5CM8B

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
169
Chain Sequence
b'GPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
molecule tags Signaling protein
source organism Mus musculus
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
total genus 35
structure length 169
sequence length 172
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm8B00
1E2FA 4DXAA 4V03A 5FOUA 1OFTA 2DFKB 4IXMA 4MGKR 3L8ZA 5JHHB 3MWKA 3IDQA 1XWIA 1DAKA 2GCNA 3BK7A 4Q4AA 4B35A 4O25A 4F92B 3IIJA 2IYSA 2GZHA 1NVVQ 3MCAA 1XU4A 3O47A 4TQ9A 4P0TA 2OO7A 1JECA 5CIWA 1JI0A 3AKDA 1M7HA 2FV8A 3KZ1E 3K70D 2NZJA 3A4NA 5GADl 4RFVA 4HYYA 4KJZA 1DE0A 4MRNA 5FOTA 4PPFA 3UIEA 1E1RD 4PHGA 5E7IA 3GJ3A 2I1VB 3GLFA 3BIFA 1VYVA 4UXIA 2RGDA 2J0UB 2WWFA 3B1WA 3BFVA 1QHHB 3SFVA 3G0HA 2QNRA 4OYHA 2FFBA 4DKXA 4N3NA 1TQDA 1GL6A 2QA5A 1CJKC 1OPXA 4HLUA 4ZCIA 4TZ0A 1Z6GA 1SXJB 3U7EB 4QGAA 4DCNA 1W2HA 1B23P 1SULA 3CRQA 2ZYWX 2ZS7A 1E9CA 2GETA 3VKWA 2PX3A 2QTFA 3VX3A 4XD7A 3PXGA 3KQHA 3K0CC 4URVR 4MYCA 2V6JA 2BBOA 2NGRA 2QP3A 5HE8A 1HQYE 3ADDA 3CF0A 4LYFA 1TQ2A 2GJ8A 5B57C 4M9ZA 4PR0A 1E0JA 1EGAA 1IHUA 4XH9B 3DKPA 521PA 1LB1B 2FPLA 3U7FB 1G7CA 5AUPB 4NMMA 4O3MA 3CPHA 2CDNA 2IF2A 1ZD8A 4ZDKA 2TMKA 2DFLA 2AX4A 2AK3A 2WWGA 2BM0A 3SBDA 3OIVA 1MABA 1E0SA 2CJWA 3NVAA 1NLYA 3VX4A 4BEJA 3TIFA 2YKGA 3SJAA 4M1SA 2FEMA 1W4CA 1G3IA 3DVLA 1KKLA 1U2RA 2FFAA 3LDAA 1P75A 3VR6A 4URYR 4A36A 3KQUA 5FBRB 3CF2A 5AJXA 2V3CC 1A82A 3SJBA 1VPLA 1XMIA 4DLXA 3P27A 2GA8A 1XCGB 2O8FA 1HURA 2J7PA 3WP1B 2J1LA 4CGZA 4FMBB 3AF4A 4EPXA 4F91B 3IIKA 2Z43A 3W6NA 5AJZA 1TTTA 3ZVNA 2V7QD 3KJHA 2A5FA 2C95A 3KL4A 4IDHA 1NN1A 1HYQA 2XITA 1AZSC 2V9PA 2VL7A 3KUDA 4FCVA 2GWHA 1U8AA 3ZLJA 1TU4A 2OZEA 2ZU6A 1RC8A 3U60B 1FW6A 2RHMA 1UKVY 2WJHA 1G18A 4EPWA 4GOKA 5L3SA 1XXHA 3PEYA 5DGXA 4NYMR 1S8FA 2IYWA 4BRWA 1SVMA 3A4MA 3H2YA 4OJQA 4TL9A 4TMXA 5LB2A 1M1YE 3LW8A 2KE5A 2IHYA 1XB2A 4AD8A 3NEYA 3I3SR 3AKYA 4B33A 1Z0KA 4HAXA 3AH8A 4OQLA 3EPHA 3KTAB 2OXRA 2XX3A 2ODWA 2CVHA 1GNRA 1NG9A 2ZYTX 3W6PA 3F0TA 1NF3A 1L4UA 4C0LA 1MABB 2V4ZA 1KZ7B 3T61A 4ASUA 5HZKA 1IAQA 1P5ZB 2GK6A 5JCZA 2R6CA 1T91A 4LBVA 3D3QA 1UFQA 4YC7A 3TQFA 1JPJA 4X8LA 4DLYA 3K0FB 3BH0A 4C0AC 3Q9LA 4DLUA 3TNFA 4QM6A 3OEED 3CF6R 3PITA 4JLDA 3RS5A 3TUZC 2FGKA 1RPZA 3RS3A 4NBSA 5DISB 1Z0IA 1AQYA 2ZQ5A 5FBVB 2ATVA 3NHAA 4FMDB 5FL3A 4A2PA 2P3SA 4Q7LA 4Q1FA 3BOSA 4ZKEA 3ZH9B 2EYQA 1CU1A 1MH1A 1R0YA 5FPKA 2IUSA 4AYTA 5BQ5A 2C99A 3U5ZB 2C8VA 4PQFA 1N5JA 2QE7A 2R6GA 3TE6A 4YMTA 1E79A 1S3GA 1DOAA 3AF0A 3U61B 4ZPXA 1JNYA 4M9QA 2IK8A 5A5GA 2CXXA 5JSZB 1ZNXA 3QQ5A 5H8WA 4M8NE 4N0EA 2A5DA 4YMSA 5JFGA 1IY2A 5FPYA 1GNQA 4Y0VA 4EIWA 3CRRA 2IW3A 2DPXA 3NH6A 2JLYA 2D62A 1OFIA 2ERXA 2HXSA 4DEXA 3NC0C 3V00A 4LJ5A 1OSNA 3LNCA 3C16C 5FUWA 1OE0A 4FIDA 4B3DA 4ZV4A 4Q4HB 4DVGA 1T0HB 3BWDD 2XGJA 3A8TA 1XXHB 4NCJA 1XBTA 3H0KA 4IFBA 3RLFA 3EZ6A 4YMVA 2DFTA 1A7JA 3H84A 1YVDA 3B1YA 3EPKA 1Z28A 1PZNA 1XCMA 1R5BA 2I4IA 2XJ4A 4QL3A 3SYKA 4E07A 4XTRA 3PUVA 2GCOB 3K53A 1VKJA 3T06B 3FFAA 1W5TA 5H70A 2QMOA 1CLUA 2QG6A 1XD2B 4Q9IA 1XMSA 5TARA 5IF9A 3SFZA 2DBYA 2CBZA 3QKSA 3KB2A 1NLZA 1XEXA 4G5OA 4WIAA 4PHHA 1G19A 2BJVA 2W6JD 3HR7A 4JLAA 4B6EA 2L0XA 821PA 2IYUA 1Q3TA 2ZRPA 1E98A 4Q1DA 3BD9A 1M6NA 4PZYA 3LBNA 4NZYA 4BE7B 2GBLA 1ONBA 1G64A 1F2UB 1KI1A 1J90A 4EFLA 2QZ4A 1BYUA 4JIMA 1Z08A 2V8OA 2CJWB 1UKYA 2ZSEA 3TJZA 3AGQA 3K0CA 3QY0A 2ZETA 3U44A 2QT0A 1S1CA 2YC2C 1MV5A 2CL0X 1CJMA 5LPNA 1CULC 1GVNB 4EJSA 5JRJA 2OBNA 2C03A 3RVBA 1KI9A 2OHFA 2DR3A 3THOA 1GOTA 3EAQA 1Z5ZA 2IWHA 1T5LA 3UXMA 4IOMA 2IYLD 1UJ2A 1G21E 2UVQA 4KBGA 1EESA 2CVFA 2O52A 3J81k 4LV6A 4IRUB 2RGAA 1KDRA 4W5WA 1ANKA 2YOHA 4FMCF 3BB4A 3FHCB 2WVJA 4GOJA 1JR3A 1QHHA 3KQKA 4IJMA 2IT1A 2ORVA 5JS7A 4TQUS 2IHBA 4DJTA 3L43A 1AQUA 3IQWA 3MGCA 1W1WA 4MH0R 4Q1EA 4A0GA 2WBLC 3RSOA 1Q57A 3VQTA 1OXSC 4Q4HA 4TYPA 1ZD9A 4YLGA 1VG0B 2AWOA 3CPJB 1OIVA 4YONB 2G9NA 1NN0A 3FVQA 4KO8A 4NTZA 3TVTA 4QKQA 1E1RA 1D6JA 1G8FA 1OLOA 4Q4AB 1SHKA 4Y0AA 1GILA 5DLQC 2F1IA 2VPPA 2XJ9A 4HZIA 3U2QA 4AIIA 1YHNA 4JZKA 4WW0A 5D3QA 4ZCLA 2MSCB 1E94E 1XZQA 2YOFA 2EQBA 5ANRB 1W0KA 2ZJBA 4DSOA 2QRZA 4QBGB 2ODEA 4HAWA 5JSZA 3GJXC 2Q21A 3DZ8A 2QPOA 1QZXA 5M04A 2XSZD 1GAJA 1LV7A 2QQ0A 1GG2A 3BRWD 3FWYA 3IPYA 2W0SA 3QXJA 1TQ4A 2VF7A 5EUQB 1JJ7A 5JWHA 4NCKA 3WXMA 2XZLA 2HUPA 2ANBA 4M1YA 5EQTA 2IYYA 2YWEA 3VKGA 3I92A 5FTKA 4GBMA 1FTNA 1W0KD 4OL0A 3BAFA 1XPOA 4UNQA 3AV0B 4M9SA 4B3FX 1VG8A 4GL2A 2NG1A 3AUXA 3A1VA 1CF4A 1T5IA 2X77A 1FL9A 2WOJA 5CM9C 3A58B 5FPHA 2BMEA 4XIGS 4B47A 3IUYA 3GLIB 4MDEA 3V4RA 1GFIA 3GFTA 3QJYA 5KNBA 1WF3A 2QI9C 2Q3MA 2ZYVX 4LI0A 2WWWA 1OB5A 2QMEA 2P0EA 2PLRA 2J3EA 2GZAA 3DM5A 4L5BA 1G8YA 1JEEA 3FTQA 3QI2A 3B2EA 1A2BA 4A6XA 3CBQA 721PA 1OH7A 4IEIA 2QQEA 3LO5A 4KXFB 3EX7C 1OIWA 2YC4C 3L0PA 4LBZA 1SVIA 4M1WA 2FE4A 1S1MA 1VDZA 2AWNA 2OLJA 1DO0A 3K9LA 4RFSA 3I61A 5AWFC 1CR2A 4LJ9A 1ZVQA 1VMAA 4ZIRB 4DEYA 2ZVQX 4BLOA 1TPZA 2RMKA 5TB5A 5JECA 2KI5A 1XEWY 1ZP6A 3MJRA 5FTLA 1SVLA 1OB2A 3ICEA 4C3ZA 4CDGA 4L9SA 3SDZA 1U9IC 5SZKB 4A0RA 1KO4A 1YR9A 5A4JA 4LJ6A 5BXQC 3HYTA 1UADA 2RHDA 1EFRA 2IXGA 4EAQA 2ZRJA 4GT1A 4RKFA 2GK7A 4MRRA 1C4OA 2P6UA 4YQFA 4CEHB 1YQTA 4ZI3A 3A37A 4QBIA 5AR1A 1JAHA 5D3MB 5J4KA 3SU8A 1DAMA 1Q44A 3LXXA 3OAAD 1EFRD 4DCVA 3ZD6A 3H4MA 2HT1A 4LHZA 4TYYA 2PT7A 2VP0A 3OEEA 4JLVA 5FOVA 1Z29A 1JXMA 1NKTA 3FMIA 4Q18A 2RGEA 4PO1A 1IN5A 4PAMA 1Q3HA 2WPDD 1P9RA 2H16A 1K8RA 2ZJ2A 3L2OB 1KMHA 5G53C 3FDIA 2HJGA 2J7PD 3GFOA 3ZVLA 4C30A 4MKHA 4D4MA 2D7DA 4C0SA 2JLZA 1FQJA 1E0KA 1P2TA 3B82A 1R0XA 4IVRA 4JKIA 5HTKA 1N0UA 2B7BA 1R4AA 5EUMA 1GIAA 3KJGA 1VYTA 1E9DA 1BMFA 1HUQA 1L8QA 1NBMD 5AJYA 3R8CA 3CPEA 3C4JA 3JZAA 2O0JA 1IM2A 1G7TA 2CK3A 4DRZA 5CLLA 1E2DA 5K8IA 1P7CA 3FKSD 4PO9A 3ZS9A 1BKDR 4ESVA 3CH4B 4HEJA 4EJSC 4LWZA 3JZMA 2HEIA 4EUNA 5F9HA 4G0NA 2NIPA 4I1VA 5JEDA 3U3OA 4X8OA 1TF5A 2VA8A 3G82C 3EG5A 2WSSA 2QRNA 4PZZA 3B13B 4JL5A 3GJ0A 4OHWA 3AVQA 3GLIE 2J7KA 1SXJC 2QBYB 1K6MA 3BE4A 1J8YF 1YR8A 4V0NA 2YNMA 1QDEA 2CNWA 4OQNA 2FPKA 1NSTA 1N6NA 4DDUA 3OFNA 1GITA 3C7KA 4IFEA 5C4MA 2O8CB 1CR0A 4TLBA 3B6EA 4Q48A 5H1YA 2DWQA 4Z54A 4QJ4A 4RSGA 4CEHA 2QUZA 3BFKA 5FR1A 1Z6YA 4WZAE 3QEOA 1A4RA 1BIFA 4EQ6A 1KKMA 1C1YA 2BEKA 1G9XA 2W00A 3Q5DA 2H57A 1S9DA 1UBGA 3VHXA 2XXAA 4P4TA 1Z2AA 3ZIAA 2EWVA 3FYHA 1TUIA 1N3BA 4CEIB 1V5WA 3CUEF 1GKYA 1XP8A 3PUYA 2VHCA 4G01B 2ZJAA 1T3LA 4IEEA 2NPFA 5B58C 3GLGA 4QGGA 1AK2A 2J46A 2ZTSA 2HJVA 2HLDD 4RFSB 3SS8A 1XD8A 2FSFA 5ELXA 5JMTA 2O8DA 1G8PA 2B21A 4Q4JA 5DE3A 4NH0A 2VH5R 2IYRA 3LLUA 1DELA 2F3TA 3BS4A 3CM0A 1OKKA 4B2PA 2ZI9A 1XTKA 4JS0A 4TYQA 5JJLA 3LX8A 2HLDA 3UG6A 1RVDA 2OESA 4A2QA 3B9PA 1W0JA 2YWFA 1CS4C 4KFRA 4QGHA 3RHFA 1J2JA 2W58A 1Z8FA 4BZXA 5B30A 3RS0A 2GVDC 3GJ5A 5CDFE 4H9GA 4LY6A 1P4SA 1IN4A 3TSZA 4HZUA 2VP9A 4PQRA 3PENA 3I62A 3C14C 4KBFA 1OIXA 3THWB 5E95A 3GLFE 4GRAA 4F4IA 2ZS8A 3IIMA 4U02A 4A8JC 4ARZB 2ASEA 1MRNA 4DLWA 1QG2A 5DNYB 1G6OA 4NYJR 4AG5A 2IS2A 1G3UA 2ZITA 3F8TA 3R9IA 2BOVA 4MUAA 2BC9A 4XWOA 2C96A 4Q9KA 1RRPA 2HF9A 5LD2B 3ZVMA 1Z2CA 1IJFA 1AZTA 1QBKC 4C7OB 1WQ1R 1MO4A 4QGFA 3RYTC 3NXSA 3P20A 1M74A 1G1MA 2C9CA 2GESA 1W36B 4QBFA 4R9UC 1R8SA 2BWJA 3NDPA 2QEQA 4Q19A 4EQ6B 4Q4LA 4PAQA 3IO5A 1Q20A 1TF7A 1AIPA 3D31A 4I4LA 2EU8A 2LCFA 4D2IA 2VO1A 2NTYC 1SQ5A 3KFVA 5FUYA 3REGA 2O5VA 1U9IA 1E2HA 3IPXA 1ZAKA 1T0JB 1Z22A 3UWOA 3MWYW 1XJCA 2O0KA 3UANA 3K8YA 1LFDB 1IY1A 3SYNA 3GJ8A 1VIYA 3K9GA 1GRQA 3CX6A 4PPQA 4JVMA 5J4HA 1RE0A 4U00A 1T8TA 2ZUCA 4NYIR 4GMXA 3HU3A 4HUQA 4A8JA 3EXAA 2AFHE 1ELOA 1TU3A 2PH1A 2BJWA 2LWIA 5FOWA 5L3RA 1QF9A 2FWRA 5HKKD 3RC3A 1TX4B 3OIWA 4UJ5A 5TDHA 1S4QA 1OXXK 4LJAA 1KSHA 5EXPA 4JJKA 1GNPA 1DARA 1GDDA 2REBA 1ZU5A 1Q22A 1TNDA 1KO5A 1XXHE 4YDSA 4TYWA 1PLJA 3NH9A 5LBIA 2NO1A 2CCKA 2ZROA 1JR6A 1LTQA 4GSYA 4QHSA 5CYPA 3U44B 1KI8A 2B6HA 4Q00A 3IQXA 1XF9A 2A9KA 1RRFA 4KAXA 2ZE5A 4RD3A 4B43A 3HR8A 3C5CA 5HZHA 5F9FA 3THYB 3JVVA 2X8AA 2PEZA 2XB4A 3I72A 4Q1BA 4OQFA 3ZZTA 1J99A 2B8TA 1KO1A 2CCJA 3ADCA 1KOFA 2XAUA 1KI3A 4P4SB 3V9PA 4ASUD 3UMFA 1FX0B 1G5PA 4W5JA 1QVAA 1Z0AA 2DY1A 3CNNA 3G5UA 1NSFA 4XSHA 1X86B 1KNQA 2ZR7A 4LJYA 3QBTA 4UQOA 3NHBA 5EE0A 3WRXC 1BS1A 1KSJA 2FX3A 5AUOB 1N6OA 5FOSA 4MKGA 5JWOA 5F98A 3IGFA 5TVKA 1NG1A 1DAFA 3H86A 2ATXA 3NTUA 2ZJOA 3BB1A 2ZIAA 3BH7A 5KSPA 4WZBE 1P61B 1LVGA 4FCTA 2FFHA 3IO3A 1EG7A 3CNOA 3WP0A 2ZUDA 4UNNA 3ZD7A 1XJ0A 1DPFA 1COWD 5AUNB 5IK2D 4HLUC 3O8DA 2VRWA 1F60A 2IYZA 1H8ED 5IK2A 4YXWA 1E6CA 1ZMXA 4KHZA 1U8YA 1XJQA 3TSWA 1XEWX 4Q03A 4HAUA 1TEVA 2GF9A 1Q1ZA 4LV5B 1VCNA 1M7GA 5EP2A 1YR7A 4XWKA 2JLQA 1VCMA 4FINA 3LQRA 1Z83A 3QSYA 2GDJA 1OW3B 4HAZA 1KI6B 1QHNA 3M0EA 2R65A 1YU9A 121PA 1T3HA 3GJ4A 3BB3A 3FB4A 1JAIA 4Q01A 3AVVA 4WBSA 1WB9A 3U3KA 1XTSA 1F6BA 2F1JA 4JLKA 5DI9A 2GEUA 2W2XA 4LOAA 5HCIA 1HT1E 1X8LA 3RRZA 3Q7PA 1KTVA 2FSHA 2QMHA 4BFTA 4CEJB 1QHXA 1OH8A 5K8TA 1E9SA 3TLXA 3LLMA 3EIQA 1Q12A 5L8VA 3ZDQA 1NP6A 2G3YA 3VR3A 5DN6D 1IXRC 3OAAA 5J5CA 2FPMA 2ZR0A 1XMJA 4IDNA 3BERA 2QAJA 3OFND 2NO7A 3KJEA 2ZE8A 3QXCA 1RYFA 3GFPA 1CJTC 2UKDA 1Q1QA 3Q7QA 3K0EA 2W6IA 4CRWB 1Z0JA 2P2LA 4OI0A 1TL7C 5FBLB 1E2EA 2PCLA 1FFHA 2QSZA 1ZM9A 4HATA 4PC3A 4JBYA 4WXRA 4Q47A 5KSOA 1ZU4A 1GKUB 2Q9BA 2IEZA 2KSQA 1U94A 3B1ZA 4DLZA 1WA5A 2X2EA 4RCZA 1A2KC 2P5TB 2D2EA 1US8B 2OM2A 4JSTA 4HB4A 3K9HA 2GEVA 1GRNA 3EA0A 3ZIAD 2IX3A 2NO6A 2G0TA 2AFIE 3SHFA 2XTMA 4GDFA 1PV4A 1NBMA 2FU5C 1W46A 4RD2A 1D2NA 2CE7A 1AN0A 2DCUA 1E2GA 3AEZA 4U7DA 1GUAA 2ZRHA 4U5XA 4LC0A 3ZQJA 2UZ3A 2J0VA 4ZKDA 3PUXA 4BWYA 1KK1A 4OI1A 2GCPA 1OV4A 1JALA 2GJSA 2AN9A 1NI3A 3AM1A 1YZTA 4GI7A 1Q0UA 2KBEA 3MLEA 2JLRA 1NNEA 4O2LA 1QHYA 2GAOA 3QF4B 4Q9JA 3GLGE 3ETLA 1KSGA 1AKYA 3CRW1 3OEHD 1E9RA 4A1FA 1OKKD 1VIAA 1M2OB 3QKUA 1ZM7A 3T35A 3T1VA 1JR3D 2MMGA 2NO9A 3K09C 4IKEA 4D0GA 3LWNA 1ETUA 4MUBA 1P2SA 3L0SA 5L3QB 4JVNA 4LYHA 4IHQA 4QXAA 3OE7A 4BUJA 5TY0A 2JDID 1E3MA 2GXQA 1XCPA 1ESNA 3EWAA 2ZRDA 4D25A 1XTIA 2CLCX 2FSGA 2ZU0C 4B71A 5KYKA 1NBME 1YE8A 2FGJA 3Q3JB 5EXTA 1G7RA 1UBCA 1E2LA 4JYBA 1P72A 3EZ2A 2GXAA 3ND9A 5EXSA 1G20E 2G1KA 3VTKA 2YWGA 5DI3A 4EKDA 2WMOB 2YVUA 1DG1G 4LGMA 2RH5A 4LK2A 2Q3FA 2G83A 4UNSA 4Q9HA 2VHQA 2WJVA 4BLQA 2ZJ5A 3THXA 3T34A 3QVVA 2R9VA 1KYIA 2ZAOA 1ZM2A 4B3XA 2D06A 4ILEA 4D4LA 3SYLA 1UBFA 2ZS9A 3HDTA 5FTJA 1S3SA 3TBKA 3BORA 1F48A 1RZ3A 2WJJA 1O87A 5KNDA 4LHXA 1WDTA 2F1HA 3WYFA 4QG7A 2BCJQ 2A7QA 4A4DA 3UPUA 2IXEA 1IXSB 5FI1B 5FR2A 4L8GA 2GBLC 4BFYA 4DB4A 3B7GA 3KX2A 5FUVA 1JQLB 2ZUBA 2F43B 2I3BA 1XEFA 1EFUA 3DOFA 1HQCA 4DSTA 1II9A 5BN5A 5JLJA 3W5IA 1M34E 4WVFA 1SKQA 2BMJA 4DIEA 4TMWA 4Z1MA 5DYGA 1E9EA 3DOEA 5FOXA 4CZ2A 4UNRA 1S96A 2GTPA 3HJNA 3QENA 1Y3AA 3IEVA 3VR5A 1OT3A 1J8MF 1P3JA 3RS4A 4A82A 2WM9B 4DDWA 1XTQA 2H92A 3GLHB 1YZGA 1G8HA 3WYAA 4R98A 2HYDA 3VU9B 3GPLA 1NVVR 2JASA 4TMVA 2WIAA 4GPTA 1ZRHA 4TN1A 2GRJA 3C8UA 2H1LA 4RZXA 5HKKA 5DI3B 2Q3HA 3ND8A 1XPUA 3K0AB 4GP6A 4JKYA 4M1KA 3SJZA 3S1AB 1QHSA 1SXJE 3PQCA 2AR7A 3NBZC 2WKRA 2V1UA 1KJZA 2WIBA 1ZYUA 3RRYA 3FKQA 4OHXA 2JJ1A 4RZ3A 1MO6A 3GCGA 1QHGA 1JJVA 1OFHA 4HAYA 4BASA 3VAAA 2VBCA 1G7SA 2GZDA 2CE2X 2ZI6A 3QIAA 3W6OA 1ZJ6A 3AP1A 3FHTA 3A36A 1P2VA 2ZRMA 2PZEA 4KLZA 4PANA 2QL6A 1N5LA 5BN3A 5J4VA 5JI2E 2ZANA 5FI0B 1MT0A 2GKSA 2XOKD 5BW8A 5KSYA 1E9BA 1E2IA 2CCGA 3ASYA 5IDVA 3UATA 2Q9CA 3B85A 4DT1A 5KO2A 5GJBA 1IN7A 4TLAA 2PT5A 1G17A 1VYUA 3K0FA 4ZI2A 3N5CA 1IN8A 2B7CA 5DHFA 1AS2A 1HH4A 1HY3A 3CWQA 1KJWA 3T5DA 4PPNA 1Z47A 2HXYA 5H68A 2F1RA 3WMEA 1KK2A 4KODA 2ZYUX 3MFYA 1NIJA 2JGNA 3DHWC 4R2IA 4W5HA 4Q5IA 3VR4A 4JSYA 3LBHA 4MDFA 1W36C 2D74A 2ZRGA 2ERYA 1SVWA 2PZFA 1WMSA 5DYIA 1NN5A 1E2NA 1W4BA 3C41J 4TLDA 4B2IA 4KLNA 3X1WA 3EZ9A 1RKBA 3NWJA 2ZPTX 3X1YA 4LCBA 5AUQA 1KI2A 3NDBB 2OBMA 1ZNWA 4QNRA 3SHWA 4V0OA 1H8HD 3FMOB 4JT4A 4OHZA 4YMUA 3FMPB 2DB3A 3Q72A 4WOPA 3I1FA 4GOXA 5EP3A 3LX5A 2CL7X 4TTPA 1E96A 3QXHA 4A15A 1BMFD 3PJRA 4AG6A 1P9WA 3QKRA 3R8FA 5KDDA 2AD5A 1ZCAA 1OF1A 1PLKA 4TZ6A 3P1JA 4JT2A 3NKVA 2B92A 3WMGA 4DDTA 2PX0A 4FMDF 2GXUA 1OJLA 1DS6A 4XJXA 5KOYA 1OXUA 1YJ5A 3LVRE 3LV8A 3UK6A 4CYMA 4D80A 1I4LD 1FUKA 1YRBA 2FNAA 2QPAA 3RSLA 2VLIA 4DSNA 1G3QA 3GJ7A 1KHTA 2Z0MA 3L82B 2I1QA 4PTLA 1WBDA 1JB1A 1ODFA 1WE2A 4JLJA 3W3ZB 4BFXA 1DAGA 4D82A 5LD2C 2REXB 3M6AA 2WSSD 1FPMA 1FP7A 1Z63A 3MD0A 1D2MA 4E22A 4EPTA 1FOEB 3I4LA 4B44A 4DLVA 1EFTA 3ECCA 5L3VA 3HYRA 4FWTA 2ZSDA 4C9BA 2QTVB 4XTCS 3EWSA 3LVQE 3B1XA 2WTUA 4RKEA 1E9AA 3TR5A 1IY0A 5IRCD 1OFUX 4EFNA 4LYJA 5BN4A 1TMKA 2WMNB 2O8BB 5CJPA 1KY2A 2FOLA 2ZXUA 1CRPA 1L4YA 2QT1A 3KUCA 4J0QA 4XSGA 3QOFA 2NZ8A 2BDTA 4BFVA 4R71A 2ORWA 2H7VA 3KKNA 3X1DA 1G8GA 4NE2A 2AK2A 2G0NA 2GXSA 1S0UA 2Y8EA 4IDOA 4KSBA 4LC1A 4Q02A 5JBQA 2OCAA 1W4RA 1EWRA 1YZNA 3VU9A 3AKCA 3KKOA 1GTVA 3GLHA 4NYIQ 4BQSA 5BWMA 3RRMA 3AGPA 1F5NA 3WHKA 3KQLA 4ACBA 5HCNA 1YRAA 4UXJA 2J0UA 2W6ID 2LKCA 1JXOA 2CLDX 3KKPA 5FBQB 2OFOA 3B8HA 1NVXQ 2ZRLA 5EE5B 2V6IA 1E99A 3WRYC 4ON9A 2E87A 3WNCA 1DAIA 4NP6A 3ICQB 4UKDA 2A3RA 2CMKA 4HB3A 4Q66C 4WZ6A 5KSZA 1R6BX 4WA7A 3BFXA 4CF7A 4V0KA 1VG9B 4C2TA 1GWNA 2O8EA 3EARA 1II8B 2KJQA 2N46A 3FHOA 2VP2A 5LB4A 3LBIA 1G291 3U3RA 4TWZA 1LW7A 1JEDA 2WWIA 1NY5A 2C5LA 1Q1BA 3AVUA 3HU2A 1OXTA 3QPWA 3ZGXA 1CBUA 2C9YA 2ORIA 3VKHA 1LF5A 4BZPA 3P26A 5C1BA 3CWZA 4BLRA 3A4LA 4XWAA 2P5SA 1S2MA 4HZUB 2VTKA 4N0DA 2CK3D 2CHVA 2QROA 3RS7A 4BECA 4DHEA 4AKIA 2ANCA 2ECKA 4ITRC 2AKAB 4DIDA 4HB0A 1G3RA 3MSXA 2VF8A 4MGYR 4URZR 2QTHA 3QG1A 4I1UA 3C15C 2OCPA 2FFQA 1TF2A 2OAP1 2PEYA 2QPTA 3OE7D 2JA1A 3IHWA 4US0R 2A5GA 1U90A 3SZRA 1ZBDA 2CHGA 3FOZA 2G77B 2O8DB 5C18A 3PIRA 5P21A 4TYNA 1L2TA 1W47A 4RD1A 3GD7A 2QU8A 2V7QA 5FUXA 5FPTA 2IXFA 2C98A 1QHIA 2AHOA 4TQAA 1OHHA 5AJWA 2IUUA 2ZAMA 2RB4A 3VHLB 4PC6A 4AK9A 2P67A 4LSGA 4PQYA 3N70A 1EX6A 4KVGA 3A1UA 3GP8A 2ZRFA 1SVSA 3SR0A 2FZLA 3KXKA 1NMZA 3IEUA 3LD9A 2Z83A 1VECA 2ZJZA 4A8JB 2PZGA 4AY2A 2WJIA 1OHHD 4M53A 1KNXA 1DBSA 5C4GB 4DDVA 3BJIC 5K8UA 3U6KA 4B76A 3HPQA 4AWXA 2CLSA 3RS2A 4AYXA 2HV8A 4ESHA 2QM8A 4NYMQ 5CK5A 4IVPA 1GKIA 3I8SA 3W8RA 4FMCB 4DWJA 3ZZUA 2XNDA 3CW2A 2BKEA 2P65A 4FWIB 1R0ZA 2JLVA 1NMXA 2WPDA 3WNBA 4QJ3A 5DIFA 4PSKA 3U6BA 2VHUA 3WY9A 1RRGA 4D81A 3EPLA 2JLUA 1DAEA 1N5KA 1U8ZA 3CZQA 5GVRA 3KKMA 3V4FA 5FTNA 4B32A 1CTQA 2ZRAA 3Q5EA 1FP6A 4LJ7A 4ZDIA 3AP2A 3UG7A 4L16A 5G40A 3EZ7A 4B6FA 2RGNC 2X2FA 1MO3A 3TMKA 2IYTA 2JCSA 1LS6A 2V55B 1SZPA 2WJGA 3QE0A 3DKVA 5KTYA 4BGDA 5JJIA 3PFIA 4GP7A 3F5FA 5CJ2A 2MMCA 1W2GA 2Q9AA 1N6RA 2IBMA 2JIZD 3PEVA 2RGXA 1F2TA 3D7MA 2BBWA 3K70B 3BXZA 3P4XA 1SVOA 3K0SA 1R5OA 4MA4A 4G5GA 1CR4A 1OH6A 4C0QC 1ZINA 2O8BA 4RY2A 4TLEA 4H1UA 5F2EA 2OV2A 2GJKA 4D26A 3IILA 2F7SA 2OE2A 1KDOA 2JIZA 1X8JA 1KMHB 1W44A 4MRVA 2CNWD 2OCBA 3EIEA 4JLBA 4TSFD 4KFSA 2R62A 2REOA 4XVUA 5A0FA 4LBWA 2AD1A 4F7WA 1E2MA 5KU1A 4QHTA 2OBLA 3SE0A 1AKEA 3HPRA 1KGDA 4AKGA 4RZUA 4ZDJA 1IJEA 1EK0A 2QM7A 1N6PA 4JJZA 2F55A 4IDQA 1GL7A 1I2MA 4NU0A 2JAQA 1HV8A 4II7A 4URXR 4I1OA 4KFUA 4WXPA 3NBXX 3OHMA 2G6BA 3I8XA 4FXPA 4BFSA 4PFSA 2GJ9A 3CX8A 3EC2A 1EFCA 1CKEA 1DVRA 1LS1A 1XD2A 3H1TA 1AS0A 1NJGA 2XZPA 1ZW6A 2JLWA 1AGPA 4BRUA 4ZO4A 1QVRA 4C2UA 4PX9A 1I4TD 3DO6A 1FUUA 2ZREA 2AXPA 3U3MA 2OUKA 2Q0HA 3RNLA 1N0WA 4C0JA 3A6PC 4BLPA 4PZLA 1FX0A 1E2PA 1TQ6A 5CIQA 5CM8B 5JS8A 2G1JA 3T1TA 3ZJYA 4AURA 2P6RA 2QAGA 2D7CA 1Z06A 2EW1A 1JR3E 1UDXA 2ZRNA 2LKDA 3I5YA 2OEPA 4NCHA 2KBFA 1Y63A 2O8EB 1HT2E 1UKZA 3GEEA 2EFCB 1Z07A 4F93B 4I99A 2PMKA 1KDPA 4MYHA 3CH5A 3L0OA 1XD9A 2XOKA 1Z6AA 3RDPA 1E2KA 2OLKA 1KMQA 3KB1A 4OK3A 5JJKA 3TSOA 1MR3F 4MKIA 4DLRA 3GJ6A 3QEJA 3A1SA 2VP5A 2F6RA 1X1RA 2ZEJA 4Z8XA 4B73A 2HT6A 3ONWA 3B5JA 1EXMA 5TV2A 2AKYA 4C0HA 2GEDA 2WJYA 4OJKA 2ZRKA 4KYIB 3A1TA 4AI6A 2GJAA 4QOSA 3F3YA 4LX0A 3ADKA 3KKQA 4O2RA 2XTZA 4M4SA 4S2EA 2H8KA 1BO6A 3FMFA 1T4GA 2FH5B 4FD2A 4G5SA 3FE2A 5DO9A 2F9LA 3NC1C 3TQCA 3MUFA 2YYZA 4JYCA 3SN6A 1SHZA 4Q21A 1XZPA 1MO5A 1G4UR 2C78A 1YR6A 5EP1A 4DCSA 2EWWA 2YINC 5C46F 2WV9A 3QXXA 3K0AA 5EE3A 1G3MA 4XD7D 1H65A 4ABYA 1WBBA 5CYOA 2GVZC 4N1AA 5FTMA 2IL1A 4H1VA 3GLHE 4BEBA 1QG4A 4B74A 2OAQ1 3KFXA 2ZI5A 3TGPA 3SQWA 2JATA 3TVDA 2ZJ8A 4XVRA 3SBEA 4QC2A 1R0WA 2FEOA 2V1XA 5L3SB 4P4UA 5C2JB 1VTKA 3ZS8A 4BFZA 2XSZA 2D3WA 3EA5A 1H8EA 2DFNA 3K1JA 2PCJA 3NBFA 5EP4A 4YXWD 2IF0A 3AKEA 4PHTA 2KWIA 4HB2A 5CITA 1XRJA 1J7KA 3AB3A 3QXSA 2BBSA 3Q85A 1X1SA 2R2AA 3RANA 3PEUA 3SOPA 1KK0A 5KPDA 1SXJD 3DMDA 1OYYA 4B3CA 1V43A 3R9WA 2IC5A 3NBYC 3OF5A 1VHTA 4M21A 4JLOA 2OFXA 3HP1A 3T5GA 2DWPA 2PJZA 4DLSA 1N6IA 1W0JD 2NMVA 4OBEA 1ZM4A 3N2EA 2GAAA 4P4SA 2W0MA 3AF3A 3QBVA 1P2UA 1OXVA 2YWHA 2ZVPX 3MJHA 1KI7A 1LF0A 3BC1A 4P33A 5FL7D 1KDTA 5J40A 2JLSA 2PBRA 4JLNA 3LXRA 1P9NA 4E03A 3THYA 1N2CE 1NVWQ 1CIPA 2BMFA 2H5EA 3VFDA 4US1R 2BV3A 3RABA 4P3YA 2WICA 5EZ6B 2QENA 1J70A 1E1QD 2X1VA 1Z0DA 2J41A 2WKPA 4AKHA 1D9ZA 3X1ZA 3ZQ6A 4NONA 4PO8A 5JI3E 2EFEB 2A2ZA 2WWHA 4O0MA 3VR2A 2R8RA 4PSVA 4C0KA 2BCGY 1CJUC 4A92A 4DCUA 2VEDA 2W83A 1F3OA 2FJUA 5SZIA 4DZZA 1ZIOA 1W36D 5HPYB 2IUTA 3K70C 3O8BA 1PUJA 1XEXB 4C4PA 2DYKA 4POAA 5JWRA 3GLGB 3QF4A 3CRVA 4MYUA 2J87A 1OH5A 5CK4A 1ZC4A 2OFWA 1XFAA 3EW9A 5EJEA 1DG3A 2OILA 1JBKA 2WZQA 3FFBA 4TT3A 4PC7A 2HYIC 2RGCA 1NRJB 4TMKA 1HE8B 1D5CA 2R6AA 4HLQB 4DLTA 4F4JA 4KVAA 2IS4A 5SZHB 2FDCA 3FGNA 3WHLA 5JEEA 3M4YA 4MITA 5BYKA 2A5YB 4ACAA 1W7AA 1AS3A 2QAGB 2VP4A 4G1UC 4S35A 4TT3D 3ZVRA 2O8CA 1CXZA 4M1TA 4URUR 1W5SA 4D0NA 2WKQA 2A78A 4PSAA 1GL9B 4JL6A 3O8RA 1US8A 2H17A 1KZGB 621PA 2CHQA 2QBYA 3AVTA 4KV9A 3JVUA 3A1WA 3TUIC 4X8MA 1G16A 1VG1A 4GMDA 2VQSA 1ZUNB 3M1IA 2FF7A 1E32A 3CR8A 3PUZA 3VNUA 2ZRCA 1FTSA 5FPSA 4LHVA 4HUTA 3U7GA 4LHYA 2BMDA 3E70C 3U4QA 3CIOA 2WAXA 4P31A 3GEIA 2ZE6A 1U0LA 2X19A 2C2HA 1Z6XA 4C7OA 4K8OA 3PR1A 2OT3B 3FKSA 3P32A 4EFMA 1TUEA 1X3SA 3W8NA 5G41A 3OIYA 3KDSE 5J47A 1TEXA 4NL4H 4A6PA 1RRCA 1JQJC 4HLDA 3THXB 4CIDA 2Z4SA 4YMWA 3DL0A 1WXQA 2XEXA 1WRBA 1G5TA 2RKOA 4A9AA 1G41A 4EJSB 1T6NA 1ZUIA 5FBWB 4Q7KA 5DH9A 3LQQA 4LZZA 4I1SA 4V0MA 5EE9A 2MSEB 3P4YA 1G5RA 2VHJA 2IYXA 4JVSB 4L9WA 4RD0A 1QRAA 2W6JA 2Z5FA 4DBLC 3TAHA 4MGZR 1N0VC 4IXNA 4UJ3A 1PUIA 3GQBA 3LAWA 2QGNA 1R2QA 1FMJA 1F2TB 3HU1A 4RZ2A 4OK5A 2WSMA 4B2LA 5HE9A 1M8PA 4PPGA 5B2ZA 1VCOA 4Z1MD 4B3GA 4Z8YA 4NCNA 2GF0A 4B3BA 3PG5A 4GFDA 1FNNA 2EFGA 4GNKA 5JZVA 4QFMA 3RRNA 3U7HB 2FSIA 4LUCA 4DUGA 3T15A 2WWYA 4E5UA 2RAPA 2RCNA 3I73A 4JLPA 4B48A 2YHSA 3U4QB 4BFWA 3SI7A 1CEEA 4PC2A 1IBRA 4EPRA 1KAOA 2R6FA 1LNZA 2NO0A 4G5RA 4KI0A 4MQBA 2F43A 4QM7A 2WOOA 1KJYA 3OEHA 1BYIA 3MWLA 2N42A 2HCJB 2DHRA 3QF7A 1LY1A 1HTWA 2QP9X 2BEJA 1G4AE 4V0ME 3AF1A 4KITB 2VHTA 5KPJA 1CRQA 4LDJA 2PJRA 3AVPA 4I81A 4D4KA 1R10A 2BHRA 2J5XA 2PMDA 3B60A 1TAGA 1D8TA 2VSFA 1KO8A 2DWOA 3DMNA 1FMLA 1AJEA 2XTNA 1NIPA 4HAVA 2FN4A 1N6LA 5KHOC 1YZKA 2QY9A 5E7JA 4IOJA 4MYTA 4OHYA 1RIFA 1CJVC 1T9HA 1UM8A 1DAHA 3UWKA 4HLCA 2MSDB 3K09A 5SZJA 4P32A 5CB8A 1FQKA 1TADA 4C0BA 1KIMA 1C9KA 4FW9A 4K81B 1UDWA 4PAOA 1HE1C 3PUWA 2QSYA 5J4LA 4OI4A 3T12A 1W4AA 1UF9A 3OZXA 5FH9A 3CONA 1N6HA 3AVWA 1PVOA 4Q4JB 3WBJA 1HEIA 1PJRA 1O3YA 3NG1A 3TR0A 3W5JA 2FG5A 4RD4A 4M1OA 4OQXA 2FMXA 2GNOA 3DZDA 1IQPA 4D6PA 4JVLA 4L15A 2GILA 1COWA 3IHLA 2HDNB 2WWXA 1X8KA 2VYFA 5CLQA 5GJCA 1NVUQ 1I2DA 1ZUHA 2J9RA 1NY6A 3DPUA 1KI4A 4KSCA 2XNSA 3I32A 4HUQB 3S1AA 3I5XA 4UXHA 1NLFA 4KCGA 1E69A 5EXXA 3BH6A 3KXLA 3L0IB 1KK3A 1XDBA 4F4CA 3RWMB 3MMPA 2G88A 4MRPA 4TTRA 4Q1AA 2HF8A 4ZCMA 4IOLA 4W7SA 3AVYA 1U0JA 4LHWA 5JRZA 4TL8A 4BLTA 1DEKA 1EFHA 2QMUA 2QGZA 2J59A 1E9FA 4EDHA 2Z6VA 5DSZA 3E5HA 4M0LA 1FZQA 2ONKA 1GRRA 2EYUA 3N2IA 4M9XA 2QN6A 1NKSA 1R8QA 1T8UA 4QRHA 1NL3A 4CVNA 4Q7JB 1U99A 2A5JA 2AL7A 3TUJC 3VR1A 4BPBA 8OHMA 1X6VA 3EC1A 3EIHA 1SGWA 1AM4D 1I4DD 2VSOA 3AQ4A 1P62B 2F3RA 3W3AA 4DC9A 4TL7A 2FA9A 3L8YA 5B64A 1UAAA 3X2SA 4X8HA 4DCTA 4IDPA 1A5TA 1U81A 4GZMA 2J0QA 4A2WA 2ZSBA 2ZM5A 1RYHA 1IXZA 1G6HA 5FL7A 5J4YA 1D9XA 1MRSA 4G3XA 1GM5A 4DB2A 1SKYB 4GZLA 1E2QA 4Z51A 3QPVA 4TMTA 3ZYCA 2RGBA 3REFA 3WBKA 1XNJA 1B0UA 2BIFA 3IBGA 4KU4A 5DHAA 4W9MC 2QP4A 4UNPA 4HI0E 3R7WA 3B9QA 4OK6A 3IKJA 2BM1A 3CRMA 2J0SA 4PC1A 5GJVC 4QJ5A 2W2TA 1SVKA 4ARZA 4CT5A 1CP2A 3CNLA 3ZZ0A 4KYUA 1KI6A 2K5UA 4E09A 1RJ9A 3SEAA 4HDCA 5BYJA 2OCYC 3CB4A 1GSIA 4JL8A 1RFLA 3DM9B 4LYAA 1IOZA 1OYWA 2Q6TA 2ZI3A 3QKTA 2IYVA 3QUSA 2H18A 3D8BA 3RWOA 1S9HA 4LV8B 1Z3IX 4MKFA 1PLLA 5GJWC 1UPTA 4EPVA 4Q7MB 2N1BA 5L3QA 1ZC3A 4BLSA 1P60A 3AF2A 2BBTA 2JJ2A 3BGWA 5GVSA 1H8HA 1ZNZA 2JEOA 3E2IA 1GZSA 1E0AA 4IVQA 1HA3A 4NCIA 4RD6A 4AKEA 1Z6TA 2ZRIA 3R7WB 5E4FA 5FFMA 1R5NA 2WHXA 3SQXA 2VIIA 2JJ2D 1KSFX 3HWSA 3CX7A 1BOFA 1M7BA 3QKSB 4TLCA 3TW4A 1N5IA 3LW7A 5KDOA 1W48A 5KNCA 2ZSAA 2RGGA 3R20A 3D6TB 2QORA 1II0A 4NKRA 4HDOB 2YZ2A 3ASZA 4R2HA 2UZIR 4HSEA 2ODNA 2Z4RA 1ZNYA 1YZUA 2NQ2C 1GP2A 1AGRA 1Q21A 3CKLA 1XX6A 2IWRA 3LFUA 2ZE7A 5JHGB 3B1VA 4US2R 4ZIRA 3DEFA 1E1QA 2P6NA 2PL3A 3WYGA 1AA9A 1WP9A 4WAUA 5TXGA 1E79D 4OI2A 3TAUA 1P73A 4IW3B 4CW7A 2IS6A 3Q8XB 2ZI4A 1ZD1A 2IYQA 2YOGA 2E1RA 4DSUA 4JBWA 3WMFA 4A0FA 3VNVA 2SHKA 1II8A 1YZLA 3VMFA 1MKYA 3TK1A 3OESA 4OHVA 1WCV1 4ZDWA 3TKLA 3EZFA 3W90A 1ZM3A 1IONA 2W2VA 3W34A 4L4UA 2O0HA 1N6KA 1P6XA 1VCIA 1XTJA 4FN5A 3AVOA 4PHFA 4EPYA 4V02A 4DT1B 1UEIA 3TW8B 3PEWA 3MG9A 5CDFA 3SJCA 1ESMA 3DDCA 4CEJA 3QPUA 2E9SA 5IHPA 1IN6A 4QHYA 1DTSA 2D2FA 4F38A 2J45A 3EPJA 3QNUA 1N25A 2ODBA 2YV5A 2EVWX 2CL6X 2FZ4A 3PVSA 4G5QA 5DN6A 4CT4B 2JLXA 1XPRA 1BH2A 4D4JA 4URWR 4OKSA 1W49A 3THWA 1Z0FA 1CR1A 2XNDD 1SKYE 2NOAA 4LPSA 1UEJA 1R7RA 4QBHA 1DO2A 2OG2A 2WAYA 4FCWA 3GEHA 3K9NA 1XTRA 5HR5A 3R9XA 5E3HA 2ZJYA 2ZR9A 4YDHB 3T1OA 2EFDB 3UMRA 4NDZA 3E1SA 2IEYA 2ONJA 3UMSA 4M1MA 3FPAA 1UBEA 1U98A 2QE7D 5LDDC 4XOIA 3OIUA 1ZCBA 2RGNA 4LPKA 4OQMA 2ZI7A 4NYJQ 3CO5A 2AXNA 2HCBA 2VP6A 3NEJA 3KTAA 3MRSA 4LJ4A 4PXAA 3RAPR 4M2LA 4LBYA 1K5DA 5AJVB 4BFUA 4TMZA 1NMYA 2V54A 1JPNA 5D3MA 5KUTA 2JJ1D 5JCPA 3LA6A 4RCYA 5F3WB 4XVQA 2IS1A 5IT5A 1VHLA 3AUYA 3QG5A 2GHIA 2PLFA 3AP3A 4B75A 4V0LA 2R6DA 4TL6A 1KY3A 4MGIR 2D4HA 2IA5A 4BZQA 1U0HC 3LY5A 3MAAC 5AK0A 4KFTA 3C5HA 2XXAB 3QKRB 2XZOA 3TRFA 2OSBA 4JLMA 3SNHA 4QNMA 1T3SA 3QVUA 2BKUA 6Q21A 1YZQA 1KAGA 4TTQA 3CR7A 3AVXA 1EWQA 2EFHB 2XB2A 5KDLA 1KO7A 1L7VC 3X1XA 2O8FB 1D2EA 2ZSFA 5EE1A 4RJLA 3MWJA 2JDIA 3PCRB 4TSFA 1EX7A 1E4YA 4B34A 4AYWA 1UKEA 5K8LA 3IBYA 3W9YA 3TH5A 2R44A 2ZRBA 1K5GA 2C9OA 3U3JA 3LH5A 1DADA 4FI3C 1NJFA 3BBPA 4K46A 4D0LB 5UKDA 3T1QA 2VSXA 2JJ8A 4DUGD 3UKDA 3CZPA 2KB0A 1E2JA 1Q1EA 4Q9LA 2BVNA 3KJIA 3ADBA 4M22A 4NPHA 4A0HA 2QAGC 3RC8A 2A30A 1RJ9B 3CLVA 5E7MA 1F2UA 1MOZA 4R7ZA 3LRPA 3PV0A 5G3YA 5TMPA 2C04A 4HDQB 1E4VA 3GLIA 3NIBA 1NN3A 1ZIPA 421PA 4IOKA 3O8CA 1RW4A 4MRSA 3KQNA 2NPIA 2YJTD 3SC3A 4CEIA 4JMPA 4ERNA 4NHOA 3B78A 1SXJA 1A1VA 2OXCA 2F9MA 221PA 2CEAA 4Q1CA 4LJ8A 2B8WA 1YKSA 4LRWA 3EASA 1FNMA 2GCOA 4JBXA 5CB6A 4RVCA 5G3ZA 3KXIA 4AC9A 3GLFB 3WNDA 2C77A 3GMTA 5EZ5A 1XMVA
chains in the Genus database with same CATH superfamily
1ILWA 1J0EA 1FDOA 1DIRA 3CH6A 2G36A 2VS1A 5FA6A 5CB4F 3G79A 1L5HB 1LDYA 1OFTA 1NLMA 3LX6A 1S2LA 3HCPA 3L8ZA 1DAKA 2GCNA 1NPDA 1VSVA 4O25A 4XD2A 3IIJA 3FVTA 2IYSA 5ALTA 2ODAA 3ZK9A 3HC7A 2WE7A 4KE6A 2OTCA 4HNUA 3FYDA 3MT8A 4YMHA 1NVVQ 1XU4A 1C29B 1PFWA 3GNLA 3O47A 4BTLA 2P2SA 3NFYA 1ACLA 2RGYA 3FYCA 1K08A 1M7HA 2MSWA 3QU7A 1CIJA 1L5HA 5EINA 2X2PA 3KZ1E 3QEMA 2G4VA 5EOVA 5GADl 1NE7A 2RHBA 3BWBA 4V0SA 1CUGA 3G3EA 4HYYA 1ABEA 3ST7A 5IT9A 3RYHA 5CD9A 1DE0A 4JFRA 1HL3A 1JDPA 4I55A 5KX5B 3GJ3A 2I1VB 3LBFA 4MX8A 4E13A 3ECAA 1VPEA 4Z7NB 1VYVA 1XKTA 3IDAA 2J0UB 3EDCA 3A06A 3NLLA 2QLNA 4OYHA 4WACA 4N3NA 1TQDA 3GOQA 1W85B 4DWOA 2HDHA 3OQOA 1LV8A 3USCS 1KRHA 1OX4B 3FJOA 4FUQA 4BQPA 1J56A 4QGAA 3GJTA 4DCNA 1E3WB 5JAZA 1SULA 1WKVA 1M2EA 2CYBA 2ZYWX 1SCQA 1SB8A 2GBPA 2GETA 3DUWA 2RI0A 3TTWA 4XD7A 3PXGA 4I5IA 3RU7A 4URVR 1E77A 2EP7A 1KZ1A 2HRDA 1IHPA 3D4IA 3AO0B 3IEXA 2V6JA 3BWYA 1LDGA 2QP3A 4KOAA 1O0BA 5CA1A 1HQYE 3E9ZA 2AS0A 2FEWB 4M9ZA 4MR7B 3DKPA 1YOVA 4MHSA 2FPLA 4ZCSA 2CVZA 4O3MA 3V80A 3CPHA 4HNAB 1ZD8A 5BW6B 3WK9A 2TMKA 5LBTA 2DFLA 3ON5A 2AK3A 1JEJA 5B6JA 3NVAA 2CJWA 3L4SO 3OQ6A 3W4IA 1A9ZA 5F3RA 1Z4JA 3C3KA 3WRXA 4K6KA 2FEMA 1CUDA 1N1EA 1G3IA 2XH8A 3M89A 1KKLA 3OZWA 2I54A 1P75A 3N2KA 4URYR 3VR6A 1SG6A 1UJMA 5BN1A 5HQ3A 1ZMTA 1MF7A 3DWGA 5CVJA 1HDIA 3D3NA 3CSSA 4B3HA 1W34A 1A82A 1QPZA 2YVQA 2WUEA 3P27A 2GA8A 3GL9A 3HBNA 2NVWA 3B8EA 2EZTA 4EEXA 1UQTA 3NVDA 1REQB 3TG8A 1L5ZA 3THOA 1JQKA 2WYUA 3DUFB 1RZRD 1N9KA 4OXNA 4CGZA 4F91B 1T2CA 2H5JA 5EPOA 1BXZA 1H2HA 1U7TA 2W6ZA 5AJZA 4J2TA 3W6NA 5K99A 4CLEA 2A5FA 3I05A 3P94A 1ZK4A 3SDSA 3ADPA 3ZN2A 1F6DA 4BO8A 4IDHA 3RTCA 2XITA 5CHYA 5HQTA 4RGVA 1A9PA 1PR6A 4F12A 2OXTA 3LUFA 4DPKA 1Q0SA 5K0CA 3A1CA 2VT2A 4DL9A 1PWXA 1ZL2A 2ZTVA 1WXHA 1PW5A 2OORC 3U9LA 4ER3A 3P9XA 2P6PA 3ZLJA 4QOFA 3CEPB 2XQJA 2OG1A 1CY0A 1WUJS 2WJHA 3R09A 4IIHA 3G2JA 4AICA 2O2XA 3GDOA 4MVJI 1L4NA 3OM0A 4OREX 1ZIXA 3HO1A 4BRWA 2Y99A 3H2YA 4BLUA 4TMXA 5H0IA 3AW9A 3WGTA 2QYSA 2HJSA 3NYWA 3Q41A 4MP8A 4BTEA 4A6EA 3OQHA 4GXQA 5IN5A 1TZMA 4WCFB 4AUNA 1A2OA 4JX8A 1YB4A 3W5HA 4LTNA 1TYCA 3KOWA 3M3DA 2O9JA 1GNRA 4J0DA 3E61A 5D1HA 2XBMA 4R1QA 1ZUD1 1DCFA 1L4UA 2CDRA 1MABB 1YDFA 3T61A 4NENB 4A16A 2ZAYA 5M7EA 1P5ZB 4DR2B 3ZYZA 2Q0SA 1YB1A 2J32A 4F5ZA 1IOVA 1T91A 3D3QA 3E9DA 4DLYA 5BSGA 5AW0A 1CEXA 4X8LA 4ER7A 5L4LA 4M88A 3TRHA 3ODGA 5A02A 1DEAA 3Q9LA 3OPXA 3OEED 3WAKA 3O3MB 2ZUEA 1SHUX 1UZMA 4L3WA 5BWBA 2E89A 3I5MA 4NBSA 4Y6GB 3EJ6A 1T5HX 5FBVB 1R4ZA 4BNFA 1D4ZA 1H6CA 2A59A 3A32A 3H9JA 4FMDB 4PGGA 1JIXA 3WQSB 2P3SA 3ZCVA 1JFRA 3R5XA 2HUNA 4Q1FA 2GD0A 4WGGA 2EYQA 3C1OA 4LC9A 3M1LA 4AYTA 1IY8A 2FMFA 4R2XA 1C4KA 2VYCA 3U5ZB 1N2CA 3KLOA 2IELA 1T0UA 2C8VA 2YJ4A 4H0NA 2OGTA 2GO1A 4WTOA 3HV0A 1ZN8A 3LIIA 4KQJA 1RYZA 3ZKWB 1LDNA 3TE6A 2ZJ7A 4YMTA 1E79A 4NOKA 1JNYA 4P58A 5A5GA 2CXXA 4BIIA 1ZNXA 5KX5A 2BE9A 2AJLI 3NATA 4OH1A 1G8KA 3OLYA 1Q7TA 3M1YA 3UHFA 5JFGA 2FWJA 4S2UA 2HMAA 4RVGA 1GNQA 3LOUA 3NUQA 4Y0VA 4BB9A 1C81A 3NH6A 2DPXA 1OFIA 5FNVA 4BV3A 5JXWA 3NC0C 4IF6A 5DRTA 3LNCA 1OXKB 1K88A 2FCAA 1L7XA 3PFBA 3RD5A 1CZOA 2BKVA 3CTPA 3QBDA 3PR3A 2AUNA 3DXXA 1TQ8A 4B3DA 3HK2A 1GAQA 5D5QA 2BCEA 1RQXA 4Q4HB 1F8UA 3IAHA 3O9VA 1T0HB 1X7WA 3GIDA 2ZULA 1EHCA 3BXGA 4Q1VA 4Y9SA 3A8TA 3RBAA 2A0UA 2ASVA 1TKAA 4OSOA 1P5HA 4HJRA 1KYXA 1XT6A 5IZCA 2C1XA 2JZOA 1RXIA 1VLHA 2HJ9A 3SYKA 3MLAA 1R5BA 2XJ4A 5ERXA 4V3CA 3VR2D 3C6YA 3SZUA 1BJRE 3V42A 1W5TA 3I12A 4NJEB 3E35A 1NW7A 2A9PA 3G7UA 1XD2B 4ADSG 4NIMA 1TKBA 2DBYA 3QKSA 1NLZA 3AR5A 4D9CA 1QIHA 4DDKA 3WGJA 2Y3IA 3IRUA 3P4UA 4CLHA 4JLAA 2L0XA 4IX9A 4PAWA 4JC4A 1T9BA 1J49A 2AJDA 1CRLA 1M6NA 1ZD4A 3MTQA 4GLFA 4AJHA 1P2FA 3L1IA 1VJ0A 3KQOA 2H0RA 3CVVA 3FTEA 1ZRMA 1MGPA 1OFUA 2O3TA 3P0IA 2GTHA 4NVRA 1N36B 1F2UB 3M3PA 1MHPA 4BXOA 1B6GA 1UBKS 2PX8A 3LPNA 3ZY6A 4E70A 2IEDA 3CZ5A 4HJXA 1QQ7A 2QZ4A 3TCXB 3IKLA 3DBRB 1N8TA 1R3DA 1TI7A 1GV0A 5ALIA 3KR2A 3R5SA 8GPBA 5KMGB 2IIBA 1ZVJA 3ZE7A 5MDHA 4U5QA 4MGEA 1GTG1 5DSTA 1BEEA 4ND7A 3R76A 4BAUA 4OAPA 4GUAA 2YC2C 2JI4A 4NCAA 2CL0X 3DBHB 4P9NA 4AJOA 5IJ9A 5LPNA 4JHLA 3TL2A 3D4PA 3OF2A 5KYUA 1EGMB 3X1JA 1CULC 2QZZA 1TGYA 4D3ZA 5E6SA 3TTVA 4L3OA 2C03A 3RVBA 1MX1A 3WICA 2DR3A 3EAQA 5A3VA 3I04M 3O8LA 3Q1KA 2XZDA 3VZDA 5D6OA 1W6UA 3L4BA 5CVVA 4IOMA 1LBTA 2YZKA 4TUYA 1RC0A 4KBGA 4P8RA 3OE4A 2CVFA 4YV1A 2MSKA 4B31A 2C07A 4W5WA 1S8NA 2YOHA 4FMCF 3BB4A 3P9YA 4IUDS 4TTJA 4AJNA 2PUGA 4ICIA 2BAGA 4EG6A 1D07A 4HTFA 4IQ8A 1IM5A 4U7PB 2AEEA 1YJ8A 2NUTA 4J49A 3COJA 4FJ2A 3OLCX 1GU1A 5EUBA 3BJZA 3U40A 5FRDA 3L43A 4BE4A 5K3CA 1DUIA 4QATA 4RF5A 1PCXA 3A3YA 2VF5X 3IQWA 4MWOA 4Q37A 4QU5A 3KEGA 5G1PA 3KKLA 3SD7A 2WBLC 1UP7A 1Q57A 4WK0B 3CUWA 4ZAZA 2AC4A 1VHJA 1O97D 1OXSC 1UT5A 4KWIA 1VG0B 3FW1A 4MJLA 4EHJA 3CPJB 1JVBA 1OIVA 4YONB 3VHRA 3TR6A 4NTZA 3AUAA 5LIPA 3SX0A 2CXNA 2FDRA 1G8FA 4QKQA 1OLOA 1AUVA 1HZJA 1CDOA 4OXRA 1RSZA 1NXXA 4I50A 4K8RB 2F1IA 5ESXA 1I33A 4Y2UA 1M76A 2OXEA 1PJ2A 4JR0A 4WW0A 5D3QA 5AW2A 1ZJWA 1M5RA 1E94E 3K8QA 4ITVA 2VHWA 3FH0A 3FUWA 4CU5A 1TM7E 2OV3A 3HN7A 4KDEA 4OO3A 4AZVA 2CSXA 2QRZA 5JSZA 1SK8A 2Q21A 5LOVB 3FX2A 4Q24A 4RAQA 1GPWB 1O6GA 4HEA1 3PFKA 3PXEA 3R4CA 5ALFA 2AE2A 1CY1A 2O3JA 2WPNA 3FWYA 3IPYA 4QICA 4AROA 5JWHA 4R0VA 4CCSA 2HUPA 2ANBA 3KXDA 1EZ1A 2VPQA 3VKGA 1NUSA 5FTKA 4GBMA 2GZMA 2C0CA 4ZVQA 1X1AA 3AV0B 1VIVA 5I9IA 4M99A 4B3FX 2ZBDA 3SBXA 4AFNA 4QOEA 3K35A 6ADHA 1T5IA 1DIOB 2X77A 2WOJA 3ZC3A 1P8AA 4O4HA 1MFPA 1I5OA 1WUHS 3MUNA 3GW8A 4MDEA 1GFIA 3O3CA 3I9NA 3TW8A 3MOGA 3VR5D 1AE1A 1KBOA 2Q3MA 2QI9C 3L8HA 5DB4A 2LRHA 3PNOA 4LGVA 1CUEA 1KAHA 3EOBI 2GZAA 1LDBA 4BU0A 2VDJA 5TMDA 4P3KA 1N32B 1RADA 2KM1A 1J5EB 4UUQA 1Y5MA 3HI4A 1JVNA 1MXHA 4A6XA 1WMFA 5K7SA 3UB4A 721PA 4IEIA 2QQEA 2WTNA 5ARCA 3LO5A 3WG9A 2Y0EA 1DQRA 2JAPA 5HRUA 3O8QA 4RDXA 4KZKA 2R8YA 3ZGOA 1UK9A 4P3XA 2OVBA 4WN9B 3PZRA 2OLJA 4GC9A 3WGGA 4MROA 1KOJA 3RSZA 1IZ0A 3DAYA 4C06A 2PS0A 1BA2A 4AG3A 1ZVQA 1XL0A 3CVUA 5AI8A 1DB3A 2VZ8A 3AR7A 1TPZA 3EF3A 3MT9A 2XGOA 4REOA 1KEVA 4NS1A 5DM0A 2NU7A 3F6EX 5IANA 4YMGA 4RBNA 1TA4A 1JEQB 1XA3A 5CAEB 3DA8A 1YUMA 4XYGA 5AVRA 3C3MA 3ICEA 4TWBA 1QIFA 1N92A 2FVXA 2ZT6A 3ETDA 3P97A 4YREA 4C3ZA 4CDGA 2GM3A 4EATA 4ZEOA 1L4GA 2QZSA 3LBAA 4PONA 5SZKB 4U2FA 3WZ2A 3HYTA 1UADA 1EBFA 1UJ5A 4WLNA 3V1MA 2ZRJA 4NX2A 2Y67A 4ETNA 1A5SB 2AN4A 4CEHB 1YQTA 2P90A 2HSDA 3TMYA 2XPCA 1JAHA 3C1TA 5KB3A 2HHAA 2O1EA 5J4KA 2CV1A 5ALLA 1SRQA 1OUMA 3GEPA 3Q3EA 4BQQA 1ZOOA 3LXXA 4WFKA 5JQGB 2OCXA 2PR2A 2XD4A 1EFRD 2QD3A 3KZMA 3H4MA 3N5KA 3R3WA 3GDWA 6GPBA 4JLVA 4QPZA 1YHYA 1MJNA 3WLNA 5DM4A 4Q18A 4XQEA 2RGEA 4YUYA 4X1IB 4DCJA 1L3CA 1Z36A 2NX2A 4PAMA 4PO1A 5JAHA 2KS6A 2WPDD 2PUFA 3JSAA 2QZPA 3KQVA 1YTUA 4GX5A 4E4YA 2F1OA 1KS9A 1Q92A 1KMHA 2M6KA 2W37A 3RC7A 2PQ6A 2HJGA 3DCJA 2DFVA 4CFYA 2RIPA 5KWEA 4RH0A 1PZEA 1XSEA 3S2FA 1NVMB 2IX9A 5JNRA 1JQ5A 3O03A 4EO7A 4IFTA 2V8BA 5KX5F 4IVRA 2VP3A 2DR0A 4G23A 4JKIA 1N0UA 4N6OA 1FDUA 4N03A 2UUCB 4E5NA 1X0XA 2I34A 1RAIA 4HX9A 2JH8A 4KRFA 1NBMD 1KOLA 4DWVA 5AJYA 3R8CA 4WX2B 3C4JA 3JZAA 2O0JA 4J76A 4M46A 3JYLA 2CK3A 3MTIA 1LJ8A 1SG9A 3V9AA 2B35A 1CQPA 1GJRA 3DAPA 1G21B 4JCCA 4E7PA 2PT9A 1ZH0A 2QUAA 1E18A 3CH4B 3EUWA 2QSUA 1A88A 3IXQA 3NYRA 4G1MB 4I0WB 5BO5A 3L93A 4HQ0A 4G0NA 3AY0A 1RFGE 5JEDA 1OLXA 5DHUA 4AMGA 1OPRA 4X60A 5NULA 2DUMA 3SXJA 4O02B 5KVSA 4YTEA 1U0NA 2XIQA 2YWBA 3E9EA 4JL5A 4OGGA 3GJ0A 3O4IA 4AU1A 2XB9A 1KKUA 1V11B 3HXKA 1SXJC 5DNVA 1ORWA 5DZSA 5K05A 4ZOLA 3DS8A 5B4TA 4EW2A 5EZSA 2EKLA 4TPKA 3DTYA 4V0QA 4YH1A 5KTKA 5KWIA 4O4IF 2CNWA 3JQAA 4UPEA 1EUDB 4YPOA 4DDUA 4CE6A 1RJFA 1HLDA 3PF8A 4JUDX 2BZSA 3K7EA 4IFEA 5G4KA 2O8CB 3GJYA 4Q48A 2DWQA 3H83A 4QJ4A 3I53A 3R9KA 2XRMA 4BIMA 2OBYA 4QECA 4CEHA 3EVGA 3SS7X 2QUZA 4L85A 3OC0A 4K6CA 1FYVA 4FYIA 5THXA 3CX4A 1A4RA 2UYCA 1C1YA 1PG2A 3AY7A 4GUDA 2W00A 3HKBA 1NTOA 3BWEA 1UBGA 3W06A 2K7ZA 3N1UA 2XXAA 3UGJA 3HJBA 4P4TA 1BXGA 1WCIA 3OIGA 3FYHA 2X6TA 4XFJA 4X61A 3RIHA 4B8ZA 3K2QA 1J4AA 3E3LA 2FKAA 3DZJA 4KREA 3QZUA 4JI1B 1ZGJA 1GPKA 4DMUB 2NN3C 3ONDA 5IFKA 1XP8A 1PGQA 4I8XA 4IEEA 2ZJAA 4JI5B 2NPFA 1U9YA 1IRXA 3KAQA 3VAYA 5LQDA 2J46A 2Y2VA 2ZTSA 4HFJA 5BQPA 1WIWA 1Y80A 1MUUA 1V4BA 1XD8A 2FSFA 4CKZA 1TT7A 1FLNA 5KNCD 3M7IA 1R4MA 1TFUA 1QP8A 2H5LA 5CR9A 3WHPA 5BRNA 1T5SA 5FBKA 2IYRA 4Y9RA 5K9ZA 4JXKA 4MPRA 3AUTA 3EVFA 5ERGB 4LDRA 3K1TA 4EKEA 1XTKA 2JFVA 5B30A 2R7LA 3A4IA 4HNQA 4P86A 2IDZA 3ZE9A 5FJJA 3UG6A 4AQYB 1WBJB 2CUZA 2F48A 3G0GA 2OGWA 3PE3A 1W0JA 4MQ4A 1CS4C 4E51A 3NRCA 3HABA 4C7JA 3EGEA 2MU1A 3F8SA 3F7NA 2QQFA 4KKVA 2PO5A 3JYQA 1P4SA 2D1RA 1IN4A 3CZCA 3AEXA 1BHJA 3OJLA 5TT0A 4RELA 2YV1A 5LZ2A 4HNGA 3JALA 4HBGA 1EQAA 1T2NA 1Y4SA 3Q3IA 2OWEA 3W1VA 5B4VA 3VKUA 5LN1A 4KBFA 2H2FA 3THWB 3E15A 4J4TA 5E95A 3NOQA 4N01A 4GRAA 4ARZB 3IIMA 3EULA 3EGDA 3CKKA 1W88B 3E5NA 4HP8A 1FLAA 1Q2UA 5CW2A 1SM4A 1BE0A 3C7AA 1GUZA 4PZEA 3RKUA 4DV4B 1G3UA 2HQSA 1NNLA 2J4FA 4N8DA 3BDIA 1C50A 2PV0A 1JG1A 2XGSA 4FYJA 4J6EA 4WOCA 4YV7A 4ZK6A 4XFKA 4DR1B 1XDWA 2VSNA 4J1TC 4HR7A 1NUQA 1T6ZA 5AP9A 4EZIA 3R7DA 1WQ1R 1EE9A 5H81A 3LRTA 3DF7A 3OHSX 4QGFA 4WXYB 2D00A 3GMIA 5MGNA 1EM8A 2XUQA 4XUCA 3IAM1 3P20A 1M74A 1G1MA 4GBED 2FP4B 4ALLA 4QBFA 2EGHA 1DBPA 1R0BA 1JPUA 2BWJA 3RUCA 3NDPA 3ZD9A 2C88A 1YRWA 2FK7A 2ZUWA 5FO0A 3G8DA 3T7DA 2D7JA 1N2JA 2G1PA 1JDNA 1QJ4A 3QFHA 2EU8A 4H6XA 5I7SA 4D2IA 4NZOA 1CNFA 2G25A 2VO1A 3SHQA 4CODB 2C1ZA 3QE4A 5K51A 3SBOA 3FR8A 3L7CA 1P4AA 3HL4A 3GDFA 2JVJA 3ZHBA 2YFYA 2DSNA 1E2HA 2BGRA 1ZAKA 3H9EO 3IPXA 3IQIX 3RC2A 3WK7A 1TEZA 3QWBA 2WDZA 1U1GA 1PV2A 2HSEA 3GOHA 1NR1A 1TIBA 2JFXA 3K9GA 3CX6A 4PPQA 4JVMA 4ZODA 1GLNA 5DT9A 1RE0A 3PJFA 1J0AA 4J75A 1E8NA 3KEOA 4U7HA 3OPYB 3I64A 4U00A 1T8TA 3NC4A 1H1LA 3HU3A 4HUQA 4E46A 2AFHE 3G0OA 4JOCA 2W9XA 1GDHA 2VAPA 3AW8A 3AFMA 2IDKA 3E4CA 3O5AA 4HGQA 1K3FA 5L3RA 4EARA 4QFDA 5AVUA 1XDSA 4H15A 4KB5A 1TX4B 3VTFA 4UJ5A 5TDHA 1YF3A 3E81A 4J0IA 4LQDA 4NU5A 2VDPB 1OXXK 5L3ZA 3KUUA 1PEDA 4RPIA 4LJAA 1EFVB 4AJ2A 4DANA 2BRUA 4JJKA 5EGNA 3UH1A 1PIWA 3LIPA 4L6AA 2RG7A 1SCDA 2REBA 5A5FA 1CDZA 1UPXA 3ESDA 1VRCA 1WHSB 4WADA 4IGKA 1TNDA 4WK2B 3H1BA 1PGPA 1NONA 4YDSA 3V33A 3I76A 4OX9B 4ZVMA 5KBYA 1CNMA 3UV7A 1OR8A 3V7NA 1YZ3A 1NJ6A 1CUUA 2PH3A 3QNWA 4Z9YA 1TAQA 5IH7A 2FN8A 3D0KA 1X77A 3HZRA 2B6HA 1RRFA 2I7CA 4ND6A 5CDUA 3B7PA 5BSKA 2ZE5A 1YO6A 2VJOA 4RD3A 2WQ6A 2AR0A 3FNGA 3UOAB 5KKAA 5F9FA 3THYB 5G0UA 3I72A 4ZO8A 2R1VB 1S01A 2M1XA 2XB4A 4NY1A 1GZVA 4O1MA 4EENA 4N48A 1J99A 3AOEC 1WL8A 3M5PA 3PQDA 4M1ZA 1KOFA 4CF5A 1AO3A 3PQFA 4KJXA 2DT8A 4ECEA 4FFVA 1WZUA 1TC1A 4YJ2B 1G20B 1G5PA 4FGJA 2DUJA 1PR9A 1H0HA 1T2EA 1RI3A 5ALGA 4JN6B 1D0SA 1H1TA 1KMNA 2OY0A 3I28A 2IPXA 3EXFA 1DEOA 4LJYA 4AX4A 3QBTA 4UQOA 5FQOA 4TKZA 1L3IA 1VQ1A 2RH4A 4I2VA 1D1SA 1R8YA 2I3GA 5JWOA 3HCBA 1TM4E 1UJ4A 5LDGA 5IXSA 2ARKA 2WT4A 3BB1A 4JI6B 5AKEA 5KSPA 1Z6ZA 5J2UB 1A4UA 1P61B 2ZG6A 3LUGA 5ALOA 2FPPA 3AF5A 5K3BA 4IS3A 3QFSA 2C2OA 3DUFA 2NSDA 3RUFA 4G86A 1HBJA 4AZ3A 2NVOA 3TOCA 3QV2A 1N57A 1TRHA 3U81A 1EG7A 1XROA 3CUUA 4NRDA 1KJJA 4W1SA 1XJ0A 5D8DA 1J6UA 1COWD 1LPAB 2V5AA 4RANA 3A11A 4BO3A 4Z9XA 4HVLA 1RXWA 2YY5A 1QJCA 4I08A 4UHCA 2DJIA 4O5OA 2II6A 2VRWA 4P38A 3SGLA 4ND8A 5AVWA 1F60A 4NATA 1I4OA 1A76A 2IKQA 1ZMXA 2IY7A 2VPTA 3QQPA 4OJNA 1U8YA 4MYDA 1BEUB 3SVZA 4CQMA 4ED9A 3HTXA 1PP4A 1KQGA 4X90A 1EE1A 1F17A 3OQVA 2WV7A 3LGSA 4FDUA 3WADA 3HH8A 4LGYA 2GF9A 1U28C 3VPDA 1OGJA 3ILYA 1LSUA 1GADO 1YR7A 1SUPA 4KE7A 5EP2A 1T8SA 1NF2A 3HRKA 5HIMA 3UWMA 5BNZA 4KPFC 5BN4B 3PI7A 3ROZA 1RQ7A 2O7VA 3JZDA 2HD4A 3NHKA 4DC1A 3QSYA 2GDJA 4LSWA 5AHRA 1O5OA 1QHNA 1XDGA 3DB1A 3I5UA 4I9UA 4G07A 3HYCA 1P1IA 1YU9A 3VJMA 4AF7A 1D6MA 1YZVA 2PS9A 4F9GA 1THGA 4Q01A 2E18A 3LE8A 1WB9A 1H2YA 1F6BA 3ZCTA 1VPVA 2BJHA 2I80A 4QUJA 1QQ5A 4HMPA 4JLKA 4YWHA 2GEUA 1R0LA 3BQMB 2QRKA 3I2GA 3SF8B 1LX6A 3BXPA 3R3VA 2JIMA 4BBZA 3N59A 2BEUA 2QMHA 4BX3A 3MK31 4Y2XA 1B3RA 4ONEA 5E8JA 2PFGA 3S4YA 1XKXA 5L8VA 4B8YA 1KH1A 2Z2XA 3MW8A 1EBUA 1NP6A 1JHVA 1YL7A 3THSA 3A1EA 3ZG6A 4BNGA 4DDMA 5DN6D 1IU9A 2FPMA 2RHRA 3QU2A 4JB0A 1TZJA 4EGJA 2JI9A 3KJEA 5L7YA 3QXCA 1DIGA 3AIIA 2IH4A 4NENA 3ZWPA 4C4RA 4AJ1A 1ABBA 2QDKA 3PQEA 3GRZA 1B2RA 3LRXA 5LJIA 1UMCA 3C3EA 5I9SA 1K9SA 1TL7C 1U6KA 3OTGA 1L5KA 2GFHA 2D1YA 4KPUB 3JQ8B 5DOVA 4DYVA 1YUBA 2ACWA 2X5NA 1S2OA 2CLHB 4RA6A 2KSQA 2P4UA 2WF7A 3ZJ5A 1T9DA 2HXGA 2Q4EA 4RCZA 2D2EA 2P5TB 4CL0A 4JSTA 5JE8A 1QNLA 2BUAA 4LWPA 1YRQA 2GEVA 4KPYA 3ZIAD 2NO6A 2WJZB 5JUWA 1GZ3A 2OV6A 1X92A 2O0LA 1UBUS 1NBMA 1EJ0A 2FU5C 1OFGA 3O2JA 2E0IA 1CETA 2CE7A 2MIIA 2NQTA 4LJKA 4O4JA 2DCUA 3U39A 1J20A 2VOJA 5K0LA 1W5FA 1VJDA 2QQ5A 5TEWA 1IBKB 4AUMA 2DFDA 2UZ3A 1JUDA 1VI5A 2KW5A 3L6DA 3NONA 2A5LA 2FUKA 2W4IA 1DMRA 2LUOA 3D6FA 5GIOE 3OO0A 4FR2A 4CM3A 4EZEA 2AN9A 2QRVB 4XLTA 4M0EA 5ED0A 1YZTA 5EJ2A 4PF1A 2WRZA 1QYCA 5JG7A 3C6QA 1QHYA 1Y4DE 3PGXA 4MS1B 5E38A 3ETLA 1KSGA 2G0AA 3CRW1 3O9ZA 2IEAA 1E9RA 3SDBA 1OKKD 1VIAA 2NACA 5A5VA 2I9KA 1SOUA 2QPLA 3IESA 4JR1A 5ESWA 3MIIA 4MQUA 5BNIA 1O97C 2A0FA 1SVUA 2G5CA 3JQGA 5CT6A 4DR7B 4D0GA 2ODPA 4M7RA 1Z34A 2PGJA 2FYTA 3LWNA 5ESRA 1XZFA 1XXLA 1CUHA 1P2SA 2HA4A 3B51X 2RSLA 3GRFA 3L0SA 4IUYA 4LYHA 4QXAA 3QUCA 3OE7A 1M5TA 4MUXA 2FJPA 4WK6A 4BUJA 1VE7A 5BVHB 4N0QA 2AOUB 2H2WA 1E3MA 3TW6A 2QXYA 2EG9A 1DKUA 1WVGA 4IV0A 5K09A 4B87A 4M0FA 3RUIA 1FYEA 1IIBA 2HA6A 4FFMA 4K28A 3CT6A 2ZU0C 1K8YB 4HNAA 1NBME 1YE8A 3EQ6A 1UBCA 3F5MA 4R9VA 1Y9JA 4IX1A 1P72A 2D5BA 1UC8A 2GPBA 3NUZA 2GXAA 1G20E 4BP1A 1L5LA 3T8YA 2J9XB 4MW2A 4U8GA 2WMOB 4FU0A 4XVHA 1XIVA 4LK2A 3VVMA 2Q41A 3RF7A 2FW8A 3THXA 4Q9HA 2VHQA 2CFCA 2ZAOA 1KYIA 4AY5A 1ZM2A 1CFJA 3E82A 4D4LA 4DS3A 2W2NA 3E03A 1S3SA 4MWSA 4BVFA 1QLHA 4BKUA 3BWMA 1MX3A 1WDTA 2F1HA 3CJQA 1T9CA 2J3IA 4QG7A 3PHGA 4WNAA 2AFHB 3SZOA 1MIOA 1DBRA 2YN0A 1I6LA 5FR2A 5IAJA 4A3SA 3WWOA 4J3FA 5IKPA 3TZCA 2PMCA 5I9BA 1V16B 3ZQ4A 1JQLB 1P3Y1 4LMAA 3WISA 1XEFA 1EFUA 3DOFA 1N2BA 2AYYA 2OL4A 1II9A 2VXBA 3EOAI 3HZHA 3OOJA 3D9QX 4WVFA 4HXFB 3W5IA 5JLJA 4M1EA 3TEFA 3SZLA 1YB2A 3DPIA 4D9JA 5DYGA 1E9EA 4CCYB 1UM9A 3P9SA 4FYWA 5JPIA 1S96A 2YW9A 1Y3AA 2RBEA 1TT5A 1U9JA 2FZ5A 4MVJF 3W77A 1Q2XA 2C3MA 5FD8A 1W9HA 2OR3A 1R15A 4LOLA 2JFBA 5COBA 1K4MA 1XTQA 3UYLA 3E23A 3GLHB 1L4BA 1VL6A 3WYAA 1Y1RA 2HYDA 4MVJE 3VU9B 1RI2A 2HDWA 3IDFA 1I9GA 2WIAA 2ADOA 1MV8A 3ANSA 2GRJA 4J9VA 4QU9A 3H6KA 2ZBPA 2W2LD 4RZXA 4A23A 3ER8A 3UJ7A 1JGTA 2O1XA 3CIFA 5FLYA 5ERYA 4QUAA 3TG2A 3HMQA 4M1KA 3PS9A 3UZUA 3ZDRA 4WINA 3LQ2A 4UBNA 3ZWNA 2HFKA 4R16A 4F3CA 3WS7A 1JEYA 4D9BA 1YRYE 4H18A 4PYOA 4D3DA 2ETXA 4NH4A 3V4PB 2B1IA 2V1UA 1T2FA 3RVRA 2YFHA 2EHJA 1SBZA 1EINA 3DMTA 2JJ1A 4D9GA 3QX7A 2P9EA 1ADCA 1RZRA 1U11A 1FRVA 1TW3A 3JRXA 3LJKA 1OFHA 5HK8A 3HGTA 1Z75A 4TVSA 2BHSA 1G7SA 4WZAA 2ZI6A 4ZHQA 4V2IA 1ACJA 1QX3A 2ZB2A 2HA0A 3AJDA 1KU6A 1P2VA 2WC1A 2PZEA 3AP1A 3LXMA 1C7FA 3FFTA 4KLZA 2WJWA 4OAOA 5BN3A 1HLFA 2Q2VA 2XOKD 2DULA 1MZVA 1XZHA 4MV0A 4PYQA 5FV7A 1EXWA 3FOBA 1J22A 3ASYA 3HKDA 3OLVA 4XGQA 5IUKC 4N39A 2J5KA 5AXBA 4IHKA 3BE8A 2PT5A 3RODA 1H4QA 1JKJA 2PZLA 4U7JA 3DQQA 5AKYA 3HP7A 3N8KA 4HWTA 1HY3A 2C5FA 1KJWA 3BL6A 3VR6H 1Z35A 5JSFA 3WMEA 1KK2A 4ZU6X 1QR6A 2C7VA 4MUHA 5B2FA 2RHWA 4FGZA 4KUHA 1RQGA 3DHWC 4J0KA 4R2IA 4W5HA 4MWBA 2GB4A 2XWQA 3DF9A 2AG8A 3L8CA 4D8YA 1W36C 1K5PA 1O58A 1WMSA 2R84A 3VI4B 1NN5A 3GVIA 5EJ5A 3MWEB 4J1NA 3C41J 3SHOA 3J7AC 4KI7A 1YMVA 2B69A 4KLNA 1UOEA 5FO1A 4YBRA 4BKRA 1NQUA 3NWJA 4NE7A 4UCFA 4B7ZA 4LCBA 4O4LB 5AUQA 2H65A 4Q3EA 3NDBB 3U17A 3TRDA 3UK7A 1DFHA 1H8HD 4JT4A 4OHZA 1AUQA 1FLVA 2IHUA 1LLUA 1X14A 1SQ6A 1PJCA 4LNHA 3TZBA 5EWMB 1PJSA 3ES9A 4TTPA 1XWFA 4K9RA 3F5SA 4A15A 4D9NA 5E6UB 4AG6A 2GPYA 1XQ1A 2DH5A 4OD0A 4YLYA 5DF1A 3TLJA 5KDDA 2AD5A 2GTIA 5K8CA 1PK7A 3ADOA 1EU1A 2Z5GA 3L0BA 3OIFA 2YTZA 3G9XA 3NKVA 3AI1A 1U8EA 4KN6A 4LSZA 4RZQA 3OY7A 1D8AA 1QB7A 3WLEA 2CSUA 3U1TA 1TDJA 1ZICA 1KQOA 2GERA 4UBKA 4C6TA 2PGIA 3LV8A 4LW8A 4EOGA 1I4LD 3VC1A 4YAIA 4I1YA 3ONNA 1YRBA 3NB0A 4MQEB 1ITZA 2V7BA 3DCIA 5HIAA 3TSYA 1N34B 2I1QA 2ZFUA 1AZLA 2JGKA 1AMNA 3W3ZB 4JLJA 4D82A 5LD2C 1DAGA 1JDBB 4LMRA 1NBWB 2CVQA 1RD4A 2WSSD 1NM5A 1FP7A 3N8IA 1Z63A 1D2MA 2GT1A 4XB2A 3IQGX 5L3VA 3I4LA 3A7DA 1EFTA 5CW1A 4DCOA 2VAMA 1AHNA 4GX1A 4FWTA 1YIOA 3C4QA 4C9BA 4RKYA 5AI0A 3BL8A 3C5WP 3PE4A 1ISFA 1WKCA 2NTEA 3ZVKA 1HM5A 4LF6B 4N49A 1GZUA 2H52A 5LWQA 5B1DA 3OT1A 5F2NA 3HNOA 1A3CA 1OWMA 3QVGA 1E3LA 2WMNB 4EMTA 2Q8QA 1F8FA 5IBQA 5B1IA 2OCGA 5U4QA 1RYDA 3ETGA 3PX7A 2QT1A 3NBKA 1JJIA 4KXLA 4XSGA 1UWLA 1YZFA 2GN2A 3ELDA 3KSRA 3QOFA 5ER6A 1ZN7A 3ZGNA 4BBJA 5IAKA 2ZRQA 3PBKA 2E4XA 1X94A 2PD3A 2PYIA 3HBLA 3FDZB 3H9BA 4HDKB 4FXOA 4I5DA 3O4GA 3GUCA 4MS4B 4M38A 5AHKA 3TD2A 1ACMA 1O4VA 1O89A 1EWRA 2VDQB 1Y6JA 3VU9A 1UT6A 1Y89A 4GOOD 3AKCA 4NYIQ 1GTVA 3PA8A 3V4OA 1Z2OX 3RRMA 1ZL0A 3WHKA 1C1DA 1U2ZA 1YDHA 2WUVA 4PFKA 2P11A 5EJIA 5HCNA 4TV9A 5TQ0B 4L02A 4ACBA 2D59A 2W6ID 5AVJA 4D25A 3DMPA 5FBQB 1Y4UA 1FFEA 1MAWA 1WPQA 2MYPA 4LNUB 1ZCFA 1H0KA 4G0VA 1XZEA 4WNYA 2ZRLA 2GR9A 3CNHA 5H5JA 1BCRB 4HH1A 1KMCA 2XUHA 3NDJA 4OLJA 1T8WA 3D1LA 5DDIP 5SYMA 2NTNA 2PRKA 3SX2A 4HY3A 4ZVTA 1DIAA 5KSZA 3CEAA 4WA7A 5EIHA 4ZZ1A 5JRDS 3CKYA 3D0RA 1V96A 2ZT7A 2R7KA 4GX0A 3FCYA 2VP2A 3RTEA 4O2AA 4M89A 4RSHA 1T5DX 1ZA1A 3CY6A 1G291 3EA4A 3DOOA 4RL6A 1LW7A 2MINB 3TO5A 3UTCA 1NRWA 1Z74A 4EHBA 1GZ4A 3H7AA 1OXTA 5EHNA 4RC9A 1CBUA 1ESEA 1TMGE 1NJSA 2ORIA 4K5QA 4WN3A 3VKHA 3GXOA 3TZEA 1VBFA 2GPAA 2XMPA 3E2MA 3L8DA 1M2FA 3A4LA 2R7AA 4H2DA 2Z3VA 1U1EA 2JFGA 3KSDO 3T9BA 1L6RA 3A0UA 4IIEA 2VTKA 2QROA 5B7PA 1XO1A 2PRJA 4BNMA 2ECKA 4TXHA 1E0AA 4AP5A 1Q3KA 4FGWA 4DIDA 3ROQA 3W1EA 4YJ3F 3AY3A 4AO7A 1AQNA 4ZJPA 4BJ3A 3TX6A 3N0XA 2VR1A 1U3VA 3LPMA 2OCPA 3GH3A 5BQXA 5HS4A 2XYPA 1TK3A 3PRHA 4BQFA 1C14A 1U90A 3M1AA 3JWPA 1K66A 5JC1A 4BO0A 2I29A 4RHUA 1CUJA 4N5HX 1W47A 4JBHA 3GD7A 3HCEA 3DXZA 1M2OA 4UU8A 4NJMB 4RSMA 4ZZ3A 2YNMD 5JSHA 5L7WA 4X62B 2C98A 2AHOA 5TF4A