Q7QA 2OE2A 2YV5A 1E0JA 3GCGA 4IDOA 2OFXA 2VBCA 2ZEJA 4TLCA 3ZIAA 2XTMA 1ZCAA 2ZSAA 4A2PA 5CYOA 3UKDA 1F3OA 2IXGA 4JL8A 2P6RA 3O8BA 3OEHD 1FMLA 4MYTA 5ELXA 5D3MB 4Q02A 2P0EA 3O47A 4QBIA 1Q3HA 4EDHA 2R2AA 3NHAA 5KPJA 4P31A 1ZYUA 4W9MC 1E9EA 2XGJA 1NY6A 3SJBA 5LB2A 3VR4A 1CULC 3GLFA 2OZEA 4TYQA 3CKLA 4U00A 4A82A 4C0JA 3EPLA 1OXUA 4ARZB 2QEQA 4E5UA 2QQEA 2CVHA 2QPTA 2YKGA 1YZTA 1PLJA 2ZQ5A 3H86A 2CBZA 3BD9A 4Q7LA 5BQ5A 4Y0VA 2O8BA 3I92A 2R6AA 4HLDA 1F2TA 4QBGB 3W6PA 3SJZA 2QGZA 4L9SA 4V02A 2BIFA 2WZQA 4BFTA 1OB5A 3Q72A 2CXXA 4A2QA 4XWKA 1UKEA 5E3HA 2YZ2A 1IN8A 3AH8A 3T61A 3Q8XB 5ANRB 1NN5A 4N3NA 5KDLA 5B64A 2QMEA 4OQXA 2VSOA 4OI0A 1E9CA 1GKIA 2O0KA 5JJKA 2FE4A 2X2EA 4U02A 1RJ9A 3KZ1E 1KDPA 4FI3C 1R8SA 1T8TA 1YRBA 2VL7A 1N2CE 3ASYA 4GT1A 4HDCA 3SHFA 1W4AA 4EPYA 2QBYB 1R2QA 4FWIB 2ZIAA 4LK2A 5JLJA 1J8YF 1KI9A 4PANA 3WRYC 4JVNA 1ZW6A 4TT3D 4GP7A 2W6ID 4HI0E 3GQBA 1SXJE 4GOKA 3LXXA 2GK6A 5HTKA 4NMMA 2WMNB 1RC8A 4IVQA 2QP4A 5KNDA 4MH0R 4TLEA 1F48A 3RVBA 1HE8B 2ZUDA 2F55A 4C3ZA 5IDVA 4MKGA 4BZXA 5FPKA 2O0JA 3GLHE 2AN9A 3SDZA 2XXAA 2QROA 1MABB 1WMSA 2VRWA 2A5DA 2C9OA 2FU5C 3AVQA 3DEFA 3AP1A 4NCJA 5BN4A 2NOAA 3NIBA 3PUVA 4EAQA 1NMZA 1XDBA 4GBMA 1IJEA 1ZM2A 5AK0A 3QKUA 1YZLA 3U4QB 4IOLA 4Q01A 1CIPA 1QBKC 1ZVQA 4OHXA 2XTNA 4TTRA 3EPKA 3X1XA 4RFSB 1DEKA 1XMJA 2FDCA 3GJ3A 3IHLA 3S1AB 2QRZA 1ZC4A 1TF2A 2JLVA 2W0MA 1XBTA 1M34E 4XVRA 2GCOB 2NQ2C 5C4MA 3D31A 2ERXA 4NDZA 4IDHA 3GLGA 4JVSB 4EFNA 4ZCIA 2PJRA 4OHWA 1D5CA 1KJWA 1L4YA 1LB1B 1TU4A 4PZYA 4RSGA 2RGCA 5IT5A 1EG7A 3TVDA 4AG6A 1ETUA 5TDHA 1M1YE 1C9KA 3WBJA 4D0LB 3PEUA 4H1UA 4TL9A 3WYFA 2RB4A 4LC1A 2ZXUA 1IQPA 3BRWD 3PVSA 3KFVA 2QQ0A 1HE1C 2GRJA 2WPDA 4L4UA 2IYQA 3CZQA 3H0KA 3MFYA 4B6FA 3THWB 1W2HA 1YRAA 1N6RA 4L8GA 3L0PA 1S3SA 2Q9BA 4NYMR 3NEJA 1E1QD 1OXSC 2B8TA 4FMCB 1QG4A 3CRW1 1MABA 2GESA 1S9HA 1H8HD 3W34A 4RCYA 3HJNA 1DO2A 1JR3A 2V7QD 1GNQA 5EP4A 2BEJA 4FD2A 1SXJD 1UBCA 4NYJQ 4PZZA 2FF7A 3WY9A 1E4YA 2IYZA 2QY9A 4AD8A 1A2BA 4DCTA 1CS4C 5J4YA 1JALA 3DHWC 4M21A 4Q7JB 5A5GA 1YU9A 4Q4AB 3E5HA 4H1VA 4RKFA 1GL6A 1TPZA 4DVGA 3G82C 2GZAA 1TEVA 1PZNA 2W83A 3RS7A 1YZNA 3TQCA 3CO5A 4NU0A 3GD7A 3ZZ0A 1EGAA 4XSHA 4DBLC 1W36B 5JI3E 3ADCA 3FHOA 3PITA 4P32A 1XWIA 4IDNA 2ZM5A 3ZH9B 3HR8A 1RVDA 2Z43A 4G1UC 1MO4A 4Q48A 2GEDA 4A8JB 3U60B 2ANCA 1I4TD 5L3SA 1R4AA 2ZROA 3THXB 1Q22A 4BFYA 4X8OA 5AUQA 3QSYA 4ACBA 4WOPA 5JEEA 4V0LA 3LLMA 4M9ZA 1LS6A 3KXKA 4MYHA 1YR9A 4URUR 5DI3A 1WBBA 4URYR 1G21E 2GCPA 1OLOA 3N2EA 4KXFB 3SBDA 1YZQA 1B23P 2JLZA 3H2YA 2UZ3A 3QKSB 4URZR 2WJGA 1VDZA 3O8RA 2HF9A 3FGNA 3RLFA 2ZS7A 1OPXA 2MSCB 3F5FA 2HJGA 1G4UR 1KO4A 4PTLA 5KYKA 5FTNA 4ACAA 4B75A 1FZQA 1OKKA 2ONKA 5KNCA 1A4RA 1OH8A 1GUAA 1NY5A 1NKTA 2WPDD 1IN6A 1Q0UA 1AIPA 3SU8A 2YC4C 4LJAA 5UKDA 2CCKA 3NDBB 2J7PA 1XD2A 2QRNA 1NN1A 2JGNA 3KJIA 2FPKA 1SXJB 1BYUA 2HYDA 1CJVC 5JS8A 2WJHA 1OF1A 3TIFA 3W5JA 4MRSA 1E1RD 5GJVC 3SNHA 3HR7A 1JQJC 2C77A 4UNSA 5FTKA 5J40A 1X3SA 4LYAA 3W90A 3CPJB 3CF6R 3VAAA 1ZM7A 1E79A 2ZR9A 4YONB 2FPLA 3HPRA 5GJCA 4ZI2A 1YZKA 2EQBA 3JVUA 3TQFA 4LYJA 5HKKD 3MWYW 1X86B 4UXJA 5E7MA 5H70A 1G9XA 4GP6A 1JI0A 3PCRB 4IJMA 3EC2A 1G6HA 4R7ZA 4G0NA 1E9FA 1KO8A 4QJ5A 1KI3A 4FWTA 4MGYR 2IS4A 1JR3D 5EP1A 1UEIA 4TQUS 3TE6A 2CHVA 4I1OA 2WKQA 2ZJBA 3BBPA 4JMPA 1VECA 3RWOA 2ZS8A 2D7CA 2G9NA 3U61B 1LNZA 4NCNA 1ZD1A 3LDAA 2QP3A 3ZVRA 1P6XA 4Q4HA 5HZKA 1Y63A 4CEIB 2YWHA 1IY1A 1NP6A 4KFSA 1YZUA 3IO5A 5JCZA 4P4SA 1TQ2A 2PCLA 4H9GA 1AGRA 5GJWC 1TEXA 3V4FA 2NO7A 3GLIA 2QSYA 1GKYA 2WWXA 5AJWA 3LVQE 2VSXA 5FBLB 1XU4A 1Z5ZA 4JLJA 3ADBA 4D2IA 5L3RA 3KKQA 4B32A 2C2HA 2XX3A 4EIWA 4A92A 3DOEA 4LJ4A 1N0UA 4PSAA 5EXTA 1XMIA 4WAUA 3AF0A 2ZRJA 1KDTA 1ZC3A 3P32A 3CRVA 1N6LA 3TSZA 4QJ3A 5TARA 4C4PA 5KSZA 2PEYA 3KDSE 2AXNA 4R9UC 1Z0KA 1UBGA 3WBKA 5FFMA 4ZIRA 1Q1EA 4MRPA 3D8BA 1Z6GA 3AF3A 4QFMA 2FOLA 1S0UA 3A37A 4P3YA 2PZEA 4Q9JA 4EKDA 2RGNA 3HDTA 5FPTA 1VCOA 1S96A 1NLYA 2J5XA 2FMXA 4IW3B 2HF8A 5LD2B 4Z8YA 2EYUA 1WP9A 1Z3IX 3ND9A 2FSGA 5FI1B 4KU4A 3B13B 2BBWA 4LC0A 2PH1A 4S35A 1G5PA 5KU1A 2IS1A 1H8EA 4LHWA 4W5HA 1OB2A 4B71A 1G19A 1AS0A 2XAUA 1M8PA 4KSBA 5AJYA 2JLRA 1KK3A 1VG8A 3FMOB 3D3QA 4URWR 4IRUB 4PQFA 4AK9A 2IF2A 1W7AA 1U0JA 4DDTA 4YDSA 2JLXA 3THXA 3KJEA 3RC3A 4AYTA 1P2SA 4TZ0A 3AVUA 2ZI6A 4PZLA 4RZ2A 3PUZA 3SN6A 4UJ3A 2C8VA 3E70C 2WAYA 1VMAA 4AYWA 1G3UA 3MWLA 1Q44A 2GJ8A 2BM1A 3MGCA 2ZJAA 1MRSA 1QHYA 1VTKA 1KJYA 4DB4A 2V4ZA 3GJ0A 3JZAA 4Q9LA 1U9IA 3NTUA 3EZ2A 4LJYA 2JATA 3CB4A 4UKDA 2VHQA 3I73A 3GFPA 3UG7A 2QZ4A 1E2QA 4JBYA 2ODWA 4PPFA 1KIMA 1GTVA 1P61B 1NI3A 4NCKA 1ZM4A 2ZYWX 5IF9A 1HA3A 1QHIA 1E9SA 1HYQA 2A5JA 5CK5A 1XPUA 2ZRLA 2ZSBA 4TYWA 1MOZA 3MJHA 1N6KA 4JVMA 2AHOA 4KCGA 1W0JA 5DHAA 2J0QA 2QMHA 1F2UB 1ZUHA 3K9LA 3PQCA 3CBQA 2OAQ1 2GF9A 1NF3A 2QT1A 4CZ2A 2VTKA 4UNPA 4D25A 1TF5A 1OXVA 5FR1A 4L16A 3ICEA 4CEJB 3GLIE 4D6PA 4OK5A 4DLYA 4K46A 4RVCA 4URVR 2QL6A 1W49A 2WWWA 3OHMA 3RRMA 3QJYA 2EVWX 1A2KC 1P2TA 3MSXA 1DAFA 1KI6B 4P33A 4EJSB 4MA4A 3QOFA 4JSTA 3PUYA 4PHFA 2XJ9A 4EFLA 1W46A 1JBKA 1JJ7A 1ONBA 2QPOA 3F3YA 4Q4HB 5A4JA 3B7GA 2OO7A 4W7SA 3EIHA 4BE7B 2J59A 1G16A 3X1YA 1X1RA 1CJMA 1GRRA 2QE7A 5DLQC 1DARA 2CNWD 2GJKA 2OLKA 4FCWA 4B44A 2IXFA 3SS8A 2HXSA 3IPYA 1UFQA 4DCVA 5JFGA 1GKUB 2ZJYA 1KSJA 1TAGA 5DSZA 3T1TA 1YR6A 1XCGB 2YOFA 1R0WA 1C4OA 4MUBA 4GMDA 1MKYA 3C41J 3I8SA 1U90A 3B78A 4TYPA 3EZ6A 3NHBA 4RD2A 2YNMA 4F4JA 4FMBB 3QXCA 1N5LA 4HUQB 4TTQA 1DAMA 1W1WA 1EX6A 3AVXA 1MO6A 4Q7MB 1XTIA 3WNBA 4TN1A 4Q18A 5C1BA 3ZLJA 3QEOA 1CR2A 1E94E 1QZXA 2JJ2D 3PR1A 3QIAA 4LOAA 3WMGA 4BLPA 4MKIA 4O3MA 3ZIAD 2V1UA 3QXSA 2OFOA 1W4BA 3LX5A 4CYMA 2XSZD 3THOA 4IXNA 4PC3A 3K0CC 3NVAA 1VIYA 1GRQA 3GJ7A 4A2WA 2DHRA 4DSTA 2R6FA 1Z2AA 5FTLA 4PR0A 3U3OA 1UJ2A 2G77B 4DUGA 3B6EA 3B82A 2PJZA 5F2EA 1IBRA 4OQMA 2REBA 5AR1A 1KAOA 1KI1A 3A36A 3ZS8A 5EE3A 3BB4A 3TH5A 4ASUD 2C95A 3UIEA 1S3GA 3AVPA 2EFEB 4RJLA 3SYKA 4C0QC 4GSYA 1XCMA 2XTZA 4M1YA 4O2RA 3L43A 4LZZA 3KTAA 3FKSD 2H1LA 2ZITA 3B2EA 2E1RA 3KJGA 1E96A 1G7CA 5P21A 3LWNA 3T12A 4ABYA 2OESA 2A30A 2OV2A 4OQNA 1FMJA 4BFSA 5JHHB 2ZU0C 2ZRAA 5DE3A 3FKSA 4NH0A 4UJ5A 1FL9A 2WWGA 4QM6A 3F0TA 1A7JA 1XEXA 2VSFA 3QKSA 4DSNA 2NPFA 1P9RA 4GPTA 3K09C 4C0AC 3EWSA 4LJ7A 4HZUA 5DGXA 2GNOA 4Q9KA 1R5BA 4BLTA 2W2XA 3BH7A 3PIRA 2ZRBA 2PX0A 4ERNA 1PLLA 2VP2A 1DE0A 3BFKA 1IXSB 2EW1A 4M1OA 3M6AA 2J45A 4I99A 2OCYC 1US8A 3VR1A 4MGIR 5L3SB 1JXMA 1GSIA 1R10A 3CH4B 4NBSA 2D7DA 1SVLA 1UKZA 1CTQA 1XD2B 2N42A 3KQNA 4L9WA 1GIAA 4FINA 2C9YA 3RS5A 4XWOA 2OT3B 3KXLA 2FV8A 4BRWA 5KDOA 1KO1A 1I2DA 1YKSA 2F3RA 2IW3A 2W2TA 3NG1A 2CCGA 5FTMA 4ESHA 5JEDA 2NO0A 4LBWA 3O8CA 2WAXA 1M7BA 1R5OA 1KTVA 1Z83A 2J0SA 3ZQJA 4QG7A 2W00A 4RZUA 3N2IA 4PPNA 2WSSD 5EE0A 3GLFE 5GVRA 3GJ8A 1IOZA 2RGAA 1G6OA 3IIJA 3W3AA 4LDJA 3EAQA 2UZIR 4P4TA 5LBIA 5IRCD 4Q5IA 2A5FA 2JJ8A 2ZVQX 4JS0A 4E03A 2D62A 1AK2A 1S9DA 4MGZR 4OK6A 1G8GA 2PCJA 4F38A 5BXQC 2A5GA 3Q5DA 1LV7A 1Z0AA 2HXYA 3W6NA 3IBYA 3AF2A 2VF8A 3L8ZA 2V55B 2ASEA 1OIWA 3LBNA 4TLBA 4LV8B 4B76A 3IEVA 1IM2A 2Y8EA 2HJVA 2GJAA 1JXOA 1GZSA 3QKTA 1YHNA 1NVVR 1FNNA 4QC2A 4BZPA 4ASUA 2ATVA 4EPRA 1IXZA 5DYGA 1FOEB 5TV2A 2BCGY 2R6GA 3H4MA 4ZDWA 1JR6A 3U4QA 3BXZA 1COWD 3Q3JB 1T3LA 3E2IA 3AGPA 2O8FB 2FNAA 5FOTA 4AYXA 3EZFA 2WWYA 2VH5R 1W36C 4KFRA 3IPXA 2R6DA 4CEIA 4B73A 4KJZA 2IHBA 3K0FB 3RANA 2WOOA 1KKMA 4B2PA 4MYUA 1I4DD 4DWJA 3GLHA 2ZYTX 3IQWA 2IYVA 4HZIA 2WJYA 3R8CA 3RS2A 1GOTA 2XB4A 4DT1B 1D2EA 4B74A 3BIFA 5BYKA 5HR5A 4Q4JA 2ZJ5A 2ZRIA 3LX8A 1VG1A 4B48A 3U6KA 1E1RA 1KY3A 3EZ9A 1FUKA 2X19A 3THYB 4Q1EA 4DXAA 2H8KA 5JRJA 3AVTA 3PFIA 4HUTA 2ZJ8A 2F7SA 4BWYA 2W0SA 5JRZA 4U5XA 4CEHB 2DWPA 2QN6A 4CF7A 2QAGB 1KMQA 4B3DA 2A2ZA 1ZNWA 1XJCA 4I81A 1J2JA 1TF7A 3FKQA 2QM8A 2ZRDA
chains in the Genus database with same CATH superfamily
3DDCA 1TECE 2UVPA 1N2CB 1RQ7A 4KOAA 3OICA 3PCXA 4R3UC 5GQSA 4MIOA 3HBFA 5ALJA 3S2SA 4CKWA 2N0SA 5EL0A 2F43A 3RBVA 3UMYA 1HSOA 4INZA 3PNBA 2ZQYA 4GPZA 2BYTA 1UBSB 4FJ1A 1T5OA 3R0XA 4R1TA 1JFRA 3HUEA 3TOCA 3VZCA 5LMNB 2MSEB 3RC8A 3DS8A 3S2ZA 4UTVA 1AC5A 2PUDA 1CPYA 2G36A 2W2LA 2GPBA 2MTBA 1KU6A 2D3WA 3K20A 4P8RA 4XCVA 2AYZA 1ZD8A 2BMEA 2ZULA 3RDPA 3EVGA 3L02A 5AXBA 2WJAA 1U0LA 1Z4JA 5AMXA 3EC1A 1C1YA 2I8AA 1IM8A 1QQ6A 2YVUA 3UJ7A 3GLFB 1U9JA 3LFHA 4FJ0A 1DT3A 1CUHA 3SM3A 2CFIA 1F7UA 5C37A 1XDGA 3RAEC 4Y18A 3BGDA 4XR4A 2PQ6A 1PDOA 3HFGA 3KHUA 1OUMA 2XVXA 1PFGA 1CJUC 1TA0A 3O74A 4IIJB 4Q1FA 3CE6A 3OX2A 1W4CA 4XIGS 5KSZA 3K6SA 1JJIA 4JT8A 4L75A 2WUVA 2FRVA 1J20A 4DCNA 4PYJA 4KAJA 3GLHB 3FWHA 1CUEA 3GLSA 2PUGA 2OV4A 2PVSA 2X6TA 2GO7A 3NEYA 4R0VA 3DAHA 5E1BA 3V4PB 2GOYA 1VPLA 3ZCUA 3HUDA 3KQOA 4DDHA 1Z4OA 3CMMA 3MM4A 3O73A 3PGVA 4H3HB 4PLTA 1V5EA 5B7QA 3ZW8A 1V5IA 2AN4A 3C3KA 3G89A 4L4RA 4NCIA 2G4CA 3LHFA 4PGAA 3DEHA 3QWHA 3E9NA 4B8ZA 3HJTA 4TVBA 3QVKA 3STHA 4YRAA 3I2HA 4LQCA 4YMTA 4ZODA 1E2UA 3U56A 4GAEA 1AZSC 1XSEA 4TTIA 5JTUA 4QATA 4UUNA 1EP1B 2E37A 4ATNA 3RASA 4WOCA 3MRSA 3CSSA 1XCJA 2HRQA 1VMIA 4EG0A 1GL3A 2EU8A 2QZZA 4D9GA 1RAIA 2JFVA 1ANKA 4FX5A 2JKZA 4PG6A 3DKIA 3JQ9A 4FZ5A 2LE0A 3L40A 4KYUA 1DAEA 1NFFA 1T2NA 2HX1A 3PWZA 3U7QA 3KR1A 1C2TA 5DT9A 1NPTO 3UCXA 5ALKA 4F91B 2C9DA 4B3GA 2HH9A 5K0BA 1FSGA 5B58C 3ODPA 1MW9X 1UXJA 3OMWA 4ZHQF 4BLSA 2XZLA 1P1HA 4QHSA 3KR0A 2EFHB 4S0ZA 2FOIA 2ZREA 3E7DA 1XAGA 3KJHA 4B9AA 4C7XA 4F45A 4NECA 4WY2A 1KO5A 2NT3A 4JBXA 2J6HA 1AVTA 1MGOA 4IIGA 3V4ZA 5IJ9A 4DR2B 3O03A 3H5IA 1YVEI 1C7RA 4OKIA 1SRRA 1UKAA 4CW7A 5HP4A 2W8BA 3FMVA 3R7WA 3TSOA 1KK2A 2EWVA 2JEYA 4IIJA 1SBIA 4O4JF 1AHPA 2J4DA 1DGQA 2EOAA 4PX5A 4CI9A 1HDEA 3HJFA 3GJYA 3LFTA 4UVEA 1RBYA 4ZI5A 2WSIA 1JVBA 3LRTA 3AHIA 1G5IA 3W4IA 2YWCA 2YS7A 3VV3A 3MTEA 3K8YA 1R6BX 4JV5B 2GN9A 2CYCA 4ZEWA 3V7NA 3LC0A 3GFTA 2WKWA 4RVNA 2JBHA 2IIBA 3QTBA 4GSKA 3ZU3A 1XPOA 3HZRA 5EQDA 5E7QA 5LSAA 3MLAA 4W8OA 1G8AA 4H6VA 5ALWA 3OQ1A 1BMDA 3QNUA 3P9XA 1VJCA 4TUYF 5CNKA 3O4HA 3OCYA 3PK0A 3KYDB 4ZQCB 4LYEA 2AMFA 2O2XA 4A36A 4ZT4A 4AKGA 4JA2A 5JW6A 3UM9A 1G9SA 1MOQA 1NIJA 1FDWA 4GS5A 5KYXB 1IBCA 2NVWA 4G0MA 3A4TA 3DULA 5ECWA 1G0OA 1Z2EA 1DBPA 4NEGA 2PO5A 4N8SA 4S1WA 3TLYA 4FE4A 4S0XA 3RW9A 3FRIA 4QWMA 1AQNA 1M9NA 4YXWD 2PBZA 3VJLA 5HJ5A 5ICEA 1QCCA 3UK7A 1F8GA 5I4KA 1AQUA 2ZBUA 4AXBA 3RUCA 5A03A 3BA6A 1XKTA 1XUOA 4G25A 1P4HA 1ZN2A 5AW2A 2C4UA 5AQ1A 4RM3A 5JU6A 4BV3A 2Y4OA 4Y1FA 3CU5A 4UUOA 1FYDA 3W77A 4QOSA 2W4MA 1O97D 2PL5A 4PRYA 2QHXA 3OOJA 4MX8A 4ZVLA 1KH2A 2X8BA 5C7LO 5F7XA 2YHUA 4NU5A 3FCYA 5L9AA 2P68A 2OB2A 2V6JA 3OQIA 1TMKA 1H6BA 3IH5A 2HLPA 3Q11A 2IXEA 2ZPTX 2E9SA 3MOIA 1U1DA 2FSIA 2E21A 2HV9A 2PX8A 4UU8A 2LNDA 2H65A 5AW5A 3BUSA 2FTKE 3G2IA 4KACA 2FEWB 3WKDA 1EFHA 2G0TA 3N2KA 4MGEA 1XXLA 5DW0A 1CE8A 3CZPA 4L4ZA 4BFUA 4XVHA 5ENZA 1MX1A 4DM4A 1JEDA 1YBHA 1P0CA 3UAVA 1OV4A 5JYBA 1YK0A 1RZUA 3NGMA 1AO3A 3L8YA 3COJA 1L4MA 3GCXA 2QM0A 4AF8A 1X70A 3DOOA 4U7FA 4A0HA 4FM9A 1WX1A 4BRUA 5AM2A 4CI0B 3BCHA 3PBKA 5IJ9B 4IS2A 1OXMA 2XT6A 4CEJA 4MIYA 3VYVA 4GEKA 4L3VA 5LNK6 1RXWA 1U8ZA 4EUKA 1VI6A 3FJYA 1DB3A 3O6VA 5EIXA 1U1GA 2DFLA 4UARA 2ZSJA 1OAKA 2NG1A 3GUVA 1JNXX 2JFHA 2FJUA 3PICA 3I01A 2XLBA 4WUTA 1BH2A 4QEKA 5JNUA 4G4IA 5JNRA 3OOSA 4EPXA 4MEAA 1QRRA 5LQNA 1JU3A 2DB3A 1LF0A 2M9MA 1AZWA 5FOSA 3TKLA 3R0IA 2GDJA 3V80A 3A9VA 1Q3TA 4MNTA 4D82A 1WXIA 4N6OA 3P0HA 1WSWA 1R0XA 3HXKA 1KBQA 1NSFA 2CEKA 3AHEA 3INGA 4G1EB 2FH5B 5F2NA 1V26A 1TZMA 1CZOA 2R44A 4DMMA 3HO1A 4DT1A 4GM0A 3SEAA 3GJ4A 1ML4A 2BMDA 5EMNA 2ZE6A 4HEA1 2CT8A 1NJFA 2ONJA 1XNJA 4H60A 2NO1A 1CUWA 3HCOA 4TSFA 4BZQA 1E66A 1HC7A 1S3FA 3JRNA 2DPYA 3KL2A 4PWZA 1P1IA 5JIBA 2I71A 2XE4A 3UG6A 2QG4A 4JOBA 1M8JA 1NW3A 5COAA 1LTHR 2A9OA 3OURA 2P62A 3NAMA 5ALZA 3M6UA 3GCZA 1XMSA 3PNPA 1V1RA 3D7KA 4B4DA 1VZ3A 1WV1A 2L42A 4WNAA 2IS2A 2XCIA 5CD1A 1UC4B 1QDUA 2GJSA 1KMCA 4CKBB 2NQTA 2ISCA 3H6GA 4IMPA 3DB2A 3PV0A 2ASVA 2PSJA 3FNEA 3PFGA 1RXCA 5ALEA 3TI9A 3W8RA 3PHIA 4AN1A 1UPFA 3UK1A 5CCDA 4L28A 1WVMA 2GTPA 1RSZA 1SUCA 3FHCB 4EYKA 4JB3A 2A35A 1T0JB 2VK1A 3GLVA 3NC1C 4G5QA 1II0A 4O2LA 2MDTA 3R3YA 2ZUFA 3LK6A 5B37A 1M1ZA 1AG9A 2I22A 3KLBA 4MVJD 1YZ3A 3IQXA 5TQ0A 4GRIA 1X13A 2JPDA 1XIVA 3RSFA 1AQJA 4P83A 2FWRA 4V1CI 4MV5A 2I2WA 1KR5A 2BM0A 2C31A 2P35A 3D6HA 2V7PA 3NW9A 4IO0A 2WU8A 1OFHA 4XQCA 3MRXA 3BGSA 1QGDA 4M8LA 1QSGA 5BSKA 5HIKA 4LVUA 1N2GA 4YRTA 1VCMA 1QIIA 2CK3D 1QFMA 3AF5A 3ETJA 2ZRMA 5B2ZA 1ZHOA 4YY3B 2GXQA 1P4SA 1J09A 2YDXA 3BHIA 3N3BC 4S3MA 3ZG6A 4C6RA 4BP8A 3O3NB 2GM5A 2AC4A 2XGMA 1GTSA 2X9LA 2Q0QA 2QYTA 3ZLUA 2H17A 5HCNA 3HMKA 5A9SA 1W0JD 3IUQA 4F6RA 1L5HA 3GRCA 1E18A 2CLCX 3AF1A 3R7BA 5KQRA 4ND2A 1EZZA 1QLHA 1HYBA 4ZMBA 1GZUA 3IIMA 1YCFA 3KB6A 4Q05A 1C80A 2DTXA 2E4WA 1OC2A 2HCBA 1DJQA 4GNRA 2I1VB 5B2FA 3KQLA 4MV4A 3O2JA 2Q3BA 2AMJA 7REQA 3FZNA 1MN6A 2B21A 2X42A 3OA2A 4DRXA 2WWFA 1BO6A 1I14A 1SKYB 1TNDA 3LA6A 3ITNA 5DFAA 3BFXA 2OILA 1MAWA 3HU5A 5FFNA 2PX3A 3W7BA 3AP2A 1BQ3A 4NHOA 4C89A 4D57A 4NJEB 3NFRA 3LF1A 3PYXA 2FZ5A 5B3KA 2VSYA 2TECE 4TTPA 2C2YA 4DUYB 2H2HA 2FSVC 4PZPA 1VG9B 5EXPA 3HN2A 2ZYHA 2XDQA 4PLFA 2ZRCA 3JR3A 4X00A 1T4DA 4EGCB 2OV1A 1T0BA 2O20A 2ZKLA 5KTSA 1F7VA 1OZHA 3QE0A 4UOQA 2E89A 2FEPA 1U1FA 4FONA 3SXUB 1J22A 1M6WA 5E1DA 1K88A 1XCBA 4GYWA 3I62A 1NHWA 3FDZA 1DXYA 3QA3E 4LXUA 1JIUA 1QG6A 2FK8A 1OVMA 5FYDA 2RH5A 3GMTA 3GYGA 3RSCA 3UUFA 4CRWB 3H2ZA 4O4IB 4XWYA 3T7IA 2GZMA 2QN9A 5I5EA 4R9SA 1YS1X 2HBRA 1XI2A 4I1SA 2Q07A 3FA2A 4V1CA 1IWPB 1AF7A 1NUTA 1VL2A 2BONA 4AIIA 2Q5OA 3AWIA 4UCFA 3ETGA 4GMKA 4YUXA 5CB8A 2RK3A 3QOYA 4G5OA 4G1VA 1MB4A 1SXIA 3F8SA 3I3OA 4DG5A 3EPRA 1V7PC 2G70A 3A1WA 4YMWA 1YJQA 1XDUA 2PUTA 3BCRA 4I1YA 4L4XA 2UU9B 2XODA 1QKIA 2ZJOA 1TJ4A 5E7JA 3ZGOA 1Y89A 2XDWA 3DWGA 4Y0AA 3T1YB 5KHAA 5BN3B 1E1QA 1UWCA 1WUYA 3W04A 4LCBA 4FZJA 3AETA 3A05A 3H83A 3R0VA 1E9BA 1N6PA 4R68A 1G8PA 5D5HA 4EG7A 1PUIA 5IM4F 3KOOA 3T4EA 4EBBA 1CUJA 3LG2A 3FPAA 4DRXB 2BFAA 2R8RA 1B8PA 3REGA 2L18A 1DJMA 4BP9A 1G1MA 2BGKA 3JVEA 4IMJB 4Z53A 1ESNA 2WM8A 1XAHA 3DJYA 4HXEB 3RYFB 5K2OA 4G4JA 3PT9A 4EW1A 3OOHA 4FT2A 4R7TA 1QJCA 1URPA 4J16A 4I4CA 4RHEA 1EHYA 4I1IA 3LWZA 4B17A 3P71T 1XX6A 1YIDA 1GARA 2ZI5A 4IUYA 2BBOA 3KO8A 1U3UA 2V6FA 4W99A 4QRHA 3VA7A 1YI0A 1ZMTA 3CG4A 4Y9SA 1AGPA 1DPFA 5K2MA 1WW3A 4ZICA 1F0YA 1R4NA 3MILA 1GADO 5AKZA 3LKZA 3TBHA 1BMFA 1ISMA 4FLEA 2H2FA 3AXSA 4GI1A 4H31A 4WKPA 5DIZA 5DYNA 3U4GA 3G8YA 4UBKA 1Y3CE 1PGOA 4AF6A 3D4PA 3L7MA 1G3IA 1DRWA 1MQSA 3OQMA 4NNOA 2G9UA 3C8MA 1JDBB 2O9JA 3DOUA 1DTWB 1EGMB 3K9NA 1P44A 1LDBA 2KPOA 2QUZA 5FF9A 2QAGC 4HDSA 3O21A 3BMXA 3K73O 4QNNA 2JEZA 4U63A 3U44B 1FX0B 3ZI4A 4IDQA 2J9XB 4OHOA 4MUYA 4QVKA 1XZGA 5E8RA 1N6NA 5I9NA 2B4KA 3VJRA 4KJXA 2FUG1 3DCNA 4AX4A 1AJEA 2IP4A 4WKOA 5A3VA 2P8SA 2ZQZA 5B12A 1VL6A 1I3MA 1XU7A 2BZSA 4FCCA 3BXXA 3SIWA 1ULSA 2JBWA 4QQRA 5GV8A 3I9V6 4CCYA 2IIPA 4W1QA 4CQMA 2DKOA 3HYRA 3NUGA 4ZCMA 5I9IA 4DDMA 1M8FA 2VYNA 4AS3A 4EUNA 2I0FA 3ABZA 3IEXA 4OHRA 4RTKA 1OZ0A 1U8UA 5HXAA 2Z1DA 3MINA 1TQ6A 1D1PA 4DVJA 3KETA 4X95A 4IIDA 2Q8NA 4JIGA 4X92A 5HKKA 2IOYA 1G17A 3CCCA 4HDKA 5EYPA 2H7CA 3TM4A 5CM2Z 3ZCRA 1BKSB 1CETA 2QG6A 4U2FA 3U7HB 2WV9A 4ZOQI 3L4JA 4H7KA 5E4TA 3DDHA 3TG2A 3UWKA 1EP2B 3D43A 2OYCA 1XYGA 3C6ZA 4NZNA 4QYTA 4EBFA 4YGXB 2QA5A 3HBMA 2AWNA 3USCS 2CBGA 1PJTA 4HH1A 3RBXA 3OZGA 1B8VA 4Q9DA 4BGUA 1GWNA 1S2OA 4AN4A 4WBNB 3GGPA 4F86A 1KDRA 3AU8A 3HB0A 2GWHA 4S2EA 5KC8A 5EERA 1G5HA 1KAHA 2OLJA 5E0OA 3GBPA 4FFDA 3B6MA 5J47A 1XZCA 2PM8A 3U16A 2HHJA 4WKGA 1SCUA 3VX4A 5T6BA 1D2CA 4FYMA 4KMRA 2AYYA 4OA8A 2Z4RA 4INOA 4UMVA 2VPWA 4EKNB 1XK6A 3VO2A 4TPKA 5EZYF 1BKDR 3VNVA 2W70A 5ILGA 4Z3OA 5HF5A 5BSEA 4DA6A 2WAAA 5TVKA 2B69A 2RAPA 1JLLB 2GBLA 2ID9A 3AI1A 2O3RA 5BSHA 1L1RA 2FZVA 3V97A 5TX7A 2OQIA 4M46A 1O2DA 4KWCA 4LIPD 4DLWA 3CLSC 3DL4A 4FP9A 3CO0S 1JEJA 3PGLA 3GLGB 4A26A 4FYVA 4DC9A 8MHTA 2VJPA 1COZA 2XYRA 4EGFA 4L9RA 1W35A 3ZDRA 1E2JA 4ND3A 3SMVA 4DNQA 4EQ6B 4QX6A 2VQFB 3EUFA 1UR5A 2QI9F 3ECCA 4FBGA 4RA9B 5LWQA 1MQ9A 4EEZA 2B3TA 1F8XA 2GN0A 4Q37A 5G02A 5DM70 3RUPA 1I6KA 4YV1A 2CGEA 3IDZA 1CDDA 3DQPA 3PRYA 4I1PA 2EIHA 3C3YA 4PW0A 1JRLA 2ZAMA 5A62A 5JWOA 3SKVA 1J8FA 1MRZA 3FYCA 4B6QA 4PO8A 2PK3A 5I7WA 4CR8A 4EMTA 3HB5X 3PQFA 1XEAA 221PA 2WQZA 5CTJA 4BJ6A 2AN1A 4HB4A 4RH3A 1T5LA 2PLAA 2G28A 3NGXA 3QUSA 4HLUA 1CV2A 1DX6A 1Z0JA 2COEA 3RABA 4AROA 4BO3A 4DABA 4EWLA 3BWYA 1FSZA 3G59A 3LTEA 4E2ZA 1XRLA 1KBZA 3R7FA 1EK2A 1HT1E 2ZIGA 3TUIC 3SC2A 4BKUA 1Y4SA 1CY1A 1R6TA 5JAUA 4BASA 5CBKA 2HT1A 3T9AA 4G56A 1BDIA 1G0NA 2WIAA 1C1DB 3SP1A 4ZYUA 3J81k 1KPHA 2KJQA 1XFDA 1E7WA 4OBEA 5DKFA 3UTDA 1KSFX 2YHIB 4XYGA 1Q0HA 1H85A 2V7VA 3JQGA 1DEXA 5TNXA 1T91A 5K3AA 2ODNA 1EUDA 5TF0A 3PD7A 5GTDA 1T6BY 3HCPA 2B8EA 1N0VC 1T1GA 3IQDB 2V7QA 4RV9A 4TWAA 5BNIA 3NBUA 4MMXB 2BDTA 1E0AA 1P1JA 2IWHA 5COQA 4LOLA 4RF3A 3JWHA 4RTOA 1UIRA 2QUHA 5FO1A 1W0KA 2FMIA 1Y9DA 5DISB 1PV1A 2WICA 1ZUWA 4J1NA 3V4SA 3BGVA 3BS4A 1UZLA 2YXPX 3AEKA 3BK7A 2OVBA 2FK7A 2ZBDA 1MGPA 1MAUA 1S2LA 1L7OA 4JY7A 1Z73A 4RMIA 3BQNB 3HBJA 2O59A 2H54A 2QT9A 4WXYB 1T0PA 4KYIB 3F5MA 4G9EA 4U7JA 1QLJA 3U37A 2XKKA 1J25A 5EHNA 4KNWA 5TXGA 1SA0A 2KX7A 1P33A 1Y3AA 4IMIB 4Q82A 1U0TA 3IUMA 3QHPA 5CT8A 5JS2A 1TW2A 4L2IB 4LMAA 2DULA 4TS1A 1QGED 4C4XA 1IN5A 4DV0B 1SCBA 5HF6A 4OLAA 2O5EA 2PWPA 2O4UX 3ZWXA 2HA2A 2J6BA 1I7QB 1E2DA 3ZWKA 4P9NA 3T1OA 4XUDA 5ALUA 3TIVA 4RV5A 1F0PA 1L5MA 1Y48E 2ZDGA 2NXNA 2ZIZA 1B00A 1ZRSA 3L6OO 1PSZA 4NV3A 2RGBA 1DIBA 5DXJA 3RFCA 4GMFA 2Q4BA 1HX7A 4X97A 1DIGA 3IQIX 1BGVA 2I2AA 4X9XA 2VRCD 2CXQA 3WHKA 1UEXC 4JJGA 2CLOB 3E9RA 1E6WA 3EZNA 3O82A 3D0RA 1FX1A 3I9NA 3M7IA 3L7BA 1FXWA 2VHYA 4R8LA 1Z6TA 1TD1A 5AKYA 1KI2A 3LUKA 1VSVA 3CX8A 4RS3A 2FX5A 2IUEA 3INYA 5DVZA 5F33A 5AVKA 5FPSA 3RB8A 3I1JA 2IOHA 3LD9A 4H1WA 5CA0F 4XGNA 4US2R 1DFIA 1C5KA 2XPCA 4HXYA 2PYIA 1JS1X 1C29B 1SQFA 3B53X 4F56A 3WIVA 1UDXA 3GEHA 5IT4A 5C8XA 4J0GA 1XFAA 2GVZC 1WZ2A 2NO6A 3WIOA 3AR3A 5EC8A 1SHTX 1W88B 1QMPA 2ENWA 1QWSA 3RF7A 3BJRA 4P54A 4RK7A 4YO8A 3U40A 3A32A 3E48A 1HZZC 4G4SO 3FWPA 1VKZA 4MROA 5FUXA 2MU1A 2JC3A 1GN9A 1QIGA 3LQKA 1P7VA 5EY5B 5BNTA 2PUJA 1U4NA 2FZWA 2DH5A 4NAUA 1PV4A 2OD2A 2OOSA 3OE7A 3OOWA 4WJLA 5BUZA 4ZO8A 4ZCTA 1PWEA 1PWHA 1P7PA 3N0VA 5HQ3B 3MAAC 1E64A 2XWQA 1A0OA 2Z5VA 2WIGA 1Y7TA 1BOFA 5GZ1A 2QD4A 2LTAA 2DQSA 3AEUA 3B70A 4XFDA 2H31A 3IUJA 3T35A 1X7WA 1L2TA 2V6IA 5AJVB 3X2EA 2OWEA 2IV2X 4EF4A 1PLKA 1S3IA 1PUXA 1V8PA 2JFQA 5HWSA 3RVDA 5CJ2A 1HDOA 1QUEA 5IAOA 5L7TA 1RMTA 1YHZA 1V48A 2EW8A 1W76A 3F6RA 2Q3DA 1STOA 2YXDA 3OJEA 3OSZA 3THSA 3TXAA 3DLTA 2WF5A 2DC1A 3C8ZA 2J3MA 3QKRB 3N59A 1MA3A 4ILKA 3DBHA 1RWQA 4MTCA 4B40A 4CT5A 1VJ0A 4EJFA 2BEUB 3RUEA 1NXVA 3T3OA 1BS2A 4TRRA 2CL6X 2R1VB 3C3BA 1H3FA 1JECA 4ALJA 3BB1A 1WXXA 1AS2A 2IYSA 2OR3A 1MENA 3D0KA 4DQXA 4JSYA 3C3PA 1O8CA 1K0FA 4LBYA 2ZAOA 1RABA 3E4CA 2OCDA 4EKEA 5GGXA 1AMNA 1F12A 1D9XA 3OE4A 1GTJ1 3FVRA 1FFWA 2XNSA 3JALA 1H2WA 3A25A 3CUWA 3OEHA 1NU8A 1JAHA 1NBMA 2YY6A 3OHPA 2QS9A 3WKEA 3OQNA 2XY4A 3TS1A 3EZXA 3DGFC 2IBMA 3K2EA 3P27A 3TQTA 1HDGO 3M6LA 1P3Y1 1VB3A 2HMVA 2ZTLA 4QXAA 1ECJA 1WO8A 2PX5A 2VP9A 4QTYA 5FADA 5JADA 3SJCA 4W5JA 4URXR 5D51S 2Q0SA 3RR2A 2OC4A 3S2IA 4OKSA 5B1IA 4DLBA 4UFNA 3V8MA 2C97A 1FP1D 1L7DA 2BJVA 2FW8A 1PRYA 2R62A 3X2FA 4ZDKA 1OILA 1DRKA 4BO5A 1XP8A 3L7JA 3RNLA 1DINA 1KIFA 2I1QA 3CR7A 2HMAA 3OAAA 4QDJA 3K9FC 3DQQA 2YINC 2R00C 3L4EA 1SRQA 2IT1A 4RIGA 1FX0A 3CNLA 3DV0A 3E8MA 4B4UA 1OT3A 5ITVA 1YNOA 2W93A 4QU0A 3ZQ6A 3KSAC 2QY6A 4I6EA 2JKYA 4WZ6A 1S02A 2HUPA 2IEAA 2QVYX 3DV2A 2M1ZA 1UAAA 1SBZA 3L7AA 4YRSA 2EIXA 1DBWA 2G82A 4JLUA 4LF6B 1ZJ6A 1E5LA 2VHCA 5KMGA 2R85A 1WDWB 5CRIA 4YJ2A 1A5TA 4OCZA 3ZIUA 1UDAA 5DNEA 3U9SA 5IT0A 2J3IA 4KSCA 5CB4A 1NI5A 2HO4A 2R8YA 3ETHA 1ESMA 1I3LA 3VYUB 3HWWA 2VO1A 4OI4A 5FWXA 3ABQB 3P94A 3O7MA 5DI9A 5JO0A 3WIDA 1L7PA 2QZPA 2ODAA 4MYCA 4JGIA 5JSZA 4OTZA 1H23A 1Q7BA 2JAPA 2Q5HA 2I7CA 4UM5A 2CXTA 2F1KA 2C3YA 1TADA 1Y7PA 2SCUA 3AY3A 2ZDQA 3LH5A 4ID9A 4IYRA 4MK4A 2B2CA 5B53A 1FXUA 3W3AD 3SQWA 4ME6A 3KQUA 4MO9A 3K70C 2BZ0A 4YLYA 5T8KC 4B3XA 2GM3A 2AJ8A 4TLMB 4YP7A 4RPKA 3BIWA 3LP6A 1C8LA 2ZT5A 3ZDEA 2ZANA 3Q9LA 1WE2A 3F9IA 3TW4A 3VDRA 5CG2A 2DEUA 4CDGA 2FR8C 3U3KA 5LOVB 2FGJA 3G0GA 1LDMA 3IBSA 13PKA 2GD6A 2XRYA 3HYLA 5DTQA 3CXRA 4C1BA 1Q1BA 5I4IA 4Q16A 3CUEF 4QBKA 1T9HA 4BWFB 2NTYC 1CQJB 2Y99A 1HO3A 1M83A 2Y1XA 4DLRA 5FXMA 4CMEC 8OHMA 3IPCA 3WC4A 1Q50A 2G25A 1R88A 4B31A 2H0RA 3EW9A 3RRYA 5LQDA 1A7KA 4TV8A 5AHWA 3LI2A 4JIMA 4QHTA 2VKQA 3C8HA 4PRLA 1T5TA 3DNPA 4ZOAA 5DGCA 3EYAA 2QN1A 5A5EA 3FOFC 1O95D 4R16A 3O0DA 5HDBB 1ZSYA 5H7XA 1ZH4A 3RVNA 2FJPA 1CJCA 1DBRA 3F7TA 3SXUA 3DO6A 1IRIA 3FY4A 1SB8A 2IYUA 1V7QA 2ZLBA 3JATB 4YA6A 2R1UA 4O5OA 1HUQA 2QD5A 2R8XA 1V9CA 1F1JA 3G5LA 1TLFA 4KH1A 4X45A 4D3XA 4HYTA 2W2OA 2PT5A 2VF2A 4DBZA 4OQDA 1JYSA 3BD8A 1EK0A 3E0QA 3ZDCA 3CJRA 4KRGA 3W9YA 3U44A 2PUCA 2VTVA 5BW6B 1Z06A 1NZFA 2BWJA 4O0MA 1C0LA 2GK4A 3EEYA 1CUIA 4M53A 1RXUA 2IRWA 4FFVA 4YQFA 3EGXB 4G0XA 3AUJB 1ECBA 1P8JA 1Z74A 2PMWB 2XUAA 4D8VA 2ZKIA 4M1KA 1DWPA 4JLNA 5FBRB 4P35A 1T36B 2ZBFA 3CEHA 4WACA 1M2FA 4OATA 1XQVA 3N2YA 4WASA 3I2KA 4YP0A 3QY0A 1JHAA 3PDIB 1WBJB 2VYFA 1VYTA 3AI3A 4KIUA 3TSYA 4AU1A 2Z2KA 1IB0A 3QUCA 3O91A 5EG5A 4KV9A 2DAPA 2MWMA 2GKGA 2W2VA 4NTZA 3D6TB 3JV7A 3OPVA 2YMPA 1T0IA 2XQFA 4C4SA 2NPIA 5B1YA 1I5EA 1C2YA 3R4CA 4YP6A 3RUFA 4NMWA 3MCWA 4IIBA 1YL7A 3DZDA 1P7CA 1TI7A 4I9GA 4Q03A 1LW6E 5F21A 3L1VA 2YFHA 4Y7DA 3A9CA 5BSRA 1ZOOA 2CYAA 3PXEA 2WKPA 2PRIA 5JAZA 5TY0A 1HE4A 5A06A 2VRBA 4CQLA 1ORHA 5IHPA 1C7JA 3IR6A 2ECOA 3D6AA 2XCQA 5KSPA 1MX5A 1IAVA 4WCFA 3B60A 5HRUA 2YMLA 2ORWA 4NNPA 1PT9A 1MHPA 4HWTA 4FOTA 4LPSA 2SECE 4G4GA 1W0CA 2YC2C 4LPKA 3VYTB 5KVQA 5THQA 1NBMD 2FUKA 1H05A 2BEWA 2I2XB 2YRWA 3ETNA 3JZMA 3O4JA 4J4HA 4PO1A 1L1FA 3P8ZA 4N7MA 1CG6A 2JAQA 4TQAA 4RBNA 4NP6A 4Z49A 1UPBA 1QGUA 1XE3A 4X0EA 2FZLA 4S1NA 5HMLA 3E6AA 4MWEA 1KZYC 2PGLA 2ZYVX 2V74B 4DJAA 5BR4A 4WTOA 1QVAA 2JRCA 1MA0A 3NH6A 1MG0A 4HOYA 2O2YA 4MQ4A 1C1HA 1I01A 3LUAA 4G1CA 1YUBA 4E5MA 3T0IA 3BJZA 1PD1A 2XMPA 4ILEA 2YJ5A 3ANMA 5EXXA 5DN6D 3HEBA 2HSWA 2Z58A 4KX3A 3TEFA 3T7KA 1F51E 1GYRA 1LBHA 1V2GA 1LNQA 3LT1A 4O2AA 4B3MB 4BEBA 3PQDA 4GOXA 2B4RO 4CLHA 4MS4A 4GR9A 4GZ5A 4ITUA 1DAIA 4G23A 4R84A 4WXPA 3G0IA 4DR3B 4RESA 1LQ2A 3ZBUA 1ZM3A 2P6MA 1TJYA 1Y6RA 2AFHE 3CEJA 3H4VA 3U17A 4ENVA 4QYIB 1RQGA 1VLVA 2D5CA 5FLEX 3ZXXA 2NZYA 3H1GA 2OCIA 2J0VA 3WL8A 1UWVA 5JZOA 1HQYE 1QYDA 4KGVA 5F35A 2DJ5A 2YQ4A 1U4SA 1L7QA 4MUGA 2DJIA 5C52B 2FW1A 1ECFA 2RGXA 3W4KA 2ZYAA 4AUMA 2QPLA 1M1XB 3S2GA 1JA9A 5HTOA 1GLNA 1ILWA 3KRTA 1ZJ4A 1UFKA 3DF9A 5H0IA 1AMOA 3KVRA 2FG7C 3A1SA 3O4IA 5BWBA 3FPBA 2ZRPA 16PKA 3WYBA 4P1ZA 1MG5A 2J8ZA 1I6MA 3H3JA 5D7NA 1XXHE 4Q9IA 5K3EA 2BHTA 1Q1QA 2A5YB 3CKYA 4ENTA 2QRKA 3KCNA 4R3NA 9LDBA 3T3NA 5J2UA 2ZRFA 1SZCA 2N3ZA 1K98A 2J48A 1RQRA 2FZGA 4XRRA 3V3TA 2IYXA 3R6GA 2QX6A 1X92A 2ZB7A 3TX6A 4QGGA 2Z6UA 3N8NA 2WDPA 5DOZA 3TTUA 1KFKB 6NULA 5JT1A 4UU0A 1AY0A 1T1IA 2FPXA 4HGOA 1Z7GA 3FYUB 5EINA 3IP7A 1NBME 3QPVA 4BHTA 4F3TA 1CEEA 2K2QB 3GLQA 4KK4A 4DYDA 4NBRA 4QOEA 4ABTA 5AI5A 1RRFA 2AN5A 3GRPA 2H1OA 1KMIY 1CZLA 5HS6A 3HKCA 2ZTMA 4RSMA 5AUOB 4M1ZA 1NXOA 3C4JA 1WY7A 1Y8AA 4GBJA 2VRCA 4BFZA 3DUFA 2ZS9A 1BHSA 2PMDA 4HB0A 4GE3A 3ZWCA 5L4SA 1BJTA 1NF9A 1OFTA 2YQ5A 4KVAA 3K09A 3PXUA 2X1HA 1EWYA 2R1ZA 4MS1A 2J31A 3KB8A 4BV2A 1IPEA 5HZGA 4CLRA 4ESVA 4I4TB 2A4MA 1KZ7B 3D7RA 5TB5A 1A3CA 4CL2A 3HR4A 5TMEA 3PGKA 2FFRA 2XUKA 3EEIA 3U80A 1IHUA 1BWRA 3NBFA 2J32A 3GEEA 2XF2A 2SCUB 2XF8A 4UEOA 4AO8A 1K9SA 5BSGA 1FFSA 3IDAA 1JNYA 3KVYA 4EO7A 1C9JA 1AXEA 4UUQA 3EISA 4CKYA 1W59A 4BUCA 4DCSA 4Z51A 1G7RA 4ALNA 4REOA 2DCUA 4GOLD 3QU7A 2CLHB 2HPZA 2HQRA 2OO5C 1FFAA 3S2UA 4A03A 1EI9A 1N6HA 2I67A 2NSLA 4XX0A 1YTLA 5PGMA 1BCSB 2UUCB 5MHTA 3ZVKA 1J42A 4EUSA 4DLPA 4HQNA 1YDGA 3M82A 1V43A 1UMDB 4YCAA 1SPBS 3MG9A 3ZCSA 1CYDA 1N5IA 1Y8CA 2C82A 3LKVA 3E84A 1ODTC 1N6OA 4CM8A 1EUCB 2OEPA 4RAOA 4RTJA 1I4WA 5CJPA 1KYYA 2JFFA 3A4MA 2QTVA 2XMZA 3K0CA 4QQKA 3RTDA 2Q1UA 2QW0X 1HYEA 1VE7A 3KTFA 2FEAA 3PT5A 3QXGA 4OA5A 3GGGA 5U4XA 3SI7A 4BJ3A 5IVPA 1U0EA 1CXZA 1XELA 3AR7A 3EFBA 4RIFA 1Z7YA 1A9PA 2NP7A 2E0IA 4ARZA 2QAJA 3NDPA 2QJFA 3E15A 2Z6VA 5BMVB 1FU4A 5FI0B 4BNDB 3HCRA 4CF5A 1PW5A 2LUOA 4D6YA 3D4LA 3I3SR 5EUBA 1QIEA 3HDQA 4AIRA 1FDTA 1SGWA 4MPTA 3HJGA 4OXRA 2DKNA 2UXCB 2PXAA 1TKCA 3MJFA 3ER6A 4XOUA 1YS7A 2VZ9A 4TWJA 4ZK6A 5CIYA 3FIJA 1WXHA 2JG3A 2R97A 3RKSA 4I5GA 4FNAA 4BZWA 6CHYA 3ENZA 3SDBA 4OQ4A 1U0OC 3OD5A 5EQTA 1PJ3A 3H9GA 4JLVA 2ODQA 3L7OA 1WPRA 3NLLA 3IDSA 4CGZA 3PTLA 4G86A 1RJEA 5C8YA 5KTRA 3DAOA 4HV4A 1DBIA 5T4FA 3MHTA 2BMFA 3BK1A 1Z16A 4U6SA 5ALGA 3ZXIA 4CUJA 1QZTA 3A6ZA 4HG2A 4BNWA 1OX6A 4A91A 3G2NA 1C4WA 1SNYA 3GA5A 1U8YA 2YZKA 1UADA 3A6LA 3I32A 4JBWA 5F52A 2QL5A 3C39A 4KNVA 5TS2A 5LLDA 2ZYUX 2H2WA 3GG9A 2WFMA 2IS6A 3L93A 4J29A 4L02A 5ALSA 1AQ6A 5IDYA 4ND7A 1D2MA 1EXMA 1QVZA 3I5UA 3AT1A 3MWFA 1WSAA 5ALHA 5ICGA 1TRHA 2IHNA 3I1YA 2Q46A 5BOVA 2HD4A 1Y4UA 1I10A 2BCJQ 2HMSA 4JT2A 1XU9A 3B1FA 3K0AB 3CBGA 1K6EA 3ICVA 2O8EA 1M34A 2ZI3A 3PEFA 4N3AA 2R2GA 2P4UA 1WU8A 2JFNA 4UNQA 4DV4B 1YA6A 1X39A 5EJ6A 1PQWA 1PGPA 2GZSA 2YN0A 1DDGA 2DF8A 2GD2A 4LY6A 3I0ZA 4N7BA 2AFIE 3W9UA 2MR6A 1QTNA 3AEXA 5EJIA 5KYYA 3R6DA 1FS4A 1EIZA 1T0HB 3GP8A 3N74A 2DRIA 2Z9DA 3A6GA 5ED0A 5ESXA 4TWZA 3ECSA 1DRVA 1P0MA 5GAJA 1OIVA 3GPLA 4ARCA 3TBKA 1JI3A 4HTAA 4F4CA 5KKNB 2J6CA 2BGMA 5F9MA 1LX6A 2F9LA 4WCFC 4NZZA 5K4AA 5T67A 1ADFA 4A0RA 1Z0IA 1OT5A 1Z28A 4AF7A 1VIAA 1YZFA 1UC9A 4GXTA 4HYQA 4OSPA 2QZJA 1KZGB 2XXBA 4F5DA 3FPJA 5KYNA 3E9YA 1FYEA 4J0EA 1U9IC 3QVMA 1IH8A 1C1XA 1OWMA 3KVOA 4XUEA 4ZCRA 2HBQA 3LBIA 1FUUA 2BFFA 3A7EA 3P9CA 1CRZA 4CG1A 3T4PA 3HJUA 3L04A 4MUHA 4DTCA 1DWUA 1QOQB 3UK6A 4AQ7A 1EE1A 4YO7A 3RS3A 1Z75A 2GF2A