5CM8B

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
169
Chain Sequence
GPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 169
sequence length 172
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm8B00
1ZNXA 4B47A 2R6CA 1IN7A 4GPTA 4KFSA 4DLWA 4PO8A 1PLJA 2YWHA 5EXTA 3BH7A 4DLXA 3T1QA 2OV2A 3AH8A 3ZDQA 5E4FA 1Q3HA 1AZTA 2PEYA 3KUDA 3GJ7A 2BC9A 4JYBA 2G77B 1U8YA 2JIZD 4QM7A 5HR5A 3ZS8A 4A4DA 2O52A 2QN6A 4IDOA 1Z6GA 1CU1A 3TLXA 4JL5A 4WZ6A 2OFOA 3KL4A 3QEJA 1CJUC 3W6OA 1R0WA 1FP7A 3ASYA 5M04A 1E9RA 4EJSC 1EWRA 2VF7A 4PSAA 3BRWD 1IXZA 1R8SA 3AP1A 1E1RD 1CJTC 2ZYVX 5K8LA 2O8FB 4EPRA 3U5ZB 3V9PA 1WB9A 2ZS8A 4QFMA 4TT3D 1MRSA 4HLDA 2ZAMA 4PPGA 1OHHA 5DHAA 4RFSB 3T12A 4V0OA 2ZYUX 5FR2A 1D9XA 2OESA 2GZDA 2QM7A 3BOSA 1II9A 2D2FA 2IYRA 3O8BA 2O5VA 5BW8A 5K8IA 2ZS9A 1UF9A 2Q3MA 2YWGA 4B6EA 1JEDA 5EP4A 1U99A 3L8ZA 3V4FA 3V00A 4DJTA 4PAOA 5JLJA 4HZIA 3HU2A 5DYGA 4ITRC 3CPEA 2GZHA 3RAPR 4TN1A 3BWDD 3LBHA 1KSGA 3GLGB 5FOUA 4EPTA 4LI0A 1HH4A 5BQ5A 4JMPA 2BKUA 3EXAA 4F93B 5C2JB 4C0SA 2UKDA 2ZJBA 4BZPA 1R0ZA 1KKLA 2IUTA 1PZNA 3BERA 3RWOA 1R0XA 2YV5A 3ECCA 4MRNA 3WNBA 3BJIC 4PSVA 3G0HA 1VHTA 5ANRB 4GL2A 2ZSEA 2BEKA 2QEQA 2ZEJA 3W6NA 2VEDA 5FTNA 1BMFA 4IVQA 1JPNA 2IT1A 2AWNA 4MKIA 5SZHB 2ECKA 4PC2A 4QBFA 2ERYA 5SZJA 4NL4H 1YRBA 4Q19A 5G53C 3PEWA 5FUVA 2BBSA 4DT1B 2O8DB 3NWJA 5TV2A 2CJWA 1G19A 2G0NA 2PZGA 3NBXX 2F1RA 1P4SA 2WPDD 3TUZC 2FPLA 2E1RA 4KSBA 2FEMA 4Z8YA 3ZYCA 3R9WA 2P67A 3EPJA 4B74A 821PA 3GQBA 2VP9A 1R5OA 1SGWA 2JIZA 2PJRA 2WJGA 1ZNYA 5H8WA 3R7WB 3SHFA 4FWIB 2NO0A 3CW2A 4B3GA 1E9SA 3FFAA 4TQUS 2FSGA 1EWQA 3GCGA 2A30A 3G5UA 5TB5A 3WBKA 2C95A 1E1RA 3KX2A 4HLUA 3C14C 4QHTA 1UEJA 2ODWA 3I5XA 3PEYA 3GEHA 3N2EA 3BAFA 4US0R 4ASUD 3EPKA 4TT3A 1SULA 2GRJA 5DI3A 4D4KA 2OCBA 2JA1A 3U44B 1A4RA 2YINC 4LBVA 1IN8A 1DPFA 1U0JA 3MD0A 4DWJA 1OT3A 3A58B 4TMWA 4IEEA 1ZM3A 2GAAA 1BYUA 2J7PD 2BM0A 2H17A 4KBFA 3U3KA 4OQMA 2JJ2D 1L7VC 1P9NA 1S9HA 1N6HA 2B7BA 2IYZA 5FPSA 2XOKD 4WBSA 4WXRA 4Q7KA 5UKDA 1GITA 1UPTA 2HLDD 5FOXA 4CDGA 3WMGA 3K09C 4B75A 2SHKA 2VBCA 3MJHA 1TUEA 4KYIB 3T1TA 3ICEA 4IXNA 1VIYA 3X1XA 5EXXA 3VR3A 5HZKA 2F43A 3BB1A 1M2OB 1NVVQ 3FKQA 3L43A 1E4YA 4KVAA 3RVBA 2J0UB 2NQ2C 4NU0A 4C0LA 4EQ6B 2GXSA 5HKKD 3PFIA 4ZDJA 2JATA 1U2RA 3BH6A 1J2JA 1EFCA 2F6RA 3AF1A 4H9GA 2XB2A 4GFDA 2VSXA 3HPQA 3KB1A 3BB4A 4Z8XA 1Z06A 2GTPA 4QJ3A 4ERNA 2RHMA 4L4UA 5TVKA 2VIIA 4WAUA 5A4JA 2FGKA 1EFHA 3NEYA 4NE2A 3ZGXA 2XZLA 1Z6XA 2XJ4A 4B3DA 2WPDA 5FUXA 4HB0A 2DWOA 2IYUA 4Q9JA 4XJXA 1US8B 4DHEA 4QGGA 1NKTA 5KUTA 2HYDA 2GJKA 1MRNA 1RFLA 2P6NA 3BFVA 1TAGA 2H1LA 3BK7A 4ZCLA 4AKEA 3GLFA 4MGIR 1PUIA 1AS2A 3IO5A 1I4LD 1O87A 3IHWA 1KK3A 4G5SA 4FMBB 5FUYA 3K70C 4ACAA 1QVAA 1F2UB 4JVLA 2NTYC 3AVUA 1TPZA 4AK9A 3FMPB 2B8WA 3ETLA 3IO3A 4IW3B 4HLUC 4TMVA 4ASUA 4Q1FA 5FPYA 2QMHA 1GILA 1GL6A 5JHGB 3TH5A 2QT1A 4O25A 3TQFA 4CVNA 3Q5EA 4OI2A 4E07A 4YMWA 2JLVA 1YQTA 2PMKA 1IY2A 2XEXA 3X2SA 4O3MA 5CIWA 3RSOA 4GMDA 5IRCD 3WHKA 4ZIRB 3HU3A 4JL8A 2O8FA 1OIXA 2FFHA 3IUYA 4B6FA 4M1MA 4BLTA 2F9MA 1JAHA 4B3FX 2J7PA 2YOFA 4EIWA 2FFBA 4PHFA 1IONA 2JJ2A 1VYUA 4BLRA 1X8LA 1VMAA 1YVDA 5CLQA 1JPJA 1SHKA 2XOKA 2ZSFA 2BEJA 4WOPA 5IF9A 4TYNA 1S1CA 3TAHA 2HLDA 4LHWA 3UWKA 3CH4B 3NIBA 2BMFA 3LQRA 1E0SA 4HB3A 2CLCX 3BC1A 1TMKA 1G18A 1M8PA 3FE2A 1OIWA 2F1JA 2B7CA 4MYHA 5FTJA 4RJLA 4DLSA 1GG2A 2VP6A 4OK3A 3I61A 1G64A 4ARZA 3QG1A 3UANA 4A2WA 3U61B 2HJVA 1N25A 5HKKA 2VP2A 4JVMA 4BE7B 2PH1A 4URXR 2KBEA 4BFXA 2W0MA 4D82A 1GZSA 4O2RA 4OI1A 4TYQA 3TSZA 4BFTA 1G7RA 4DB4A 2ZRDA 4KFRA 1SVKA 2NO7A 4C0AC 3RS2A 2F1IA 2QTFA 2YHSA 1T5IA 2KBFA 1K5GA 1CS4C 3KJGA 2GK6A 3OESA 1Q1ZA 4M9ZA 4Z1MD 4RD3A 2ZJZA 2ZE7A 4C7OB 3EAQA 1OH5A 2H8KA 3HR8A 2QGNA 5CB6A 5KSOA 2JLRA 4HAZA 4JBYA 4JS0A 3QKRB 4MGKR 4PR0A 1UAAA 2ZSBA 3B82A 5AJZA 1ZC3A 1QRAA 2CL6X 121PA 3N2IA 2O8DA 4LJ9A 1D6JA 4JJKA 2F7SA 2W6JD 3LA6A 4AC9A 3SZRA 1VKJA 1G41A 5HE9A 3N5CA 4W5HA 1ZD8A 1K5DA 1T4GA 2HXSA 3THYB 3M6AA 1AGRA 2ASEA 5LB4A 5C4MA 3EWAA 4Q9LA 1Z8FA 2BWJA 2QG6A 3M0EA 3R7WA 3CZQA 3MMPA 3QSYA 1LTQA 4MRRA 3QY0A 1I2DA 2BV3A 4DCNA 2ATXA 1GP2A 1ZC4A 2C2HA 2PEZA 2J7KA 2PCJA 4PO1A 3F5FA 2J0SA 4PHTA 3T06B 2PZEA 3LQQA 3GLHB 4HAWA 5C46F 1VTKA 5E7IA 4PQFA 2J0QA 2R6FA 4PAMA 3VNUA 4TLBA 3TNFA 3QXCA 3U44A 1N5IA 1YE8A 5B2ZA 1Q0UA 1JJVA 1OH8A 3GLFE 4MUAA 4PTLA 2AKYA 2GJ9A 3KKOA 4CEIB 1XJCA 3T5GA 4PANA 1CXZA 2IA5A 1PUJA 2J87A 3I8SA 4JVNA 3HWSA 2IXEA 4LC1A 1GM5A 4JLOA 3W6PA 4TLAA 3GJ8A 5AR1A 1D9ZA 1RKBA 1YZNA 3IQXA 4KBGA 2C8VA 1CJMA 3CR7A 1XB2A 4A15A 2WVJA 4FXPA 3WYFA 4DSOA 3O47A 1WDTA 3REGA 4V0KA 4BUJA 5J4KA 3TE6A 3RC3A 1L2TA 2O8CB 4EQ6A 1UJ2A 2J0UA 4YXWD 4D26A 4Z1MA 1SVSA 1UKEA 4CF7A 4BLQA 3U3OA 4FIDA 1DOAA 1FOEB 3QXHA 1FTSA 1SVIA 1TF7A 2XITA 3AKEA 3S1AB 4EJSB 4QJ5A 1HYQA 3DMDA 1LS1A 1CF4A 4B73A 1XNJA 2HXYA 2I1VB 3OE7D 1LW7A 1YU9A 1ZU5A 2MSDB 2IS1A 3T1VA 5CIQA 1G5PA 2EYQA 2R2AA 5DYIA 2HCBA 3AKYA 2VO1A 4A92A 2HEIA 1TEXA 5JFGA 3VX3A 4B44A 4DEXA 1I2MA 1E9AA 5JWHA 1NI3A 3EIEA 4HI0E 1HE8B 1RRPA 2ZRJA 3K8YA 4WIAA 3TAUA 2CCKA 1US8A 1NMXA 4TZ0A 2KB0A 4OBEA 4QGFA 1WMSA 1GSIA 1P2UA 4XTCS 2MSCB 3ADBA 1ZUHA 3VR1A 5EP2A 2FMXA 5CDFA 5C1BA 1NN3A 1VCIA 2EQBA 2ZREA 3EA5A 1NG9A 4TSFD 1F2UA 2HF9A 3EIHA 3U7EB 1SVWA 1BO6A 1M6NA 2WZQA 3PITA 4EDHA 5AUOB 1EFRD 5KSZA 3KDSE 4D25A 2ZU0C 4TMZA 3ZS9A 5BYKA 2WKPA 3EZ6A 3SU8A 1OFIA 4C0KA 3NKVA 5FTLA 1GNQA 3LBIA 3I3SR 4KO8A 1RRFA 1SVMA 2G88A 2EYUA 3A36A 2BBOA 2P5SA 4UKDA 4ZIRA 3L0PA 2WSSD 3BFKA 1AQYA 2ORIA 4MKGA 1VG9B 5DNYB 3H84A 5L3SA 2ZUBA 1KY2A 2RGAA 1XPOA 4TL6A 1DELA 4V03A 3VKWA 4M0LA 2XXAB 4XWAA 3SFVA 2BDTA 2KE5A 1NG1A 4M53A 1KI9A 5KYKA 2R8RA 1FZQA 4NCJA 4S2EA 4RY2A 4OQLA 3QKTA 5JEEA 4GOXA 2GVDC 5B30A 2JLXA 5DISB 5KDLA 2FGJA 4F4JA 2BM1A 4B43A 2P5TB 2OLJA 2BKEA 3RHFA 4Q9KA 2IK8A 4C0JA 1U8ZA 4WVFA 4X8HA 4ZDWA 2ORWA 3OE7A 1AJEA 4II7A 4Q48A 4C0BA 2AD1A 1N6OA 1ELOA 1EXMA 1OW3B 2ZE5A 1HT2E 4C7OA 4P3YA 3SE0A 1ZBDA 3GD7A 1KI2A 3IPYA 2V6JA 1U0HC 4RFVA 5LB2A 3QKRA 3GLFB 5DH9A 1IHUA 2NO9A 4NH0A 2IBMA 1BH2A 5D3MA 4XSGA 1TU3A 2IXFA 1XD2B 5JSZB 2G6BA 4B33A 5CYPA 3CPHA 3CPJB 2VP0A 4BASA 2G9NA 4JLVA 3OFND 1W2GA 3VR4A 5JWOA 4TSFA 5E3HA 3THYA 2R6AA 1N6PA 1KI8A 1LFDB 4MRSA 4ZV4A 1EFRA 2QROA 4XVRA 4B32A 3ADKA 4KU4A 2IYXA 4BGDA 2FH5B 3W3AA 4JJZA 1KAOA 5DO9A 2PLRA 2WOJA 4TMKA 3SYKA 2UZIR 4A8JB 1DAIA 1P73A 4DSTA 4MRVA 3NH6A 1X8KA 3SOPA 3CR8A 3FPAA 1BKDR 1QHHB 1J8YF 1SQ5A 2WSSA 4ZPXA 5GJBA 2QMUA 3GLHA 1SZPA 4EKDA 4MDFA 2J3EA 1Z0IA 2OBNA 3DZDA 3MG9A 4G5OA 4HB2A 1KNXA 5FBWB 2FPMA 3R9IA 4CEHB 1RE0A 1TQ6A 2W83A 3VR5A 1J99A 3T15A 2J0VA 2CJWB 2OFWA 5FPTA 1S9DA 3F0TA 5CDFE 4CEIA 4AKIA 4OHYA 1CTQA 3ZLJA 1XPUA 3QIAA 1RJ9B 4N0DA 2ZR0A 3KJEA 1PLLA 1II0A 2ZI7A 5G41A 2ZVPX 1TTTA 2GXAA 1GRRA 1W4AA 4M9QA 4NYIR 4E03A 4LJYA 3K70B 1E99A 4IDPA 3A37A 4HLCA 5JCPA 2H7VA 1ANKA 2OXCA 1FTNA 3AB3A 1KDOA 5HCNA 1G8YA 2OBMA 3RLFA 3CRQA 4F7WA 5JWRA 2HYIC 2CE2X 1OH7A 4LPSA 2O8CA 3GFPA 2P0EA 5CM8B 2HCJB 4HAVA 4NP6A 4EAQA 1CULC 2VSFA 2YJTD 3S1AA 3UK6A 1XTSA 1SKYB 4G5QA 3DEFA 2KWIA 1DBSA 2REXB 1FW6A 5H1YA 2OCAA 4Q9IA 4G1UC 3B1XA 4NDZA 3QKUA 5EZ5A 1FMLA 5EUQB 2FFAA 3W8NA 1U81A 1Z07A 4PC3A 1XF9A 4AWXA 3T61A 4UNSA 5FI0B 1U98A 2FOLA 3FWYA 1KK0A 3P4YA 2ZJOA 1UFQA 3Q7QA 5F9HA 1R5BA 3P1JA 1GVNB 3QEOA 1NN0A 4Y0VA 4Q9HA 3OFNA 4OHWA 1F2TB 1JXMA 1O3YA 2ZRCA 1NIJA 3A1SA 2BJWA 4YDHB 4V02A 4DLZA 2R62A 4TL7A 1ZINA 3KFVA 4E22A 1KDRA 4YMUA 1IM2A 5DHFA 2R65A 1VIAA 2CL0X 3LW7A 3ND9A 4C0HA 2YC4C 4LYHA 4TTQA 1Z08A 2DY1A 5TARA 3UMFA 2YKGA 2IYSA 5EE0A 1RIFA 3NH9A 1VHLA 3B5JA 2ZANA 2X2FA 3LX8A 2XTZA 1XMIA 2QU8A 2V55B 4DRZA 3L0OA 4DEYA 2D2EA 4FCWA 4IFEA 3SYLA 3I5YA 1HA3A 3ZH9B 1E2LA 4FMCF 3VX4A 4AIIA 4W5JA 2WIBA 2CXXA 4D4MA 421PA 4Q1EA 3M4YA 1G3RA 5KPDA 3MSXA 1Q1EA 4F91B 2VHCA 4BFZA 3CNLA 4GRAA 5GJCA 1MOZA 4I1OA 3GJXC 2XXAA 5GVRA 4RCYA 3CRMA 2HF8A 1DAGA 4PFSA 1ZIOA 4AI6A 1G8HA 3B2EA 2OEPA 3D8BA 1MABB 1XEXB 5TY0A 1NVXQ 1XBTA 5DIFA 3BBPA 1ZIPA 3SJBA 3GLHE 3TJZA 2BMEA 1E2HA 2DFNA 2XSZD 3QKSB 3K70D 2UVQA 4EFMA 1WA5A 3THWB 3ZZTA 2EFGA 2QMOA 1C4OA 1ZVQA 1IY1A 1R10A 4FCTA 2J1LA 4JYCA 1OSNA 4Q4JB 4X8LA 4ESVA 3NVAA 4P33A 1SXJC 4OI4A 1BOFA 2A5FA 2NIPA 4ON9A 4TYPA 5CK4A 5JJLA 2YZ2A 4KYUA 3DM9B 1M1YE 3MLEA 4U7DA 3PUVA 2D62A 1KI6B 2CHVA 5HZHA 3WRYC 5LDDC 4B34A 4TMTA 5CJ2A 3K0CC 3NC1C 5FL3A 1CRPA 4LCBA 221PA 3CIOA 3Q9LA 4FI3C 1ZP6A 1ZM4A 4QBGB 5AUQA 3C7KA 4LYFA 1G8GA 1XD2A 3RC8A 2GEDA 5JSZA 1PV4A 5KDOA 2QENA 3K9LA 1QHSA 2FJUA 4ARZB 2ZTSA 1XPRA 3ZZUA 3B8HA 1U0LA 3K09A 4IDHA 3SC3A 3CF0A 4D0LB 1KMQA 2G83A 3H4MA 2TMKA 3L82B 3HPRA 2Q9BA 3E2IA 2P2LA 3PR1A 3HJNA 1CR0A 2AD5A 2IYLD 4LHYA 3OIWA 4KXFB 3AF2A 1IY0A 2PX0A 1FP6A 4A8JA 3KTAB 4QBIA 4RKEA 3CNNA 3R20A 1TEVA 3D7MA 2BOVA 1QHHA 5FH9A 1J7KA 1R2QA 4FMDF 2EU8A 3AF4A 3QXSA 4IJMA 5AK0A 1NY5A 2REBA 4B2PA 1HT1E 1N5LA 1AZSC 4CEHA 2QI9C 4JBWA 4TL8A 3DZ8A 4BRUA 2PX3A 4CT4B 2QGZA 2CVHA 4EPVA 1ODFA 1N2CE 2G1KA 3D6TB 1SKQA 2DYKA 1Q1QA 2Q6TA 4QGAA 5J4LA 1RJ9A 1EESA 2RGGA 2OXRA 3QQ5A 1XRJA 1CIPA 4Y0AA 3WP1B 1RYFA 1FMJA 4B2IA 1UKVY 5AJYA 1ZCBA 2JEOA 2XSZA 2ZUDA 3TR5A 4ILEA 1XP8A 2WBLC 3CX8A 3LLMA 4AG6A 2VRWA 5KNBA 1X6VA 1QHYA 3SBEA 4AG5A 5P21A 1DARA 1AN0A 3G82C 1XMJA 3J81k 3ZQJA 2ZRAA 5FOWA 3U6BA 1R8QA 4N1AA 2EFCB 3CRVA 2PCLA 3IDQA 1Q3TA 2CHGA 2ZI3A 3E1SA 3EZ9A 2GXQA 3KQLA 4WA7A 4IDNA 1ZUNB 2IW3A 2QPTA 2CLDX 4RZXA 4HEJA 4MA4A 1W5SA 3FB4A 1M34E 4JKIA 3UG6A 3EZ2A 2C03A 3VKHA 4MKFA 4Q47A 3SEAA 1AIPA 2NO1A 2PZFA 5GVSA 2BHRA 2KI5A 1G20E 4HUQB 1OKKD 3DDCA 3H86A 4LBYA 2CCJA 2QPOA 1F2TA 4AYTA 4PPFA 1KSFX 2YC2C 3U3RA 2PLFA 2VHJA 4CIDA 2RAPA 1W36C 4QJ4A 2JLUA 1OFTA 4KI0A 1H8ED 1QZXA 4NYJR 2QP3A 1KKMA 3AP2A 3JZMA 2F3RA 4RZUA 5EQTA 2AXPA 5JRZA 3P20A 1WP9A 3T34A 4A8JC 1OFUX 3EPLA 1UBCA 2MSEB 3X1WA 5EZ6B 5KNDA 3SJAA 1ETUA 3GLIA 4DDVA 2BJVA 4CZ2A 1T9HA 4D6PA 4HLQB 3NBYC 2CL7X 4L9WA 2C98A 3FDIA 2O8EA 1E2NA 1S2MA 2ZPTX 2XJ9A 4MYCA 3QVUA 3PUZA 3RRNA 4FN5A 1P61B 1XTQA 1QHXA 2AWOA 1DAMA 4P4SB 2OAQ1 1MO3A 4DIDA 2RGNC 1VCMA 2GAOA 2A3RA 1XD9A 2DBYA 4MGYR 3MAAC 4DLYA 5EP3A 1PJRA 5A0FA 3I1FA 4D0GA 1CR1A 1KZ7B 5JS8A 1Z0FA 4WZBE 5GJVC 3OEED 4W5WA 1FX0B 2V9PA 1MABA 1XEXA 2FG5A 4NCNA 1E9DA 2HT6A 1NRJB 4O2LA 1YKSA 2GXUA 1JXOA 2W0SA 5C4GB 1S3GA 2ZJAA 4L15A 4MKHA 4W7SA 3SS8A 1EX7A 4Q4AA 3QKSA 3JZAA 4GOKA 4KLNA 4GDFA 3O8DA 4P4TA 2VHQA 3GP8A 3THWA 5F9FA 4MDEA 2QORA 2ZROA 4MH0R 4OHXA 1GKYA 2IXGA 2ZQ5A 1OXVA 4I1VA 1AK2A 4Q4JA 4RZ3A 1XJQA 2ZSDA 1ZM9A 4H1VA 5K8TA 1G4UR 4OJQA 2OT3B 2JAQA 4PPNA 2JLSA 1YZQA 4E09A 2WAXA 3U7FB 3ZVMA 3DO6A 1D2EA 2BVNA 4RD0A 5L3SB 2FA9A 1KI6A 3PEVA 1WQ1R 4BFSA 3I4LA 3UPUA 2OUKA 1NN1A 1OKKA 1XWIA 4C2TA 1XEWX 5L3RA 3U60B 1TX4B 3K9NA 4M1WA 3AVOA 3GJ4A 1B0UA 3LX5A 3MGCA 4FWTA 2IEZA 4W9MC 1D2NA 2KSQA 1W4BA 1XX6A 1T8UA 4OL0A 5EUMA 5FOVA 2UZ3A 3QJYA 1OJLA 3TVDA 3B1YA 3VHLB 1NVUQ 3AP3A 3IQWA 4UXIA 2JASA 4IOMA 1SKYE 1BYIA 3A1VA 2RGEA 4PPQA 3QVVA 1JB1A 2IWRA 5B57C 3LH5A 4C4PA 3DMNA 1P5ZB 3CM0A 1F60A 4PC1A 1E4VA 1L4UA 2WM9B 4I99A 5JMTA 2AK2A 3NEJA 4NYIQ 2ZJ8A 4IDQA 1K6MA 3KTAA 1G6HA 1GFIA 2J45A 4DCVA 4NZYA 1FUKA 2QBYB 1X3SA 1Z0KA 4JZKA 4M8NE 1YZLA 4MRPA 2DCUA 3M1IA 5EE1A 3LAWA 2A2ZA 3WYAA 4DDUA 1XFAA 2D06A 1NJGA 3VFDA 3EWSA 1FPMA 3CUEF 1XTJA 3PUXA 2GJ8A 4KFUA 5D3MB 5DI9A 2B92A 1KDPA 5JI3E 5EE5B 4PX9A 1E2GA 3CBQA 4LJ4A 2X19A 1T0JB 1P9RA 2FSIA 2X8AA 4XWOA 4RCZA 3BH0A 3CRW1 1T8TA 4A0HA 3OHMA 3RS4A 1KO7A 4LWZA 3LWNA 1GKIA 4NCKA 3GLIE 4Q1AA 3CX7A 2KJQA 4JLBA 1E0AA 3FMFA 2FV8A 2RCNA 2ZS7A 4B2LA 5BN3A 1UADA 4URWR 3AVPA 1JQLB 3C15C 3OIUA 4URUR 5DLQC 1R6BX 3AVQA 4V0MA 2QAGC 4ACBA 1NVWQ 1G1MA 2VA8A 4Q7MB 3PV0A 2D7DA 1YZTA 5FPHA 1KJYA 3LV8A 3TSOA 2WJIA 4C9BA 1DADA 2OAP1 4EPYA 3FTQA 3QPUA 4LV5B 2RGCA 5DE3A 4LPKA 2J41A 1T3HA 3EARA 4G5RA 1ESMA 1KSHA 4YC7A 2R6DA 1GIAA 3P32A 4P32A 4JLAA 4CT5A 3BB3A 1IXRC 1W47A 2NMVA 3IIKA 1CRQA 4LC0A 2PMDA 1HURA 3SYNA 1WCV1 1OB2A 2GHIA 3K9HA 4HUQA 4UXJA 1XMSA 2YYZA 1P6XA 2ODEA 3LBNA 3VMFA 4YLGA 4Q1BA 1QG2A 5AWFC 1PLKA 4JLNA 4TYWA 2V7QD 3BS4A 5FOSA 4UNQA 5EXPA 3RDPA 3K0EA 5DN6D 5JRJA 1V43A 4UXHA 5FL7D 5FOTA 1NP6A 5FTKA 3QBTA 4TTRA 4L9SA 4LYJA 1T3SA 1G9XA 4K8OA 3IGFA 4QKQA 3UMRA 1NSTA 2FPKA 1SXJB 3TW4A 3JVUA 1AS3A 2OM2A 3VR2A 3FGNA 5FPKA 5BN5A 2WWGA 1Q22A 1COWD 2W6JA 1A82A 2ZIAA 2XNDD 2X1VA 1D2MA 1A1VA 4P4SA 1CKEA 3Q7PA 3FMIA 3U6KA 1MKYA 4QBHA 5G40A 4LGMA 1EFTA 3VNVA 1XZQA 1KSJA 2ONJA 2VTKA 2XB4A 3P27A 3ND8A 4A9AA 2V54A 3RRMA 1XTIA 4NHOA 4ZI2A 1FX0A 1KGDA 3B6EA 4V0NA 1JNYA 3C5HA 1X8JA 5B64A 1YJ5A 2CVFA 4KAXA 2N46A 1UBFA 1N0VC 2W00A 4G0NA 2NPFA 3WY9A 1U8AA 1Z22A 3A6PC 2N42A 1QF9A 4B3CA 2C9CA 3KZ1E 3D3QA 5E7JA 1E9BA 2GZAA 4JT2A 1SVOA 4M1TA 1E2QA 3Q8XB 4BLSA 2IHYA 2NO6A 4AD8A 1KTVA 4JLPA 2IS6A 3UIEA 1DAFA 5FUWA 1Q20A 1S8FA 1KO8A 1NSFA 4ZO4A 3KQHA 4LJ7A 1TADA 3BXZA 2GEVA 2REOA 1KO4A 4B71A 2ANBA 5KSYA 4OK5A 5J4HA 5L3VA 3OAAD 4PAQA 4V0ME 2FZ4A 3RS3A 3GJ5A 4RD1A 5DN6A 4ZI3A 2GVZC 4JIMA 5FL7A 4YXWA 2Z4RA 3W5IA 4IOJA 4HAYA 3THXB 1KI1A 3V4RA 4XH9B 1P3JA 4AYWA 3EIQA 3CLVA 4MQBA 2PT5A 3NTUA 4A0RA 1ZUIA 2C99A 1NVVR 3QPWA 3FHTA 3KXKA 2VQSA 3K0AB 1JAIA 2YOHA 4P4UA 3WMFA 1OFHA 3U3MA 1COWA 4DUGD 4Q02A 3OEHD 2XNDA 2VP4A 3CX6A 1NMZA 4DB2A 2QBYA 1GKUB 1DAHA 1G21E 3A4LA 3CWQA 4IRUB 4BEJA 2ZE6A 4BPBA 1SXJD 2CMKA 3IHLA 2V3CC 3KXIA 3CONA 4YQFA 4US2R 4RD4A 1HE1C 2PL3A 2QE7D 2V4ZA 3L8YA 4F4CA 1HY3A 4ZDKA 3NDBB 4EFNA 1TF2A 2AX4A 4NMMA 2ORVA 4M9XA 8OHMA 2EVWX 1W36B 4TZ6A 4KHZA 3FFBA 1NNEA 1G17A 1TNDA 2ZI4A 2QL6A 3O8CA 4LDJA 5CM9C 5FBLB 4A6XA 3TW8B 4PO9A 1Q12A 1EG7A 1OYYA 3RS0A 3C4JA 1CR2A 3LXRA 4TYYA 4A36A 2V8OA 3B78A 1KMHB 5HE8A 3KFXA 2IF2A 1R4AA 1QHIA 1UDWA 3ZIAD 1IJEA 3UMSA 5JEDA 5LBIA 4IHQA 4NYJQ 2WWIA 4US1R 1IOZA 3A1TA 3SN6A 2XZPA 2CE7A 4FMDB 3I73A 3K0FB 4DDWA 2OCYC 3NBZC 4GZMA 5AJVB 3IIJA 1GNRA 3TVTA 621PA 2GDJA 2HUPA 2W58A 5EE3A 1XXHA 3PEUA 2V1UA 3OAAA 2QY9A 2ZI9A 4AY2A 1VG8A 2IS2A 2I3BA 2VP5A 4KSCA 4KFTA 2RGBA 3NG1A 1EK0A 4J0QA 4JT4A 4CW7A 3MUFA 1W1WA 1VECA 2ONKA 1YR7A 3R9XA 2J9RA 2IUUA 2C5LA 4HDQB 5J4YA 5FR1A 2NPIA 1A5TA 1FNNA 2V6IA 3B9QA 1Z2AA 5IDVA 3RANA 4LRWA 4DUGA 2WWWA 3KQKA 3OEHA 2G0TA 4X8MA 4NONA 1RYHA 4GNKA 1E2DA 1W46A 3QPVA 4Q4HB 3IPXA 1SXJA 1TQ2A 2CHQA 2QUZA 4URZR 5JCZA 1G3IA 2JGNA 1F5NA 4OI0A 3QENA 3A1WA 4NCIA 1KZGB 1KK2A 2QAJA 3PUWA 4HSEA 2QE7A 2QQ0A 3QI2A 2P3SA 3UG7A 2R44A 1VDZA 1LNZA 1E32A 3K0CA 3Q5DA 4JSYA 4A1FA 4NKRA 2F3TA 2XTMA 5IK2D 3BGWA 2FFQA 4JL6A 4H1UA 2BBTA 5FBVB 1QDEA 4BFVA 5KO2A 4CGZA 2FZLA 1N6LA 1NF3A 4D81A 1NY6A 5A5GA 1T91A 1WF3A 2IYWA 2IYVA 2Q9AA 3AVWA 3GJ3A 2WAYA 1LF0A 2A7QA 3H0KA 3KKMA 1W36D 5TDHA 2ZETA 3ZIAA 2NZ8A 5CJPA 1F3OA 3BORA 4BEBA 3GLIB 2QTHA 4TQAA 3GJ6A 4M4SA 5G3YA 1JEEA 2ZRMA 3U2QA 3B7GA 3ZD6A 2CLSA 3B1WA 2EFHB 4BRWA 1HQCA 2O8EB 3LFUA 2WWHA 3RNLA 3O8RA 3I8XA 2MMCA 3WMEA 4C3ZA 1X1SA 3SQXA 3C41J 4QL3A 2QT0A 2D7CA 4B35A 4YMVA 1E69A 1EGAA 1JI0A 2H18A 1H8HD 4EPWA 3CNOA 5J47A 1JECA 3ASZA 5KPJA 2Z43A 4XOIA 3Q85A 3U3JA 4LOAA 1G6OA 1CP2A 2XGJA 1IBRA 4XD7D 2O0HA 2YNMA 3VU9A 2EW1A 1E9FA 2D74A 4RVCA 4QC2A 2FSHA 2ODBA 3P26A 4BWYA 3AVXA 4Q5IA 4C30A 3MWKA 3EG5A 3TK1A 3THXA 4Q4AB 1W49A 2Q0HA 4L16A 4D4JA 1KI7A 3SDZA 1X1RA 1Z29A 2OE2A 2QAGB 2I4IA 1KJZA 3FVQA 2H5EA 4LYAA 2F55A 3K0AA 4TMXA 3KJIA 5HTKA 1XXHE 4D80A 1OB5A 1Q44A 2HT1A 1ZD1A 1ZAKA 4LBZA 4OYHA 2ZRPA 5IK2A 1E2MA 2WMOB 3NHAA 3VAAA 2MMGA 2DWPA 1DAKA 4URVR 3SNHA 4RKFA 2A5DA 2Y8EA 1IQPA 3E5HA 4I81A 5FFMA 4C0QC 2ZJ5A 3BE4A 3GEEA 4M1SA 3SR0A 2WJJA 1XEFA 3FKSD 3LD9A 3QXXA 3LO5A 3QF4B 4Q4LA 3B1VA 1WBBA 3VTKA 1S0UA 1L4YA 1P72A 2ZI5A 721PA 2FWRA 2VYFA 1H65A 4LJAA 5GADl 4TTPA 5FBRB 2Z4SA 3A4MA 5CLLA 4ZKDA 4LJ8A 1SXJE 2ZRGA 2P6UA 4LJ6A 4Q1CA 4GBMA 4IOLA 3DL0A 2CCGA 1LVGA 4M22A 4TLDA 1R5NA 1IXSB 2QP9X 1KMHA 4ZCIA 4LSGA 1XTKA 3SJZA 2GNOA 3CZPA 1IJFA 2O0KA 4HZUA 1YR6A 1N6NA 1Z3IX 1OE0A 3SBDA 4BFWA 3THOA 1RPZA 1VG1A 1E9EA 1H8HA 1VG0B 1Z6AA 1ONBA 3K0FA 1E94E 1JR6A 2QSZA 2ZXUA 3EC2A 3KQUA 4V0LA 1P2TA 2RGNA 2X77A 4R2IA 1M7GA 5JS7A 4XD7A 1JJ7A 1MO6A 4QM6A 1OYWA 1UKZA 3QF7A 4R9UC 1E2IA 2AHOA 2ANCA 3RS7A 1ZMXA 2IUSA 2XAUA 3OIVA 1II8B 5JJKA 2ZYWX 4QG7A 1Y63A 4I4LA 5CITA 1GDDA 2GF0A 2FSFA 1GRNA 1S1MA 3MJRA 2QQEA 1E9CA 1OH6A 2P65A 3AGPA 3L0IB 2JLZA 1P60A 2ZI6A 4JVSB 1P62B 2G3YA 2LWIA 5J5CA 2OCPA 1D8TA 1R7RA 4XTRA 2ZM5A 3PUYA 3TSWA 5L8VA 2B6HA 4KODA 1TF5A 1K8RA 4Q4HA 4A2PA 3BIFA 1ZD9A 1TQ4A 1LF5A 3GFTA 1BS1A 2XNSA 4Q7JB 2WKRA 1KAGA 1XDBA 4LZZA 5ELXA 5JI2E 1WE2A 3FKSA 3NC0C 1KO5A 4BZQA 4CEJB 2O8BB 4JLKA 4LY6A 4XVUA 1ZCAA 3T1OA 2ZRLA 1L8QA 1Z0AA 2RH5A 1Z6YA 1JQJC 3CB4A 1OXUA 4QRHA 3WNCA 2WOOA 3DHWC 1Z0DA 2ZRKA 4DLUA 5EP1A 2B21A 1RRCA 3CF6R 3QUSA 4KVGA 1U90A 4XIGS 1G291 1Z0JA 3PG5A 3FYHA 5L3QB 4LK2A 3U4QA 1C1YA 4AKHA 4K46A 4KJZA 4R98A 4R71A 3H2YA 4A82A 4TLCA 2GKSA 2OFXA 3EPHA 2C9YA 1MO5A 4Q1DA 3QG5A 1IN4A 4BFYA 5FTMA 2QPAA 4IOKA 3TQCA 3F8TA 2Q3FA 3OZXA 5LPNA 3RABA 4EUNA 2YVUA 2HV8A 1TL7C 3E70C 2EFDB 1T5LA 4DCSA 4R7ZA 4IFBA 4F92B 4LV6A 4UJ5A 1DVRA 1ZNWA 1YRAA 4JLDA 2XZOA 3I32A 1RZ3A 2ZRIA 1DEKA 1TQDA 1XU4A 4NCHA 2IS4A 2AK3A 2W2TA 2R9VA 1T3LA 1TU4A 4KV9A 5IT5A 4MGZR 1Z2CA 2EWWA 4EPXA 1Z83A 1E79D 4N0EA 4QNMA 3CO5A 3DPUA 2LKCA 2WKQA 3TUJC 1GL9B 2W2XA 3AQ4A 1G3QA 1E2PA 1N5KA 1MT0A 1ZRHA 1ZYUA 5FI1B 2QSYA 1HUQA 2LKDA 5KOYA 2ZU6A 1Z6TA 5CB8A 3AM1A 2H16A 2QAGA 2VPPA 3HYTA 1XMVA 3ZVNA 3DVLA 3W34A 2ZE8A 2ZJYA 4UNRA 3FMOB 1ZU4A 3AGQA 1R0YA 2K5UA 3PVSA 2JLWA 2CDNA 4O0MA 1Q1BA 3NHBA 1RRGA 2C04A 1FQKA 1NIPA 5EE9A 1G4AE 2X2EA 2WWYA 3C5CA 1KI4A 4NYMR 1E96A 1HV8A 4QOSA 4JLMA 4LHZA 4URYR 4DSUA 1G3MA 1EFUA 2CNWD 3ADCA 1QG4A 2GCOB 1G8PA 3PENA 1A7JA 1E0KA 2VHTA 1AA9A 1H8EA 1RC8A 1J8MF 3GJ0A 4GP7A 1F6BA 1E2KA 3QF4A 4A0FA 3K53A 4X8OA 3FHCB 2DFKB 2Q9CA 4N3NA 4FW9A 2QM8A 5CYOA 5J4VA 4NTZA 1M74A 4Q66C 4BFUA 1P75A 4RFSA 4M2LA 1KY3A 3WHLA 2IL1A 1DG3A 3D31A 1PVOA 1KOFA 3SQWA 4B3BA 4DCUA 2WWXA 3A8TA 5JZVA 3UKDA 3VHXA 1IAQA 3W90A 2WSMA 1G8FA 1KO1A 4OHVA 2P6RA 2FE4A 2IWHA 1J90A 2A5JA 4JBXA 4KLZA 3EZFA 1UBEA 4HAUA 1XZPA 4PZZA 4DLVA 3CH5A 1QBKC 3IIMA 2PJZA 3GLGA 1WXQA 3L0SA 1S96A 3LLUA 4MITA 3WRXC 2G1JA 1G16A 4CRWB 2NG1A 1CEEA 3HU1A 2F9LA 2QZ4A 5EXSA 3SI7A 2ZR7A 4PC6A 5H68A 3RS5A 4RD6A 3EW9A 4Z51A 1N6RA 1E3MA 4DCTA 3GEIA 3U7HB 3W8RA 5E7MA 3RRZA 3OEEA 2A5YB 5DGXA 4PZLA 2C96A 4QXAA 1E79A 2AL7A 4PSKA 1Z5ZA 4GSYA 1FL9A 1II8A 1QHNA 4IKEA 5G3ZA 2JLYA 3PXGA 4M9SA 4G5GA 4RZ2A 4PC7A 3WXMA 3VKGA 4Q18A 2ZRFA 4XVQA 1N3BA 3X1YA 2WIAA 3IKJA 3KUCA 3X1DA 1LY1A 1DO0A 4DT1A 2QRZA 4HDOB 1VCOA 1UM8A 2FN4A 5TMPA 2GCPA 4Q00A 4PHHA 4LJ5A 5AUNB 1AM4D 4GT1A 2H92A 4EFLA 4M1YA 3HP1A 4DIEA 5JJIA 4DBLC 3PQCA 1Z63A 1LB1B 1GOTA 1XCGB 3B60A 1P2SA 4P0TA 3ZJYA 3REFA 2EFEB 3CF2A 4G01B 2DWQA 1DG1G 3JVVA 5KSPA 4WW0A 4HYYA 4Q01A 2NZJA 4FD2A 3SFZA 3EZ7A 3W3ZB 3LXXA 4QHYA 1YZGA 3TBKA 3A4NA 1XXHB 2CNWA 4CYMA 4NBSA 4BQSA 2O0JA 4CEJA 2O8BA 1ZM2A 2ZVQX 3W9YA 4PZYA 4UJ3A 1G3UA 1VYTA 3KKNA 4U02A 5H70A 4B76A 2NOAA 3TRFA 1GRQA 4BLOA 4TL9A 5HPYB 1I4TD 2WICA 2VSOA 5J40A 3AF3A 3VQTA 1NBMD 1GWNA 1OXTA 2OLKA 1JR3D 3LVQE 2FEOA 4TWZA 4U00A 4DSNA 4MYTA 5L3QA 2DPXA 1N0UA 1GL7A 4UNPA 5LD2B 1CR4A 1N5JA 4IVPA 4MYUA 3VR6A 4IXMA 1OXSC 4RSGA 2CEAA 1XD8A 4D4LA 4P31A 3N70A 5AJXA 3OIYA 4B48A 2OILA 4I1UA 1SHZA 1N0WA 2C77A 2Z83A 3W5JA 3QOFA 4C2UA 2AFHE 4ZCMA 1YZUA 1U9IA 3AKCA 1OXXK 4LHVA 3QXJA 2A5GA 2GILA 3ONWA 4M21A 4WZAE 1YHNA 1T6NA 3DKVA 4HUTA 2WJYA 1UEIA 4OQXA 4PXAA 4LBWA 2WJVA 3NXSA 5E95A 3BD9A 3CWZA 4POAA 3KKQA 5F2EA 2VL7A 4FCVA 3KB2A 2RMKA 4NPHA 4AURA 3PIRA 2FNAA 2LCFA 1VCNA 4DVGA 1OIVA 3NDPA 4KCGA 5GJWC 4BLPA 4DDTA 5JHHB 1W0JD 4B3XA 1A2BA 2GK7A 4Z54A 5FBQB 2Z5FA 4M1OA 3RYTC 4E5UA 5JBQA 3QNUA 3GLGE 1SVLA 5BYJA 1G5TA 1XCPA 1ZNZA 3HR7A 2CK3D 1KK1A 1QVRA 5K8UA 5HCIA 3UATA 1S4QA 2D3WA 4A0GA 1W0KD 3B1ZA 1G7CA 5F98A 2WTUA 3ICQB 3ZQ6A 2GCNA 3KXLA 3TGPA 1W4CA 2BIFA 1DTSA 1G5RA 1P2VA 2I1QA 1ZW6A 4R2HA 4U5XA 3WBJA 1MV5A 1NLYA 1VYVA 2WMNB 3DOFA 2BMDA 2VLIA 4GZLA 5AJWA 4AKGA 1E2FA 4FMCB 3WNDA 4DXAA 3R8CA 2VH5R 1A2KC 2RKOA 1XJ0A 4M1KA 2A9KA 2QTVB 4YDSA 1NN5A 4LUCA 2ATVA 1P7CA 3HYRA 1JALA 5SZKB 4HAXA 1GAJA 3AUYA 2E87A 1NBMA 3VU9B 2GCOA 5BWMA 2V7QA 1YR9A 1JR3A 2FX3A 2WWFA 1C9KA 4TQ9A 2QMEA 1P9WA 4WXPA 3ZVLA 1N6IA 1VPLA 2JDID 5KNCA 1V5WA 2JLQA 1DS6A 4K81B 2E9SA 2OHFA 3IEVA 1CJKC 2JJ8A 3ZD7A 2ZAOA 1OPXA 4LHXA 4GOJA 1LS6A 3AVYA 3RWMB 2ZITA 1FUUA 3GPLA 1J70A 1XCMA 3MRSA 4UNNA 5F3WB 1KI3A 2V1XA 1EX6A 4QHSA 2GETA 3T35A 3IBGA 4D0NA 3Q72A 2GA8A 5CK5A 3GFOA 2AR7A 2QA5A 2JCSA 1GUAA 2FF7A 1FNMA 3T5DA 1OV4A 3MWJA 4D2IA 2BCJQ 1U94A 2J46A 2YWEA 3SJCA 3C8UA 1YZKA 2ZJ2A 3H1TA 4OKSA 1XEWY 2VF8A 1FQJA 5KHOC 3U7GA 1U9IC 4QNRA 1ZJ6A 1WBDA 2WJHA 4HB4A 4OQNA 3AKDA 3TIFA 2PBRA 4JLJA 4QGHA 3WYGA 3K9GA 2AFIE 1E98A 1OLOA 1M7BA 1Z28A 2GF9A 2D4HA 1N6KA 1NLFA 1XTRA 3MWLA 3RRYA 3KQNA 2JJ1D 4AYXA 4OJKA 3Q3JB 1W0JA 4RD2A 2IC5A 3SHWA 3PCRB 1WRBA 4XWKA 3P4XA 4A2QA 1M7HA 1W4RA 2FU5C 1E6CA 2ZYTX 2R6GA 1E0JA 1T0HB 2CK3A 2YOGA 3UXMA 1G7TA 2RGXA 2W6ID 5KDDA 1W0KA 1E2JA 1MR3F 2DR3A 4A6PA 5BXQC 2J59A 4F38A 1W5TA 3MFYA 1GNPA 3DM5A 2WV9A 4HZUB 2WHXA 3C16C 1W2HA 2OZEA 3A1UA 5B58C 1E1QD 2XTNA 4IEIA 4OK6A 1AKEA 5TXGA 2OO7A 4DC9A 2H57A 3OF5A 4BZXA 4DLTA 1UKYA 3B9PA 2A78A 2ERXA 3LNCA 2Z0MA 1W48A 5KTYA 1AGPA 4ABYA 2BMJA 1CBUA 2IEYA 1B23P 1CLUA 1Y3AA 3CKLA 3LY5A 3NBFA 1Q57A 2BCGY 3F3YA 1F48A 3LDAA 4L8GA 1Q21A 1KYIA 2JDIA 1FFHA 3L2OB 3LVRE 2IHBA 2L0XA 5C18A 1DE0A 1NKSA 4UQOA 5JECA 5SZIA 4OQFA 521PA 1IN6A 4G3XA 3CRRA 2QRNA 4YMSA 4ZDIA 1KDTA 3I72A 2W2VA 3GMTA 2B8TA 4L5BA 3RSLA 1CJVC 1S3SA 4Q7LA 1AS0A 1D5CA 2GEUA 3K1JA 2F1HA 2GBLA 2Z6VA 3LRPA 2Q21A 1MH1A 1HQYE 2QNRA 4DZZA 3ADDA 1G7SA 2OBLA 2RB4A 3B85A 2ZSAA 3AVVA 3FOZA 3PJRA 1ESNA 2PT7A 1NBME 2ZRHA 1JR3E 4PQYA 2GJAA 1OF1A 1NLZA 4Q21A 2JJ1A 2DB3A 2CBZA 4HATA 2QP4A 4DLRA 3EC1A 2RGDA 1IN5A 1UBGA 4GMXA 4GI7A 4PQRA 2DHRA 3WP0A 4EJSA 5DSZA 5DI3B 1LV7A 2GESA 1KJWA 2AKAB 3MWYW 2IF0A 2ZR9A 3B13B 3TUIC 2W6IA 6Q21A 5BN4A 2C78A 4ZKEA 4NYMQ 1YR8A 3EASA 3U4QB 4YMTA 3IILA 4YONB 1ZM7A 1I4DD 2J5XA 4FINA 1OHHD 4F4IA 4HDCA 3IEUA 4OHZA 3FHOA 2DFLA 3KJHA 1E1QA 3EA0A 3UWOA 2GJSA 2FDCA 2ODNA 2XX3A 1JBKA 2IX3A 2IYTA 4JKYA 3K0SA 3MCAA 3QBVA 2AN9A 4IVRA 4I1SA 4TLEA 1KHTA 1MO4A 3TKLA 5EJEA 2IYYA 3KKPA 3QE0A 4LV8B 4XSHA 2ZRNA 4S35A 2F43B 5AUPB 1NMYA 1W44A 3AEZA 3X1ZA 4GP6A 3I62A 1E2EA 3R8FA 2N1BA 1AQUA 4MUBA 1TUIA 3TMKA 2IYQA 1BIFA 1QHGA 3LW8A 3DKPA 4PHGA 2RHDA 5KU1A 1KNQA 2GWHA 2VHUA 2HJGA 5IHPA 2OG2A 1NL3A 3HDTA 1AKYA 1Z47A 1RW4A 4Q03A 2C9OA 1W7AA 3I92A 1BMFD 3ZZ0A 2YWFA 2ZRBA 1X86B 1HEIA 3TR0A 4LX0A 2HDNB 4JSTA 4ESHA 2AXNA 2BBWA 2DFTA 1UDXA 3AV0B 3BFXA 1NJFA 3AVTA 2NGRA 1DAEA 2Q3HA 4KITB 5LD2C 3EX7C 1GTVA 3DOEA 2GBLC 5D3QA 3AF0A 2ZUCA 4BECA 2EWVA 4DKXA 3IBYA 3AUXA 1DO2A 3ZVRA 1RVDA 2OSBA 1HTWA 1KIMA
chains in the Genus database with same CATH superfamily
5F76A 3RRJA 2R6CA 4GX1A 4KFSA 4BCDA 4AJ1A 4PO8A 5EHGA 5IKEA 4DLXA 4JUIA 2NQTA 1FJHA 3ETNA 1HFJA 4HWTA 1I94B 2PEYA 2FZGA 2HKIA 4CCSA 3HKBB 1H9CA 2JIZD 1RMYA 1YTUA 5HR5A 2PZJA 4ICIA 3AEXA 3R40A 4A4DA 4QFDA 1GAEO 1Z6GA 2GEJA 1TGYA 2H0QA 2AB0A 3QU9A 4J4TA 3TLXA 1W5EA 2AEJA 4G4GA 5B6JA 1Y5LA 1C7ZA 1LPSA 3BGOS 3UK1A 3ZN2A 4LXQA 1RS0A 1TYCA 1R8SA 2Q2OA 3AP1A 1DEXA 4W8HA 5K8LA 1QFMA 2O8FB 4RZIA 1RI5A 1U8TA 3ZE2B 4RJIA 3ZH2A 1WB9A 2ZS8A 2Y05A 4FVTA 1EIZA 1FJ2A 1DRKA 3K6SA 3GLRA 1AV6A 3T12A 4V0OA 4IDGA 5BT8A 1CEQA 2DHQA 1Y80A 2GZDA 3DCYA 3OTOB 1K3FA 4PX5A 3BOSA 2IYRA 3O8BA 3HEMA 1X9IA 2JGLA 1SC3A 3AJRA 1AY0A 1UQTA 3L8ZA 5IM5A 5SV2A 3FHLA 5LZ5A 4MS4B 1GSOA 2CUZA 1WCWA 2LZ0A 4D4GA 4B3GA 1A4XA 3DOCA 4UHBA 3VZQA 3BWDD 3LBHA 3OQIA 2D1QA 3L7NA 3OP4A 4KOEC 4JMPA 4F93B 4QT0A 1QGUA 2IGTA 4QDTA 2YMMA 2ZJBA 3ABRB 3ESQA 4BZPA 1O7JA 1R0ZA 5IARA 1QK4A 2IUTA 4EO9A 1PZNA 2IEGA 4CGYA 4NEHB 2HDWA 2YXBA 3FIJA 4MQFB 3GN1A 4PSVA 3G89A 3PQ8A 3R4CA 3FOWA 2BEKA 1SFRA 2ZEJA 5FLYA 3W6NA 3VPBA 2VEDA 4IVQA 2IT1A 2RJOA 3AI2A 2NSHA 3OKFA 2ZIXA 3ONNA 1CYDA 1VJRA 4MKIA 5TQ2B 2OC4A 4QBFA 1O4WA 1CY7A 1RYBA 4J0CA 1AB5A 5FOQA 1SXQA 1YRBA 2IDKA 2QZZA 4EX7A 1P9LA 1EBUA 2PFSA 3BZBA 3HI6A 2HHHB 3CN9A 4FHDA 1G8KA 1NUSA 1K92A 5TV2A 1DXOA 2R48A 1T2EA 2CJWA 1G19A 2Y9MB 3A6LA 4R8RA 4BKPA 3PPVA 3NBXX 4XGKA 4YLEA 4ZVQA 1P4SA 1JPUA 2WPDD 3S2SA 2FPLA 2FR0A 2Q8PA 3TUZC 1FSPA 1S5PA 1Y4UA 1E5TA 4KSBA 1Y8AA 4Z8YA 4E2ZA 4JVOA 1QNLA 3G7UA 3DWGA 1LLDA 3ZWKA 3FZYA 2UUAB 4EVIA 3BVPA 4P4GA 2PJRA 5H8WA 1PFGA 4AZ0A 4YRZA 5LFAA 4N8EA 1ZJ5A 3D0QA 4ND5A 4QLAA 1OAKA 1E9SA 2BKXA 3FFAA 3O6VA 3CZCA 4MI3A 5D3KA 4LF7B 5T57A 5D6NA 4C04A 2FSGA 4I3FA 3WXBA 1OOEA 3BRWA 2O2CA 3OT1B 1IZ7A 1XXLA 2C95A 3H9BA 3LXMA 1Q3KA 4HLUA 3PS9A 3B6IA 4A3SA 3UGJA 4RKYA 4CV3A 3UB4A 3PEYA 4KR9A 4X1IB 1V11A 3N2EA 4OQPA 3BAFA 2SCUA 3AFMA 5B7GA 4JBLA 3UJNA 1X14A 3TF5A 2FZVA 1V1RA 4G56A 5C32A 5IKOA 1A4RA 2YINC 3CLUD 2IYAA 1O57A 4DW8A 1IN8A 5LLTA 1N78A 1OT3A 5IVDA 3PPIA 3WO0A 2X3YA 1L3CA 1R64A 2BM0A 1ZONA 2EJBA 2J7PD 2QUHA 2R1VB 2QTBA 2FN9A 1PFQA 2FPIA 3PF9A 4OQMA 4TKMA 1P9NA 1U6IA 4ZAGA 1S9HA 2OHOA 5H0IA 1KPGA 3WKAA 2B7BA 4RGVA 4QOEA 5FPSA 1IM5A 1A9SA 1WXWA 2R97A 4FW8A 4BNWA 3NONA 2IXDA 3C3XA 5K7SA 3WGJA 4D9HA 4CQLB 3FKJA 3CZMA 1CUJA 3KKLA 1B2LA 1TUEA 5T64A 1Z2PX 5MGBA 3T1TA 3ICEA 5JMPA 4BTVA 4JJAA 2I3GA 3ORSA 3VR3A 4CIAA 3TFWA 4KVAA 5F9MA 1JTEA 3RVBA 1WD5A 5TE9A 2ENUA 2OVFA 5HKKD 1EWTA 3BWEA 4PYMA 3NR2A 3TBHA 4RLFA 1DQRA 1RDFA 4ZDJA 1HT0A 2JBHA 4XFDA 3CUKA 1GN9A 4LGCA 3RSSA 1FP4B 4H9GA 3ID6C 3ZY4A 4D6XA 4DKJA 2VSXA 4CM8B 2XB2A 2GTPA 3U3DA 3QLEA 1TZCA 5HA5A 1AXRA 2CDCA 2J9XB 2RHMA 1YA6A 1SCAA 4G8DA 5LP6C 2YMQA 3LS2A 2VIIA 1PZEA 8ATCA 4PYKA 3INYA 3GEBA 1U02A 3UHPA 1NNSA 4Q39A 2C4NA 2H6EA 4B3DA 1IBCA 1L1RA 3AUSA 3S4YA 1PDWA 4JCOA 5FUXA 5KJ6A 4FX5A 3GELA 1RHJA 2VTEA 3FVWA 2IYUA 3Q6MA 3R6GA 4DV1B 3BK1A 1XDWA 5KAMA 5TQVA 3SXPA 2K6GA 2ZPUA 4KDRA 1NKTA 4PGGA 2GJKA 3NIFB 4F2DA 1TAGA 2H1LA 3BK7A 1EWVA 2J3JA 1PUIA 2IBSA 1AS2A 4ER3A 1GO2A 3K70C 2IHUA 3LSTA 2EG9A 4HDRB 1QVAA 4O4HA 5F7JA 3V1TC 4JVLA 3ZHQA 1P0CA 1VSBA 4WD3A 3WZ2A 1BXGA 3HSSA 2FEWB 2PSFA 1FS6A 4MPPA 2I6GA 1CUGA 1J5XA 2H9IA 1RWKA 3E8SA 3IESA 5A6VA 5A7FA 1ZH2A 3THSA 1HI9A 4G97A 2QT1A 4G2TA 3C7TA 3LRXA 3MTAA 5ILOA 1A5SB 1BA2A 2C5GA 2FRDA 1L7OA 3JWEA 2RAVA 2W93A 1WCIA 3EY9A 4YMWA 3X2SA 5KYYB 4O3MA 4HKTA 3P71T 1K0FA 4GMDA 4ZIRB 3BTOA 3HU3A 2J4DA 3QLVC 1OIXA 4ISBA 4JL8A 4MB2A 2DMRA 5TRTA 1ZZGA 3SF0A 4B3FX 2D2IA 3VPDA 1JFTA 4WSOA 1WIWA 4I14A 5G1PA 3Q7EA 1YVDA 2C7QA 3DLHA 1K6IA 2C31A 2IOQA 1TEHA 3QNWA 2X58A 1YT5A 3CH4B 3JYQA 3LQRA 4N5MA 4CM6A 3FFTA 4YP0A 2CKMA 2HU5A 4WBNF 4YV7A 2RH8A 2XWPA 4M0FA 3FE2A 1I36A 1OIWA 1WLSA 5D86A 5FTJA 1ZD2P 1G64A 1RP1A 2W2KA 3AUFA 4PLCA 4CV0A 1P80A 4BNMA 2WFLB 2MSNA 3SGLA 2KBEA 4XW2A 3CU5A 5KWJA 3OCYA 4KXUA 3TSZA 3WYBA 4EFKA 4TRMA 4MROA 1BNCA 1XT6A 3U7QB 4UTOA 4CU2A 5EJ5A 1ZW1A 4Y2HA 2NU8A 4B7CA 1QQBA 4BMYA 3QELA 2GK6A 5LMCA 3IP5A 4OCZA 1KMNA 1DGQA 3C70A 2I4TA 1RM0A 3L7YA 3UMJA 1BOOA 2GLXA 4L4XA 5JS2A 4GQAA 2H8KA 1OH5A 1K7FB 2BGRA 2H1IA 2QGNA 2Q3CA 3OOEA 4JBYA 4JS0A 4MGKR 4QXOA 5CVCA 3CTPA 2J9GA 2PVSA 1NVGA 3P5SA 1ZC3A 1FTYA 5AJZA 2EGHA 4KXYA 1QRAA 2CL6X 3M3DA 1SR8A 2WD7A 2O8NA 1HRKA 1NBWB 2W37A 1EHYA 1VLJA 3VVLA 5FWXA 1FQOA 3O82A 4WN9B 1VKJA 1JSCA 3DVAA 5DBFA 2WI8A 2IU6A 1G41A 4OXYA 4WCFC 4PLPA 3ZV7A 3BCRA 3N5CA 1LQUA 4W5HA 1PYGA 2GO1A 4KQ1A 1OJ7A 1G5HA 4F1JA 1T4GA 2JIBA 5HK8A 4N7RA 5LMZA 2GPYA 2PDAA 3HSKA 3N07A 3M6AA 3O26A 4Q82A 2FWAA 3SDSA 3OETA 4PE5B 1E20A 2R8EA 4LGVA 2BWJA 2G8LA 2B1GA 3OZIA 3MMPA 1HPLA 1O9HA 1XR3A 2AOVA 3QSYA 5C0OE 1LTQA 1YXMA 1Z12A 3HCEA 1I2DA 3QY0A 2J6BA 3GB9A 2PT6A 4HDSA 2ATXA 5DNDA 5EIBC 3UICA 3V7UA 4W5TA 5T3UA 4MPJA 4LW8A 3L4EA 3ZLBA 2FCRA 3F5FA 3LC2O 1Q91A 1UJBA 4TKUB 3T06B 3WWOA 4WJZA 5AI6A 3ILVA 1XRPA 5C46F 2BDUA 1VPWA 1KYZA 4R3UC 2BFAA 4EVSA 1S2NA 1RXIA 2X5NA 1P45A 3VPAA 1YE8A 1JLSA 2HA3A 3L06A 3PNBA 5A4KA 1JJVA 4WNAA 1OH8A 1G2IA 3O21A 3YASA 2XUQA 2WILA 3SIWA 2GJ9A 1BWSA 2R2GA 3I12A 4KGXA 1XJCA 2NZYA 2ZTLA 3U4DA 1U1IA 2X0DA 5IBCA 3BG5A 3GMIA 4LMBA 1JGTA 1PUJA 4JVNA 5K3FA 3WGUA 1M1YB 2GM3A 2IXEA 3CW8X 5E1BA 2WR8A 1W96A 4MUIA 1N9ZA 2FUG1 2IU3A 5ITZB 1HDCA 3ZY6A 1KPIA 4M1QA 3L07A 1JB9A 3TVYA 5IXSA 4BVBA 2KHZA 4D45A 5AR1A 3W7VA 3HYNA 1D9ZA 4ONEA 1RKBA 1YZNA 1WP4A 2JD2A 3IQXA 2EKQA 3O7WA 3TAXA 2WZDA 3N0TA 4FHFA 4NDNE 4PRYA 4DMCA 1AD2A 1ATZA 1KFKB 1BS2A 1HZZC 2D5LA 3WYFA 3MOGA 2AH5A 3WLSA 3UT5A 4JQOA 5J43A 1FZTA 4XYEA 1QV7A 3RYIB 3CINA 5A4AA 1M2OA 2OORA 2VN8A 2YBDA 3GEMA 3EIUA 1DUSA 1E1KA 1UJ2A 1TTPB 3ZWXA 5HUJA 4HRAA 4F9FA 1UKEA 2VJPA 3FMGA 4CF7A 5KREA 4D26A 1DOAA 1FOEB 4ARIA 1U1GA 1DKMA 1TF7A 3P19A 3AKEA 1OTYA 3PI6A 3HUTA 4OX9Y 4QJ5A 3S68A 3DMDA 1CF4A 1LS1A 4IHKA 1YGPA 5A3SA 1XNJA 3H1EA 1PX2A 3C8DA 4LG1A 4UHKA 5DM0A 3SSMA 1LW7A 2D0PB 5BUCA 1DINA 1YU9A 4OH1A 1MJGA 2MSDB 1YRLA 5A04A 1O0BA 3T1VA 2C2ZA 4KWEA 5CAEA 4C22A 4AO6A 2QRUA 2OB1A 2R2AA 3CMCO 3G2JA 1KS2A 5BURA 2FW1A 3AKYA 2X9LA 5REQA 1VI5A 2HEIA 3F67A 1EAMA 2GOYA 1NF8A 3F46A 3VX3A 2Q4DA 4UBJA 1NI3A 3MINA 2X0IA 4HI0E 3ROQA 2PUEA 1HE8B 3W8FA 5KC9A 4UBOA 5LXTA 3L7KA 4V39A 5FO0A 4PRZA 4WKOA 4TZ0A 4N3AA 5FDFA 1PFUA 2ETXA 4B85A 3V8VA 3T7SA 5CXXA 3W1EA 2E5WA 1XMPA 4XTCS 4WOKA 5JV5A 1Y1LA 2E85A 3LRTA 4CCYA 2H4ZA 3DBIA 3FDFA 1NAIA 2BLNA 4MX8A 1YUNA 4NBRA 3ZWBA 1NN3A 3DEJA 1N1MA 1XN1A 2PLAA 4WWHA 4QVKA 4W5RA 1NG9A 1RLUA 2W48A 1VI6A 1C7JA 2XXJA 3L49A 3M3HA 5EIEA 9MHTA 3ISJA 1EE1A 1BO6A 3PITA 3R7FA 2O2XA 4N6GA 5A4IS 1YONA 7ADHA 3RODA 2KMLA 1ZXXA 3D6AA 3L05A 3FYDA 1XELA 5K03A 4XEHA 4TMZA 4U7HA 3QUBA 2WKPA 3L6BA 2AQIA 9ATCA 1Q14A 3F47A 3O7MA 3HUEA 1CZKA 4K6FA 1GNQA 3QA3E 1IUOA 4L7VA 4LHEA 3ZNNA 4CM5A 2XDWA 3O1IC 1RU3A 3IBTA 3KE9A 2GWRA 2OD7A 1XZHA 3FYUB 2EYUA 4N40A 1KJJA 2P5SA 3I2YX 1ZCJA 5IASA 3L0PA 1UPBA 3S2ZA 3IQGX 1U9ZA 1QJ4A 4MA5A 4KWCA 3HJHA 4WV3A 4ZU3A 2HF7A 2ZUBA 5DMHA 2RGAA 2IE8A 3VR5D 1DELA 2XXAB 4M0LA 3QE4A 2ZYRA 5T3YA 1IHXA 1U80A 3B3JA 2BDTA 3HVRA 4JI4B 1I7LA 5FI5A 1FRFS 1NG1A 3AOGA 3NZEA 3NIWA 3UCFA 1FYEA 2Y0PA 1FZQA 3EIOA 4RY2A 1M34B 3QKTA 5HW0A 3NKLA 5B30A 5ENDA 3QITA 3RYFA 5KDLA 3KU1A 1SCQA 2FGJA 4ZO7A 3ZW7A 3H65A 2BM1A 1PL0A 4G9GA 2VK2A 1HLGA 2P5TB 1L7RA 2BKEA 3RHFA 4Q9KA 1JMKC 4GMGA 5CT6A 1TM2A 3UOWA 3WX0A 3TLAA 4UD6A 2IIPA 1U8ZA 4C0JA 1TGVA 2D5AA 3BHJA 3QU5A 4QQKA 2WJ4A 5D5PA 5LQNA 1N2HA 4IXWA 4ZDWA 3SQOA 4F0JA 5MN4A 4QFBA 5E8RA 1T5OA 1W87A 3OTWA 1R8XA 4EJ2A 4II7A 5HOEA 3F5DA 4D42A 1K1EA 3ZKWA 3L7IA 1F1JA 1UZUA 3RVRA 3FTEA 1R18A 3R9KA 4DC0A 2XE4A 2MU1A 5EGSA 5FCDA 2BFBB 1KJIA 3Q3VA 2H1HA 2H9AA 3SE0A 4RSRA 3MTGA 1W34A 1QIDA 1NHGA 1TKRA 2JARA 1IEQA 2JGEA 3GRAA 1LSSA 2IBMA 2PL5A 3MPUA 1J2EA 5E6SA 4ZHQF 4HXFB 3VSBA 4XSGA 4MICA 4TXJA 1TK2A 1I6KA 2IXFA 4S1NA 2NZ2A 4J3JA 4X3OA 4EGAA 2BHTA 2BUAA 4RMNA 4NH4A 4Q3CA 2GCIA 1F5SA 1X7GA 4S3MA 4EYKA 3O1LA 4ALLA 4BASA 4EHJA 4J6FA 2MYPA 4HGRA 5DGTA 2H7CA 3DP7A 3G8DA 5HQTA 4TSFA 1OLSA 2P1ZA 4I4TB 4HYEA 4KYVA 1PG2A 3L4BA 3DWIA 5E3HA 4DJEC 2R6AA 2XGOA 3EQ6A 1MJHA 3HRKA 1ZRMA 1ZMTA 1ZK2A 2QROA 2VJOA 4XVRA 4B32A 4ZV4A 4KU4A 3AIKA 2FQXA 3A6GA 3K1TA 1M66A 2FH5B 2QZSA 3GWZA 1KAOA 1UZAA 3PHJA 3W3AA 4FZ5A 3GL9A 2UZIR 3W9UA 1DJOA 1VIMA 3OPQA 2G1UA 3NH6A 5GONB 5LP1A 3SOPA 4NV3A 4GWKA 3ZHYA 1CZRA 4X65B 4RTOA 4MW9A 3H1PA 3EVBA 3CEJA 1BKDR 1QHHB 4PG4A 2WSSA 2PRZA 3O2SB 2R1TB 4AS2A 4DVJA 2VNSA 3TL3A 3N8KA 5IUNC 1HTTA 3A1CA 3FETA 3O84A 3O8OA 2J3EA 1Z0IA 5GPBA 3R9IA 1TPYA 1KNXA 2IFTA 1M73E 3M6FA 3T15A 4F97A 3U40A 2WFMA 2XGSA 4RV4A 3F0TA 3B3QA 2BRUC 4AKIA 3COWA 3S28A 1S4MA 3EMDA 3IDOA 1CTQA 3ND5A 1ZJ4A 2W71A 1W35A 2A84A 1CF2O 1NC3A 3ZQUA 2ZBVA 3HLYA 3AUAA 4F5DA 2ZFUA 3GRRA 4M9QA 3ZY3A 1EFAA 1OVMA 1BGXT 1PR5A 3AMVA 1RBYA 2EP7A 4HLCA 4BX8A 1W93A 4V0LA 4EGFA 1KDOA 2A57A 1DX9A 5HCNA 3VO9A 1NQVA 3PCTA 3SZ3A 2CE2X 1ZR4A 2QNBA 4PTZA 1EDEA 4MI6A 1V0JA 5CM8B 1LPOA 2HCJB 4NP6A 4BMVA 4G0WA 4R3WA 5FQOA 4WVLA 2RHHA 2VSFA 2YJTD 4YGXB 3R5JA 5CVJA 1SKYB 3ZU3A 5CB0A 2LVBA 4G5QA 1GZHB 2C7BA 3PJEA 1TM1E 1PHRA 2OCAA 1B1CA 3QKUA 4UQPA 1NHWA 4MHOA 5EUQB 3W8NA 1CFZA 2A0KA 4YR9A 3UAYA 2EQAA 4AWXA 3T61A 4UNSA 2ZJOA 1UFQA 5JSYA 1XLTA 4LE1A 2Q29A 1AU9A 1YBMA 3QEOA 4Y0VA 3OFNA 4JNKA 2B8EA 4OL9A 3T3PB 1FU7A 4KLAA 1JXMA 1O3YA 1UXJA 4IMIB 3DZFA 1NIJA 3A1SA 4HY3A 3ZDCA 3QQPA 4TL7A 4CIBA 2H5JA 3LT1A 4CL0A 5I7SA 1O94D 5K0GA 2CL0X 3TQRA 4UUQA 1XA0A 2HMVA 1HM5A 1JW9B 5FJIA 3HXMA 2GD6A 1N2CA 5EE0A 3A27A 4DNXA 3OICA 1QCZA 1KQGA 4HXYA 3AM5A 1CJBA 4JB0A 3RW9A 5K20A 3MJVA 4J2HA 3TNLA 2HRBA 1WCYA 3CUTA 4YCCA 1IB6A 2V55B 2ASVA 3L0OA 3QE3A 4BC1A 4EEZA 2FMHA 4INPA 1SXGA 2XBMA 1ECFA 3SYLA 1HA3A 4PU0A 4B7XA 5IJ9B 4XVHA 5FUBA 4MYSA 1Z37A 2J32A 3IAS6 4MS1A 4RHTA 3VX4A 1Y6JA 2WIBA 4WCDA 4CKWB 1VP9A 4LRTB 3D4LA 4BRZA 3RVOA 4YRNA 5K3AA 3UJCA 4OQYA 4UBMA 3BIOA 4PGAA 3MSXA 2OQIA 4W6ZA 1B8PA 1ACMA 1E3QA 4XIIA 3TJMA 4CM3A 3FM9A 4GRAA 5IEJA 4K5QA 3JZIA 4W8GA 3C3WA 1HKUA 3CJTA 2O59A 1K6EA 1X2BA 4TX1A 5GVRA 4RCYA 4AAYA 5BSKA 3CNEA 3J80A 1J0BA 5CR9A 2BM9A 5FLKA 3U3ZA 3VU8A 4KO1S 1A9ZA 2VT3A 3DVRX 4MUFA 3F7MA 3MSCA 2O07A 2IVZA 4JX9A 1MABB 1XEXB 2CB9A 3LYHA 1MBZA 5JE8A 5L7YA 3KDPA 4JI1B 3W5DA 2C29D 4CF4A 3D0OA 1BWQA 3BBPA 1ZIPA 3SJBA 2CHFA 1QPGA 1YIOA 4LRYA 1E5LA 3LVFO 4RTRA 4QEKA 3STHA 4J0JA 1QPBA 1HYHA 3V1KA 3THWB 3I76A 2RE8A 2FZCA 4KEAA 1KQOA 3STYA 1J1IA 1C4OA 1U31A 3WB2A 5F4BA 4FCTA 4EWLA 2J1LA 3LHKA 1PO7A 1RWNA 1Z35A 4GVXA 1X0XA 4Q4JB 3TLGB 1PBTA 3NVAA 1EUZA 1WS6A 2R5NA 5J9FA 3TI9A 1SXJC 4GRIA 5ITWA 2NIPA 2IZ6A 4ON9A 1UBSB 1RKUA 4OVKA 3UY4A 1MQSA 5EHXA 2YZ2A 3S55A 1I2CA 2FUCA 2KLBA 2FHPA 1EFDN 2D62A 1ODJA 2CJPA 1XMQB 3ZKAA 4ZFNA 1PT7A 5HIIA 3E7PA 3TPCA 2V59A 5CFLA 2Q1YA 3V1UA 1TJ3A 3EQ9A 1CRPA 2G40A 3KSRA 2SICE 3NHZA 4BNFA 2R8OA 1ZM4A 1V8BA 2XMDA 5HKAA 3C7KA 4LYFA 1Z16A 4BV8A 5JSZA 5GQSA 3IEVA 3K9LA 2HWXA 3LG2A 4JODA 1P6UA 1QHSA 2FJUA 3DNFA 3EWIA 3JSXA 4H7JA 5K3DA 3B8HA 3HLKA 3QX8A 1WKVA 3ZHRA 2VNHA 1TDJA 3OZUA 5JD3A 3QEAZ 2FPGB 3EGIA 1EJ2A 3Q7RA 1AGNA 4HP8A 2AG1A 4YGYA 1N2EA 2F59A 3ETHA 4K6KA 3JQ8A 1JI3A 1ZIDA 3HPRA 1E77A 1YDWA 2P2LA 3LPCA 4QOIA 5HGJA 1CR0A 5L3ZA 2J3HA 1FSGA 3KYIB 5IVKA 1DX6A 5CA0A 4BGEA 3EXFB 4J0EA 4ARCA 4A8JA 3L6DA 5CTAA 2CXRA 2QUJA 3QVGA 1X7WB 2BI7A 4RKEA 3WLJA 2OV1A 1ADCA 3Q9SA 1M5TA 1XYYA 1G8JA 2V3VA 4MKZA 4GI1A 2E0IA 5D1NA 1J7KA 1HFEL 3AF4A 4IMJB 5A6SA 5BUSA 3DE7X 3QXSA 5LP6A 4HK4A 4IIHA 4H7HA 1H2YA 1F2VA 1MB3A 1HT1E 4YJFB 1PQYA 1GZ4A 1YK0A 3OTQA 4GM1A 3UJ7A 1RXVA 3O92A 1V8PA 1I7SB 4L4ZA 2QL5A 2PX3A 1WHSB 1Y7TA 1U7ZA 1VLQA 5EJIA 2P9EA 2YIJA 3HJAA 5EIWA 4EPVA 3ASVA 4HPWA 3MLAA 1PR3A 4PYQA 5AP9A 4J0IA 4QGAA 2Q6TA 5HG0A 2DJIA 3N2GA 3LY8A 5C31A 8ABPA 1CIPA 1VRWA 3PRHA 3KPUA 2DUNA 1FMJA 3T5TA 4CMGA 1E7RA 2HRDA 2JFVA 3ZXUB 3I4CA 4J90A 3ETGA 4YALA 1ZCZA 3W4KA 2D1TA 4D79A 3BXHA 2ZUDA 4JASB 3IB6A 1CE8B 5BN3B 5KEIA 2BGUA 5A3JA 4RIHA 4WLEA 1O6CA 2FW8A 4NFSA 1JQ3A 3TL2A 1QGZA 5KNBA 3BICA 2GGSA 1EM8B 1QHYA 3L8DA 2BGMA 1MC5A 5P21A 4KAAA 1ESEA 2QTLA 3COSA 2PMFA 3RBVA 2PUBA 1XMXA 1GA1A 3G82C 3JQGA 2PTHA 3MBOA 4YFVA 3GT7A 3WKCA 2EFCB 3CRVA 1H2WA 2JHAA 1MJFA 2ZI3A 3H0EA 1J0AA 1PZFA 2DFVA 1Z0SA 5I8PA 4K28A 4L85A 3JD3A 3ZX5A 4MAMA 4GKVA 3QLVA 2CV0A 1TAUA 4RVSA 1P29A 4RZXA 4PF1A 4NXMB 4JJFA 3MCTA 4LC9A 1W5SA 3K2EA 4JKIA 2WYVA 3A3NA 3CMMA 4Q3NA 1HGXA 1U5BB 2EERA 4CMEC 2JW5A 3UPDA 5HXAA 1PGOA 1ISRA 5ALUA 1A9QA 2H3HA 3IRUA 3SLRA 5JVDF 2FCAA 2BHRA 2KI5A 3FCXA 4TMFA 1G20E 1G21B 5AKEA 3DDCA 3IKVA 1N2JA 1H2RS 4YN3A 1JAYA 3VPFA 2CCJA 3ZIDA 2MINB 3CLTD 4AYTA 4PPFA 5KS2A 2YC2C 4B3MB 4UOQA 1C8LA 3F1KA 5FYDA 4YAWA 1ZL2A 3FCUB 3QPBA 4FKBA 2HH9A 1SU4A 2C9DA 4IUDS 1PQWA 2ES4A 1AH2A 4F4DA 1GD1O 3EPLA 4F6CA 3AKZA 4FGKA 3X1WA 5BOSA 1GV0A 5BSRA 1OZAA 3GLIA 1ETUA 3RYCB 4DDVA 1V6SA 2BJVA 3PT9A 5H7XA 3EGVA 4NCXA 4POOA 1N5RA 1HOTA 2HEGA 4NENA 2JGAA 4L9WA 1IZ9A 3OPVA 3PDCA 1DWOA 3DQZA 5D84A 2WKSA 1S2MA 5HOQA 1LSJA 4RPCA 3QVUA 4XXHA 3FNQA 3PUZA 4JEUA 1QJCA 1RCFA 2JGFA 3RRNA 1Y1SA 2EL7A 3VZDA 4YJDA 1DAMA 3I42A 2JFHA 2R1ZA 4C1NA 4L78A 3JY6A 1XLUA 4DR3B 1XRSB 2XRFA 2O3TA 3OOWA 1WG8A 1VL6A 3Q0EA 3MAAC 4MGYR 5CJJA 1ZR2A 2WY2D 1V1MA 3I1FA 4WCFA 1CR1A 1KZ7B 1M2GA 4D96A 1N3LA 4UATA 3STXA 5JS8A 3ZLTA 2XYHA 1WPGA 1ODIA 1LBEA 4WZBE 4JMLA 3IJ5A 1K75A 4KX3A 2FG5A 1QONA 4C4OA 3H83A 1E9DA 1RXUA 2XOXA 2WU1A 2GHQA 2GH1A 3MCZA 4K6HA 4FQ7A 4N65A 4P6VF 3AHEA 4GI5A 3S5JA 1XK6A 3QLJA 4BVHA 4MKHA 1F0KA 3SS8A 1UJMA 4B5LA 1XC7A 3ZEIA 1DIBA 1TIBA 1LLFA 1U2EA 4FILA 1UJ5A 3QKSA 1Q0SA 4KLNA 4JJ6A 4Q0MA 2PWYA 4P4TA 2VHQA 3GP8A 1QE0A 4MDEA 2QORA 3E58A 1VKZA 4KIUA 4MH0R 1N8SA 4O4IF 1KBZA 2JIPA 3C48A 1C9YA 1OZ0A 2ZSDA 4FX2A 4H1VA 1G4UR 2VRNA 2JKZA 1MO2A 1J2RA 3HKDA 4O4HF 4PPNA 4TTIA 3T7EA 4EQZA 3SC6A 2GPTA 3N2YA 3ZVMA 3DO6A 4RD0A 5KNLA 4YI5A 3JYPA 3UPUA 1ZESA 1UAGA 4JOCA 1OKKA 1CY1A 1F4VA 1XEWX 4D8VA 4CIWA 1B0UA 3MGCA 1PT6A 2P9FA 2R85A 4UU7A 4W9MC 1AKRA 4S24A 1W4BA 3ONFA 4XEUA 5AW0A 2ZUFA 3WAKA 5EESA 5EKSA 2PFGA 2VQEB 4GX2A 3QJYA 1OJLA 3HH8A 3R3YA 3VHLB 1GZ3A 1NVUQ 1Q0QA 1S89A 2JRLA 2NVUA 3BIXA 4KPUA 2EHJA 4WFIA 4CQMD 1SQ0A 2MYTA 2I4NA 1DBIA 1QF6A 4EGSA 1UMDA 2RGEA 2IWRA 1JB1A 3LH5A 1GUYA 3DMNA 4G26A 5CPBA 1F60A 4HGZA 2A86A 4TQGA 4I99A 5JMTA 2AK2A 4NYIQ 4PQEA 4A6EA 2O06A 5CBKA 1KZ9A 3WA6A 5FWYA 3KSMA 4NZYA 5AVUA 1FUKA 3KQSA 3ZXXA 1X3SA 1Y5MA 3CZRA 4M8NE 3UA3A 2X7HA 3BTVA 2RBEA 2DCUA 4Q34A 1KBQA 4DDUA 2A2ZA 1SOMA 3VFDA 1GCIA 3KM0A 1FPMA 2GK3A 2GJ8A 5FUMA 2B92A 1KDPA 1T29A 4ND3A 4PX9A 1SN7A 4LJ4A 5CH8A 1T35A 4HSGA 1T0JB 3PUJA 4UTXA 4RCZA 2NUAA 4AS3A 4A0HA 3AFNA 1E3LA 1SKAA 3RS4A 3KSBC 3MNFA 4NCKA 3GAZA 3D8NA 4B4KA 3MS7A 3SG0A 1MVOA 4CLRA 2KJQA 2RK3A 1R6XA 4FFOA 1X94A 4A26A 4JIGA 2RCNA 2ZS7A 1X80B 1JDZA 1M8JA 5U1PA 1UMCA 1AKUA 3AVPA 3C15C 1UODA 2D2VA 4M55A 2VH1A 2ZAYA 1CZUA 3NORA 2QRMA 1NU6A 3R5FA 4KOAA 5DLQC 3ROFA 3LYLA 4BY9E 3Q1LA 1VPDA 5AMXA 3CVWA 2B1IA 1A7KA 1J0CA 3ENNA 3PV0A 4KQCA 1GGJA 2WF5A 1A1SA 3HP4A 4G0YA 4WQMA 1KU6A 2OAP1 4IIEA 3VOBA 3ZDBA 2GZ3A 2RGCA 3N76A 2EBUA 1QVVA 3EVAA 4B4UA 5DN9A 5FX2A 3EARA 4RK6A 3HKCB 4YMLA 5L45A 1ZUNA 1B42A 1CV2A 1KSHA 2OSVA 2R6DA 3BXGA 3NO4A 3O4RA 3TCNA 1HX7A 2Y93A 4JLAA 3OX4A 2J33A 1W47A 2NMVA 2XMCA 3RAJA 1ZDMA 4PIVA 3ELDA 1TIPA 4LC0A 4YMIA 4MDYA 5IAOA 2I6SA 4X6UA 2BSXA 3VDNB 2XQIA 2OFPA 1PU2A 3ETCA 4HUQA 5IBRA 1XMSA 3ASUA 3GBVA 4OAPA 4Y6GB 1P6XA 4QSHA 2ZUWA 2VZLA 2COEA 3R9XB 3IA7A 5AWFC 3PQ6A 4OTZA 3CR3C 1PLKA 2NU6B 3GH3A 3WSWA 1YL7A 3AYXB 3SHOA 2BAGA 1C3JA 4OHUA 3HWX1 4PYOA 3RDPA 3UKJA 5JASA 1NP6A 2BHSA 2IHKA 4TTRA 3GX1A 1B73A 2FZWA 3E27A 1FCJA 3GDHA 4L9SA 4C4TA 1JWLA 3B6ZA 1QZZA 1DC6A 4UM5A 4D98A 4YJGB 1NPTO 5EWMA 2ADMA 3PR3A 4C05A 1YR1A 4U9UA 1YQEA 3CUYA 4QDZA 2C0CA 4DPMA 2B9VA 2OM2A 3JQRA 4DG8A 1EYZA 4JB8A 2ZT5A 5FPKA 2Y1EA 4ZQIA 1Q1GA 1B8OA 3PHGA 3LOQA 2GK4A 3MTBA 1A82A 5IFLA 1QIKA 1DMSA 2G9UA 2X1VA 3SZMA 1ZUWA 1AA6A 3WGNA 2XDQA 4MSUA 4JX8A 4LJKA 4P4SA 5F1KA 5EMJA 1MKYA 1QCYA 2WU8A 3H04A 3HHEA 2QE6A 1QQ7A 4QBHA 1QTQA 4QD3A 1EFTA 1DOZA 4X6YA 5BNIA 3IR6A 2Q49A 3JZFA 2VCEA 1KSJA 5C52B 1E1DA 1M6VB 4H6VA 4MW0A 1UM9A 2VTKA 2B8NA 2G4VA 3NHRA 2VAPA 3VOSA 4A9AA 1WPXA 1YC2A 2R00A 1ZAYA 1FX0A 1KGDA 2O3RA 5A2QA 2I3AA 1RWWA 1C7RA 3ND6A 4ZAXA 4KAXA 3F2VA 4K9NA 4DNOA 4EBFA 1FSZA 2DF8A 1N0VC 3HVHA 4MQEB 5LXTF 1RXYA 3UK2A 2W00A 3BSYA 3NUQA 5IN5A 3NU1A 4A27A 3BKXA 1JLLA 1HNNA 1Z22A 2WVGA 1GCGA 2DFPA 3IP6A 4BGUA 5AHXA 2D4AA 4BQPA 2RIPA 1Q0RA 3FTFA 4JT2A 4M1TA 2GAFA 3ONEA 2HA0A 2QX6A 4BLSA 1A3CA 2PYZA 2X5XA 3F96A 3TM5A 1N3YA 1C14A 1O6BA 3PGVA 2QTRA 2VG8A 3S1SA 2BFFA 3IQZA 4AD8A 4AUKA 3EXG1 3RU2A 4FC6A 4DAEA 4EB0A 4CQJA 1T5BA 3I45A 2LTAA 4X91A 1DAFA 5JJ5A 2B8JA 1P6QA 1SIUA 4TM8A 4ZO4A 2I1WA 4LJ7A 1Z15A 3DB2A 1GCUA 4O63O 3VV3A 2REOA 3KQHA 2BGWA 3K8ZA 1KO4A 2XUGA 4OK5A 4FE3A 4E2XA 5J4HA 5FAXA 3QBEA 2FZ4A 5ALFA 4B6GA 2BP7B 4PTYA 3RS3A 1BMQA 1K68A 3GJ5A 4RD1A 4YRIA 3W06A 2J8ZA 5KCMA 1PJ4A 4YXWA 5LUAA 1LPPA 1Z0UA 1J1ZA 3PUKA 1MLDA 3E3MA 1G20B 4HAYA 4Q7QA 4MPTA 4IIUA 4XH9B 4ND4A 4P58A 2ZRQA 1VJDA 1YAJA 3K20A 1XQ9A 1HDEA 2M2IA 3QPWA 3TNYA 2OA0A 4Z4EA 1D0SA 4QIHA 2IEBA 3G23A 2YBEA 4KXWA 5JFTA 1MA0A 2YOHA 4R2MA 1ZGBA 4LY3A 5C34B 4X1OA 2E1PA 1OFHA 1Y1RA 2HWKA 1Q2XA 3IVGA 1MA3A 4Q02A 4DQUA 1E6KA 2G04A 3CX6A 3QGMA 4RH1A 3EXEA 1GKUB 3SHVA 4JYAB 4BEJA 4IRUB 3O5AA 4X7BA 1VJGA 1ULAA 3A6KA 4O33A 1RKVA 1KMIY 2WZCA 5LLDA 1UPAA 1M76A 1X19A 4X0EA 4TWJA 1Z2EA 1CF9A 2IY8A 3W6ZA 2ODAA 3ESDA 1G2OA 3KOYA 5CT8A 4HR7A 1BGWA 1A8HA 2ZCVA 2QE7D 4XB1A 4FGUA 3JWGA 4QQRA 3V6LA 2Q3JA 4ZDKA 4IBOA 2OFFA 3FBWA 4EGCB 2BHLA 3PB3A 3WRVA 5TJ9A 1W36B 4QOFA 2C7GA 3FUCA 1O6GA 2WU3A 1O96B 4KE9A 4RK0A 5CT5A 1G17A 1NAHA 3IQDB 1YJXA 5HS6A 4JB3A 2ZI4A 1Q7BA 3CCFA 5AOAA 1ZISA 5HKOA 1GTL1 4OA8A 2ECOA 2C07A 4L8VA 4BNTA 3C7CB 3ZWYA 1Z5WA 5ALWA 3RS0A 3LXRA 4H3SA 2V8OA 5T4BA 4ZOLB 1KMHB 4E5YA 1QHIA 2V6GA 3L8FA 5KTPA 3O3OB 2C0QA 1K6JA 1PIWA 1QAMA 3ZIAD 5IYZB 2BTEA 1IJEA 5TS3A 3UMSA 4UAJA 5DYYA 3DMGA 4GC9A