5CM8B

Structural basis for the selectivity of guanine nucleotide exchange factors for the small g-protein ral
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
172
structure length
169
Chain Sequence
GPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator-like 2
publication title The structure of the Guanine Nucleotide Exchange Factor Rlf in complex with the small G-protein Ral identifies conformational intermediates of the exchange reaction and the basis for the selectivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 35
structure length 169
sequence length 172
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cm8B00
1A2BA 1ONBA 1ODFA 4BZQA 4G5GA 2ZJ5A 1MV5A 1NN5A 1JECA 4C7OB 3TR0A 1Q1ZA 4HLQB 3VFDA 1XMIA 1YZUA 3O8CA 2Z43A 3IIKA 1WBBA 2CEAA 4CYMA 4EQ6B 1XCMA 4Q01A 3THYA 1G8PA 1TL7C 2L0XA 2QENA 2YOFA 4M53A 2R9VA 1N6IA 1VHTA 3Q72A 4JLVA 4Q7JB 1IBRA 1E2HA 2F9LA 2KI5A 1P62B 2ZVPX 2VL7A 5CJ2A 4OHZA 1U0JA 2AFHE 2WSSA 3TUZC 1M34E 1QBKC 1QHYA 1MO3A 1P7CA 1A1VA 4TYYA 3EG5A 1TAGA 4DSOA 2WPDD 3PXGA 4HZUA 1OKKD 3CONA 1EK0A 4FMBB 1GM5A 4B74A 3W6NA 3B1YA 2RGXA 4JMPA 4ZCLA 4TMZA 1IN7A 2FNAA 3O47A 5GJVC 1Z3IX 4G5SA 3EZ2A 2ZJAA 1AQYA 1OXSC 2GXQA 2DHRA 3K9HA 3MLEA 2CCKA 3BGWA 3T06B 2NZ8A 4I81A 4BASA 1JAHA 1DO0A 1E94E 1T8TA 1XZQA 3TAHA 4FCWA 1P60A 3RC3A 3K0SA 1BO6A 1T9HA 3W6OA 2ASEA 3NBFA 2WKPA 5KDOA 3ICQB 1M8PA 2YINC 4QGHA 5JFGA 2JJ1D 2IYLD 4LYFA 5K8LA 4S2EA 5FBLB 3QY0A 3W6PA 4KLNA 4PSAA 2QUZA 2VIIA 3AVVA 3BH0A 5EE1A 1V43A 1U99A 2IF2A 5B57C 3VX4A 2FN4A 3RSOA 2D7CA 3VNVA 1ZM9A 1II0A 4JL8A 3F5FA 4HAVA 3SJCA 121PA 3FTQA 3GJ4A 5A5GA 1JR3E 3F0TA 4JBYA 4B71A 3T12A 4BEJA 2ZVQX 3I92A 3GLHB 3KTAA 2J1LA 3KUCA 2GJ9A 2GVZC 2ZSBA 1ZAKA 1N6RA 1XD8A 2PL3A 3L0OA 5E4FA 3QJYA 2XTNA 2ANBA 5CK4A 2QE7A 3QQ5A 1KI1A 3H0KA 4UXIA 3QEOA 4W5HA 4IFEA 1P9WA 4UXHA 4CRWB 2ZRBA 2N42A 2BCJQ 2FEOA 2IK8A 3CO5A 3B7GA 5DI9A 3UG6A 4EJSC 2OO7A 1R5OA 1VG0B 2ZR7A 5LPNA 1KJWA 2VH5R 2C9CA 3FDIA 2IYTA 3ETLA 1G64A 3KJEA 2FU5C 3ADDA 1IJFA 1CR1A 4BFXA 1F5NA 1XFAA 4JLNA 1XMSA 3PR1A 3PUYA 5FOUA 4DDUA 3B9QA 2QAGC 1NSFA 3Q5EA 3IHWA 3UMFA 3W90A 1XCPA 1A5TA 4MYUA 3S1AB 4JT4A 1MRNA 2ZSAA 5KNDA 1W7AA 1P4SA 2KB0A 4A6XA 3OHMA 2YWGA 1KDRA 2ODEA 1TF2A 1XX6A 2BWJA 4DCTA 5CDFE 5DGXA 4MYHA 5JCZA 5EE0A 3BK7A 3DO6A 2IEZA 4FMCF 5HCNA 3OIWA 4NDZA 1Q0UA 3OEEA 2QPOA 2Q9CA 2ECKA 4LPKA 4JVNA 2ZSDA 1UKYA 5SZIA 1GIAA 2IX3A 1G8GA 5HE9A 4DKXA 1M6NA 3K09C 2I3BA 5HCIA 5CLQA 5FBQB 3QF7A 2V1XA 4TMTA 2IXFA 3CPHA 2O8EB 2RH5A 3RNLA 5DN6D 5BWMA 4ESHA 1FPMA 2R62A 4IOLA 1FX0A 2MMCA 3B6EA 4F4IA 1HV8A 4ZKDA 4NYJQ 1DEKA 5FR2A 1KZ7B 4TQUS 2W2XA 4BFZA 1E1RD 1S4QA 1WRBA 3SYNA 1AA9A 2QRNA 5GADl 1FMJA 2OSBA 4PZYA 4L9SA 4TT3D 2XX3A 3QXSA 4TTQA 4D4JA 4HUTA 1HH4A 4RCYA 1G20E 2W0SA 2VP2A 4LV5B 3R8CA 4EPWA 2GKSA 2XOKD 5F9FA 4KSBA 3ZD7A 3DOFA 4BLRA 1VYTA 4M9ZA 3U6KA 3TR5A 1AS2A 3RS2A 5FPYA 2FFAA 5GJBA 2ZI3A 3UWOA 1E98A 3GPLA 3KQNA 4C0LA 1CU1A 3TSWA 2AXPA 2ZSFA 1DG1G 1JJVA 3U44B 3P32A 3FE2A 1P5ZB 2YHSA 2HT1A 4OHYA 5HR5A 4PPNA 2ZUDA 3F8TA 3IEUA 2IXGA 3MWKA 3UKDA 4D0LB 2FSIA 2IUUA 1FMLA 1OXVA 1T5IA 1QHXA 3K0AA 2KSQA 4PQYA 2ZI9A 2YJTD 2ZAOA 1VPLA 1DO2A 1GFIA 3EIQA 4OK5A 1GKIA 1SKYE 2YOHA 1KO1A 1Z47A 4JJZA 1N6KA 1VKJA 1LTQA 1W47A 1G1MA 1PUIA 4NU0A 3GLGB 2GK6A 1E9FA 1E96A 4UJ5A 3KQHA 1Q3HA 2BV3A 3F3YA 2RGBA 4DUGA 1XPUA 4JLDA 4PHFA 2UZIR 1F3OA 5HPYB 4Q1AA 4DRZA 3KZ1E 4L8GA 1E2PA 5TVKA 3OIVA 2ZI7A 4H1UA 4Q4AA 1MO6A 3TSOA 1WBDA 2NGRA 5L3SB 4LBYA 1X1RA 3C5HA 5IK2D 1GZSA 4F4CA 2NO9A 2P6UA 2VF8A 3TSZA 4B33A 2C78A 2Z4SA 1E99A 3R7WA 4GMXA 5JSZA 4D25A 2PH1A 3PEVA 3BORA 3U3JA 5TDHA 3KDSE 1G18A 3BFKA 1P9NA 2EFCB 2QG6A 3QXJA 3GLFB 2NPFA 3TVDA 1GILA 5BW8A 1KI3A 3OESA 4X8OA 1RIFA 5J5CA 1P2SA 2PJZA 4R2HA 4OJKA 1ZCAA 2Z6VA 2VEDA 1JQLB 3GEHA 5IF9A 1OYYA 2REBA 4PHGA 3AKDA 3BIFA 3NEYA 5C4MA 2IYQA 3WNBA 3A6PC 3OFNA 2ORWA 4EJSA 2XSZA 4UKDA 1DAIA 3WYAA 4Q7MB 1CJVC 5EXTA 5SZKB 1PV4A 2UKDA 3SQXA 3PCRB 3LXRA 1KI2A 3QSYA 1NVWQ 2XZOA 2FEMA 4RD1A 1VTKA 3CZPA 3BFVA 3A1UA 5FOTA 4DSNA 2QAGA 1NVXQ 3GP8A 1SXJA 5E3HA 5DNYB 4TYPA 3FMIA 1FW6A 3NBXX 4RD4A 1QVAA 1IXZA 2GWHA 2RAPA 1TU3A 4JVMA 4MUAA 1TUEA 2QMUA 4NE2A 4R7ZA 3PUWA 2CCJA 3KL4A 2VHUA 4B3GA 1X1SA 2Q3FA 3QBVA 2XB2A 2V8OA 5KYKA 3K09A 5HTKA 2OAQ1 1T6NA 4LV8B 1B0UA 4DIDA 1NLYA 1ZD1A 4HLCA 1SKYB 1KSFX 4GOXA 3ASZA 2RGNA 3EPLA 1Y63A 3CZQA 1P72A 3LVRE 4BECA 1KK0A 4JBXA 4TLBA 4DIEA 2OXCA 1G41A 3X1YA 2AK3A 4NCKA 4BFWA 1OFIA 3KXKA 3HYRA 3LAWA 1N3BA 1OH5A 1YR8A 3EPHA 3TBKA 1QHHB 4OI0A 4D80A 1Z83A 2ONKA 2W58A 3U5ZB 2WJVA 3C16C 1DAEA 3UMRA 2BM0A 1ESNA 1G7RA 5J4VA 1F2UB 2CK3A 2ZJ2A 2WJYA 3G5UA 3MJRA 3RRMA 4DLZA 4DSUA 4X8LA 5IRCD 5JHGB 1W5TA 2UVQA 4DC9A 1G5RA 1G7TA 1ZIOA 1F48A 3VKGA 1G6OA 2CXXA 4GZMA 4QFMA 3MWLA 1R6BX 1KNXA 1W0KD 3UPUA 2R65A 3QE0A 2GZAA 4IKEA 3EPKA 4Q4LA 2F43B 1X6VA 2ZROA 4GDFA 3B1ZA 2WZQA 5LDDC 1E32A 4GFDA 5KPJA 1G9XA 3THXB 1RPZA 3LH5A 3EWAA 4Q19A 2H57A 4ZV4A 4L16A 1BYUA 4Q7KA 3FGNA 2HXYA 4LV6A 3NWJA 1XCGB 4Q9LA 5DO9A 1XPRA 2ZAMA 1BIFA 3E1SA 4PSKA 2BIFA 4IDHA 5AJYA 4W7SA 3R8FA 4IVQA 4B32A 2ODNA 4N3NA 1ZD8A 2FMXA 2AN9A 1G21E 3K0CC 1XXHB 1Z0AA 4NKRA 2FE4A 2VPPA 5FR1A 1J2JA 1XDBA 2C98A 2P0EA 4Q00A 2WWXA 1FNMA 5FPHA 1KTVA 1KI7A 3BBPA 3OE7D 1IN5A 1YZLA 1ZC4A 4LX0A 3CRRA 2JDIA 1Z06A 1COWD 3MFYA 5CM9C 2ZUCA 3WYFA 1W4AA 2VHCA 3BFXA 1YJ5A 2BDTA 4D82A 2AD1A 3EC1A 2J3EA 2X19A 1U8ZA 5FOXA 4R2IA 2FG5A 4ITRC 5EQTA 5B2ZA 1KI4A 1WP9A 4A0GA 3KXLA 2HDNB 3TUJC 1N6LA 2GXSA 3P1JA 1JBKA 4PAMA 1MOZA 4EPRA 2FPKA 1IHUA 5HKKA 1E0SA 2EWVA 3PUVA 1GOTA 2IYWA 3EZ6A 4HLUC 2BEJA 2WWWA 2J46A 3RS7A 2O8DB 1Q1QA 5TY0A 1U8AA 1ZMXA 2MSDB 3A4NA 1EX7A 1OJLA 3HPQA 5J47A 3I61A 3BXZA 3ZGXA 2PZEA 4BGDA 2BMJA 3U7HB 2QI9C 2J87A 4JVLA 1CJTC 3GLHA 2WKRA 2HUPA 4C4PA 3SC3A 1XEWX 1XP8A 2G9NA 5FL3A 1GNQA 5DI3B 3H1TA 5KNCA 3QNUA 4M0LA 4ZCIA 5C2JB 5KO2A 4P4SA 5EXPA 1FUKA 2IYYA 4P33A 4B47A 4M1OA 4WVFA 1X8KA 5J4LA 5JRJA 4C0SA 2QBYB 3ZQ6A 2LCFA 2HLDA 3CX8A 4PZZA 4QBFA 4B2LA 2N1BA 4MRSA 4CVNA 2ZIAA 4TLDA 5JCPA 1IM2A 2VSOA 4DVGA 2VF7A 1SQ5A 221PA 2CLCX 3Q3JB 3B78A 5KU1A 2ZE6A 4S35A 3GJ7A 1UKZA 1XD2B 4HB3A 3S1AA 2BCGY 2D2FA 4OQMA 2G0NA 2PZFA 4PANA 4CIDA 2NO1A 4W9MC 4Z1MA 2WWFA 3LDAA 2J0UA 3TMKA 3WRYC 5H70A 2DBYA 3NKVA 2ORVA 2PT5A 1OSNA 5FTMA 1IJEA 4XSGA 5JRZA 2C77A 3L82B 3QIAA 4K81B 1OXTA 4IXMA 3U7EB 3AKEA 4L9WA 5JJKA 4BQSA 2O8EA 3RRYA 2F1RA 3QENA 1ZNXA 1SHZA 1TF5A 3CWQA 2ORIA 1ZRHA 1G7SA 4EPYA 1DPFA 3VX3A 3AP3A 3ONWA 1HT2E 1MABA 4X8HA 1HUQA 4LCBA 2A5YB 2AFIE 2FA9A 5B30A 1FFHA 4A8JA 3SN6A 4B2PA 4BLQA 2FZLA 3IBYA 4I99A 4C0JA 3QXCA 2GDJA 4K8OA 3CIOA 4ARZB 2P5SA 1IAQA 4FCVA 4GBMA 4URVR 4MKGA 3PIRA 2ZRKA 2QM8A 2IYUA 1U9IC 1IN8A 1XEXA 2P65A 4GZLA 3M0EA 1CR2A 2P67A 1JR3A 3PV0A 4P4TA 1Z0FA 1OXXK 1KSGA 3LY5A 2J45A 1YU9A 1H8EA 2ZS7A 4QG7A 4RZ2A 3ZZ0A 3SFVA 2ATXA 5B58C 3DPUA 3K9NA 3IPXA 4Q4JB 1QG2A 4ZDJA 3RHFA 3KB2A 2PBRA 2ZE5A 5EP2A 4JLMA 4JYCA 2WWHA 4IDNA 5FUWA 3OAAD 5DLQC 1DARA 4NCJA 3U6BA 2XXAB 1RVDA 5IT5A 1DE0A 1KKLA 3EIEA 2FGKA 3H2YA 2CNWA 2FFQA 2H18A 4IDOA 4Q48A 2KE5A 5F98A 4PC6A 3WYGA 4TYNA 2JLYA 2QMOA 2E87A 4MQBA 3CM0A 1P73A 3MWJA 2C03A 2J0SA 2FGJA 3GJXC 4OBEA 4BFVA 3B60A 1LNZA 3LV8A 4G5OA 4A6PA 1F2TA 3AGQA 1KIMA 3P4YA 3Q7PA 2FJUA 4YMTA 5C18A 2XTMA 4Z8YA 1C1YA 1E1QA 1XRJA 3GEEA 2G1KA 4AKHA 3TH5A 3HYTA 3LBIA 1JJ7A 2UZ3A 1TQ6A 4NYIR 5ELXA 2QP9X 1M7HA 3EXAA 1ZU4A 4PSVA 2O0KA 5L3SA 2G83A 1HT1E 4ZI3A 4HLUA 4QL3A 5CDFA 2R8RA 3BRWD 1II9A 5FTLA 3B5JA 4R9UC 2IYRA 4DWJA 5E95A 4LJ4A 2JASA 4LHWA 4D0GA 4RFSB 3R9WA 2XNDD 1OF1A 4KODA 5LBIA 1UADA 2Q3MA 3KUDA 4C0AC 5K8IA 4RZUA 4B76A 1L4UA 4PAQA 2HV8A 4MITA 4DLTA 1QDEA 1ZM7A 3B13B 1M7BA 4PPGA 4AYXA 3SR0A 1W4CA 821PA 2NG1A 5KTYA 3ZLJA 1XB2A 1SVSA 4W5JA 3DKPA 3PUZA 4V0OA 1D6JA 4B3XA 1E79D 1TX4B 2JJ2A 5CM8B 3TGPA 4MDFA 1R5NA 2QM7A 4M1SA 4PO9A 4A2QA 1WF3A 2EW1A 4IRUB 5D3MB 4IEIA 4R71A 2WJJA 1WE2A 2OCYC 2ANCA 5DYIA 3RABA 3SEAA 2A9KA 2Z5FA 1T4GA 1NLZA 5CYOA 2JAQA 4A1FA 4F91B 1E9CA 2C8VA 4URWR 4JLJA 4XTRA 4EFLA 4P0TA 1K5DA 4DSTA 1T5LA 2A78A 5KSOA 4NPHA 2G77B 4QHSA 2HF9A 4TLEA 4N0EA 1EG7A 4M9QA 1D2MA 5SZJA 3GLIE 1KO8A 2REOA 3C4JA 4DLXA 4TTPA 4HEJA 2PLRA 2V6IA 1KGDA 4AG5A 3CNOA 2N46A 4BLSA 1XTJA 1O87A 1T3HA 3I5YA 1Z2AA 3LQRA 2ODWA 4LZZA 1LY1A 3DKVA 3KKOA 1R0ZA 4JLPA 4JKYA 3OEHA 2OBLA 2JIZA 4XWOA 1W49A 1JR6A 3TE6A 2A2ZA 2BJWA 3NBYC 1KOFA 4WA7A 1P6XA 5C4GB 4TYQA 1ZW6A 2AR7A 1NN1A 1E0AA 1T91A 4XOIA 1G5TA 4XWAA 5TARA 1F2UA 3FWYA 4Y0AA 1XBTA 2V6JA 1N5LA 1SHKA 4Q21A 1CS4C 2YWEA 1TMKA 2XB4A 4JYBA 2IYVA 3TQFA 4GMDA 5IHPA 1UBEA 2NQ2C 2ODBA 2H92A 3DMDA 4QJ5A 3REGA 1RRFA 1E9AA 2O8BA 2ZRPA 1XD9A 1S8FA 1GRQA 3GD7A 2P3SA 2F43A 1W4RA 2H7VA 4TSFD 4C3ZA 2GJ8A 3FPAA 5BYKA 1D8TA 4H1VA 2AXNA 4Q4HB 2VA8A 3P4XA 4LBVA 3WBJA 1RJ9B 5AR1A 4AURA 3BAFA 3EWSA 1SGWA 2Z4RA 2A5FA 3K0FB 3NG1A 3QPVA 3G0HA 4P32A 2QGZA 4ACBA 1R5BA 2GTPA 2ZJOA 1TQ2A 2ZYUX 3K70D 2NO0A 1IXSB 2QNRA 1K6MA 2W6IA 3THWA 1RYHA 1I2DA 4EDHA 4QGGA 4U7DA 3PEUA 1M7GA 2OBMA 1XXHA 4TMKA 2WJHA 1GG2A 4FMCB 1PLJA 3B1WA 2IUSA 5JS7A 3MG9A 4JJKA 5F9HA 1ZC3A 5DIFA 3QF4B 1J70A 2WAXA 2VYFA 3U7FB 1XF9A 4JZKA 4ESVA 1HQCA 2Q0HA 4JSYA 3FHTA 3PENA 4B48A 3CNNA 5AUNB 1VECA 3CNLA 4H9GA 2R6CA 3AGPA 3R9XA 4XWKA 5FBWB 3LA6A 5CITA 2GF0A 4V0LA 3VR6A 1XJQA 4NTZA 5E7MA 3GLIB 2ZJ8A 1LF5A 1JEDA 1KI6B 2B7CA 2QN6A 3A8TA 1S1CA 2ZJYA 4BPBA 4MH0R 2R6DA 3RS0A 1E9BA 4YMUA 3TNFA 3HP1A 1YHNA 4AC9A 1MO4A 3SBEA 4C0HA 1WCV1 3A58B 2IWHA 2GBLA 1W0JA 4WW0A 1JXOA 4LOAA 4NCNA 3GLGE 1AQUA 2I1QA 2FFHA 5BQ5A 2WSSD 3W5IA 5L3RA 4F93B 2AK2A 3K1JA 1J8YF 4HAUA 5KHOC 1T3LA 2GEVA 3DOEA 3C8UA 3EA5A 2XZLA 3NH9A 1N2CE 4TL6A 4L15A 1XMJA 2CHQA 2XJ9A 3LXXA 4B3CA 4Q02A 4BFUA 1NVUQ 1RE0A 1OPXA 4NMMA 2JLZA 1GP2A 4UJ3A 2VP5A 5TB5A 2BBSA 2PCJA 2WTUA 1Q1EA 3FMOB 2D74A 2LWIA 3BH6A 4FIDA 1C4OA 3ADKA 4XTCS 4KHZA 5DE3A 3X1WA 3VNUA 2DY1A 2HEIA 2EWWA 2O8CB 3X1ZA 1T0HB 3FKSA 3M4YA 1HY3A 1E3MA 3BB4A 1YVDA 2ZEJA 5ANRB 3GLFE 1PLKA 2J7PA 1FP7A 3Q9LA 1VCIA 4C0QC 3H4MA 5JWHA 5FUYA 4EFNA 4LHZA 1NG9A 2YWHA 1D9XA 4NP6A 1ZD9A 4PC3A 1W36D 2OUKA 4XJXA 2Z0MA 2ZU0C 5FPKA 5KSYA 2P2LA 3JZAA 4XVUA 3D6TB 1UAAA 1IY1A 2DFTA 4GL2A 4QOSA 3VAAA 4Q1EA 1XD2A 1G3IA 5UKDA 3X1XA 4TQ9A 4PC2A 4DDTA 5BN3A 1YR7A 5G40A 4Q66C 1EWRA 2IS6A 3ZVMA 4MYTA 4HB2A 2O0JA 1KDPA 3GJ3A 3JVVA 3WRXC 4HYYA 1JEEA 5M04A 1VDZA 2BC9A 1EFTA 1KYIA 2H16A 2QRZA 2OG2A 2QU8A 4Q1FA 2XGJA 2A5GA 1KMHB 1LW7A 1YZGA 2B21A 2QE7D 3V00A 2WSMA 1R0XA 2EFGA 3GJ6A 1RYFA 4IXNA 2R44A 2QGNA 3W9YA 1OH6A 5AJXA 1UDWA 5FOVA 1MRSA 2VP0A 3AKCA 4RSGA 3GJ0A 1YKSA 4BZPA 2GZHA 3B2EA 1FUUA 1OHHA 2XNSA 3T5DA 1E69A 4DZZA 2VSFA 3ADBA 5FBRB 2ZRCA 4Y0VA 5JHHB 4MKFA 4EPVA 1RFLA 3B1XA 4PPFA 3WNCA 4ARZA 1CRPA 4D6PA 1SVWA 5H68A 4PHHA 4Z51A 5BN4A 3K8YA 4CEIA 1QZXA 1OB2A 2PCLA 2GVDC 4LYJA 2F55A 2XAUA 5JZVA 4DCVA 1AGPA 2H8KA 1KNQA 2V4ZA 3LRPA 4C2TA 1Q20A 3I72A 2IS2A 2NZJA 1QHIA 4NYIQ 1G5PA 4EAQA 2QL6A 2VLIA 2GHIA 3OEED 4BE7B 3G82C 3IGFA 3WMGA 1S9DA 2V55B 3H84A 4Q1DA 3TQCA 1KAOA 3CX7A 4QBHA 5GJCA 3AF0A 3ND9A 5FUVA 1IOZA 1OFTA 2ZYTX 1GUAA 4TYWA 1OIWA 3GFTA 4ZPXA 3O8RA 3HWSA 3BERA 3EC2A 4PFSA 2EFEB 1XWIA 2IXEA 1CBUA 3FVQA 5FH9A 1E9SA 2J7PD 521PA 1XMVA 3O8DA 2ZRGA 1QHSA 1R2QA 3LQQA 4L4UA 3KX2A 4WAUA 3DDCA 1EFHA 2GCPA 1S3GA 3KKQA 4B6EA 2ZS8A 3DHWC 5AWFC 5LB4A 1DAFA 3MAAC 5CYPA 2JLVA 4ACAA 2QMEA 4AIIA 4AKEA 2NTYC 1OE0A 3I32A 4FW9A 3C15C 4HAYA 5K8TA 3IDQA 4HZIA 1F6BA 1T8UA 2PX3A 4B44A 1XTKA 5G3YA 3RDPA 1CJUC 2I1VB 2OEPA 1E2FA 4OJQA 4TLAA 4BLPA 5AJWA 1SULA 2QMHA 3WXMA 2IC5A 3SFZA 1BMFA 4OI1A 1XXHE 2OFXA 4B35A 1ZM2A 2Q21A 3BC1A 2F3RA 3IUYA 4E03A 3PVSA 2CBZA 4LHYA 4RY2A 5CIWA 5CB6A 3LLUA 3U2QA 1L8QA 3I5XA 1N6OA 5LD2B 4ZDKA 2JLQA 2C9YA 4U00A 1W46A 5EP3A 4UQOA 1TQDA 1NNEA 4QNRA 3T35A 2J0VA 2J41A 1H8HA 4PO1A 1U0HC 2AL7A 5HZHA 1R7RA 2CJWA 4C30A 5JMTA 1NIPA 1P2TA 1T0JB 3B8HA 3WNDA 1IONA 2GILA 4KFRA 3I8XA 1OIXA 3FHCB 3R9IA 4Z8XA 1RRCA 1Y3AA 1AS0A 1DAMA 1NN0A 2XJ4A 2IT1A 2F3TA 2Q9BA 3EZFA 1U98A 3PEYA 3MRSA 3DZ8A 2GCOB 1WXQA 1E9EA 2BKUA 2DFNA 1OH8A 2O5VA 4FWTA 2DWQA 2F1HA 1ZINA 4M1YA 4NHOA 4DUGD 2V7QA 4ZO4A 1DBSA 4RJLA 5D3MA 2OILA 1GRNA 1TQ4A 2IHBA 2ZRFA 1ZJ6A 2HYIC 2LKCA 2W6JA 4QBGB 3AP1A 4LHXA 3FHOA 3I8SA 2H1LA 3JZMA 5L3QA 2OLKA 5FTJA 1VIYA 3PG5A 1MR3F 3CPEA 3L8ZA 1E4VA 3SHWA 4Q47A 1UKVY 4YQFA 3K0EA 2MMGA 3LD9A 4O25A 2WJIA 1VYVA 2HT6A 1JI0A 1G19A 3THYB 5P21A 3VHLB 1G291 3RC8A 1EFRA 3FMFA 5KDDA 4LYHA 1AKEA 2B6HA 4WZBE 3SJBA 4PQFA 4KFTA 4OHVA 1KI9A 3HDTA 4C7OA 2ZRNA 5J40A 1SVOA 3GQBA 5FI1B 5JEDA 2P6RA 3I62A 3NH6A 1II8B 2V54A 1XU4A 3FMPB 5G41A 4EQ6A 3ZJYA 4CGZA 2WVJA 3QKTA 1N5IA 3D8BA 1CTQA 1BKDR 5EZ6B 2O8FB 3LW8A 2CLDX 3AF3A 1DVRA 1FNNA 3NIBA 4Q03A 5FTKA 3OFND 2NO7A 1L2TA 2XSZD 3L0IB 3T61A 4XD7A 3ZS8A 1ELOA 3QEJA 4QHYA 5BYJA 5FBVB 3PJRA 4GOKA 3FKQA 4LJ5A 5TMPA 1CJMA 1BS1A 1TU4A 4DEYA 3MD0A 2NPIA 2YC4C 1IY0A 5AUPB 5A0FA 2R6AA 1SXJD 1KJZA 3U60B 4TZ6A 1H8HD 4B3DA 3EX7C 2D2EA 3QI2A 2VHQA 1NMZA 4HDQB 4MDEA 2RGAA 4JT2A 3TUIC 4QM6A 1SVKA 3C5CA 1OFUX 5FL7A 4ASUA 4EUNA 1NN3A 4JSTA 1IY2A 1G3RA 2Q3HA 1NIJA 4FD2A 4LBWA 1SKQA 2QP3A 3AVPA 4OKSA 2ZRHA 4Q4HA 4CZ2A 4US2R 1RJ9A 3BH7A 4DLWA 1G8FA 2PT7A 3MGCA 4QBIA 1CKEA 3LFUA 1ZP6A 1N6HA 3DM9B 4A4DA 2W83A 2D06A 1KSHA 4E07A 1NKSA 4QJ4A 5K8UA 1EWQA 1W1WA 4G5QA 3RS4A 4HDOB 2CVFA 3KTAB 4BZXA 1IN4A 4ZI2A 5EP1A 2BBTA 1NI3A 5DSZA 2WHXA 4DLRA 721PA 4KBFA 4KCGA 1TADA 4RVCA 5L8VA 1VCMA 2ZRMA 1R8QA 2WWYA 2CK3D 3CH4B 1AK2A 3DMNA 1QG4A 4ZIRB 3W3AA 4LJ6A 3CH5A 4MRNA 2A5JA 3AKYA 4PQRA 1BH2A 2ZTSA 1XEFA 2ZETA 4NYMR 4V0ME 3CF0A 1ZCBA 1HEIA 4A82A 2WBLC 3KFXA 3NC0C 2WWIA 4IOMA 3ZD6A 3SBDA 3GLIA 2HCBA 1W48A 2ERXA 2WIAA 1ETUA 3KKMA 4TZ0A 3I73A 1A2KC 4WBSA 4YMWA 1WDTA 4B3BA 3ZZTA 3WBKA 1Z6TA 2EYQA 3LW7A 1GL6A 1J90A 4YC7A 4BFYA 1US8B 3FFAA 1RW4A 2RGDA 3EIHA 1GITA 2G3YA 4QC2A 2CVHA 5JLJA 3ADCA 4JLKA 1WB9A 1WMSA 3B85A 3L0PA 2QTFA 1KO5A 5AJZA 1MH1A 4DCNA 1GAJA 2OT3B 2BEKA 5LD2C 4HUQB 3ECCA 2G0TA 4HAXA 3ZH9B 3T1TA 8OHMA 5C46F 1N6NA 4OQNA 4RCZA 4MUBA 5AUQA 1LS1A 3N5CA 2D62A 4X8MA 1R10A 1TUIA 1G8YA 1FX0B 4JS0A 4KV9A 5FL7D 2JDID 5L3VA 2V1UA 3NDBB 2OZEA 3GFOA 1ZM3A 1I4LD 2VO1A 4AYTA 2C99A 2LKDA 1OLOA 1QRAA 4M4SA 4TMXA 3AUXA 5CLLA 2RGGA 2O8CA 2CHVA 1Z07A 4MKIA 1E2KA 4KYIB 4FINA 4TTRA 2X77A 1CF4A 4YXWA 4FMDF 2B92A 1CLUA 2JEOA 4DDVA 4HAWA 1OW3B 5J4KA 1U8YA 1EFUA 3UWKA 2CE2X 5HKKD 3IPYA 4TL7A 4CEHB 3SHFA 4O2LA 2IF0A 4M1TA 4XVQA 2NMVA 2DFLA 1DELA 5EP4A 1ZVQA 1KHTA 2BOVA 4NCHA 4BEBA 5E7IA 1RZ3A 1CIPA 2QY9A 1NMXA 3NDPA 2WIBA 4EPTA 3QPWA 5H8WA 5FI0B 3AV0B 4GPTA 2GJAA 2F1JA 2O0HA 1S3SA 5EXXA 3K0CA 3U44A 1QVRA 4MA4A 2ZJBA 1JPJA 4TWZA 1R8SA 4C9BA 1E2GA 5JI3E 3P27A 4XSHA 1NMYA 2VQSA 3M6AA 2HLDD 4URYR 4W5WA 2JLXA 1PZNA 4YMVA 1OH7A 4CT4B 4Q4AB 4B75A 4I1OA 3SJZA 3AVXA 3QVUA 2ZRLA 3I3SR 4A0HA 2AWNA 2GCNA 4C0BA 3GLGA 3RAPR 1U2RA 3K53A 4GP7A 2W2VA 5KDLA 2KJQA 4Z1MD 1U94A 4CW7A 4II7A 3WP1B 3OIUA 4D4KA 2GXAA 4IEEA 1Z5ZA 3BWDD 4IOKA 5EUQB 3D31A 4A2PA 2KBFA 4IVRA 3SJAA 1AGRA 4TLCA 3UMSA 4UNPA 4CEJB 2GA8A 4E09A 3P20A 4B73A 1NKTA 3NXSA 5FOSA 1AZTA 1XEWY 2D7DA 4Q9HA 2NIPA 2D3WA 2DB3A 2VHJA 3AEZA 2IHYA 1ZNZA 3KJIA 4KO8A 3GLFA 4DHEA 3IBGA 1OYWA 4FCTA 2FSGA 3SNHA 3LLMA 4B2IA 3ZVRA 1ZU5A 4MKHA 2DCUA 1N5KA 1J7KA 2B7BA 2RHMA 3D3QA 2QPAA 3AP2A 4Q7LA 4YDHB 2GJSA 2WPDA 4GSYA 1TPZA 2ZM5A 1OKKA 3B1VA 3GJ8A 2OLJA 1SXJB 2BJVA 1A82A 3K9LA 5G53C 2EFDB 4D81A 2BMFA 3IIJA 4RD2A 4RZXA 1JR3D 1Z0IA 5DISB 2GJKA 1AKYA 1SVLA 3QOFA 4R98A 1H8ED 3C14C 3GFPA 3KQKA 1XTQA 1IXRC 1S96A 2BKEA 2FSHA 4LJ9A 2J59A 4US1R 3W8RA 1VIAA 1G4UR 4M1WA 2AWOA 3ZYCA 621PA 4LHVA 2HYDA 2C2HA 2RMKA 1ZYUA 2ZITA 1CXZA 2OCAA 4F38A 3VR4A 1YR6A 3VQTA 2JJ1A 3RSLA 1Z0JA 2X2EA 2GNOA 4DCSA 2CNWD 3QVVA 5EZ5A 3BB1A 4D2IA 1W44A 1VHLA 4KBGA 3CRMA 4RZ3A 2VRWA 4CDGA 3AVYA 2C04A 4RD0A 1G3UA 1Z08A 4CF7A 5JJIA 4BRWA 2BHRA 3IKJA 1H65A 3GEIA 1E0JA 3L0SA 4JLAA 4C2UA 1E2LA 2ZRDA 4POAA 1S1MA 3KFVA 4GT1A 4FWIB 1E2QA 1E1QD 1KDOA 1K5GA 3A1TA 3ASYA 1G7CA 2OAP1 4AWXA 4MGIR 1FTSA 2BVNA 1Z2CA 2YC2C 1QHHA 3EA0A 2AX4A 4LGMA 1AJEA 3WMEA 1OT3A 3IHLA 4A36A 5CIQA 4LPSA 2TMKA 4Z54A 1FQKA 4HB0A 4YONB 4A9AA 4G01B 1NF3A 3MCAA 2PEZA 2FF7A 3PFIA 1U9IA 4M22A 4LDJA 5JWRA 1OIVA 2GXUA 2C95A 3UANA 3FB4A 5GJWC 1VCOA 1Z6XA 2VP4A 1NJGA 4NCIA 4OI2A 2FDCA 4DEXA 2JJ8A 1KDTA 2XZPA 3AH8A 1QHGA 5BN5A 3C41J 4QGFA 3OF5A 2OFOA 5G3ZA 2FOLA 2RB4A 4KLZA 4KVGA 1II8A 2QA5A 1EGAA 3EW9A 4IFBA 2YNMA 1KK2A 4LRWA 3WMFA 4AG6A 3THXA 4YDSA 2WOJA 1M2OB 2O8FA 2C5LA 2ZR9A 2VSXA 4NBSA 1P75A 3RLFA 4GRAA 3RS3A 3AVUA 3KKPA 3CF2A 2JJ2D 3V4FA 3HU3A 4WZ6A 3T1VA 4PO8A 1CP2A 1E0KA 4OHXA 4KSCA 4AYWA 1NBME 4JKIA 3GMTA 4YLGA 4DDWA 4Q9JA 1IN6A 1ANKA 2OE2A 3P26A 2OFWA 1AIPA 2DPXA 1MO5A 1IQPA 1PLLA 4NONA 1Z0KA 5DN6A 4KJZA 1DAKA 3TAUA 2WKQA 5FFMA 1HE1C 1JPNA 1O3YA 4GNKA 2ZRIA 3SDZA 1NLFA 1B23P 3IO3A 1ZUIA 4I1UA 3I1FA 4NYMQ 3MWYW 3EZ7A 2KBEA 4URXR 5JBQA 2VHTA 1E1RA 2HXSA 3O8BA 3E70C 2ZSEA 4TT3A 1YE8A 1KK1A 4OHWA 4A15A 4M1KA 3W34A 1XTIA 2XOKA 3HR8A 4ZDWA 2CLSA 4PTLA 2Z83A 2JA1A 2JLUA 2CL6X 1KMQA 3ZQJA 4D4LA 4KU4A 3W5JA 2PLFA 3OEHD 2JIZD 5HZKA 1VG9B 1UBFA 3CUEF 4AK9A 2NOAA 3TW8B 3U3RA 1FTNA 3NBZC 2O8DA 2QEQA 3UG7A 3X2SA 4EKDA 3Q8XB 3NC1C 1X8LA 3T15A 4ZIRA 3CRVA 3MJHA 3QG5A 1YZTA 1NVVR 2AD5A 4KFUA 4P4SB 1CR0A 1JQJC 3X1DA 2J7KA 4DT1B 2R2AA 1JB1A 1G3MA 2KWIA 3D7MA 4IOJA 4M9XA 2EQBA 4ERNA 1WA5A 4Q1CA 5DI3A 2GETA 2ONJA 4B6FA 1N0UA 1TF7A 3VR2A 1G17A 2ERYA 3QKSB 4M2LA 3GCGA 2FV8A 3V4RA 2QBYA 3AVTA 3LX5A 1SXJC 2BM1A 4RD6A 2QPTA 1US8A 1P3JA 3CRQA 3W8NA 4Q9KA 4V03A 3TJZA 1KAGA 4RKEA 4LSGA 2J0UB 1VCNA 2YV5A 5KNBA 4D26A 1Z0DA 2W6ID 1CRQA 2QT0A 1C9KA 3VU9B 1U81A 5IK2A 1J8MF 4DLVA 1XJ0A 1ZUNB 4EPXA 3CRW1 4JLOA 4HUQA 4LJYA 3CB4A 1UKEA 4OL0A 1QF9A 2O52A 3EARA 1S2MA 2VTKA 2YYZA 4IJMA 2F9MA 4TN1A 1Z6YA 5FPSA 2WJGA 2FFBA 3CR8A 2Q9AA 4JL6A 2RGNC 2HF8A 2ZYWX 4ZKEA 2WV9A 2JLRA 3LBHA 3KKNA 3Q7QA 3QPUA 3RWMB 1MABB 1W5SA 2DFKB 1R0YA 3BB3A 1N25A 3UIEA 3CF6R 5FTNA 3CR7A 1Q1BA 3N2EA 4YMSA 1I4TD 4A8JB 3LO5A 1AS3A 1YRBA 3QBTA 5DH9A 3IILA 1NSTA 3TW4A 1NRJB 4KXFB 1Z28A 4HB4A 5D3QA 4URZR 2IS1A 1D2EA 3QKRB 4HDCA 3HR7A 5EUMA 3A1WA 1G8HA 1XEXB 2J9RA 3ICEA 4PC7A 4A2WA 1W0JD 1YRAA 1S0UA 2OCPA 4CEHA 4LBZA 3T1OA 1JALA 1ZM4A 1TEXA 4XIGS 4E22A 2W00A 1DTSA 1A4RA 5JEEA 2FX3A 1E9DA 2OM2A 3I4LA 3LNCA 3PQCA 2MSCB 1MKYA 3RVBA 4IDQA 1M74A 3LWNA 2PMKA 4LJ8A 3EPJA 1F60A 4QKQA 1R4AA 4U02A 4KFSA 3J81k 1YZNA 4A0RA 4Q4JA 5F2EA 1DS6A 4V0NA 4QHTA 4V0MA 1UFQA 5JS8A 5IDVA 1V5WA 3FKSD 2XXAA 4KYUA 3EASA 2QORA 3A37A 1CR4A 3ND8A 1HTWA 3QXXA 5LB2A 1F2TB 4HSEA 3TKLA 1OV4A 4KVAA 4DB2A 4PC1A 1GVNB 2E9SA 3DM5A 3E5HA 3RANA 1KI8A 4JL5A 4PAOA 2WAYA 4Q5IA 3KXIA 2VP9A 4M8NE 1YZKA 4LI0A 2G1JA 4JVSB 4BRUA 3WHLA 3SYKA 1Z8FA 2PJRA 2CCGA 4C0KA 1RRPA 3LX8A 3SYLA 5AK0A 5TXGA 2FWRA 4OI4A 1Z6AA 1HYQA 4A0FA 3W3ZB 3VMFA 5KOYA 1Q22A 1W0KA 2B8TA 1BOFA 3SE0A 4TL8A 3LBNA 1Z6GA 1ZNYA 3U3MA 4TMWA 3U4QB 1OB5A 4EFMA 4KITB 1CJKC 5GVSA 4CEJA 4F7WA 3N2IA 2GK7A 1G4AE 3EAQA 3KQUA 5F3WB 1NL3A 4RFSA 3RRNA 3KJHA 4AY2A 2J0QA 4BFTA 1GTVA 2A3RA 2PEYA 4Q1BA 4MGZR 4QRHA 2IA5A 4RD3A 1PUJA 1LF0A 1J99A 1OHHD 3K70B 1UBCA 3WY9A 2NO6A 1D5CA 2F6RA 4MRRA 2YZ2A 4PXAA 2DYKA 1OFHA 1P2UA 1KY2A 2ATVA 4NH0A 3OZXA 3BS4A 1AN0A 4I1SA 4E5UA 3IIMA 2GAAA 1QHNA 1S9HA 5B64A 4URUR 2OBNA 4OQLA 2G6BA 1HA3A 2WICA 1WQ1R 4BFSA 2CL7X 3OE7A 3HU1A 5KPDA 4BUJA 1COWA 3AF1A 4O0MA 1MT0A 1KSJA 1D9ZA 2ZS9A 1W2HA 2A30A 4M9SA 2HJVA 1M1YE 2RCNA 2G88A 4DCUA 3A4LA 4D4MA 2F1IA 3SU8A 1CULC 3T34A 3CWZA 4MGKR 1SZPA 3H86A 2WM9B 3VR3A 4DLUA 1T3SA 3BD9A 5KSPA 2ZE7A 2RKOA 3AQ4A 3QG1A 3SOPA 3VR1A 3ZZUA 1Z63A 2ZPTX 5FPTA 2JLWA 4TQAA 4KI0A 4P3YA 4HATA 2QSZA 4OK6A 1Q21A 1EXMA 3ZVNA 1TNDA 3VR5A 4AI6A 3OIYA 4HZUB 1GDDA 1NJFA 2QAJA 4WXRA 2K5UA 1X3SA 4RKFA 4AKGA 5HE8A 2QZ4A 1XZPA 5E7JA 5AUOB 2QSYA 3IO5A 1GNRA 3A1VA 2AKYA 4K46A 1XNJA 3K9GA 2O8BB 3Q85A 1BMFD 3SS8A 1N0WA 3REFA 4A8JC 5EE5B 2PZGA 1GKUB 2QP4A 2X2FA 1LV7A 1HE8B 2GAOA 5EJEA 1XTRA 5EE9A 3JVUA 3RYTC 3PUXA 1DG3A 4P4UA 2IS4A 5EE3A 1NG1A 1P9RA 4LJ7A 5GVRA 3V9PA 421PA 4A92A 2ZUBA 4N1AA 4B43A 1K8RA 1W36B 1EESA 3AF2A 1UEIA 1R0WA 3THWB 3T1QA 1KK3A 4UNSA 4KAXA 3ZIAA 3CW2A 1EFCA 2FPLA 2JGNA 4ILEA 3K0FA 2CE7A 1GKYA 1KO4A 1E2NA 1LB1B 2X1VA 3BOSA 1E2IA 3Q5DA 1P61B 1A7JA 4F92B 2P6NA 3T5GA 2CDNA 4GP6A 2V7QD 3NEJA 6Q21A 1GSIA 1VMAA 1P2VA 2RGCA 1DAHA 2W6JD 4PPQA 3TRFA 5JECA 1E4YA 3MSXA 3CLVA 4LWZA 4LC0A 1PVOA 5FUXA 3PITA 5FOWA 1E2EA 4DB4A 1ZNWA 2V3CC 4WOPA 1YR9A 1Z22A 4L5BA 1NP6A 3AUYA 2IBMA 3R20A 1RKBA 4MGYR 3QF4A 4OQFA 4I1VA 4PZLA 1EFRD 4JLBA 2ZQ5A 2OCBA 1NVVQ 1SVMA 1Q12A 4FXPA 2ZU6A 4ZDIA 2WWGA 4QM7A 3TIFA 2QTHA 4FMDB 1X8JA 3UXMA 2ZI6A 3B9PA 4UNRA 1FP6A 2CHGA 4DXAA 2YWFA 1KI6A 3QUSA 4G1UC 3A4MA 2OXRA 3VKWA 2V9PA 1NY5A 2C96A 1HURA 1KKMA 4O3MA 1SVIA 3DEFA 5DHFA 2IYSA 4IDPA 1N6PA 1W2GA 1I2MA 4XVRA 1FOEB 4TL9A 2FH5B 1UBGA 1W4BA 2GRJA 3VKHA 4XD7D 4FN5A 2DWPA 1E2JA 2BMEA 2BMDA 2IYXA 4FI3C 2QQEA 3RRZA 1XTSA 3A36A 2ZANA 5CB8A 4LUCA 4WIAA 1FZQA 1XJCA 1E6CA 4RFVA 2R6FA 4ABYA 1BYIA 4QJ3A 3DL0A 4I4LA 4B3FX 2RHDA 3OAAA 3NTUA 4Q18A 3TLXA 4XH9B 3FFBA 3FOZA 1JXMA 1UF9A 1YZQA 3MMPA 4OYHA 4DT1A 4US0R 3EZ9A 1UEJA 2DWOA 3K70C 3VTKA 1DAGA 3SQWA 1CEEA 3RWOA 4ASUD 2GESA 4Q9IA 1JAIA 1UPTA 3UK6A 3CX6A 4O2RA 5A4JA 3ZIAD 5AJVB 4EIWA 3QKSA 1KY3A 2ZJZA 2VBCA 4DLYA 3SI7A 3SZRA 4UNQA 2YKGA 1N0VC 2E1RA 3AM1A 5KSZA 3L2OB 3C7KA 2OV2A 2BBWA 1GWNA 1LS6A 2WMOB 3L43A 3E2IA 2H17A 3IQXA 4J0QA 3LVQE 4PR0A 3PEWA 5J4YA 3VU9A 1DOAA 1VG8A 2W2TA 1EX6A 4IVPA 2IYZA 1NBMA 1SXJE 4M21A 2OESA 2XEXA 2PMDA 1XPOA 4NL4H 2WOOA 3CBQA 3WP0A 2XNDA 2FPMA 3AVWA 1I4DD 1KJYA 2IWRA 2ZYVX 3L8YA 4BWYA 1D2NA 4NYJR 4WZAE 5JI2E 4G0NA 4P31A 2QT1A 2XITA 3K0AB 2Q6TA 2REXB 5TV2A 3AF4A 2HCJB 1TTTA 3TVTA 2DR3A 4QNMA 1KMHA 2PX0A 4LC1A 4MRPA 2JCSA 2JATA 4GOJA 2Y8EA 2MSEB 2ZR0A 2WMNB 3DZDA 3QKRA 1E79A 4OQXA 1KO7A 1OXUA 4UNNA 3NHBA 4CEIB 3QKUA 2JLSA 2ZREA 3BE4A 2ZI5A 4ZCMA 2GF9A 5BXQC 1E2MA 1E9RA 4AKIA 3BJIC 3CKLA 3HU2A 4JIMA 3VHXA 2ZXUA 4F4JA 4M1MA 2J5XA 1L7VC 2EYUA 3B82A 3NHAA 1Q3TA 2IW3A 2C9OA 3MUFA 3QXHA 5EXSA 4B34A 1DADA 4DBLC 5KUTA 2P5TB 2YVUA 2H5EA 2ZE8A 4LYAA 3R7WB 1G3QA 3ZDQA 3KJGA 5JSZB 2EVWX 1KZGB 3FYHA 2ZRAA 1ZIPA 1E2DA 2FSFA 3ZVLA 4LK2A 4AD8A 2XTZA 5DHAA 1W36C 5C1BA 2I4IA 4TMVA 4U5XA 4IHQA 1UDXA 1G6HA 1GL9B 2IUTA 3U3OA 4HLDA 4V02A 1YQTA 2X8AA 1G16A 1VYUA 1ZBDA 2AHOA 1UJ2A 2IEYA 2QROA 3THOA 4NZYA 1Z29A 4YXWD 2BBOA 3IEVA 1N5JA 1L4YA 4CT5A 3HJNA 4OK3A 3GJ5A 4EJSB 4IW3B 2A5DA 2HJGA 3KB1A 5JWOA 1AZSC 2GEDA 1NY6A 3RS5A 5JJLA 2ZRJA 1LFDB 2IL1A 3HPRA 5H1YA 4QXAA 1FQJA 1NBMD 2QQ0A 3N70A 1ESMA 2QAGB 1GRRA 3ZS9A 4DLSA 1HQYE 1JNYA 4N0DA 2CMKA 2GZDA 1GNPA 2D4HA 2CJWB 1X86B 1RC8A 1Q44A 2VP6A 1TEVA 3U3KA 2GBLC 5CJPA 2AKAB 3U7GA 2EU8A 3U4QA 2SHKA 4TSFA 2R6GA 2OHFA 2YOGA 4UXJA 3NVAA 3A1SA 4MYCA 1LVGA 1UM8A 4BLOA 3KQLA 1Q57A 3AB3A 1AM4D 4JBWA 4D0NA 4HAZA 1RRGA 2FZ4A 2ZI4A 3CPJB 3TK1A 4ON9A 1U90A 2GEUA 4PX9A 5SZHB 3M1IA 4MRVA 2CL0X 1GL7A 1ZUHA 4PHTA 4QGAA 3AVQA 3DVLA 3IQWA 4BLTA 2B8WA 1FL9A 5CK5A 3AVOA 5DYGA 4HI0E 4G5RA 5L3QB 3WHKA 2GCOA 4V0KA 4G3XA 4GI7A 2QTVB 4LJAA 5J4HA 2RGEA 3U61B 1U0LA 1VG1A 4DJTA 2A7QA 3GLHE 2F7SA 4WXPA 2W0MA 4LY6A 2EFHB 3UATA 1PJRA
chains in the Genus database with same CATH superfamily
1A2BA 3HL0A 4J1NA 1ODFA 1ZGAA 5ESRA 5K3CA 2BFAA 2CHFA 1MB3A 3D8NA 3GP3A 4RWEA 2JCVA 1Q1ZA 1ZD4A 3IUJA 3PHCA 4HLQB 1IQRA 4L8WB 5KOJA 2CN1A 2P4SA 3UW1A 3RR2A 1E3QA 3K96A 3R5TA 2DY0A 2W90A 4WD3A 1WBBA 2VNSA 2X9GA 4XE5A 4EQ6B 5CVEA 3TL6A 4AN1A 2ZPAA 1JPVA 2PN1A 1U2GA 2JVKA 2L0XA 4R2LA 1QX3A 1XF1A 4ZT2A 1JG1A 2OB1A 2R9VA 3AFNA 2H2IA 4JLVA 2XQJA 1IBRA 1E2HA 5GQSA 2KI5A 2ID4A 2VL7A 2SKCA 4N03A 5E9JA 3JQ9A 3AMVA 4QLBA 2QTBA 2WSSA 2FQYA 3FVRA 1ADCA 2HPVA 2I3DA 2W2LA 3EG5A 2O05A 5BSFA 1LFAA 4NIMA 4IY1A 7REQA 2WPDD 2EARA 4ANFA 3PXGA 3WLKX 2UYOA 2YHIA 2XW6A 4EUFA 1EK0A 1YDEA 2XDQB 3SJUA 3FPCA 3L18A 1QIFA 4I36A 5TMBA 1MC1A 4J0KA 3SQDA 3PA8A 2WK1A 1S2NA 3Q6IA 3SX2A 4BNDB 5FAKA 2WM3A 2FB9A 4H15A 5EZQA 3KP1A 2I6TA 2QMYA 4TMZA 2FNAA 3O47A 1Z3IX 4PX5A 4NJEB 1A9YA 4CLRB 1LRJA 1AQYA 1BXRB 2IPAB 4K7JA 2DPLA 1SD5A 1XLUA 1E59A 2A0YA 4OLJA 1E94E 4J1TA 3AEUB 1T8TA 1LBSA 3ENZA 4OH1A 1BO6A 2BDUA 5IH7A 1WTAA 2CXUA 4WY5A 1NPYA 4J03A 3ICQB 1HDEA 1E6WA 2IYLD 3L4EA 1XXLA 3TLJA 5K8LA 5K51A 5L40A 1OX4B 3HO6A 1H5NA 3PNQA 3QY0A 4H3KB 1VJRA 1YUNA 4GOND 4TROA 3RF6A 3UJHA 1MA0A 2QUZA 3GX1A 4C1NA 1Y6RA 1AUVA 2WTMA 3ER6A 2IF2A 4IZ6A 4ND8B 5EXDA 5AH0A 1LBEA 4EHFA 5JXGA 4DAOA 3MJDA 2FN4A 3OECA 4NV3A 4KAAA 2D7CA 3BEOA 4ZHQA 3VNVA 5EQDA 1I3LA 1KQPA 4FSXA 4AJ2A 4M0MA 3AFMA 1ZSVA 4M0PA 5TQ2B 3SJCA 5SYMA 1PT6A 3GJ4A 1JR3E 3F0TA 4OLBA 3NASA 4O3FA 3SMQA 1I7PA 3HCRA 3A6EA 2ID9A 1JLKA 2ZVQX 3JWPA 3QUCA 3D6UA 4J6FA 1KZ6A 4KMRA 5GP1A 2GJ9A 4F4HA 1G4HA 1PFGA 3KU1A 3SZUA 3MQFA 4C78A 1BW9B 1JDPA 4P2GA 3WK9A 1OXKB 1HZZA 3RREA 4UXIA 1V5GA 1ZHHA 4ZN6A 3STTA 2N42A 1FFYA 1CRLA 1NHGA 4XCXA 1EH5A 2F9FA 1IN1A 1YUBA 3LPCA 1ML4A 3GYGA 3ZV6A 3VPFA 3UG6A 2W7TA 1GEEA 3NT2A 1RYYA 2RH9B 4HSGA 4N49A 3WFJA 2YV4A 2C9CA 3W4KA 3FDIA 4F4FA 2DH6A 3ETLA 3HUDA 2ZXFA 4LTMA 4L4YA 1KZHA 3DS8A 4ETIA 5F2OA 5B4VA 2C88A 1PJQA 1XFAA 4JLNA 4TTIA 2GZSA 3E7DA 4P22A 1JHAA 3TFWA 1A96A 1FXUA 3RGGA 1YCGA 1MXHA 1YFLA 1A5TA 2E4VA 1C7RA 1Y42X 4LE0A 1KDVA 1W7AA 3D0RA 4A6XA 3DE1X 5T8KC 1X7XA 1ML3A 3URKA 4G8CA 4NJMA 4JA0A 5EJ8A 5JYEA 1Q7EA 1SNYA 3HKBB 2PRIA 4MYHA 1ZGCA 4FMCF 3IJRA 3OIWA 1Q7BA 1KQFA 2QPOA 4UCQA 1I5EA 4JVNA 3O3OB 2L42A 3MWDA 4ZVKA 2QE6A 4E70A 3PNKA 2P62A 2XNCA 1QG0A 3K09C 3PPXA 2FSPA 3ZQ4A 1Q7TA 4IJ6A 1EFLA 4BWYA 3BGOS 3QF7A 2V1XA 3H0EA 4TMTA 2A5LA 5CVTA 1TZJA 4XM0A 1U02A 5DN6D 1YU6A 4FLFA 2R62A 1TMYA 2OGWA 4IOLA 5T5QA 3GI1A 3B6EA 3W5HA 1NYLA 2LIPA 4ZKDA 3ROPA 4NYJQ 4FSDA 4HCJA 3V8BA 3ISTA 5HXAA 4AMUA 5KX5A 1AMNA 3GRYA 3TQRA 1YI8A 1Z56C 3GZJA 4I3FA 4P8RA 4BFZA 2Y66A 1A9PA 4PZUA 3V4PB 1GCIA 3CH7A 5KTRA 5GADl 4PZYA 4L9SA 4TT3D 3EDCA 1XZCA 2QUJA 1HH4A 2DBZA 4Y7CA 1G20E 2W0SA 4EOGA 4ZEMA 2XOKD 1P1IA 1TM7E 4GUAA 2XWBF 4UULA 5H9VA 3QXGA 4UW9A 4BLRA 2JI7A 3VHRA 1ABBA 2GRUA 2AX3A 4REOA 1P7ZA 5K0EA 3DOIA 3P2KA 4UPEA 3AM3A 5AD1A 5C5EA 5GJBA 4WI1A 1MIOB 1QWOA 4EY8A 4KRFA 1CU1A 1SA0A 2VCYA 3BM5A 2JH3A 2ZSFA 2C00A 3JTMA 3GNSA 4GX1A 4R40A 1YS1X 3FYSA 3GFGA 1W6RA 2HT1A 2XGMA 1OWPA 1DMRA 1CE8B 3GCXA 3UKDA 4D0LB 2FSIA 2IUUA 2AB0A 3W9SA 1QFMA 3IJPA 4GGPA 4AQYB 2FFRA 3D7SA 2KSQA 3K0AA 1DIBA 2ZI9A 3U19A 2ZAOA 1PDOA 5I51A 5B1YA 3F5MA 1HG0A 2VTEA 4NARA 4OM8A 4RJKA 2UXCB 4KQCA 3MAJA 5C8YF 2YOHA 1Z47A 3MD9A 1N6KA 4L4RA 1VKJA 3VU0A 1LTQA 2IU3A 4MCHA 3HUUA 4NU0A 1JG4A 2GK6A 4I4CA 1E96A 4UJ5A 4LJRA 1NVDA 3REOA 2J5RA 1QAOA 1HI9A 4PHFA 1F3OA 4ZQFA 5H3CA 4YUVA 1GQYA 4LSMA 4FKBA 3KZ1E 4L8GA 1HPLA 4RCVA 5A4KA 2ZI7A 4DCJA 1E7YA 3EE6A 2HFKA 3U7QB 2FUNB 5JD4A 1UM9B 3DZBA 5F2KA 1IH8A 3GIDA 3WL3A 4K6KA 5JZMA 3FPKA 3OA2A 4FYWA 4LBYA 3C5HA 1Q0PA 2HEGA 3ROKA 5EGSA 4F4CA 5I7FA 2LCIA 5IK2D 3FSGA 4D6XA 3TSZA 4I1YA 3MB8A 3WB0A 4HFNA 2Z5VA 3B3FA 2VDLB 3HJRA 4GMXA 1WXEA 1WXFA 3PEVA 5EYPA 3CF4G 3FLMA 3KXDA 3U3JA 5TDHA 1RTKA 1GG9A 3BE5A 2UYCA 3NM4A 5E4TA 1EFDN 1QFSA 2QG6A 4UCWA 1DGQA 2JHPA 3CZRA 4ZAXA 5ADWA 4YP7A 5BO5A 4RJJA 3BWEA 4R6XA 3OESA 4X8OA 3PJEA 4K40A 1P2SA 2NAPA 5CH3A 2P9QA 3WIEA 1GCGA 2W48A 2Z6VA 3V2IA 1JDZA 1F2VA 2I80A 3T1HB 1JQLB 2QW0X 3FNQA 3GEHA 5H83A 3OT1B 3V7FA 1C7EA 2G9VA 2MSWA 3AKDA 4RANA 3T5TA 5A7FA 3GFBA 3ME5A 5B3KA 5C35A 4FN4A 3WL7A 5KNBH 1U4SA 1UFVA 3KUXA 2NM0A 1UJCA 4HGOA 1Q2XA 2A14A 4U1RA 3TOSA 2ORWA 4BVLA 5SYNA 3GFQA 4FSHA 1RAIA 4W99A 1DAIA 2X22A 1Y3DE 1ZZEA 2VDVE 4FBGA 4Q7MB 1CJVC 1ZSNA 5EXTA 2J6CA 5SZKB 4YV1A 3SQXA 1A8UA 3FCOA 4H7JA 3L4BC 1XNGA 3HEAA 2QD3A 5E1OA 1H0HA 1BWQA 1E3EA 5KSYA 3BFVA 1JJBA 1SC1A 3QYFA 5A02A 5J1SB 3D7KA 4DSNA 1XELA 2FWAA 1N8TA 4TWIA 5GV8A 4HVCA 3AO0B 4OHCA 1YE5A 1UAYA 1USVA 5T8KA 3FMIA 4KR3A 1OWOA 3KOXA 5EJ6A 1ZDMA 2PVCA 3NBXX 4FZ3A 2NYRA 4RD4A 3WGIA 1RM0A 2RAPA 2J6HA 2DPHA 3WYCA 4YDQA 1Z2NX 3OQBA 3PUWA 5KVCA 2NU6B 4WZAA 3CE6A 2Q3FA 3OI7A 3QBVA 5CT5A 3IAEA 2J3KA 5KYKA 4NNPA 5KQSA 1QGED 1FUEA 2HJSA 4LCEA 1E18A 3K09A 2OAQ1 5F52A 5HTKA 5IT9A 1NONA 1NLYA 1J39A 2GARA 4NZ9A 4DV3B 1T8YA 3G1WA 3GY0A 1SKYB 2RBKA 4EENA 1PEKE 5KJ6A 4BJ5A 2DKOA 1BEZA 4E08A 1CHNA 3A1NA 1KSFX 3Q3EA 2RGNA 3ML1A 1Y63A 1P72A 2XYVA 4BECA 3LP6A 1IHXA 3ZY2A 4JBXA 5LUBA 1U04A 4KXMA 4ZODA 5J5AA 1Y7IA 2OXCA 2Q3CA 4FONA 2AHRA 4Z9YA 3USCS 3ZWOA 4DIEA 1OZAA 5CBPA 1N3BA 1JJAA 1YR8A 1H2WA 2BEWB 1I0IA 4FFBB 3E9RA 1GGNA 3O95A 5HJ2A 2AN4A 3AYZB 5DIZA 1Z83A 2EX0A 3ZNPA 4OYYA 4BVBA 3EFOA 2VJMB 3C16C 4FQ5A 3QNWA 1HT0A 2RKWA 3RVJA 3UMRA 4CKWA 3U5ZB 3BL6A 3UWSA 2PVPA 4JQSA 3EGCA 1F2UB 3G5UA 1V9LA 1Q3KA 4DSUA 4X8LA 3R7NA 4DFDA 4DC9A 3ZWVA 1G7TA 1NUPA 2GAFA 1F48A 3OM9A 1I9CA 4HX2A 4KQHA 4QFMA 1VKNA 4F60A 1AHPA 1ND6A 2MHCA 3CEJA 3UPUA 2B82A 2C82A 3LXUX 2R65A 3QE0A 5GONB 2GZAA 4ENPA 4QOHA 5F1YA 2IXTA 3HYLA 4Q4LA 3DJYA 4S1VA 1X6VA 3SS9X 1RCUA 2ZROA 4CQLA 2R96A 3B1ZA 1MXFA 4RGYA 3STXA 1DFHA 4D8YA 5T3UA 4F85A 4IWXA 5KPJA 3THXB 3INTA 1RPZA 3LH5A 3EWAA 1WEKA 4I8IA 4Q19A 3RBAA 4MUEA 4ZV4A 3UA3A 4Q7KA 4JT9A 3FGNA 1DT5A 3ZEAA 5FHQA 1F4PA 1FP2A 2HXYA 4LV6A 3NWJA 5GM2A 1B2LA 3FUCA 4QOFA 4E51A 2GYUA 1BIFA 2ZRQA 1GUDA 1W19A 2BIFA 2ZBRA 4G09A 4IDHA 5AJYA 4C2AA 4N48A 1KP2A 1EGMB 1ODKA 3Q9SA 1S2OA 3P2MA 1FFXA 1QGUA 3K7EA 1GL3A 4MROA 3ZHYA 1CUGA 4F0JA 1T26A 4DJAA 4J3JA 1E64A 1O77A 1JIIA 2QD5A 1ES9A 3K0CC 2C7BA 1MC4A 2ESRA 5E6RA 1L7DA 1E3WB 2WFLB 3MJVA 4P82A 3RASA 4DV1B 5AVZA 3FIUA 1HR0B 4BKQA 1GAEO 3SSMA 1KI7A 4TMFA 2P2DA 3OE7D 4JVOA 2PZAA 3OZWA 2YRFA 4A6EA 4O6VA 4X1IA 5FWYB 2Z57A 4YAGA 2NADA 1BNCA 1K5HA 3WYFA 3EIOA 2VHCA 3BFXA 1YJ5A 2I67A 3QLVA 4G5HA 2BDTA 2VT2A 5J59A 5FV4A 1FFDA 2WF8A 3DL4A 4JUFA 2J3EA 4QGSA 3NZEA 1T3GA 5FOXA 2GAIA 3P7MA 4ITRC 3WK6A 4EHAA 1KI4A 3KJXA 2PSDA 3F5DA 4IYJA 4J91A 3H1GA 3L02A 1KFCB 2C92A 1OROA 3KXLA 3OZSA 4YJ3F 5DXJA 5TPWB 1G6Q1 3TUJC 4Y6OA 1ODJA 4E15A 3GZTB 3P1JA 2FX2A 2WILA 2C2GA 3PHJA 1N2SA 1Q0SA 1XTPA 1MOZA 1SQSA 2QTGA 4EPRA 2FPKA 4D9MA 5B3JC 5HKKA 2WM2A 3CLHA 4DA0A 1GOTA 3EZ6A 4X44A 4OHBA 3WWEA 2XZTA 2WWWA 4J0HA 2XRMA 4MV6A 5LMZA 1EU1A 1Q1QA 3W2FA 1DKOA 5CDHA 1O7JA 4ZAFA 3IQFA 1E20A 3UJ3X 4Y2YA 4YASA 5J47A 1SOWA 2PZEA 5AJTA 4D25A 2QI9C 4D4HA 2BFCA 4C2UA 4YRPA 1GGEA 3GLHA 1PT9A 3I2IA 2A33A 2C3PA 2HUPA 5D2CA 3X44A 4C4PA 5CXXA 4JR2A 4AZWA 5FL3A 1NI5A 3L4BA 3NONA 2NYVA 2H3EA 1Z2PX 1NYQA 4DLAA 4OVKA 5KO2A 4WXMA 3NJRA 4IHJF 4YCJA 5LA6B 3SZ3A 1LQ2A 3DEHA 4EGAA 1UPBA 2IYYA 1Z6PA 4DRXB 2NX2A 4P33A 4E2XA 4WVFA 3EEOA 4DR3B 2QRLA 3I9MA 3NP7A 4JB8A 1B76A 1OBVA 2HY7A 2HLDA 3CX8A 1ONPA 4CVNA 2W9XA 4EG6A 1YUMA 1EYZA 4LXQA 3CLSC 4DVGA 3LY9A 2NT4A 5CTJA 5GIOE 1ODSA 2AFHA 2CLOB 3HBLA 4OQZA 3ACDA 5FD8A 1QIJA 3Q3JB 3CLRD 5KU1A 3TZBA 3GJ7A 1A5ZA 3G2NA 3I04M 3UQYS 3A11A 1B0AA 4PVDA 3ZXSA 1W581 1XRNA 2PSJA 4W9MC 4Z1MA 2E5FA 1ZH8A 1P0CA 2WWFA 2J0UA 2XUFA 1ADFA 3Q8WA 3V1NA 3IP8A 4Z99A 5I5GA 4YLYA 3ZZMA 3NKVA 2BFPA 4LF4B 3UH0A 1Y1TA 4L9RA 5FTMA 3CLKA 3RIEA 2VJAA 1JEQB 1ZQ9A 5GGYA 3LT2A 4K81B 4JC8A 4PZ0A 1OXTA 1EK2A 3K73O 4QUDA 1CUJA 3OCVA 3NHFA 4FE7A 5JJKA 2YWCA 2BGLA 2FHPA 3P9NA 3RRYA 2O8EA 4I6GA 2NU9B 5IM4F 4AMBA 1ZNXA 2P6OA 4ZQEA 4CU2A 3ANLA 1ZRHA 2GFQA 2Y9MB 4COOA 4EPYA 4QDZA 3VX3A 1R64A 1T5SA 4MB6A 3ONWA 1EFPA 4X8HA 1UPUA 4LCBA 5LA6F 3O8NA 1I5RA 2F00A 1FFHA 2AJ8A 3EVNA 4UM5A 4A8JA 4B2PA 4BLQA 4YXFA 1YL5A 3WZLA 4ZCTA 3UM9A 4W8HA 3ECAA 3CIOA 2DBRA 1STOA 1JN0A 4FCVA 1L5KA 1XZMA 1CB7A 1V35A 2ZRKA 3TD9A 4R1OA 3HB0A 4OGFA 2V45A 1KEEA 3TZKA 1BN6A 2PH3A 2B8JA 2CLKB 1YB1A 2YN0A 2GT1A 1KR5A 2P65A 1A4UA 1CY7A 3M0EA 1CR2A 4LRUA 5IJ9A 2D2XA 4P4TA 2H1CA 1H8EA 2Q8PA 2ZS7A 3GFVA 1VIDA 2ATXA 1Y80A 4OGLA 5B58C 4Q4JB 2H1OA 3H5LA 4EL0A 2FZ5A 4ZDJA 4PY2A 5CX1A 4ND7A 1FS6A 2HW8A 2PBRA 5KIAA 1B41A 2OYSA 3PTAA 2GM5A 4JYCA 3AZOA 3OAAD 4BFCA 1E61A 1C0EA 1R16A 4NCJA 4QJIA 4Q4CA 3UB2A 1NFRA 1P8AA 3V1MA 3UCEA 1DE0A 2WA2A 3SSOA 3EIEA 2FGKA 4JJAA 2CNWA 4DJJA 2H18A 4Q48A 1BCRB 2KE5A 3QWAA 1FNDA 4PC6A 3WYGA 1IVSA 1E1LA 1WU7A 4YP6A 3X3HA 2JLYA 1T2CA 1MX3A 1D6SA 2E87A 3CM0A 3F90A 3MWJA 3OPMA 2R1VB 2YZKA 3UJ9A 1LQTA 3MERA 1MA3A 4BFVA 3GAMA 1Q14A 1TFRA 2Q1SA 4G5OA 5L6MB 5JG7A 2ES4A 3AGQA 1YRWA 4IGFA 4MJ3A 1CUWA 4AMGA 4YMTA 5AW9A 1C1YA 1E1QA 3GEEA 2G1KA 4G24A 3SP1A 1IEXA 3TN7A 1JJ7A 2DM6A 1OC2A 2HCFA 2QIPA 2OL4A 1K7XB 3QU9A 3L8HA 2IOFA 2P7IA 4TTSA 1DQZA 1IZYA 2BHTA 1DCKA 3A6DA 5B3JA 3I9KA 4XJVA 2JGIA 1HT1E 3B2NA 3GT7A 3QNMA 1ZEMA 4GM1A 4I2NA 2XMGA 3N0VA 3EGIA 4MO9A 2HUNA 5GMOA 4U7TB 1B3RA 1VRWA 1Z45A 1U7XA 4R9UC 2ZJ1A 3TD6A 1E5DA 1UJ4A 3KYIB 3PC3A 4GPIB 1UADA 4C0AC 4EUHA 3MGBA 3V33A 5K8IA 2VCHA 3ITEA 1A97A 3QVWA 4RZUA 4UHDA 4B76A 2CJXA 1JDUA 3CT6A 3T3PB 2CDAA 1SWWA 1O6FA 1D1PA 1GPKA 1FPQA 1Y7LA 3FLBA 1FNSA 5EEGA 1HDOA 1M7BA 3KPYA 3RVPA 2FDXA 2CFIA 4LF8B 5DK4A 2K2WA 4MVJF 4UUMA 821PA 3FNRA 4FQ7A 1SVSA 5BW5A 5ALGA 1QRTA 3G88A 4GD3Q 1R6XA 1S8AA 3OPYB 4RUKA 3KQSA 1E79D 3H87A 3ESYA 1BROA 2C4WA 2QM7A 4PO9A 4EHKA 1WF3A 3G23A 3M6WA 1JBQA 2WJJA 2AJBA 2Y4OA 4JENA 2BUCA 4IS3A 2GJ4A 3LWBA 4CCSA 3SBOA 4N0QA 2E21A 1PQ4A 3SEAA 1BWRA 3C98A 1N3YA 3B6KA 1H0KA 1GR0A 3L5KA 1GLNA 2YUIA 4A1FA 4DMGA 4F91B 1UBKS 4C6SA 4URWR 4EFLA 5FT9A 1V7PC 4OIFA 4UEQA 4DSTA 1FCJA 4D8VA 1YDGA 1E1KA 1T5LA 4P7FA 4BNIA 3EGXA 5BNIA 4IICA 2G77B 4QHSA 3DZKA 3HJGA 3DFZA 5I9TA 5LL6P 4TLEA 2EF0A 4YV0A 1NJ2A 5PNTA 1XZHA 3GRCA 4FWBA 1EG7A 4N5HX 5SZJA 3SAJA 1CB0A 1T2VA 4TTAA 2CXRA 4E5MA 3WO0A 1P4AA 4TTPA 1ZUWA 3D0KA 4G8JA 1DDIA 3EZLA 2VOEA 4HYEA 4QPCA 2PLRA 4RM2A 4AG5A 4K87A 4R4JA 4BLSA 3CXRA 5HIAA 2PO7A 3AL3A 1HM5A 1ZVMA 1Z2AA 3C87A 3G2IA 3D3WA 3MWEA 4EX6A 1WWKA 5K0JA 2ZP1A 2I8LA 3KKOA 1XZKA 1R0ZA 3C3KA 2WF5A 4JLPA 4LRSB 3ZGYA 3FCUB 1W49A 1JR6A 3DWGA 4YY3B 1U7UA 2BJWA 2WFZA 2X1HA 2ZUUA 1GZ6A 1C30B 4HXGA 1UAGA 2V8BA 1P6XA 3C1OA 4JNCA 5C4GB 1UKAA 1UH5A 4TYQA 3WYNA 5IKEA 1JHPA 2R7NA 4UBOA 3ZV7A 1T91A 1VMKA 4FDUA 4XOIA 5IG2A 4MQLA 3FWYA 4CN8A 3VR0A 4Y0AA 4RTKA 4Q21A 3PNBA 1N5LA 1ULAA 5KMGB 4R2KA 2YWEA 1TMKA 2BZ0A 1O6CA 2PUCA 3TQFA 4GMDA 1L4HA 2JZCA 1Z13A 2ODBA 3UFXA 2X5NA 1ISRA 2QRVB 3D7LA 3DUWA 3IAUA 3REGA 5I7OA 4YRKA 5HZMA 1RRFA 1E9AA 1L8XA 2ZRPA 3CVOA 4NG5A 1XU7A 1L7AA 1GRQA 3H9JA 3V34A 2H7VA 4G0YA 4G1FA 4UE6A 5C5DA 5L3SB 6ADHA 3LWZA 5BYKA 4KYTA 2ZB2A 1N9GB 1EB9A 2AXNA 4H1VA 2UAGA 4Q4HB 4FZJA 4C3UA 4LBVA 1DBIA 3UJPA 5AP9A 4M9UA 4DL9A 4GM0A 4ROSA 3I76A 4P32A 2IH5A 1U0EA 1ECLA 2QGZA 5SV2A 3BIJA 5HRAA 1OY1A 2WUWE 3MTAA 3T9CA 1YS4A 3I6MA 2ZJOA 2XECA 1TQ2A 4HNRA 1Q7GA 2ZYUX 3WA7A 4XPIB 3K70D 4OB7A 1IXSB 5IEJA 2VG8A 4O1MA 1I4EB 2J9FB 4LG1A 1WHTB 3HABA 4YX9A 3BZWA 1Q15A 1V5FA 3DLAA 1D5WA 1A4IA 2F90A 5TC4A 4UC0A 5KWSA 1HLPA 3H5RA 3A1EA 1PWHA 3SZLA 4G63A 1JFFA 5AKXA 1ZJWA 2VYVA 1M7GA 1O2DA 4CFYA 4GC9A 2IUSA 3MUNA 4TV8B 1AQNA 3WC4A 4IWNA 5F9HA 1ZC3A 3UTDA 3CLUC 2A0WA 5ELMA 3RWBA 3QF4B 3V4LA 1U1EA 1ZLYA 2H1FA 1XF9A 1ZK2A 1CQZA 4FYVA 4IDEA 1C3VA 4YACA 4B45A 5JARA 5L45A 1BQ3A 4ESVA 4LGYA 4L08A 2HJWA 4JSYA 2BP7B 3FHTA 3PENA 4R84A 3FN4A 1T9GS 4WKPA 1IEWA 3D8TA 1KKUA 2R6CA 2JK1A 3AGPA 3FNBA 4HMOA 1OREA 4V39A 5FBWB 1EVJA 4GR4A 2I65A 3H9CA 4CJXA 4QU9A 2XR1A 2DPYA 1MJFA 2W2OA 5FUQA 3F6BX 3GLIB 1JEDA 2B7CA 2QN6A 3PJGA 1PQUA 4RABA 4BPBA 4Y6LA 2PO5A 2R6DA 3E03A 1E9BA 5FJJA 4C76A 4UUPA 4TM7A 3H2KA 4QSHA 3K2EA 2F3UA 4AC9A 1CS0A 1R0RE 2WAMA 1EK1A 2V3VA 1UWLA 3LGSA 2I1QA 1VXRA 2HR1A 4MI6A 1KP3A 3O4JA 3WYDA 1J8YF 4AF6A 2PGJA 1IBCA 2H2HA 2PRZA 2OK7A 4GPAA 3C8UA 5AK3A 1N2CE 2G70A 4B3CA 3G68A 2XHZA 3NT5A 4TXJA 2ZIXA 4Q02A 2QL9A 1LDMA 3HXMA 1QV6A 1QKJA 2Z95A 1IK6A 3UJ8A 3GNQA 4MKRA 3PFCA 3DVSX 1GP2A 4HDAA 4F86A 1C1HA 3GVIA 1YRHA 3MCUA 5ENZA 1SVNA 4Y2GA 1Q1EA 1JFLA 1XKTA 3P0IA 3O3CA 2AN5A 3CUUA 1PT8A 1H9BA 3VH4A 3FLAA 5JANA 4P92A 3HFSA 4EYOA 3TSYA 4PNHA 2HEIA 2VK1A 5K3SA 2ALJA 2C8LA 2EWWA 1ZUD1 2ZZKA 3CTPA 3A6LA 1JHQA 1YVDA 2ZEJA 3BB4A 1T8RA 2HA6A 3DVRX 3WSTA 1WSDA 4E1AA 2Q45A 3GLFE 5B58T 1USUA 3NIFB 2IVFA 2PZJA 3Q9LA 3SHQA 1VCIA 5D6OA 2IUFA 4ESOA 1M9NA 1UP6A 4BAUA 3OFSA 3MCVA 1TCAA 2Q5QA 1XK7A 2YWHA 3EIFA 3HCAA 4XYBA 4XJXA 4X90A 3UAYA 2Z0MA 2AEJA 2HO5A 1T9BA 4GL2A 4QOSA 2XB9A 1CUSA 2OHHA 3R3XA 5UKDA 3PL1A 2VDWB 2IH2A 2ZBEA 4HMPA 4HQKA 4PC2A 2XZDA 3L1UA 4Y67A 3PEFA 3SK0A 1EWRA 2IS6A 1SCJA 2YMMA 4MYTA 1QCYA 3ZVMA 1CRWG 4KR0A 5EWMA 4PPYA 2B8NA 3FFTA 1HTTA 4X6LA 1VDZA 1EP9A 1PR0A 3NUQA 2H16A 4XYMA 2FPSA 2QRZA 3GNTA 4IM7A 3ZWCA 3EOAI 4EKYA 2QU8A 2QN9A 4Q1FA 1YZGA 2BEVB 2QE7D 3MIIA 5A06A 1Q91A 3L4KA 3T3OA 3LG2A 4KXNA 3KQMA 1LK5A 1YA4A 3GCZA 2JEYA 4Z5XA 2PUAA 5K8CA 5KHAA 2PUEA 3OLVA 2GZHA 4KO3S 1IZ7A 1OHHA 1YGPA 2GYWA 2GCIA 2VPXA 3JWEA 4ZAWA 4MWTA 3RCBA 4CCYA 4RH1A 1JIVA 3A3NA 4DZZA 1HDIA 2VSFA 3OLWA 4I0WB 5K3FA 4ZI5A 3TMYA 1N77A 1DTEA 2B9VA 1KJJA 1MU0A 1MCZA 3IVXA 3VDQA 4PPFA 4EPVA 1BX1A 1VE1A 4YRAA 4KREA 4ER7A 1IBMB 4D6PA 2A9RA 5DNEA 1LI4A 3TQTA 4CEIA 1QZXA 1Z5VA 4LNUA 1S3IA 1OB2A 3E1GA 3SDSA 4R1PA 1GGMA 4FLMA 3QEBZ 1RXIA 4RA6B 3JQ8B 2P2SA 4BV2A 2H8KA 1KNQA 2V4ZA 4N65A 1LC0A 3S3TA 3SCZA 1FDUA 1KYVA 3W05A 3ZI7A 1KYQA 6CHYA 2NZJA 1U3VA 3RKSA 4E3WA 5KVSA 3OEED 4BE7B 5KHLB 5CFZA 3G82C 3GUCA 3ZE6A 3WMGA 3GROA 3VZBA 4C3OB 3TQCA 3CX7A 1EWTA 2AOTB 3AF0A 2IEAA 3HRKA 1OFTA 2ZYTX 3ND9A 4NG4A 5CLFA 3GFTA 1DG9A 4X20B 4AJ1A 5LZ9A 2AVDA 3O8RA 3HKDA 1UT5A 4RAOA 2Y27A 3H4VA 4URHA 2IXEA 3I23A 4GIBA 2Q4TA 3FVQA 4FYIA 4UQPA 5FH9A 1Q7CA 4X1YB 1S2GA 3U3XA 5J2UA 2GLXA 1LPMA 3O8DA 4KR9A 2IV2X 1ZZGA 2ZBPA 1V6AA 1VJDA 3DJFA 3DTVD 2TRSB 2EZTA 4KQGA 2W43A 4ZVRA 2A0FA 4B6EA 2R8XA 3MAAC 5CYPA 2FN3A 2QMEA 3GHHA 1ORIA 1Q19A 1ORVA 3T7KA 4AKEA 5KNDH 2G9ZA 3B1JA 4FW9A 5AVJA 3C15C 3E9MA 3VISA 1JDBB 2HN9A 5K8TA 2NO5A 1U8EA 5HWSA 4JJIA 2FUKA 1SPXA 2R4UA 3OPVA 5IC5A 2QN8A 4B44A 5KAPA 4KH1A 3NKFA 3RDPA 4C0XA 1E2FA 5ESWA 5TLSA 1GNLA 1V9SA 1RHUA 4XRRA 2A9QA 2EIXA 4PBRA 3RAFC 2R7LA 1QYCA 4C29A 1MDFA 5F12A 1K8QA 1O9BA 1XSEA 4PCAA 4RY2A 5CIWA 1HK7A 3U9SA 3LLUA 3IEMA 4YAWA 1N6OA 5LD2B 3D6JA 4FIZA 3DTYA 4PWZA 4X00A 5DM4A 1TQDA 5EP3A 1S2LA 4O29A 4ER0A 2G1PA 2V6BA 3AIIA 3KTOA 1GY8A 1UK6A 2NZXA 3H3FA 4HVAA 4LYYA 2YRWA 4R1MA 5FLEX 4B6PA 4CR6A 2LCQA 2ZUVA 1JDNA 1RU3A 2OZLB 4WFKA 3U40A 1AHNA 3WNDA 3LJKA 3TF5A 4K6HA 3M9XA 1ZKMA 3R3YA 3R9IA 3MTGA 4PQGA 3OO1A 1PJ4A 5I9IA 1GPDG 1Y5IA 3IOMA 1AS0A 1FRVA 2ZT7A 3EZFA 1HDRA 2Q9BA 1P1HA 2AFIA 3QEMB 3PEYA 2XMQA 3P4UA 3GDWA 1R0BA 2GCOB 1WXQA 4MW4A 2BKUA 2GTIA 1I2BA 3USES 2O5VA 2PH7A 2DWQA 4L8YA 4F3KA 1GZ4A 4ZYUA 2Q2OA 2K7FA 4A03A 3P0JA 1TM1E 4MVJD 3SKYA 1DBSA 3IQGX 3FYUB 3S8YA 3AT1A 1CDDA 5EIAA 2RB5A 1RAEA 1TQ4A 4LGVA 1QVZA 4MQUA 3I9NA 4R7TA 5EPUA 2F8TA 2QRUA 1UZAA 3PLNA 2W6CX 3QJ5A 1NPTO 4AW9A 5CYFA 1UWKA 4YJ2F 2OPBA 2G80A 3LSTA 5J3JA 3OPQA 3WIUA 3PG5A 3L8ZA 1E4VA 4YQEA 1HFJA 1TO1E 5KOJB 4Q47A 3RVMA 2QZSA 3K0EA 4ISCA 2MMGA 5TT1A 1IXYA 2IYOA 1YXMA 2V97A 5DTEA 2WJIA 1VYVA 2COEA 1XE3A 3GPIA 3JTEA 1EFRA 1R9MA 3NDJA 1AKEA 3DCIA 1NW4A 4LYGA 2H3HA 1WDLA 2FLKA 4PQFA 4WZBE 1JGTA 3H8VA 3CNQS 3R09A 4C03A 3COVA 1SVOA 5BN5B 2XRYA 2YMQA 1FJGB 3ECSA 3ER9A 1IB0A 3NH6A 5JMPA 3M34A 4KK4A 3WOVA 4IIEA 5G41A 2Z5GA 3I0NA 2BW0A 3ZE0B 3QKTA 1Q17A 3D0QA 1CZHA 5ALVA 5EZ6B 2O8FB 4O8CA 3KYJB 2AMYA 2YWXA 2QRPA 1IIBA 2X5OA 2IODA 3IKVA 4BVHA 2NO7A 2XSZD 4XD7A 3ZS8A 2FSVC 5BYJA 5THXA 1X80A 4CIYA 1MHTA 5EPEA 1U8XX 5E1BA 2QDXA 1WSBA 1CJMA 1GTZA 1L7EA 2EDCA 2W4IA 2WSLA 4HQ6A 3FX2A 1QQ7A 4MVYA 5I48A 1TU4A 5DTMA 3WYBA 1BGVA 1DJLA 4BTLA 3STHA 1ISSA 1LDEA 2V65A 1OU0A 2PXHA 2YC4C 3DP7A 1C80A 3HEMA 5A7GA 2Q2QA 1Z82A 2FCAA 5HQ3A 2JKVA 3T4XA 1SXJD 1UANA 1YS2X 5LDGA 3ESXA 1CQWA 5FORA 1NYTA 2FPIB 2D2EA 3QI2A 4RF3A 4HDQB 4FZVA 1KEPA 4QQRA 5EJMA 1PYOA 1RHJA 1OFUX 2V0CA 4MR7A 4EUNA 1VPEA 2BLLA 1JLLB 1NN3A 3NTOA 2SICE 1G3RA 2ZCUA 3QKIA 1SKQA 2A7XA 1T9AA 4FYHA 4QRIA 4CZ2A 3SXPA 2BZGA 1YDFA 3OY7A 4J2HA 1CY0A 1EHYA 2B4YA 5B2EA 2VDMB 2BTEA 4BNYA 4OEHA 4GVPA 2Q5FA 2W71A 4I08A 5JAMA 1I7DA 3K9CA 3LFUA 5DOZA 4BB6A 1N6HA 1C1XA 2PS0A 2QR5A 3FIJA 2JD2A 1LSJA 3A6FA 1JVBA 4A4DA 3AEKA 5K8UA 1MG5A 4UBJA 4S1OA 2QRGA 4YJGA 1EWQA 4WN9A 1W1WA 3NIGB 5B55A 3RS4A 1DRVA 1HC7A 4CM6A 3JD2A 4M0KA 3RJZA 4HTAA 3PNOA 1M2VA 2IIPA 2JI6A 3O4HA 4NBNA 2BBTA 3E35A 3DWEX 2QQGA 4JIGA 3U1VA 2OHIA 4KCGA 3SLRA 1PJZA 4HGQA 1N2XA 1ZGHA 3OJFA 1Z12A 1QG4A 2ETXA 3N7AA 4ZIRB 3W3AA 3WJ7A 4BL5A 4LISA 1L7NA 4MRNA 3TLEA 3G9QA 4Q9AA 3T1NA 3AKYA 4L95C 2CEKA 1N7HA 4HXEB 3P9CA 4M60A 1NBAA 1UMCA 4MLZA 3QYPA 2XDWA 2AZ4A 1ZCBA 2VAXA 5C1IA 4BVGA 2JFWA 3DO8A 5AVTA 2WB2A 4Y9TA 2CYCA 4DQXA 5JYDA 3NC0C 2CGEA 3H1FA 3OZAA 4IOMA 3HXQA 2BH2A 2AR0A 5CIYA 2HCBA 2ERXA 2WIAA 1TCCA 5DYNA 1ETUA 2X6QA 2TYSB 2HMYB 4GGMX 5KKAA 3GPCA 3V1YA 3NB0A 4WBSA 2GCEA 5HHTA 4YMWA 1WDTA 2CXPA 4YAOA 4XCQA 3LW7A 3GUZA 3N2KA 1EDEA 2C42A 2Y68A 3C6XA 4IUYA 2HADA 3WJ1A 1Z7GA 4BFYA 3SDBA 1EXDA 3VVBA 1XGKA 3LC1O 1BA3A 1DIGA 2QRJA 2VNHA 1RKVA 3A0UA 4QC2A 1FUIA 2DU8A 3B12A 3DHEA 4NJMB 1WU8A 2HRCA 4ZHQF 3REQB 1A8PA 4TRJA 2ZBDA 4BNGA 3F6PA 2QTFA 3UV3A 4DA7A 3IAM1 5AJZA 4E13A 1MH1A 4M7WA 1ZMRA 1QH9A 2BEKA 3QX7A 4MRAA 3MWDB 3ZCVA 1CUFA 1MEJA 1VPDA 2JIMA 5ILQA 2GNPA 3LPNA 1UPCA 3ECCA 4JUCA 1N9ZA 1UJBA 3K5IA 8OHMA 5I4BA 3K8ZA 3JASA 5C46F 4L8VA 5I7AA 3MOIA 1NE2A 4KDCA 3JWGA 4OP3A 4Z6KA 5EIBD 4S04A 4ITVA 3O93A 3ZCTA 1R10A 4MQFB 1QS0A 5T7BA 1LLDA 4QQ8A 3WL6A