3ER9A

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
288
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
molecule tags Transcription, transferase/rna
source organism Vaccinia virus wr
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
total genus 102
structure length 288
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3er9A00
5FWDA 4QPPA 2GPYA 3DMHA 2YUIA 3FUVA 2YXEA 3HA3A 3P2KA 4OQDA 1FPQA 1NW7A 3M6VA 4K6MA 2XYVA 1T43A 3R3HA 5P8WA 2IDKA 3B7PA 5EMLA 1NW3A 2G70A 3BUSA 3LL7A 3OCJA 5KQRA 1X1CA 4GOLD 2P8JA 3UJ9A 1VL5A 1ZKDA 1H1DA 5HILA 3LBFA 5K0BA 2AS0A 2OY0A 5KVAA 4PIPA 5HIKA 1ZGJA 2GH1A 2NNWB 5DM0A 3U81A 1WZNA 3FPGA 2ZWAA 5EG5A 1AF7A 5GIOE 1JG4A 4CKBA 2PX8A 3G2QA 1D2GA 4QQNA 5JUWA 1BKYA 3MQ2A 5HEKA 4ATNA 4QTUB 4GOOD 2O07A 1QAOA 3VYWA 1RJGA 4PNEA 3DLIA 4F84A 5CVEA 1ZQ9A 5KS2A 1NBHA 2WA2A 1EAMA 2WK1A 2Y1WA 3PX2A 4XCXA 4Z2YA 2NP7A 3KPJA 4RYLA 3A7DA 4XUDA 1XCJA 3WSTA 3HVIA 3UJDA 4RTRA 3EMDA 5GOZA 5LQUA 4F85A 2OYRA 2Y1XA 4GQBA 3B3FA 3B89A 1Q0SA 3BKWA 2CMGA 4BLWA 3UJBA 1EQAA 5FWAA 3BWCA 4BP3A 2O05A 1NW6A 2ZWVA 3NVKI 3G2MA 1XCLA 2G1PA 3P9CA 1AV6A 3HTXA 2FRXA 2HNKA 3T7SA 3FRIA 3PT9A 4PYMA 3NTVA 3FZGA 2AOWA 5MHTA 5GM2A 4OX9Y 3HA5A 2YXLA 3C3PA 3DXZA 3SSMA 4U7PB 2B78A 2P3OA 1R18A 1G60A 3TR6A 2ORED 3AXSA 5BW5A 3AXTA 4POOA 3HCAA 1G55A 3P71T 3KKZA 1SG9A 1VPTA 2G71A 2B2CA 3EMBA 4C06A 3EVDA 2OXTA 3GRVA 2BM8A 1JG1A 2QM3A 3JWGA 3T0IA 1KYWA 4E70A 2GA9A 2OPBA 2AN3A 3AJDA 4MWZA 1P91A 1X1DA 4XUEA 4MIKA 3FPHA 2P41A 4V0QA 2O57A 1B42A 1L3BA 3C0KA 3GIWA 4C07A 2PWYA 4FZVA 3DXYA 2QRVB 2ADMA 1KPIA 1YB2A 1INLA 1YZ3A 2PWPA 3E8SA 3SXJA 5EMMA 3UFBA 1UWVA 2ZCJA 4P58A 1R74A 3LCUA 5DSTA 1F3LA 5FTWA 5FULA 5K05A 2C7QA 3MB5A 2R3SA 3LDGA 4RX1A 3KR2A 1YFLA 3JWHA 1YF3A 1IM8A 2PLWA 4BLVA 1FP2A 4HGZA 5FHQA 1BC5A 3QV2A 5LQAA 10MHA 1P39A 4RVDA 4RV9A 2FPOA 5F2KA 2I9KA 2AOUA 3M6XA 2DPMA 1SVUA 1JQ3A 5LR6A 1JG2A 1P1BA 2ONYA 5E1OA 3I5UA 5IH3A 1R6AA 4FP9A 1JQEA 4C03A 4WXHA 1KP9A 2C7RA 2B25A 2I62A 2OZVA 3GNLA 2PXAA 5B1SA 2IFTA 2ZULA 3GO4A 3MCTA 1HNNA 5HFJA 3AWIA 3RIEA 3TPZA 4DMGA 1QYRA 1F38A 4QVGA 4PWYA 2H11A 2JH9A 2AZTA 3EGEA 4KIGA 2AVNA 2IPXA 2PV0A 3BKXA 4QDKA 1QANA 3NDJA 4JXJA 5DTQA 2OB2A 3G2PA 1M0EA 3BWYA 2PT9A 3MHTA 1YZHA 4EVIA 2UYCA 2PKWA 3TFWA 1TPYA 3A27A 2IH4A 3IEIA 5F2NA 1KYZA 3OU6A 4V0RA 4GEKA 1R00A 5FQNA 2ZZMA 4R8SA 5EGSA 2VDUE 2VS1A 5EMJA 3TOSA 1RI2A 2R6ZA 4FSXA 1YUBA 3K0BA 5K0NA 5CM2Z 2P40A 3FRHA 3OZSA 5HOQA 3T7TA 2YQZA 3G5LA 4YMGA 5CCXA 4G56A 4YUVA 3LX6A 4L7VA 1VP3A 1KHHA 4HG2A 5DT2A 2VP3A 1JTEA 3FTCA 2H00A 3I53A 2ZZKA 2PX5A 3EVBA 3FTFA 2H1RA 5DM1A 4DKJA 1NW5A 3NVMB 4P7KA 5LQJA 2NP6A 2QE6A 3P9NA 3TMAA 3KPUA 4RTSA 8MHTA 3LSTA 2IH2A 2PVCA 5LSAA 1NW8A 2PGXA 3UJ7A 3GRZA 5E2AA 7MHTA 1MJFA 1ZHFA 2XVMA 3M6UA 3MCZA 4RTJA 3KQOA 5DRTA 3NMUF 3Q87B 1NKVA 4KVZA 5EMKA 2VZ9A 4FT4A 1RJDA 3SR4A 1Z3CA 4PYQA 4LG1A 3R6TA 2AOUB 1VIDA 3BGIA 4RTLA 3HCDA 5E1DA 4ZTBA 4DQ0A 5K0CA 4E2ZA 4E2YA 3O31A 5E2BA 5GINE 3FYDA 4FGZA 4DM3A 1MHTA 1SUSA 2BR5A 4YV0A 3PVCA 2G8NA 2P3LA 3E7PA 4EMSA 4GOND 4HGYA 4CTJA 3TQSA 4E30A 3MTEA 2ZFUA 2V7EA 4M38A 4RVGA 2JHCA 4MTLA 2AN4A 2OKCA 2Z6QA 3PLAE 4RTNA 1ZGAA 2YX1A 3EEOA 3G2OA 3VSEA 3B5IA 1VBFA 5M5BA 3JWJA 3HVJA 4X41A 3EEYA 3G8AA 1RI1A 3KR9A 4H0NA 3C6KA 4M36A 5EOVA 5T6BA 4P7JA 4RWZA 3OU2A 3EGIA 3LBYA 4ER0A 2IP2A 4RTKA 2C7PA 1XDUA 2AVDA 3SGLA 4KW7A 4CXMA 5DSXA 3P2IA 5FUBA 4C08A 4YMHA 4DCGA 2PY6A 2OB1A 3UA3A 2CKDA 3O4FA 4GC9A 2Q41A 3UJAA 4CKEA 3GJYA 2K4MA 5CD1A 2IH5A 5K0EA 3SSNA 1NE2A 2A14A 2YTZA 2GAFA 2O0LA 5FA8A 5T67A 4YV2A 3HCBA 4LWOA 5HIIA 3FUWA 3MGGA 3MAGA 5C9ZA 2B9EA 4AZVA 5U4XA 4C05A 2EFJA 2YVLA 2JJQA 3OE5A 5FQOA 3I9FA 2IBTA 3BT7A 5GWXA 4NECA 3LKZA 4AZWA 3ELUA 4FS8A 2ZIGA 4PCAA 4QVKA 4EK9A 3IV6A 2N47A 1G38A 1JR4A 1P1CA 3M4XA 3ME5A 4YUYA 5K09A 3SVZA 1WXXA 3ANXA 1X19A 3KR1A 3Q7EA 2BH2A 3QOXA 4EQZA 4KRGA 1XDSA 1G8SA 5CIYA 2JH8A 2LD4A 4A6DA 3REOA 3LPMA 3GRRA 4IWNA 1X1AA 4BLUA 3DLCA 3GDHA 2PSSA 1D2HA 5GM1A 3P9IA 3FPFA 1IXKA 3G89A 1O9HA 2YR0A 5DRYA 2WA1A 3PB3A 1DUSA 5E9QA 5EKUA 3CVOA 4E31A 2JHAA 2NXCA 1RJEA 5C1IA 1AQJA 3PFGA 2AOXA 3EVGA 3BZBA 1XTPA 2EX4A 4RTOA 1WG8A 2EG5A 4RTPA 4QDJA 3UZUA 2Z6AA 1M6EX 3H2BA 2UYOA 3HCFA 3KR0A 4ER3A 2FYTA 2KW5A 3M70A 3GGDA 5EIWA 5HIJA 4ER5A 4LWPA 5K01A 3UBTA 5CVDA 1NT2A 3S68A 2HMYB 1D2CA 3LKDA 3VC2A 3RW9A 2BR3A 4OBXA 3DR5A 9MHTA 1N2XA 1TW2A 1FBNA 3OPNA 5E1BA 5LQRA 1WXWA 5GP1A 1RI4A 3GRYA 1VQ1A 1XJ5A 3FPJA 4QQKA 5T64A 3T7RA 3KPYA 4E2WA 4KDRA 1N7IA 1O54A 3CGGA 5DM2A 1ORHA 4FT2A 3FPEA 3PX3A 1DCTA 1QZZA 2DULA 3E23A 1Y8CA 1NBIA 3FYCA 2HV9A 3VC1A 1JTFA 3EPPA 3NWEA 2AOTB 3R0QA 1VP9A 2F8LA 5DTRA 3V97A 3ERCA 4GOMD 3I64A 3KQTA 3B3GA 1HMYA 2ZW9A 3UWPA 1JSZA 3GRUA 3UJ6A 3A7EA 3P8ZA 3TKAA 3HCEA 4PYLA 1UFKA 4PYIA 4YUWA 5DPMA 2E5WA 1RJFA 4UOEA 3EVEA 3CCFA 5EC8A 2B3TA 1PRYA 5HIMA 3OZRA 3P97A 1EJ0A 1X1BA 4RTMA 2CWWA 5KQSA 3ELWA 1G8AA 1I4WA 5GIPE 5K8VA 4M37A 2I6GA 5LQNA 1IY9A 4C4AA 2UYHA 5JR3A 3ELYA 3ELDA 3AY0A 2FK7A 2NXNA 3LCVB 5CCBA 4HC4A 5DXJA 3HEMA 5DX8A 3PS9A 5EKXA 4QTTB 4X63A 3KQPA 4CWAA 4Y30A 2OBFA 3ER8A 5FA5A 5DWQA 3TM4A 2P7HA 3G8BA 3P2EA 1XDZA 2G72A 5EEHA 5BW4A 2ZBPA 3I58A 4RVFA 5CUQA 5LQKA 5FCDA 4R6WA 3EVFA 3FUXA 1I1NA 4GBED 4R8RA 1WY7A 4F86A 2CMHA 3EVCA 2O06A 1YFJA 2CL5A 5DXAA 3R24A 2PBFA 2IIPA 1KR5A 3CJQA 5DLYA 3DMGA 5EHGA 2XVAA 2ZVJA 5ERGB 2IGTA 3B3JA 3GXOA 3KQSA 3BGDA 5E1MA 3NW9A 4YUZA 1XXLA 2HWKA 2P7IA 2BR4A 3LGAA 3V8VA 3BGVA 3EVAA 3CJRA 4C04A 3L8DA 3X0DA 3DUWA 3KPWA 1JQDA 4B17A 3KQWA 3G5TA 4PYKA 3KHKA 1SQFA 2OO3A 4X1OA 1UIRA 4KWCA 1KPGA 3OFJA 3LECA 3DOUA 4OBWA 3ER9A 5DX0A 1SKMA 2PX2A 4M7RA 4E33A 3BWMA 4HTFA 5EQJB 1EIZA 2PXCA 1AQIA 1FJXA 3SM3A 1DL5A 2NXJA 2EJTA 4FSDA 2BZGA 5EVJA 3E05A 3PFHA 3GU3A 4AZSA 2QRVA 3CKKA 1TW3A 5K0LA 4CKCA 5BXYA 4LECA 5HZMA 2NYUA 1U2ZA 5E9JA 2ONZA 5CVVA 3F4KA 2PX4A 3UJ8A 1XVAA 4IV0A 1G6Q1 3CBGA 2P1DA 2P3QA 1SUIA 1KIAA 1L9KA 1O9GA 4O29A 4R05A 2YXDA 5CVJA 1EJ6A 2FHPA 3C3YA 3GWZA 5E8JA 3R9XB 3BXOA 4E2XA 4PYOA 1SQGA 2GS9A 3G7UA 5ICCA 3UJCA 1L3CA 2AN5A 5EEGA 2PT6A 1PJZA 5FHRA 3SSOA 3DXXA 4WVLA 4X60A 2I7CA 3DULA 5E9WA 2ZTHA 3A26A 2VDWA 5LQCA 2Z6UA 3IHTA 4HSGA 4KDCA 3OE4A 1NV9A 3THRA 1FP1D 2AOVA 1VE3A 4A6EA 2ZLBA 3FTEA 4PYJA 1L3IA 3ID6C 2P35A 4ER7A 2VDVE 4DZRA 1Q0TA 1R8YA 4QPNA 3FTDA 1I9GA 3TLJA 2GLUA 1KPHA 1QAQA 3CC8A 3DTNA 3OU7A 5K03A 3OZTA 1RI3A 5K0GA 4PIMA 4RSRA 4P7GA 3EVZA 2BM9A 1L1EA 4IKPA 4PINA 5EPEA 5FADA 4DCMA 3BWBA 2ESRA 4BP1A 4GUAA 3M33A 1KXZA 3CJTA 1WS6A 4MQ4A 4HRAA 3M6WA 4PCLA 4R6XA 3RODA 3KQYA 2V74B 3O7WA 4HTFB 5ICFA 3D2LA 1M6YA 3HVKA 3ORHA 3EGVA 3P9KA 5E8RA 5K0JA 3HNRA 3MTIA 3G88A 5EZQA 4GC5A 5CVUA 4DA4A 4U7TB 4ISCA 2EJUA 2FK8A 3K6RA 3OFKA 4RVHA 4X61A 3SX0A 3JWIA 2JHPA 4CTKA 5BP7A 1VLMA 4OA8A 2FCAA 5H02A 3GCZA 2IBSA 4HH4A 5D1HA 5DTMA 4ER6A 2C7OA 3C6MA 2HR1A 4YV1A 4P7FA 2ZSUA 3TRKA 1V39A 4EKIA 1ZG3A 4BY9E 3NJRA 2XYRA 1RI5A 2PXXA 2UYQA 3DMFA 3FUTA 5DM4A 3THSA 4RTQA 1BOOA 4GF5A 4FR0A 5ICGA 2GB4A 4Y2HA 3SMQA 5D1NA 3KPVA 2HTEA 4OA5A 4OQEA 2XBMA 1N7JA 3FUUA 4AUKA 3IYLW 3LCCA 4EKGA 3HCCA 2ZBQA 3MERA 2ERCA 4IV8A 3PTAA 4MHTA 1OR8A 3DH0A 3NWBA 3LDFA 4AX8A 1BHJA 1NV8A 4E32A 4YUXA 2JG3A 3TM5A 2IDJA 2ZIEA 2QYOA 4PGGA 5EZSA 5EIFA 3HVHA 3NDIA 3HM2A 3KQMA 4PGHA 3KU1A 2ZIFA 1EG2A 2PJDA 5F2OA 1R8XA 2AR0A 2QY6A 2AOTA 3DP7A 1ORIA 2NXEA 3A25A 3HP7A 3QOWA 4XUCA 5ICEA 5KYGA 5EHIA 5G02A 3A4TA 3TKYA 4DF3A 5DX1A 3HA7A 2UZ4A 5C0OE 4PONA 4KIFA 4PYNA 5IKMA 5K0FA 1JG3A 3KQQA 3KQVA 4AZTA 3LHDA 1QAMA 2XYQA 2ZZNA 3UA4A 2ZBRA 3LDUA 1JSXA
chains in the Genus database with same CATH superfamily
2QTAA 3GDGA 4RANA 2WAAA 3TEJA 2QJRA 4Z54A 2PUAA 3DMHA 2YXEA 3HA3A 4Q4LA 3U4QB 2FLVA 3DM5A 4LXYA 3HBMA 2FZEA 4JBNA 3BRWA 1S2MA 2J5KA 3SEZA 5I8WA 3C5HA 2FEOA 1KJYA 1RMQA 1RBQA 3NYIA 2J07A 1M6NA 2FG6C 1KDTA 2GCOB 1PUIA 2OBNA 2ZUBA 3AVPA 3GRKA 3RS5A 1S4QA 2Y4NA 2JFNA 1EVJA 1YH3A 3H04A 3MF4A 3CRVA 3P9RA 4YQFA 3H8WA 5CTJA 5JNUA 4C0QC 3O47A 4RA9B 1G3UA 3ZX4A 4CKBA 1K0UA 1D2GA 1Z4QA 1N7HA 4PANA 2I34A 3QFHA 4UUMA 5KAPA 1XLVA 1RJGA 5J4KA 2D54A 4TLBA 1ZEMA 1ZOSA 2NZUG 2Z4TA 4X1KB 1MJ5A 3RC9A 1YAJA 1DBWA 2IZ7A 2G77B 5DYIA 4G0NA 4P32A 1S9HA 4YJFA 3VOTA 2C5EA 3A7DA 1JR3D 5LP6B 1DV1A 2FVYA 2WNIA 4WJZA 1U0NA 1EUDA 2CUNA 2P2LA 3IJRA 3BMNA 1A5BB 2OYRA 1NMQA 4PQGA 2BHTA 3JQRA 2CHGA 4K6CA 3B51X 5KTSA 1RE0A 1WZIA 4CM8B 2E6KA 3E9ZA 1BMDA 3PXGA 4TQGA 4IP0A 3D8NA 5CBPB 3HZHA 4B3BA 3IAFA 3KYCA 1QR6A 1XR3A 4JBXA 3RVLA 4D4HA 3FZGA 4M7PA 4UFNA 1T15A 1GPJA 1V8DA 1OGJA 2AEJA 4HZUB 2WEKA 2ATEA 1TIKA 1VHLA 2B78A 2GJ4A 2WSSA 2XNJA 3N5CA 4D4GA 1Q83A 4JH0A 1W36C 1YDEA 2X6QA 3H1TA 3SWWA 4O2AA 4AKIA 4KGZA 4YT4A 3BH0A 3EMBA 3STUA 2M98A 4MWOA 2ZJ0A 5FBZA 3ONEA 4GXRA 1THGA 1O0BA 1T2DA 5ALYA 4XWAA 3ZPXA 2JLAA 3QY0A 5E3IA 1WTAA 3GVCA 4YHBA 3G02A 2TMYA 1OF1A 2WI8A 4QOJA 2RC6A 4PSKA 4XUEA 2K87A 3K70D 1OXKB 1L3BA 5BSMA 6GPBA 4LFCB 4WZBA 1UBFA 4GKJB 2EFHB 2ZWOA 2AD5A 4RSMA 3DP9A 1WVMA 4Q3NA 1FU8A 2BFMA 3K0FA 1DKLA 4XA8A 1YTLA 5EMMA 4UD6A 5BQ3A 1Z28A 1K06A 1M2KA 1R74A 3CWCA 2OBMA 3KWMA 1UC9A 4HRVA 4HADA 1E0DA 5EMNA 1R1DA 3PBKA 3C39A 4QODA 2OA0A 4YDSA 3UMRA 4RX1A 3UNXA 4AMBA 4MQLA 4D3ZA 5B1YA 5AMXA 4BLVA 4BN5A 1W35A 3G8YA 2Z30A 2HHHB 2IU4A 2XA9A 3ZG6A 2Y92A 3JRWA 4QT4A 2OMKA 3AEKB 1G5RA 4HF7A 3H6KA 4YRBA 2FPXA 3I5UA 3OJEA 5DIZA 3IUJA 1CR6A 1VYHA 3EZLA 4TWBA 4EF4A 4EW3A 4ZEXA 1WHTB 2CFOA 5J59A 3RF7A 1OZHA 3NORA 3JYQA 3R4CA 3TRJA 3FLEA 3PUVA 2HLHA 5G0WA 2P4SA 3MAAC 4MB0A 4MR9B 2JK1A 4EGSA 2WD7A 3H7IA 3LK6A 4GM1A 4ZAYA 4OHFA 1H6DA 2KM1A 1B15A 1VIYA 2VQ3A 2XCLA 3THOA 1C4KA 2AFHE 5ALEA 5AW5A 3V4ZA 1EB9A 4BQIA 2Y0EA 1I3OA 1L5ZA 4YMLA 4MWSA 3TSZA 4HWRA 2NADA 2OAP1 4RHCA 5C7LO 3DFFA 5I3CA 4EKYA 2IH4A 4Z3OA 2L17A 2RAFA 3SBDA 1U8YA 4MWEA 2I3BA 4RPHA 2Q4OA 4US1R 1T36B 5I4IA 3H5VA 5JNVA 2HF2A 2JB9A 3RYFB 1FRZA 1J2JA 2G6BA 1QIDA 1YU6A 2N46A 2RONA 1FMTA 2VSYA 3AR3A 3FROA 3LT1A 3FMFA 2I8CA 1FMJA 4MYRA 2QUZA 3OI7A 2VPZA 1YR9A 5A06A 4BECA 2UXDB 3HZOA 4BV3A 1ZNXA 2A5LA 3KOZA 2IP4A 2RK4A 1WQ4A 2CSXA 2FDXA 3H3JA 3KBOA 3WDLA 1Z34A 4FGWA 1S3SA 1X8JA 1P6QA 2DFVA 2QE6A 2IX3A 3AZOA 1A4IA 1XJ0A 3GJZA 3QFFA 4MPRA 3HYCA 4WWHA 5AM1A 5J5VA 2DF8A 2COKA 4ZZIA 3HKDB 2X13A 3CPEA 2J32A 2P11A 1ZH6A 2VHTA 1FDUA 2V1UA 3K70B 3NT2A 5FI5A 1MR3F 2WP0A 3GEMA 1OIWA 1JMKC 1PKEA 2MSDB 4GYYA 4OUDB 4CMJA 4MGHA 4P08A 1AKTA 3LQKA 5DI9A 5AFSA 5JJ5A 4JJ7A 3IAM1 1QG4A 2DU8A 5CEFA 4C89A 2I3GA 1M2FA 1NI4B 2VSQA 1ULTA 3D8UA 3Q41A 4MUYA 4WD3A 4YAEA 3W5SA 1FIUA 4DM3A 1FJ2A 1NULA 1LKZA 2VK4A 3OJ0A 1Y9JA 2KWIA 1E60A 1M1YB 3EDYA 2RGEA 3QLVC 1CUEA 5KC8A 2GZ3A 2BFNA 2P3LA 1CUGA 4UPDA 4ID3A 3VNSA 1KMNA 4A4DA 2V7EA 3SEAA 1SEVA 1BS1A 1QZ3A 2FZVA 1QR2A 1N5IA 5AH0A 1BJTA 1L7NA 1SZPA 2P4UA 3BTVA 4ZQEA 3ZXUB 3EEOA 2W6CX 2BUCA 4BFWA 1Y82A 2PZAA 4DRYA 4G07A 3B1KA 4FQ7A 4KR6A 3PLRA 3R7NA 3QEAZ 1FNSA 1U3TA 3HGQA 4L2IA 4EENA 1T4CB 4QHTA 1VCOA 4GR5A 3H5RA 2B5VA 4MX8A 4C2UA 2GEKA 3WLQA 2W2LA 1WP4A 3QKIA 1YRHA 4MYHA 3HYLA 1REQB 5DSXA 1J0XO 2FEMA 5FUBA 3SP1A 4BLTA 4BRWA 4V1CB 2CKDA 5A5DA 3ADOA 4IO0A 1GV1A 2C2YA 1WMAA 2ZKLA 3OG9A 3GQVA 3SSNA 4EQ6B 3EFOA 4N01A 2O0LA 1I3KA 1O8BA 5LFAA 3RS3A 2B1JA 1Z8HA 4U9UA 4JAVC 4HOYA 2PO7A 4OU4A 3D0KA 4ZI7A 3SOZA 3UMYA 1C3OA 3ZDCA 2CNKA 1U7PA 3K2EA 2ZIGA 3GEEA 4F04A 2Q4DA 1Q16A 1DXOA 1QMGA 4K3VA 5JS7A 4F3YA 3PNOA 4QZVA 1DGQA 2CLIB 3EYAA 3K1AB 1XPOA 4RL6A 2CNLA 4PX9A 2ORYA 3DNMA 3EEIA 1B14A 1HTTA 3IKJA 4GMKA 4PHTA 5DTIA 4NBKA 5ESWA 4M3NA 3KE8A 4E5PA 7YASA 3UKOA 5IJXA 3KNZA 1EK1A 1KYYA 5KKNB 1FXUA 1OT3A 1Y48E 2ZJOA 5ULLA 3WRYA 2A30A 5A4KA 1KR2A 3REOA 3BQMB 1DXQA 1T2VA 3PYXA 4N8EA 1AM4D 3D8SA 5FYQA 2X76A 2CZGA 1MG5A 3DLCA 3SXUB 2QX8A 2Z3WA 5IXSA 4HWSA 3CZPA 2R60A 1LXCA 3K2QA 5JMPA 5JD4A 1DQZA 4U0KA 5DRYA 8ADHA 1AU9A 1VSQA 4MR8B 5EKUA 3ZGZA 2WRZA 1CQPA 2B34A 2C04A 3HWWA 3QLEA 4CT0A 1QONA 4B3TB 3O8BA 2B30A 3PPYA 1HL7A 1QZTA 4P54A 4BC1A 5FUXA 4DA9A 4QJ3A 2Z6AA 1XRMA 4A73A 1F7VA 2A3RA 2OHOA 1PJ4A 3DMPA 2B36A 3WA6A 1P17A 2ZCVA 4Q19A 5JAIA 1C8VB 2P77A 1QU3A 3LC2O 4EIWA 3STVA 3X3HA 3ZGXA 3GHHA 3NAZA 3U4QA 3OF5A 4GOKA 3QBVA 2XIQA 1KK2A 1A9PA 5JYBA 5C46F 2LKDA 3DCIA 4YPOA 3QP9A 4URUR 2C2OA 3T7RA 5T64A 3NHFA 3ROPA 3ADBA 4E2WA 4ZMBA 1ULUA 3PE6A 1KJJA 3KALA 1DC5A 1ORHA 2G9QA 4QYWA 1PSDA 3FPEA 2I4TA 2WTMA 1YCGA 2HC9A 3IT0A 3R1IA 4Q7MB 2W6PA 2BF4A 3NH9A 3V4VB 2F17A 4EYEA 2FJUA 4YT2A 1PT6A 3BB4A 3ECAA 2B4KA 2F8LA 3LWZA 3MELA 3V97A 1S3FA 3HABA 1MB4A 4GOMD 4QHYA 4ALMA 1XD8A 3KQTA 4OXYA 2R2AA 4B74A 2FRVA 4B45A 4BNTA 3FAZA 3KAKA 2IRWA 3P0FA 1XEXB 5J4LA 1EWYA 4ZVQA 1JYSA 4HEA1 4KRXA 2E5WA 2FVXA 2A0KA 3AG5A 4CEHA 1II8A 4O59O 4HQLA 4MAFA 2FW6A 1UWKA 4MYUA 2F3PA 1Z7EA 2GARA 4C87A 1VM6A 1DAOA 4KYIB 5DSZA 5JCJD 3U5TA 1J0CA 2F1IA 3LDAA 1TYEB 4RJJA 5C1BA 3WNQA 4Q7JB 4JMLA 3TNLA 4UJ5A 3R74A 1E2MA 1USWA 5HOEA 3AY0A 1L5WA 1GT91 3ZLUA 2BEWA 5FD8A 4WBNA 2MSCB 1BFKA 5DXJA 5SY6A 3WS7A 4OB8A 4HX2A 4W8OA 2E4AA 2YV4A 1Y5NA 5G2OA 3WGKA 4TOIA 3KQPA 2BKXA 4UDNA 5H70A 4NULA 3D8HA 2XCRB 3UMCA 5C35A 1CZOA 3DQQA 3TM4A 2A57A 3OURA 3GELA 3MSXA 3DZKA 4YJDA 3RWBA 3CF4G 3GRPA 2RBGA 3VO2A 4D0LB 1I3NA 2I4MA 3RKSA 4MYTA 2W71A 5IAJA 1W87A 3MWGA 5CP8A 5B1IA 3SIWA 4BV9A 2O0JA 2IGTA 5CPBA 1EVZA 4RVUA 1SURA 2MWMA 5E1MA 4ZT6A 2BTEA 2HB6A 2JIZA 4WZAB 3QPWA 3U7IA 4B6SA 4FDVA 4IDBA 4JDUA 3IPXA 4C3OB 3MS4A 4E6EA 3DPUA 4B6OA 1PLJA 2C0QA 1B3BA 2Q6IA 4PNHA 4Y2RA 3V8NA 3CUKA 2Q5QA 2J30A 2ODPA 3W5HA 3I2KA 3W8FA 3W8DA 1QGYA 1V7ZA 2QMQA 4OSPA 3UG6A 4CN8A 1ZHOA 4P1ZA 1ZU5A 4UNSA 3WGNA 4C0XA 4FMCF 3BULA 3PFIA 5A03A 4B34A 1SU7A 1UXKA 2R4TA 5LP1A 2CCKA 4IHJF 3B1YA 4G8BA 1O6ZA 4YA6A 3RTEA 3QWBA 1TC1A 1V9LA 2QPTA 3OQ6A 3QW2A 4R1UA 3AEZA 4YQZA 5AICA 4BAZA 4E3WA 5JSFA 3R5JA 2ENUA 1E6KA 5EMHA 4IV0A 3SFZA 5JCJA 4PLWA 5DOZA 2Z5VA 1KAHA 3TFQA 1PR1A 4JR2A 3PQ4A 1TKCA 1JA1A 4DSUA 3VO8A 2QN2A 1FFSA 3FCSB 5FPQA 1RFLA 2FEXA 5DCUA 5HF5A 1PZXA 2PT6A 4QNRA 5LU9A 3BRCA 5KJ6A 3DXXA 2V5VA 2X7HA 3JVVA 5JXGA 1HE5A 3RU3A 5KTTA 5AI4A 1Y1LA 5G4LA 5BQ5A 1IATA 4MV9A 4BGUA 2VDJA 2VLBA 2WIJA 2ZIZA 4Y0NA 3X1XA 5BYAA 2RHCA 1XUOA 1WXGA 2CZCA 3NOXA 2WF7A 4YQEA 5FTJA 3L7BA 3OPXA 2K7ZA 2NU8B 3RJ9A 5C1OA 4G2NA 2C59A 3WQQA 5K03A 4DLVA 4UVIA 5HZKA 1SQ5A 2QP3A 2YHSA 4QU0A 3ENKA 3EOBI 4PINA 4NP6A 2AG0A 5AYVA 1NF3A 2YHIB 1N36B 1CUZA 3FY4A 5DISB 2VYVD 3U7RA 4I08A 4ESVA 4R6XA 1WMSA 1WLSA 4BMPB 3KTAA 5A3JA 3EGDA 4XVUA 1GSOA 3TW4A 3D31A 3HVKA 3P9KA 1F51E 5E8RA 2A1UB 3HNRA 2W6QA 4BMDA 3MTIA 3G88A 5EZQA 4RF2A 3VAAA 1SA0B 1QM5A 2ZUCA 1O58A 3K6RA 4RVHA 4OQYA 4XQCA 1T0UA 2W0MA 3F90A 3K16A 1VLMA 2QGNA 3IP5A 3L8ZA 3Q5GA 5LB4A 2QRKA 2MSEB 4PVDA 1CJTC 3AETA 4P2GA 2RB4A 4A8JA 5EL0A 4ETWA 1E89A 3HBNA 3PTZA 2IL1A 4K9DA 4XZ3A 4CPDA 1JE1A 1T5LA 4EKIA 3ZHCA 1ATIA 1EZZA 1G42A 4WKPA 4OPMA 4H18A 1VGQA 1XQVA 2VPTA 3LX4A 2HBQA 3WI7A 3TR5A 4AS3A 4FR0A 4EYGA 2ZB4A 1E3WB 4CDNA 3X2EA 4PEVA 3FUCA 1JXMA 2UYGA 2R5FA 3WYAA 3TDMA 3MINB 1W4AA 3RPEA 5DYYA 3U4GA 4UZFA 5DLPA 4AY6A 3HCCA 1R8SA 4UBKA 3HWSA 5C8YF 5LL6P 4KYTA 3DBVO 3NWBA 5JAHA 2JHFA 4LZZA 2BFEB 4X0EA 4XGNA 2BYTA 4I14A 4KAFA 1A98A 4DNQA 4AUNA 2QYOA 5KYKA 3ZVMA 2G09A 1D2EA 1QG6A 4RULA 1I3LA 3HM2A 3IDOA 3TBKA 4BRZA 2WG0A 1QGUA 4REQB 5CBKA 5JROA 1AHHA 2SNIE 4K9LA 4GZ3A 3OQOA 3IEKA 4XUCA 3THYB 3FCUB 1FDWA 4PZCA 4DT1B 4Q9NA 5CLIA 2X8WA 5AR1A 3C43A 1SKYB 5KTOA 4PONA 1Z75A 1VDMA 1P80A 5KX5A 2QL9A 1VGRA 2XYQA 4GLOA 1G9SA 1FUYB 1RNLA 3NBKA 5COQA 1GZHB 1GV0A 1D4FA 1H1TA 2VDWB 5JFTA 1PJSA 3EIWA 4OJNA 3D6JA 1RLIA 3OKCA 1G0NA 5DGHA 3JD0A 5DBHX 1PS0A 1SWWA 4RHEA 2CFCA 1N8NA 3E9CA 3N2KB 2AE2A 1BHO1 1QKKA 4D8YA 3F1KA 1HETA 4G9EA 3DGFC 2JARA 2ALJA 1F20A 1VL5A 4N49A 3UJ9A 3FF1A 3CZAA 3H2JA 5K0BA 2Q4BA 3ZD8A 1KRXA 3FOFC 2QZ9A 1CEYA 4IMIB 4QL3A 2EIHA 3RS7A 2IUUA 1WZNA 4R1QA 2OMEA 5A9SB 1T2FA 4YXWA 3LCJA 5HEKA 1GYRA 1GZ4A 2EC5A 2OBYA 1II0A 1YOBA 2IU3A 3LHIA 1LB1B 4MVJA 4ALKA 1Q74A 1Q0LA 4BMSA 4GSYA 4GUDA 1IOVA 5LLDA 1C7IA 4LVNA 1E5VA 2WA2A 1XN4A 4RYLA 5B4TA 3P9SA 4DV6B 1WKBA 3OOJA 5FT9A 1USUA 3I5YA 1D4ZA 1SU8A 2NO6A 4TWZA 1CTQA 3ZJYA 4HX9A 1TAHA 1DZ3A 1M83A 4R2WA 4E5NA 1NKTA 4CT4B 2RFLA 3RJZA 2CMGA 4J91A 4E5MA 2JCVA 2O05A 3BTSA 2ZWVA 4XYGA 3X43A 5FBKA 3LRTA 3QWAA 3DYIA 3EBPA 1USGA 3PHCA 4PGAA 1LD3A 2QR5A 4A5SA 2CE2X 3CW8X 2Y66A 1QHFA 3HI4A 1NA5A 5AXDA 4RY2A 4X90A 3T1NA 1VBMA 2A9RA 3FOEC 3WXMA 4BE9A 1KDRA 3CH4B 3OQPA 2IITA 4QASA 1EUCB 5E7IA 5FOXA 2YQ4A 3LW7A 3KKZA 3UANA 1EBUA 4MQEB 4CF5A 2DKOA 2SICE 2NSDA 2NUBA 1V2GA 1WDLA 1QQ5A 4MQ5A 1OI2A 2VWHA 3FI0A 4WCFB 2AA3A 1X7WB 4NCAA 3K20A 4WBNF 1RQXA 2GCOA 2MOKA 5JE8A 1X1DA 4OLHA 3C15C 3HGTA 5AVTA 2ZJ3A 2IPNA 3LQ1A 4QJIA 3T0FA 1V7QA 5EI5A 4IIYA 4C07A 1NRIA 4NE9A 4DRXA 4FD3A 5BT9A 3SXJA 1INLA 1FNDA 1GPKA 1Y7LA 1TEXA 2RHWA 5K1ZA 2IYUA 2R48A 3PXXA 4C4TA 1WP9A 3GBPA 2ZETA 3OCVA 4XJSA 4FCWA 4JT9A 4XM2A 1JUDA 3RT7A 3L1KA 4EFKA 5K05A 2HSWA 5HE8A 5THQA 2MTBA 4X20A 1DOHA 4Q0MA 4EB8A 1BC5A 1E1KA 2PQMA 3QV2A 3EC2A 3FBGA 4O1IA 2PGNA 2IHVA 3SS8A 3WHKA 2IDZA 4M8NE 2X2PA 4O6VA 4QYXA 5BRJA 5A5VA 4NBTA 5TE9A 3GNQA 4YXWD 1L7BA 5K3DA 5AQ1A 3H0EA 3IC5A 5IK2A 5AW4A 1KOJA 3OJWA 4L0QA 2I78A 2R6JA 3A2LA 1K2WA 3Q7TA 5DKFA 2PXAA 3ZBTA 1DO2A 3AWIA 5AUOB 4DMGA 1DX6A 3B7GA 4HS4A 1M7GA 2OCPA 1YZTA 1GPDG 5BNZA 2V6GA 4H15A 4A2WA 2MHCA 3W78A 1H3EA 4KTVE 2XZLA 2H63A 4W9RA 1Z0AA 4WBNB 3ZHQA 3WGHA 3VQTA 3AHEA 3U3XA 5DI3A 3F71A 5I9MA 1I2BA 5JU6A 3IR7A 2EP8A 3OOHA 1MXFA 1L5VA 4MA0A 3MWYW 2JLRA 3P0HA 5CA0B 1A77A 2IHBA 2VAWA 2QF7A 4TMYA 4Z9YA 1NBMA 3HUFA 1N5RA 1O96B 4K9QA 1KSHA 3N53A 3QF7A 2JI6A 5C80A 4CIWA 5HOQA 3RASA 2F7SA 3PR1A 2W5UA 3FTPA 3H5OA 3IAHA 4O2BA 2PUJA 3VU0A 4AYTA 1UF9A 4RO0A 4C4RA 1NXSA 2F00A 4G56A 1RU3A 4WFKA 2JFPA 2HQRA 5EERA 1A2KC 1LPNA 4BFYA 1K7YA 3CE6A 4TTTS 1F14A 3F7TA 4YN3A 4CMBA 4MQEA 2DG2A 1G9TA 3TOCA 4XPIB 3RG2A 2VPPA 3GJRA 3LPLA 4ROTA 3T9AA 3QKRB 5KYWB 1FW6A 3K4PA 4I19A 3B9RA 3R9KA 3Q98A 4JUBA 4KQCA 2Y6VA 2W6OA 3T52A 2CD9A 5KYWA 1P60A 3DVAA 1GNQA 5LMCA 2JBHA 3M5PA 3Q7PA 1PV4A 1WB5A 4QE3A 1M66A 1BVRA 3IP3A 1E79D 3NMUF 1H0RA 2IEZA 4V03A 1Z63A 1KY3A 3AC0A 5FYDA 3AW9A 1HYQA 4DCJA 2M1XA 3ROKA 4R2XA 3NBZC 1JKJB 1LFDB 1RXCA 5I9TA 4A6PA 2FMTA 2JGAA 3MVEA 3NB0A 1NJ8A 4E5YA 4EAQA 5K0CA 4UKDA 3GEBA 3NM4A 2B92A 2HZ7A 1E2UA 1Y7TA 2PRKA 3AH8A 5FFFA 5CDGA 5JXWA 3ZD6A 3IALA 4J0JA 2BFFA 2ID7A 1DIHA 1XZPA 4GEGA 2J0VA 1X9HA 4PHCA 3W8EA 4EMSA 4F56A 3TGLA 2GCNA 3STHA 4JENA 1F7UA 1JEDA 4YO7A 1TRKA 4BS9A 1SBNE 3BDAA 1TFRA 3MXTA 4ABTA 5EWLA 4E13A 3OAAD 4I6JA 1PUJA 3HBLA 5F3DA 4WL0A 1EESA 4GVPA 4H0FA 1FDOA 3OE7A 4CMAA 3JWJA 3TNDA 3EEYA 2DBYA 3C2QA 2I2AA 3R8XA 3O9MA 2Z1NA 4MV1A 4RWZA 3EIFA 1FVOA 1X7ZA 5ADUS 5AKLA 1AA6A 2EW8A 4ZARA 1X6VA 2A1UA 5U1PA 5EZYA 1T4GA 3AGQA 3R7BA 4RKWA 1BW9A 1OZ0A 2XJ9A 4N76A 3O95A 3ZIAA 5F5XA 2AKEA 4LMAA 3OKFA 2JLXA 4HNAB 1KVQA 2VYQA 3H1EA 2V4MA 3Q2IA 1WXDA 5K2MA 2YJNA 3D6NB 1R10A 2AFHA 2CNBA 1NW4A 1ZVJA 4HZUA 3E1GA 4RY0A 5FL7A 3JQFC 1R4NB 4JJGA 1UK8A 2QTZA 4LWOA 4V3CA 1NFFA 5CMLA 4V0SA 5FBQB 5C5CA 4JGBA 4EMUA 1ZIDA 1NBMD 3EZFA 5JEDA 4YRJA 1OZGA 3FB4A 3HMQA 3OLWA 2AC4A 4YB8A 2EFEB 3F73A 2V6MA 3U3JA 2BAGA 4F4FA 4IIBA 5JXHA 4JNCA 4BAUA 3I72A 1WPXA 3D5QA 3CLVA 2IPAB 4KFRA 1ZOOA 2D59A 4RK1A 5GJWC 5TPWB 3ESXA 4CQLB 5IN4A 1JSCA 3NC1C 3SC3A 3NT4A 1ATZA 1SM4A 1YZKA 2HQBA 3GEGA 4JGIA 4DVGA 5LP6F 4O8ZA 1YC5A 2V54A 2VP0A 1T6BY 3N86A 3TJRA 3B6JA 2OOSA 1DUSA 5JYDA 5JD3A 1JKJA 1UBOS 5AW8A 5DTJA 1EFKA 2LRHA 2QK4A 3TQQA 1PJLA 2VATA 3I2HA 3KO8A 3MRVA 4LKRA 3OHMA 3G1UA 3DLAA 4S1VA 4WLEA 1GLVA 2OV3A 2Q21A 4MPJA 5EXDA 4EGCB 1ZMRA 2P0YA 5KYYB 1PBTA 1ZJYA 4CCYA 1S8OA 4EJSC 2C9BA 1CY8A 2XHZA 4YHHB 5B7PA 1KI3A 1GNTA 1Y98A 1PR0A 3LLCA 5JT1A 3BTOA 1BDIA 1U3UA 2JFGA 2CLKB 3LH5A 5EXPA 3JPYA 2WUWE 1N2CA 1NQWA 2XOEA 2Q5EA 4XYMA 5FBLB 3CEPB 3T1OA 2NO0A 3GRYA 3K9HA 5AXAA 1ZL2A 4OOEA 4A91A 4DDTA 1GPYA 1QU2A 4PTLA 1A9OA 4RA6A 1F2DA 3BDVA 1ICEA 1OYWA 1TUGA 4MAAA 4EHBA 3JSAA 5LDGA 4Q66C 3R0QA 4RDXA 1RAHA 4DA0A 3ERCA 1ZUD1 1CZKA 2NU8A 1QTQA 4ZI7B 4HFNA 2QJTA 1QZUA 1R0BA 3MJ4A 4N6NA 3UWPA 1KU6A 4MQFA 4EY3A 1X15A 1P2FA 3TUZC 4JKIA 2YZGA 3MC1A 1CVRA 1L8XA 5HG0A 2CLEB 1DINA 4A0SA 4YUWA 5HKKA 4RNDB 4CF4A 4O2RA 1G2IA 4ZO8A 1CWUA 1P33A 3WLIA 2D1RA 1WA5A 1KE2A 3S2YA 1W25A 4YALA 5AK3A 3U7GA 3IUEA 1T91A 2AMLA 1TM3E 1W88A 3ND9A 3Q1KA 5IJ9B 4RY8A 5IVPA 3F8SA 3I9KA 1Y5LA 4RMIA 1CR0A 1D1SA 2DHDA 3OPYI 5I5GA 4S12A 5GIPE 3R9XA 3GUCA 3HUEA 3SDZA 1HT3A 1E5TA 1PEYA 1UPCA 2VHJA 3E9YA 1X14A 3R5SA 4MV5A 3VKUA 4D8TA 3EY4A 1LC0A 4NLLA 3W4KA 1XRQA 1BDJA 3W2EA 2LDXA 3AR5A 3IHKA 3OM0A 2FY8A 4I0WB 2GEJA 4R7TA 1SUAA 1XEFA 1Q5PA 2GFHA 3N0TA 3M49A 4IVPA 4K9SA 4YI5A 3U7JA 1TT5A 3IUSA 3IMEA 2P7HA 4UARA 4HH0A 4OAOA 4X9XA 3CMMA 3R5XA 1FRQA 3GLTA 2H5JA 3NJ8A 3AEUA 3W2HA 3FUXA 1SOWA 3N0RA 4GBED 3QVXA 4Y6QA 4KXVA 5TEVA 1T9DA 3V2UA 4HGQA 2PBFA 1VMEA 3QM1A 2FOXA 2OGUA 1QHHA 4U7GA 4W5TA 3STTA 3Q6NA 3KB6A 2NZWA 3GUYA 5JFGA 3LUHA 1GAJA 2V3VA 4EJ2A 4AM8A 3GEDA 4JNKA 3V3TA 1MGOA 3LZCA 3EVAA 1SEPA 4GPAA 3C8DA 3SKVA 3ZWOA 2DQSA 2VUIB 3UV3A 5E6RA 1O6FA 3I34X 2JGIA 1YRAA 2HIAA 4PYKA 4JODA 4X1OA 1GL9B 2H7YA 2VQSA 4EI8A 1AGYA 2C4MA 2F48A 2HSEA 4RK0A 1ACJA 4XW2A 4QO8A 2VC2B 5AHOA 3DCNA 1EFVA 2HJGA 5BN5A 4RKEA 4U9IS 4PO8A 4C78A 5A71A 1T6XA 3QF4A 5KC9A 4K8RB 3UHOA 1DWUA 3ZUGA 4NKRA 3TNJA 4NEGA 4QQ8A 2I2XB 3L6RA 1TO1E 1TW3A 1U9JA 3D4BA 3FAKA 3HBFA 4FJ1A 2PRYA 1S2NA 2XF8A 4OAQA 3AUAA 4OHXA 3RHTA 5K51A 4NPHA 3WGOA 4EM6A 5CAEA 3QSYA 1XRSB 3I39X 4XIFA 1HQKA 5D86A 1U0JA 1GUDA 2H2HA 5ILGA 3UJ8A 3VDXA 3X44A 5CFNA 4L9AA 5HK9A 3HA2A 5CGZA 5KNBH 5DCWA 4IDHA 5LJIA 4OI0A 1LRLA 3GWZA 2FZ4A 1BCRA 1QQTA 3J7TA 3OLZA 4QYMA 1O2DA 4HGNA 5DU2A 2B7CA 3MFQA 2WWFA 1AHPA 3K1YA 4WVLA 3FFTA 1PLKA 3RK4A 3WO1A 3TN7A 1OTYA 4MW7A 4NQRA 2AUMA 1PR2A 1Y6QA 4OFBA 2QVBA 3ZHRA 2P35A 3IIKA 2PS9A 2FX3A 3TWOA 4DZRA 4BQSA 3IXMA 3K5WA 3LUPA 4JSYA 3FPKA 1GKKA 1N2JA 5CLFA 2GEUA 1NAHA 1TKAA 1T0PA 2OGZA 2WSYB 2GGSA 2C84A 1YFKA 4MNTA 4QJBA 5KB3A 4MVCA 4PLTA 1MORA 2HYIC 1W85A 3GJQA 2ESRA 3QWIA 1K88A 5JECA 4WCFA 4DFDA 2ZU0C 2EFCB 2ZBEA 2OEPA 1PJQA 2D1FA 1TKRA 3NRJA 2HH9A 3WX0A 4IGEA 2NO1A 3PGVA 2AHRA 2I1VB 3IGFA 5BVGA 1LF5A 3WC4A 3COJA 3SEFA 2XT0A 4HNHA 3BORA 1BVUA 4YONB 3USCS 1WETA 1JIIA 2BHRA 3EC7A 2IY7A 1WX1A 4URHA 1ZONA 3LPNA 4URVR 5HKKD 3VPHA 2VHVA 5H02A 1CR4A 5EJ7A 3SY8A 2ILTA 4P3PA 3DDWA 3VPGA 5D1HA 4LMPA 4EZBA 4F3TA 5FXMA 3UHAA 3H42B 3S2SA 1DAEA 3UOGA 1ND6A 2BKUA 1I24A 3D1JA 4GG1A 4MPTA 2CL0X 4RF4A 3TBHA 5D84A 2AFRA 5CJ2A 3WFIA 3O38A 4LOKA 2NZJA 4X66B 4JOSA 4U5QA 1FDIA 2XTJA 3ZIAD 3SNHA 3OFVA 1K5GA 1RYHA 5D1NA 2XF2A 3COYA 4ARUA 5IFLA 3FWHA 1M2OA 2GBPA 3I76A 2HHJA 3ZV6A 3N8KA 4BMNA 2X4IA 5F77A 1W6RA 4LHXA 2CV2A 3ZE1B 5AJTA 1K4KA 5EJEA 1U80A 3KVNA 3L0IB 3G0DA 1WF3A 4EHLA 3LDFA 4AX8A 2CLLB 3K9GA 5F7ZA 3M6MD 4E32A 4RVSA 5ALZA 1DBIA 2EW1A 2ZIEA 1AQLA 3LA8A 1V9CA 2I6TA 1MC1A 4RF3A 3DMTA 1KZ1A 3M5CA 4ZQBA 3WSWA 2V4ZA 1Q7GA 2WJIA 3CG0A 3O3OB 5ICEA 1DEXA 2YC4C 1QQ6A 3QWHA 4P81A 1H85A 5AM4A 2BGTA 5DYTA 3Q88A 1GPUA 2JFVA 4B35A 3RVRA 4D4MA 4F4JA 4F2DA 5IT5A 4RHUA 5K0FA 1AHIA 1KO7A 3RVSA 2XUOA 3NBQA 3ABSB 3A2NA 4NTZA 5LP6A 1JSXA 1MO3A 1QRDA 1UMCA 3E9NA 4OGGA 1T29A 1XHLA 2Q4RA 3IVMA 3Q5DA 4LRXA 1M0WA 2CBXA 4I2NA 4IZIA 4AO7A 4CNQA 1H2AS 3AVYA 3RG8A 2ZQ5A 1Y34E 3B3AA 4DV2B 3A04A 3LUCA 2JDID 3KEMA 2ZDQA 2QLNA 4HQKA 5K3BA 4IX1A 5CA1B 2PYIA 2LXNA 4BVBA 3QTBA 3BQ9A 4IAOA 2COUA 1NW3A 2H5LA 2ZPAA 1F6BA 5CNIA 1UBMS 3RF6A 5KWJA 3GJXC 4MB2A 2GYVA 1OQAA 4IFTA 4X93A 1QRUA 2O19A 1TL7C 2EKDA 3S5UA 3V1NA 3VYSB 1PFKA 2VAXA 1N8TA 4UBMA 1QIMA 2J3DA 3C45A 1SKBA 2CUZA 3CPSA 5B2EA 1DTSA 3GFGA 1AIPA 2YOGA 4HAUA 2WKRA 4AB1A 1HBJA 4ATNA 1OFTA 4KQ1A 3CVXA 4QTUB 4QXPA 1QAOA 5C52B 1KC1A 5LB2A 2FMIA 3IR5A 3NIFB 4B7XA 4FNGA 4E2FA 4F3NA 5JSQA 3ICPA 4NCNA 1JLLB 4RTRA 4KMSA 4KQMA 2PPVA 4HNQA 1SXJB 1YZVA 3FG9A 1RLOA 2BFAA 3DZJA 1QC5A 2PLAA 3HRKA 4BLWA 1CHNA 1GKIA 3WGVA 1TYZA 2AEEA 1U8CB 4GLLA 5KAMA 4JI3B 3RAEC 1H1LA 2YJ6A 3E6AA 1R3UA 2R4UA 2YNMD 1RHJA 3PT9A 1MHPA 4PYMA 2DH5A 4WX2B 2D13A 3PDIA 1PO7A 3MTGA 4HEA6 2QHXA 1R18A 1WCIB 3WGYA 2PWZA 1LW7A 1PF7E 3ICOA 1VJTA 4ZV4A 2Z8YA 4QG3A 4MIOA 1OBVA 2WJYA 1SG9A 2B6HA 2B2CA 3DW1X 4AJ4A 4DMFA 4ZYZA 1HFEL 3IEPA 5JHHB 3EF3A 3QVWA 3NC0C 4C4ZA 3EIXA 2XDQA 4PCVA 3SQWA 2J4DA 4MW2A 1OLUB 5AOVA 4R98A 1VOTA 3TQCA 1ZI9A 1U4NA 4G0OA 4XVQA 4FFWA 1K6XA 2QTWB 2ZAYA 3AHHA 1Y1SA 3HZZA 4P4GA 4V38A 1XEAA 3F0TA 5HKBA 1ZWKA 4REOA 2BH9A 1C9MA 2PWPA 3HSSA 4Y6GB 5LU8A 2W42A 1KS9A 3K8YA 5EJ5A 4IILA 2G9NA 4AP5A 1JV2B 2LZ0A 4TKUB 4ZANA 3LBNA 4IXTA 1ML4A 3PUKA 5JTUA 3O1LA 1IM8A 5LQAA 4X8MA 1QP7A 1N2ZA 5BSWA 5DHUA 4CBVA 1U0BB 5DDIP 3CISA 4IXDA 4M1TA 5FA6A 3RKUA 5JJIA 1GP2A 2DHQA 2YWXA 4JT4A 4WTOA 3SLRA 5LR6A 2O6HA 3EZYA 5KJCA 1MC5A 5CFZA 1FSGA 3SQDA 5EJ8A 1PWXA 2FWBA 1DWQA 2UVPB 2GZ2A 1KP9A 3Q7QA 3G23A 1KAOA 3GLVA 2FLKA 3QITA 5DGXA 2PUEA 4G5FA 1JLSA 5CDUA 4MVJH 4M8IA 3ZEAA 2JJ1D 1JB9A 2JH9A 1NXXA 4OY3A 4QXOA 3V7WA 1G4AE 2PV0A 3IAAA 2G5TA 2XLBA 4H3KB 5EJ6A 2WFZA 2OQIA 4H08A 1NN3A 1YV9A 5H16A 1QK3A 4AZ3A 1GQ2A 2DVMA 3IBYA 4FINA 4EVIA 3AEXA 4GR9A 5ITWA 4HRYA 4ZJZA 4G6ZA 1OPRA 5A3QA 3FA2A 2QD1A 2P9TA 4V0RA 5JZVA 1G3RA 5DNUA 3AL0C 4YCJA 1EBFA 3S8YA 3U6BA 1KGDA 3A6KA 1H1LB 4ALIA 3UAVA 4KIUA 3TZHA 1XRPA 3K0BA 2B99A 3P9YA 3C14C 3GFTA 5T8KC 1N8KA 3U56A 1KFEB 1A2BA 2P3SA 2WHRA 5NULA 1ZM4A 3CNLA 5CRIA 4UAVA 2G7ZA 2WU4A 4OIMA 4LDPA 2QDKA 3VVCA 1A8HA 2OECA 3MBKA 1W1UA 1QOPB 3DFIA 2HPAA 5DM1A 5F5LA 4P7KA 1KC3A 5AI0A 4M46A 5K3FB 1LSOA 1JIJA 3M1YA 1TYAE 1BX0A 4IY1A 4YMIA 4BRSA 1E1NA 4P86A 1LC3A 1GL3A 4OGLA 1PEDA 1TF7A 4KPYA 2PGXA 3TR0A 4M87A 4CLDA 1P1HA 2CHFA 4GKVA 1EHIA 4HNRA 4NESA 3C3JA 1OI4A 3MPUA 2FSVA 1S2OA 1EX6A 2VXCA 4HDCA 4U2CA 1MRZA 4XD7A 4TMVA 4PYQA 4JWKA 2EP7A 2EWMA 4NJMB 4YP7A 2W4IA 4C5CA 1KSJA 4ZJYA 2YYSA 3BGIA 1P6XA 2NACA 3AVQA 3E2IA 4G37A 4E2ZA 3NI2A 5AVUA 1SHLA 1E2EA 2HRRA 5DEOA 4C6HA 5GINE 1DIOB 4KFUA 1SUSA 2QRMA 2CVQA 4KFSA 3A4MA 4OO3A 4W5OA 3UG7A 1RQGA 1MABA 1MTOA 4HCJA 4JMPA 4TRJA 2QTGA 1B8OA 3ZXSA 1QH0A 2ATVA 1NJ5A 1XWIA 3PWTA 3SR3A 3PEEA 3PPWA 3TKLA 2K6GA 2TMKA 1YT5A 2V9PA 2A86A 3AWDA 3CLRC 4LMBA 3PLAE 4L22A 1I2DA 1EE2A 5F52A 1U0RA 3R09A 2NZYA 1F3OA 3KUUA 1NBAA 2ANCA 2QIPA 3N76A 3NWJA 4U8GA 4ZQGA 2QX6A 3B2NA 3C6KA 5F3RA 1X7YB 3RT9A 3HDQA 2F1OA 1H69A 2R97A 3A31A 4TYNA 2NYVA 4P22A 3I5AA 4W1SA 1YVPA 1ODJA 3CX3A 3N05A 1DE0A 5HDBB 5KZMB 3AU8A 3IT1A 3RAJA 3TXAA 3NUQA 1BDBA 2R86A 4Y2SA 3EQ2A 2CMKA 1VA4A 3QBEA 4J3FA 2WV9A 4UMFA 4LHZA 5T41A 2FNAA 3UJ3X 4KN8A 5IJAA 1W0CA 2F1RA 5L40A 2OORA 1E7MA 2YTZA 2JFWA 1CUYA 2UVQA 3L5OA 4JWTA 4TSFD 5ABPA 4D99A 1N9KA 2GPJA 3NNDA 3HN7A 3PEWA 4AI6A 4YV2A 2OCXA 2F3QA 1K7EB 3V1LA 1XDBA 4C0SA 2GHTA 1UPTA 2B9EA 3A4NA 3FH0A 2R2GA 2DBVO 1WCV1 2DYKA 1DNPA 1SGWA 3G68A 4MK4A 4OGKA 4IDEA 1S2GA 4TSKA 4UMEA 4EY5A 3LKZA 4EK9A 4CKZA 1Y6JA 2QMOA 2VT3A 3VSBA 1NNSA 1B2LA 1HXHA 1JR4A 3W6UA 3F7OA 4WESB 1L9XA 1T9CA 3FM9A 3DC7A 5BR1A 5JZSA 1IBMB 3RTAA 6NULA 5ALSA 3RNLA 2CLOB 2P0EA 3K8OE 1M2VA 2PQ0A 4LJ9A 1UAYA 4LJ6A 1CEXA 4N40A 2BSAA 2CDCA 2C2MA 2H7VA 4LBWA 4TS4A 4Y2VA 5FWXA 3JQ8B 4ISBA 2Q1SA 3ZDRA 1YA6A 1Z4IA 3TSWA 2Z2KA 2AQ8A 2QPAA 3FNEA 2J5XA 1VJRA 2YFQA 1GDTA 1RRPA 3EMKA 2NXCA 4EVRA 5EIOA 2FUG6 3WB0A 3G7NA 1XZIA 3UGJA 1RYNA 4O0LA 5LN1A 2PUBA 3G9UA 2EX4A 3IHWA 1FCJA 1N0VC 3C70A 4QOFA 4DSNA 1RYBA 3OECA 1ZUNA 2GPWA 4EZIA 3HCFA 2ZRJA 1WV0A 3P0IA 3M70A 1L5SA 2F59A 4CKWB 1DADA 1SHUX 4HAYA 3M81A 1Y8RB 1YQTA 3AKDA 5A3RA 3CNQS 4M60A 3M2TA 3VX3A 4KO8A 4MVJG 3FSGA 1W52X 4E12A 3ZWMA 4GPEA 1T0HB 3A4LA 1EWKA 2NUPB 4GQAA 1C9NA 5A3SA 1EWVA 1TQHA 4CIYA 3KB2A 1UWLA 2ZB2A 4YYEA 4IRMA 4B5LA 3B12A 2VQEB 5KVSA 4Z51A 1NBIA 3BK1A 5IT4A 1FUKA 2APJA 3S2EA 3EPPA 3CNBA 3PC8C 4PPYA 5EYPB 1BXKA 3O91A 3R0XA 3DVQX 5EA2A 2XD9A 1O03A 4KZPA 2OV8A 4LIPD 2VJDA 4R71A 1HMYA 4TSFA 2RK6A 2X8AA 1DRJA 4Z9AA 1FDVA 4BIMA 3W5CA 3EAFA 5IUKC 4JL8A 3ACBA 1ZRSA 3HCEA 4A1FA 4CMIB 1L4BA 2HQOA 2XPCA 3VJMA 4BO6A 1E9EA 2XMZA 2MR6A 2RI1A 1HFJA 4NPCA 2IW3A 3LSYA 3CHYA 4JQYA 4MHSA 1X1BA 2H4HA 2PL3A 2VK1A 2E55A 2WM3A 3LP8A 2BN4A 2PUWA 3AQIA 4QYSA 1SWVA 1WF6A 4Q4CA 1D0VA 1FFBA 4G09A 5BSUA 3VTZA 2H59A 5EIEA 1IZZA 1DG9A 1EA7A 1GNVA 2Q9BA 2QKYA 2FB9A 4HLUA 3C6XA 3ZGLA 2FQQA 1GFSA 4FBLA 2KLBA 1E2LA 4HC4A 4EBBA 3QYJA 1ZNWA 1Z83A 4QTTB 3U19A 3PUXA 2WHXA 2FP3A 3DAFA 3D81A 1Z0KA 2V0NA 1W5TA 4B4KA 2ECKA 4O3FA 2GQ0A 1ONOA 2Q6VA 2QUAA 3OPVA 1V8PA 4YPVA 2VLIA 1XEWY 2P2GA 5KNCA 2AJBA 5BW4A 3MWJA 4MKZA 4A2PA 1Z62A 3FPLA 4C4PA 2HIGA 1V1RA 3AFOA 5UKDA 8ATCA 1ZM9A 4B47A 2P0AA 3AOEA 3RK0A 4WDRA 1NVUQ 1AZLA 1OX4A 1NX6A 3IPRA 3NIGB 4PVCA 2JCBA 2BFCB 2N1MA 5EPOA 4IL5A 4KPUB 1ONPA 4FK8A 1NMEA 1U1IA 1TCVA 2R9VA 3ABOB 1ZZGA 3B6EA 2J41A 4FJ2A 1ID1A 2BZ1A 3HI6A 4G8DA 2BMAA 4M8SA 2HEGA 3RTGA 4C76A 1W1IA 3BIXA 1JU9A 2P62A 2Q8QA 4R9NA 3BRSA 4BNUA 2FX5A 1W88B 2A5GA 3KQWA 4EB6B 5EQFA 4TVKA 2GEFA 4NZOA 4IOKA 4Q9DA 1RRVA 5G40A 3ZLTA 5A7HA 1NUTA 1SG6A 2M6RA 3VR6H 3VPDA 5G0UA 1JX6A 1L4YA 1UMCB 4ZD6A 1YZUA 3OVMA 1Q3TA 5FOQA 3O03A 2I2CA 1GTSA 4IYJA 5D85A 1NOKA 3ULKA 1KZGB 3D7NA 2PAFA 3EQ9A 1YL7A 4MJXA 4X3CA 2QVLA 1FE8A 2I6QA 1JEYB 3GEIA 2PD6A 2OO5A 3C3EA 1TEVA 3EHDA 1S2DA 4RTQA 2DUWA 4R8MA 4JASB 2IUFA 4UCFA 2FMXA 5P21A 4JLKA 4EPTA 1TC2A 3G9XA 1NL3A 3H5WA 1UZLA 2WB4A 4ZHSA 3C3YA 3JARB 3VDNB 4NY1A 4W7IA 4RMGA 1U7XA 4QUGA 3EZXA 1RXUA 4M7OA 5AI6A 2PKEA 3VO9A 1YJQA 3WQRA 1CEEA 1WEHA 4I55A 3EFEA 5JS8A 1A7KA 2FWRA 1XVUA 1XZGA 2ODEA 3DL0A 2P75A 2W58A 1Q17A 4NENB 1F06A 2NTYC 4KVGA 2J8ZA 5F4BA 1M34B 2WAXA 4HSGA 4FYVA 2JLVA 5TS3A 3I8SA 2JAXA 1VE3A 2GVDC 2OZEA 3G59A 3FTEA 1X0XA 3HHEA 4FI3C 4BNKA 4X44A 4MWDA 1ZIPA 4IYRA 4UCWA 4X8HA 1S6YA 5C4IA 2QTLA 4R0MA 1HGXA 2A0YA 4OCZA 1OIXA 3IXQA 4KR2A 4XDGA 1UXIA 3R3UA 5D7NA 1SVLA 1ZD3A 5FPPA 3ROEA 3SKXA 3VM6A 3IAS6 1U7WA 2G83A 1UPAA 1WS6A 5HJ7A 4J7UA 3HXQA 3GAFA 4M0CA 4RIEA 1OKKD 4F7DA 1RVDA 2O3QA 3QQPA 3WWOA 5IEJA 4AQYB 3ORHA 1XI2A 3MJSA 2YWCA 3IDSA 3RBZA 2HO4A 4IJ6A 4Q21A 1QTIA 3C3XA 1F1JA 3CU5A 4MWGA 1NVMB 4TPKA 1VPDA 3KZCA 1M1UA 4CKYA 1E59A 4MKXA 1CZRA 2ISSD 3SS7X 5K8CA 3AR9A 5J4HA 5JCPA 2W2KB 1JAIA 3U1BA 3GCZA 1PJ2A 4HH4A 1YQGA 3CS3A 3DOFA 2PE5A 4IDPA 1JPVA 2NT3A 3WA7A 2PBRA 3DVSX 1YCDA 4BUZA 4YV1A 2FQYA 2AN9A 2WHQA 2ZSUA 4BEJA 4DCVA 4E94A 4JI0B 2XXAB 2CV1A 4FNMA 5CCEA 4KKXB 3BIWA 2G82A 1S02A 1YJ8A 1A5ZA 1NMYA 1LZLA 2FFBA 2I4IA 2A7XA 2OWDA 2QTBA 4MV8A 2GK3A 2V5AA 3IDZA 3JQ9C 5F51A 5FPHA 3DDCA 3INYA 3UUFA 4D46A 1KNQA 5JH7A 1N33B 2FMHA 1V6AA 5E2IA 2B94A 3AR7A 5TSDA 1KFJB 4KE9A 4XPZA 2WWVD 3UOAB 5DVZA 1BCRB 1AOXA 4A0QA 5GAJA 4GWLA 1XG5A 2ZTSA 5J2UF 1POXA 4Y1RA 4FSHA 4MO2A 4R41A 4I8IA 1VL6A 16PKA 1ZWLA 2XBLA 2ZAMA 4KXMA 3GJ8A 3ETHA 4PO3X 3KT6A 3PE3A 4RVNA 4X65B 2DJ5A 1KEZA 3I0ZA 1I33A 3HP7A 2VEDA 3NOQA 1PK8A 4PO9A 5E9AA 5BORA 1CVIA 4KI0A 4NH4A 1T3HA 4F92B 4XOUA 1VZ3A 2JEOA 5AHKA 3U3KA 5KCMA 1E18A 2PUVA 5EE1A 4DG8A 2AJTA 1PK9A 4G0YA 1O4VA 4HN9A 3BEDA 1GUBA 1QOQB 4GDMA 5DMHA 5EGNA 1RQLA 2IEGA 5ELLA 1WHSA 1SXJC 1IZYA 2X2FA 4FZ3A 2OT3B 1CJMA 1QCCA 1N9GB 3UXMA 1JBEA 3B2EA 1HZZC 1OOEA 1FRNA 4GGOA 4EHFA 1NIPA 1OBCA 2CUTA 2XYVA 5P8WA 5TQJA 3UJNA 5EMLA 1KEEA 1ZBDA 2EQBA 2G70A 3ETDA 2DPHA 3NHKA 1ISRA 4HLCA 3SR0A 2BV3A 5DLDA 4L5JA 3UIEA 2KI5A 3VMMA 4F4CA 1VG8A 2YXPX 5AI8A 3SU8A 3UFXB 3W0LB 1OXUA 3IJPA 2WG2A 1VKNA 4JC5A 1LPAB 3KJQA 1QHHB 1U2GA 5KYVA 4FZ5A 2NNWB 3ETNA 1RIFA 2WT9A 3OCYA 2FETA 4KACA 4LA4A 4GI5A 2VJMA 3V8EA 3HPQA 5BUZA 2B7LA 3AFMA 3G2QA 3TCKA 2XODA 2O59A 1M2VB 3BB3A 3BREA 3FGNA 4KIWA 3WL8A 1KZ7B 1O95C 1U98A 5EPUA 3CRRA 4V2IA 3S40A 5I7FA 2GF2A 4DTIA 3K3PA 1CIVA 1P1FA 1DBVO 1AQYA 4OMFG 1NONA 4W6ZA 5CM8B 4OTZA 3X1ZA 4KX5A 5CDFA 4LRYA 4MI1A 4ND8A 5GOZA 2Z2IA 4C6TA 4I1VA 4HFMA 2GNOA 1XXHA 4CEIB 4KE8A 5K3SA 1EQAA 1LDBA 3AP3A 3VGJA 3PK0A 2ZRIA 1NW6A 4TTSA 4OXXA 1XRJA 4JI4B 1R0XA 1U2RA 1HYGA 4JX9A 3GGSA 4RL4A 3HTXA 2I22A 4QFMA 3F49S 1OV4A 3NTVA 1EVYA 5KKAA 1BQEA 4I1OA 4HL6A 1XKXA 3GPIA 3PQ6A 3LY9A 3ZV4A 1JR3A 4U7PB 2P3OA 1PZFA 3AUFA 2P9FA 3CLUC 3HJTA 3HP4A 4NQZA 1DZIA 1PNOA 2REQB 3AXSA 4QYIB 5C51B 4UDOA 3LUAA 1G55A 1VRVA 4KG7A 1BXRB 2R4QA 2XVZA 4BTVA 2AW3A 2XWSA 4BO8A 3MLAA 3OTQA 3A05A 2ACKA 2QXYA 4M9CA 4D44A 3MGKA 4ZGBA 3T95A 1S0UA 2R79A 2ZR9A 4J4HA 1K9VF 4NABA 2OXRA 3O93A 1H65A 5CBPA 5F4ZA 3L4EA 2QRJA 2W4QA 4MUBA 4IICA 1NJ1A 3OMLA 3PDUA 4V0QA 2QM0A 3RI3A 4B3FX 2OV4A 1RWNA 2QUBA 1G3MA 4KRFA 4R3WA 5BNTA 5BXQC 4WN9A 1PK7A 1E3JA 3D3WA 4LYAA 3WLKX 4AW9A 1G9XA 3DXYA 3QLUA 2RGBA 1XP8A 1EXDA 3IPYA 2B83A 4HUJA 1FXWA 4KAAA 5DT9A 2WNSA 3BS4A 4DJDC 4TXLA 2CLSA 1W6UA 1ZS9A 4DVJA 1K8RA 1JH9A 2OCIA 2F8MA 4JJAA 1EDOA 1DAPA 4OB7A 1L5GB 3PNPA 1Y3DE 3TDKA 4A0RA 1B00A 1G5HA 1SVNA 1FP2A 3VZDA 2XVXA 3NPMA 4MHOA 1MUUA 3ELBA 3K0AA 1SUWA 1YO6A 4Q3AA 4U6SA 3M9XA 2X5OA 1PSZA 3K9QO 5JQGB 3IO5A 4KXQA 2VYFA 3I6ZA 4WZBE 3S2IA 4AUEA 1IG3A 4J43A 4UU7A 4GXNA 4RKYA 1E7SA 1JDTA 3KSZO 4L6AA 3MEQA 1XSEA 2X58A 3DVAB 4HXYA 4MV3A 3WK7A 4F8JA 3IXLA 4MICA 4QDKA 3RLIA 1QANA 4UHEA 5CH5A 4YLYA 1A9XB 4UM5A 4BMXA 1G7RA 2IHJA 5GVSA 2XE8A 2C1EA 2Q2NA 3PCTA 4G0QA 1UJ4A 4XCQA 2B4TO 4AS1A 3LOQA 4IDCA 4AG5A 1E4EA 1H22A 4RPLA 1GXSB 1FP4A 1TB4A 4HQOA 1XAJA 4LXQA 1E9SA 4GEKA 4LZNA 2HRQA 2ZYSA 5JZ9A 2E82A 1D4AA 3TUIC 1HZZA 2WJ4A 4PX5A 3BXZA 2PJZA 5IU6A 3JQ6A 4YFVA 3ZVNA 5C8YB 1J6UA 2FE1A 2FP4A 1SCUA 1XTVA 1Z0JA 2AMVA 1FUEA 2P40A 3PYMA 4KXYA 2C99A 3PQ2A 1Z4NA 1I6WA 2Y9MB 2FJPA 1JZSA 4YR9A 1Y9DA 5AUPB 2ABWA 4IIEA 2PRSA 3LX6A 1MAUA 5B3KA 2X9QA 1X70A 3I53A 5DULA 3IIMA 3CSSA 1IQ0A 1KKLA 2Q9CA 2G9VA 2RH8A 3BF7A 1ZA2A 2G9RA 3IUYA 3TMAA 1BW9B 4L7QA 2C0PA 3KHUA 1MU0A 1AGPA 2UVPA 1E9FA 4HK4A 2GZSA 1X7ZB 4GYJA 2I8AA 4JVMA 3Q87B 3RRMA 4AO6A 2X5NA 3QK7A 2R5WA 1IVSA 4GYKA 4EKDA 1W5SA 1U7OA 5B57C 2Z6VA 3IHLA 3LWBA 5E1DA 3NP7A 1BKSB 1KFBB 2OZPA 5H80A 4F6LA 2AUNA 3O5AA 1CG6A 3P0JA 2FG5A 2O7RA 3GFQA 4U63A 3U3RA 2G8NA 3PD1A 1GGNA 4G84A 5JG7A 5KOJB 4CTJA 1MIOB 4IH4A 3OM9A 1ZSYA 1PHRA 1JVBA 2NGRA 2ISQA 4RD1A 5CX1A 5AKKA 3O0TA 2CK3A 2PGDA 2PL5A 4NONA 3ESBA 4CV0A 3SYRA 3ZE0B 2XQJA 3DWIA 1DV2A 3O1HB 2NQ8A 2VZ0A 2OXTA 3QLTA 4TKZA 4UQPA 5EOVA 1QO9A 2Q3JA 3EIHA 3T5AA 3CFYA 5GGYA 2D3WA 4PLPA 3MOIA 1NMZA 4X94A 5A6SA 3H3XA 1L5LA 5KWIA 5EJMA 3DWGA 2WIGA 3NH6A 3ZK8A 1NU8A 3WLPA 2R96A 1ZK2A 1ZD1A 1ESEA 4ON9A 5LYJA 5J2TF 1HRKA 2IYAA 4KLAA 1JDJA 4L9WA 1VYTA 3HC7A 3GROA 2MYNA 4G4IA 3EAGA 1CLEA 2PK3A 3HH8A 4NBUA 4IPTA 5A4FS 3L18A 2H4FA 3KL4A 4FCVA 5U4XA 4B73A 2I6FA 4AAYA 3BT7A 1SK8A 4I1PA 2NVUA 1NR1A 2QNIA 4NECA 4HPWA 2VNKA 2BUAA 4F5EA 2OAGA 5ARBA 2ZRNA 1FMLA 2N47A 4LQLA 4U8HA 4UTRA 4YUYA 4CM4A 1X7HA 3DOHA 3ANXA 4J0EA 2BH2A 5IJ0B 3Q7EA 4BO2A 4KRGA 1E8DA 1DG3A 2GK7A 3PG5A 3Q8LA 4QARA 1RWVA 3NP9A 5EUMA 5A6VA 1E2DA 5HP4A 4XYBA 2GN0A 4KQFA 4TKUA 1DPFA 1C9JA 1JA9A 4D6XA 2EBFX 3GDHA 4PAMA 2BMEA 2ODAA 2V6JA 1PG0A 4MVJP 2QAGB 2X2EA 1OWMA 2HDOA 4TM7A 3TTTA 3SVLA 3ADCA 1PVOA 1H05A 3KEFA 3STYA 3VZBA 1IUNA 1RJEA 3PFGA 4CM4B 1QORA 2RKOA 2R6R1 3BZBA 2YWFA 1ZD5A 3RSOA 2ROQA 1YDHA 3MCWA 4DIMA 3TRDA 3WNBA 1TZBA 5CD9A 1ZJWA 1ZXLA 2YW9A 1FVXA 1T2EA 4J4TA 1AT1A 4DZZA 3S28A 3HLKA 3D3QA 2ZUTA 3SIPA 4B3XA 1V95A 4CV1A 3SG0A 1PEAA 2QG9A 4M0FA 4NH0A 3L9WA 2J0EA 4IIJB 2ZBVA 4NBWA 3ZIUA 4DYDA 4HDQB 3VBCA 1G8PA 2NSLA 3K6SA 5JNWA 2C78A 3DDZX 1IWOA 3DE5X 1UK6A 3QPVA 3UB2A 2CVOA 4HAWA 1AC5A 5BWBA 1SIWA 1O54A 1FS6A 1WU8A 2L42A 4OJYA 2GLXA 2ASEA 5DM2A 3W9UA 1T4CA 2M1ZA 1DCTA 2PZEA 3GZTB 4MYCA 2QTCA 2ZVDA 1PJCA 1GTMA 4YP1A 3U3DA 5JQWA 1OGYA 3HFGA 4LISA 4CNBA 4B9AA 1XZFA 4BFVA 3UMBA 2HA7A 1CV2A 4MINA 1ADYA 3JR3A 5FOSA 3B3GA 1RC1A 3UT5A 3DZ8A 4HDSB 2DR3A 2RHOA 3QI7A 3NONA 1ISPA 1LK5A 2Z09A 3JX9A 4XTCS 2JIBA 3LCRA 1TKBA 2CLDX 5CB0A 5MFPA 2QRGA 5J2UA 2B4RO 2JCSA 4I4IA 5MN4A 3LWNA 3C8MA 1P9NA 2ZJFA 1S8NA 1JPNA 1GKLA 4LOLA 3P2JA 3FF4A 4DRXB 3C3MA 3FCAA 1UM9B 3KUXA 4MRPA 3ZWDA 3OUTA 3DFUA 1EJ0A 1Z15A 3COPA 3ELWA 3FBTA 3PKIA 2CLHB 4HS9A 4DBLE 5JQGF 1JHUA 3F4LA 2NYRA 1ZH2A 2RAUA 3O1IC 5B12A 1ULSA 1CX9B 2AYZA 3AB3A 3E81A 1E32A 3K1AA 5LQNA 2X23A 1E1LA 2QLMA 3U48A 3TPCA 4BGIA 4XLTA 4GMFA 1F9EA 4FFOA 3B1FA 2Y1DA 4K7JA 1A7JA 3MUOA 4TKLA 4W82A 4WXMA 5EFOA 3BMNB 1AKVA 5TGTA 3IQFA 1YVRA 5J1TB 3KVVA 1F6DA 1BXRA 1U2TA 2GHQA 3ASYA 5T4EA 2HHCA 5ITVA 3LC7O 1T5SA 4RK4A 4ZEVA 4IDOA 2JAOA 1A27A 1PL8A 2E49A 2V8BA 4K9PA 1R5NA 2HU7A 5CYOA 4B4UA 2VCYA 1X2EA 1M72A 4LF8B 1WKCA 3DQZA 2IJGX 5EJ2A 1AKEA 1NY6A 3WWYA 3LHSA 1O77A 2XVAA 2Z3VA 1I51A 3H5LA 5EY5B 3IOBA 5BQPA 4Q1EA 1UBNA 3E9EA 3S2UA 4KB5A 3CTPA 1VMIA 2VWQA 5H7XA 2IZ1A 3BMQB 4O8CA 4OFZA 3VISA 2V7QD 3JY6A 3NEAA 3H8JA 5IM4A 2HBRA 4BWVA 4IVRA 4LQCA 4JV5B 4EF6A 1GA1A 2Y2UA 4N1AA 1NW9B 4AZ0A 1F12A 3W9YA 4CZ2A 3A9TA 4FDTA 2HLDD 5C7YA 3QXSA 4H3HB 1EHCA 2FQXA 5LLTA 3PP8A 1DQNA 3PC2A 1Q6YA 2JW5A 1F2TA 1UFRA 2CNOA 1KK3A 4GX0A 4O4JF 2EZ9A 5A4JA 3A3PA 4RW0A 4FSDA 4LYDA 3S7ZA 1W94A 4EA9A 3O3NB 1Z6QA 2Z04A 1Z6AA 3IERA 1KZ9A 5C1PA 5KNDD 4CIXA 2Y9PB 4JHXA 3FLAA 2D00A 3H1GA 4OQZA 3W5VA 5A4DA 2WPNA 4BEBA 1WUJS 2CJWB 2GM5A 2WTXA 2Z95A 3IAM6 1H2HA 4F3KA 2Q1YA 3UFXA 3E0XA 1HF3A 3LW8A 2P6OA 3NDBB 5E8JA 4A0GA 1J8YF 2GEBA 1TZKA 2VI5A 3K5PA 1SQGA 2NWQA 2VWGA 3ONNA 4Z8XA 3TLKA 3KKPA 1YZYA 4UNQA 3VHQA 3IQXA 2ANBA 2AN5A 3H9UA 1LSSA 3IMGA 1Q1EA 1PJAA 4RWEA 3PR2B 5ECYA 3UICA 1V1MA 1XTBA 3U31A 2FUNB 2J3MA 2PRJA 4TXMA 3DULA 5AHXA 1N0UA 1YMUA 1KFCB 3HR8A 2IYEA 3O4JA 1OXVA 1HE3A 3N2YA 1EK0A 4PLHA 4KQXA 1HO3A 3Q9NA 4A9AA 1MQSA 1M74A 2AOVA 2XRFA 3MCUA 2RGGA 1BYUA 2JGLA 1CY6A 1QKJA 3H9GA 2IV3A 1EM8A 2PVPA 1U0SY 5TEWA 1R8YA 4PQYA 1CP2A 1YMQA 2BEWB 2CD7A 2GLUA 5E7JA 621PA 3HXMA 2DSTA 4M0LA 5REQB 2NZ8A 4LOAA 3FZYA 1XZ8A 2C07A 5LP6C 5TDHA 3OIDA 1JBQA 1U04A 1XTIA 3ORQA 1X13A 3ZBUA 1V7PC 2C7VA 4J6FA 2C82A 4GM0A 4S24A 4ZAVA 3W6ZA 4DADA 1T8SA 1OXXK 3FDXA 3K09C 3D6FA 4HRAA 1WR8A 4RESA 4H27A 2AYYA 4BKQA 4ERXA 2OZLA 5ICFA 1JU4A 2DLDA 4LDAA 2VBGA 2WYIA 2IYRA 4FR5A 1I8TA 2ZB7A 1IDOA 1ST3A 3BPSA 2Q9UA 3SX0A 3G82C 1QRRA 2PIAA 2HDWA 3WVNA 3D5TA 4IQ8A 2IBSA 3K32A 3EUEA 3PA8A 4BNJA 5IVHA 2BMVA 2O3TA 2GEDA 3C6MA 3OQ1A 5J4YA 5B2ZA 2F8SA 1EUZA 2CW5A 4YAWA 1RWXA 4KITB 3Q9UA 3V4OA 5A5EA 4ENUA 1TAUA 1Z5ZA 4AZSA 2R8EA 1T5HX 3ZY2A 2VJLA 1Z8NA 4GF5A 4QSMA 2QA5A 2VNHA 1Z07A 3F74A 4CI9A 3ENNA 1QHNA 1AZWA 1PZHA 3FYSA 4OX9B 2VNAA 2WAMA 1JJFA 2VJAA 2VOJA 2D0PB 1JT9A 3OHSX 1BHJA 4RD2A 2AHOA 4Q4JA 4KODA 1F4PA 3W5IA 4MUNA 5ECDA 1WB9A 3B13B 2FUCA 2R68A 1IUPA 3KQMA 1U28C 1FXSA 1OD6A 3M5WA 4XEHA 5F2OA 3DP7A 2QY6A 3W2TA 3U26A 4FB4A 4B3RB 5A6SB 1N5KA 2FZWA 4QRHA 5EHIA 5G02A 5F9FA 1IRXA 1P2SA 1WUHS 2PH7A 1SVIA 4HI0E 3LDUA 4B5KA 3R7FA 4EARA 3GK3A 4XFKA 3GX1A 2QMZA 3VJRA 5SYMA 1TCCA 2YRWA 3E4CA 4D9HA 5KTRA 4H1WA 1UK9A 4N5HX 4RABA 2PXHA 2WQ7A 1GTVA 1KYTA 2YZ7A 4L1KA 2IDKA 3L0PA 5LQDA 2YDYA 1I0ZA 3O3MB 4CM1A 4IWYA 2A0WA 3TSCA 2K5UA 3CLTD 1KQNA 2PKXA 3AYXB 4Z9BA 1U3WA 1UXJA 4G65A 1LI5A 1GTZA 2WHPB 5E0OA 4W5QA 3KQLA 1NATA 3RFXA 1LDNA 4Z0TA 4DEYA 1LV7A 4BMVA 4Q1AA 1X1SA 4Y6LA 4KFTA 3BK2A 1NHWA 5FL7D 2ZWAA 3RYTC 4G36A 2PX8A 3O8QB 1G16A 2AGVA 1UL1X 4OQNA 1L5HA 2EL7A 3A3NA 1TI7A 2QMEA 1R88A 3RC2A 1NBHA 5CH8A 3TFOA 2G25A 1Y8AA 2NU7A 1AZSC 1GCOA 4RK5A 1PDWA 4HB4A 4Y1FA 4YGYA 3UJDA 5DNCA 3I61A 2YHIA 5EN4A 2OQ2A 2XNCA 2VDNB 2DB3A 1ABFA 1QF7A 1UBEA 2HRZA 1LJUA 1UJCA 2WSLA 2RHLA 3KKEA 1IQRA 3EFBA 4PZDA 4DR6B 4F72A 4JI6B 2GVNA 2JDIA 3MLBA 1O5TA 4FTWA 2TECE 3LT4A 1SXHA 3ZHVA 4RS3A 4CL3A 3GLFB 5J2TA 1P75A 1JE0A 2QAGA 1JAXA 3IULA 3NTUA 1EJ2A 1RBYA 1ECBA 4H7JA 4L9SA 3RSCA 4BQRA 4ZDIA 4GL4A 2CLCX 3CF0A 4AROA 3LIIA 1MNAA 1AKNA 1AQUA 3UWMA 1IY1A 3HU5A 5DHAA 1DKUA 1ODKA 3UGQA 5AUQA 3JZMA 1P0QA 2CNWD 1SPXA 5JLAA 1OV6A 1NMSA 3M6FA 5JDIC 2QYSA 3R5FA 3OOSA 4H6VA 5DW3A 2XQGA 3RTBA 3B8EA 3RV4A 2ACVA 1GUYA 1KKUA 1QDEA 3IJ5A 2JCGA 2DQKA 4HDSA 2YICA 4B40A 1D2NA 4OJTA 5AJVB 3DO8A 4UHFA 2YCLA 1P91A 3AUUA 5KTKA 4DAOA 4K46A 2BEJA 1WBBA 1WSWA 2J7PA 4EFLA 4E09A 2P9HA 3AJAA 3ZQJA 5JISA 4MULA 3DCYA 4LZLA 3DZCA 1SOUA 3D6TB 4OJKA 2XUIA 1R12A 4Q9IA 1UWVA 2PIDA 2GDJA 1GG9A 3CH5A 3CZQA 2EXXA 4ESEA 1Q11A 3U4MA 1ECPA 5GMOA 3JWEA 5AK4A 1E7QA 1EP2B 1XLTA 2VDPB 2W2VA 3KJZA 9GPBA 3KR2A 3I3SR 3JWHA 2AK3A 2P4HX 5E6RB 3BFKA 1P19A 2DHEA 2QR2A 2X42A 3JCZA 5CT4A 3T7JA 2N0SA 3HKCA 1JDBB 1PKXA 1U31A 4WCDA 2FKAA 5SZHB 1J21A 2ZIAA 5K6AC 2V0GA 1NYLA 1B7GO 1ZD2P 3ESCA 1W96A 2FGKA 1L5YA 2ONYA 3IA7A 4JI8B 4FP9A 1JQEA 4AJHA 1QHXA 1FU7A 4Z53A 2OD7A 4MUFA 4C03A 3NU1A 1LLQA 1WDWB 2PGLA 4ZCTA 4DB4A 1NLYA 3FTFA 4L78A 3P0EA 1E1YA 1WZ2A 1RAGA 3WL5A 2ZUEA 5KQLA 1F38A 1ZNYA 2ZSDA 4EVSA 3FGZA 1SBIA 2ZUWA 4I36A 4ZA2A 4XRGA 5EE9A 3TLAA 3G5AA 4LSMA 2Z9CA 3NFYA 5ESXA 4FHDA 3NDJA 4X45A 2ZANA 1SC6A 5I7RA 2OB2A 1C7EA 3BWYA 1GR1A 1RYZA 3U7FB 1DBSA 2ET6A 4QAQA 3O2NA 2QN1A 3NM5A 3QVSA 2I66A 1UT5A 3USES 1RZUA 2FFJA 4TQ9A 4H7KA 4URWR 3HM9A 4N6GA 2J48A 3LPAA 3QX7A 4LRWA 3OCZA 1Q92A 1C5KA 1D1TA 2OM6A 3C24A 1W0JA 4GI3A 1JHYA 5CR9A 5HJ2A 1KTIA 1FRVA 3IIJA 4MR8A 3QHQA 5HE9A 1TU4A 3OCWA 1IOWA 2B4AA 1ZW1A 3M1AA 4GXQA 4EWLA 4YJGA 4DM7A 1KTVA 4FR2A 2G06A 4NBNA 4EP1A <