3ER9A

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
288
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/rna
total genus 102
structure length 288
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3er9A00
5EQJB 2B25A 2ZIGA 4EMSA 4HRAA 3C3YA 4ER6A 1QAMA 4RTSA 4FSXA 1JG2A 1KPIA 2BM9A 2PX5A 3PVCA 5EEHA 2P8JA 4M38A 5EHGA 5EMMA 4C4AA 4DMGA 3T7SA 3ERCA 2FCAA 2XYVA 3M6XA 1RI4A 4HSGA 4IKPA 1QANA 4H0NA 1M6YA 1SQGA 3EGIA 3KQMA 5EVJA 3GRYA 4RTJA 3A25A 4YMGA 4RVDA 3P71T 1VL5A 3KQQA 3JWIA 3ORHA 3HM2A 4MIKA 1Q0SA 3HA7A 2P1DA 3NW9A 3C0KA 4E31A 2K4MA 1H1DA 4DZRA 1QYRA 1ORHA 2JG3A 5P8WA 5DSXA 5HILA 5EIFA 2LD4A 3GXOA 3IHTA 1MJFA 2DPMA 5HZMA 5KQSA 3HCAA 5FWAA 2C7RA 4KVZA 3AY0A 4RTKA 2NP6A 2FYTA 3HEMA 3UJ9A 4G56A 5HFJA 3OU2A 3RIEA 4QVGA 5DXJA 5FQNA 3HA5A 5U4XA 4JXJA 2H11A 3GJYA 1KP9A 4KDCA 2QYOA 5T64A 5EMJA 5KQRA 2HR1A 1R00A 3OZTA 2HMYB 2PWYA 5CVJA 2HNKA 1EJ6A 4FT4A 4F86A 1JQEA 1M6EX 3DTNA 2PY6A 3OPNA 2FHPA 4FZVA 4PGGA 5K03A 1SKMA 2VDVE 4PYQA 3B3FA 3P9KA 3PB3A 3CJTA 3LDFA 3DMHA 3HCEA 1G38A 5D1HA 4PYKA 3DLCA 9MHTA 1X1DA 2ERCA 3O4FA 2VDUE 3TKAA 1QZZA 3GO4A 3HNRA 5DX8A 1L3CA 4P7KA 4R05A 3KPWA 4AZSA 4YMHA 4QQNA 5E1BA 1IM8A 3UJ6A 3DMGA 2GLUA 3CJRA 2FK7A 1VP3A 1BC5A 3LPMA 5GINE 1VP9A 3CKKA 4Y2HA 4V0RA 5EGSA 1OR8A 5F2KA 3REOA 1WXWA 1TPYA 1VE3A 3G5TA 2IPXA 4MQ4A 3HP7A 4DCMA 2R6ZA 1XTPA 3G2MA 2ZBQA 3JWJA 3LL7A 3ELYA 3NDJA 3MQ2A 5GM1A 5K0GA 2IH5A 3I5UA 1R6AA 2G70A 5GWXA 2UYCA 1ORIA 5C1IA 5FA5A 4FSDA 4GUAA 5C9ZA 2YXLA 3FTEA 2JJQA 4PIPA 3M4XA 3TM5A 2G8NA 3ELDA 5B1SA 2VP3A 2HWKA 1IXKA 2PLWA 3OCJA 4R8RA 4Y30A 7MHTA 1JG4A 5DTMA 1KHHA 1WS6A 3R0QA 4QDJA 2AOVA 2AVDA 3E05A 3UBTA 1F3LA 3THSA 2O0LA 2YXDA 1NE2A 4OA5A 2AR0A 3UJDA 2N47A 5BXYA 3PFHA 1YFLA 5FHQA 2H1RA 4PGHA 4KDRA 2IH4A 1WXXA 4PYOA 3P2IA 5FHRA 1I9GA 4BY9E 2HV9A 3C6MA 3FRHA 5K8VA 3KPVA 1YB2A 4ER5A 3AWIA 1Q0TA 3ME5A 3Q87B 3BGVA 3GRVA 3PS9A 2CMGA 3FTCA 4X60A 3B3GA 1NW6A 3P2KA 3MHTA 2BM8A 2P40A 4M36A 2WA2A 4E2ZA 1O9HA 4BLVA 3KQSA 4KW7A 4WXHA 2I9KA 1HMYA 5JUWA 5EIWA 3RODA 2PWPA 3EVBA 2PKWA 1JG1A 4XCXA 4CTKA 2FRXA 3LCCA 3P9CA 1VLMA 1G6Q1 4GOLD 4GQBA 1RJDA 3FUVA 3LSTA 3BT7A 5DXAA 2IP2A 5E9WA 4LWPA 3HA3A 4QVKA 8MHTA 1ZQ9A 4LWOA 1M0EA 3DUWA 1DCTA 2ZWVA 2ZIFA 1JTEA 2C7OA 2A14A 3T0IA 1AQIA 2AN3A 3B7PA 4RTQA 3E7PA 4BP3A 1YF3A 3LECA 4FP9A 4DCGA 1P91A 2PBFA 3AXSA 3BXOA 1R8YA 1NW8A 1AV6A 3M6UA 2IFTA 2O06A 1X19A 2BR5A 4HG2A 4BLUA 3GGDA 5GIPE 2YQZA 3KQPA 3R24A 4POOA 1EG2A 3MTIA 3KHKA 2JHPA 4YUZA 1XVAA 5FCDA 1D2GA 1JQ3A 1MHTA 4CWAA 1XCJA 4RX1A 5FQOA 1ZHFA 5EMKA 3KQOA 3SVZA 1NKVA 1XDUA 4CXMA 1RI5A 3EVEA 5FTWA 3MTEA 3DP7A 1ZGJA 2FPOA 2FK8A 3OZRA 4GC5A 4IV8A 2P7IA 4PONA 4HGZA 2P3OA 3I53A 4P58A 5F2NA 1WG8A 1EAMA 2OO3A 3GU3A 4OBWA 2JH8A 4X1OA 3G7UA 5GOZA 1N7IA 2I62A 5FWDA 3VC2A 4EVIA 5ICFA 3V8VA 2PGXA 1JTFA 3LBFA 2P3LA 1EQAA 1YZ3A 1Z3CA 5DT2A 3UJCA 1QAQA 1XCLA 2ZTHA 3FPFA 5DLYA 3EVGA 3EMDA 2VZ9A 3PTAA 2G1PA 2AN4A 1RI1A 3G89A 3FPGA 4V0QA 4E70A 2BR3A 1G55A 1NW7A 5CVEA 3T7RA 4C08A 2ZZNA 2QY6A 1D2HA 1N2XA 4XUEA 1JQDA 2ZW9A 1TW3A 4PYJA 5DWQA 3SSOA 4PIMA 4R8SA 3TR6A 3LGAA 4C06A 2O05A 3LDGA 1P39A 1SVUA 2JH9A 5HIMA 3V97A 4ATNA 4QPPA 4X41A 1L9KA 2NNWB 3LBYA 4WVLA 4A6EA 4PNEA 1NW3A 3IEIA 3DLIA 5DPMA 3B3JA 3CGGA 3RW9A 3MGGA 1XXLA 1WZNA 3WSTA 3O31A 3MERA 5GIOE 1YFJA 2PT6A 3EVDA 3PFGA 3NVMB 10MHA 1QAOA 5G02A 1JSXA 2YX1A 4RVFA 1KIAA 1R18A 3GRZA 3P2EA 2YR0A 4FR0A 4KIGA 4F85A 4RTMA 4PCAA 3EEOA 4UOEA 5EOVA 1L3BA 2AN5A 3FUUA 3LX6A 3M6VA 4IWNA 3DULA 3BWMA 5HOQA 3K6RA 5DSTA 3KQWA 4AZVA 2EJTA 4MHTA 4O29A 1JG3A 4E32A 1PRYA 3OE4A 1JSZA 2GPYA 5E1MA 3SX0A 2ONYA 3G8BA 1NW5A 3K0BA 2P35A 3CCFA 3KQTA 5CM2Z 5BP7A 3BWCA 2GA9A 3O7WA 4RTLA 3THRA 1KPGA 3EGEA 3ER9A 4M37A 3BWYA 2C7PA 2PX2A 3KPYA 3NWEA 4A6DA 2B9EA 2QRVA 3P9NA 5ICGA 5C0OE 3NTVA 4EKGA 3T7TA 2GS9A 1RJFA 3PX2A 3TPZA 3EVAA 2AS0A 3S68A 4DQ0A 5ICCA 4OX9Y 2XVAA 5EEGA 3UWPA 4KIFA 5K0NA 2CKDA 4XUDA 2G72A 2OKCA 3EEYA 3LCUA 5DX1A 1NV8A 5LQUA 2KW5A 3JWHA 3G2OA 3FUWA 4DKJA 3R6TA 2ESRA 5HEKA 5LQRA 4ER3A 4RTOA 1FJXA 2IDJA 5EPEA 2JHAA 3TKYA 5K0CA 3G2QA 4HGYA 3NJRA 3FRIA 2GB4A 4KWCA 1RI3A 5FADA 3UJBA 1I4WA 3D2LA 3KPUA 3OZSA 5BW4A 3G88A 4RVHA 1I1NA 4OQEA 4P7FA 3VSEA 3R3HA 3DR5A 3FTFA 3NMUF 4PWYA 3A27A 5LQKA 4QTTB 3B89A 3A4TA 4GC9A 5E2BA 2GH1A 3P8ZA 4C04A 3BKWA 5K01A 3BUSA 3FZGA 3GNLA 5JR3A 2Z6AA 1VQ1A 3P9IA 4U7TB 2ZLBA 2IH2A 5ERGB 5T67A 5ICEA 2AVNA 3FPHA 3HCDA 3HVIA 2V74B 4GOOD 2Y1XA 3DXXA 4RSRA 1NT2A 5E1DA 1X1AA 1SG9A 3GRRA 4FGZA 4DA4A 1VBFA 2P41A 3CJQA 2CWWA 3E23A 1NBIA 1D2CA 3M6WA 3PX3A 5HIJA 5CD1A 2AOTA 1FPQA 2QRVB 5CVUA 5E2AA 4PYMA 2UYQA 4YV0A 3MAGA 3ANXA 3TLJA 3EVFA 2OYRA 3ER8A 4HTFA 5CVVA 1NBHA 2I6GA 2OB1A 3PT9A 2BH2A 1KR5A 2XYQA 3FPEA 3EVZA 2AOUA 4EQZA 2H00A 5EHIA 3DOUA 3GRUA 4FT2A 5FA8A 3FYCA 2XYRA 2UYOA 4P7JA 4E33A 1G60A 2Y1WA 4LECA 3TOSA 1N7JA 4XUCA 1KYWA 1JR4A 4PCLA 3VYWA 2B3TA 3LDUA 2ZZKA 4GF5A 3BKXA 3KU1A 4AX8A 2E5WA 3KR2A 5HIIA 3HVHA 2WA1A 1SUSA 5DX0A 1FP1D 2YXEA 5CCBA 5MHTA 4YV2A 2ZZMA 3NWBA 2QE6A 1XJ5A 2NXCA 2CL5A 2PX8A 3MCZA 4U7PB 5DM2A 2ZWAA 2B2CA 1YZHA 2OPBA 2AOXA 3M33A 4E2YA 1B42A 2IIPA 3TM4A 3SM3A 3VC1A 4C03A 5K0FA 1UWVA 3UJ7A 2HTEA 4QTUB 1F38A 3SGLA 1SUIA 3TFWA 4DF3A 5E9JA 1RJEA 3OFJA 4R6WA 2B78A 4IV0A 3X0DA 5KYGA 3I9FA 3NVKI 3E8SA 1G8AA 4GOND 4L7VA 5K05A 1R74A 3LCVB 5HIKA 2IBSA 5F2OA 2PT9A 1EJ0A 4FS8A 3CBGA 1KYZA 3LKDA 4NECA 5K0LA 4E2WA 2BR4A 2VDWA 4YUYA 5DTRA 1KPHA 1Y8CA 2VS1A 2UZ4A 1T43A 2ZSUA 3LHDA 2AOTB 5DM1A 3FPJA 4RV9A 4QPNA 2IDKA 3EPPA 3EVCA 4HTFB 1ZG3A 5H02A 3SXJA 4EKIA 2ADMA 5K0JA 5CUQA 3KR9A 1PJZA 5K0BA 5M5BA 2AOUB 3ELUA 4GOMD 4HC4A 5GP1A 5KVAA 3PLAE 3SSNA 4AZWA 4PYLA 1RJGA 3TMAA 2ONZA 3UJ8A 4C07A 1V39A 1DL5A 3SSMA 2ZBRA 3BZBA 4MTLA 2OXTA 4DM3A 2PXAA 2XVMA 4ER7A 4ZTBA 5LQNA 1P1BA 3B5IA 3QV2A 3KKZA 2G71A 4RYLA 4CKCA 3I58A 5FULA 2I7CA 1TW2A 4ER0A 4RTNA 2O57A 3ID6C 3TRKA 2C7QA 5LQJA 2PSSA 1ZKDA 4RWZA 5DRYA 1O9GA 4CKEA 2XBMA 5LR6A 2AOWA 1HNNA 1FP2A 3FUXA 4C05A 5CVDA 3C6KA 3HVJA 1L1EA 3IV6A 4OA8A 3NDIA 2JHCA 3UA3A 2V7EA 2NXNA 5T6BA 1BKYA 3G2PA 3LKZA 2P3QA 1WY7A 2EFJA 1BHJA 2WK1A 3A7DA 1SQFA 5K09A 4OQDA 3EGVA 3UZUA 4CKBA 1FBNA 5K0EA 5EKUA 3QOWA 5LQAA 3SMQA 3AXTA 5DM4A 5DRTA 4PINA 1NV9A 1YUBA 1P1CA 2YVLA 3KQVA 4PYIA 3ELWA 1XDZA 1KXZA 1UFKA 3HCBA 4HH4A 3CVOA 3BGDA 3BGIA 5CCXA 5EZSA 2PXXA 2NXEA 4E30A 4QDKA 5EZQA 4RVGA 1AQJA 1O54A 2DULA 2ZVJA 2ZULA 4E2XA 1RI2A 3AJDA 3F4KA 1ZGAA 3FUTA 5E9QA 1UIRA 2Z6UA 3FTDA 1U2ZA 3DXZA 4OBXA 4YUVA 3OU7A 2P7HA 2ORED 3H2BA 2OB2A 2R3SA 4GBED 3G8AA 3L8DA 5EC8A 2QM3A 5D1NA 5EMLA 1VPTA 2UYHA 3UA4A 4AZTA 3GCZA 4BLWA 2IGTA 3DXYA 5E1OA 2NYUA 3OE5A 4BP1A 5LSAA 2EG5A 3GDHA 3UJAA 4LG1A 4EK9A 2PJDA 3KR1A 4RTRA 1X1CA 1IY9A 3Q7EA 3GWZA 2ZFUA 4AUKA 2Z6QA 1INLA 2OZVA 2PV0A 4KRGA 2YTZA 2ZCJA 3M70A 1G8SA 4X63A 3TQSA 4R6XA 3P97A 5IKMA 2IBTA 3DH0A 3HVKA 5IH3A 3FYDA 2F8LA 2GAFA 3A7EA 3GIWA 3I64A 3DMFA 1AF7A 3HTXA 3R9XB 4YUXA 3SR4A 4CTJA 1DUSA 4YV1A 2PVCA 5E8JA 2OY0A 4Z2YA 2EJUA 4M7RA 3KQYA 3HCCA 1BOOA 4B17A 4MWZA 2PXCA 3MB5A 2AZTA 4PYNA 5FUBA 3BWBA 1L3IA 3IYLW 4F84A 4YUWA 4X61A 2NXJA 3KPJA 5CIYA 3G5LA 2OBFA 4K6MA 3OFKA 1R8XA 3OU6A 2NP7A 3C3PA 5DM0A 2PX4A 1EIZA 1X1BA 1XDSA 3A26A 5DTQA 2CMHA 4QQKA 5EG5A 5BW5A 5E8RA 1VIDA 4ISCA 2Q41A 3U81A 5LQCA 4GEKA 2EX4A 4P7GA 3KR0A 2ZBPA 5GM2A 3CC8A 4RTPA 3UFBA 3EMBA 3QOXA 5KS2A 5EKXA 2BZGA 2ZIEA 2O07A 3JWGA 3HCFA 3MCTA 2YUIA
chains in the Genus database with same CATH superfamily
5BT9A 3UK2A 1ECFA 4WXEA 1H2BA 1MEOA 4HRAA 1K5GA 4DLZA 3R0IA 1CG6A 3KLMX 4DQXA 2DFKB 5CA1B 4LRUA 4E4RA 3C6XA 2W37A 2GERA 5EEHA 2P8JA 5FJJA 3VKWA 4WZAB 1XDBA 3KVRA 2WUDA 4QGAA 1B3RA 2LKDA 3WQSB 3WISA 4YMGA 2FWNA 1AKTA 3R7NA 3GZNB 3AIKA 5A4JA 4L76A 1N5JA 1KOGA 1XAHA 3RVQA 5EVCA 1L8AA 1YSCA 2W2XA 2W9XA 3QK7A 5REQA 3SE7A 5FWAA 1A2OA 2C9ZA 2L0XA 3GNTA 1R4MA 4MUAA 3BWXA 1Z7EA 1Z6GA 1T9GS 3RRJA 2HCTA 1T2EA 2IT1A 2QB5A 1TLFA 2FMHA 4I4TF 1C7EA 4TTSA 4UZFA 4WKBA 3RIEA 3S4YA 1E5LA 1JHUA 3T3PB 3TN7A 2I9PA 4LXIA 1W0CA 1QIGA 4DG9A 4QT4A 1DVRA 1GZ7A 2C3MA 2B92A 3AF5A 5JMOA 3VNUA 2GEVA 2YMQA 5KQRA 3M4JA 3T61A 4XEHA 1IEXA 2CEKA 1ZGGA 3FI9A 4E7OA 2HNKA 4WBNA 3WWYA 4IIVA 1E1MA 5ISMA 3NBMA 2J85A 3NWJA 3VU8A 2NUAA 1XRMA 2VK8A 1FRVA 4MDHA 1C1XB 2AJTA 5DGCA 2NIPA 3OTOB 1OAOC 4B3BA 2HLPA 5BNIA 2VJPA 3QF4B 3D4LA 2AL7A 4RYDA 4NCJA 2ERCA 2E37A 4A9AA 3EMKA 2C83A 4EB0A 2Y0BA 3TKAA 2P77A 4ZT3A 4OX9B 2KPOA 3PITA 4WL0A 2J41A 6ADHA 4EGCB 2H2FA 1QO0D 1CZKA 1SM4A 3AW9A 2Y68A 3IKLA 5JNWA 3K8YA 2DWCA 2PU5A 3I1FA 3UJ6A 1NMYA 5CT9A 1FNCA 1NBWB 4Y2HA 4PYRA 1DV2A 3PDWA 1RXYA 3NIFB 1PWEA 1WXWA 3K1AB 3RLFA 1U7DA 1CZHA 3Q8KA 4ARZA 4EUSA 2BGLA 3GAFA 3OTHA 3AZPA 2BFDA 2VHUA 1IOLA 1NXPA 4K1LA 1AA9A 3H05A 3E18A 3I42A 1R6AA 5GWXA 3F73A 4QYMA 1KVUA 1VKRA 3K20A 1Z2OX 2YXLA 3PFWO 4GUAA 4A82A 4CUZA 3PYXA 4WADA 2XKBA 3REQB 3ZIAD 1DC8A 4K9LA 1UPXA 2PZFA 2D7DA 4JYAB 2EARA 3MCWA 4HK4A 2HRZA 3IA7A 3C4JA 3QMVA 5DTMA 4D9HA 3I6ZA 1QZ3A 6LDHA 3ITKA 3RTAA 1X7YB 4EHNA 1CRLA 5FNVA 4O4JA 4S05A 2WT4A 1S3GA 2Z9CA 5KOYA 1FFWA 3F5SA 4ND7A 4OA5A 4RD0A 4U7WA 2VXCA 3JXEA 4OU5A 4W5QA 4WDRA 1NJSA 1PE0A 3O8OB 5FHQA 2XOEA 4C7OB 1RWVA 3H2SA 3MCAA 1Z15A 2C3YA 3ECAA 3C6MA 3MB8A 1G5QA 4HNVA 4UAUA 3NWPA 4IW3B 5ES4B 1U0JA 3Q87B 1Q1AA 1ZIDA 2ZR8A 2CMGA 2RK4A 2WJJA 3DV9A 1KMMA 3L43A 4X60A 1PD1A 1ZZGA 2ORWA 3MK31 4JQSA 5EIHA 1QYIA 2QORA 3PQ2A 5ALVA 3DTTA 3DCIA 3N70A 1Y6JA 2F00A 3F5QA 4JR2A 1QMPA 1EX7A 4WERA 2OHFA 3GH1A 1PEDA 1W0JA 4YAIA 5KJ1A 3KOYA 3D0RA 4MYCA 4PLHA 5CT4A 2C99A 2W5UA 2H5JA 1J33A 1JJVA 1MJNA 3AYXB 2WTAA 4MQEB 1DQPA 3CE9A 2XMSA 5FPSA 1U31A 1M0TA 4I6GA 4CTKA 5CXUA 5JISA 5COQA 2E5LB 1VLMA 4RC9A 1N1MA 1P3DA 4MGHA 1T36B 3RUFA 4YRZA 5HUJA 1OI3A 1JG6A 4W4TA 3H6KA 5D5QA 1FSZA 2Q6OA 3HUFA 4WASA 3QXGA 4RK4A 5EFZA 2IHBA 1B00A 3EQ6A 3VU9B 4XM1A 3PNSA 4UU0A 4IYJA 3DNFA 4JFAA 4BFSA 4JMPA 1NQOA 2JI6A 3AUUA 1RIFA 3L4EA 4N3BA 2RHCA 721PA 1P17A 3UQZA 4D42A 2J9YB 1NLYA 1SOVA 3W1EA 2ACEA 1U94A 1T5IA 4NVRA 1I7PA 1EG2A 5ELLA 2JHPA 3ZKWB 4RZ3A 3R8FA 2O8EB 4ZOLB 5K4GA 1XCJA 4DEVA 1O94A 1DXHA 4PHFA 3SVZA 1NKVA 2D3WA 2ZBVA 3WSVA 1H3FA 2CNWD 5H70A 1OH8A 2CJWA 3WJ7A 4DLLA 3CN7A 3ZDAA 1HOXA 2J67A 3OP1A 4WZAE 3IR7A 2WYWA 4P4NA 1WRBA 4ZOAA 1G0NA 4YQEA 1GEGA 4K2HA 3SFTA 3P2MA 2PGXA 4QWWA 3R23A 5IT5A 1A97A 1EIWA 4P0TA 1CRPA 1JA1A 3UJCA 4HRYA 3EMDA 5LNK1 1B6RA 1SZCA 2IQ5A 4A27A 3PTAA 3FPGA 3IPXA 4RMIA 3MINB 5ED0A 4MB0A 1Z39A 2OESA 2Z4TA 4G2TA 1DMRA 4GPEA 4TT3D 3V4OA 5BYAA 4LF5B 1T91A 3C5VA 5CYOA 2QUJA 5KVSA 3HU2A 4ZP1A 2IIQA 3ZZMA 1ID1A 4YI3A 3OUUA 1UBSB 3HDYA 3IV9A 4RE6A 4ATNA 3KXLA 4WNAB 1G8HA 3CRW1 3G5UA 3JQAD 3ILYA 1DTEA 5DULA 1JN0A 2O2SA 2H4JA 4JLKA 1JQBA 2PMFA 2W4MA 4MLCA 4I5GA 2JAWA 4NOJA 5G0SA 3WB2A 3F46A 1QAOA 2HF9A 3QY9A 2D1YA 4YDHB 3ZCXA 1GV0A 2FZCA 3CZ4A 4AKGA 3PF8A 3TMYA 3K2BA 1TC2A 5KYUA 4Q6BA 4HYQA 1EB8A 4BGDA 1MRSA 2EZTA 2GTPA 4DMKA 3QITA 5EQTA 1B6TA 3K6RA 5AI9A 2IHYA 2QYHA 1YVDA 1KU0A 2ID4A 2WSSA 4UUMA 3RUPA 4BNFA 4MHTA 1DG1G 2NZXA 1KDOA 5BV7A 3OMWA 3T1VA 2VQEB 1H8HD 2ZWOA 3K73O 2QL7A 2R8EA 3DVAA 4NX2A 2KX7A 2P0YA 2P2NA 3EUAA 1ZJ4A 2FUEA 4R8KA 5E1MA 1YKGA 3C1TA 1ENOA 3G8BA 4BP8A 1JVNA 3CCFA 4HLUA 3UCFA 3WB1A 3BJEA 3VPBA 2A7QA 4IFEA 2DBZA 3W6OA 3O8RA 3EGEA 1SC4A 1UBNA 3C8HA 3EEIA 4QDTA 1LX7A 4AAYA 4GWLA 1CETA 1J07A 3HH8A 4JI6B 4KITB 3OWHA 4BO0A 1EVEA 2CSXA 5FLXA 1TL7C 3C3XA 1NVKA 1Q84A 5KKAA 1QBKC 4OQLA 1RHMA 3D8HA 3S68A 5EHXA 4KHPB 4UAGA 3LS2A 1XVIA 1PVDA 2VSNA 1G4UR 1D6SA 5B37A 3RRBA 1NF8A 3KVVA 5HJ2A 3RTGA 4TMTA 4DYDA 2O4UX 1XK6A 4L0MA 5G1PA 5HGXA 2GD0A 2ESRA 3WKCA 4DRYA 1KO4A 4AUNA 2IJGX 1U04A 3TXXA 1P5ZB 3VPDA 1FJXA 3WLIA 1IJKA 1Z62A 5H1YA 2A57A 3VNRA 1SKAA 4OK6A 3ZDRA 4CI9A 3GGGA 4B81A 2JJYA 1XU9A 1OASA 1R4ZA 1PJ3A 2B6HA 2GNAA 2O1WA 3E8XA 3NU1A 3OZSA 4XYMA 4X5OA 4QEZA 5G53C 3DXFA 4OAPA 4FYWA 5CM9C 3FTFA 1NJGA 2OECA 2FDRA 1ECGA 3BA1A 3IEVA 4QTTB 2QQ5A 2GHIA 4QPJC 4F4IA 1EXMA 2PZEA 2HNAA 3P8ZA 3WYCA 5IVIA 1CR1A 3DKRA 3JQ8A 4UMFA 5KTTA 1H5QA 2WU4A 4BKUA 2Q1YA 1KC1A 2C97A 4DV1B 2CNBA 2O3JA 3GN2A 5IMSA 1RQRA 4QLAA 5K3EA 1R6UA 4DIMA 4RSRA 1UAYA 3DXXA 1RLUA 3AJEA 2VTVA 2WYVA 4DA4A 3QE4A 1JLHA 2OQ2A 4HADA 5DHRA 4PZUA 1BHQ1 4KJZA 4LSMA 4DSOA 1R9GA 4AP5A 5TXGA 2W22A 3SR0A 2V9ZA 3QLJA 3QXJA 1W30A 5JT1A 1JEQA 5FFNA 5KYYA 2DERA 2WWWA 4IIJB 4B83A 3N0RA 3KJIA 3BQ9A 4LE2A 5JNTA 2EIXA 3FWZA 1V4BA 3DVSX 3EXHA 4RNDB 4V0KA 1T9CA 1VHJA 2BV3A 4PCLA 1BG6A 3ZBUA 2D1FA 4QHSA 4ZGGA 2RI1A 3ZBQA 1CDEA 1OFUX 3CVUA 5BYKA 1P0IA 2Q62A 4AVYA 4HF7A 2CL5A 4MV9A 5C81A 2DB3A 4D56A 4KKXB 1IL0A 4F04A 4DCNA 2B9VA 2C2XA 2QI9C 4WE3A 1YZHA 3E7DA 3IAFA 4YJDA 1ODLA 4ZAZA 1YZYA 4D0GA 5JBIA 1BWPA 3N2EA 2R6JA 1YDFA 3PFCA 3IOEA 3NYWA 4NMMA 1A4RA 3AB3A 4HFMA 1UJNA 1I0ZA 3DWEX 4Y1FA 1F38A 1FBTA 2OBXA 4AG5A 1AKMA 5B57C 5H8WA 5C8DA 3LUDA 3OKFA 3OFJA 5C53B 3Q3EA 1M2KA 1XCMA 4IV0A 1AGYA 1R0WA 4PBSA 3L9XA 3RH0A 2V3CC 2K2QB 3IP5A 1XTRA 4XCQA 5K05A 2PRZA 1YK0A 2UUPA 3H99A 4G0VA 1PYDA 1P4SA 2AFIB 1ACMA 2NT3A 4U2BA 3LKDA 1Z38A 4MWCA 5JDCC 4GP6A 1GYPA 5DTRA 4AO6A 1KPHA 1JBEA 1Y8CA 3MGKA 4FHZA 5KTPA 4G0UA 5EJMA 1BMDA 1GT91 2RMKA 4WN9B 3RC3A 5MGNA 1FMCA 2QTRA 2WG0A 4U7HA 1SKBA 3L18A 1R88A 1Q17A 1VSQA 2MDTA 3U39A 4RORA 1HNZB 2PMWB 2W2LD 1EWRA 1EM6A 3ELUA 3EE6A 1J0AA 2VYNA 5GOTA 5IDYA 2W8BB 1MT3A 4ZQGA 4PYLA 3NHJA 4ZEWA 2R48A 1XUOA 3CNQS 1LH0A 1UKAA 4M9RA 1LY1A 1T0PA 2IWRA 4ER7A 4GLLA 3MC1A 3QHAA 3RHFA 1LLUA 1NOIA 3SZOA 3TL6A 1RC0A 4F71A 3LOQA 4B3GA 4O2RA 1YDHA 4GP7A 1DJMA 4QAJA 3IMEA 4Q01A 1ORWA 3TTSA 1E2JA 3UV6A 2AOWA 4QL3A 3UJ3X 1XE3A 2ODPA 4O5OA 5T4FA 3MD0A 1E66A 5IABA 3LP6A 5G2OA 5L7WA 3BFVA 3AW8A 1LUAA 1QH8B 2J5QA 5JSZB 1KERA 1U2DA 2OWEA 4M83A 4UM5A 1XZPA 3R7FA 3DZJA 5ESXA 4ZD6A 2IX3A 2BFOA 1WE2A 4GMHA 4U9IS 4DABA 2IHKA 3OZGA 1Z0AA 4L0DA 3NEPX 1O7JA 1NM5A 5TQVA 3BMQB 3UV7A 4G4SP 2NZWA 3OIFA 1MH1A 4H16A 4PINA 4TVSA 1QNLA 4HNSA 3ZEAA 4LK3A 3RS7A 4N5HX 2UXDB 1IHUA 1BS1A 1EDZA 2C58A 5JAUA 3EPJA 2P90A 3QPUA 2PNJA 2YWGA 1ZD4A 4PC3A 5AHKA 3AR6A 1KYVA 2R87A 3LBNA 3UK6A 5KIAA 4N7MA 4XGNA 1M5RA 1XKXA 2FEKA 3W3ZB 3KSZO 3I04A 4KLNA 1FUKA 2M9MA 3EHEA 3VPHA 3ND9A 4Y6GB 1KAGA 4TLDA 4CKWB 1S8AA 1DUIA 3AQIA 1YV9A 1GSHA 1SCJA 4Z4IA 5JQGF 1UMCA 1C4WA 4U63A 4K9DA 4TGLA 3H2BA 4U2GA 1XKQA 2HK8A 3JD3A 4RJIA 1M1YB 3CN9A 2PBLA 3B1YA 4O4HF 1Z25A 3IP8A 1WF6A 4TXHA 4B82A 4Z2AA 4JLVA 3EH1A 2BDEA 5KNBD 1YR6A 2VSOA 5B5SA 4CTOA 4BVJA 3HGTA 1EJBA 3PU6A 1J5XA 2PJDA 1TCUA 5JMPA 1RWMA 3RIGA 3PD7A 4CM1A 3U49A 1VBMA 1Y9JA 5A0VA 1J1ZA 1LPAB 1HLPA 7MHTA 4HAVA 3LDHA 5JSKA 4GECA 1L7OA 1EUCB 2FU5C 1DBSA 2H48A 4XJVA 1FLDA 1LVGA 1SG6A 3GZJA 3MUEA 1PAUA 1IC6A 4IX1A 4MCAA 4XOUA 4DA8A 4J16C 4J29A 4HR7A 2WLSA 3IX7A 2F8SA 2CYAA 2OY0A 1MG0A 1XZEA 1W2HA 3K09C 3S2ZA 4DXHA 1TF2A 1C0IA 1BOOA 1DJQA 4KGZA 2PXCA 3FB1A 3FCYA 3UHPA 3RTCA 1XMJA 2J0SA 1WMDA 2TMYA 1L3IA 4P4SA 4HB3A 1X70A 4RZHA 4X61A 5HQJA 4Z4GA 1NYQA 1YKFA 2DPYA 3T4XA 4LHSA 1AT1A 3E3NA 1S0UA 5B2ZA 1GXSB 3C3PA 4KPFC 1IM2A 1FY2A 1K3FA 4DLVA 3PGMA 1X1BA 2O8BB 3PNOA 3T38A 1Q7CA 2WD7B 3KT8A 3TYXA 3GGOA 1I10A 4GEKA 4UC0A 4QOJA 5JJ5A 4QKQA 4K9KA 4L02A 2H7CA 3NBZC 1I4OA 3IDSA 3IULA 4DBZA 5KS2A 1OB2A 4MS4A 5ETJA 1RZRD 1OREA 2PWAA 4DLAA 1BMTA 4KIFA 1PX2A 1E2LA 2B25A 1WCYA 5CB6A 4GX1A 1RFGE 1CEQA 1U0EA 2C61A 2ERXA 3OOHA 3D5TA 3I23A 4BQFA 3UIEA 1ZCBA 3Q9LA 1RHRA 5FPQA 3H5AA 1AGRA 3CEHA 4ZT2A 5GJBA 4WGGA 1SCIA 4Z49A 4LRQA 3JRNA 3M9WA 1JJFA 2QRPA 1M6YA 1I0IA 4Q3KA 3A25A 1J2EA 1KDTA 2AFIE 2KMLA 3JW8A 3BH7A 8ADHA 5HJ7A 1Q0SA 4BNNA 4J6FA 4K8RB 4DPLA 4BAZA 3D5QA 2O8FA 4KJXA 3CVVA 1ORHA 2B8EA 3EQ7A 5HZMA 1TM2A 4KRXA 4Z0NA 3EZLA 4BJ1A 3PGLA 1J6UA 3UMSA 3EFHA 2ECPA 3OT4A 1RLJA 4GQAA 2VHXA 4I5EA 1XNQB 4EG4A 1ZMXA 2XIJA 3DE7X 4AYWA 1NN3A 3TLGB 5DCWA 4RDHA 1VKOA 3VO9A 2B1JA 2YZKA 2GAOA 2F9MA 3C97A 3B6EA 3QE0A 4XVRA 1Y6FA 2PX6A 2UVQA 2BELA 1TADA 3PQCA 3PXAA 1TXGA 3WA7A 1M2GA 2I33A 1Y1TA 4MUHA 2YQ4A 4Y9RA 1JFTA 1LV8A 3LLUA 1ZNXA 3ZGYA 4CL2A 3GDGA 4CCSA 2CT8A 1KSFX 1I2BA 2YRWA 3A6JA 3A1NA 1FTWA 1UODA 3RK4A 1CY4A 1VCMA 3PB3A 1Z5UA 4F2GA 4REMA 1B8PA 4Y7DA 1H05A 2TRSB 1A8SA 1ZJWA 1M6VA 3ZHOA 4D4JA 3TQFA 2FWBA 2PM8A 4R1LA 5LQDA 2H2HA 3TZLA 1D09A 3Q85A 3HO6A 1YBFA 5J1TB 2HPAA 3IXLA 5DTJA 4MKRA 1NNUA 1CRQA 4LRWA 4DFDA 4QQNA 1WVMA 3CLRD 4NAHA 1ONPA 3G0GA 4O2LA 3EPRA 3OT1B 3QNUA 3T0GA 1J06A 4C9BA 1JMVA 1HT0A 2CFCA 2BC9A 1QGYA 3JAWB 3VI4B 3DKVA 2Q5FA 4DCMA 5HHTA 4JVNA 2VYVA 4KR2A 2YJ6A 3VR3D 2ZWMA 3ELYA 1OF1A 3WGTA 5FV4A 1P6UA 3IIMA 4BEVA 4WT7A 4N0MA 1BW9A 1H0HA 2WVAA 3NGLA 2IITA 4QUGA 5I5EA 1XDWA 4OD0A 3VR4D 3A4LA 3AGQA 1XD9A 2ETVA 2XMBA 2D4HA 3ELDA 5KB3A 4G97A 5A2GA 3ISVA 4PLWA 4Y30A 3A11A 3HWSA 3ORSA 4MV4A 3L01A 1GNRA 2OZLB 1L7BA 2AVDA 2PS3A 3GFSA 3HJUA 2X4LA 1TA0A 4MIOA 4RD4A 5CT6A 1T8RA 2HXGA 3DOFA 4UW9A 4FR5A 3P4YA 1CZOA 5BV0A 4EHAA 3HKCA 2J3QA 3ASVA 1C9JA 1GQSA 2QPTA 4LZPA 1W36C 1BEEA 3P2IA 3NC0C 1GITA 1O5IA 3CTPA 3NCTA 4NYJR 3HV2A 3PJRA 4LJYA 3GVHA 1AG9A 3SZRA 2CZGA 3FNFA 4W1RA 3WIUA 4CKBB 1U28C 3MHTA 4XQ9A 4ALIA 4ZU1X 4L0QA 1Z56C 1C7RA 1N1DA 4J7CA 1AGXA 2EEPA 2X1MA 3AKEA 3KQSA 2ZAYA 2FB9A 4Z0TA 3SM9A 4WKPA 4BEBA 3RG2A 2AC4A 3KJZA 3TW4A 2GSWA 5EIWA 4EPYA 1NJ1A 2PWPA 3TLMA 5FFFA 4D96A 4OXXA 4OFZA 1E4EB 4DA7A 1UT8A 4Q7LA 1N9GA 4PQGA 1F48A 1RJDA 3FUVA 3KZXA 3LSTA 2FSIA 2C4TA 3TSYA 1EZZA 2Q28A 2PRIA 1PFUA 3NP9A 1I0LA 5JSYA 3KOMA 1ORDA 3EAGA 4LHYA 3IHWA 1DTWA 5THQA 4HAZA 5JFTA 4GAEA 3F2VA 4JQOA 2X8JA 3HR7A 1UC4B 4BB0A 4BVHA 2AN3A 2IA5A 3GLHA 2R60A 2GZ2A 2G0TA 1VE7A 2VDQB 2JFWA 4RA9B 2H0QA 1M2WA 2PKRA 3K35A 2O2YA 1W4AA 4RK7A 5JXJA 1GFZA 2B7LA 1A4IA 1DDOA 4NAVA 2IPAB 3K5PA 3SHFA 3HKBA 4MA0A 4LA4A 4NFYA 2ZUBA 2JI9A 2QRQA 2A94A 2H7VA 4RX1A 2Z95A 4UHKA 3KVOA 3A9SA 1ESNA 2IHJA 4PC6A 2BDTA 3RK1A 2GJ4A 3W5BA 3PPYA 2FJUA 2FQWA 3HWX1 3OZRA 4IR7A 5GV8A 1WDLA 4O63O 3EC2A 1W85B 2OD7A 3G68A 3WC4A 4AJLA 3WLQA 3CG4A 1LX6A 5EE5B 1JTFA 4W63A 4OHKA 3WRWA 4E5VA 3KZ1E 1KY5A 1XCLA 1GQFA 3EVGA 2BFMA 2VZ9A 1P7WA 4KMMA 2H18A 3D6FA 3OQPA 4L9WA 2PPVA 3VDMA 4CMEA 1V8FA 4MCJA 4BE4A 2W2KB 4OXQA 2R5FA 3AF2A 5ITZB 4B87A 1G2IA 2O2IA 2OK8A 1ZIPA 4LSZA 3WAJA 3UK7A 2H4ZA 1KBOA 5ICSA 2G67A 1LLFA 1MAAA 4F7WA 2Z3WA 1D4OA 3KXIA 2O20A 4DAOA 2IXBA 3EG5A 5DU2A 4AJ9A 4B32A 4ZCRA 5BVGA 1V1RA 3IEIA 1X86B 2ZI6A 4QUJA 1RMYA 3ZXUB 1XDGA 3F47A 4KBGA 4WACA 3I2IA 3TR5A 4CM8B 1J9GA 4GMXA 2ZRLA 4M9UA 3NVMB 4PBTA 4QU5A 1Y3IA 4N0DA 2HDWA 3W9SA 3AC0A 3MS4A 3WDMA 1Z8FA 1GPUA 3GX1A 5ALPA 3W1WA 4NKRA 2RCYA 4RZ2A 4BQOA 1VMDA 1EK5A 2GJKA 3N2ZB 2FVXA 2GCOA 2EFYA 2I66A 3FLEA 1NBME 4NJOA 1EYZA 5DYYA 2ZRAA 3SFZA 1FQWA 1GUYA 3IMFA 4JP5A 2PUGA 1QVRA 1ACJA 3KQWA 1V3VA 1LBTA 4AZVA 5CBKA 4XDHA 4II3A 5HVNA 2JRCA 1JU3A 1I4EB 1C2YA 1LNZA 3R76A 1Y6RA 1E61A 4AXXA 3WK4A 1SXJC 4I8XA 2G06A 4UJ5A 2HA2A 1E6EA 3FAZA 4XRRA 3MTJA 3OHPA 5CM2Z 3MWLA 2GA9A 2GZ3A 2POCA 4WOKA 1RTKA 2X8BA 2PJZA 1U5BB 1I5RA 2O1SA 2VZ0A 2IOFK 3VX3A 3PWZA 2E21A 4ZHQA 3F3YA 4DJJA 4L8YA 2C5SA 2HC9A 2OGWA 2AS0A 2R8PA 3ICWA 2WAAA 4C7KA 2JC3A 1ESMA 2PG3A 1T25A 2WIKA 3D4OA 5JNSA 4HPWA 3UWSA 3BVPA 3SG0A 1E2FA 1KH3A 2G72A 2HJWA 2WF9A 3R0VA 1U8XX 1NV8A 1XPUA 3FDJA 1S4MA 3IIJA 1SOWA 2Q5CA 1H22A 1LA2A 4AMUA 3ZJYA 5EPEA 1RRCA 2D5AA 3SYMA 1TJYA 2V03A 4QOIA 1KGSA 3JQGA 2C4KA 3FRIA 4ZU6X 5FO0A 3GQVA 3T9BA 1QYWA 2O59A 2Z8ZA 1ZRMA 3D2LA 1SHKA 3ZBTA 4DNFA 1FVOA 1XLTC 1WW2A 4WXRA 4UTVA 2V4MA 4AM8A 3M89A 4L8LA 3HE3A 3DDUA 2Z1NA 4H60A 1BQEA 2WHQA 1P2TA 3HABA 3K70B 1A9XB 1Q1ZA 1UJ6A 2OA0A 1SD2A 5JR3A 4U7TB 2XZOA 1FS6A 2XTMA 5TQ0A 5ERGB 2WWFA 3UAXA 2WPNA 2HUPA 5JJLA 4TXLA 1NT2A 3FVTA 2HW8A 1PCXA 4UUAA 1SC3A 2DTXA 1BWSA 3EDCA 2XMDA 4ZGWA 3LUAA 3CO0S 5DSZA 4C0XA 1FVHA 4RF4A 1KKMA 4MAFA 3O90A 5JBQA 3P96A 2OB1A 5A1TA 1PFWA 4TYQA 2X5OA 2FMUA 4XYLA 2F1OA 1NVVR 4JC0A 3ICCA 1E1CB 7YASA 5EXEA 4YQYA 1XHEA 2P67A 5HDQA 2V6IA 4PSAA 4Q3BA 4HDMB 2E48A 1N57A 3KU1A 5F51A 1E3LA 2YRFA 2GPBA 4TYMA 2QBYA 4OKIA 1VXOA 5KJCA 5BXQC 4C4PA 1E89A 4JASB 4QSHA 4FFNA 3WIDA 3SDZA 2B1QA 2BSAA 4F4DA 2GEUA 3EDYA 4M9XA 2PIDA 2O2XA 2ZGVA 1VL0A 2B1IA 2R4TA 3C48A 4JIMA 2O2EA 3GLKA 1SURA 2RJ3A 3RNLA 3TM4A 4B76A 4KE9A 5IBCA 1POXA 1UWVA 4TWJA 2BKAA 1SUIA 3PVZA 4ZOBA 1G2PA 2W6CX 4DF3A 3D0QA 5BORA 1GRVA 1YULA 2YFKA 2G9VA 2IZOA 2NTNA 2OORA 3HUEA 4R6WA 4C0LA 1QVZA 1G17A 3UOAB 3WXBA 3GVPA 3DP9A 3GW8A 5IVHA 1YI0A 4ARAA 4AFNA 5DBHX 1N5LA 1ST3A 1W96A 2FUG6 5ADHA 1EESA 3I2FA 3LHDA 1TVCA 2AOTB 1IHPA 1V3QE 2H2WA 3N0WA 1NPTO 2DWQA 1HUQA 3H0EA 4Q15A 5L51A 1KRXA 3OJCA 1GCGA 4KPUA 1ZDMA 3PDHA 4O8ZA 4GT1A 4RVCA 1VGVA 1Y1PA 3GQBA 4ZOLF 2B5WA 1HPLA 4HWRA 3AK4A 1CYEA 4AZWA 1HNXB 1UDBA 5FI5A 3CSDA 1A7UA 2Y4OA 2FPMA 1I3OA 4MTLA 2WKQA 3M9LA 1PYGA 1FP4B 4J0FA 4QGBA 1RYFA 3AH8A 3KTAB 3KT3A 3GEIA 3QFSA 3VJMA 4BO1A 3K9CA 5LZ2A 4NRDA 4FYMA 1I5EA 1Z5ZA 3E35A 3EF1A 5HUHA 1BDIA 3OURA 4EITA 3PTLA 2I91A 5LQJA 4DB2A 1RJ9A 4EPWA 3UTCA 3DT9A 4LHVA 1HC7A 2X8AA 3E58A 2HH9A 3F97A 1R8QA 3ZWKA 5CB4B 9GPBA 1KFKB 4DEYA 1XCGB 1W2GA 2ZAOA 2ONJA 1XYVA 2UKDA 3DHEA 1E6CA 2OV3A 3PC4A 5KYWA 2IYUA 2QTTA 2R79A 3OX4A 5K09A 3S1SA 4IAOA 1EBFA 2FRDC 1NJ8A 4S1VA 4TL6A 1XA4A 4MKFA 3RHSA 5KNCH 3PQ4A 1Z5GA 2OHJA 3EDQA 2PH1A 4L57A 3WMEA 4MQMA 3JR7A 1GPWB 1HWYA 4NMXB 4PFKA 5DYIA 1KDZA 3RVLA 1TK9A 5AVQA 1C0KA 2A59A 1R3DA 4E94A 3BIJA 5EZSA 1IJBA 3NTUA 1CRZA 6AT1A 1XI2A 5HFAA 2CXPA 3OG9A 1Z7YA 3FF4A 1U0LA 1VI5A 1CD5A 1HFJA 2EP8A 2G1UA 4OV6B 5IAKA 2J5BA 2AMLA 2BISA 3TOXA 3UWOA 2XNDD 4JNCA 1I3MA 2NX2A 1GGMA 1UKVY 2IZ5A 2I99A 4LOHA 4RGQA 3G1TA 1Y3HA 3D3NA 4MVJF 1DO2A 3TD9A 3AR7A 3KYCA 4ISBA 3ZY6A 3JV7A 4B4UA 4D79A 1IBSA 4WXPA 4KXVA 6REQB 4TKLA 2PKYX 3G7NA 1ODTC 4H27A 3EXFA 4XR9A 3T1NA 4WUVA 5EMLA 4BZWA 2ZB2A 1LU9A 4OXNA 2JGAA 3Q4GA 2G9UA 3TW8A 1WV0A 3ENWA 3MFYA 1DC3A 4BNJA 1UFVA 2D59A 2FPIA 3OD1A 5G41A 1FU7A 5JASA 5K8LA 1EBBA 1XTVA 1F9AA 1JNYA 3SIPA 3KFXA 4K6OA 4RY0A 4MQFB 2OZVA 1PN3A 2QDKA 1AJEA 2YJNA 3AHCA 5KYXA 4HXYA 4JA0A 3T54A 4Z9BA 3GIWA 3Q8MA 3ZU3A 1SXGA 5IJ9A 4TKUA 2AWOA 3BREA 5KBYA 1F2TA 4FJ2A 2ZBGA 5I7SA 3RAEC 4KX3A 4Z0HO 2OFFA 2H92A 4KO1S 3PFFA 4ZO4A 4CT0A 3DQQA 1USUA 2Q5EA 3OJOA 4IHJB 4L85A 1HORA 1NAIA 3KSMA 1KK2A 4XQCA 4BQEA 3JVDA 1FMTA 4HQKA 4CEJA 2IS6A 1VKNA 3PNBA 4JT8A 1E3TA 3CT6A 4LGYA 4YRFA 3LQQA 4R81A 3A6LA 1BQ3A 4JJEA 1W36B 2X2PA 3D02A 3IEPA 3GMTA 4NDNE 4UTPA 2B2NA 2HKIA 2R7KA 3CCBA 3C6YA 1HK7A 3USZA 4DLRA 5F78A 2XVXA 3A26A 3H1FA 4QGFA 3BHIA 4OG2A 5F98A 1RM4A 1VB3A 4G0NA 2C94A 4CN9A 3OX3A 4XH9B 2QSZA 2O7SA 2ATIA 3QOXA 5J5CA 2VAPA 4GR9A 2B5OA 4BFUA 1LTHR 3LPNA 1YNSA 2B61A 5JNVA 1GUZA 4DDHA 3KAKA 4QODA 1GQ2A 4O33A 5A3SA 4B6GA 3PL1A 4D80A 4Z9YA 3EZ6A 4Q1VA 2EG9A 1HBJA 3H2IA 1TAUA 3QNMA 2QNRA 3DBHA 3NOQA 1PVVA 4FOSA 1ULSA 5LZ5A 1KQGA 2PSHA 3DEYX 1FSPA 3L0OA 3A1VA 5SY4A 5KYNA 1YNOA 2BHLA 3G59A 1ZZEA 1M2EA 5F76A 2ADFA 2C4VA 1DXQA 2VQ6A 4E31A 3HSYA 1XHFA 3RKSA 1Z63A 1CJSA 5FX2A 1IQUA 5EWLB 5LBIA 3W4JA 4BN5A 4Z7NB 2WDZA 2Q3EA 2LD4A 4Y6PA 4QTYA 4IIJF 3P2JA 4JT9A 5ERYA 5EUBA 3EW9A 5FPTA 1CR2A 4W82A 3VU1A 4D4HA 4BXOA 4ITRC 3BORA 1JA0A 4RF5A 4K6GA 2FP4A 1G8JA 3D6TB 3FSEA 1EFVB 3M0EA 4KPEC 5AW5A 1JJBA 5U4XA 5IT0A 4YFYA 3GJYA 1SVIA 2CE7A 3FMIA 3EIXA 4FYXA 4L07A 5LP6F 3KZMA 4X85A 1CWUA 4E5YA 1TM1E 3TSCA 3AFHA 3C70A 2HMYB 5CVJA 2CJXA 4HQOA 1WUYA 5ALWA 5K2OA 1E5XA 3A6FA 1JQEA 1QHHB 4J0EA 4ZVNA 3KB6A 3GLGA 3DO8A 1V8PA 1E18A 1M1UA 2VNIA 3LX8A 2ZT7A 3VDNB 3GJ3A 1EINA 1YRYE 5K8JB 3I8XA 4PO3X 3CF0A 2ZT5A 3GT3A 3HDHA 3SR3A 4JKYA 2E4YA 3NBXX 2AJLI 1FU8A 1XK7A 3GO4A 5DX8A 4CM9A 2AYYA 2VT7A 3GUCA 1O2DA 3PT5A 1N9KA 5JS1A 3HI4A 4R2IA 1NLZA 3H5VA 3U1BA 4F6RA 1TKAA 5ESDA 5BPFA 1IM8A 1SOUA 5A9SB 2CKMA 5IBQA 3V4VB 3D6VA 3RSSA 2QP9X 4CJXA 3WDSA 2HSJA 3IFSA 3ZTWA 4FKBA 1UQUA 1FLNA 2O0MA 1XXHA 3CLUC 2CZCA 3RVKA 1DBWA 3GLIB 2FN9A 3E7WA 4Y6SA 3T3IA 4FI3C 4TV9F 3BK7A 1UKYA 3KOUA 4IY1A 2FPRA 5EJIA 4BKPA 1ORIA 1U7HA 3ZD7A 1ULUA 2HMAA 1GOTA 1PQ4A 3TIGA 1X1TA 5G1OA 2QJFA 4Y2SA 1F6BA 1SPXA 1B8UA 5B7NA 5MFZA 1JJAA 2WIFA 2XYPA 2Y8EA 3PIRA 4GZ5A 4J0KA 3TB4A 1P18A 2EFCB 2HQSA 3E48A 3R0QA 4R9UC 5G4KB 3S5JA 4UE6A 5B12A 1FMFA 1TQ8A 4HX2A 1WX1A 1F2UB 3TDNA 3IC5A 2NACA 3SAJA 4DXDA 4DY6A 5T4HA 4EB3A 2AR0A 1WETA 4NABA 3DLPX 4YAFA 4E2FA 3GLGB 3LZDA 1SXJB 1DXYA 1MH9A 2H1VA 3PRYA 4I4TA 4QIHA 1F4VA 1QDLB 2LCFA 4UUQA 2I1WA 2LE0A 2ONKA 3KM0A 1XWWA 4O4LB 4YRJA 3KPVA 3RSQA 5DO9A 4DILA 1CQPA 2MMGA 4C20A 3GRVA 3U0BA 1ETHA 1NHGA 1RRVA 3P2KA 1R0YA 4BJ6A 2VSQA 4Q3AA 1EFUA 4PVCA 2CVOA 2EDAA 2EX1A 1KKLA 2ODTX 1PIWA 2VJYA 3HP1A 4Z53A 3L41A 1IBRA 3CNNA 4KW7A 2RIPA 2FPGA 4RPJA 4MAAA 3IE2A 4B74A 3F5FA 4M87A 5KOJA 1C1DA 4ZMRA 1V5WA 2QTBA 2LGJA 1JG1A 1HDIA 1BE8A 3VYRB 1R4NB 2BZSA 3ASUA 3WLHA 5HBGA 4EGQA 1F14A 3C15C 4HMOA 4PC2A 1PZFA 2IP2A 2XAAA 3LLVA 3K96A 4JVOA 3I76A 1ZK1A 5IWAB 1P0MA 1ZQ9A 4XWGA 1M0EA 1UXGA 4BE7B 1LBIA 2P69A 4B79A 4BNDB 3V8QA 1JTEA 2XTZA 1WKBA 4QAQA 4TRMA 1WSDA 3A9UA 3QOYA 1A95A 4ZO8A 5LDHA 3ZNOA 1AF4A 4ZYLA 1P91A 5TX7A 5GZ1A 4CEIA 4EO7A 3U5TA 5I3CA 1X19A 3ORFA 2WE8A 3E84A 3UWKA 1W1UA 2D7CA 4Q47A 4XWYA 1J4AA 4A91A 4BQQA 1FX1A 1JQ3A 2PD4A 9ABPA 4JNKA 1FIUA 4H6PA 3GR6A 1SZJG 4QATA 1BHO1 1JIUA 2L69A 3OFNA 5JYDA 3OUTA 4CG3A 3L8EA 3MTEA 5BMVB 1I7QB 1GU0A 1U2EA 1II8A 4HNTA 3N8DA 3R75A 4Y2GA 5K0TA 2R8XA 2H2GA 1NPDA 3IAM6 1Y7TA 1LQUA 1Q0HA 221PA 5AW4A 1Q1BA 2HM7A 4ARVA 2OP0A 5F2NA 4OBWA 4MDEA 1TO2E 3QA9A 5IUKC 4FR2A 4RDIA 4JI5B 3H3XA 4G0QA 1Z17A 1BRTA 4HVLA 2P3LA 3IVRA 4TKVB 3ZGNA 4H6VA 1E2HA 3PGJA 2QQEA 4UMDA 5EXSA 5A71A 2CF5A 2EBFX 2ID8A 5LA6B 3GA7A 3G89A 3B2EA 4IUCS 2CNOA 2MYTA 2FE1A 1Y5LA 2HR1A 5ECYA 2OD2A 2HRQA 1XZMA 3ANYB 1GL9B 1CUXA 2O05A 4HYTA 1JB1A 3QG1A 3CRQA 3PR1A 5EXPA 4A8HA 2IKQA 2WE7A 4KDEA 5DTEA 3V8BA 1YJAA 3V97A 5DOZA 1XNJA 4U5QA 5FLKA 1QYXA 4KN9S 3MUFA 1D07A 4GLFA 1JHMA 1MABA 4OHPA 2XT9A 2OBBA 2C20A 2L19A 1E2BA 1SUEA 4ERNA 4KWTA 3DBLA 4PG4A 1QIJA 2ERYA 2B2XA 2WJPA 4IJKA 2X4DA 4GMDA 2FSHA 2VYQA 1GAJA 5JZBA 5DI3B 3AUAA 3O4IA 1MNAA 3PXUA 1JSXA 1V48A 4M1MA 2QLTA 1RABA 3G0OA 4US0R 1VFNA 1XNGA 3BIOA 4G67A 4LZZA 4CMIB 3BCSA 4RTMA 5H4GA 3TTVA 3ANSA 1SBQA 1UZAA 4S04A 3KV1A 2AN5A 2ZU0C 3ZIUA 5B7PA 1QC5A 3D2BA 5HOQA 3OQ6A 4KEAA 1RRMA 2BKXA 3KX2A 1JPJA 1M1NA 3GF4A 1L6RA 3OIVA 4DBLE 2HA7A 5M2QA 1WPQA 5LZ9A 2O3SA 1SWWA 1TT7A 3F2IA 3MUNA 3CISA 3PNYA 1IK6A 1RYZA 2AWNA 2HOQA 2ODWA 4MR9A 4D1YA 4DC1A 2HTFA 2VTBA 2AFRA 3SLRA 3NEJA 1CX9B 4K1XA 3QQPA 1T2AA 2GYUA 4G1EB 4Q82A 4XGIA 1SXIA 4ZT4A 4HHEA 4XGRA 1CERA 1K2VN 1RJFA 1BX1A 3G49A 4BGUA 2YMLA 3UAWA 2REQA 5F9FA 3QVVA 5EE1A 1E1DA 1KTIA 1NUAA 1AU9A 2OKCA 4U39A 4F2PA 2HMWA 4WN3A 5K9ZA 4AK9A 4DARA 3K1ZA 1JPVA 3WNZA 1GNQA 1HXHA 3FVVA 1SXJE 3HYRA 1TVEA 1G66A 2C2YA 4JSTA 1XZFA 3OKCA 2YN0A 3NDPA 1Y0BA 4TWBA 3WYGA 3NJRA 1CTQA 2CFIA 2NUBA 3FYUA 3OVMA 4KWCA 4II2A 2XUAA 3QX9A 2P9ZA 4QFMA 1M1ZA 4YVFA 1ECLA 3SYKA 2OCLA 3BFPA 5KNDA 2ZJ2A 4MGYR 4IZ6A 3W2HA 2FSVA 4N6NA 5JEEA 2PUCA 3PGA1 3Q6IA 4GC9A 2F3PA 3TLXA 2AQKA 1Y63A 4GFDA 4KUGA 1RCTE 3PDIB 3FZGA 4URYR 4MYTA 4EJ2A 1U3WA 5IW8A 4Y2JA 3A1UA 1T26A 2WSLA 2HA5A 3LMKA 4QOSA 4PG8A 3C3CA 5AK6A 5LFAA 2V74B 3VZPA 2PYDA 4R9SA 3WRXC 4W99A 5GJVC 1XD2B 2GRJA 3LC2O 1KYTA 2OFWA 2CDBA 4ZAVA 1DWUA 3GJQA 4P5PA 2EW2A 3DF7A 3PX3A 2HN9A 2J3EA 4LE1A 1AKWA 1B8NA 1MO2A 1FDIA 3QPCA 1M72A 3U4HA 5KSOA 4BMPB 4C0JA 1NURA 3TSWA 4UDNA 1PL7A 2IXTA 3ER8A 2QYSA 3OE7D 4GXTA 3K70D 3UATA 2V8OA 2XCQA 3WTCA 1HOTA 2VP0A 3R4VA 1CLEA 2VF5X 3DDZX 1Q7TA 4INZA 4JX9A 4DN6A 4Q4HB 5EE3A 2UYOA 1CK4A 3IQGX 2I29A 3VZCA 2XODA 5JLJA 3CVJA 3FNQA 3W5CA 5B3LA 4HQLA 4JBHA 4N03A 2HK6A 2Q4BA 1MB0A 3BKXA 3OFSA 3IDAA 4YGYA 3KR2A 3HVHA 3I9KA 3ZI7A 2VZ8A 1GPKA 4Y2QA 4E22A 1FFHA 2HCJB 5JW6A 2PX8A 1RQPA 1YZQA 2MINB 1JW9B 1MEJA 2ZJ5A 3PCRB 4U7PB 5DM2A 5A0TA 4M4SA 1DRJA 3QKIA 3RC9A 3ZTTA 5KCZA 5F64A 2C3PA 4WJLA 2CNNA 3SM3A 1BIFA 1NIJA 2GNOA 1YFZA 2RAPA 2WIBA 3LF2A 1H0RA 1HTWA 3F3SA 3UWMA 1EM8A 3V2HA 4Y1GA 4JELA 1MG5A 1NLMA 1A8QA 1WPRA 1JHVA 2WKWA 3E9YA 2C7VA 4NJEA 1MFZA 3LPCA 1L4UA 3MRSA 4RM2A 4YTEA 5H68A 4E1BA 2PUWA 2QM8A 5MN4A 4MXDA 4MW4A 2JGFA 2IS4A 1YU6A 4J6EA 4QSMA 5AHOA 1Z4MA 1BEUB 2VJNA 4EVSA 3OIDA 1E2MA 4Y2VA 2ANCA 3QKWA 1KK1A 2VUSA 5AKXA 4BMVA 2I7VA 5K99A 2H2DA 3AEXA 4JDUA 5CP8A 5JCJA 4JGIA 3VKUA 3EVCA 3T15A 1A72A 3L7IA 3CUTA 5B53A 1MMFB 2OBNA 3QPDA 1WEHA 3F67A 4PO1A 3SQMA 4L4UA 4OGWA 3MWJA 1AKEA 1E2UA 1NQWA 2QGFA 4MUXA 5J2TA 5B36A 2X7XA 3V4FA 2WSBA 4DR4B 1VI2A 2E4ZA 2HU7A 4S12A 2J3LA 3LP8A 3LP5A 4ECAA 4URVR 2MR6A 4RJKA 4EUHA 1PEAA 2P2DA 3L0SA 2FLKA 1Z2EA 4RKEA 4D82A 4ENQA 1AZTA 2GVZC 3T1YB 1L1QA 2IW1A 3TNFA 4TZ6A 4F60A 4HEA6 3P4XA 4CKEA 3F4BA 4KFRA 4IDQA 4ONEA 4C05A 4TTJA 1RRGA 5DISB 3UN1A 4YX9A 1SFRA 2EU8A 1R10A 3HZZA 3JYNA 1OGJA 2NXNA 3T94A 4MWOA 2RG7A 1JX6A 4NV3A 2IUSA 3CKMA 4PAGA 5I7VA 4LBVA 1CDOA 1N2CA 3KP1A 13PKA 3ZCUA 3D4IA 1MB2A 5I9SA 5LQAA 1UDWA 4FN4A 3ZCPA 2YWBA 2SKCA 1E5TA 4FCCA 4ABYA 1YUBA 3QE2A 1CUBA 4J07A 4J43A 3F6BX 5DFAA 5KMGA 3IT0A 3ON5A 1WD5A 4J9VA 1NATA 3NYQA 2XE4A 5FOTA 1AS2A 1R0KA 2A7XA 2JJMA 1E1RA 1GQRA 1M74A 2QI9F 1TEHA 2H9AA 2VR1A 2BI8A 4OHOA 5DK6A 5DNAA 5EIBD 1UBLS 2BW0A 5SY6A 3SI7A 4EKNB 3QUTA 1V35A 2NV6A 3HCRA 3TNYA 3VTFA 3L1IA 5AIBA 4L8GA 4PFSA 4RLHA 1TFRA 1KIFA 5FPHA 1LLQA 4C22A 1DAIA 2ATEA 3F9CA 4TMXA 1KQFA 4X65B 1UC5B 2IZ6A 3JALA 4HXFB 2CB9A 3WAGA 1LZKA 3EB9A 3QZUA 5THXA 1ORTA 4DM4A 2D0DA 4PAOA 4YK7A 2JFQA 2NSDA 2FUG1 4LYHA 4HJXA 5D86A 4G4JA 1GDHA 1O95C 2GEKA 2XAUA 3VKHA 4N8SA 5LSAA 2ZUSA 3SS9X 1M0SA 1VL8A 1GPAA 5GMOA 4EOGA 5A5FA 3ANMA 4BU1A 3AIIA 1H5NA 5F7XA 4HH3C 4U5XA 5C5DA 1S2DA 3EIUA 2ZCJA 3CPJB 3CZRA 1MQ9A 3FFAA 3RTDA 3V1TC 4TWRA 2QTVA 3ZWBA 1F9EA 4MGEA 2DHQA 4MYUA 4EI2A 3U61B 2WZCA 4YB8A 4CF4A 4CIYA 1U3CA 1JQAA 5E8JA 2GAAA 4TVBA 1FJHA 4IBOA 4S1PA 1JZSA 1FJGB 1XGKA 1ZA2A 3KCNA 3MB5A 3FDXA 4J0GA 4PYNA 4UXJA 5ALUA 5HF9A 3ONNA 4E09A 2QT0A 2GN0A 3C5WP 4R1TA 1MAWA 2R1TB 2WYHA 4XRGA 1R50A 3RFVA 1PT6A 2C2ZA 4UEJA 1IVSA 4TTAA 1Q0RA 2OBFA 4E21A 4IICA 1XBTA 2I5PO 4AZ3A 1KK3A 1E5VA 1H2RS 2XNJA 4PQFA 4MB2A 4QEKA 2HT6A 3K0CA 4MUMA 4RESA 3ZY4A 2JFNA 3VBCA 4P7GA 2ZTVA 5FP0A 5EHZA 5LUBA 4RSMA 1TTPB 3D64A 5CFRA 4MS3B 4KL8S 5ILOA 4P4TA 1U6KA 3AR8A 2DLCX 4MI1A 3U4QA 2QN2A 2OGUA 3L1HA 2G36A 4MV8A 4L5IA 4AJ2A 3FGZA 2O7RA 2JGDB 2X7HA 1J0DA 3C3YA 2C0QA 3IKJA 4TL7A 4URHA 3KXKA 1EHIA 3PVCA 3D3EA 4K9NA 2XT0A 5JQGA 1WBBA 2BHTA 3UHFA 3ZZTA 3ERCA 5JWHA 1EXDA 4HTAA 2C98A 1N5IA 3O4JA 4O4HA 4OEHA 4YYEA 3TTUA 3WRVA 1I51A 1GQQA 4QE3A 2IOFA 3G9XA 3KQQA 4MUGA 3KSRA 4B33A 1AX9A 1ML3A 4GXQA 2J9XB 1H4VB 2OHXA 3DG9A 3DZGA 4X45A 4ZZ1A 1SD5A 4E5KA 1NW9B 5HJEA 3DJYA 4B4KA 1KGDA 5L3ZA 5KX5B 4GEGA 1T15A 5T8KA 2BONA 2F3RA 4A10A 2FQ1A 1IRIA 2FOXA 2QY9A 2EAUA 4ZXPA 2WF8A 1T35A 2E89A 1MX5A 4NPAA 4A8JA 4LCJA 4NBTA 1DJPA 4XIJA 3ORYA 1PJ2A 2FCRA 5EMJA 3QVJA 1KZ6A 2QX9A 1UXJA 3H6HA 1BX3A 1B6SA 1BVRA 4CV3A 1VHDA 1E3EA 1Y3CE 3V8RA 2G5CA 4KU4A 4MV3A 3IO5A 1XAGA 5GVRA 3PGVA 1NFRA 2GR9A 2QL9A 2YJ3A 5BN3A 1XIVA 2WMNB 3TTWA 1OH5A 1YONA 2P9EA 3VA7A 3BD9A 4H7DA 2QS9A 3TPFA 1BXGB 3VH1A 3DM9B 4R4JA 5IAEA 1BGWA 1D04A 1Q20A 1V71A 4RPIA 5ABPA 5AHWA 1D5WA 1S2OA 3AI1A 3CA8A 1SQ0A 1L3CA 4NHEA 3K8QA 4KQ2A 4TS9A 2FFJA 3DL7A 1KMIY 4WQMA 1ML4A 3HO8A 4JJ4A 4R9RA 4F8JA 1S02A 2LDXA 3DC2A 1DO0A 3CKKA 1G2OA 2QOEA 4NCIA 4LY3A 1E3WA 1LV7A 5G0UA 2X77A 1JILA 3D0OA 2I2WA 4KFSA 1ND6A 1VE3A 2BTOA 3ONWA 4A23A 5A3QA 3H4MA 4NDAA 1XEXA 4ZODA 3O4RA 1QGUB 2AHOA 3C4QA 5K0GA 3MQ2A 5REQB 4GDMA 3VO2A 5KWSA 2ZUDA 3MBKA 4GRAA 1JEEA 4KQMA 2V96A 3FTEA 1GGEA 1WKCA 2JJQA 1MAHA 4NCBA 3B1VA 2EHJA 3DA8A 2G8NA 3C7KA 5MN5A 2VCHA 3HZRA 2GHRA 4GU5A 4BVKA 3KB1A 4ZYYA 4UQPA 3H75A 1HX7A 3GJ0A 3PRJA 3AUFA 4I9HA 4KX5A 5B1IA 3CLSD 1BN7A 1QOZA 3D31A 3ECCA 3RUEA 4C3VA 4Z9FA 5FWYB 1QPZA 1WIWA 2E3JA 2F3TA 3V1LA 3H17A 4KO8A 5ALQA 3UJDA 3PFHA 2QD5A 1ARZA 1KMNA 4ANFA 2ZIWB 4L4SA 2J3DA 8GPBA 2GZHA 2ZYHA 2GRUA 5AK3A 1GYRA 2B0CA 4V1CA 2PUTA 1YB2A 4PCVA 2N75A 1H2ZA 1HYGA 4MLZA 4JGBA 3LUCA 4LJKA 4N3CA 3HB0A 4QX6A 4ZVPA 4J2HA 1I3KA 1PBNA 3IPYA 4JB2A 4K6CA 5KHAA 2CFSA 1NTRA 2WA2A 2J7KA 5JNLA 1EVZA 3IQFA 5LLSA 3IAS6 3BMNB 5LJLA 1ZITA 4HS9A 1ZL0A 4DR2B 2P6PA 3IUSA 3RODA 3OD5A 5NLLA 4J3FA 1KOFA 1YQQA 4ARZB 1KI1A 2FX3A 2J6BA 2VRBA 2PSFA 2GVNA 2AK3A 2R00A 3ZV7A 2EC5A 1SCKA 2VDJA 1NI5A 1ZUD1 3TINA 2ZIFA 3K05A 4B73A 2FJ0A 1MX3A 4FFVA 3QLUA 4BDSA 5BVHB 3EYWA 5LVAA 4G36A 2UZ1A 4DMFA 4RHFA 1MIHA 2FSFA 1WQ3A 2W2NA 4IRMA 3EOZA 2O06A 3GG2A 2PJRA 4M55A 4FS3A 3T3HA 5BSHA 2CHEA 4HY3A 5DGTA 3V3TA 2VHWA 4LOLA 4YUZA 5HF6A 1LSJA 2ILVA 2F1JA 4PANA 5BSKA 3ZGZA 1MEEA 4MRRA 2ODEA 2EKZA 3VAZA 3LCJA 3COJA 3KQOA 3DEIA 3EC1A 3TE6A 1DELA 1XDUA 2XZTA 4M21A 3L8FA 4BBJA 4HX9A 3FHJA 5CCDA 4DV7B 3OIGA 3Q6NA 1UKZA 2C4NA 1LVUA 2ZYWX 1RP1A 2PGNA 4HS4A 4UBMA 4KXNA 3ZKAA 1MW9X 2CXUA 4DQDA 2B83A 1GSOA 1P7ZA 1ZJJA 3GP8A 1GTSA 1Q7GA 2B4QA 4FCVA 3H5RA 2H9IA 3V8VA 4MGIR 1S5PA 3U7FB 5EP1A 4IJ5A 2Q0HA 2F55A 2MCFA 1YZ3A 3SKXA 1QKKA 1W48A 1D4ZA 3F6RA 1VKJA 1D6MA 3ROMA 2VJOA 2HO4A 2PKXA 3I72A 4MGZR 5SZKB 3EIQA 3OSUA 3BB3A 2QDXA 4M6WB 1U1EA 2OAGA 1HQCA 4NSNA 1F7VA 5CLHA 5TARA 1XT6A 4BV9A 4V3CA 4R2MA 1L5MA 3QU9A 3DT8A 3ZE1B 4LJLA 3VHQA 1GDDA 2R8YA 4S1TA 5HIMA 2NNWB 1PR5A 1RRPA 3QG5A 1JLMA 3CTMA 2G88A 5CFPA 4XLLA 4DMHA 2OGTA 4R2XA 5H4HA 3ADOA 1O8CA 3SIWA 1REQA 3OF5A 5JHHB 4U7DA 3CNEA 1N7GA 2F3SA 4UPEA 2J59A 3FETA 2YWEA 4UOQA 1OZHA 1SBHA 1E4VA 3LXXA 3DE3X 5A6SA 1HNWB 2X3YA 2WHPA 1T8WA 1X38A 3LTNC 2VBCA 4B2PA 3EXEB 2AG1A 2DFNA 4KMOA 3TL2A 3OTIA 2VPXA 3M6VA 3SEZA 1AZSC 2Z8YM 1IHOA 3KTOA 5BSTA 3NM5A 1KEZA 1TZCA 2Q0QA 3AUYA 4NYMR 1QIHA 4Q4JB 3LIPA 1PRYA 3G85A 4MQUA 3SXUA 4EM6A 2P8SA 3M6AA 4F46A 4YCMA 5JLAA 4QM6A 3UMCA 1U02A 4UUPA 4JJ6A 3M1AA 2C9DA 1WA5A 1UPFA 3O8DA 3DOEA 3WQQA 4X1KA 4IUYA 5ALSA 4JI7B 3R9XA 1BXRA 5ALYA 1J2UA 5B6PA 1TQHA 5EJ7A 4TVOA 3OCVA 1A04A 1Q22A 2TMDA 3ZC3A 1G5RA 1Z47A 4LTMA 3LQYA 3JQ9C 4GH5A 1DJOA 3IAM1 4GVLA 4PPGA 2HMTA 3I2JA 4K05A 3A3NA 3FOAA 1I1QB 4LV8B 3TNLA 4B46A 1Z07A 1GTL1 1QWOA 1XZAA 2R7MA 3EG9A 4IIXA 1EUZA 1SIWA 1OXMA 3EEYA 3EGCA 3O47A 5HG0A 3UYLA 4PN7A 1OXUA 2XF2A 4TWAA 3N87A 3FUWA 3W5IA 3AHFA 1Y4UA 5LQRA 3GFGA 1NDQA 2NLOA 3STTA 3QFCA 2ZKLA 5L3QB 1MBZA 4RMNA 3G2QA 3F8WA 2AFHA 5BN5A 3FJOA 1I01A 3MMXA 4PAWA 3L7OA 2IXGA 4OHVA 1SBNE 3T1QA 3PDJA 5HNKA 1USWA 4RDCA 1ZI9A 5KYUB 3TIXB 1E9EA 3DR5A 4N6GA 4H7KA 2P68A 5JANA 4WCFC 1X3SA 3HP4A 4XKJA 2G04A 3YASA 1CF9A 3QNWA 2IY8A 2ZRIA 3CUYA 5C3MA 1XMSA 3OQBA 1SHZA 3N2KB 3BKWA 3BUSA 4WBSA 4ARIA 1E1QA 3E2PA 3AONB 5ENDA 3B78A 4BQSA 2ZLBA 3DVAB 1WY5A 5CIWA 4C0KA 4RY9A 3QEMA 1ZH4A 2G07A 3HCDA 1NJ5A 4J0DA 4JOBA 5BY2A 3IQDB 1E69A 3OEYA 1EWTA 2ZUVA 1QNFA 3DAOA 3R7LA 2QX8A 3VYUB 2WUWE 1MKYA 1D2CA 3W0LB 4ZVKA 2PQ6A 2VZEA 1NVFA 4EARA 4ENVA 3MAGA 1T1SA 2FOLA 4ENWA 1XA3A 1Z34A 1CU1A 3FPEA 1PDWA 3OZCA 3BRSA 4TLMB 4MVYA 4FT2A 3UMGA 5K8UA 1PTJA 4E33A 1IY8A 2PVSA 3L7CA 4IQGA 1G5IA 1KJ9A 4OYHA 2IEBA 2A78A 4O4LF 4CV0A 1JF8A 1ISPA 1ZBDA 2C5BA 2OLEA 4LDJA 4WTOA 5HS6A 1KEEB 4EFLA 4QBTA 2VPWA 2YN2A 3A10A 2RAUA 2CVPA 1NRXA 5I9BA 1PWHA 1GKYA 4ZQFA 2Z4SA 3OICA 4RJJA 4CDMA 5FV7A 1X7ZB 1NJ6A 1RLTA 1EDDA 5DNEA 5LZ4A 1LBEA 3CONA 2JCBA 3C8DA 4JJZA 4EEZA 2VAWA 1R9NA 3GH3A 3QF4A 3GEPA 2GJ8A 2O5RA 3RCBA 1G8PA 3VMMA 4KXUA 3PQFA 3BD6A 5TB5A 1V6CA 1X9IA 3T4UA 4E46A 1G8AA 4HVCA 1XD8A 1IXYA 4GICA 4UHFA 2PT9A 4EZBA 1JIVA 2FN8A 2JVIA 2RK6A 3CBGA 3PP8A 1WCV1 3S55A 1QB8A 1RXEA 2B1GA 2QTAA 3BJZA 3QKRA 5KNBH 3K1AA 2KI5A 5TEVA 1VDZA 3WWOA 1TYAE 4KIWA 2HFJA 2ZTMA 2DZDA 4YRNA 4MYSA 3A05A 5FJIA 3T3GA 3LVRE 1PT7A 5ELXA 1RQNA 2GEDA 3FG9A 1JEQB 1MJGA 5BRNA 3WIBA 2IUYA 1BNCA 2ZDHA 1KO7A 2W11A 2ZRKA 3ESBA 4Q37A 3RANA 4AF8A 4BX0A 5IFLA 3HY3A 3OHMA 2PKQO 3GEHA 4CMEC 4EABA 4LRYA 3REQA 4C07A 4AZ0B 3UGTA 1TIKA 5EKXA 1B2RA 4S1OA 2RFLA 3GRCA 2BOVA 5A5EA 5AFSA 3GZTB 5BMVF 4N65A 3KKZA 2XMCA 4JP3A 4MPPA 4CKCA 2BFBB 1K88A 4F6LA 4QVIA 1TX4B 2GPJA 2I7CA 2K5UA 1N33B 3K1TA 3NAZA 3M3DA 1E3SA 1GKKA 2QUBA 1M5UA 3OIYA 3ZHTA 3ZH9B 4PZEA 4AULA 1C1YA 2G82A 4EHIA 2PUFA 3ZJTA 4LUCA 3O8OA 4Y9UA 3LRTA 3C6KA 3GLTA 1OW3B 2JJ2D 1OXVA 3DZIA 4QRIA 1ZVQA 1Q83A 4KC0A 4OHBA 3BM5A 5A9TA 4ETMA 3G2PA 4PHHA 5AKEA 1HL3A 1X0VA 1DINA 4PNHA 4ZRMA 2JGJA 3IUPA 2X0JA 2VVTA 5IT9A 1AZWA 4FLEA 1GIAA 5K6AA 3ZQ6A 2WQZA 3ESZA 2PD6A 1MRNA 3P7MA 3BSSA 1PU2A 2LP4Y 2O8VA 1MB9A 1U7UA 3EZFA 4AIRA 5B3JC 1T3TA 2O0KA 2ODNA 3VH2A 2QRUA 5DLDA 1GADO 1TIBA 3FPSA 3ZNNA 4FWBA 5DV9A 2XTNA 2YC4C 4ZEXA 1EG7A 3D6JA 4HZUB 1T36A 2QTGA 2ZULA 4E2XA 5HJ5A 1CY8A 3F4KA 1FCJA 1G42A 3AZOA 5AJTA 4GP9A 1KZ4A 4V39A 3P32A 1UIRA 3FTDA 3V6MA 4IFTA 2OTCA 3VU9A 3A4IA 5GV7A 3QFFA 1EFAA 5IMBA 2JLWA 5ALXA 4OJMX 4DSAA 1ZJZA 5LLTA 4J4HA 1JFFB 3ZDYB 4AROA 3HJHA 3V9AA 5EJAA 2P9FA 3GCZA 5HA5A 2HLDA 3SQNA 3DHWC 1UZLA 5C8YF 1OFGA 3UOGA 1THMA 3SF0A 3KVYA 2O8EA 3UC9A 4ZOLA 2AI2A 3KQNA 1J1UA 4QNNA 3PQ6A 2DHRA 3NQ41 3UT5B 5IKOA 2Z6QA 4L8FA 1IXZA 1K3TA 4QU8A 5F5NA 1HDRA 2CHQA 2CGEA 2QHXA 3GEBA 3CUUA 1Y42X 4HZIA 1EDEA 4EPXA 2F8LA 4EH1A 1G8YA 1NR1A 2P9TA 5JJIA 2P2GA 2R9VA 1GR0A 3K6JA 4O0MA 5CHEA 1HZZC 2WW8A 4YXWA 1JLKA 5IK2D 5F1OA 4OCZA 3OEHD 1PZEA 5ALFA 4HEA1 3L0IB 4F84A 4MNTA 2QZSA 1NHWA 4BZQA 2HB6A 5JARA 5FI3A 2M2IA 3MINA 5A02A 3N76A 1T3LA 1CULC 1T4MA 4O02B 4BO9A 2Q9BA 3PUXA 4DVJA 1R8XA 1EVLA 1G6OA 5EHNA 3MJRA 1WV1A 1GPYA 3BCRA 2I4NA 2ZPAA 3ZH2A 5HKAA 3GFOA 2VP2A 3DDWA 4KCGA 1AK2A 1B26A 1GLVA 1UMCB 1PI3A 1R0CA 2QKYA 3IUMA 4I1YA 2Q6KA 1JIIA 4IEIA 1FFAA 3JU3A 4WNAA 3R3UA 2JLYA 1N1EA 3MWFA 1AUQA 3VZRA 3FIUA 3W34A 1FUYB 3WFIA 3KOWA 4O2AB 5G3YA 4RPCA 3DM5A 2FMFA 3ZJ5A 3MCTA 4D3XA 4CIBA 1HKHA 5JATA 5L6LB 1HFKA 2IY9A 4GXNA 2XW6A 4E3ZA 2WSIA 3L5KA 1FNMA 4CYMA 3DWFA 2RHDA 4NS1A 4WXMA 4MVJA 3VR4H 1S8FA 3FAKA 4L51A 3THYB 2P1RA 4C4AA 3CX8A 2O52A 5C32A 1K6EA 1QP8A 2FCAA 2WWIA 3ITNA 4EGFA 2V7GA 1TUGA 2A8YA 3M6XA 3RVOA 1GZVA 3HR4A 3R9KA 3EGIA 3VZDA 2J5XA 4E5UA 4NDZA 5AYVA 4Q6WA 2GCGA 3C0KA 4CGYA 1QQ7A 1T3ZA 4UQLA 1TD9A 1QYRA 3MOIA 1J8FA 1NMZA 2WC1A 3QEOA 2O8NA 2YIDA 3FPKA 4ID9A 4OB7A 4C5CA 4E5NA 3U4CA 4F9EA 5A2QA 1NTOA 2UZIR 3VRHA 1ZN9A 1G21B 4XWTA 5TE9A 3UMBA 4LNUA 1HA3A 3PFNA 3QVUA 4P4SB 3R5JA 5CDTA 2FYTA 3KDSE 1TJPB 1UJ2A 4ZQHA 3H65A 3OU2A 2X1HA 3I5XA 1SCNE 2OORC 1UXKA 4NU0A 1L4YA 4LOAA 1JDUA 3HA5A 1LFDB 3SJZA 2WHXA 3G2NA 1GAEO 4NF2A 1CJCA 3DL0A 4JL6A 2JCGA 3FCAA 5AW9A 5CLFA 3X3HA 4BJ3A 1FNSA 1GZDA 1QV9A 2H06A 4R51A 2Q3LA 4HDSA 1VHTA 1JXQA 1UZUA 1M6EX 1T5OA 2HU2A 2V7WA 3IE0A 3F5MA 4MWTA 3DFIA 4P35A 4V24A 2A0YA 4YMUA 2D2VA 1ORRA 4MS4B 4MMYB 6CHYA 1DI0A 5CK5A 3SJUA 4KNWA 3NP7A 1ENZA 2DPGA 2JLBA 3AHDA 1E9VA 3T1OA 4DA9A 3U4MA 4BEWA 1OUMA 1SEPA 2H1SA 3HO1A 1CY6A 4JBYA 3QXCA 1DTSA 3OM1A 1UC9A 2UZ0A 1H6AA 1YZTA 3SHOA 2ZB4A 2WAXA 1KU6A 4BQPA 2NU7B 2ZQYA 4YMHA 1G3IA 3KZOA 2JVKA 1BC5A 4LMPA 1NVDA 4V0RA 4DJFC 1T34A 2X1LA 1T4GA 4R0MA 4FFLA 4I46A 3E82A 3DFZA 3GL9A 5BN4B 3HP7A 2RIRA 1E0DA 3VXKA 2XI4A 1CUYA 2ATCA 1OZ0A 1SVSA 1WHSA 3BC1A 3DL4A 3JQEA 4D6PA 4PZ9A 4QUKA 1IUPA 5I8ZA 2IU6A 4TQUS 1G59A 4R8RA 1QCYA 2VOJA 4ZCMA 4HNHA 5IJ9B 2VHTA 3LQ4A 1Q1QA 2UVPB 4PNZA 1H6CA 2ZVPX 4OXKA 2JGMA 4ZCTA 1OTHA 4IIJA 4TQGA 2ODAA 3ED5A 3EZXA 4K28A 3WY9A 1PNVA 1ODJA 4L6AA 1BXZA 1KO1A 1WXXA 4PYOA 5BRJA 2ZTLA 4NNJA 1XFAA 3LPLA 2A9QA 4YWHA 4HH0A 5LP6A 3OPYI 3PFKA 4CHTA 3W6ZA 2HJHA 2FETA 3QMWA 3L8GA 5BSGA 2ZYAA 3VNBA 4F4JA 5KVVA 3ULKA 2BBWA 2VRCA 4A16A 4E5MA 5FB3A 5BUQA 2WZBA 2DWUA 4UM9D 2ACKA 2K7FA 4H35A 1GN8A 2ZS8A 4DL9A 2CVQA 5JUWA 2P4EA 2IDMA 3FOBA 3OJEA 1N4DA 4HWOA 4DIKA 1XZHA 2VCYA 3BL5A 4BL5A 1Z8DA 2H3EA 1ZAKA 3D8TA 1MGPA 4M22A 3LW8A 2OV2A 4EHKA 2FQQA 5IJXA 1NU6A 4LWOA 5IXSA 4OGLA 1BW9B 2JCYA 2WICA 4MH0R 3TZHA 5L4SA 1MC1A 2IYRA 1U2PA 1BE1A 3UANA 4J7AA 1WU7A 2JW5A 3ETLA 1H2YA 3GHHA 5JO9A 4UARA 3RYFB 2CMKA 1JGTA 4FP9A 4WN9A 1QHXA 5FL7A 3BXOA 1XRSB 1R64A 5CEFA 1H9BA 3M6UA 2B0JA 4WCFB 4PRLA 4B9EA 1U7ZA 1N0VC 1PZMA 5GIPE 1MF7A 2QG4A 3BL6A 4YAOA 1S3SA 4EB6A 4TV9A 4WZBA 2ZPTX 1F17A 1ETUA 3E2IA 1TO6A 4ZZ0A 4IJMA 1G5TA 1YB7A 2W8BA 1Z2CA 3HKCB 3QUAA 4KP7A 3KDPA 4FI3F 1RWNA 4O08A 3IQEA 1NP3A 2VBFA 2YVUA 5DI9A 4Z7JA 1LSUA 3OZFA 4C2BA 3T9DA 3W4KA 3E9EA 4I3GA 4NS4A 3W2GA 2FPOA 3ZVRA 4A1FA 2JCSA 2WFLA 3L1UA 4XLTA 4Z5XA 3KD3A 2PUEA 3OI7A 1EAMA 1LI5A 1R4AA 4OKNA 2YN4A 1OOEA 2ISCA 4LQ4A 1W4ZA 2WKPA 4MYDA 4N5NA 1PLLA 3LUBA 2YW9A 2CV1A 4FFSA 2BHRA 2PMKA 2O19A 5BOSA 4TTQA 3HJTA 5FKJA 4INAA 1KEUA 4FEYA 1LPSA 4AJHA 3RBVA 2C1XA 5HIAA 2QN8A 1L6IA 1QRUA 1PQWA 3ET5A 3WO1A 1M8FA 4XUEA 4H3HB 3HWWA 1E20A 1T8YA 1D4AA 2W2TA 3BMQA 1VKHA 1P7YA 1ZUHA 1NBEA 3HYSA 1V8OA 1ZL2A 3LF1A 3NV9A 3PA8A 4MLDA 2J5KA 1USGA 4R1SA 5DCUA 2RHHA 5THKA 1DTWB 1Z0DA 1C8VB 4L4RA 4URZR 1ND5A 4D45A 1W0JD 4AWXA 4K8OA 3FROA 1ISSA 1QHFA 1Z0JA 3GLHB 2E0IA 1NW3A 3IHLA 1STOA 1G7SA 3EOBI 4QBKA 3RLIA 3UENA 3ZGXA 1H0KA 1IXRC 3IAS1 4HPJB 2CXNA 2P4QA 2H51A 4MQ5A 4PC7A 2ZJ6A 3HB4X 1OAOA 3IVAA 3KZKA 2R8ZA 2YIVX 4GBMA 1C8LA 2YHIA 1N6PA 4CKWA 4DOMA 1KRWA 4ME6A 4QJBA <