3ER9A

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
288
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
total genus 102
structure length 288
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3er9A00
4PONA 2BR3A 4C07A 3UA3A 4C03A 4PYKA 4UOEA 4RTMA 3CVOA 2OB1A 2YUIA 3TKAA 2PY6A 3EGVA 2N47A 3DULA 4LWPA 1NV8A 2ZULA 3GGDA 4GOMD 4QVKA 1JSXA 2PX4A 4CTKA 2WA2A 3DTNA 3KR2A 2YXLA 3IHTA 5EMKA 1FPQA 1ORIA 2AN3A 2EJUA 3OCJA 1NW7A 4PCLA 5KQSA 1ZGAA 1YFJA 1QYRA 3LECA 2UYHA 3DR5A 5H02A 3KPJA 1KP9A 2GPYA 5DX0A 5FADA 3TM5A 5BW4A 2HWKA 1ZQ9A 3HA3A 4ER6A 1RI3A 3EVEA 3HEMA 9MHTA 5EEHA 2PWPA 3KU1A 3LBYA 5BP7A 2PT9A 1SVUA 5EVJA 2AVNA 2AOTB 3FPJA 1XJ5A 4DF3A 3OE4A 1U2ZA 4POOA 3REOA 2ZZKA 3HCFA 2BZGA 2GA9A 1ZG3A 3GWZA 5FUBA 1HMYA 3IV6A 5EKUA 3BWMA 5DSXA 3E7PA 3EMDA 3ORHA 3C6KA 4PYJA 3UA4A 5HFJA 1X1BA 1L1EA 3BWCA 2YTZA 2ZVJA 4MIKA 4OBXA 5ERGB 4YV2A 1NW5A 2ZIFA 4KDCA 1X1CA 5E9WA 4C04A 2ZIEA 7MHTA 2VS1A 3LDUA 4PYNA 1O54A 4PCAA 1AV6A 4M37A 4QVGA 2ERCA 3CGGA 3LCUA 5EGSA 3JWIA 3JWHA 2ZBPA 2XVMA 2H00A 2G8NA 4E2YA 1NV9A 3AJDA 5JR3A 1RJGA 2IIPA 3KQOA 4A6EA 1PJZA 1AQIA 5T6BA 2IGTA 3EVFA 4P58A 5FQNA 2ORED 3DMFA 5M5BA 2BH2A 4F85A 2HNKA 3B7PA 2NP6A 2P3LA 3HCDA 3AY0A 3ID6C 4R6XA 5DM4A 1D2CA 4LECA 5FTWA 4C06A 4YV1A 5CCBA 1I4WA 2PXAA 5CCXA 2R3SA 1R74A 3P9IA 4QQNA 1AF7A 3CJRA 2A14A 3QOWA 1DUSA 2WA1A 5HIJA 4AZWA 3LHDA 5ICGA 3ELWA 2ZBRA 2P1DA 4HH4A 3GO4A 3SVZA 2Z6UA 3BKXA 3LKZA 5K03A 1G8AA 5ICFA 1KPIA 4CKCA 3LBFA 3C6MA 1SUSA 4R6WA 1BC5A 2PJDA 3TFWA 3FRIA 2AOTA 3LCVB 5CD1A 2EX4A 3V8VA 3KQSA 3KR9A 4RSRA 5DTMA 5EC8A 5GINE 3CJQA 3EEOA 5EG5A 2IBTA 2AN4A 2PVCA 2G1PA 2AOUB 3WSTA 1IY9A 1DCTA 1I1NA 2BR4A 2YXDA 3FRHA 2JHAA 1VIDA 3FYDA 4DCMA 2ZIGA 5LR6A 2NXEA 5FWAA 5T67A 5LQNA 1ORHA 3NJRA 1VQ1A 2JG3A 4F84A 5MHTA 5EOVA 4YUYA 1G55A 1N2XA 3JWGA 1FBNA 1VL5A 2EJTA 4KWCA 4PIMA 4QQKA 5FA5A 1R6AA 4OA5A 3CCFA 2IH2A 5DXAA 4QPNA 2AR0A 5P8WA 5FHRA 1YF3A 3VC1A 3NVMB 3BKWA 1Y8CA 1JR4A 4RTRA 3HVHA 3ME5A 2IH5A 3FUTA 4X41A 4PGHA 5JUWA 3MCZA 5K0NA 1X1AA 4PWYA 5GIPE 1M6YA 4EMSA 1NKVA 4QTTB 3LDGA 2PX2A 5HIKA 4WXHA 3MB5A 1WG8A 1L3BA 3DMGA 3KQVA 4QPPA 2O57A 2XBMA 5HOQA 4HG2A 5FQOA 3P71T 2O05A 1D2HA 1KR5A 2NXCA 2IH4A 3RODA 3P2KA 2ZFUA 1R18A 3TM4A 3UJ7A 3PFGA 5E1DA 4EK9A 5EKXA 4E70A 4EKIA 5DM0A 1WS6A 2XYVA 1NT2A 1N7JA 2G71A 3DOUA 4M7RA 1X19A 5LQCA 5DM2A 3OPNA 5GM1A 3UJCA 4RVDA 2B78A 3FUVA 4RV9A 2AOUA 3SM3A 3BT7A 4QDKA 1JTEA 3EVGA 3UBTA 1ZHFA 2ADMA 3LX6A 4WVLA 2HMYB 2XYRA 3HNRA 5CVVA 3KQWA 3UZUA 2C7OA 3PX3A 3A7DA 1RJFA 1UIRA 2G70A 5EQJB 4MTLA 2Y1XA 3B89A 4FT4A 5EHGA 4M36A 3EVAA 3LDFA 5DTRA 10MHA 3G2QA 2VDWA 3EVBA 1EJ0A 2AS0A 2IP2A 3OFJA 2P40A 5K0BA 4NECA 1M6EX 2FK7A 3M70A 2R6ZA 5GM2A 1Q0TA 2YX1A 5EMJA 2ZW9A 3AXTA 1JSZA 5HZMA 5K0FA 2BM8A 3O4FA 5ICEA 2K4MA 4FSDA 4MWZA 1UWVA 2OO3A 4KVZA 5HIMA 4YUWA 1SG9A 1Q0SA 4RTPA 3GIWA 5FULA 3PS9A 4V0RA 5LSAA 4RVGA 4E30A 4MHTA 2OZVA 2ONZA 2ZTHA 4OBWA 2IDJA 1Z3CA 2PT6A 3AWIA 1D2GA 1PRYA 2ZZMA 3THRA 2B9EA 2HTEA 3I9FA 2WK1A 2YVLA 4KDRA 2C7PA 5FA8A 4QDJA 4GOND 4BY9E 5E8RA 5EIWA 3BXOA 4PGGA 4OA8A 1WXWA 3DUWA 3I5UA 5E8JA 4U7TB 4GQBA 3SGLA 3UJAA 1XDZA 2O07A 2JH9A 3OU2A 4U7PB 1YZHA 1KXZA 2ZWAA 3UJBA 4GBED 2XVAA 2I7CA 1R8YA 1XDSA 2DPMA 2PX8A 4HSGA 1BHJA 2AOXA 3VYWA 3THSA 5DSTA 2ONYA 5CVEA 4EQZA 3ER9A 5LQJA 2IPXA 1P1BA 2JH8A 4DQ0A 4DKJA 4R05A 3OU6A 3BGVA 3EEYA 3KR0A 5DWQA 2OB2A 1QAMA 1UFKA 3KQPA 3MTEA 3G8BA 4KIFA 1T43A 1NW3A 4HTFB 5CM2Z 3EVZA 2CMGA 2XYQA 3Q7EA 3LSTA 1WZNA 5E1BA 1EG2A 1VE3A 3G5TA 3O7WA 3FPHA 3DMHA 3B3FA 2UYQA 3FPGA 3FTCA 4MQ4A 3TRKA 3LKDA 3PX2A 4C05A 4CWAA 4AX8A 1JG4A 2ZBQA 2KW5A 4AZVA 1ZKDA 1B42A 3PFHA 4ZTBA 4A6DA 4GUAA 2C7RA 3CKKA 3GRVA 1TW2A 5GOZA 3NMUF 1DL5A 1IXKA 3R0QA 1FJXA 3MCTA 4FS8A 4HGZA 3TOSA 3PLAE 1QANA 3DXYA 4RTQA 5C9ZA 5EEGA 3BWYA 2ZCJA 1KIAA 1VPTA 3DXXA 3I64A 3TQSA 4ER5A 3ERCA 2QE6A 4P7JA 3B3JA 3V97A 1JG1A 2C7QA 5FCDA 1SQGA 1EIZA 2PV0A 2P3OA 3EGIA 3L8DA 3P9KA 5G02A 2AN5A 1G60A 5KS2A 2F8LA 2NXJA 1OR8A 3KQQA 4HRAA 4KRGA 2ZZNA 5K09A 4PYMA 1SQFA 5EMLA 3C3YA 4PYIA 3JWJA 5EIFA 4PYOA 5LQUA 1P1CA 1QAQA 1FP2A 5LQKA 5U4XA 1VP9A 4Z2YA 3GNLA 5D1HA 1QZZA 4GOOD 1XCJA 4AUKA 2NP7A 3SSNA 2P8JA 4ER0A 1KYWA 4IV8A 5K0JA 4ER3A 3E8SA 3HA7A 3EVDA 5BXYA 1TW3A 2NNWB 4KIGA 4RVFA 2GLUA 4HTFA 3O31A 2QYOA 2UYOA 5GP1A 3BWBA 2VZ9A 1R8XA 3GRYA 2HR1A 4JXJA 3M6WA 2PKWA 2IDKA 3FUUA 3M6VA 3NDIA 3HA5A 4GC5A 3TMAA 2PXCA 2VDVE 3KPUA 3GU3A 2GH1A 3KQMA 4XUDA 3U81A 3M6UA 4YUXA 3VC2A 1BKYA 2EFJA 3DP7A 2O06A 3HVJA 3MQ2A 3KPYA 5HILA 2H1RA 1YFLA 5E2BA 3UJ8A 1INLA 2YR0A 2HV9A 2YXEA 4G56A 5CVJA 1VLMA 5K8VA 1YB2A 3P9NA 3K0BA 2Z6AA 3TKYA 2CMHA 2FYTA 1FP1D 4DZRA 4X60A 1P91A 3NWEA 1YUBA 5EPEA 3R9XB 4IWNA 3OZRA 5DRYA 4LWOA 5E2AA 2JHCA 3A7EA 5C0OE 3ELUA 3IYLW 3G89A 4C08A 3EMBA 3LCCA 4Y30A 1G38A 3SR4A 3PTAA 1EJ6A 5EMMA 2BR5A 1RI2A 2ZWVA 3MTIA 3SSOA 4PNEA 2Y1WA 5E9QA 5E9JA 3NTVA 2FK8A 3S68A 1IM8A 5KVAA 3QOXA 1MHTA 3HCAA 3GDHA 4LG1A 5DPMA 3EPPA 3P97A 3ANXA 4RTNA 3BUSA 2GAFA 3M4XA 2PBFA 4RTKA 3HCEA 3GRRA 3KPVA 4BP3A 1V39A 4RTOA 3DLIA 2AVDA 1F3LA 4OX9Y 4H0NA 1ZGJA 4PYQA 3HVIA 5CVDA 5GWXA 5GIOE 4FR0A 2OYRA 4PIPA 2PSSA 2VP3A 3M6XA 1F38A 3MGGA 2OPBA 5K01A 2CL5A 2NYUA 4X61A 3BGIA 3OU7A 3B5IA 3HP7A 2E5WA 4CTJA 3C3PA 2B3TA 2B2CA 4RWZA 1R00A 1XTPA 2CWWA 1HNNA 1H1DA 1XXLA 5EZQA 4BP1A 1KPGA 4RTJA 1SUIA 2QM3A 5DTQA 5E1OA 3OZSA 3UJ6A 1XDUA 3CBGA 3GJYA 3I53A 5DX1A 2I9KA 4E31A 2PLWA 2P3QA 1WY7A 1RI4A 2OBFA 3G2OA 4YV0A 2OY0A 4YMHA 3A25A 3UFBA 1JG3A 4K6MA 3RIEA 3DXZA 4R8SA 3FUWA 1MJFA 3E23A 3Q87B 2O0LA 4RTSA 4FT2A 2EG5A 3CJTA 5C1IA 5D1NA 4XUCA 4FZVA 3MERA 2V7EA 5EZSA 3P2EA 3X0DA 4F86A 5K0EA 1WXXA 2Q41A 2FCAA 5DXJA 3KR1A 3GXOA 3PVCA 3ER8A 3C0KA 1XVAA 1NBHA 5KQRA 3OE5A 3QV2A 2AOVA 4RYLA 2NXNA 3A26A 5KYGA 3GRUA 1L9KA 2B25A 2ZLBA 3FYCA 4XCXA 4P7FA 8MHTA 4DCGA 1RJEA 3G88A 3K6RA 1NE2A 4OQDA 1O9GA 3D2LA 3EGEA 4YUVA 1N7IA 2LD4A 3A27A 2BM9A 3G5LA 3TR6A 2P41A 5K05A 4R8RA 3FTEA 4ATNA 1G8SA 3AXSA 5FHQA 5EHIA 1TPYA 1JQEA 2FHPA 2UZ4A 2Z6QA 3FTDA 4CXMA 1SKMA 3LL7A 2OKCA 4AZTA 3KKZA 4OQEA 5F2OA 4BLUA 2UYCA 2FPOA 1EAMA 4FSXA 5DM1A 2P7HA 3G7UA 3M33A 4L7VA 3GRZA 5T64A 3HVKA 4YUZA 4X63A 4C4AA 1KHHA 3FPFA 3NWBA 2QY6A 4BLWA 3BGDA 1XCLA 5LQAA 3SXJA 4Y2HA 5F2NA 5DX8A 5B1SA 4ER7A 3LPMA 4AZSA 2H11A 2AZTA 3OFKA 4ISCA 3G2PA 4E33A 1JG2A 3PB3A 3P2IA 5DRTA 1VP3A 3KPWA 4HGYA 2JJQA 3G8AA 3NW9A 3TPZA 1EQAA 2P35A 3B3GA 5K0GA 2G72A 2QRVB 2YQZA 2ZSUA 3PT9A 3KQYA 4O29A 3UJDA 3HCCA 4RX1A 1X1DA 3P9CA 5CVUA 3I58A 5IKMA 1L3IA 3NDJA 5F2KA 3IEIA 3VSEA 2PX5A 1QAOA 3P8ZA 4GF5A 5CIYA 3R24A 2JHPA 3OZTA 3LGAA 3KQTA 1NBIA 4PINA 3FZGA 3FTFA 3GCZA 1BOOA 5ICCA 3SSMA 3E05A 5E1MA 5HEKA 5K0LA 1NW6A 3SX0A 4CKEA 4E32A 1RI1A 1JQDA 3DH0A 2P7IA 3A4TA 2AOWA 5DLYA 5DT2A 1JTFA 4GC9A 3T0IA 1P39A 1M0EA 4IV0A 4CKBA 1O9HA 4DMGA 5IH3A 3HTXA 4GOLD 4PYLA 3F4KA 3NVKI 3KHKA 4V0QA 4E2XA 4EVIA 1VBFA 4FP9A 5CUQA 2ESRA 2FRXA 4QTUB 4XUEA 4X1OA 3UJ9A 1KPHA 4FGZA 4DM3A 4P7KA 5FWDA 3CC8A 3T7SA 4E2ZA 5K0CA 3ELDA 2DULA 4DA4A 2V74B 1RJDA 4BLVA 4EKGA 2GB4A 3MHTA 4HC4A 1RI5A 1I9GA 3EVCA 3TLJA 2IBSA 1JQ3A 2I6GA 4GEKA 1KYZA 4KW7A 2OXTA 1L3CA 2PXXA 3RW9A 3T7RA 5HIIA 5BW5A 2VDUE 1YZ3A 3R3HA 3DLCA 3ELYA 2IFTA 3HCBA 4IKPA 3UWPA 1NW8A 2CKDA 1AQJA 4P7GA 4M38A 3G2MA 3HM2A 3T7TA 2QRVA 3R6TA 2I62A 3FPEA 5LQRA 1G6Q1 4YMGA 2PGXA 4RVHA 4RTLA 3BZBA 3MAGA 3H2BA 4E2WA 3FUXA 4B17A 3SMQA 2GS9A 2PWYA
chains in the Genus database with same CATH superfamily
1W4ZA 2A7QA 1OASA 3ROZA 4EA7A 1D7OA 3NIBA 4ZN6A 1VG8A 1AN9A 2RKBA 1IB0A 1YKGA 5T4FA 3RRJA 4IGKA 4O2AB 3ZZTA 1V11A 3WNQA 1HDZA 1GKIA 4XFDA 5NLLA 3HM9A 3AERA 1NN5A 1XTUA 1UM9B 1XGKA 2Z2XA 4GLLA 1LF5A 4QUEA 2CCKA 1VKJA 2WV7A 3HGTA 1WLYA 2NVUA 3NOXA 3NP9A 1M10A 1E9EA 2KX7A 3WLLA 2R68A 5IEBA 4YJHB 2CFCA 4M7OA 2XRYA 2PUWA 1E2NA 2PWPA 5LA6F 1OAOA 4ENWA 4MVJE 4O3FA 3UGKA 3JATB 5I8WA 2VPZA 3CMMA 2J07A 4HDNB 2ZDGA 2P0EA 4N5IX 3CONA 1V37A 2Z1NA 4F45A 1YZNA 4JLJA 2HJWA 1TL7C 1XSEA 3OZBA 5B6PA 1AZLA 1CTQA 3K30A 1M1NA 4G0WA 2ZSBA 2G6TA 4Z53A 2WYOA 4MIKA 1HDIA 3OIFA 3HB4X 5E9WA 4HRYA 1A82A 1DUIA 1I6WA 4TL7A 2HIHA 1PKXA 3L7LA 4XPIB 4CLRA 3MWKA 1P0MA 4PCAA 2RK3A 1UUFA 4JAVC 1IOVA 3TX6A 2A9VA 3UUEA 4CM5A 4PAOA 4OO3A 4DLAA 4GGOA 4OLBA 1WE2A 2DUMA 3AI7A 3KQUA 1NV9A 2AFHE 1PYOA 5M2QA 5FKJA 1J7JA 1HDGO 3VR3A 3K32A 4AQDA 1N78A 1W581 4LY0A 3DOHA 1F0PA 1TMGE 3MJRA 2G9NA 2QP3A 4HVTA 2RGCA 1NPDA 1KH2A 5CLIA 1IHXA 4U6SA 1PIWA 4LECA 4O3MA 4CYMA 4PSDA 1SBZA 4AP6A 4EHIA 2A9QA 5JATA 1R6BX 1DUSA 3IXQA 4MV4A 1XWWA 4YASA 2I6FA 3RC7A 1V7QA 5CXUA 1ND6A 2JBAA 3PVSA 2JLVA 2VLIA 3CXUA 3E2PA 5A3SA 3ILXA 3ZHBA 1EDEA 1UBOS 4F7WA 1H6CA 2ZUWA 3TGLA 3BK1A 3N0WA 1UXGA 4L6CA 4BGVA 1KDTA 2TECE 3NCTA 3PDIA 4R5HA 3JRXA 4HDAA 3OWXA 4LRWA 1EAYA 4OJMX 2YINC 3FPKA 2HOQA 1QB7A 1DCTA 3DHEA 1SVIA 4MS3A 3OQBA 3LQYA 5A6VA 2ZU6A 3FYDA 3BHIA 2OCDA 3FYTA 4MV6A 4BUCA 4FFRA 1IJFA 1ECBA 1SWWA 2DBRA 4FZ3A 3RSOA 2V98A 4S35A 2NADA 5L7WA 4G09A 4RLSA 1O57A 4RPHA 1QMPA 4AF6A 4G5SA 3GJ5A 3BKWA 4YRBA 3FHCB 1TCAA 1N6IA 1O95C 2J4CA 3I8XA 2UYYA 3D4NA 3NDBB 4IY1A 3DLPX 1EU1A 5H4HA 4C7OB 3KJFA 1LC3A 1A9QA 1E66A 1OH7A 4WLFA 2GAJA 4F2HA 2YJ5A 1DJPA 1WG8A 4QGSA 5AFSA 3SOZA 5ALXA 2J4FA 1FNMA 2O57A 4MPJA 4UM8B 3LOPA 5DXFA 4ZGGA 5CR9A 3KJHA 2A1UA 3ITDA 5G4KB 2B8WA 4JENA 3WKAA 4MPTA 4MHOA 1U02A 1VLJA 2OBLA 2O7SA 3HA2A 4EL5A 1C4XA 3T61A 3TTXA 5CT5A 3KUKA 2GZ2A 3UXHA 1RADA 2QTWB 3UJ7A 1KZYC 2RGYA 3WNZA 2WJIA 3E53A 1I5OA 2WTAA 4C4TA 3KOWA 2ODEA 5TPZA 3IA7A 4TTRA 3EIXA 2VSFA 1O9BA 1ADCA 1NVUQ 2OD2A 5DFAA 4EGCB 4RVDA 1QGDA 1U8ZA 2C4WA 4RV9A 2H5JA 1TAGA 4GE3A 1U8XX 3ZW9A 2BJWA 4COOA 3CINA 4FGLA 4NEQA 1QCZA 4NJEA 4XB1A 4LAFA 4IYJA 3SXPA 5B12A 2F2TA 3I62A 3ZOKA 1BRMA 3THYA 2IHJA 3GG9A 3NGXA 3IA2A 1Y7LA 4FMDF 2E89A 5C5DA 10MHA 3ZI4A 1W75A 4JI1B 1CVLA 1XZPA 3OFJA 4M1SA 1QCDA 1M6EX 2C8KA 4AI6A 5BV2P 3UH1A 1U0TA 1DQPA 1JSZA 2M2IA 4C0WA 1OBOA 5JDIA 2P78A 4JK3A 4YP9A 1FFHA 3Q3HA 2PJUA 1S4QA 4IS2A 1RHMA 2WAAA 3VSBA 3VR6D 3CLTC 4NBTA 4U2BA 2Q4DA 3GIWA 4H6XA 4EM6A 3FG9A 4B3MB 1G5HA 1Z5NA 3GLVA 2POQX 2VJDA 5HMLA 2ONZA 4TSRA 1M5TA 4OBWA 3LUAA 5KI6A 1F4PA 5JJBA 2J45A 3NBXX 4YWJA 1OB2A 4U5XA 2WYUA 4WKNA 2IOHA 3BJMA 4G0VA 5IBRA 1E6KA 4MRMB 1MC1A 3PKJA 4G84A 5E8RA 2Y9MB 1YKFA 3EZYA 5EIWA 3VI4B 3MPUA 4Z51A 3DDNA 4V0ME 1GZUA 4U9IS 3U7JA 3VH1A 3PCXA 1WXIA 1ONBA 3FFAA 2I66A 2W6ID 1XNRB 1G4HA 1ANKA 2YYYA 3D3EA 3S70A 3WMGA 4IRUB 4G4IA 5FD8A 2VA8A 4D9JA 2PFKA 3KVOA 4INZA 3KXPA 5CFMA 4JKIA 1EWKA 4NCNA 2V7PA 3C3KA 2AOXA 1ADYA 2C4KA 1ZLYA 3DCYA 4JR1A 2G4VA 3B2QA 5DSTA 3GELA 3ZWMA 1PFUA 2FE4A 2JIBA 3NEPX 3O74A 1CZUA 4FFBA 4TXHA 1E2PA 1CYEA 5A9RA 2HAEA 1ADFA 2H06A 1D1QA 3NOQA 3OFVA 2AXNA 4TSFD 5CDHA 2I80A 5L4LA 4R2IA 1QXSA 2ZIUB 3BGOS 1F8GA 2QP4A 4KMRA 4EJ0A 2CMGA 1QOPB 2VYND 2XYQA 3SDSA 3Q10A 3K4PA 4P80A 1GQYA 4C14A 1W46A 4Q3BA 2HBRA 1UP6A 1GAXA 3OSUA 4Q12A 2O4CA 1ZP6A 2JVIA 2RARA 3EDRA 3MYRA 1FLNA 3PXXA 2OWDA 2IIQA 4YRPA 2Z95A 3TINA 3VR6A 5I7HA 2QN6A 1RWBA 2ZWOA 3BXFA 3C5CA 4L3WA 2JATA 4TM7A 4TLCA 2FPPB 4CM4A 2C4UA 3O0TA 3X2FA 2FOLA 4PGAA 3OT1B 1EA5A 1U5BB 5TLSA 3PPVA 1Q74A 1XQYA 3T5DA 1G8MA 2Q5HA 1WNTA 4B2LA 4OEHA 1C1XA 1G5PA 4LY3A 1PQYA 3HBFA 1XMVA 3K2EA 1JL3A 3L18A 3ONVA 1TQHA 3PDJA 3PSAA 3GUHA 1A8QA 1M2VA 3N2EA 4JBHA 4LJKA 5LXTF 2W6IA 3MUOA 2E7ZA 4M8KA 1J07A 2QR2A 4H7DA 2NZ2A 3AUKA 1Y1RA 3PYXA 3UC9A 1A3CA 1TIPA 3U80A 1J2JA 1M2OA 4B83A 2ZRKA 1V8DA 1WXQA 2JGFA 1DBIA 2VF5X 3QHPA 2L17A 5D3MA 3TLEA 3ZLJA 1C4OA 4LY9A 1T4CA 1SOMA 1D0SA 1EBFA 2YY7A 1GGMA 2G28A 5CG1A 4Z4FA 4L57A 2VTDA 3NYIA 5DOZA 3RTBA 1QPBA 2YFYA 1QKIA 1Z2CA 5HK9A 1SQ0A 3EQZA 3WWDA 1NG9A 4A2CA 5IJWA 4WLUA 5KWJA 3CH5A 3C3JA 1I3OA 3U6BA 2D59A 3F3SA 1YWGO 1Z6GA 2VYNA 1G2IA 5B5SA 1JVNA 4JYCA 4UEKA 1KAGA 2DCUA 1Z5GA 1R8XA 4LMRA 4B47A 1WOMA 5B30A 3W2IA 3EJWA 1ZGZA 3P0RA 1SCAA 2P9GA 3B9RA 4DJDC 4DY4A 1UBRS 3IVGA 4KX5A 1AS3A 2WAYA 3E7XA 5HUJA 2QTLA 2HF8A 1BKYA 1JWBB 2D62A 4MNTA 4EUSA 2FP3A 3A6KA 2H1RA 3CTMA 2VLBA 3PXAA 1AX9A 3Q12A 5E2BA 3N2GB 2GAAA 3SFVA 3EFHA 3PD1A 2QYHA 2LUOA 1G0OA 2FYTA 1TIBA 2WSYB 3MUNA 5I7AA 4JELA 2BDUA 4AYWA 1ONPA 1M0EA 5EPEA 4J7AA 3H05A 4JASB 4PRZA 4H18A 1RLMA 2P9CA 4OHBA 4BO2A 2OD7A 3UGQA 1M73E 4TMXA 4NBKA 3ZZ0A 4BO5A 1L7DA 2BWJA 5F78A 3O8QB 1O94D 4OFXA 3V4VB 4U2FA 1DQNA 2CHEA 1UZLA 2G7ZA 4URYR 4PNEA 1F2VA 2WB2A 2VAVA 2WD9A 1N6RA 2XAAA 4ON9A 3I0ZA 1D03A 1K5HA 3I01A 2MR6A 3KYJB 1M2WA 2QDXA 1BGWA 1PD1A 3ANXA 3P97A 4CL2A 1QFSA 2FSVC 3MJFA 1PTKA 1MO6A 1Q3HA 1FMTA 3UAWA 4BNFA 1C7ZA 1EUDA 3U3JA 1A27A 1MQ8B 2E4VA 4OX9Y 4DOMA 4LCEA 3HVIA 2YMPA 3CRNA 5CB4B 5DYYA 1U1GA 3WE7A 5F4BA 2OESA 2EARA 1H5QA 1V3VA 2POCA 1DS6A 2O7NA 1FU4A 2XUHA 1RC8A 1L5QA 2OAEA 3G5MA 4BP1A 5DW3A 4G1CA 1WQ3A 2J9GA 4XLLA 3VTFA 2DGDA 1XLWA 4K5QA 1J42A 4F5WA 5J2TB 3I52A 3KFVA 2E4AA 3FNQA 4P2BA 1N2SA 4QDOA 3ZCXA 4LFAB 2FSPA 2XB8A 2WD7B 1FFXA 1W85A 2WV9A 1FQWA 1VI5A 2VBCA 2XEXA 3E8MA 1RQGA 3EXHA 3PXBA 3A25A 3I30X 1XF9A 3NRCA 4B7XA 3FUWA 4CEIB 4GGPA 3IAS1 3PV0A 1X7WA 1TMYA 2TMDA 3E15A 2XGGA 3RSZA 1O94A 5D1NA 4ARAA 5ES4B 4YJFB 2L18A 2WTNA 1E69A 1YHYA 1R1DA 1TT5A 2PRKA 4K9RA 3TIFA 4MYDA 2MYNA 1H2FA 3CIFA 1DEKA 3FD8A 1DJMA 3DDUA 3L7AA 4L4SA 5DW0A 1J21A 3V3TA 4EYOA 2QL6A 1WSWA 3S5JA 2FZ5A 4UBJA 2XUAA 5JO9A 4Q4CA 2PD6A 1L9KA 2QQEA 4KOAA 4YAEA 4W1QA 4ZVUA 3RS4A 1LJUA 4IX9A 2RIPA 4JX8A 1SBTA 1I2AA 3EBPA 3GGSA 4Z0PA 2OGTA 2YJ3A 2R6GA 2AI3A 2DY1A 1E7MA 3D2LA 3UCXA 1EJ2A 2WWVD 1YRBA 2J30A 3A27A 3TR6A 5CBKA 3AFGA 4F71A 4UE6A 3CRQA 1WU7A 1HEUA 2EZUA 2X5KO 1E1QD 3KWJA 2FHPA 4RKQA 2DERA 5JPIA 5IAGA 2P2YA 4O4JA 1QV7A 3MOSA 2MINB 3L7NA 1CY7A 3JARA 2X4LA 4REOA 1J8QA 4R51A 2VL7A 1NRXA 3ADDA 4TN1A 5HUHA 3NWBA 1B1AA 2C0PA 2FPXA 2HDNB 4XI9A 5DWDA 4BLSA 1I1OA 4C0XA 4CLDA 5BWMA 1Y6ZA 4M22A 3WV5A 4QU8A 2FFQA 3QF4B 3ZDYB 2C7GA 4BB5A 2ZUSA 2CDRA 5JPDA 5JQGF 1T5SA 4KLZA 3UMFA 2WQZA 3N6VA 2Z8XA 2PUJA 3Q11A 2QZPA 1F8FA 1I2MA 1ZCBA 2ZEJA 2V1XA 2C5GA 2RGXA 2VA9A 1XTIA 3CS3A 3CWZA 5C5IA 4HF7A 5BOSB 4YN3A 4M8LA 1JPNA 2P2LA 3RSLA 3ZWCA 3QITA 2RGDA 3CN7A 1QS0A 3C3WA 3L0OA 2QUHA 2W9XA 4MUAA 3FHTA 1IK4A 4WCFB 4BXOA 5M7EA 4GP9A 5I7SA 2EW8A 1OIVA 1XCPA 3FBTA 4FPXA 4L7QA 2PKYX 1DPGA 3ICVA 4NMHA 2O8FA 3DGFC 3WKDA 4JV5B 1GG8A 2QN9A 4B32A 2JCYA 2XNHA 1XFDA 5B53A 4WNIA 3GCZA 3V7FA 5JMOA 3VZPA 2PA0A 2EF1A 4IV5A 4XVUA 1OWOA 3WGLA 5GZ3A 3VH4A 2GILA 2OC9A 1T0PA 2BYTA 4IO0A 4PS1A 3LWNA 1E2IA 5K3EA 1TF7A 3I34X 4ES6A 1E1QA 4IDQA 4P92A 5HGXA 3IR6A 2EWWA 4KIUA 4UQOA 1X86B 1H22A 3QJ5A 4ND3A 1CQXA 4TTIA 4U63A 1NQOA 1TB4A 4C2AA 1T0IA 2AB0A 5LUAA 5H3LA 2P9TA 1V4NA 1UMCA 4JB8A 4WK2B 3T3PB 4DCNA 1JG6A 4OHVA 2VSYA 3ICWA 3LRXA 4OHXA 3ZQJA 4ZPJA 3RRZA 2A94A 3TVYA 1M6VA 4Y3UA 2WFLA 4LZOA 4XIJA 1ETUA 3AFMA 1D1SA 2RJ3A 5FBLB 1YZ3A 4BNWA 3TS1A 2HA6A 3B1XA 5AW9A 1L9XA 2DU8A 2JEZA 3IUQA 4DYDA 2OSVA 4HAWA 3RTEA 2CL7X 1RVDA 1QG0A 3PR3A 3T12A 3CW8X 1A7AA 4A82A 1X7GA 4URXR 3JD3A 3LT0A 3B5JA 2F67A 4JFRA 5LYJF 1GA6A 1E1LA 3GBSA 3H0KA 3WRWA 3VV2A 1HYGA 3C5VA 2Y1LA 3R7WB 4D0SA 2FQQA 4IJ5A 4ADSG 3A4NA 2PMEA 2BEVA 1M8JA 2I29A 4JKOA 4K1XA 4P08A 3S2GA 2QYTA 4XM2A 2VP6A 3GJ6A 4PYKA 2Q5QA 4MB6A 4C03A 5HM8A 1Y8ZA 2P0YA 3OVMA 4UNSA 2PL9A 1WX1A 3NPAA 1GUYA 1LRLA 4IAOA 4FC6A 1A2QA 5B4TA 5T41A 7GPBA 2WUDA 5AM0A 1RWQA 3U1TA 4GYJA 2RI6A 4IXNA 4F5EA 1L5RA 4DWVA 1NWCA 3JQAD 1GEEA 3P32A 1U8YA 3LECA 1VFNA 2V5AA 3DR5A 4I1VA 1EFPA 3T9DA 3VOTA 4BBZA 3GLSA 4GKVA 1VLVA 3TZQA 3OPMA 3ZXYA 9MHTA 1NC3A 5SICE 1R0ZA 1SVUA 1TMKA 2D54A 1NQ5A 1WF3A 3ABZA 4RKYA 4JQZA 1KI4A 5EQFA 2BL4A 1OY1A 2QVGA 2Q3DA 1U2ZA 1OKKA 2L82A 4R2JA 5B1EA 2NSJA 2BZGA 1DRVA 5A4IS 3GWZA 4LZZA 2GPBA 1THMA 4LQ4A 5ALYA 5P21A 5LPNA 4NXMB 1YBHA 4TLAA 2AWOA 2LE0A 1RQ7A 2VHJA 2NQ8A 1TQ4A 1EFLA 3IJRA 2E9SA 1NONA 3A4IA 4OBXA 4Q0MA 4MIOA 3W7VA 1Y9AA 4JBGA 2IZZA 3EFEA 4AXBA 3AKCA 3QVLA 1E8NA 2Q46A 9LDBA 1UFQA 2Y0DA 4R71A 3WRYC 3VH3A 1ZRHA 4QYWA 1JEQA 1Z16A 2A67A 2BMWA 3L4BA 4PG4A 1OFIA 4ALMA 3H3JA 4WBNF 3QYPA 1KK2A 2GPAA 1L4FA 2IYFA 2G8NA 2FWAA 6REQB 2DLDA 1E8DA 1ULBA 2G9RA 2RB4A 5AKKA 2NO9A 3CRMA 4KACA 3DVRX 5FL7D 1UEJA 3H75A 3LUGA 1WCIA 2QBYA 1MN6A 2HPAA 3QLVC 5JECA 1QIMA 2O8BA 3C4JA 4HLDA 1TADA 5FTLA 2B83A 2Z08A 3JQAA 4LQLA 2GO1A 2YJTD 5FTWA 4F4FA 5LZ2A 4KJZA 4XIFA 2R8XA 4EEKA 1XZJA 1KSFX 2J3JA 2BT4A 2EX0A 3EY4A 4K8OA 4MINA 4RKWA 3A2KA 3PQCA 2ZQYA 1YZGA 1T5LA 2GHTA 4UTRA 1X42A 1NBWB 3EQ2A 2V55B 4D26A 3P45A 2OHHA 3NHRA 4AN4A 1QHFA 1CFZA 2Z6VA 4R6WA 5FPHA 3BMOB 4DDHA 2AOTA 2PLRA 5IXSA 2VJNA 2FP4B 4N3CA 1ZINA 4NWIA 4YT4A 4RKRA 3UK6A 4MVJF 5EMNA 3STXA 1S8NA 3RYIA 4D79A 3BIOA 4XWAA 2DQ4A 4GFDA 2F8TA 5FOWA 1U8AA 3I9MA 3KSRA 5ALQA 1J20A 2H2AA 2ZSFA 4JJEA 2W37A 1NXTA 1CR2A 1MOSA 3CWCA 4YPFA 2IYQA 1JTVA 4RULA 1HL3A 4NAVA 2UVDA 1I32A 1O89A 4NBLA 5EOVA 5JW6A 4KWCA 1FBNA 1Z2NX 5CJ2A 4WZZA 4CNQA 3N87A 2FWMX 3BZWA 5FHRA 4MQUA 3UAOA 5DI9A 1C4WA 5BWLA 4MQBA 3DZKA 5FL7A 3U4MA 2FZWA 3H2KA 1OAOC 2CFIA 3NVDA 2IELA 4KTTE 1FJGB 4R9VA 3LDGA 2RD2A 1XB2A 3RTGA 1U31A 3WIUA 4DB2A 2DJIA 2ZUUA 1AUPA 2DR0A 2VHWA 1NJ6A 4HATA 1X7XB 4RXUA 2I7XA 4FI3C 3RLIA 4B6EA 4TYPA 2FEWB 4YRKA 1EDOA 1LBSA 4HG2A 2PNFA 1RM5A 1DINA 2OV2A 4A8JA 1IH8A 5L7YA 2RGGA 3WGOA 3CVXA 2ASVA 2IW1A 3KT6A 1GTL1 2MMGA 2NU9B 4BVLA 1DDGA 5E7IA 1SK9A 2WP8J 3TN7A 3MRSA 3V4FA 1WEHA 4CM7A 1GPJA 1NW4A 1S2MA 3CZQA 3MT9A 4E70A 1LDEA 4LZPA 4UM9B 2VVTA 2NYVA 3BWXA 1H6BA 3PNYA 1YNOA 3OPNA 2FR8C 1BE1A 1EMDA 1V3TA 3LC1O 4O4HB 2VPWA 4E1VA 5L3VA 1NAIA 4H7JA 2RBGA 1I7NA 4KV9A 3HV2A 3RWOA 2HMYB 3QBDA 1QQ7A 1YD7A 2Q1YA 5F64A 1UIRA 2GWRA 5D85A 2QLTA 4QEZA 3OBBA 1YR3A 3OWOA 4ZDJA 3FNGA 4HWKA 5BN5B 4D3FA 2XNDD 5EUMA 5CB6A 1ODLA 5AM4A 3VAZA 4NECA 3KEQA 4WESB 1K88A 2GK6A 3U9TA 1E2DA 1Z0DA 1XEWX 2PL3A 2PMFA 1GCGA 4JUCA 4BL5A 5M3BA 5A3VA 2QTGA 5IKOA 4DF3A 5AW0A 1CQIA 1R0SA 4DBZA 4YMTA 2OO3A 3JZFA 5BURA 1E2LA 4H77A 2YWXA 4OIMA 1Y5MA 3UC5A 3L77A 4V0RA 4MHTA 4DLUA 1C9DB 3OH8A 3SEFA 1Q0RA 3GIDA 2XCQA 9GPBA 1PRYA 4TTAA 5B58C 3I9FA 5H9VA 5LLDA 2NPIA 5C46F 2GHRA 1B8NA 4DL9A 3JYNA 5IDYA 121PA 3OT4A 3TRDA 2B20A 2HX1A 3RTAA 1JBEA 5HFNA 3I5UA 2XB9A 3NQ41 5B6JA 5BV7A 5KTNA 2V45A 1HDEA 1RQ2A 2OZPA 3SKVA 5CYOA 3VNRA 3PITA 4IEFB 3A6LA 1U04A 1XHFA 2ZWAA 4CT0A 3N07A 5BSWA 4EYQA 2DPMA 3IP5A 1TJYA 3CWQA 2GF9A 4BE4A 5K8TA 2D5BA 4G1BA 4H31A 4ZCQA 3E18A 4CFYA 1DFGA 3V8QA 4NCKA 2WJHA 3R6GA 4GYYA 1L5HA 5JVDA 2YXNA 2IL1A 4H0FA 1NW3A 2XNDA 1PI3A 4LGYA 2GPWA 3WBBA 2E1RA 4P54A 4DY6A 1SHZA 2IGBA 2VT7A 3S1SA 4BUZA 3DZJA 5ADHA 1GL3A 1JQAA 2FUG1 2TMKA 1H5NA 4CWAA 4U7DA 2M6SA 1GYPA 1ZSNA 4U2KA 1L5GB 3EEBA 2XTAA 3DAHA 4KXFB 1E2GA 1Z45A 3U61B 1N2IA 3HJBA 3M1LA 3LXRA 1USVA 3IVCA 1QC5B 1U0OC 2CLLB 2JAXA 3E3NA 2WM3A 3MXOA 4EVSA 3HU5A 1EK5A 1NYRA 1RWOA 4OFBA 4F9EA 4JVSB 4HJXA 2XKAA 1DG9A 1VPTA 2DHCA 3BTSA 3P4UA 3BGWA 4ZV4A 5B3JA 1GIAA 3R0JA 3BD8A 5CJJA 4AUEA 2V5VA 1YL6A 1K5DA 3C45A 2P3OA 1SXIA 3L8DA 5CT9A 5GZ6A 1SBIA 4O1HA 5DO9A 5G02A 1JXAA 4W1PA 1J22A 1Y3BE 1JAYA 1XFAA 3LX4A 3N74A 4DR3B 3PEYA 2MYUA 2HJVA 3JCZA 3MWDB 1XZMA 3QU7A 4UXHA 4ZVLA 4EG5A 1F8YA 1LX6A 4NE2A 4PYIA 5EIFA 1ENOA 1Q3TA 1KQ3A 2X1VA 2XLBA 4PYOA 5HFAA 1XVUA 4WFKA 4EYKA 2IYXA 1LB1B 1AIPA 4JJFA 1ZGCA 1TTHA 4GOOD 2DWQA 4HNRA 1L7RA 2QDKA 4MO9A 3AVYA 2GVZC 5HS6A 1URPA 1QOQB 2ZUTA 4ER3A 1WP9A 3TIIA 1ZJYA 3C1UA 1U98A 2RI0A 2C84A 3CKMA 1O96A 3IUEA 5IULC 2QYOA 1NQAO 2UYOA 1P73A 2FFAA 2OHOA 2X8JA 1L1FA 3SU8A 1HTBA 1Z28A 5JC1A 1QH9A 3C48A 3MTGA 5DP2A 2QSUA 3MVEA 3UKJA 4IDFA 3LA8A 2PXCA 2VDVE 4ARUA 5BNFA 2D4HA 1ZL2A 4TQAA 4YV7A 2ZETA 1CEEA 2ROQA 2JFGA 3LCRA 3QFTA 4WGFA 4BMDA 5EIBD 2KSQA 2P1RA 2OR3A 3ZJ5A 1XMJA 3HUEA 1VE1A 4U2DA 3SHVA 1DO0A 3V2HA 1UDXA 2D5LA 3O1IC 3RGWS 1APBA 1N9ZA 1P91A 4NULA 5CA0F 3I0NA 2YN4A 2CBZA 2Y4NA 4G25A 3VUFA 2QN7A 3CPJB 3LYHA 3I2HA 3UF0A 1C7RA 1R7RA 1A50B 2XJ9A 4LZAA 2QXTA 1GRVA 1IVYA 2QTFA 3IPXA 1JEYA 3N8NA 4ENSA 2ARKA 3MTIA 4OJQA 4Q47A 3STUA 1ZZEA 4WJZA 2IEAA 3P94A 3IDAA 5E9QA 5G0VA 3WRVA 1A8UA 5KVAA 2FXIA 1PNRA 1GPWB 1ZN9A 2VH1A 3MCWA 3U3XA 3VM6A 1QIKA 5EL0A 5FUVA 3H0CA 4JDUA 2J7PA 1PX0A 2Z2ZA 3TBFA 4RTKA 1P81A 3R4CA 3N3AC 1T9CA 1T2UA 4IIGA 1V39A 3OZXA 5DNUA 2IHUA 2Y68A 3DBLA 2P6MA 3WGYA 1QP8A 1LNZA 1S9DA 3S1LA 2C04A 1B3RA 5H4GA 5HCIA 5BRAA 1I2ZA 1Z33A 2FMUA 3L8EA 4FR0A 1LXCA 2OYRA 4EI7A 4EG7A 4C7OA 1KS9A 2D1QA 4GNRA 1KJIA 1DT3A 4HZIA 4W6QA 5K01A 2FUEA 3ZEIA 4X61A 3L5KA 2JI7A 4LHYA 5J2UF 1AXRA 2BFBB 3QVJA 5TF4A 2GWHA 2PZGA 3CXRA 3K73O 5DHSA 1K68A 3W9UA 4EB6B 2PYZA 3WMEA 5BORA 2NW6A 3WOVA 3OLZA 2ZCVA 1B0PA 2G40A 1T6BY 2IWRA 1USIA 3LK7A 2EATA 4KDFA 4U7FA 1ZH2A 1F0NA 2NV0A 4R8LA 2GSWA 1ISFA 1RYFA 3KLOA 1RI4A 4YP6A 3AF4A 3OZWA 3B6MA 1AY0A 2P6OA 5EJEA 3BMNA 5JXIA 2JGDA 3E23A 3UW3A 4AP5A 4C3ZA 4HQ0A 3VU8A 1PSDA 1FCJA 1E3QA 1QHSA 2W43A 4LN1A 1YA8A 2Y2UA 1YBMA 3ZV7A 1AMOA 2DB3A 1E7YA 5BMOA 4DR6B 3FGNA 2E6UX 4JP8A 4YTEA 2Y1EA 2YH2A 1MAAA 5JH7B 3ROPA 3DW3X 3ETEA 4DQUA 1QH0A 5ELLA 3KR1A 5ER6A 4KO8A 1HFKA 1JR3E 2XRMA 3F67A 1GA4A 1GPBA 5KQRA 4UVIA 1YGYA 1OXSC 4B48A 3DZCA 3RVOA 4HGPA 1OI2A 4INAA 4MWEA 4RYLA 4Z1OA 1UC8A 3E82A 3L1IA 3PRYA 2HPVA 1BCSA 2MU1A 5BUZA 4MGKR 4KO3S 5KNBD 3LQ2A 4D6YA 4EB8A 1TO1E 5LMUB 1GQSA 2I87A 1H69A 1V1RB 1FUEA 2LNDA 3FDFA 4DIFA 2ZI3A 4NJMB 3GZNA 4EZIA 1U8CB 1AUXA 2VYCA 1P17A 2DUJA 1OX4B 2OMKA 1DJOA 1OZAA 2OG2A 3ENQA 3RUEA 4F3KA 4ZI7F 4N7RA 1XEXA 2W7TA 1QOZA 1JVSA 4OHRA 1V8BA 4RDCA 1SKMA 3ETCA 1W88A 4PU0A 1VBMA 4BO8A 5ALVA 3T5PA 1EX7A 1W1WA 3ZCVA 4D80A 2FLWA 2WJGA 3HBAA 3M33A 2R9VA 2GM3A 3HVKA 3L02A 3PUWA 1BWPA 2IE8A 3HCNA 3FPFA 5T64A 4A2QA 4C4AA 4BU1A 3CPHA 3ABQB 5LVAA 4ZQFA 1QG6A 4R2KA 4ILKA 5FUMA 3O9ZA 2F6RA 3GVIA 2AW5A 1BX0A 1ODTC 2FETA 4KYUA 2O3TA 2CXHA 5B1SA 3LPMA 3UHAA 5MGBA 1GTRA 5ARCA 3H6KA 3TPCA 4KYIB 4ZV9A 5IBCA 5AVWA 3QNUA 4WX2B 5I7UA 4RY2A 4EGQA 1C2TA 4YRIA 2VR1A 4UTVA 4J94A 4UUPA 1L4UA 2EFYA 2Z3WA 4AX4A 4CLXA 2E85A 2KB0A 1SXHA 3K9WA 2YQZA 1K1EA 1SURA 3CN9A 1MHPA 3MGAA 5FNVF 4RM3A 1OBCA 4JB0A 2C4VA 1KI3A 4KR0A 3ZDXB 3DFIA 1WLSA 4Z3KA 2O6LA 3SLKA 3KU4A 1QKJA 2WG1A 3E22B 1BOOA 2J7KA 2OHXA 1NKTA 5E7JA 3FBWA 4ZEXA 3HJNA 2ZT8A 2C9MA 4O4LB 2JJ2A 3QEMB 1SCKA 3BRQA 1U8UA 2AEEA 2JAPA 1O94C 3GEIA 4FGJA 5GAJA 3TGPA 5UKDA 4OHPA 3LXMA 1RTKA 4WNAB 1FYXA 4X8LA 3RS8A 3AHDA 3IE2A 1XVLA 2BE9A 1P2GA 2G76A 4N8SA 1CQJB 1VBFA 1NULA 5I9NA 1ELOA 3JQ9A 2D8AA 3Q9UA 4FP9A 4XLTA 2YXPX 3IERA 4XUEA 3UJ9A 1KPHA 3ETLA 1MV5A 4FGZA 1LZKA 4L28A 4Q9NA 4F5DA 4E2ZA 3NNNA 1Q21A 1PS0A 5D3QA 5AK6A 3WFIA 1JIIA 1VGVA 5AK5A 4ZU3A 2QR5A 3SJCA 1EE2A 2JW5A 4EKGA 1TEXA 1YRHA 4D82A 3KKLA 4ZAWA 3TLJA 5FR2A 5JT1A 2I6GA 3LTNC 4GEKA 2ADOA 2V8BA 3V4ZA 5LCXA 1MNQA 2AI1A 2KHZA 3B7WA 3MWEB 5F4ZA 4CF4A 1U7ZA 2PKEA 2QPAA 3MT8A 1W6RA 4YJDA 1CJCA 3RRYA 3TIGA 3PPYA 3UWPA 3D3NA 3KJQA 2BJVA 4H16A 3FXAA 1DRKA 2IPOA 4FGWA 1Q84A 5KAMA 4FU0A 3FDZB 4MVJI 1KWGA 1CUAA 2XWPA 4KLNA 5G0UA 3WHKA 1QX3A 4IXMA 4RTLA 1NVDA 1R9JA 1V4BA 4G2NA 1CF2O 4OQZA 4Y2YA 1ZU4A 5IJ9B 4Q03A 1JAZA 3W1WA 3DXFA 3CVOA 3JZIA 4FYYA 5EXEA 5HKLA 3R5JA 4OYYA 4RTMA 2PY6A 1UBKS 4LZLA 4ZCIA 1R5BA 3QYAA 1V0JA 4RACA 1NUPA 1BXZA 1XJCA 1Y33E 4NQZA 2C8LA 3E9NA 2H6EA 4GZLA 1T0BA 3TL6A 4BHTA 4EGSA 2Y92A 4QBIA 1JKIA 5AI4A 1YFJA 2GK4A 3CLRD 1E1YA 2I1LA 3Q7PA 3RIYA 3D2BA 3W3ZB 5CLFA 1SZPA 4AUNA 1Z2AA 5H16A 4DSUA 1XRQA 4V3BA 3QVXA 2P2ZA 1GL7A 2VKQA 4ER6A 3OUZA 3HDVA 3WIVA 5IN4A 5I8PA 2B21A 2YYAA 3PQ7A 4DMRA 3BWDD 3ESCA 3GNQA 4PANA 3OE4A 1PFGA 5THKA 3SK0A 4L8FA 1K4YA 4L27A 3LOQA 4RK4A 1CUUA 2ZYVX 4IXTA 3W79A 3FTPA 4IIEA 5EKUA 2YIJA 2YV3A 4RZQA 4I2NA 1V1MB 4MV0A 5DSXA 3C6KA 1KKUA 2FQXA 3DONA 3U9SA 3BRWD 2IUEA 2O9JA 1FDTA 4PG7A 4RL6A 2IHVA 3CLKA 4X8MA 3JQRA 3U3OA 1ST2A 3KV3O 4WLNA 2BBOA 3DZIA 4AU1A 4PYNA 1OZ0A 2ICAA 5CB4A 2HJSA 1RTTA 1QV6A 4IHJF 4D98A 1K06A 4Q3OA 1VA5A 1DBRA 1YV9A 1IN4A 2VUIB 2QV7A 1A9ZA 4F4CA 3QWAA 5KOJB 3C43A 1N57A 1VIMA 2AFHB 2YC2C 3HCPA 3PNKA 1X13A 3KUDA 1CK4A 4FWBA 2NXWA 4A16A 2EJWA 4F85A 1M7HA 2J48A 2AJDA 1LLQA 3NKVA 4OK3A 1MRZA 5FX2A 2X0NA 3MF4A 3MAAC 4HLCA 1Q5PA 1CZNA 1SUAA 3FVWA 3JR7A 4OU5A 5EQTA 1GZ6A 1R74A 2VCEA 5IYZA 1XIVA 3N1UA 1RAHA 1LDMA 4OMUA 4IPTA 3ELWA 1GNQA 2OZEA 4P4TA 2PZFA 1J2TA 2QTHA 4CM8A 3Q2IA 1IBRA 2QTMA 3WMFA 4D42A 5COAA 2D4AA 2QROA 3D7MA 4RABA 1ZJ5A 3JVUA 3QHQA 1BC5A 2DFPA 4G24A 4C76A 3OQIB 4QOJA 2O52A 1TZMA 3D0OA 1OBVA 4OQNA 1RIFA 3A32A 2JL1A 2PVCA 2J08A 2NSHA 2Z5LA 1LPPA 1J9EA 3AX6A 2FN9A 2VPYA 3BRWA 3PCTA 3DUFB 4MPRA 2QRMA 3B8HA 2EYQA 2BUCA 2JFVA 3F6RA 3DS8A 1JLHA 2JHAA 4PZ9A 2CV0A 3AIKA 2X5OA 3N2ZB 1CPYA 2ZK7A 4KYTA 4EHJA 4XPZA 3IT3A 5ECWA 4DLWA 1VJDA 1XQ1A 1SXJE 4D4MA 2JCVA 3NOVA 1RAIA 2HJHA 5EP3A 2C78A 4DLXA 1EVLA 3ONDA 3TTUA 3BQMB 4IIFA 5GADl 1Y8CA 4UUOA 1J8FA 2CMFA 3H9BA 4BAGA 5FNZA 2BFDB 1D6JA 3ZE6A 3ZR4B 1ZXLA 1OA1A 4K9OA 5F21A 5DB4A 1HQCA 1NU8A 3OQJA 4JOBA 1V25A 3HY3A 2I4RA 1XQVA 5H82A 4DNXA 4MW5A 1OWLA 2IC5A 2AZMA 4HLUC 4MR7B 2GBGA 3WKCA 3ZXSA 3Q7RA 4JQOA 4O33A 1RP7A 4EBBA 5DGIA 5HHTA 4TLMB 1A4XA 3QF4A 1XQWA 2UV8A 1E4OA 4FBLA 3RIGA 3NHFA 4JOSA 2FTKE 1REQA 4ED9A 2FN8A 2QGZA 4LOKA 4CL8A 4DHEA 3HU1A 4GS5A 1KYXA 4GE0A 5SY4A 3O21A 3ZWAA 4W5QA 4BFXA 3GD5A 4Z4EA 3K1AB 4ZWNA 1WDLA 3DV2A 3VR5H 3VGJA 4UNRA 1EGHA 3EGXA 4YX9A 1UMBA 1AKNA 1BH6A 4KSYA 1UK8A 2BLLA 2W93A 3F8TA 3RHTA 4Q7MB 2C2WA 1HKUA 3P9PA 2WDPA 5CHEA 4LNUB 3STTA 3P1JA 3ENWA 3X1KA 2Y1XA 2FOIA 3RC1A 3LDFA 1MPXA 1YDEA 3A4YA 3O92A 2F3UA 1WCWA 1UMKA 5GGYA 1FS4A 1DX6A 1LTKA 2CDNA 2RHTA 4J0DA 3CX8A 2FCRA 5PGMA 1YQDA 5HZMA 5LKRA 4QSMA 3NHLA 4D2IA 2JIQA 4PN7A 4EELA 3BMCB 5AXCA 1NBAA 2JRLA 5K6AA 3EXIB 4OSOA 1P3DA 2FW6A 2XPCA 3KZCA 1OFTA 3BMXA 3FZYA 5F51A 5SZKB 3SZ3A 2OFOA 1K4KA 5AVUA 3CZMA 2GR9A 2UVPB 4XDGA 3P2JA 3RUPA 2C57A 2VH5R 3LV8A 2HRDA 1NVKA 3B20A 4QDJA 5FA8A 1L7NA 3RVRA 4CR7A 1U0SY 3RT7A 3EZ7A 5JAHA 2D0OB 1ISIA 2GPJA 3RI3A 2CV2A 2C1XA 1JR2A 2ZWIA 1I30A 3RV4A 5L51A 4XIIA 3RYHB 5JALA 1D0VA 1P2TA 5SY6A 3K20A 4G5OA 2O8EA 4ZGWA 1DC4A 2FJUA 3TMKA 1LD3A 1QHIA 3EUWA 4X1YB 1F5SA 4X90A 2G09A 3UJBA 4EO4A 5DI3B 5JZ9A 2I7CA 4CJXA 4AYXA 1E1RA 2Q6VA 4J9UE 1T2CA 1ZN2A 2EJCA 2X7XA 4R7TA 3ZHCA 4UMFA 1GFWA 1Q50A 3HR8A 4J7XA 1ZICA 4P3XA 4WXEA 3EDOA 2IPXA 1XDGA 1ODJA 2VG8A 4ZRDA 2H1FA 2XUQA 1IOZA 3R7AA 1AD2A 3OU6A 3KBOA 3QTBA 4L5JA 4D9CA 3KQPA 4QOGA 2JI9A 2QMYA 5EJ2A 4WMLA 2DOKA 5B36A 1YR6A 2VQFB 3WAKA 2DFLA 4DMLA 4DT1B 4ERXA 1WOYA 4KMMA 3HUDA 4S2UA 5G40A 3TSWA 3QWHA 4OP1A 4C05A 1CY2A 4HBGA 1TI7A 3Q1LA 4XAQA 1PYGA 3F4BA 3JSAA 2JDID 2J9FB 4DRYA 1GUZA 3W9YA 1ZU5A 5JXHA 3AVUA 1U9IA 1JG7A 2IDMA 2YJGA 1BX3A 1JDBB 1H0HA 5DGXA 3P96A 3NMUF 3E27A 2O50A 4XGIA 4DM4A 2QI9C 3R7SA 4FS8A 3CT4A 3WDMA 3RC3A 2B7BA 1UDWA 1U8EA 3PBKA 3PLAE 2O8CB 4OM8A 2D0PB 3DKKA 1LNSA 1HF3A 4MCAA 3FMVA 1KDVA 4DADA 5AUNB 4ER5A 1EUQA 3DF9A 1G66A 1K6IA 1RLTA 4RW0A 1DIRA 1EIZA 4I6JA 5B3AA 4ZYVA 4B33A 4NOJA 1TNDA 3T3DA 2F1OA 3PC7A 3OF3A 3ST7A 3OE1A 4F11A 3K72B 3PUVA 4Z3DA 2ZIXB 1PNVA 2ZPTX 1IN8A 4G9EA 4IRMA 5IAJA 1AURA 4DSTA 1ENZA 1KQOA 2ODWA 2VN8A 3F2IA 4H7KA 4YALA 4R3UC 3L7CA 1JRLA 2JVKA 3AUUA 3GAAA 4Z2YA 3JQ7A 4BC1A 5D1HA 2OVBA 4NMLA 5L45A 1RWMA 1FB5A 3OKPA 4HGRA 4W82A 1RC1A 1T26A 1ZRSA 3IAXA 1D2EA 4NICA 2FW7A 2WMOB 2JFUA 3HR4A 3PXCX 5C3UA 5K0JA 4G65A 1X77A 3S55A 4NU6A 4TV8F 2KMLA 1P7VA 4B3RB 4OXIA 2IVZA 5KYYB 1UC9A 3EARA 4I4TF 2Z3ZA 3EZGA 2BPOA 3QEJA 3R3WA 5U9CA 3ITNA 2PUVA 8ABPA 5CJPA 4AN1A 5CP8A 5FPTA 1C3OB 1JFLA 3NDIA 1R3UA 4RLFA 4NPAA 3UQYS 1BXGB 2Z4RA 2Y77A 3LCMA 5TDHA 2QM8A 3FNIA 4X7RA 1P6QA 3WYAA 2EFJA 4GZ6A 1XNJA 1DBWA 4DSNA 4CLHA 4G56A 4P3KA 1ITZA 5JZBA 1Z68A 1ZH8A 3RO7A 3UHFA 1ZI6A 2JASA 5IH7A 2FP4A 2IBMA 3D3QA 3OIWA 1FRVA 1YUBA 2C20A 1P2FA 2LTAA 2F48A 3NBFA 4IWNA 2V1UA 3AVTA 2R751 2XOXA 1JLSA 3M2PA 3MWGA 5CLJA 1QHHB 4ZT7A 1B23P 3IYLW 4YFVA 3AR7A 3EMBA 2FPWA 4HN2A 4M1WA 4Y30A 2WIJA 1Q0UA 3AUXA 3SR4A 3VX4A 2B35A 4DA6A 4PQRA 2G07A 3K5PA 3F6EX 1KYQA 4HD8A 2V7WA 3P19A 3JS5A 5HQTA 3NTVA 3C6XA 6CHYA 3GUYA 3MLBA 5K8IA 1FNCA 1BQ4A 2V8OA 3JQGB 3UAGA 3ZGXA 4GOKA 3JASB 1H42A 1NUAA 2Q49A 3H7AA 3KSZO 3T35A 2PH5A 2QLFA 1WF6A 2J5KA 3QENA 3CW2A 3OUUA 1JHVA 3LXXA 1W9MA 2PGLA 4RTOA 3UT0A 4BTLA 1WKBA 3QTTA 4HAZA 1Y6FA 4CEJB 3GMTA 5B3JC 4ASUD 5FPKA 1U9YA 1B1CA 1WDWB 4L4XA 5CX1A 5CMLA 2HCFA 1X7XA 1I5RA 5TSDA 4QG3A 4ZAFA 2R8ZA 2C07A 1VL1A 1XTPA 1UPXA 1YBVA 3ISTA 1KPGA 3CF2A 4EDHA 1TMOA 3IODA 1SQ6A 4X3OA 5E1OA 1E2FA 3UJPA 1A96A 3FR7A 1U2SA 2ZJ2A 3DVAB 2IYPA 4AWBA 3GG2A 2B1QA 4UCQA 4BX9A 9LDTA 3ZXUB 4MGHA 3PYMA 4BB0A 4E31A 2PLWA 5LWHA 3BTUA 2EZTA 2OBFA 1B00A 2P9JA 4EUEA 2CLMB 3PIDA 5I7RA 4LCBA 4RC9A 1AZWA 4TLDA 1DAPA 1EFVB 1U1EA 1X1TA 1RLJA 2O0LA 3PHHA 4IF4A 4KB5A 4DB4A 1CYDA 2ZS8A 1F2UB 4QG7A 1XZAA 4KO4S 2V7EA 3EZNA 3MWLA 1JE0A 3OPXA 1X80B 2VJCA 3LYLA 3ACDA 4D9GA 5K0EA 4JNCA 2ZT6A 2FCAA 4QX6A 4X91A 1EYZA 4MYUA 3RSQA 5EHZA 3X1YA 3HQ4O 2J5BA 4AO8A 2OHJA 1E5DA 1I10A 5JPCA 1KAEA 3R6WA 4RIGA 5CDFA 3O91A 1E99A 3W5HA 2QZJA 4CT5A 3MIZA 1N0UA 1QF7A 2WILA 1GU7A 1XO1A 2CLKB 2J0EA 4ALNA 5AKYA 1G1MA 2VXOA 4OQDA 2IV2X 4KP7A 4ASUA 5K8JB 1VECA 1BQEA 1DG1G 1GY8A 3L4JA 4MZXA 1N25A 3R2JA 5TB5A 3GFBA 3AEXA 3D5QA 1NN0A 3ECCA 3GLHE 4FGSA 4UARA 4LWZA 2UZ4A 1PT8A 2QUIA 3RVJA 3EXEA 3G59A 4AZTA 2EWVA 2CSXA 1A5SB 5CXXA 5LXTA 2X7JA 1DTWA 2MMCA 4FKMA 1DQRA 1AO0A 5DNYB 4DWOA 1CJKC 3K15A 1CCWA 4FNAA 4U2GA 1KAHA 4AZ0A 4JGBA 1N34B 4AF8A 4G36A 1N1MA 4R83A 4BDTA 1H2ZA 4IOMA 1Q0PA 4Q6BA 4PLWA 5FBWB 2Q3EA 1GPLA 3QUTA 4BUJA 2QRGA 2IRWA 3EEQA 1S1CA 1XL0A 2V59A 3VAYA 1EP1B 2GZHA 5E4FA 3WHIA 2Z2YA 1NXWA 3LDAA 2DLCX 3HKEA 4JXZA 5A4DA 1HH4A 4U7GA 4B3DA 1B74A 2F3PA 2R1ZA 2BGMA 2PZ8A 4ILEA 2PGOA 2ZSUA 4Y9SA 3KQYA 3UG7A 3V2UA 5EIBC 2ZSJA 4PSAA 1ZC4A 1V8FA 2Q3FA 3P9CA 4RX1A 4BO6A 1KIMA 1VOTA 4QOSA 3VPBA 1G8JA 5DSZA 5HE8A 3IJPA 1Z4MA 4PR3A 1A2OA 1DKLA 1DXQA 2BFFA 4QFBA 3NHAA 4UCXA 2QORA 5EXXA 1DEOA 2N46A 4PQEA 3VHRA 4LTNA 4CG0A 2ZSIA 2AHOA 4HLQB 3J7AC 3E05A 3TSYA 4UDXX 1L8OA 1NW6A 3K1JA 3SX0A 1OYYA 3A9TA 2PTHA 5FPQA 4CKEA 3QFSA 5BO5A 1JTFA 1V7ZA 4TWZA 1T6ZA 3GJRA 2W4MA 4TMYA 1PQUA 1YQTA 1SVSA 4L02A 4RS3A 2VDKB 5ILOA 3QE9Y 3UQZA 1ZRMA 2RKWA 2WF8A 3JQ6A 1BW9B 1H8HD 1U8FO 3KVRA 2BELA 4MQEB 4DAEA 2WU8A 3TTWA 2JH3A 3JZMA 4S12A 2BGWA 5K8CA 4G9GA 3ZHVA 3ED1A 1PJLA 3I5XA 3WLRA 3EUEA 3CC8A 3HCRA 3ENKA 1E5QA 5LMNB 4PHGA 2I6UA 1N2OA 2NT3A 3RANA 4DA4A 2PLAA 2PUTA 3DOIA 1PD0A 4L72A 4KXMA 1OT3A 1UEIA 3D7RA 4FD3A 5EIEA 5BSTA 2Q5LA 3ZCPA 4NU0A 1TFRA 3NHJA 5DK6A 4AMZA 3CUYA 1EGAA 2XWBF 4TTQA 4UQPA 3OLWA 4KVAA 1YVDA 4WLOA 4FZ5A 4N4AA 4YROA 4YA6A 1FDVA 1I6KA 1NFRA 1PF7E 2F9LA 3OD5A 2H5EA 1GQOA 3FPEA 1IZYA 4FC7A 2IEGA 3D31A 4LSWA 4MUGA 4LE1A 4YMGA 1G0NA 2B99A 2WU0A 3BZBA 2O7VA 1RDFA 2HQSA 3SS7X 3MBKA 2ZR9A 4IX1A 1Z37A 4GI3A 1XZFA 1R4AA 2BFPA 4LQCA 5JASA 1JW9B 5JY1A 1ZS9A 1RMQA 3PHJA 4J4HA 2AC2A 3W9SA 1CJMA 1SOVA 2BTOA 2Q4TA 4YT2A 2OCIA 3M81A 4HXFB 1FFSA 1KMMA 2VP4A 3HB1A 3WGJA 1NXPA 1JEAA 2WA2A 2CLFB 4P4UA 3SPXA 2JK1A 4D4JA 4L1KA 3I5AA 5DULA 4XCVA 1NW7A 1WBDA 4UE2A 1ZGAA 1H8HA 3H9GA 1GGVA 2WUEA 4B40A 2UYHA 4UM5A 5AHOA 3A1TA 3KD2A 2AFIA 5G1PA 4FN5A 5C8DA 1HA3A 3HWWA 1G63A 1VKRA 3HA3A 1UZAA 1IG3A 1GPDG 1ULUA 1N0WA 2UZ1B 2XDAA 5JJLA 3RABA 3K0AA 3R20A 1L4BA 4DARA 1Y8QB 2FEMA 3OMWA 3NTUA 4CQMB 1UFRA 4CKCB 2AI2A 4JJ6A 4GKKB 2Q2OA 1KJQA 4Z7OB 3I2KA 4GRAA 3SMVA 3E7FA 3QX9A 1WXEA 3NTXA 721PA 3G5AA 5KHOC 4NMXB 3REOA 3FCEA 2PKQP 1IEWA 2VQDA 4L22A 4GOXA 1TYZA 1JB1A 3WWYA 2AF4C 4IKOA 4YCLA 1P9LA 2GRAA 3S1AB 3A3KA 4JZKA 1G16A 5HOEA 5FLYA 5ERGB 3ZU5A 1NW5A 2GPTA 4DG5A 2XYGA 4C04A 1IEVA 5C7IO 4DMCA 5AVVA 3IELA 1MOZA 5JCXA 1QJCA 1OV6A 2RGEA 1PEAA 1PTJA 1NLFA 5AM2A 4GI2A 3VXKA 3V7NA 4RL4A 2NO0A 5EGSA 4F6RB 1ZK1A 5HKAA 3JWHA 3D3WB 1B41A 3GLQA 5JG7A 5AOBA 3GUZA 4MCIA 5BSKA 4FMCF 1PO7A 2B4QA 1T0HB 1ZRNA 4ZEMA 4TZ0A 5D7BA 1LC0A 3HG7A 3I4LA 5A7FA 3DMFA 4DCJA 4DLPA 3R77A 4EGFA 3QW2A 4RA6A 1GSIA 3WK7A 2B8EA 2DLNA 4DDKA 2F55A 2D3TA 3NM4A 1D2CA 5J9FA 2IIBA 2JAWA 1FU7A 4NS4A 3SI7A 1X38A 4CMJA 3EMKA 2VP9A 2LZ0A 2DQKA 4G0XA 4I2VA 2QSJA 4WY5A 5ICGA 1BGVA 1UANA 2CHGA 3SBOA 3ZE9A 1Y3IA 1G7CA 1UFVA 2IKQA 4KKVA 4FYPA 4EABA 2DQYA 4ML3A 4HDCA 1P4AA 3GCDA 4BFTA 1KETA 4MKGA 1QBGA 1XNGA 4N49A 4YMLA 1KEEA 1B8OA 3PDHA 3BRSA 2C0CA 2DBQA 1TUBA 1V43A 2PCLA 3L1JA 4FIZA 2XT9A 3G3EA 2ONKA 3VDMA 3M6IA 5H0IA 3EQ8A 3TL2A 5TQ2B 1SPXA 1JBQA 1L8XA 2IU6A 2IW3A 1KNXA 2Y0PA 4DDUA 4LYGA 1KQNA 1E96A 5EIHA 4ETIA 3AQIA 2XKBA 3INGA 4D02A 5F23A 1TF2A 1H94A 4I1IA 2NZYA 2IY9A 2YMQA 3FCSB 5FA5A 4IMRA 3GJQA 1P33A 5DXAA 4QPNA 1A7KA 1DP4A 3GL9A 5H80A 4LGVA 3TL3A 1XCOA 2HO5A 4G37A 1W96A 1F2TA 1NI4B 2AL7A 1OZFA 5KTRA 1E3SA 3LPNA 3UK0A 5HKBA 2C42A 3OE7D 2QQ0A 1E60A 2GHIA 4CMAA 5CEEA 3WGNA 1A0OA 2WC1A 3W6UA 1BWSA 2DVMA 1VKHA 3HN6A 3BFVA 3V4LA 4HQFA 1Q1GA 1M1YA 1Z83A 3VO2A 4JWKA 1UCFA 3MGCA 3D6JA 4LW8A 5BR4A 4N3BA 1GVHA 1L7AA 1RLUA 2VXYA 4HAYA 5E1DA 3ZDBA 4V0KA 2KYRA 5HSGA 5KX5F 2XYVA 2YHAA 2QZZA 3KJXA 3C4QA 4M55A 5AKJA 1QO7A 2QD3A 2E5FA 4K2AA 4QQFA 2W8BB 4GWGA 1ZK0A 2B78A 4IP0A 4TRMA 3W06A 2YIMA 3MELA 4OXQA 2A86A 4QDKA 3EGDA 3ORFA 3ELBA 3VYTB 1QQ6A 2ATVA 4TWRA 2GFIA 3ZDRA 2QAIA 2GN4A 3PQ8A 4ER0A 3CLRC 4M1QA 2FEXA 5ESXA 1BVHA 4CF3A 3N2KB 3MUEA 821PA 1EP9A 4YJ3B 2JLUA 2QL7A 4BKMA 3ZV6A 5CB0A 5K0BA 4OQLA 3V1YA 4ARZA 3BTVA 3VDNB 1NVGA 1BSVA 4YRDA 4ZEOA 1E2JA 2GMWA 5CW1A 3KYCA 3OE7A 3K9HA 3ESBA 1J6UA 1Y7HA 2EKBA 5JNRA 2CF5A 1G8PA 1CQJA 3LU1A 3OCUA 1X8KA 3OESA 1JJ7A 1Q92A 1GILA 1QWSA 4HB3A 4KQ6A 3OLYA 5LIPA 3HGMA 1HY3A 2ZTHA 3ZCSA 4C0KA 3LC2O 4DFDA 1JT2A 2WT8A 1OW3B 4HMQA 3UJHA 3NIDB 3ZVRA 3ZY6A 1YB1A 2O1SA 4LMBA 1XZQA 1JIXA 2WT9A 1ENYA 1HEIA 1FNSA 3JD4A 4N0DA 1L7OA 1M8PA 4MVJD 5CDSA 2G9QA 3MWEA 1LU9A 1KYTA 2I54A 3PUHA 3EXFB 2YJZA 4P38A 2LW7A 2BBSA 1PWXA 1NLZA 1Q15A 2AA3A 3BSYA 4GBED 4CR6A 2HPHA 4MWOA 1DUVG 1XK6A 3ONEA 3EQ7A 3FM9A 4DMMA 5KCMA 1Y1KE 2Y8EA 2E48A 4L3VA 4JT4A 4MS4B 2ONYA 1UFOA 1LI7A 4J07A 3S99A 4B5LA 3OIYA 4M8NE 5KJEA 5FDFA 4GG1A 3JX9A 4HPWA 5FUXA 1ISPA 5HPYB 2ZP1A 3O82A 3ZY3A 1BXKA 3JQ8A 3RFVA 4F38A 4IUBS 4Q05A 1EUZA 1R37A 2A9FA 2K5UA 2PBLA 3PP8A 4RF5A 2YCLA 2HH9A 1DLJA 3P2OA 4EECA 4ZYTA 5ERXA 1GNLA 3RARA 3K0CC 2IU3A 4WEQA 2XMPA 1WVMA 3CA8A 1MDFA 2Q3LA 4V2UA 3VKVA 3BB1A 2VTBB 1MJGM 1ZKDA 1B76A 4O4IF 3QELB 4GZ5A 3KFLA 2NO4A 4IHQA 4JVOA 1VRVA 5K3SA 3WLIA 4HEHA 5IKXA 4TM8A 2COKA 2XT0A 3CNQS 5BRNA 4A0RA 4RTQA 5HNKA 1VE6A 1K7CA 3JQFA 4CTNA 2ZCJA 4P0TA 3ISVA 3I73A 1WTAA 5GOTA 5A5VA 3ERCA 3ZQUA 5CTAA 5KSWB 4MVJA 1NY6A 4MJLA 3FHOA 2AN5A 3MINA 2ZBUA 4MVYA 1V1MA 1U7XA 4F2GA 4DRXA 3R44A 1V8OA 1GU1A 4JL6A 1KI6B 4WBSA 3FBGA 2P4EA 1RE1A 4QUGA 3P52A 4CBVA 4JROA 2W2VA 3KZVA 3FOEC 3S8YA 3AVWA 2FV8A 2PSEA 4S1NA 3KOMA 4AZ3A 1J2UA 2NP7A 3C15C 2VHXA 2EKPA 1BVYF 4OQFA 2XXAB 3FKSD 1WZIA 3FDIA 3K0EA 1XTQA 3Q9NA 4D0RA 3OHMA 4CDRA 1YONA 1BS2A 1QE5A 1A5BB 5ABPA 2ST1A 1GKKA 2VXCA 4YBRA 2ZROA 1LBIA 1ISSA 2Q6KA 5COBA 1P9NA 1JQJC 1IB6A 3Q41A 2WTMA 5EE0A 2EZ4A 1JIQA 1DWUA 1BAPA 5I5GA 2D74A 4CVNA 2MOKA 4OBBA 2IX3A 3T3NA 1EXDA 4JITA 1HK7A 2J87A 3DMNA 3ZHTA 1SXQA 4LYHA 3H16A 3PGMA 4B4WA 4IJQA 2ZQZA 1SCQA 3FWKA 1NBMA 3SS8A 4BNUA 4EG4A 1VPEA 1CJTC 2VNAA 3E58A 3O5AA 1EK6A 1EP3B 4MKXA 5AKLA 2H1OA 2YR0A 2WJ6A 5JYEA 5K4HA 1N6OA 1W0CA 2Y0BA 3DDHA 1PV4A 5AM3A 1JS1X 2FRDA 2VJLA 3GH1A 2DFDA 1ZIXA 4WN3A 4CM1A 3NWEA 2DFTA 4WASA 1KK0A 4A27A 3OM9A 4ZVMA 3OZRA 4UPVA 1F9AA 4C3UA 3B1JA 4TMVA 2XB2A 2XE4A 2K2WA 4LVUA 2OCGA 4HGNA 3PTAA 3HY6A 1CZKA 4L4YA 2WZDA 4RGBA 5CG2A 3SSOA 3EN0A 4W8GA 4ZYYA 4UU0A 1OJLA 4GR5A 4OQMA 3CRW1 4L5YA 4RV4A 1IM8A 5A3QA 1N32B 4EMTA 1T8PA 3FFXA 3GDHA 1U9IC 3K92A 3H18A 2QKYA 3WR5A 5BNTA 1RWKA 1KFKB 1GQQA 3D4PA 3HZHA 3VNQA 4A15A 4WXPA 3GEDA 2JFOA 4E88A 5I51A 2ECPA 4IH9A 3M1IA 7MDHA 5BPHA 1K0FA 3CURA 4H6VA 4ZU1X 4TL9A 4CM9D 3PCRB 1XAIA 2A5FA 4H0NA 4UUQA 2O8DB 1Q3KA 5TQVA 1O6GA 5BR1A 2BGJA 1AGXA 5EZ6B 1DX9A 2CL5A 1KFJB 1PKEA 2VDMB 4G97A 3OU7A 4NX2A 4XRRA 1ECGA 3RAPR 3I23A 1JFVA 2A4MA 3ZJUA 1H1DA 3ETHA 2Z98A 5KSOA 4DG9A 2GBIA 1G20B 1W19A 3WJ7A 3SIWA 3T3IA 2YFHA 5HQ3A 2JFQA 3ES9A 4K6FA 3GEMA 4BQSA 4WAUA 2X76A 1ZUNA 1P5HA 5BWNA 2OLEA 3O3OB 3AG5A 1WUIS 5KHAA 4KCGA 3HXQA 4X6LA 1NHGA 1PJ4A 2GJ9A 4FFMA 4GDFA 4LEIA 5K7SA 3H2IA 3ZHOA 1RYEA 3KJEA 3IRVA 1FTQA 4FT2A 2PWAA 3KZNA 2Z30A 1EFUA 2AGVA 3P2EA 2PKRA 4KJXA 4LZNA 1WXGA 4YRQA 5T3YA 4RY9A 4H1UA 3EIHA 2HCRA 3GXOA 5CA1B 4KVGA 2ONJA 4RV5A 3NV7A 1OFUX 4HYYA 4UCWA 2BF7A 3A26A 4RJTA 3EXG1 3ZD6A 1DWOA 1GR1A 2VRBA 3MC1A 4A8HA 2JLYA 8MHTA 3JW8A 3SC2B 4CM9A 3M1AA 3UAZA 3RASA 4EITA 1XD9A 4U7HA 3Q6IA 1GU0A 5J5VA 4ZGBA 1ND5A 3GT4A 3ZNQA 5BRJA 2JGEA 1W30A 4YUVA 1Y6JA 3CO0S 2ERXA 5DHPA 2O3RA 1GFSA 2HSEA 5DNAA 1Z7WA 2P41A 3T94A 4MW1A 5A3JA 5JS6A 3WK6A 1C7IA 3TLYA 1DAHA 3GLKA 3TXYA 3F6YA 4NE9A 1C30B 3GEBA 4HZUA 2UVPA 1UBNA 3KSUA 5AI9A 3FTDA 4A4DA 4CXMA 1G8KA 2XCSB 3FPBA 1KDPA 1NTRA 3ANNA 3QLTA 4W9NA 3LG2A 1OWMA 2J9RA 2FG7C 3QMVA 1FP4B 5JAIA 3RYHA 1GV0A 2H7CA 1QP4A 1Z38A 5MGNA 1C9YA 1R9GA 1UZUA 2DKOA 4FUQA 1O6CA 3WB1A 2OO5A 1ULAA 4H17A 1U4OA 4PG5A 3HL0A 1ZZGA 4QBGB 4DREA 5F2NA 2GX6A 1WHSB 3FN4A 2IHBA 2I76A 2AZTA 5DGCA 4E33A 2GF0A 4IWYA 1KI7A 4E14A 4BCCA 1YULA 4MW0A 4XRGA 2AKYA 2XB4A 4HGYA 1N2GA 2JJQA 3G8AA 3SJZA 1DT5A 3CM0A 2EEZA 3DHNA 4ID3A 1ZMOA 1X0XA 5K0GA 13PKA 3QQPA 3T5AA 3PT9A 2YNMD 3R40A 4E5PA 2PRSA 4WOCA 1K75A 3G8CA 2XMRA 2HQ1A 1HRKA 4I6GA 16PKA 1RLOA 4U4AA 1MO4A 4CN9A 5AIAA 3RVDA 1FNBA 4P34A 1X9IA 2ZRIA 3OZTA 5B1HA 3EA4A 2ZI7A 4WXRA 3T7KA 1E79A 3BIWA 2V7GA 4QGFA 2G77B 2W6JD 3EPRA 5FWXA 3U39A 3RK1A 5AVKA 1QIDA 4PO8A 2GM9A 3GBPA 4KL8S 3A4TA 4LRUA 1G1AA 5HM6A 4DMUB 2B5WA 3GVPA 3GPBA 3OOJA 2O8CA 2XOKD 2XUKA 3DZFA 3PUXA 4GOLD 4RD2A 4EJSB 4R2XA 4Q4JB 1K9SA 2EC5A 4JQCA 3G9QA 3KHKA 1SGWA 4IMJB 4N01A 4F9FA 5CA0A 4DV5B 1QRTA 1HGXA 2G08A 2WPDD 4KPGA 3ZU2A 4LMPA 1ETHA 1DAKA 3L1VA 2DFKB 3OA2A 4HDMB 1R9MA 4MUEA 3IE0A 3MA0A 4UBMA 1IFXA 1KI8A 3MSCA 3HJRA 5KDDA 4JX9A 4C4YA 2IS4A 1TJ3A 1RJDA 2IYOA 2V9CA 1GYRA 1I9CA 1JP7A 1WPXA 2O2ZA 4I3HA 1MENA 4A3SA 2X0RA 2RDMA 1B0ZA 4AWXA 3I5YA 1GL6A 2PXXA 4JA2A 3SF8B 3NHKA 2RC5A 1MEOA 1EXMA 1JFFA 3DLCA 2FX2A 2VO1A 1T6XA 2A33A 2VWQA 3ELYA 3HB9A 4LHSA 3PC4A 2H51A 1ZIYA 2YNMA 3U16A 2VNIA 4U0KA 3BD6A 4H60A 4RDHA 2BKUA 3DBIA 3N8KA 3IP9A 5EZYB 1ZUHA 3JTEA 4PC6A 1JEJA 5JRDS 4ZOEA 4J0EA 5LNK6 4M0MA 4W5TA 5FI0B 1XRPA 2BDEA 4IGIA 4HQOA 3OZVA 3ZU6A 4TROA 2PWYA 5J2UA 1X8JA 4CGZA 2W6JA 3EAGA 3D4LA 3MQFA 2ZSAA 4CM3A 2YV5A 3CFYA 4R98A 4AKTA 1MFPA 4F5YA 1KOLA 1V7PC 1RXUA 3AVQA 2BGGA 2N47A 1A9XB 3TSAA 4R2WA 4BFYA 1L5NA 1WIWA 1HQKA 2H1HA 1XF1A 1KFCB 1LZLA 1U7TA 1V2GA 1Y3AA 1XMXA 2G5GX 1K0UA 4LOAA 2EZ9A 1ORIA 3KALA 3K05A 3KYDA 5HKKD 3E4CA 3O7MA 5EKDA 3CIOA 5H02A 1YVEI 4TMFA 3PF9A 2IXGA 4K1LA 4OAQA 1CY1A 4FDLA 5JS7A 1XTJA 3R3ZA 4LI3X 5DV9A 3LI2A 2EGHA 4YCNA 1PT6A 5AXBA 2ZBEA 4QATA 4D25A 4R68A 2D1RA 1C1DB 2P9YA 1HBJA 2WOOA 1PZMA 2W8ZA 2AEFA 3LY5A 3JQGA 2ZRJA 3T3MB 3FYUA 2JA2A 4N8EA 3IV6A 3ZLUA 4C6SA 7REQA 5AQEA 1J2YA 1RCTE 3EMDA 3S7TA 4RHUA 4O2BF 4QHYA 2XRZA 1AB5A 1PNTA 2F43A 2Z4TA 1QYDA 2ZIFA 4QZVA 1SG0A 1J1ZA 5FPSA 2VS1A 4OI4A 4RM2A 4TWIA 4Y2XA 3VVMA 3OEHD 4HADA 2ERCA 2ID9A 2J5XA 2XJ4A 3PRKE 4I46A 4YJ2F 1SMKA 2J0UB 1R5JA 3U44B 4BFSA 1AXEA 4TGLA 4DQLA 3AU9A 3B36A 5KKNB 1XRSB 2V0NA 4N5HX 4ZI7A 3GMIA 1DXYA 2R2AA 3LM8A 5T6BA 3SVLA 4DR1B 4PTZA 3P27A 2PDAA 3REQB 1SD2A 3DFUA 5HG0A 5AW2A 2VP2A 4ZT5A 1PSWA 3KVYA 2P2GA 3M0EA 5HKKA 1JVBA 1NTOA 2XSZD 3IUPA 4KK3A 3MT7A 1JYFA 4F0JA 3O2JA 1YR8A 1M34B 1CFJA 3WSWA 3A3YA 1ABEA 3LHDA 1PL0A 2ZRDA 3N28A 3OSZA 1J1UA 1RABA 3ZWDA 2H0RA 4ENVA 2P1DA 2D13A 3G0OA 3SVZA 3UTCA 4DDWA 6YASA 5CEJA 1E94E 1QG4A 2WVGA 1CRLA 1QIEA 4YT8A 5JAOA 3QKRA 3GA7A 1IVSA 2P5TB 3EEOA 4PFJA 1JHQA 2B5VA 2PPVA 4YAUA 2NM0A 3PDUA 2XZDA 3SC4A 4OLJA 3AVXA 5FNVA 5FJJA 2BR4A 2JFFA 2BMVA 3FRHA 4FS3A 3DBHB 1G5QA 1V45E 1HT0A 2I22A 4WGGA 4KFSA 4UHKA 4W63A 1NOJA 1US8B 1PK9A 3CUWA 3DVLA 2ENWA 3OEHA 5FBHA 3QMWA 4CHTA 1NXOA 2G9UA 2REOA 1OSNA 2CLDX 4IDGA 4PIMA 4PR0A 3NJ8A 3RBXA 3RCBA 1SXJB 3DD1A 3OIGA 4MLPA 3RLFA 1O5OA 4NU8X 1OX6A 3CH7A 3ROQA 4RTRA 2QRZA 3FUTA 4BJ5A 4QLBA 5F7XA 4PGHA 1SUCA 1QU3A 2DHRA 1Z8FA 3NI2A 3V80A 4HDOB 4WPGA 5MN6A 1CP3A 3BJIC 3DFZA 4R31A 1LPSA 4MGEA 2XSZA 3OQVA 1OXVA 4NNJA 3VKGA 3EOBI 3KJGA 4BMNA 1AKQA 4MDFA 1RPTA 1P4HA 2KJQA 3CSUA 4MCJA 2CZCA 4OGWA 2XDYA 3Q5EA 5FQOA 5J4HA 1OH6A 4WDQA 5KYUA 3B51X 4OHKA 2HYDA 2WEKA 3B70A 4WKGA 4KPUB 3ZJTA 3Q88A 2VP5A 5ULLA 2FPGA 1PTJC 2ZJ4A 5LZ4A 4JP1A 4ZU6X 5A5FA 4N0QA 3ZGLA 1Z06A 2DUUA 1ISMA 5ALLA 4K6KA 1XZCA 3AF1A 5EKXA 5BMVB 5J58A 1N7JA 3GLFA 1WBJB 4H7HA 5CGQB 3AR3A 4FWTA 3T1TA 3AVVA 2FGJA 3U1VA 4ZJYA 3E0QA 5K2MA 4KIWA 2E2WA 2FEKA 1RKVA 4IQ4A 2MT9A 1KJWA 2W2OA 1NQVA 3D6MA 4IWXA 2TSYB 1A1VA 3D5EA 3HXMA 4HFRA 3RHFA 4ZARA 3PX3A 3A7DA 3SYMA 1CHNA 1S4MA 1OTXA 1QH8A 2J5RA 3IALA 4W1RA 4IINA 5LZ5A 1RXVA 2DTDA 2IP2A 2ZRPA 1NWHA 4LIPD 3LPCA 3WGMA 1GLNA 5AI6A 3WGUA 4HNGA 2ZI9A 2X19A 1SCJA 3S44A 1GN8A 4GVPA 1YQGA 5FBRB