5CM8B

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
169
Chain Sequence
GPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 35
structure length 169
sequence length 172
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm8B00
4XWKA 4GFDA 4TQ9A 3UPUA 3RDPA 1E1RD 1GNQA 1JNYA 4JLOA 2VP6A 3K9LA 4TTQA 5DI3A 4ZV4A 4NCJA 2D2EA 4KLZA 4KO8A 2GCOA 2W0SA 3AUXA 4LUCA 2N42A 4L16A 1COWD 3BB1A 1S9DA 2W83A 2R9VA 4PHGA 2HXYA 4A6PA 1BOFA 1P3JA 3HWSA 1ZRHA 2XB4A 4BRUA 3VR3A 2NO6A 1PLKA 2Q9AA 3RS5A 4JLVA 3LNCA 2WKQA 3MG9A 4U5XA 2Q3HA 1E32A 3GLFA 3CPEA 3PIRA 4IEIA 4E03A 2ANBA 3N5CA 3THXB 3N2EA 4LV8B 1GKYA 3CWQA 1OF1A 4TSFA 2J5XA 1ESMA 2ZRDA 4IVRA 5JBQA 5C4MA 4EPRA 1AKEA 3GJ5A 1IHUA 1QHHB 1OFIA 3TW8B 1XB2A 4QBHA 2NO7A 2ZITA 2FSIA 3AP3A 3NC0C 3K0FA 3SFZA 1Q21A 3BB3A 4WZ6A 1R5BA 5EZ5A 1KDRA 1II9A 1CRPA 4ITRC 4JT4A 4Q9IA 1MOZA 2WWGA 4K46A 1ZINA 5KO2A 1EWQA 2XNDA 4UNPA 4M9ZA 3RRYA 3PQCA 1A7JA 5FUWA 2D74A 4DRZA 2X2FA 5EE1A 2BHRA 1CU1A 1NVUQ 1Z6YA 1G3MA 3N70A 1U8ZA 2IC5A 4HLUC 1SKYE 2R8RA 4DC9A 4UJ3A 4DVGA 2ZRMA 1F3OA 3K09A 2MSCB 3L0OA 3MWJA 3MWLA 3WMGA 3B78A 1BS1A 1NMXA 2ZSFA 1XMJA 1KI6A 3CWZA 3TW4A 621PA 1AZSC 3OEHA 3TBKA 1A4RA 1X1RA 3KJGA 4XD7D 4TLEA 5FI1B 5L3VA 1DAIA 3K70B 5SZKB 2EFDB 4EPXA 5FOSA 3KB2A 1D2MA 4M2LA 4ARZA 5AUPB 2P6NA 3EWSA 5B2ZA 1NJFA 4B6EA 5JJLA 2FNAA 1EFRA 2NO1A 5FTNA 2WTUA 1XTJA 2KB0A 2HYIC 2VLIA 3K9HA 1KHTA 1GL7A 2GHIA 2ZRCA 1ANKA 1W0KD 3EARA 3ZQ6A 5EQTA 2AR7A 1BO6A 4EIWA 4D4KA 1CJTC 4V0ME 2QU8A 3CBQA 1YQTA 4BEJA 4EFNA 1DAMA 1OW3B 3NEYA 1A2BA 1KMHB 4C9BA 1XEWY 4KVAA 2FFQA 3QKRB 1W7AA 2KWIA 5SZJA 5FBQB 4RZXA 4GBMA 2W00A 3PUVA 2VRWA 3IPYA 3CNLA 3K9NA 4FMDF 2YHSA 3T1OA 3RVBA 2EYUA 1VCNA 2OO7A 4MRRA 1NY6A 2J0UA 1U90A 3QEJA 1E94E 2YNMA 3T1QA 2O8BB 4Z8XA 3RS0A 2D7DA 5K8TA 4I4LA 1PV4A 3P1JA 4M22A 1KSHA 1ZCAA 4Z51A 4H9GA 1Z2AA 1RRPA 4HLCA 1XTIA 4IKEA 3RSLA 4RKEA 1US8B 1EXMA 1U9IC 3BWDD 4GI7A 4OQNA 4DLXA 4EPVA 3FTQA 3DMDA 1E4VA 3QPWA 1GZSA 2WWWA 2WSMA 5K8UA 3TRFA 4ZI2A 1DEKA 4P31A 1II8B 3A8TA 1K8RA 4RZUA 2GCNA 1R7RA 1U0HC 4HAUA 3IHWA 1JAIA 4MYUA 4PZLA 1KNQA 2V1UA 5EE5B 4D81A 3T5DA 1P9NA 1GKIA 1G8FA 2V7QD 4PC2A 2WPDA 1I2MA 4B6FA 4RD4A 1F2UA 1FP7A 3GEHA 1OB2A 3W8RA 3PXGA 5M04A 1T0HB 1XP8A 2ZRFA 4JZKA 1JPJA 2QPTA 3AKYA 3R8CA 2PMDA 3C5HA 1OB5A 1G3RA 2GBLA 3CF6R 4KFUA 4LYFA 2QRNA 4LHYA 4JVMA 2GZAA 3EZFA 3X1XA 3WMFA 1G41A 2HUPA 2IK8A 4B3XA 4HAVA 3SR0A 3NBFA 4O0MA 4DCNA 1N5LA 3A4LA 2A5YB 2VEDA 5JFGA 2QP3A 2J59A 4MGYR 4B2LA 4O2LA 2BWJA 4TLDA 1OYWA 1XZPA 3CRMA 5IK2D 2GJAA 2O8EA 4R2IA 1MRSA 5DN6D 4RD0A 1F48A 3CONA 4A8JA 1B0UA 1OPXA 5IT5A 4PO9A 2FWRA 3ECCA 2H18A 1SULA 1P2UA 4W7SA 5AUNB 3KXKA 4DLYA 2ZVPX 4A6XA 4A0GA 4HB4A 2FX3A 1Q3HA 1PUJA 3QXCA 3P27A 1N5KA 5DGXA 3LVQE 4HDQB 2QE7A 1P62B 1E9EA 1XCPA 3TGPA 4LHVA 2EWVA 2IXGA 1KMQA 1A5TA 3NHAA 1ZD8A 4NYMQ 3EPLA 4Q4HA 1EFTA 2NTYC 2BBTA 2IUSA 4QHYA 2BM1A 3C41J 2R6GA 4BASA 1DARA 2ZYUX 2R44A 1I2DA 1U2RA 1UKZA 2ZI3A 4KVGA 5DH9A 2IS2A 4M8NE 1Q3TA 4RKFA 4P32A 2V1XA 4Q02A 3ZZUA 1G4AE 2RGNA 3AVPA 1IY0A 3O8RA 3PUWA 5TARA 4LOAA 3ZGXA 2XOKA 1NIJA 2ZSDA 3WP1B 4PC3A 3K1JA 4HDOB 3VU9A 1VHLA 2NZ8A 3QVUA 5JJKA 4TLCA 4Q1BA 3SOPA 3CPHA 4C0LA 3NVAA 5HTKA 4Q4AB 3W90A 1IM2A 4KU4A 2WJIA 2ODBA 1W4BA 3CX6A 2ZUCA 1XBTA 1A2KC 1U94A 4TQUS 1U0JA 4ILEA 3D6TB 2BJVA 4NYMR 2QTHA 5SZIA 2XXAA 1DBSA 1TQDA 4B47A 1MO6A 1LTQA 2IXFA 1KK3A 1M34E 2I3BA 3GJ8A 4UXJA 3U3MA 3L8ZA 3NDBB 1TQ4A 3HU2A 4B2PA 4M21A 3M0EA 2ORWA 1YVDA 2WWXA 3U3KA 3EPHA 4MUAA 2WWHA 2OAP1 2WMOB 4XSGA 3ZIAA 1KO5A 3U44A 5ELXA 5FOXA 3BK7A 2J3EA 3TK1A 3BH0A 4GP7A 1EG7A 4V02A 3SJCA 2AD1A 4TMTA 5TV2A 3MLEA 1G16A 1UKYA 4WXRA 3TUJC 4ACAA 3SC3A 3TNFA 1BIFA 2HEIA 2PJZA 3AVVA 4DT1A 3ICQB 3B7GA 3FFAA 1CJVC 3FKSA 2G1KA 2XTZA 4FCWA 5C4GB 4HB0A 3VKWA 3KQUA 4IOMA 5LB2A 4A36A 2ZM5A 5J4YA 2IYSA 2EFGA 5EXTA 4OL0A 3EASA 1SXJA 5ANRB 1CJUC 3QKUA 2GDJA 3T35A 1K5DA 3VR5A 1Y63A 1UM8A 4M1TA 2WM9B 5L3QA 1Z6XA 4FMCF 3UKDA 4DLTA 5GVSA 2REOA 1EFCA 4IJMA 2CMKA 3S1AA 3OHMA 4LJAA 4PC1A 5J40A 2CE2X 4M1WA 5AWFC 1XWIA 1AKYA 4MYHA 1P61B 2J0VA 3CX8A 3NWJA 5HE8A 2GAOA 5FBRB 2IWHA 4F92B 1P2TA 4NMMA 3A1VA 1Q22A 2XTMA 1KAOA 1HT2E 1CLUA 1YR6A 2H17A 2QAGB 4G01B 4MYTA 3RAPR 3VAAA 5CDFE 4JLAA 1XEXA 5FR2A 1T6NA 1GAJA 2HV8A 2J0QA 2DBYA 1NY5A 1YR9A 2D06A 1QHIA 3E5HA 1W2GA 3BS4A 3CH4B 2H8KA 1KOFA 1W5SA 2OXRA 1XTRA 5AJXA 3WY9A 1FUUA 2ZE5A 4MDFA 1OHHD 5B58C 2QSYA 4LRWA 2ZRHA 2WSSA 4GOKA 5GJWC 4IVQA 4M4SA 3H1TA 4PPFA 1G1MA 4M1OA 1J90A 1G8YA 1GG2A 4RD6A 2HYDA 4TL8A 4BFVA 2FH5B 4JYCA 3AKCA 3HYTA 4BLQA 1J7KA 3UG7A 1E2QA 3GLIB 4URZR 4FCTA 4PO1A 1P75A 2CHVA 2RMKA 3SYNA 5C18A 3ZYCA 3I61A 1D9XA 1KK0A 2YWFA 2OE2A 2KBEA 3BH7A 3LX8A 1E1QA 1II0A 1J2JA 3LX5A 2IEZA 3U7GA 1VMAA 4G5QA 4MITA 2QQ0A 1LW7A 3BORA 4QGAA 4C0KA 1IXSB 2W58A 2JLYA 4BFSA 2GVZC 3AP1A 5HCIA 2RGEA 4BE7B 2TMKA 3KDSE 1Z0IA 2CLSA 2UKDA 4P4UA 1P9RA 4MKIA 2FPKA 2O52A 4H1UA 1C1YA 1G3UA 1CF4A 3NG1A 6Q21A 1E1RA 3AVWA 3ZZTA 2V9PA 4PSAA 3RSOA 2QTFA 4M0LA 1E98A 1G6HA 3NIBA 2IUTA 4MKGA 1AA9A 3FMIA 1COWA 3EZ2A 4ZDJA 4FINA 3ZVMA 1D2NA 1NMYA 4QBIA 4C0AC 4GSYA 1X1SA 2HF9A 3GMTA 1LY1A 5J4HA 1OYYA 3LDAA 2FPMA 3A4MA 4FWIB 2O0HA 1H65A 2QPAA 1NVXQ 1S1MA 3MUFA 5EXPA 3SE0A 4B76A 4DBLC 2ZJ2A 5DSZA 1XD8A 5TXGA 2FFBA 4IXMA 5FOTA 3Q72A 4TLBA 2PMKA 2EFHB 3LBNA 4QGFA 1YE8A 4CZ2A 1N6KA 1SVIA 3A58B 1U8YA 2H5EA 3EZ9A 2ZROA 3B1XA 4JMPA 2XB2A 3ZH9B 3CLVA 2KJQA 4AD8A 5DIFA 2IS4A 3AVQA 4LI0A 2AD5A 1M74A 2GJ9A 4B43A 1P6XA 3M1IA 3PUYA 2I1QA 2QT0A 4G0NA 4LPSA 3TLXA 2IYWA 1VG9B 1XTQA 2WWFA 1PLLA 4TT3A 4JVNA 5AJWA 4B48A 5TDHA 5EP3A 2F1RA 1GITA 2ZPTX 2O8CA 4KBFA 1S1CA 2VYFA 4OHXA 4QOSA 4EJSB 4MRNA 1ZUIA 2F1IA 1H8HA 2WAXA 1DAGA 1IXRC 1WRBA 3EWAA 4JL5A 5UKDA 1GSIA 3BRWD 3U7FB 3GLGA 1KAGA 5FUVA 2GF9A 3NTUA 1R6BX 5FR1A 3G82C 5CJPA 5FPSA 1JB1A 4YDSA 2ZRGA 3RWMB 1E9BA 3U60B 1IJEA 2VL7A 4X8MA 1E2IA 4KJZA 3RRMA 4A8JC 1YKSA 2A3RA 5FBLB 3OF5A 3KQKA 4QRHA 2YINC 3VKHA 4WA7A 4RFSA 3B1VA 4KHZA 3RS7A 4X8LA 2EWWA 1NL3A 1CS4C 3M4YA 5H1YA 3AV0B 3GLIE 4ZCIA 3RS2A 5BXQC 3DKVA 3H2YA 1E9FA 1U8AA 2QM8A 4PC6A 2RB4A 3I1FA 2JASA 1ELOA 2OSBA 5DYGA 4Q01A 2ZE7A 1OIXA 3E70C 1FMLA 1E2PA 4CRWB 2ORIA 2ZR0A 4BLPA 4O2RA 4A0FA 2VHJA 4XD7A 3AH8A 1N6LA 3I72A 5JSZB 1U98A 3GJ7A 1KNXA 5G41A 2HJGA 3WNCA 1NLYA 1NN3A 1QF9A 4WIAA 5E7JA 4BECA 2D62A 3H0KA 2Q3FA 1J70A 1KKMA 1XF9A 1IXZA 2B7BA 3WBJA 2XGJA 3TAUA 3EA5A 2WKRA 5JRJA 5AJZA 3I5YA 2XAUA 4L5BA 2NIPA 1DO0A 1E6CA 2ODWA 3AVXA 1ZIOA 3UK6A 1UDXA 4LYAA 4UXIA 4Q4JA 3VMFA 5G40A 1ZU4A 5A4JA 4DCSA 3KB1A 3RANA 1O3YA 3VR2A 1CJMA 2IS1A 4ZKDA 5FPYA 1G6OA 2GNOA 4OI1A 2AN9A 3SN6A 2V6IA 4DLUA 1ZJ6A 4A92A 1FL9A 4OQFA 1Z5ZA 2DFLA 5AK0A 5DLQC 1L4YA 3K70D 5GVRA 1JR3A 3TIFA 3BAFA 3VNUA 2Z5FA 1OXSC 2ZJBA 2ANCA 4KXFB 5F3WB 2ZEJA 1F2TB 1E0AA 3EC1A 4CEJA 5AR1A 3HU1A 5DHFA 1M6NA 2QY9A 4FXPA 2ZTSA 3KKOA 4FCVA 4RJLA 1M7HA 5GADl 1IAQA 1JJVA 1VDZA 4I1UA 4LBWA 5FL7A 2ZYVX 4URVR 1TMKA 1XNJA 4HAZA 2W0MA 3NBZC 3UG6A 3PFIA 5EUMA 3X1DA 1W4AA 1DS6A 2LCFA 4RFVA 5CIWA 4ZCLA 2OCYC 4N3NA 4KCGA 4DDWA 2ORVA 1FTSA 4GMDA 2J7KA 4KBGA 1MO4A 2IHBA 1X8LA 2AX4A 2PLRA 4B34A 2ZI4A 2UZ3A 3BIFA 2KSQA 1Q20A 2OCPA 4NONA 1GKUB 3THWB 1ZP6A 1HQYE 4AK9A 2EQBA 1W49A 4FD2A 4OK5A 2V7QA 2ZRPA 2GWHA 4X8HA 3SEAA 1LS1A 4OQMA 3B1YA 2RGAA 2AXNA 2BBSA 4IDNA 4PC7A 4LC1A 2X1VA 2YVUA 2FFAA 1JXOA 2Q9BA 2G1JA 4LPKA 3K70C 4IVPA 3DKPA 2ZI6A 5JCZA 4G5OA 3FMPB 4LZZA 2QP9X 4HATA 1KY3A 1JQJC 2B21A 1MO5A 2NO9A 5BN4A 1VPLA 2BVNA 2CHQA 3UXMA 4OHZA 4MQBA 1XFAA 1ETUA 3QF4B 2ZQ5A 1RZ3A 2VP5A 4JSYA 2XJ4A 1I4LD 3NBYC 3PEYA 3EA0A 1EX6A 1TTTA 4ZDKA 4BPBA 1E99A 4XVRA 3U3RA 4BGDA 5IK2A 5D3MB 5CYOA 1G291 3TR0A 3GLHB 4G5RA 4LDJA 5DN6A 5KU1A 1G8PA 1UPTA 5TB5A 3KZ1E 4YXWA 4DJTA 3BFVA 3DPUA 3U6KA 4XSHA 1WQ1R 1OV4A 3AKDA 4Q7KA 2OXCA 2R62A 1RYFA 4OI2A 1W46A 3W3AA 4QC2A 4F4IA 1DAEA 1P2SA 2JLVA 4AKEA 5JI2E 1NRJB 4LGMA 3MSXA 4MGKR 1FNMA 2ZYTX 2QG6A 1Z0JA 2PZEA 1TEXA 1IN6A 3QQ5A 1U0LA 1OFUX 1KJWA 4QGHA 5EJEA 1E9SA 4O3MA 2WBLC 1P7CA 3KJEA 3T61A 1SVSA 4OI4A 3UATA 2F3TA 1GUAA 4N0EA 3ZD7A 2VBCA 3TSOA 4R71A 1JI0A 4F38A 4URUR 1QDEA 3GEIA 4B3DA 4XVUA 5JHGB 2VF8A 1W36B 3LQRA 4LCBA 4P4SA 2GXQA 1NBME 1KTVA 1ZC3A 2PL3A 4NL4H 4DCUA 2CK3D 1IJFA 1E96A 3F0TA 5C46F 2ONKA 3A37A 4QJ4A 2ZJYA 1L7VC 4BQSA 3DZ8A 5FL3A 2BCGY 2WMNB 4OYHA 1RE0A 3TR5A 1IY1A 2F43A 5DI9A 2QBYB 5CLQA 4EUNA 4BZXA 1KI7A 4YONB 5JEDA 3REFA 3V00A 2ASEA 4CEIA 2KBFA 1UADA 1QVRA 2OHFA 2O8FA 4DLWA 1E2KA 1E9CA 5TMPA 2ERXA 3U4QA 5J4LA 4TMZA 1BH2A 3K53A 2UVQA 1C4OA 4RD1A 1UAAA 3VU9B 2DFTA 1GOTA 3OFNA 4KYIB 3VNVA 2ZJ8A 1KO1A 2FN4A 3RC8A 3GD7A 4DSOA 3QBVA 3I92A 1ZM3A 2FSGA 3CX7A 3QENA 3UMSA 4BLSA 2FZ4A 4ZDIA 2X19A 1X86B 3RC3A 1WF3A 4QJ3A 4DZZA 1FQJA 3ADKA 1NN1A 2OFWA 2XXAB 1LFDB 1FQKA 1NLZA 3CF2A 1E79D 3MGCA 2ZI7A 2AKAB 4RSGA 2EYQA 5L3SB 2DWQA 4Q1EA 4LWZA 3OZXA 3FKQA 2JAQA 1OFHA 1OH7A 4CGZA 3QF7A 3ZDQA 1LF0A 5FTMA 5LD2B 1Z8FA 4JJZA 2PT5A 2JEOA 3GLHE 5GJCA 1P9WA 5B64A 1YZTA 1ZAKA 3IBGA 1XTKA 4PO8A 3TQCA 1KI1A 2PX0A 221PA 1G7SA 1H8ED 1T91A 1IONA 3TQFA 4WOPA 1KK2A 2ZJZA 5EP1A 4BFTA 3SBEA 4C0HA 1OIWA 4HAYA 3FMOB 2W6ID 4N0DA 1G3QA 1SQ5A 2CXXA 2OBMA 4TYNA 2FA9A 2FEOA 4B75A 4C0SA 4XVQA 3E1SA 1L2TA 2CNWA 2GK6A 1D2EA 3AF1A 1FMJA 2GXSA 2Z83A 1Y3AA 1P2VA 2G3YA 1G5TA 2J7PD 3AVOA 3I32A 4D25A 2VHUA 4K8OA 2WJVA 4C2UA 4PPNA 5K8LA 3KUCA 1Q0UA 5A5GA 4HUQB 3EAQA 3REGA 1NJGA 1P4SA 1Z6AA 5KNDA 4CT4B 3LVRE 2MMGA 3B60A 1MV5A 4R9UC 2IS6A 2ZANA 1XD2B 3P4XA 5GJBA 1OHHA 4PQYA 1SVOA 4URXR 4LJYA 4DUGD 1AN0A 5KSOA 4TYYA 5EUQB 2BDTA 5FOUA 2QMEA 4IDQA 1DAKA 3QEOA 2WIAA 3HJNA 3GQBA 1Z0FA 2I1VB 3QKSB 4TL9A 4M1SA 5BN3A 2QI9C 3GJ3A 1DVRA 2YOGA 3B2EA 4JS0A 3DVLA 2IYZA 4H1VA 3ZVRA 3DO6A 1MO3A 3AVTA 1DADA 4Q47A 2FU5C 5FUXA 3UWKA 4JLKA 2D7CA 3GFTA 3VQTA 4GDFA 2IHYA 3KKPA 4ERNA 3SJZA 3U6BA 3FYHA 4A2WA 5EP4A 3CO5A 4UNQA 1XMVA 3KQHA 1OH8A 1S4QA 1YRBA 3MMPA 3PCRB 4KSBA 4QBFA 2CL0X 3C4JA 2OCAA 3PEWA 4L4UA 5LBIA 3R7WA 2W2VA 4D4JA 3SZRA 2F7SA 3GPLA 2C77A 4NCHA 5J5CA 4D0NA 2QQEA 1KKLA 4A15A 1PJRA 3C16C 5E95A 1OXTA 4JKIA 1QHXA 3MFYA 4ZO4A 4EDHA 3NBXX 2HT1A 3IQXA 3BJIC 2YWGA 1XMSA 3NC1C 4D0LB 2RHDA 3OE7D 2MSEB 4M9SA 1N0WA 3AEZA 3PUXA 4OK3A 1AS3A 4YMWA 1E2LA 4WAUA 2QMHA 1G8GA 4LBVA 1HQCA 2QAGC 5P21A 1A1VA 3HR7A 1QBKC 4PSKA 1R0ZA 1JPNA 4QHSA 1KIMA 4GZLA 2CJWA 1DAHA 3KTAA 2RAPA 4TMWA 2C8VA 1Z0AA 2VF7A 4AIIA 121PA 4TZ6A 2C5LA 4EFMA 2VTKA 3WNDA 4FN5A 2VA8A 2QEQA 1NP6A 2W2XA 1XJQA 5EE0A 4DSTA 1MT0A 1G7TA 2H16A 1W47A 2HCJB 1CR1A 4HAXA 5BWMA 1KI4A 1R0YA 2QL6A 4V0MA 3U3OA 4A82A 4E07A 4PHFA 3IDQA 3R20A 3GEEA 1DG1G 2W6JD 2FGJA 4P33A 2C99A 1Z06A 2IYVA 3EC2A 4LC0A 1G7RA 3KJHA 1G19A 1D9ZA 2ZR7A 2YZ2A 3B82A 1T3SA 2YWHA 4PQFA 2GJSA 1ZVQA 3THXA 2Q6TA 2IX3A 3IKJA 5H8WA 1NSTA 2GRJA 1GFIA 2VHQA 2C9OA 1KY2A 3UMFA 3RS3A 3W5JA 4NBSA 3QY0A 5LPNA 2EU8A 1EWRA 1E4YA 1G7CA 4BFYA 2VP4A 3FGNA 1QHHA 3SDZA 2AK3A 2ZS7A 1R8SA 3O8BA 2HDNB 4OJQA 3Q7PA 2VIIA 4BLTA 1WDTA 3ZD6A 2ZU0C 1AIPA 4OJKA 4DB4A 1KI8A 2OCBA 3T34A 1XXHB 3AF4A 4C0JA 4D4MA 4DSUA 5C1BA 2NGRA 3GJ0A 4D4LA 3IIMA 2X77A 4Q5IA 2NO0A 4JIMA 1HTWA 3KXIA 3ZVLA 5BYJA 2JJ8A 2ZSEA 1CULC 4V0NA 2OLKA 5AUOB 4Z8YA 2H92A 2ZRIA 4JKYA 2HF8A 1MKYA 3JVVA 3G5UA 4RD2A 3D31A 1Z28A 3LH5A 3LWNA 1OH5A 3E2IA 4RCYA 3NKVA 1ZC4A 4PPQA 3LAWA 2JLUA 1JQLB 1UEIA 3WYAA 4JLBA 2BV3A 1KDPA 4ON9A 4WZBE 2GXAA 4NZYA 1SZPA 2Z4SA 2Z6VA 1HE1C 1YZLA 2XNDD 4QL3A 4CYMA 3AVUA 4Y0AA 3GJXC 1XPUA 3K0AB 3ETLA 2PCJA 3LRPA 4PZZA 5E3HA 4F4JA 2HT6A 2IYYA 2ZAMA 2ZSAA 2H57A 2J87A 2WJJA 2ERYA 3ZVNA 1LF5A 1GRQA 2BCJQ 3LO5A 4L8GA 2YJTD 1OE0A 2C9YA 2YOFA 4QM6A 2HLDD 1XD9A 1LB1B 3IQWA 2EFEB 4E22A 4TYQA 4NCKA 2F1JA 5B57C 2ZJAA 1Q44A 3OEHD 4UNSA 5J4KA 3FWYA 5HR5A 2F1HA 3TMKA 4ZIRB 5D3QA 5CITA 1KI3A 1DAFA 1N2CE 4R2HA 1G4UR 4P0TA 1VCMA 4CDGA 4S2EA 4JLJA 4JLNA 3VR1A 4DDUA 1KMHA 2B8WA 2LKDA 4JBWA 2DFKB 4EAQA 4DKXA 1M7BA 1WA5A 1BYUA 5F98A 3QKRA 4I81A 2A5JA 4F4CA 1ZNZA 3KQNA 1NVWQ 4II7A 2R6FA 4KAXA 4AYTA 5IF9A 1VYUA 2J9RA 2A9KA 4AKHA 1XCGB 1OKKD 2QM7A 1NBMD 3BBPA 3ND8A 1VYTA 1Q12A 4YLGA 3SYKA 4YMUA 1WBBA 4CEHB 1EK0A 1RJ9B 1ZBDA 2O8BA 1ZUNB 1RFLA 1XX6A 3P4YA 1ZD9A 4A2QA 4BFXA 2SHKA 5KSYA 3HU3A 1XTSA 1VG0B 3DHWC 4M9XA 3VR6A 1X8JA 4GPTA 1US8A 3Q3JB 1I4TD 4OI0A 5JWHA 4Q1DA 5CLLA 5HPYB 1BMFD 2BM0A 4AURA 3QXHA 1NVVR 3W5IA 1MABB 3NH9A 4KFTA 1II8A 2DWPA 2FE4A 4EQ6B 2GEVA 4GMXA 5AJVB 1XXHE 4JVLA 4YC7A 1Q1EA 1W4CA 1S0UA 2G6BA 4R7ZA 1F60A 3L8YA 4TL7A 1YRAA 4CVNA 1AGRA 2QGNA 1E2HA 2WJGA 4RZ3A 3OESA 4PR0A 1AJEA 3J81k 1GM5A 2HJVA 4Q19A 1NMZA 4Z54A 5CJ2A 1E2JA 4AY2A 1FX0B 3DL0A 3CNOA 4ZDWA 3A4NA 5CIQA 3VX3A 2JLZA 4TYPA 4PAMA 4QGGA 1TADA 2GKSA 4W5HA 2DYKA 2Q0HA 4I1VA 2F9LA 3AF2A 2OV2A 3RLFA 5CK5A 1AZTA 1Z07A 2VPPA 2YKGA 1ZYUA 3W34A 3EPJA 1OH6A 3U3JA 2WJYA 4MYCA 1XZQA 4LJ8A 1N5JA 4WW0A 1S3SA 1N0UA 4US2R 5EE9A 3C8UA 1AK2A 1HH4A 2YWEA 5JEEA 4UXHA 4WVFA 3QPUA 2B8TA 5DI3B 1K6MA 2JLRA 3D7MA 4UKDA 4M1KA 2WWIA 1QVAA 2C9CA 2CK3A 2EVWX 4G5SA 2GCOB 1J8YF 3SNHA 3FHTA 5KNBA 3EZ7A 2GETA 1OSNA 4EKDA 4IDPA 4DCTA 2QGZA 3LQQA 4Q1CA 4WBSA 3VKGA 1PVOA 3I5XA 3QUSA 2CLCX 2P0EA 2R65A 4GOJA 1ZCBA 3BOSA 1G5RA 3RNLA 3U7EB 2BEKA 2ZRKA 3DEFA 1YZNA 1T4GA 1XEWX 3GLFB 2L0XA 3A36A 3QSYA 2FZLA 1KGDA 4IW3B 3LY5A 2PLFA 2OBNA 4XJXA 3CF0A 4KITB 4C2TA 2K5UA 1G17A 2N46A 4ABYA 1OLOA 2R6DA 3Q8XB 1SKQA 1X6VA 4W5JA 5CDFA 1W36D 1KZ7B 4RD3A 1KDOA 3PEUA 4Q1AA 2D4HA 1SVKA 4CEIB 4Q9HA 4HLDA 1AS0A 4UNNA 2QE7D 3ZQJA 4UJ5A 2ZYWX 2WVJA 3I8SA 5E7MA 2ZRJA 3QG1A 2QMOA 1G9XA 2NZJA 5JZVA 1RRCA 1CBUA 1VECA 3OIYA 3O8CA 2RGBA 1A82A 1UBEA 3FPAA 3K0FB 1TQ2A 2ZS9A 1D5CA 1E79A 4LJ7A 4DHEA 1CR4A 3OEED 1Z08A 3AF0A 4KV9A 1SHZA 4RCZA 4S35A 4ASUD 4Q4AA 5FTLA 3FHOA 4G1UC 4URWR 2X2EA 3JZAA 5JWOA 1XMIA 4KSCA 1FZQA 5JECA 1GL9B 3VR4A 2XOKD 1RPZA 1QG4A 4P4TA 4F91B 5KDDA 1OXXK 3LBHA 3H84A 1CRQA 3LFUA 3A1TA 1TUEA 4Q9JA 2FPLA 2ZXUA 3IEUA 1KSGA 4CIDA 2AWOA 3PEVA 2A5DA 2PZGA 1F6BA 5L8VA 1ZUHA 2JIZD 1KI6B 4LJ4A 2C98A 2DB3A 1IN8A 1ZM9A 2W6IA 2ZIAA 1OXUA 1PUIA 3CH5A 4WZAE 5FOWA 3R9XA 1XRJA 3U5ZB 1W0KA 1QHNA 1R0WA 3W6OA 1KDTA 1QRAA 3AB3A 4HB2A 4M9QA 1C9KA 4ARZB 2ZI9A 2JJ1D 5KYKA 3SU8A 3CR7A 2ATXA 2R6CA 4IRUB 4MA4A 2V54A 4PFSA 1UFQA 2J7PA 1VTKA 5FPKA 3IIKA 1JXMA 1FPMA 1CEEA 4EPWA 4M53A 4NYIQ 4FW9A 5H70A 3UIEA 1UEJA 1YZKA 2PBRA 3Q5EA 3IHLA 5GJVC 3L43A 5JMTA 1Z47A 2EW1A 3KX2A 4B44A 4DXAA 5F9FA 2ZU6A 1ZMXA 4HZIA 1XPRA 2AFHE 2OAQ1 3FKSD 1HY3A 2WICA 4P3YA 2OM2A 3JVUA 4DUGA 5JLJA 3T5GA 1AM4D 2O0JA 3GLFE 2GEUA 3EIHA 4TLAA 4NE2A 4C30A 1XU4A 2FDCA 3B85A 1N6IA 4B3CA 4D26A 2J0UB 3ONWA 5F2EA 2AXPA 3P32A 4IFEA 2D2FA 4MRVA 3LBIA 4NH0A 2QAGA 2XTNA 5CYPA 1S96A 5J47A 1P5ZB 2ZRBA 2B6HA 2IF2A 4MGZR 521PA 1N5IA 4NU0A 1XEFA 2ZAOA 3MRSA 3KKNA 1Z3IX 3PR1A 4NYIR 4DDVA 5L3RA 4NHOA 1N6RA 3BC1A 3ZLJA 4MH0R 2DCUA 5E4FA 4LJ6A 2CCKA 5AUQA 3MWKA 1SVMA 3HYRA 3NXSA 1Z6TA 1FUKA 2E87A 4JVSB 4M1YA 4US1R 4US0R 3A1WA 3RS4A 2V3CC 3SFVA 1P73A 2QNRA 3VHLB 3EW9A 1W4RA 3MWYW 4A0HA 4ZI3A 3AVYA 2LKCA 2GCPA 1KJYA 3BD9A 3TUZC 4DLSA 2IYXA 2IW3A 4B3FX 2OBLA 1WBDA 1G5PA 2Y8EA 3QOFA 1QHGA 1F2UB 3GLIA 2OUKA 2IXEA 2FEMA 3BFKA 1DO2A 3L0SA 3B1WA 4PSVA 1DELA 1SVLA 1TPZA 2GK7A 2ZETA 3OE7A 4HZUA 4DCVA 3BH6A 2WSSD 2IYLD 1E0SA 1OIVA 2QORA 5SZHB 3R7WB 5KSZA 2WV9A 2V6JA 1G21E 1E0JA 5G53C 2HCBA 1N6HA 2UZIR 4DLZA 1EFUA 2FJUA 2DHRA 5DISB 3RYTC 4PX9A 3TE6A 1HYQA 2O8EB 1DE0A 2PEYA 2WIBA 1UJ2A 4A8JB 1IBRA 5DE3A 5DO9A 4L15A 4W5WA 2XZPA 3THYA 2G0NA 4BZPA 5BN5A 1UKEA 3CM0A 1EX7A 2QN6A 3L0PA 4TWZA 4U02A 5H68A 2IWRA 3OIVA 2XZOA 3QBTA 1CKEA 3KTAB 4AI6A 2W6JA 1JEDA 1KO4A 3ASZA 3UANA 4V03A 1R10A 2IA5A 1J99A 3K0CC 2FMXA 1GVNB 4MDEA 2YV5A 2ZI5A 3LD9A 3FOZA 2FSFA 1KI2A 2A5GA 2AFIE 3F5FA 4Q4HB 1LV7A 2NOAA 3T1VA 3OAAD 2GZHA 2QTVB 3B13B 3BB4A 3F3YA 2ZR9A 3JZMA 3QJYA 1YZGA 2FV8A 3B6EA 4Q9KA 1FTNA 1E2FA 2QSZA 2ATVA 4QNRA 2RGXA 2H1LA 3CZPA 1BYIA 1W44A 4Q7MB 3TVTA 3GFPA 1GRRA 1M1YE 3CR8A 1T8TA 2BKEA 2BOVA 2P65A 3D8BA 3PITA 3W6NA 3DM5A 4EJSA 4C7OA 5FBVB 5EXXA 2YOHA 2CL6X 1RRFA 4I99A 4JBYA 5CK4A 1TF5A 1ZD1A 3HDTA 3T06B 1OXVA 3EPKA 2ODNA 4TT3D 4OQLA 1UBFA 3C7KA 2BMDA 3HP1A 2BMJA 2CL7X 2RH5A 2J45A 2GZDA 4JYBA 4L9SA 4YMTA 1JR6A 1CR2A 4JL6A 2P6RA 2O8DA 2F6RA 1H8HD 5HKKD 5JS8A 1QHSA 1X8KA 4BEBA 5FPTA 1EESA 3THOA 1M2OB 5JJIA 1NLFA 4XIGS 4PPGA 3R8FA 8OHMA 3QE0A 2VP2A 3U44B 1NG1A 2C03A 2VSXA 1T0JB 5FUYA 4OK6A 2CVHA 4LV6A 3ZJYA 1ZU5A 4OQXA 4EPYA 1IQPA 5JSZA 4LHWA 4DT1B 5B30A 1N3BA 1YZQA 4B73A 3RHFA 4AWXA 5TVKA 1CTQA 2NQ2C 2HLDA 1IN7A 1S8FA 2PT7A 3GJ6A 4FI3C 4LV5B 1S3GA 4HUTA 1DTSA 3TH5A 1VIYA 5TY0A 1G20E 2AWNA 1T8UA 1E9DA 1KSFX 3NHBA 4AKIA 1UF9A 1SXJB 2QAJA 3TAHA 1E2GA 1NN0A 2XZLA 1VG1A 4A9AA 2JDID 1FNNA 5J4VA 1D8TA 2Q3MA 2WJHA 5L3QB 2XJ9A 3QKTA 3AM1A 4NCNA 2XX3A 4NTZA 3TJZA 3WHKA 4D82A 2RGDA 4LJ5A 3SYLA 3DDCA 3FVQA 2OESA 4OHVA 2QP4A 3S1AB 4HDCA 2F3RA 1FFHA 2ECKA 3I3SR 3TSWA 5HE9A 2ZREA 4Q7LA 1T3LA 1U81A 2FOLA 3C15C 4YQFA 3QNUA 4G3XA 1OKKA 2BMEA 1WB9A 1NBMA 4UNRA 3O8DA 3G0HA 3FFBA 1W0JD 1P72A 1TF2A 1F2TA 1XEXB 3O47A 5EXSA 4NKRA 4HLQB 4C0BA 2IBMA 4MKFA 1JJ7A 4BLOA 4QM7A 2IYQA 4JT2A 5BW8A 2MSDB 1BMFA 1HV8A 3DM9B 1JR3D 2ODEA 2PCLA 1XDBA 1TNDA 4Q7JB 2JJ2D 3GFOA 3KL4A 3X1WA 4JBXA 2C78A 4KLNA 3KJIA 4EPTA 4DWJA 1IN4A 1B23P 1IOZA 1FOEB 1ZNYA 1XJ0A 1N6OA 2CEAA 3NH6A 5FL7D 4F7WA 4PZYA 3THWA 1GRNA 3NDPA 2CBZA 1G18A 5DNYB 3BXZA 4FMDB 1NKSA 1SGWA 1Q57A 2A30A 3I8XA 3PG5A 2ZRNA 2ZJOA 4IDHA 1OFTA 4LBZA 1R4AA 3D3QA 3WRXC 3ASYA 5KTYA 3L2OB 4MRPA 1W48A 2W2TA 4QFMA 2QROA 4V0LA 3SQXA 2G77B 2AKYA 2QA5A 3CNNA 1TX4B 1VYVA 2OEPA 3GJ4A 1CR0A 3EIQA 5FFMA 4QHTA 3VX4A 4Q4LA 3H86A 3HPRA 2QZ4A 1R0XA 3QF4A 1GTVA 2P2LA 4URYR 4BRWA 3QXSA 3SI7A 3RWOA 4NPHA 1D6JA 2B7CA 2FFHA 3U2QA 1F5NA 2BJWA 2C96A 2XITA 2QRZA 4YMSA 2REXB 4PAOA 3MAAC 1E3MA 3HPQA 3RRZA 4POAA 3CB4A 4CW7A 5D3MA 2VQSA 3SHFA 1Q1BA 3GLHA 3EG5A 2ZRAA 4MGIR 2DFNA 2R2AA 4WXPA 2FG5A 4DLRA 4D80A 1UBGA 4FIDA 2P67A 4NCIA 1G64A 4BLRA 3SJBA 4Z1MD 2QPOA 1SXJE 3CRW1 4QNMA 5CM8B 3NEJA 4ZKEA 2GJ8A 4BZQA 1UBCA 3KXLA 2BBOA 1KI9A 1YJ5A 3CPJB 4B35A 2E1RA 2IYTA 2JLSA 2N1BA 3MD0A 4A0RA 4YXWD 1SHKA 1WE2A 2A2ZA 3IUYA 2XSZD 2LWIA 1NNEA 4MKHA 2Z4RA 1OJLA 1R2QA 1RVDA 4TQAA 2OFXA 3EX7C 1JECA 1GDDA 5FTJA 2NPFA 1RC8A 4G5GA 1GNPA 4IXNA 3K9GA 1HURA 2JATA 3VTKA 2XNSA 3Q9LA 1W1WA 1YR7A 3EIEA 3QXJA 2VSFA 1CP2A 1CIPA 3BERA 3PUZA 1N25A 2D3WA 3GCGA 1Z0DA 4KFSA 2O8CB 2J0SA 1Z63A 1DPFA 4Q21A 2JCSA 4PANA 1YR8A 1GILA 4TN1A 3BFXA 2C2HA 2QENA 4U00A 2QBYA 4GRAA 3OEEA 3PV0A 3GLGB 4LYJA 4Q03A 1KO7A 3TSZA 2C04A 1Z0KA 4ASUA 5EZ6B 4AG6A 4KI0A 2NMVA 3TVDA 1N0VC 1NN5A 5FTKA 5JHHB 3VFDA 4C4PA 4XWOA 4TSFD 1MR3F 2A5FA 4RFSB 2PEZA 1N6NA 3OIUA 2VSOA 1YZUA 4PHHA 4I1OA 1TEVA 2DPXA 2G88A 2ZE8A 2BC9A 2OG2A 3Q85A 3QG5A 4GP6A 1UKVY 1GNRA 1Z29A 2JIZA 3W3ZB 4AG5A 2WWYA 1HT1E 2X8AA 2B92A 4BFWA 3P20A 4HAWA 4F93B 1G3IA 5FI0B 4IFBA 1TU3A 2IEYA 3OFND 3FDIA 2DY1A 3ZS8A 4RVCA 1EGAA 2JJ1A 3AGQA 1RW4A 2G83A 5L3SA 1KZGB 2ZSBA 4R98A 4CT5A 1DOAA 2REBA 4ZPXA 4Y0VA 3OIWA 2ZUBA 3EXAA 2DR3A 4N1AA 2QT1A 4LSGA 4QJ5A 2JLQA 1XJCA 2IF0A 3KKQA 3QI2A 1Z83A 4PHTA 1Z6GA 2PZFA 3AUYA 3IIJA 3T15A 4Q4JB 1O87A 1ZW6A 5EE3A 1VCIA 4EJSC 3EZ6A 3ND9A 4JJKA 1NI3A 5HZHA 1E2DA 1ZIPA 2BMFA 2HXSA 4DIEA 3CRQA 3M6AA 3RRNA 3X1ZA 1E2NA 2GESA 4L9WA 3IO5A 4TTRA 3B1ZA 4BFUA 4B71A 2VP9A 2IYUA 4MUBA 4HSEA 2GVDC 1NVVQ 2PJRA 2F55A 1RKBA 1AQUA 5JRZA 2NPIA 1M8PA 4TMVA 4BFZA 1Z2CA 1EFRD 2RCNA 4CEJB 5G3YA 2OT3B 2OILA 1MH1A 1W5TA 3AF3A 1AQYA 1WCV1 2GA8A 1IN5A 1M7GA 3KQLA 4LYHA 2ZRLA 4HUQA 3KFXA 1EFHA 2CNWD 1R5NA 1E69A 1KYIA 1S9HA 4XTCS 3AQ4A 1YU9A 4NYJQ 1XD2A 4A1FA 3C5CA 2GILA 4FMCB 2Z43A 1RRGA 2GJKA 1E9AA 4YDHB 3GLGE 3ICEA 4C3ZA 2JA1A 4E5UA 4GZMA 1W2HA 3K09C 4IEEA 3MJRA 2AK2A 4GL2A 1QG2A 1KSJA 2NG1A 4Q1FA 4TMXA 4D0GA 3WNBA 2V55B 3QKSA 2WHXA 1E9RA 3LXXA 4LHXA 3K0CA 4IDOA 1XCMA 3I4LA 1WP9A 4DIDA 3L0IB 4TYWA 1Q1QA 1QHYA 4B2IA 3WBKA 1TUIA 3DZDA 3CZQA 1R5OA 4PXAA 3V9PA 1NF3A 3AKEA 5KPDA 3FB4A 3VHXA 1ODFA 3QIAA 5G3ZA 4TZ0A 5DHAA 4QG7A 3UWOA 1AS2A 1CJKC 4KFRA 4ESHA 4GOXA 3ZZ0A 2CCJA 1NKTA 4NYJR 2JLXA 2QUZA 3T12A 1LS6A 4HZUB 5IDVA 2P6UA 1T3HA 4GT1A 1R8QA 4ACBA 4Q00A 3U7HB 1HEIA 4IOJA 1DG3A 3QPVA 3V4RA 4JLMA 2RKOA 4V0KA 2ZVQX 4D6PA 2WPDD 3IILA 5KSPA 4YMVA 4FWTA 4Q48A 4DLVA 3B5JA 3H4MA 1I4DD 2C95A 3SJAA 2YYZA 5KPJA 3L82B 4TL6A 2VO1A 1KO8A 4KYUA 3BE4A 5KOYA 3C14C 3ADDA 3MJHA 4LBYA 1HE8B 1OT3A 2Q21A 4J0QA 3MCAA 3FHCB 3DOFA 2WOJA 3THYB 1LNZA 2GXUA 5IRCD 1ONBA 3Q7QA 2AL7A 3IEVA 2CDNA 4LHZA 2VH5R 3OAAA 4B74A 4GNKA 2V8OA 1V5WA 2VHCA 3AP2A 1BKDR 821PA 1NSFA 4P4SB 1JR3E 2KI5A 5K8IA 3LLMA 1N6PA 2F9MA 1T9HA 2CCGA 4RY2A 2YC2C 1ZM2A 2EFCB 2H7VA 4OHYA 3K0EA 3B8HA 4IHQA 1GL6A 3U61B 1L4UA 1NG9A 1HUQA 4HI0E 4UQOA 4HLUA 2Z0MA 3TUIC 1X3SA 4RZ2A 2F43B 2IUUA 3R9IA 1AGPA 1ZM7A 3B9QA 3LW8A 1UDWA 2QMUA 3DMNA 3LA6A 5AJYA 1VIAA 5LDDC 1V43A 4HEJA 4LK2A 2O8FB 2WKPA 4U7DA 1MRNA 1RIFA 1U99A 3CRRA 4LX0A 4OBEA 5HCNA 3WXMA 3U4QB 3SQWA 3R9WA 4BWYA 2GBLC 3CRVA 4QKQA 4AKGA 3QVVA 3UMRA 5KDLA 4E09A 4CF7A 4PAQA 3LXRA 5KDOA 4C7OB 3CKLA 3CIOA 5FPHA 3W8NA 5HKKA 4ESVA 2WOOA 2WZQA 1JAHA 4IOKA 1JALA 3SHWA 2R6AA 4DDTA 5KHOC 4I1SA 3WMEA 3QXXA 3AGPA 5A0FA 1FW6A 2CLDX 2O0KA 3A1SA 2J1LA 3BGWA 3CUEF 4TMKA 5E7IA 2ZS8A 4B32A 3W6PA 2KE5A 5FOVA 4NP6A 3I73A 5BQ5A 3LW7A 2J41A 3ZS9A 4DEYA 2O8DB 1IY2A 3N2IA 3I62A 1TAGA 1XXHA 1LVGA 2IYRA 1H8EA 2CHGA 4B3GA 2FGKA 2GF0A 2OFOA 3Q5DA 4B3BA 1W36C 1SVWA 2RHMA 2BIFA 3SBDA 2MMCA 1VHTA 1JBKA 1Z22A 4XWAA 1GP2A 2A7QA 3IBYA 3B9PA 2G0TA 4JLDA 4JLPA 4K81B 4D2IA 4QXAA 4XH9B 1YHNA 2PH1A 1PLJA 2JDIA 2PX3A 1FP6A 1TQ6A 2BBWA 1U9IA 2BKUA 2DWOA 3KKMA 5LB4A 3ZIAD 5KNCA 1HA3A 4FMBB 1T5LA 2XEXA 1VCOA 2G9NA 2RGNC 4DB2A 3IPXA 3K0AA 1TL7C 4DSNA 1P60A 3PENA 3PJRA 1G8HA 1ZM4A 1L8QA 2FF7A 5DYIA 2ZJ5A 1W0JA 1E2MA 1GIAA 4PQRA 4O25A 1KJZA 2AHOA 2I4IA 3LLUA 5C2JB 5JCPA 3GP8A 4KODA 3P26A 2CVFA 5KUTA 4Q66C 2P5TB 4Q18A 5CM9C 1ZNWA 2O5VA 1SXJD 4ZIRA 3KFVA 5FBWB 1XPOA 2GAAA 421PA 5IHPA 4X8OA 1E2EA 4QBGB 3WP0A 1J8MF 2JJ2A 4OKSA 5EP2A 4B33A 4V0OA 1TU4A 2VHTA 1PZNA 1NIPA 1RYHA 3K0SA 4HYYA 4Q9LA 3W9YA 1WMSA 3HR8A 1VG8A 2ONJA 4C0QC 5LD2C 1Q1ZA 2P5SA 3X2SA 2VP0A 4JSTA 4CEHA 4IOLA 2ZE6A 1RJ9A 3A6PC 3K8YA 2P3SA 5CB6A 5FH9A 3ADBA 4EFLA 5F9HA 4LY6A 1QZXA 3CW2A 4DEXA 2V4ZA 1VKJA 4TTPA 2E9SA 4A4DA 3IGFA 1S2MA 4A2PA 3DOEA 2JGNA 1ZNXA 4AC9A 3WHLA 4OHWA 3ADCA 1KK1A 3F8TA 1K5GA 1MABA 1JEEA 3FMFA 4NDZA 1SXJC 4EQ6A 4W9MC 1GWNA 4LJ9A 3WYFA 3A1UA 3X1YA 2FSHA 2OLJA 5JS7A 4HB3A 3LV8A 5HZKA 4AYXA 3T1TA 3TKLA 3FE2A 2RGCA 1E0KA 4XOIA 2BEJA 1SKYB 2YC4C 3KUDA 4JL8A 2JLWA 4XTRA 4ZCMA 5BYKA 4PTLA 4Z1MA 2IT1A 2OZEA 1E1QD 1FX0A 1WXQA 3PVSA 2GTPA 5JWRA 2J46A 5JI3E 721PA 1TF7A 3SS8A 2Q9CA 3IO3A 3V4FA 1CXZA 1T5IA 3WRYC 4BUJA 2GEDA 2ZUDA 4M1MA 2IL1A 2WAYA 2CE7A 2RGGA 4MRSA 2XSZA 2CJWB 3RABA 4AYWA 1ESNA 3WYGA 5CB8A 2A78A
chains in the Genus database with same CATH superfamily
4JKOA 1KIAA 3NR2A 1JNYA 1S8OA 2KW5A 3GCXA 3HWX1 4KE8A 4MPRA 4N65A 3TTWA 4W5QA 4XOUA 2E4WA 2D5BA 3G0IA 3QLJA 4OGLA 3HXMA 4WBXC 1WHSB 1MXHA 4Z7NB 4FE3A 5C1PA 1JFSA 4U2DA 5HZGA 1COWD 3MTDA 1S9DA 4D99A 4YVFA 1KRWA 4IDDA 4RADA 1P3JA 4QARA 1IM5A 3D6UA 2WHYA 1ZGGA 3VV2A 4ALMA 3VR3A 2NO6A 4NXMB 3QFTA 4KBYA 4JLVA 3LNCA 2UYHA 2MOKA 2Q3HA 4LRUA 4HVLA 1SXGA 4WDQA 4H7FA 3NHJA 4N82A 3DL4A 5LA6B 3WYDA 1LSUA 2B4RO 2FUEA 1Z15A 4OLJA 3IPCA 3PIRA 5FWXB 1PR0A 2EHJA 5E2BA 5FLXA 3KHTA 3IV9A 1B0PA 3N2EA 3L05A 2IYNA 2SECE 1GKYA 2CUZA 3VZSA 3TL6A 1Y6FA 2HMSA 2IPNA 3BIOA 3R6WA 3USES 1C0KA 4MP6A 3RAGA 1QP4A 5I8ZA 4DV5B 4FZJA 4XM1A 5C4MA 1WNTA 4M0MA 5CD9A 1PK9A 1RQXA 4EPRA 1YH3A 3QLUA 4KXNA 2XOEA 2OHVA 4WKCA 1YIAA 2E89A 3NB0A 3PVZA 1ORIA 3N7AA 4R83A 1T0IA 3IBCA 1IHUA 2AN5A 1I0ZA 2UU9B 2ES4A 1PBNA 2FK8A 1GZ5A 1AHNA 1BW9B 3LPDA 2HHJA 3DAFA 2AF4C 2WEKA 1IY9A 5FNVB 1MDBA 2CDCA 4RSHA 3SFZA 4ZCTA 3TTUA 4WZ6A 5H9WA 3IL2A 2QRMA 2NVUB 4G4GA 3SKVA 9ATCA 1JPUA 1Y6QA 3A6DA 4KI7A 4DKJA 1DB3A 1II9A 3H9GA 4YYZA 1WSAA 2XLBA 4U5QA 4CQMB 1V1RB 2BTOA 1P3Y1 2Y1OA 1MOZA 3IJ5A 2H0QA 4FLEA 2IUFA 4EVSA 3QYPA 1EXWA 2CSUA 1K75A 2FDRA 4E1BA 1EWYA 1YZFA 3JPYA 4UNPA 4GX0A 4ZHQF 3QKIA 3RRYA 1C0EA 2HSZA 3PQCA 3VDRA 3CUUA 3NHPA 3T7SA 2JGEA 2B3TA 2FG7C 2XVAA 2XMPA 4PWYA 5FV7A 1Z56C 3K2QA 3IMFA 3FTNA 1LC0A 1Z6YA 4IRMA 5EIHA 5B4UA 5F2NA 5EWLA 4UHFA 1SKYE 2PBLA 2R8RA 4UJ3A 3UW1A 1AX9A 2ZRMA 1F3OA 2DR0A 3K1ZA 5EJ2A 5C7IO 3GJYA 1ESDA 2NTEA 3N2GA 3AEQA 3LHIA 1BS1A 2SCUA 3S6JA 1DPGA 1CY1A 1KI6A 4D3XA 5JH7B 4KMRA 1TLTA 2Q6OA 2HDHA 2PKYX 4UVGA 5M7EA 1FRZA 4ZYWA 1RWXA 1X1RA 5FI1B 4C21A 5FWDA 1DAIA 2XYQA 1SK9A 2CDRA 2O2ZA 1D2MA 2V03A 3LDFA 2QUIA 2XMGA 3BMCB 4ARZA 4H6VA 2CV0A 3KVNA 4B6EA 4IXWA 1MTZA 1EFRA 2WFLA 1IWBB 2XA9A 4YJGB 2WTUA 2KB0A 4UE6A 2WE7A 1TO6A 1G6KA 1NC1A 1XAIA 2E7ZA 5KYUA 5HXAA 3U81A 2LW7A 1JMKC 1KHTA 2DQKA 2GHIA 1EK1A 1W0KD 3EARA 4E70A 4KQJA 4CLRA 3PT5A 3RUCA 1WPXA 3L49A 1EG2A 2HCTA 4B5KA 1VL6A 1P5FA 3AJRA 3EFEA 2QUKA 1DNPA 5ELMA 4DIOA 1A2BA 2BFBA 2GJ4A 2R6ZA 4WH0A 4F84A 3I1JA 4YUZA 5JANA 3LCRA 4YY3B 3SC4A 2FFQA 4WOCA 3QKRB 1K7SN 4BKPA 3AU9A 1WPQA 2GPTA 2KWIA 3ZE7A 3QM1A 1U7OA 3PUVA 4GBMA 1QGAA 5K5EA 4S24A 3IPYA 1H4VB 1UWLA 2GNPA 1MBZA 3C1AA 3K9NA 1KBOA 3A2MA 5ALEA 5DYTA 3R3XA 4E3ZA 1DV1A 2EYUA 3N2ZB 1VCNA 3PPWA 4ISBA 3UUFA 3H6GA 3DHNA 4O2AA 4QBKA 5J59A 1U90A 4MI9A 4DSZA 1XKTA 2YNMA 2C8KA 2P4SA 4G8CA 4JH0A 4Z8XA 3TRIA 4U7HA 1J0XO 1MOQA 4JI1B 3QU4A 4OB6A 3PPIA 1JVNA 4XLZA 1KSHA 1RJGA 3LUAA 2OG1A 1CUSA 1G8SA 2PSHA 1RRPA 2J9XB 4BWGA 4CN9A 4IKEA 1I5RA 2EATA 2J4CA 5K3AA 5E38A 4EPVA 4J7AA 4YDQA 2NYVA 1GRVA 5IARA 4F4HA 2ST1A 2WWWA 2JARA 2QJRA 3HP7A 3DOJA 3TRFA 2ZUFA 1QU2A 1L3BA 3QWAA 1DIRA 1CY4A 1HFEL 3A8TA 1IY8A 2IE8A 4E4TA 1NXTA 1XL1A 2D2VA 4DV4B 3KEGA 2TECE 3LT0A 2V1UA 3NOQA 5EE5B 5CYGA 3EIOA 1H0RA 1M34B 1N8TA 4FGUA 4D74A 1W35A 4Z5XA 1RBMA 1JFTA 4JI8B 1IMOA 4LF8B 3A28A 2WPDA 3T0GA 4B6FA 3OKFA 1L8AA 4K7JA 5CPFA 1O77A 4R8SA 1OB2A 2DVMA 3W8RA 2CNLA 4MWGA 2ZRFA 1S2GA 4IWYA 4MVWA 4YRBA 1JPJA 2ZM6B 4JJGA 4MUEA 5IAEA 3COJA 1QMGA 4LA4A 1G38A 3AKYA 1XZ8A 3R8CA 2PMDA 1G3RA 2GBLA 4KFUA 3OOJA 3HB0A 3HYLA 4LHYA 3NLLA 1CUBA 1SVUA 1VE3A 2VJAA 5HFJA 3V1TC 4DZTA 3C48A 4RMJA 4B3XA 1E5VA 3NBFA 3THSA 3VR6H 4DCNA 4EBBA 3FCYA 2A5YB 2VEDA 4Q16A 4QVGA 5KTPA 5FTWA 2J59A 4MGYR 4B2LA 4TV8B 3G8DA 2B4YA 3M70A 1FRFS 2ZQYA 5A3VA 4TLDA 1JHZA 2CLLB 1IXKA 1XUOA 3CRMA 5IK2D 2GJAA 3NJ8A 1JYSA 4MS1A 1QZUA 1PWEA 1Q92A 2P1DA 1U3CA 3RYCA 3CONA 3P9NA 1OPRA 3LRTA 4L1KA 3UT6A 1BOOA 4A8JA 4F6RA 4G5YA 4PO9A 3EXFB 3G2HA 3VC3A 2X15A 4UU0A 3RUIA 3RU7A 4UM9B 4HQKA 3W3AD 5CUQA 5F4BA 5DYYA 5AUNB 3CE6A 1U7XA 1NQ5A 1CUFA 3EH1A 3L4BC 4NHEA 4CN8A 4DLYA 1CK4A 3Q3HA 5JNLA 4QEDA 2GHQA 3QXCA 3CLRC 2NZXA 4C7KA 2APJA 3JY6A 3TRJA 3ZR4B 1NJSA 1Y1PA 4QDJA 1P62B 1RYBA 3G85A 4K3VA 4Z4IA 2R2GA 2WYVA 1E7SA 1KXZA 3DWFA 3NWPA 1UP7A 1ZD8A 3WMWA 4CMGA 1Y6JA 4ZHSA 2PHZA 4K03A 4Q4HA 4JJ6A 5BSRA 1N2CB 4ENRA 2JHCA 3R3JA 4QHYA 2BM1A 3C41J 3CTPA 4EAAA 5FI3A 3HKEB 4RA9A 4FGSA 1HYEA 4EDFA 2R44A 1H2HA 1I2DA 1Y8RA 3E3AA 2IS2A 4AY5A 2ZDGA 1EYZA 1Q3TA 2YXNA 4M8NE 4OUDB 3RSQA 3ZZUA 2JJQA 2X1HA 4F8JA 3AVPA 4U7PB 4ROTA 2I2XB 3SX4A 3O8RA 3PUWA 4LOAA 2XOKA 1NIJA 4PC3A 2YRFA 1Z8HA 3K1JA 4PLZA 4HDOB 5H3LA 1MB4A 3VU9A 1WU7A 2C9ZA 3ZE8A 2ODQA 3G1TA 4Q1BA 4M0EA 1WCIB 3QQPA 1J9GA 2P6PA 2ZIXB 1O58A 3CPHA 3JYPA 3NVAA 4MSUA 5HTKA 4PRLA 5IPFA 3A3YA 5JAUA 3E35A 4CMHA 2BF7A 1U0JA 4ILEA 3H65A 1JEOA 3GVPA 1B1CA 2B94A 4I1YA 4DW8A 4FYMA 1DBSA 1RQGA 1TQDA 3N9IA 1T3GA 2X7XA 4N6OA 4WNAA 1LTQA 2IXFA 4EUHA 3PJGA 2HX1A 2AB0A 3H9UA 4UXJA 3L8ZA 2AG5A 3F78A 3HU2A 2JLCA 1GUFA 5KU7A 4PYKA 1UCFA 3WOHA 4AXBA 2FRDA 4ZTUB 1HYGA 2CFIA 4L08A 3TB4A 3ZJTA 4MUAA 4DMKA 3EF0A 2OAP1 2YYSA 3SSMA 5KC9A 3O94A 1DCMA 4JQOA 5HG0A 3WGHA 1MB9A 1HNNA 5DCUA 4GC5A 4U7TB 1Y3HA 3SSAA 1TD9A 3EIXA 4YPVA 2GZRA 2X9NA 2Z5LA 4V02A 1X8XA 4X64B 3HJTA 2AOXA 4I50A 4TXMA 2WJ3A 4RF3A 1ADCA 3O84A 4WXRA 3ZW9A 1BIFA 2ZCJA 4KRFA 3PQ5A 3RK0A 4I2NA 4DT1A 2PSEA 1QONA 4HTAA 2IOYA 2HA5A 1O96B 3BKXA 5SV2A 4DMUB 4BNKA 1C3OB 3LOQA 5IBQA 3S28A 3KQUA 5DRTA 4Y30A 1NHGA 4IOMA 2GASA 2Y66A 5F64A 2QMYA 5LB2A 2CYCA 4C7BA 4S0ZA 2IYSA 1A5AB 2F8MA 4TKZA 4OL0A 3EASA 1HC7A 1NF2A 2A84A 1CJUC 3C1OA 5AKLA 5FADA 3QKUA 4DRYA 3ZE2B 5F7XA 3E15A 1Q7RA 2EKPA 2UUBB 1NBWB 3VR5A 3R09A 2OHJA 3PKIA 5HSGA 3K71B 3IODA 2PZ8A 4R2JA 5HMMA 2CFOA 4M1TA 4LDPA 3UKDA 4DLTA 5GVSA 2YASA 2GVNA 2VDMB 3DSRA 2Y68A 4LSMA 1YDEA 4LJAA 4MUKA 4RKQA 3VTFA 3BD7A 2XMZA 2AC7A 4M1WA 1PWZA 3CYFA 4OJMX 4ZT7A 1AKYA 3IP6A 4IGAA 5E6SB 3V55A 1U80A 1DHTA 3CX8A 4Y1GA 5EEGA 1O8CA 4PG7A 4F92B 5DLPA 4EG0A 3PGKA 2C5SA 4OSPA 1HT2E 2QAGB 1FSFA 1QZ3A 3RM3A 4IV0A 3SEFA 3CISA 4JLAA 5FR2A 1DT5A 1U8XX 3A6JA 4PM4A 3NYWA 3PWSA 4EB6A 4ZYTA 3HMKA 1NY5A 5HQTA 5TIIA 1NP7A 2Y1FA 5CVCA 5KNDD 5T5QA 5CDYA 3TFOA 2HNBA 2QVGA 1GQFA 4JI3B 2D8AA 1HI9A 1O4VA 4K6OA 1RM3A 3GRVA 4W8HA 1FNSA 1B0ZA 5SY6A 5HOQA 2ZE5A 3KHUA 4YI3A 5K03A 4MDFA 2X4IA 4OYLA 5CTAA 4O4JA 2R7KA 2BFEB 2VF2A 4GOKA 1MX9A 3WGNA 5GJWC 1AUQA 5C81A 2RGRA 3ILXA 4FHDA 1YFJA 4IVQA 4GE3A 4PPFA 4JMLA 1UBLS 5CW1A 4DV7B 1G8YA 2H1IA 4RGYA 2EP8A 4JYCA 5GOTA 4UARA 4Y6GB 4MHOA 3B5IA 3HYTA 5ALSA 1J7KA 2P6OA 1ISGA 1KP2A 4URZR 5EFZA 1P75A 4L0CA 4HDMB 4LEIA 3WB0A 1Z5VA 5CDTA 1UBOS 1D9XA 4R0MA 4WESB 1DKUA 1JRLA 1II0A 2Y0PA 5SY4A 3U7GA 5C5CA 1DIAA 1WY5A 3ANSA 3PXUA 4QGAA 3UT0A 3PC8C 4BX3A 2HQOA 2W58A 4HXEB 1JILA 4TS1A 1E8NA 4L27A 4BFSA 1FFGA 2BY4A 5CNMA 1QQAA 2PLNA 2YHBA 2TMKA 1XDZA 4WJKB 4L4SA 3JALB 2BEWA 2CLSA 2UKDA 3T4PA 3FNQA 1V16B 2AQIA 1P9RA 4L9AA 1JG4A 1XLUA 4XCVA 3RHTA 4Q3CA 3UJDA 2CV1A 4LF4B 4CKXA 4J4HA 3MJTA 3EUFA 3HL4A 3NG1A 3PC3A 4MPDA 1J39A 3AVWA 4O33A 1LQUA 4RV9A 1MX3A 4YPOA 1AK1A 4N7MA 4BAUA 1M54A 1OZAA 2ERCA 3NHKA 4HR7A 1JEYB 5BN5B 2ZYIA 2HK6A 4ZOLA 2HSEA 3EZ2A 3PEWA 1NYRA 1YIDA 3AR5A 4YREA 1ZR4A 1X1SA 1NFFA 2FPIA 3JD1A 3EODA 3NONA 3NW9A 1OYYA 3LDAA 1UMCA 1MGPA 3PEEA 4FWIB 4AX8A 2TRSB 1RTKA 4I55A 1JDBB 3RFFA 5HILA 4DBLC 1NOJA 2ZJ2A 3EXEB 1N0HA 3OUUA 1DZ3A 3PSAA 3MHPA 4HRXA 3Q72A 2O3TA 2PMKA 3I30X 3MMXA 3QVWA 4TLBA 1N77A 2OCGA 4GBED 4RIEA 2A9VA 1YE8A 4HPXB 2PSJA 3VZCA 3IVAA 3ZY2A 5LCXA 3FTFA 1U8YA 4MVJM 2WU3A 3W3AH 3I2YX 4FFNA 3U4DA 3SHVA 1U0TA 3D8RA 4JMPA 4KQGA 1Z4PX 4MB2A 3ZH9B 3IE2A 2KJQA 2AFHB 4MLPA 3JD3A 3NDRA 4V0QA 4LI0A 1QANA 1XVUA 4XVCA 3NGXA 2GJ9A 2QL5A 4G0NA 3TLXA 3PUYA 1YHZA 1TOAA 3EXHC 3I2HA 3UA3A 3IDOA 1E64A 4KSYA 3OETA 4JVNA 3WWEA 3RTAA 3GPBA 4R05A 2O2YA 4P83A 1BE0A 5KYVA 5TDHA 4COKA 1VBFA 2V7TA 6ABPA 1Z4IA 5DK6A 2ZPTX 2O8CA 2GO7A 2WKWA 2K6GA 1S1CA 4KBFA 4EL5A 1L5LA 2LR0A 1F9EA 1N2HA 4GOMD 1ZUIA 4EJSB 2WAXA 5F1YA 1DAGA 3A6EA 1B73A 4MKRA 5PGMA 3PFHA 2PXCA 4JL5A 5UKDA 1KVUA 1NQVA 3U7FB 3KAQA 1KAGA 1UBJS 4Y9TA 3NTUA 5AK4A 3NV9A 3BMQA 5FR1A 5CJPA 2X13A 3ZOKA 3PRKE 4DMGA 5EHGA 1Y7PA 1ZVJA 3UJ7A 3BMNA 1IJEA 2Z09A 1KPIA 2VL7A 4FCCA 5ENDA 4X1YB 1TT5B 4EENA 4KJZA 5D7BA 1YKSA 2J6IA 3NEAA 4MPPA 3G2KA 2YINC 2RSLA 1XA3A 4OKIA 1E7RA 1Y81A 1M2HA 3B1VA 3L8EA 4RFSA 4S1PA 1RJFA 3ZU3A 4X8LA 5HRAA 2C7GA 3QSGA 4K6GA 5BXQC 3DKVA 3MAGA 1E9FA 1L4LA 4JASB 4W5RA 1EHYA 4H4CA 3E4CA 1CVRA 2A5LA 4X3OA 1JIIA 5H02A 3SJUA 2OSBA 3TIGA 5IXSA 4D41A 3DKRA 1OIXA 1SUPA 4NNOA 4F5DA 3G68A 4Y2XA 4QDXA 1T6BY 1JDTA 4A0FA 2C1XA 1CR6A 4EY5A 3OA0A 4REQA 4KQ2A 4XD7A 1OREA 4G1CA 5C4IA 3PCXA 1KQNA 4NOJA 1GTJ1 4X71A 1GPH1 4W4TA 3SC2A 5C7OO 5LNK1 2GM9A 1VBKA 4FDLA 1QF9A 3GBSA 4BNJA 3RG8A 2D62A 5MFZA 2CJYA 2VDKB 2OK7A 1OZFA 4JBNA 2J09A 1VLJA 3OD1A 3PPXA 2IPOA 3LLCA 2WKRA 3PKZA 5JRJA 2CB0A 1M9NA 1MH9A 1THTA 3LNTA 4MAAA 2LGJA 4JCCA 1EVZA 4L5BA 4MP3A 5E1MA 4WBNF 1E6CA 2ODWA 1ZD3A 1CHDA 1NVBA 4JI5B 2A57A 2WTMA 4B4OA 3MOSA 1U1EA 5B6JA 4TRMA 3VMFA 5A4JA 3GUHA 4AJ9A 3U1TA 3RTCA 1CJMA 3UW3A 2CXRA 2GNOA 2AN9A 1YDHA 3FA2A 4DLUA 4MA5A 5J1SB 3AR3A 3IKTA 1EEHA 1EM6A 5DLQC 4AT1A 8ABPA 2P3LA 2GYUA 2XW6A 6NULA 3F73A 1PF7E 4YP6A 4M8SA 1MC8A 4P7BA 4JEIA 4Q39A 3BAFA 3OM8A 3NAGA 3Q9SA 4LRYA 1YUBA 2V4UA 2ANCA 4KXFB 5F3WB 1OBCA 3NIGB 1EUYA 2YV2A 3EC1A 3RG2A 4CEJA 2MYTA 4KQWA 5FKJA 1H6DA 4DA0A 1U8TA 1T2UA 2VNJA 2XZTA 4FVTA 3WIEA 1W0CA 2QRVA 5AVJA 3WL4A 2UZAA 3KKOA 4FCVA 4JP3A 5BMVA 1IAQA 3PT9A 4AKSA 1UZLA 1TMKA 3L6BA 2HQBA 1VE9A 3QFHA 3WGVA 1JJBA 2GPYA 5EWJA 3QFCA 2HGZA 4GMHA 3X1DA 3QMMA 3NEPX 2RBKA 4ZANA 5CIWA 4ZCLA 2H2FA 2OCYC 4AMYA 1Y1SA 2D0DA 4YCNA 3WDSA 4ZEVA 5I9LA 1JB9A 1CERA 2ORVA 1FTSA 2V96A 4MWTA 4DDWA 5DK4A 1I32A 2IHBA 1QK5A 3ER8A 2PLRA 1M2JA 2I9PA 2ZI4A 3NNNA 2UZ3A 1X38A 4OMCA 5HP4A 1FLNA 1Q20A 5CGZA 4D79A 1M1YB 4ZVRA 3ESYA 4AK9A 4H7IA 4OHFA 3ZHCA 3THWB 2PH7A 5BT9A 2GWHA 1E5DA 3SEAA 5DP2A 2W6CX 4M7WA 4KOAA 1OJ7A 3OU2A 3KOWA 3VBEA 4O4LB 5KX5A 3G8AA 4KEAA 4LPKA 1KOGA 2G1JA 5E2IA 1HR0B 1NPTO 3DKPA 2OD7A 4UFNA 3G88A 1YI1A 4NBNA 4HATA 1BEEA 1KY3A 4ALLA 5KWJA 5BN4A 4LMAA 3L1UA 3UXMA 5A06A 2PSSA 5ILOA 1KRXA 1XFAA 3IKVA 3NM5A 3R6TA 3QF4B 1UC4B 3QUQA 1TM2A 4KKVA 4MS3A 4NFHA 4RIFA 1RZ3A 3ZU4A 5AVWA 3Q88A 1DLJA 4JSYA 2Q41A 2XJ4A 1I4LD 4EW6A 4F96A 2RK3A 4BPBA 1RQRA 4ZDKA 3DEHA 4TMYA 5ALTA 3TR0A 1DC3A 5IKOA 3CZMA 5KU1A 2XWSA 1G8PA 2ZTVA 4QU9A 1UK7A 4L3OA 4CFZA 2C0CA 5ARCA 3AKDA 1D4ZA 5LP6A 1RYFA 1W46A 4KWCA 4B1FA 1DAEA 3BICA 5ED4A 5CFZA 1F7VA 3BTSA 2V45A 1J2YA 2QM0A 4Z7OB 5JI2E 1NRJB 4DVJA 3RS8A 3B2NA 4YRSA 5A4AA 3ZY3A 3MSXA 5ED0A 3W2IA 5IF3A 3V2HA 1F1JA 4NLLA 1MC1A 1RSZA 4RWEA 2C2GA 2WW8A 3QQ5A 3AHEA 3S8YA 3WGYA 4XJVA 4EKGA 5EJEA 1J0DA 3ETJA 1GN9A 2Z8YA 4LYGA 5KTSA 1Q7EA 2EKDA 1ENZA 2NU7B 3QGMA 4F5YA 1SZJG 2QVLA 2FW9A 2J3QA 3QW4B 4O08A 2E85A 4OI4A 5DGCA 4EO4A 3M5WA 5FX2A 2HH9A 1QP8A 2VBCA 3TSOA 1YDWA 2OENG 4HXYA 4URUR 4XVUA 4YIHA 3G8YA 1H2ZA 1NFRA 1BDJA 4LCBA 1TLFA 3C3CA 2GXQA 2FQWA 3QU5A 3REQA 2PL3A 4DCUA 2X5NA 1BDIA 1R1DA 2XNCA 2XNHA 2CD9A 3A0UA 3MEQA 2B25A 1G2IA 5HUQA 5KNBD 4RELA 4RTKA 3A37A 1BCSA 4UM9D 1L7VC 2QJTA 4BQSA 4JFRA 1V7ZA 2EKLA 3DZ8A 4ZYVA 3VNRA 3TR5A 4KL8S 1DWUA 2F43A 5B7NA 2F8TA 3EN0A 3ZBTA 4EI2A 3ORQA 4AUEA 4BZXA 5B7PA 4YONB 4LQDA 2IBSA 1UADA 3ELYA 2WHEA 5LIPA 1GGHA 2O6LA 5TMPA 1G8MA 3B6IA 5EZYA 1MAVA 1PEYA 3TZBA 3DCJA 1BH2A 3W7AA 5J63A 3K53A 1G5QA 2OFPA 5KBYA 2WIFA 3UHOA 1YOVA 4RD1A 1MEJA 3IDAA 4II3A 4UBMA 3STUA 3V5NA 4DDKA 1YKGA 2G07A 1CZLA 2ZJ8A 4IWNA 5B7GA 4M7OA 1ZUWA 3GD7A 4RTPA 1X13A 5DCLA 1CDZA 3HEBA 3I0ZA 4QVIA 1KWKA 2UYCA 3TQCA 4W6QA 2PT9A 4XIFA 3RC3A 1WF3A 4JI7B 1CF2O 5IDYA 4QJ3A 3EVNA 4OJYA 1MFZA 1J1UA 1FQJA 3ADKA 2Y4OA 4JJ4A 4P81A 4F1WA 2XXAB 1TRKA 3Q6IA 4N3AA 3EZYA 1CQIA 5LM3A 3CVXA 1E79D 2ZI7A 1OAKA 5L45A 1IWOA 4HVTA 4RSGA 2WM2A 2C57A 4Z2YA 1C29B 1KR2A 3FKQA 3MCTA 1OFHA 3SIWA 1OH7A 2G82A 4LKOA 4PYRA 5TSDA 2ZRQA 2XQVA 3OLQA 2B8JA 4K6FA 5FTMA 3TPFA 5LD2B 1XZGA 4MI3A 1QKKA 1UIMA 1GA6A 2DFDA 2JEOA 3WLPA 4BO7A 5LQDA 4BVBA 4IQ4A 2B1GA 1Z6QA 3KLOA 3FMGA 4FSXA 3NQ41 4KE7A 1V4BA 3ZCSA 4XWTA 3UUWA 2VDUE 1WG8A 3V4OA 2DBQA 2IPAB 3AHIA 3CGGA 3IMCA 1IVSA 1XTKA 2M6RA 1XELA 2P78A 3WE7A 1W6UA 5ALNA 1VXRA 3BJEA 3C6BA 1CNFA 5E3IA 2EJWA 5EP1A 1QE3A 4TWBA 5FT9A 2PFKA 3UH0A 1M1ZA 3KL2A 2Q4OA 1OIWA 4ZU3A 4F4UA 3FMOB 3KSAC 5AVTA 4IG4A 3HQ4O 4ZHQB 4B75A 5E6UB 4P58A 3E1SA 1L2TA 3AF1A 4LY3A 5K0BA 3M6WA 4BNDB 3C6XA 3OLCX 4FYXA 2C4VA 2X2PA 2G3YA 3K73O 3I32A 3JD0A 1KORA 1PP4A 4K8OA 5ICCA 3RUPA 4C2UA 4PPNA 2HLNA 4B8ZA 4XWGA 1SC6A 4IYJA 1P4SA 2OORC 5AVXA 3H2JA 1CY7A 1Q50A 4WLOA 4DMHA 3RROA 4AP6A 2K4MA 2IP1A 1NVKA 2WWTA 4ND1A 2IS6A 3EEQA 1WF6A 3P4XA 4QYMA 2QVXX 1EK2A 4GPIB 2W8ZA 1LDGA 4DGQA 1OHHA 3PE6A 4O4IB 1SVOA 1XZHA 3PEFA 1OC2A 3JYNA 4B7UA 2N9UA 2JVIA 3GRAA 4DUGD 4F0JA 2ZUVA 5JJ5A 2WINI 2VZLA 3K9QO 3ZDXB 4MHSA 3QEOA 5A0VA 3HJNA 5CFNA 1SMKA 5EKDA 5KWIA 3GQBA 5K8JB 3C5VA 1XZCA 1I3NA 4U2GA 4JI4B 1PG0A 1IQRA 1E3QA 4M1SA 4XUEA 5HJ2A 5BN3A 2QI9C 3ITNA 3FH0A 2YOGA 5J2TF 3FJYA 4R9RA 3I4FA 1ULBA 1S2IA 3DVLA 1FBTA 2IYZA 1VI6A 2NTNA 2ZWAA 3HEAA 4IH4A 4Q34A 4FX2A 2XYRA 1PNOA 3KEOA 4Q47A 1UBHS 1BE1A 3ROXA 1Y1QA 1I5EA 4II2A 3LYUA 4B81A 4DBZA 2JH9A 2D7CA 4RK7A 3BULA 4U7JA 3STYA 3IPAA 3WBBA 4GDFA 1FQWA 2C4TA 1OWPA 4OXYA 1HTBA 4ERNA 5IANA 3R23A 4XARA 4A2WA 5I9MA 5EJAA 1GHTA 3AHDA 1S4QA 4J0HA 5CLJA 1Y6ZA 3R1IA 5AHXA 3JQAB 3C4JA 4IX1A 5T4BA 4E6EA 4I19A 2YX1A 1NM5A 1SWVA 4LXGA 1LDBA 3GPIA 2Q6IA 3DMTC 3NMUF 2VZ9A 4UTZA 4UATA 1QM5A 3DBOB 2GUWA 3F6CA 4M83A 1NBEA 1QF6A 1MD9A 4NCHA 1ZXBA 4KMSA 1KKLA 3FKJA 4MW5A 5IYZF 3C16C 1OXTA 4JKIA 4MEAA 1W36B 5CEFA 3O3NB 2HT1A 3BJIC 4YK7A 2VPYA 1GNTA 3DAHA 3NC1C 2XUPA 4D0LB 2RHDA 4K0RA 5BVHA 1E77A 1G6Q1 4QWWA 1XLWA 1DBPA 3AI2A 1AS3A 2J08A 3IAUA 2EKZA 1T34A 4LBVA 1VSVA 2OKCA 3OSZA 5AVQA 1BHQ1 4M0FA 4BN5A 3S8EA 1QBKC 1XTTA 1UFVA 5BSGA 1R0ZA 1HXHA 4HMOA 4C07A 3RJTA 1A8PA 3IV7A 2GMWA 5EIEA 2G0AA 1JG7A 4EMSA 5JARA 3HR4A 3KQSA 1AF7A 4M89A 2I65A 4HG2A 5LXTA 3W7BA 1K98A 4AZ3B 1Z0AA 2HCRA 2VF7A 5JCJA 3UAZA 4BVAA 1A9TA 2BLNA 4TZ6A 5CXSA 3L7MA 4EFMA 2VTKA 1GSHA 4HYTA 4OHBA 2VA8A 4YP0A 2QEQA 1NP6A 1TCUA 3EOZA 3D4OA 2AR9A 1XJQA 4EGSA 1PYDA 1MT0A 2IZ7A 3CX3A 1G7TA 3ORYA 1QRUA 1UZAA 2WNIA 5BWMA 3LT4A 4S05A 3OQJA 3NNDA 4V0MA 5K9ZA 4C87A 1E7YA 4PHFA 4ZC8A 3IDQA 3KXPA 3R20A 3LECA 4RC9A 4KAAA 1LPPA 2D0OB 4UBJA 3S7ZA 1E4OA 3DW1X 5EZSA 1B14A 5DASA 1TTHA 4S1VA 2P9QA 1VLQA 3T6KA 2QLMA 1KS2A 1QIKA 2ZR7A 4TWJA 5DW3A 2YZ2A 2H7YA 4IY1A 4AN4A 1DGQA 1UOQA 3B82A 3CJRA 2YWHA 4IUDS 3VPCA 2GD1O 5TGTA 1BS2A 3PFBA 4KTTE 2O2SA 3O5AA 3OEYA 4KP7A 1YB5A 4IHJA 2QB5A 3L7YA 3ZK7A 2XUIA 3GGPA 3KSMA 1KY2A 1NVMB 3ACCA 3RS3A 3HC7A 3UMFA 3V80A 4BNWA 4AAYA 3W5JA 4NBSA 2D6FA 4RJKA 4YBRA 1XMQB 5LPNA 4M6WB 2I33A 2WHPB 4AB1A 4G36A 1EWRA 3R76A 4BLVA 4BFYA 3OQ6A 3FGNA 2OAGA 4BBPA 2AK3A 1ES9A 1I13A 3MUNA 4OJQA 3Q7PA 1E3SA 3DE4X 4IJVA 1OGIA 5CJJA 1DJNA 1K9VF 3D6NB 5DTIA 5E8JA 4DCOA 1V11B 1LBTA 3E7WA 3T34A 4C0JA 2WQZA 2NGRA 1V8ZA 1YQGA 1B0AA 3IIMA 1CQPA 2Y6VA 4JIMA 5WRFA 1NKVA 5IAGA 1YF3A 1DDOA 1NU8A 1Z4JA 4G0WA 2JCVA 2RHWA 1X39A 4WCDA 3HJUA 1CJSA 4TLLB 4FDUA 2H92A 2AMJA 2WHRA 1MKYA 3JVVA 3OZAA 5E0KB 4LXUA 4DJDC 4BIIA 3HBNA 4X92A 1Z28A 1R4MB 3VU1A 3QX8A 3QFSA 1M76A 2X9GA 1O57A 4RCYA 2VTBA 1ZC4A 3QV1A 3W8EA 1MXFA 4R2KA 5CA0B 4JLBA 2K7FA 2EZTA 2JFQA 2V5UA 3K9BA 3RQSA 4O6VA 2BKVA 3IR5A 3QEKA 4U2EA 2AOTA 4WZBE 1EGMB 3ROGA 3W5HA 4CFYA 4B9AA 1TDJA 2Z4SA 2Z6VA 1HE1C 4FZ5A 2QN1A 4Q9NA 4DB4A 1YZLA 2XNDD 2LD4A 4QL3A 4CYMA 5CFRA 1XPUA 1Q0HA 2TMDA 5HUHA 3K0AB 3HRKA 3LRPA 4PCUA 1Y3CE 2WE8A 1QCZA 5L95A 2F4VB 2GN4A 1HYBA 2J87A 3FCOA 4P4LA 1LF5A 3HDJA 4L8GA 3D02A 2YJTD 3HACA 1QWSA 2VWQA 3AY0A 3D6MA 3DE2X 4QM6A 1PFKA 2Y1GA 5CT4A 4TKMA 3QH4A 1PHRA 3D8HA 4K9KA 2F1JA 2FTKE 1U1DA 5I01A 3CW8X 4ZIRB 5JC1A 1UAYA 3PHBE 1GPUA 1ZEJA 3GJZA 4P93A 4RA6B 4TOIA 1N2CE 1QGED 4D44A 5SYNA 1DKMA 3H9BA 4AF6A 1DXQA 1ZK1A 3NHSA 2BDUA 4JLJA 1RLOA 3UV7A 3GAZA 2DFKB 4EJMA 3N58A 4DKXA 1M7BA 1WA5A 2Z2YA 3UV3A 3W5DA 3ZDBA 1XF1A 1SQ0A 4F4CA 3L4KA 1FFAA 4II7A 2NN3C 3ZJVA 2E4ZA 2JGFA 4KAXA 4DA9A 3MQ4A 3USZA 1AO3A 2YWXA 5BWNA 2AUTA 1JKMA 1E3JA 3PGA1 4MWZA 4ZCPA 4EGJA 3ND8A 1WV0A 1EUZA 1U04A 2V9CA 2FSPA 2WMYA 4MUGA 1U0FA 4UVEA 4YLGA 1RJ9B 3D2BA 4MVJI 2WF8A 1ZUNB 1T2CA 3R5FA 4YAEA 4AICA 3GJQA 1U3DA 1JHOA 1US8A 1ZH4A 2JCBA 3Q3JB 2X0RA 3ZJ5A 2PL9A 3OCYA 3HFGA 5T64A 3LQKA 3QXHA 4M0UA 3W5IA 4KR2A 1MABB 3TI7A 2A14A 2C3UA 1II8A 2PS1A 2HQSA 2Z8ZA 3HFJA 1UZNA 3NH9A 3OZWA 4KFTA 3QVXA 1L7MA 4GM4A 4UCFA 1XXHE 4G2NA 4PLCA 2WSBA 4YC7A 2CDAA 2BW0A 1S0UA 1QG6A 1MGOA 2JNWA 4TL7A 3RI3A 4YJHA 3U31A 3ZDEA 4CVNA 3QNWA 4U2BA 1E2HA 5AESA 4KQMA 1D1PA 4AQ7A 5ITZB 3O7WA 4XPZA 1VGQA 1QVWA 2QX7A 4ES6A 3J81k 3GA0A 3IMEA 3QEMA 4G1EB 2CFSA 5EKXA 3UXYA 5DNUA 1VCHA 2YMLA 2WD7A 1NMZA 1VHWA 2PS0A 3ZWMA 4ONEA 3L40A 4LQ4A 1XAHA 1XFDA 2V8BA 3CURA 3DJFA 3EG9A 4KQEA 3QTBA 3E0QA 3DLPX 4PXYA 3GK3A 4GP9A 3DLIA 4TYPA 3EGOA 4W5HA 4Y1RA 1ORWA 4P0PB 1QGUB 3FYCA 2F9LA 1OWOA 3D3NA 1VSBA 2OV2A 3JQGA 3RLFA 2L18A 4LVNA 1AZTA 4YV2A 1OLXA 3QU7A 1LBSA 1LLDA 1ZMTA 1ZYUA 2XGGA 5AIAA 5AXAA 3EPJA 1OI2A 2JS7A 1MIOA 3SX2A 3A1CA 3U3JA 1K7FB 2Q5JA 1XZQA 4IWXA 4LJ8A 4NBLA 4MYCA 4UU8A 4WW0A 5CCDA 3ZV5A 2H3EA 1GPBA 1WETA 2IZZA 4UQPA 2DCMA 1Q1GA 3RJ5A 1DBIA 1MJNA 2HF7A 4WVFA 5AH0A 1PJCA 2B8TA 2AUNA 4J1TA 1T9BA 2RONA 3FOAA 4H59A 1FDRA 1QVAA 1U65A 3V2UA 1J8YF 2JK0A 4G8JA 2V7VA 5I4BA 2Z95A 1NA5A 1OYOA 1CB7A 3I28A 1CZKA 3SLGA 4DA7A 3BDAA 3LQQA 4WBSA 3SS9X 2RE8A 1OTHA 2NTVA 4GPBA 3GZNA 3LCJA 4C4ZA 4WK4B 2PJUA 1O8BA 3L7BA 4RK0A 4OMFG 1P7PA 3L93A 2ZWOA 4NIMA 4XIYA 4BDTA 2ZRKA 2CD7A 2V3WA 3O4JA 5F23A 2VUUA 3E23A 4DCCA 1MJGA 4EJFA 2F3SA 1KGDA 2O2DA 3UOGA 3GQVA 2CVQA 1N7IA 3PR3A 1JKFA 2HSGA 2I7DA 2OB1A 1DXHA 2I2WA 3F1LA 4CG3A 3AQIA 4ZN6A 1XA0A 4OG2A 4INPA 1HDCA 5KYTA 5CLHA 1IBSA 2I6XA 1SKQA 3FCUB 4XYMA 2ZP1A 4RD3A 3TX6A 2ZIVB 2MJLA 1MG5A 3PEUA 4H0FA 4CEIB 4OH1A 5C52B 1PTKA 4UUAA 4BNUA 4X00A 4FGWA 4UNNA 2QE7D 3UA4A 4UJ5A 2ZYWX 3ZQJA 5EMLA 4DIKA 4HXFB 1ZXLA 2VKQA 2ZRJA 3ZK9A 4LF6B 1VJDA 1SA0B 2NUPA 2NZJA 5JZVA 1Z75A 2QVBA 1RRCA 4O5OA 1VECA 3O8CA 1SXQA 1UBEA 3FPAA 1M1NB 4FXOA 1P5JA 4K9RA 1FSPA 2IODA 3UXEA