1UK6A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with propionate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 105
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk6A00
2RGUA 4C88A 1EB8A 2JGJA 1UK7A 3HC7A 1UXOA 2H7XA 1WHTA 2UZ0A 4XVCA 2XMGA 3K2IA 3B3QA 1J2EA 1PJAA 1TKRA 2ONCA 5CT9A 1UOOA 4F0JA 2WKWA 4Y7DA 4ZV9A 4G1FA 3TRDA 3ZPXA 1QTIA 4I4CA 1ZD2P 3DL7A 4LHEA 4JYMA 4OU5A 4QNNA 4ARAA 4BRSA 4MQMA 3LIIA 2R11A 1XZFA 5JAUA 1A7UA 3EQ9A 2XMCA 4G9EA 2CUTA 4X6YA 3OTQA 3NGMA 1N5MA 4BZZA 2BUBA 5DWDA 4DSAA 3CCBA 3IDAA 1MT3A 5A2GA 1TRHA 4WDQA 1VE6A 4X93A 2QUBA 1EDBA 4KAAA 2WJ4A 1UK9A 4V2IA 1T4MA 1CV2A 2QZPA 3AZPA 4GECA 3MVEA 3TEJA 2DR0A 4J0JA 3KD2A 5J3JA 3MUOA 3I2GA 4BP8A 4EHBA 2ACKA 4W1SA 3HJUA 2OGSA 4G8CA 1YR2A 1YB6A 4U2CA 2HDWA 3ILSA 4QDUA 3M81A 3V1NA 2ZSHA 4TGLA 2I3ZA 5DTIA 5AK6A 1HL7A 1MNAA 5DYYA 4PSDA 3ZLVA 5KWJA 4MJ3A 1Q83A 2W6CX 4QDZA 2VT6A 1EXWA 2XQIA 4AO8A 3VISA 4MWSA 5AM2A 1IUOA 2XQJA 4OB8A 5D3KA 2GZRA 5K3EA 2EDAA 4QZVA 3AJAA 3WKCA 3STWA 1XZAA 3I6ZA 4UHDA 4FWBA 1FFCA 2WIFA 4C01A 1QIJA 4J0HA 2PSFA 2WG0A 3G7NA 3DNMA 2Y2UA 1JKMA 5ESRA 2HA6A 4X94A 4H35A 4LXHA 2YXPX 1ACJA 4HS9A 3I28A 1Q0ZA 1WB4A 4ZV7A 3A70A 5CH3A 1LZKA 2O2GA 1LGYA 1CUGA 4UBLA 1CUSA 2XLCA 4QDTA 1ZI8A 3C5VA 2XUQA 1CVLA 4Y2UA 3HRHA 1LBTA 2BGNA 5ALRA 4UFOA 4AN1A 4QLOA 3W06A 2Z8ZA 4WJLA 1CQZA 3KXPA 1RYYA 2ZYHA 4PNZA 4NZZA 3G8YA 3Q0TA 4A5SA 2PU5A 4J7AA 5JYCA 3BJRA 3BL8A 1ODCA 1GPKA 3JYHA 4UFNA 5AKZA 1XKLA 1H22A 3DYIA 1XRMA 1Y7HA 1XROA 2GYWA 2WU3A 2WUEA 1EINA 3WWPA 3ZLUA 3STXA 3W04A 4Y2YA 2WLSA 1CRLA 1JU3A 3WKBA 3H1BA 1MAHA 4AXBA 4X90A 4KE7A 1ZJ4A 1QOZA 5AHXA 4RE6A 3ZV7A 2QS9A 1JJIA 2EDCA 1MJ5A 4IO0A 5HF6A 2WUDA 1DTEA 1WCYA 1CFJA 1KEZA 4K6GA 5DNUA 3D3NA 2QJWA 1R50A 2OCKA 4W63A 2GBCA 1VOTA 2VA9A 2O7RA 2Y2VA 1F8UA 4ITVA 2QRUA 4B0OA 1Q84A 3STTA 4CI9A 4E11A 1VJ5A 5ALXA 3DQZA 2OQIA 5LYYA 3KWJA 2OCIA 4QLAA 2WJ3A 1DWPA 1MX9A 2OG1A 3B5EA 1YA8A 1DINA 4ZI5A 1ZD3A 3AIKA 5HF5A 2R8BA 2GYVA 5HFNA 5E4YA 1XQWA 4P08A 3FAKA 4MYSA 5EHXA 4UPDA 2FX5A 3DLTA 1SCIA 1HLGA 5AKXA 3L1HA 4X97A 2XUDA 2V98A 1R88A 3FYUB 1MNQA 1A8QA 1QO7A 3PE6A 4G8BA 5JD6A 3D7RA 2ES4A 1DQZA 1WHSA 1WB6A 1CIJA 2HIHA 4L9AA 4QE3A 1F0NA 1QGED 2QVBA 3HABA 5BV7A 2QKYA 3W05A 2OGZA 3CXUA 4X3CA 1QTRA 1CUWA 1ORVA 1EVQA 2HA4A 5KREA 4J0CA 1J06A 4E15A 4HRXA 1BEZA 5LZ8A 3DKKA 1CUUA 3YASA 4OB6A 1CUEA 4UHHA 1THTA 5ISMA 4DM7A 3G9UA 5AKLA 3BIWA 5CBKA 4AO7A 3KOOA 2AJLI 4AZ3A 4C6HA 4KAFA 4H7HA 1YS2X 3IA2A 2XMQA 1CPYA 2XI4A 3GBSA 2VT7A 3QMVA 3F97A 2EEPA 3AIOA 4UBKA 1N1MA 1VXRA 2VJBA 3QYJA 2WJ6A 2ZVDA 4AO6A 2FJ0A 4Y2SA 2JEZA 3JW8A 5LZ7A 4EBBA 4HAIA 5AK4A 4C4YA 4B83A 3NWOA 1HBJA 5HKAA 3I2HA 4N8DA 3CN9A 2LIPA 3OC0A 4CCWA 5ALOA 2BJHA 3G0BA 1MU0A 3AILA 3FVRA 1W1IA 2HA3A 5ALHA 3MUNA 4UBIA 3H2KA 3F98A 4Z49A 2ROQA 5AOCA 2XMDA 2VF2A 2O7VA 4C4XA 1LLFA 2WHQA 1WB5A 1K63A 2HADA 3H2HA 4S0XA 1SCQA 2XMRA 2B61A 2DFPA 3EBLA 3FCYA 4EA6A 1Y7IA 3C5WP 1UWCA 4GW3A 1DX6A 1XRNA 4F5ZA 2RHWA 1XRPA 5HK9A 1QIHA 4YASA 5AKIA 4Q34A 2ZJ6A 4N5HX 4J0DA 4PV7A 5FUMA 1P0QA 4F60A 1A8SA 3TJMA 1QIIA 2IIVA 4GDMA 5ALZA 3HZOA 2PX6A 1R9MA 1P0IA 5KWIA 2HRRA 3V9AA 4K6HA 1XRQA 4YK7A 3WK6A 4RE5A 2H9YA 1ORWA 1QJ4A 2OXEA 5DJ5A 1X2BA 3ZWQA 2QXUA 2ZSIA 3VVMA 5HQ3B 3UMJA 2HA0A 3DDUA 4DMKA 4G4JA 4NMWA 1HPLA 5I8PA 2VQ6A 2Z3ZA 3JWEA 3OOSA 5JAOA 4WCVA 3K6KA 1D07A 1TIBA 3WWDA 2G63A 3OG9A 5AM5A 3G0IA 1LZLA 4J03A 5C8ZA 5AOBA 4BE4A 1N5RA 4AMYA 4CIBA 5JANA 1AMNA 4JH0A 1G4HA 5DYWA 3EQ7A 3I1IA 5FKJA 4ZXFA 4O08A 5LZ4A 2OLEA 5T4EA 2CBGA 1JT2A 4D9JA 4M0FA 3HEAA 1ZGBA 3VVLA 4LYDA 1CLEA 2WU4A 1BRTA 1E66A 1L7AA 1C4XA 1EVEA 3IUMA 4WY5A 4WFKA 1DWQA 3G0DA 2RONA 1LPSA 3R3UA 4BRZA 5LZ9A 2WIGA 4KACA 1GGVA 1CEXA 1WPXA 1XZCA 1BU8A 2YH2A 5E4JA 2XB6A 3OM8A 3UUEA 3S8YA 1LBSA 5CXXA 4WFIA 2PVSA 5LP1A 1CQWA 5F4ZA 5A6VA 5ALUA 1WPRA 1LNSA 5CURA 5IVDA 4IH1A 2ORYA 5AP9A 5JZ9A 1NU8A 4BDTA 1H2YA 5ALLA 1XZKA 2XMSA 2H7CA 1QFMA 3WWEA 5EHNA 3M3DA 2WHPA 1UOPA 3QH4A 1EA5A 1OXMA 3I2JA 1CUZA 4Q1VA 4DNPA 1GKLA 3GELA 3KSRA 4GWLA 4H18A 2DSNA 1XLVA 1J1IA 1E8NA 1SCKA 1IZ8A 2D0DA 3ANSA 2VAVA 2PU7A 3QM1A 4AQDA 4BP9A 3I2KA 3BDIA 4UHBA 1QLWA 4YPVA 3ICVA 2QJRA 3HLKA 5K3FB 3H2JA 4CG2A 4BTLA 3G0GA 5JAHA 5LZ2A 4K6KA 3WK4A 5AJHA 1TQHA 5K3BA 4C89A 1ZI9A 2CZQA 2BUAA 4ARBA 3WKEA 3RKSA 3S2ZA 3WK7A 4FTWA 2VEOA 3O4GA 1CUFA 2OGTA 3FYTA 1FSSA 1ETHA 1C7IA 2B4KA 4INZA 3GUUA 4IHAA 1CUYA 4LXIA 4LXGA 4BCCA 3X3HA 1MX5A 3IB3A 1ZICA 4UHEA 3H1AA 4KR0A 1ISPA 4FLEA 1XLUA 2RIPA 3AFIA 5LLSA 1G66A 3O4IA 1ODSA 4TPKA 2V9ZA 3H2IA 1ZD4A 2XUFA 3R40A 4WY8A 4P9NA 2I3DA 2PSJA 3DL4A 4A23A 2PPLA 2NW6A 4PW0A 4QDXA 1SOMA 1TCAA 4Q3OA 4UHCA 5ALTA 1IUNA 4NVRA 3L1JA 4N5IX 2VTVA 3WJ1A 5ALDA 5ALMA 5CW2A 4J0IA 5D6OA 1BEEA 1LPMA 3WI7A 2B20A 3DEAA 4E14A 4IQ4A 1JFRA 1DU4A 3R3ZA 2J3DA 1B41A 2O2IA 3QVMA 1EDEA 4OU4A 4L3WA 2PUHA 4Q3LA 1CR6A 3OPMA 2XMBA 2C5FA 3IUQA 2XLBA 1BS9A 2ECFA 3ANTA 4K2AA 3Q8WA 3V1KA 3PF8A 1WOMA 5FLKA 2HL6A 4Q82A 1UK8A 3VJMA 4DMCA 3I2IA 3PDCA 1RWQA 4AZ0A 1VLQA 3V1MA 3D2AA 4AX4A 1MO2A 1R4ZA 3SC2A 2WSLA 2CB9A 2XQKA 2V96A 4LYEA 3ESAA 5SYNA 2AJDA 4XX1A 3BJMA 2XUAA 3FOBA 2IX9A 3D0KA 3RM3A 5AKEA 3EIOA 1T2NA 1EK2A 4L0CA 1CUBA 2HFKA 2IITA 4HVTA 3E1GA 1ZI6A 5AM4A 3E3AA 4J0KA 2V97A 2Z8XA 2HA5A 1EHYA 2WM2A 3DYVA 5ALNA 5CMLA 5JASA 3GZJA 2WTMA 3H2GA 3O9VA 3FYUC 5HF8A 1IZ7A 1CUHA 1S8OA 2VATA 3H18A 3WIOA 3FVTA 1DT5A 3C6XA 3W9BA 3O9MA 5C81A 3FCXA 5EHZA 1EX9A 4ZREA 1F0PA 1FFDA 5JZSA 4GEGA 2Y1KA 4B9EA 2XUIA 3DOIA 5H3HA 2WFLA 2WIDA 4KE8A 4B85A 3R3YA 1YB7A 3FSGD 1W75A 3A2LA 1GKKA 3R3XA 1A8UA 1R9NA 2BKLA 4P92A 5AIBA 3QPAA 2XUHA 1E3QA 3I6MA 3SX4A 5CRIA 2WIJA 1W52X 4UBOA 4KEAA 4BYMA 1GQRA 4Y9SA 3AZQA 3WKAA 4HXGA 1JJBA 2X8BA 5HK8A 2JGIA 3C70A 4H0CA 2QT9A 5C7YA 4EY5A 4BVJA 1ODTC 1AGYA 4AN0A 4U2BA 5E4TA 3AIMA 4XJVA 2QOEA 5AKKA 5ALIA 1IVYA 2BAGA 3D59A 1MPXA 2VJDA 1JI3A 4FLMA 4EY8A 4JNCA 1WM1A 2C4HA 4UBMA 2ZJ7A 3KDAA 2OPHA 4LIPD 5E2IA 2B9VA 1XKTA 3WZMA 1QONA 2HHAA 3I2FA 4KRXA 4XWGA 5CXUA 1QIDA 2HA2A 3PF9A 4GBGA 2ZYIA 3GROA 5DYTA 5A7GA 1ZIXA 1AC5A 5AI5A 1JJFA 2DHDA 2AJCA 4CCYA 1VZ3A 4NS4A 4Y2JA 1XZLA 3BF7A 3F96A 1R3DA 1YSCA 3A6ZA 3IUJA 4YX9A 5T4FA 1LPAB 4BE9A 4JEIA 1FFBA 3E0XA 3EQ8A 4G4GA 3WLAA 4BZWA 1YA4A 3N0TA 3W9UA 2CKMA 5T4HA 1AURA 1AUOA 4WFJA 1BCRA 2WUGA 4ZWNA 3FLBA 5IH7A 3VJKA 3ZLTA 3ESCA 4WDRA 4BC0A 4EZIA 1YASA 1K6EA 4H7IA 5JIBA 1TK3A 3A2MA 1DT3A 2HRQA 2AXEA 4OUKX 1ZOIA 3ED1A 1O6FA 2BCEA 1UT6A 5AKHA 2QM0A 4MQLA 5ALGA 1UKAA 5AO9A 1P0PA 3FLAA 1B6GA 5IVKA 4MWTA 4CG3A 1UKCA 5LKAA 1HDEA 1XZIA 3DS8A 2GZSA 3C6BA 4BCDA 1E8MA 2WHRA 2JBWA 1W76A 2DHCA 2OQVA 2WIKA 4A16A 1UZAA 1EI9A 2GYUA 5AKGA 4BAGA 3WA7A 3O0DA 3U0VA 1DQYA 2K2QB 1QZ3A 5IKXA 1X2EA 4QWWA 2YYSA 1SFRA 5FPQA 4BAUA 1QIFA 3G9TA 4H7DA 4JUIA 5ALYA 4FHZA 1LPOA 4GI1A 4P93A 4U2GA 4BBZA 2RHTA 1XQXA 3G0CA 4L72A 5HCUA 3QITA 4HXEB 3WIBA 1RP1A 3G02A 4QA9A 4EY4A 3ICWA 3HACA 3IUNA 2D5LA 1QIKA 2WFLB 3C8HA 1FJ2A 1XZMA 4KAJA 5I9IA 5JARA 3NUZA 5JATA 3IURA 4K5QA 4G4IA 5ALVA 2G5TA 3ESBA 3WJ2A 1XRRA 1AKNA 1L7QA 3PFCA 4C87A 2AJBA 2HM7A 3DCNA 1K8QA 3HI4A 5EHQA 5A7HA 5A7FA 2HU8A 5ALSA 4DTCA 1YS1X 4BVLA 2G5PA 2C7BA 3VXKA 2G4LA 3ZI7A 2X5XA 2JGMA 1LPPA 4OPMA 3R3WA 5YASA 5DNWA 3FLEA 1H2XA 5BOVA 2HFJA 1W6RA 4ETWA 4X6UA 1HKHA 3U1TA 1TCBA 4QDOA 5FP0A 3BWXA 5AI8A 2XMZA 3WKDA 2GBGA 4I3FA 4OYYA 4B7ZA 3WL5A 1QE3A 4AMZA 1K5PA 2C58A 4GHWA 2PSDA 4DNFA 2XDWA 2Z3WA 3LLCA 2DQYA 1YAJA 3C87A 4EY6A 4CIAA 3P2MA 3WL6A 4OYLA 5HKBA 5JAPA 3DD5A 5AI4A 1M33A 5CT8A 2QXTA 1H2WA 4X71A 5LKRA 4CCYB 5AOAA 2XT0A 4B84A 1MX1A 2XUGA 4DNOA 5EIEA 3QBJA 3FNBA 5BWBA 4U2EA 5FV4A 3C6ZA 2QR5A 1CUAA 1CUDA 4J3JA 3NOXA 1XZJA 3M83A 5AI9A 2GBFA 5AICA 1YCDA 6YASA 4W1QA 4DYHA 4W9RA 3C8DA 3T52A 3BDVA 4UFPA 5JALA 1JMKC 3WWOA 3O4JA 5A62A 1GXSA 5FOQA 4PO3X 3WL8A 1NX9A 4B80A 3N2ZB 2CMFA 1XFDA 4MXDA 1BE0A 1USWA 2JF0A 5ALKA 1U2EA 1ZGCA 2Q0XA 3BF8A 4OB7A 3UUFA 2XUOA 1JMYA 3FYUA 5ALEA 3H17A 3G9XA 4QWMA 5ALFA 3FBWA 4Q3KA 2JGKA 3I6YA 3ESDA 4X91A 4BC1A 5DLPA 3DOHA 5JZBA 4OD0A 2YASA 1U8EA 2OCLA 3QZUA 4HRYA 4G5XA 1EH5A 2BFNA 4FFWA 4BTVA 4KJXA 4FOLA 3H0CA 3G9ZA 1Z68A 1AZWA 3RK4A 4H7EA 4HTAA 3WQHA 2VSQA 1X70A 4BB0A 1QIEA 1XZGA 4ZRDA 3BIXA 1DX4A 4B6GA 4Y2RA 3PUIA 2PBLA 4X95A 4AB1A 4KRYA 3C6YA 4UBNA 3STVA 4X92A 2J4CA 2PL5A 2WUFA 4GLBA 1VXOA 1E5TA 4OSEA 2RAUA 5CH8A 3CN7A 3H19A 3QMWA 1XLWA 1THGA 2CJPA 5IVIA 4BATA 4CG1A 4G8DA 4FBLA 1ZIYA 4X85A 4B82A 4LKOA 5FRDA 1L7RA 4FFVA 1VKHA 4FNGA 4DMHA 1CUJA 3FSGA 5LZ5A 4N8EA 3W2TA 1J07A 2I78A 2DCMA 3LP5A 1R1DA 1U65A 4M0EA 4Q05A 5AKJA 2OAEA 4ROTA 5AI0A 2XQFA 3SWWA 3R41A 1GZ7A 1XZEA 4PSCA 1MAAA 3H04A 3HYSA 2XUKA 5A71A 3IVMA 1CUVA 4X6XA 4BAZA 2H7YA 4PF1A 3PUHA 1BN6A 1YAHA 1VA5A 1GPNA 2XQGA 5AK5A 4W1RA 4TVKA 4Y2VA 4Y2PA 3RLIA 2FUKA 1G42A 1NU6A 5AM1A 1N8SA 5EI5A 4ZGBA 5HFAA 5T4BA 3FWHA 4PQEA 1EB9A 2W22A 2VJAA 3R0VA 4BVKA 3DJYA 2E3JA 1W4LA 5IVHA 4C4ZA 2WHPB 5FDFA 5FXMA 3F8SA 4JYPA 2CEKA 4KYVA 1KU6A 1ACLA 1BCSA 5AI6A 1MTZA 3WYNA 2I03A 3HXKA 3CCCA 3O95A 4IH9A 4Y2QA 4RGYA 5CH5A 5ALQA 3A2NA 3OURA 1BN7A 1VA4A 1O6GA 4X7BA 3WL7A 5HQ3A 1U4NA 2ZYSA 1LPBB 3WZLA 2FJPA 4DIUA 2X76A 1IUPA 1KU0A 4RPCA 3L1IA 4W1PA 1XQYA 4H7JA 1XQVA 4FLFA 2HU5A 1IMJA 4MYDA 3D2BA 5I7UA 2JGFA 5ALJA 3D4LA 2VAXA 7YASA 5KBYA 2OCGA 4EY7A 3T4UA 2RI6A 3BXPA 3SK0A 5CT6A 4DGQA 1GT6A 4IH4A 5D3ZA 3STYA 3KWFA 5CTAA 1FFEA 5HF9A 2PSEA 3IIIA 3GFFA 2AJ8A 4H7FA 1G5FA 4G9GA 1F6WA 2C5GA 1UOQA 5LIPA 3WK8A 2WILA 1XZDA 3F9CA 4H77A 3WMRA 4EUSA 2WG1A 4FKBA 1MN6A 2C0QA 4DNQA 4E46A 2Y6UA 2QTBA 4U2DA 1XZBA 4FBMA 1QO9A 3C43A 4H7KA 1GQSA 1TAHA 1CUCA 4N8SA 3D5EA 1HQDA 1AQLA 2XE4A 1EK1A 3PFBA 1UFOA 1OILA 3MGAA 4Y2XA 4UBJA 1I6WA 1VE7A 4KE6A 2HU7A 2VJCA 4CFSA 4KE9A 5C8XA 4RNCA 2ACEA 2ZJFA 2GBIA 2HA7A 2O2HA 3EF3A 1A88A 2ZYRA 3DKRA 1C7JA 4F21A 2QUAA 1SC9A 1CUIA 5K5EA 3WYDA 3K9BA 2BUCA 5ALPA 5EIAA 1CUXA 5JD5A 5JADA 3LCRA 3GA7A 5K3CA 5AK3A 2PM8A 1QFSA 1FFAA 5C8VA 3RARA 3WK5A 1Y37A 4DSZA 5AIAA 3O4HA 1JU4A 4BDSA 3WWCA 3AZOA 2JIDA 5CT4A 4DMFA 1BROA 1OCEA 4XIIA 5K3FA 2PSHA 3B12A 3R3VA 3F67A 1ZD5A 1ZJ5A 4OCZA 5AM3A 3E4DA 4U2FA 2WFZA 2P8SA 4FMPA 4FNMA 5FPPA 3QMMA 3VKFA 3VDXA 2J4FA 1QIGA 4HXFB 4J0GA 3V48A 3VJLA 1PV1A 2WQZA 2WFMA 4M0MA 1E8DA 5AH0A 3PICA 2C0PA 4FDMA 4B0PA 3V1LA 5D7BA 3IBTA 1H2ZA 2WTNA 3HSSA 4HZGA 3AINA 2DHEA 2J3QA 5AKYA 1K4YA 4B81A 3BE8A 2JEYA 4B9AA 3STUA 3LIPA 4EB0A 2XUJA 2BGRA 1GPLA 3D2CA 4QEKA 1XRLA 5SYMA 4MEAA 3M82A 5EIHA 3C45A 1UKBA 2PUJA 2JGEA 1PFQA 3TGLA 1TCCA 4I19A 2WG2A 3IULA 1XZHA 4PSUA 4BCBA 1VZ2A 4UHFA 1QIMA 5AM0A 4MEBA 1EDDA 1LPNA 2PKYX 5EFZA 4DLNA 4Y2TA 4UUQA 1DWOA 5DTJA 2XUPA 3PI6A 5K3DA 1Q0RA 5DNVA 3QPCA 5EGNA 1E89A 2QMQA 3AUKA 5ALWA 1AX9A 2H1IA 1H23A 5K3AA 5HZGA 3WK9A 1P0MA 2Y6VA 5BWCA 4GXNA 3LS2A 5CT5A 5JD4A 2DQZA 4X00A 2OAGA 2JGLA 3WA6A 3QPDA 2Z5GA 1UK6A 3I1YA
chains in the Genus database with same CATH superfamily
2HJ9A 4I4TA 4ODIA 4C88A 3EA5A 1EB8A 5KYUA 5AVUA 3RIYA 2R1TB 1IN4A 1J8MF 3H4VA 3ZTTA 3W5JA 1OWLA 3L18A 3QKTA 5EMHA 1GU0A 2F64A 1EFVB 3N70A 4H6WA 4RTRA 1EK0A 3HC7A 4TUYF 4JDPA 5B3LA 1PJLA 5CK5A 4BY9E 2HPHA 3GRPA 2AN5A 1W29A 1CZLA 4MJ7A 1R0KA 2VZ0A 1WZUA 3TXYA 4XVCA 2VDJA 3HYRA 3UHAA 1XWWA 2Q28A 1P8JA 1U8TA 3T3PB 1SVOA 2B37A 1OZHA 4D4GA 4P7FA 4AY6A 2J32A 1J2EA 1M2KA 4DANA 1IBLB 2YINC 4QYWA 1ZK1A 5FAKA 2O8FA 4IZ6A 1TM1E 3PXGA 2WJWA 4RY2A 4Q1AA 1TKRA 2C00A 2X9QA 2XB2A 1UOOA 4GGOA 4M0DA 3GJRA 2VHJA 4F0JA 4G5SA 4FFBB 4ZV9A 3HJTA 1TJPB 1NBEA 1B2LA 3GDGA 4R0VA 4RQTA 1QC5A 2YWBA 1JGTA 3RQSA 2CMGA 4M83A 2J8ZA 1RZRD 2A9FA 4YS6A 5EPUA 3UJ6A 3LFHA 2QY9A 1O6ZA 1XVUA 4IKEA 4BQSA 1ZD2P 3DCYA 3PNPA 4F93B 3H6GA 2UV8A 4DS3A 5DRTA 4HMQA 4ARAA 2HLDA 1TT5A 4NV0A 2ZUEA 3SYRA 2FWAA 1JHOA 4MQEB 3HXQA 4IEFB 3G88A 4NWIA 4NEHB 2PBZA 4TQAA 2GN2A 3ZJVA 3NXKA 4ZYUA 3U4QA 4LKRA 4TQGA 1U7HA 4UQPA 4XIGS 1DBVO 3I58A 2ZJ0A 5LOVB 3MRVA 1QQAA 1MOPA 1CZNA 2W2VA 1NJFA 4IWYA 1V11A 4YP0A 1PWZA 3QEKA 1BCRB 2DETA 3JVDA 3OO0A 2JAUA 3NGMA 1RIIA 3FDZA 3JALB 1PZGA 3QWBA 3FJYA 1XTSA 1WQ3A 2BUBA 2YOFA 1U2ZA 3NTOA 1NQOA 1C0PA 2JA2A 4OOFA 4WXRA 3ZIDA 2ZUFA 5IEJA 1AQIA 2B2XA 4BNIA 2X19A 2YJ6A 3IDAA 1ISIA 1KQPA 1EDZA 1GRNA 2HMWA 3OI7A 5ESDA 5JSFA 3NVDA 3ZKAA 1S2LA 2WKRA 1WKBA 1E2DA 3AI2A 3NT2A 4G8JA 4WDQA 2J9FB 5AR1A 4FOSA 1VE6A 1SKAA 4KRGA 4L8GA 5H3CA 1XMXA 4G5RA 4PSVA 4I9NA 5HDBB 4PGGA 5H82A 2JLAA 1ZLYA 2NGRA 3JD3A 4G23A 1VIAA 4HF7A 3GVHA 1E6EA 2XHEA 3HB0A 3A1SA 5C32A 5CNIA 5I8ZA 5KHOC 1T4MA 4NBTA 4OFBA 4BPBA 2JJMA 2PGAA 2NTEA 2HGZA 1DXQA 1ZRHA 2IPXA 2LDBA 4CN9A 3KHUA 1E92A 4R0MA 1XCOA 1ZIDA 4EBFA 5JQWA 3E82A 1XWFA 1U6IA 5BN5B 2ECKA 1ZX1A 4REOA 3KWLA 5J3JA 5FI5A 4QOHA 4HUTA 3W79A 1JEAA 4G0XA 3I1FA 4PTYA 1NNEA 1J56A 4RETA 1CJTC 1YFZA 3HJUA 1L5NA 4DV4B 3LDAA 1YR2A 4CVNA 1KJ8A 1DQSA 3M3HA 3K9WA 4F6RB 1JB1A 3AL3A 4Y18A 1PF7E 3FCAA 2C42A 4CMBA 3REGA 1G64A 4QDUA 2XNJA 4EI7A 2INGX 4E5NA 4FHDA 3E9QA 1P3Y1 4ER6A 4TGLA 1GWNA 2ERXA 3LQFA 1QCDA 2FPMA 4NICA 4FZ3A 1GTL1 4URHA 3UFXA 4GU5A 4KLZA 3LT0A 4BLUA 3UTCA 4A6XA 2I0FA 4BZQA 3GL9A 3B9PA 3RUIA 1G6KA 3WB0A 3J81A 3ZLVA 4Z7QB 3ERCA 5KWJA 1UM9A 4LYYA 4MJ3A 4ZARA 5IP5A 2BMFA 3CUTA 4IUCS 1L5KA 1N4DA 4QDZA 4RD6A 5DDIP 4ROSA 1EXWA 3V9PA 4GPZA 5DHRA 1BWRA 4UTZA 4HD8A 4GPBA 3TZBA 5BORA 4FCVA 5AW8A 2OBYA 3V1UA 5A1JA 3RAEC 3KR9A 3AJ8A 3RQIA 4MWSA 3VISA 5I4KA 5CB4B 4UM8B 4GH5A 4BKPA 5GZ6A 4PG5A 1OI4A 3V5NA 2CE7A 2X8WA 3LM8A 4DUGA 4PGAA 4DDWA 2PEYA 3ZKWA 5K8JB 3C85A 3DFKA 1K6XA 1FFCA 3UAWA 4AMBA 1N0IA 1UJBA 3BCRA 1E20A 2CLFB 4J0HA 4M3NA 3QSYA 4CBVA 3AB7A 4BLWA 1D4ZA 1I4DD 2G9RA 1E3WB 1Y3CE 1DDOA 4MI1A 1IZYA 4Q4HA 2Q9AA 4S1PA 3ROXA 4C9BA 2BLLA 3PLRA 3ZJ4A 3GIWA 5J4KA 4F1KA 2QRJA 2IU3A 2J9RA 2EX0A 1YOVA 3V7FA 1JKMA 4RHFA 1I6MA 3WLKX 3O2QB 1MUUA 1QGAA 4IV0A 4DQXA 2AZDA 1LNQA 2AR7A 3B1XA 4MRMA 1ZEJA 4WAUA 4X8OA 4KZPA 1V4BA 3K1ZA 3WFZA 4D99A 3VKHA 5KYGA 5KAPA 2YXPX 3AMVA 4K40A 4QHSA 4GMFA 3ZIUA 4R1SA 1ACJA 2WD9A 5COQA 1CB0A 1K68A 3TBFA 1YHNA 2JIOA 3A58B 2CXRA 1QOQB 3A70A 1XRSB 1IJBA 4YP6A 2ZJ3A 2GZAA 1RKBA 4L4ZA 4BKUA 3TSWA 4MKFA 4PYIA 4E1AA 1RWKA 4M0UA 2I1LA 1QBGA 3K6SA 4G1BA 1LGYA 3KTFA 4URZR 2HBRA 1LUAA 4E4YA 1Y3IA 1E2HA 2ZIFA 1X77A 2WB4A 3MJVA 1PG2A 4QDTA 4R7TA 2ICAA 2Q1TA 3EIUA 3GFVA 3UH0A 1DC3A 4HNSA 2H4YA 2OMEA 1XEXB 4Y2UA 3L7CA 1LBTA 2FPKA 1U2QA 1AKUA 1U7ZA 1LH0A 3MWYW 4HWGA 5ALRA 5C8YA 1QF9A 2QUJA 4GEKA 3I0ZA 3MHPA 1NWCA 1Y5MA 4OXXA 3M5WA 2PKRA 2QPOA 1M6VA 1PGNA 2HD4A 1EBBA 1CY2A 6REQB 2HXYA 4WJLA 1CQZA 1QG0A 1GV1A 2PX0A 2J48A 2NVBA 2W2NA 3JRWA 3KZXA 4OHUA 3RC7A 1IXRC 4ZEMA 4MGEA 4F3CA 3DSRA 3P71T 2WC1A 4PSKA 2ZYHA 3LVFO 2FSIA 5B53A 1K3UB 4G63A 4OKIA 4NZZA 1RD4A 2ORVA 4LZPA 2AS0A 4AXXA 2P9QA 3F8WA 4Z99A 4J7AA 1JDTA 1I10A 5JT1A 4IO1A 4W99A 5BW5A 1L3BA 4R1PA 1JSXA 4MWZA 4H4CA 4CEJB 2QN2A 3GEIA 3BL8A 5SY9A 4HVCA 4OHZA 5ENDA 5LL6P 4F2DA 4MWDA 5DK6A 1GPKA 2B2CA 3O1IC 3JYHA 3OE7A 3QWAA 4OAQA 4WGFA 1GAQA 2I5PO 4EA8A 4AUMA 1KVUA 3AH8A 1L9XA 3DYIA 2DHQA 2VK8A 2WTEA 3SC4A 5JNLA 4J1QA 3A1FA 1BMFD 3C41J 3P0IA 1P5JA 1PAUA 3JWJA 3A7EA 3RHTA 5TQ2B 1RPAA 1BEUB 3T5PA 4LE0A 3GLFA 4E09A 1IQPA 2J3JA 1KORA 2P9YA 3GLUA 1KQFA 1VE1A 4QQ8A 1Z37A 1GUAA 5E8RA 4CM7A 3G23A 5KZMB 2I76A 1RLJA 4YRJA 3WWPA 1EE9A 1PGPA 4Q5IA 3K32A 1ISGA 1KY4A 3STXA 3TRIA 1XVVA 3U3DA 4RUKA 1L0BA 3ZGOA 2GXUA 4B6OA 5E1DA 2AFRA 2O20A 2Q3EA 3OD1A 2OHHA 3H1BA 3KS9A 2DUWA 4REMA 3AEQB 1R0ZA 5FTKA 1QOZA 1LLCA 1OHHA 1T15A 3NKFA 1ZM9A 2ZAIA 4UZSA 2AW3A 4JSRA 5FWYA 1U3FA 4DPKA 1UAGA 4WESA 4I55B 3CF6R 1PT5A 5E1OA 2CUKA 3ITNA 3VZQA 2CW5A 2QS9A 2D0PB 3OUZA 2HR1A 4CU5A 3BICA 2EDCA 4NBKA 3HDGA 3OEHD 3QJGA 4KQKA 4IO0A 1YTLA 3CZ5A 2WUDA 3DFFA 1WULS 2WZQA 1DTEA 1KI9A 4O2AF 1CFJA 1O2DA 2A0WA 5EJFA 3EZLA 1G2QA 1UJ5A 4BRWA 4FOPA 1JAYA 1GM5A 3NYWA 4H27A 3EIQA 4LYJA 2QJWA 4FN4A 4AM8A 3TEFA 3A25A 4NATA 1SJ9A 2GBCA 1DEOA 1VOTA 3C8ZA 1MGPA 2GBLC 2MYUA 3EOAI 3R24A 1E3EA 4QRDA 2VA9A 4LMAA 5A9TA 4DWVA 4LF6B 4LE1A 1QVAA 1YONA 2WEKA 2YVUA 4JP3A 2QLTA 4C3ZA 1R9JA 4OXIA 4B3GA 3RAJA 1N2CE 3Q7TA 1SOWA 1CJVC 1RI4A 1EFUA 3PQ2A 4TKUA 5EMJA 4PC1A 2QRMA 4BGIA 1HE3A 1BXGA 1G9XA 4FONA 1NG1A 3D0QA 3KU4A 5E6RA 2HU2A 3DGEC 1A95A 3SIWA 3KYCB 5TMDA 1WSBA 3A04A 5SY6A 3I9V6 3F2VA 5DT2A 2CE2X 1GCOA 1RLIA 3QFHA 4G36A 1ZGZA 1WD7A 1I4OA 2AKAB 3CJQA 5BT8A 3N8NA 3A4VA 2QQ0A 4ZI5A 3D6UA 4Z5XA 1TMYA 2NU9A 1COWA 1ZD3A 2CJFA 2RBGA 4O2BF 4QAJA 5HF5A 3OOJA 1VL5A 3ZNOA 1YMUA 3L79A 4OGWA 5EZ6B 3THYA 1L9KA 4E51A 5I8WA 5DSZA 3Q2IA 5LLTA 3LZDA 3QUAA 1DOAA 2B35A 1DO8A 2PV7A 2ZWPA 3DLTA 5BWLA 3HKEB 4KXXA 2ZDQA 4G3XA 1JQBA 1N1DA 3D4BA 4NX2A 3H3XA 2RGEA 4JLJA 1RDFA 2ECOA 2I3AA 3ET5A 3LPDA 3ABQB 4FFRA 4XKJA 4YV0A 4NZ9A 2A7QA 2QTTA 3CZPA 2H51A 1QG4A 3IUYA 2CLEB 4F92B 1UBEA 4F4DA 3JATA 2JFPA 4B34A 4XGIA 2Z5VA 1LF5A 3TQQA 3WQRA 1MNQA 1A4RA 1CHNA 3HCCA 4WNAB 2AMJA 3KTAB 4JL6A 2ZCUA 1N7JA 4RHTA 1AKWA 2RHLA 2ZWVA 3ENQA 2QX6A 5D3QA 2NO9A 1P81A 2D00A 4DR6B 2N75A 3MNFA 1FNNA 1CIJA 3J7TA 4F84A 1JR3D 2HIHA 2PUCA 2A86A 2P6NA 5JCJA 1UOEA 3ZWOA 5CCXA 4TV9F 2AV6A 4BXOB 3DGFC 1YZNA 2FRDA 2FTKE 3FMFA 4KLRA 3FFAA 1F0NA 1Y6RA 3NNDA 3BGSA 2EHDA 2BGLA 2POQX 2I6QA 2QX8A 4BOYA 4QLBA 2NQ2C 4B3FX 1JLKA 1QOPB 1J49A 3A4YA 3JYOA 4HHEA 1H2AS 3G6WA 3SHOA 4BNFA 1S0UA 4IQ0A 5AW6A 1MB0A 1VG1A 3FTQA 3SJAA 1P1IA 1B73A 4Q7MB 3W05A 2VHVA 2YNMC 5BVHB 1XTQA 4UUMA 2AFHE 5G1NA 3OCCA 4QO7A 3C98A 5ER6A 2RB4A 2RGAA 2H0RA 2ZB2A 3GRZA 4PINA 1GG2A 4D97A 3KPJA 1YZTA 2XTJA 3DMYA 3TI7A 1ONPA 4NDZA 1VE3A 4YC7A 1DKQA 2Q9BA 3AFOA 4ZCIA 3LBAA 4DR4B 5HWSA 1J06A 2PUVA 4ZCRA 4CW7A 2H2WA 3C6KA 1HFJA 3QPBA 1S2NA 4IDEA 2Q8PA 4EPRA 1EVYA 1VSVA 2EFHB 2HLHA 1Q20A 1XTUA 2H07A 2PRYA 3L0YA 2X77A 3A6JA 1K3TA 3GJTA 1I2MA 3B85A 2PR2A 4L57A 2F9FA 1NT4A 4I6GA 4URVR 1VL1A 4Z3OA 5CBKA 1OV4A 3L4BC 4CKZA 2OCAA 2BDEA 4OHOA 4MVJF 2JDID 2VKQA 5J58A 1PE0A 5CCBA 1YNOA 2GAFA 2B6HA 3ESZA 4LTDA 1Z4NA 1EUCB 1K6JA 4XVQA 1N8NA 5ITVA 5IS2A 5B2ZA 2AKEA 2VSFA 4H7HA 1KDTA 2OY0A 1YS2X 3HPRA 2BGUA 2JJ2D 3CEPB 3KL2A 5HE8A 3EK2A 1XELA 1VCNA 1DFIA 3ABOB 3MINA 1J22A 2VT7A 3OQHA 3ONNA 4TKZA 4BASA 1PJ8A 2IXAA 4H1UA 3F97A 2XRZA 2AQ8A 1P62B 2D3WA 4BO0A 3OO1A 1N1MA 1VXRA 2VJBA 3ILHA 4WZAE 2FUG1 3BWVA 3U4AA 1V16A 3QYJA 4TLAA 3N2KB 5GPBA 3VPDA 2P27A 2IK8A 4CLXA 4L74A 2PA0A 1L4KA 2JASA 5BSKA 4R9UC 1LTKA 4MKHA 4XYGA 5K4GA 2WJPA 2CUZA 3D4PA 4HAIA 5CXSA 1KAGA 4CLDA 3GBPA 2APJA 4UNSA 4C43A 4JBLA 1SA0A 4C4YA 1O7JA 3LOPA 2C9BA 5DB4A 4PRLA 3T3EA 3V8MA 3GY0A 4MHOA 1HBJA 4EB3A 5C52B 1EQ2A 4TKMA 5JCZA 5HKAA 2P2DA 2GPJA 4TUYB 5E0OA 2V3CC 1X80A 4L02A 3OA2A 5C34B 1VJCA 2WF6A 3GP5A 3FBGA 4E7OA 1D09A 3PRJA 5HCIA 2QD1A 3BCSA 4HDSB 3SBXA 3KKEA 1D2NA 1OX6A 2I7TA 4ND7A 4CCWA 2BJHA 1KYVA 4RJ2A 4DJFC 5SZHB 3PR3A 1P2VA 2AFIA 4V1CA 3SXUA 4EPTA 4MWCA 4C0HA 1UBLS 2GH1A 2RCYA 1E7RA 3D9QX 4M9UA 3TLMA 4CCSA 1YVUA 2D8MA 1PDWA 3G5LA 3I39X 4MV6A 4UCWA 5EUBA 1GRRA 1CDOA 2WYHA 3AT1A 3DG9A 1I7LA 1IRIA 1XPUA 4AG6A 3H2KA 1KO5A 3LBYA 3L7JA 2QE7D 5DFAA 5E3JA 4AT1A 1KERA 1FX0B 3KLMX 3M8KA 4NABA 3N3BC 4YRDA 1BS1A 4YJ2A 2VF2A 2O7VA 5IBPA 3MMXA 1RBYA 2WHQA 1WB5A 2PLNA 1PZHA 2QHXA 4GZ3A 4KTVE 4N7MA 5G41A 4PHFA 6GPBA 1JH9A 4TT8A 4S0XA 3Q3HA 1SCQA 2BISA 3HNRA 4HSGA 1GPBA 2XMRA 4GLFA 1NVAA 3ETJA 4J1TA 2DFPA 3LX6A 3R9IA 3QEAZ 2JIQA 4EA6A 4M98A 4NS1A 1Y7IA 4DT1B 4EHJA 1NNSA 3BAFA 4URXR 1JAIA 1I9GA 4GW3A 3UPDA 4B3CA 3DLAA 3UGTA 3AM1A 2QN9A 1JW9B 1AQ6A 2WABA 2IEZA 4YMWA 5L3SB 3LCVB 5HK9A 1PW7A 3L7OA 1AO0A 4QUBA 1QIHA 2IH5A 5EA2A 1XXLA 1PUJA 3NI2A 1OI2A 3TTUA 1EJ0A 4Q34A 2QN6A 4RYLA 3R0QA 4N5HX 3P0EA 4HUQB 4K6FA 2P79A 4PV7A 2FSVC 5H4GA 5H80A 1BQ3A 2YC4C 2XXJA 3GJYA 4BBAA 3ZHUA 3SF8A 3LP6A 2OWDA 2EAUA 2WNSA 3QFCA 4YNBA 5LN1A 4UU8A 5ALZA 1RHRA 2OCBA 3FTNA 3RDPA 4BYGA 3HZOA 2A94A 4FVTA 2D5AA 1NQWA 3P96A 4P7BA 4ARVA 1QV6A 3JWPA 1BCSB 4XUGB 4ZRNA 4ZZ0A 1RZRA 2YWRA 3A9CA 2JKYA 2ZJ8A 1OGYA 2QDKA 1SIBE 4PYOA 1QYIA 2W6ID 4LY9A 1Z45A 4U7GA 4K6HA 3SJBA 5BSMA 3GNLA 2E4UA 2Y4OA 3G5MA 4MV4A 1FXWF 2R66A 1H3NA 3C3XA 2GWHA 1HKUA 2FMFA 3CW9A 5ECGC 2Y67A 3C8MA 4RE5A 2CT8A 2I80A 4XEUA 5T8KC 3OCXA 3NDPA 3AF4A 2GGSA 1DCMA 3V2GA 4DIMA 3R44A 1OXKB 1PZNA 4MMZB 3F3YA 1OUMA 3OCUA 2AXPA 4GYJA 1N2SA 4HFNA 5C35A 1PV2A 4LYGA 4XWKA 3FTEA 1R0XA 1UEJA 3I04M 4JB2A 4TN5A 3CKKA 2J3IA 5AJUA 1I9CA 1IPFA 5TGTA 4G4JA 4NMWA 4DOMA 4ZAYA 1RJWA 4V0ME 1Z5VA 3QTBA 1Q7BA 4JBHA 1K75A 2AOXA 4B2IA 1BOFA 2OZVA 3E5MA 3RVKA 1MW8X 3CLUD 5JAOA 3DXYA 4KZKA 3GXBA 2G0NA 4DCOA 3WY9A 4BQNA 3ODPA 3VU3A 3QWHA 4QDJA 4YRQA 3SBEA 4GYYA 2XNSA 3D4OA 1MORA 2D1TA 4DHEA 2GFQA 3TZKA 2VDWA 4G84A 4RM3A 3D6JA 4GPEA 5AM5A 4D6XA 5JMWA 5GM1A 4GXQA 5LDHA 4PZDA 1IHDA 1UP4A 1WP9A 4B4OA 4BE4A 1TM5E 3MGGA 5CFNA 1M34B 2OB2A 3C3MA 1OAKA 4JZKA 3SX0A 3DEHA 5K0NA 4AMYA 5K51A 1ZJJA 3LPLA 2QDXA 5KJ1A 4EG5A 5J4YA 1QQBA 3TQRA 1Z2NX 2G7ZA 4MI6A 2JPDA 3FZNA 4JH0A 1ZVVA 3JY6A 5E4FA 2V9PA 2GXSA 2WOJA 3O74A 3TMKA 4LNUB 4C7JA 5THXA 2XIQA 1XEWX 2VO1A 4PYNA 2ZYGA 4UAUA 1KRHA 2JI6A 3DDZX 4YPFA 1KI2A 3ELYA 3TVYA 4C0BA 4IDNA 2XWQA 2Y99A 2C0CA 1XXHE 1JRLA 2F43B 4D9JA 4C4PA 4F4JA 4OHYA 3DE3X 2GARA 5JO0A 3K4QA 2Q2OA 5DK4A 4EJFA 3QEJA 3JZIA 3MJEA 4IFBA 4J16A 4JX9A 2GJ9A 3P2YA 3I9OA 121PA 1VL8A 1NBWB 1BRTA 1LWOA 3E9EA 3EZGA 3O1HB 3KUXA 5DLQC 4O4JF 3B13B 5I9TA 2QL7A 1FNDA 3U3RA 2Q5QA 1C4XA 2PBRA 3LZCA 3OY2A 1EVEA 4CLOB 2KBFA 4PAGA 4L28A 2JVJA 3I52A 4WY5A 3EH1A 5AVXA 3DTTA 1WDKA 3UT5B 4UM9D 3F1KA 2EG5A 2LW7A 4HX9A 3KVYA 4TXJA 3N3AC 1NW9B 1LPSA 2ONZA 1JA1A 4DG8A 3GLHE 4DNXA 4D0SA 1TYAE 4F45A 1MQ8B 1JPVA 1A3CA 1KS9A 1Y1QA 3G2IA 1LDNA 1KJNA 3AYXB 3P0FA 2ZDGA 4KACA 4K87A 4OVKA 1WPXA 5ICMA 1N4AA 3ZY2A 1SUDA 3PEVA 1PSZA 1Z6YA 4IDPA 4ZT5A 1XMOB 4R31A 5E4JA 2XB6A 1ULSA 2P7IA 5B7NA 5F3WB 1IULA 4UXIA 3TLCA 2D06A 2PWPA 1RMYA 1ILEA 1WEHA 2HXGA 2RK3A 3H5NA 3VC1A 4RTNA 3K35A 5CX1A 2ZB7A 3DVRX 3EN0A 1LBSA 2FWRA 3M33A 3S8MA 4BLVA 2ZIGA 4EG3A 3DMNA 5KKNB 2BE7A 1MABA 3I73A 1XEAA 5LP1A 3M7IA 4OBBA 4L08A 5KSPA 4NMHA 2ZJ2A 3RYFA 2PIDA 1BFDA 1CF9A 4ON9A 4RMJA 4O59O 5IUJC 2O8BA 1YGPA 4PN3A 1TD9A 1ZVKA 2CDBA 4HX2A 4WOCA 1JPJA 1RC0A 3GFRA 3HA5A 4K88A 1JDJA 4OL0A 4ZQGA 1H2YA 2IVFA 4KO4S 4AG3A 8OHMA 1N36B 4KN8A 2YIVX 1DBSA 4ZT3A 3CC8A 1PNOA 2HEIA 2PUEA 2A92A 3HY3A 3WLPA 3KJIA 1J0BA 3E7DA 1QH1B 1CP2A 1YDGA 4ID3A 4RJIA 4NCBA 1WMSA 1ZGAA 3CZCA 2QZ9A 4QUKA 4OLAA 2WU8A 3LSTA 1PTJA 3L6RA 3QSGA 3A27A 2QTCA 2QTVA 2IPAB 3EEYA 4TL6A 1UJMA 1NQTA 1MJGM 1Z6PA 2Q8QA 2QVZX 2H0AA 3QH4A 1EA5A 1GA1A 4IDCA 4MR9B 4S0ZA 4LGYA 2AUMA 4PIPA 2BMVA 1CUZA 2SKCA 3NBAA 3RFTA 4BEBA 3A9WA 2PRSA 1GTJ1 1PCXA 4PFKA 1EBFA 1U8FO 3ZK8A 1IVNA 5KTOA 4GWLA 1XD2A 3JQGA 1XLVA 2PGJA 4OX9B 1Z4OA 4IS2A 4X0EA 3TLZA 5C1OA 2VPIA 3VHLB 4YRZA 3VHXB 1E8NA 1BE8A 1SCKA 1X3SA 1SOUA 1Z8FA 2RGBA 3EWIA 4MVJM 4RSRA 2Q21A 4PLVA 4QHYA 1X87A 4RAQA 3EYAA 2IUUA 2FW7A 5KYWA 2PU7A 1F60A 2W2KA 3ANYB 3MXTA 3QM1A 5BW8A 8AT1A 4NBRA 3IE1A 4AQDA 2Z56A 4JWTA 3KQLA 2IEDA 3PWZA 2WFAA 3N7UA 3BDIA 5EXSA 1W49A 1XMPA 2B1IA 4UHBA 5GQSA 1W44A 4YR9A 1YR6A 3LLSA 1REQA 1KFKB 3E84A 1IC6A 3EIWA 3HLKA 3L01A 4QOJA 3N9IA 3LBNA 3V3TA 3HEBA 3HKDB 4QQRA 2XE6A 1F9EA 3KKNA 3PEUA 3A6HA 5LZ2A 3BTUA 1YI1A 1X1TA 4NL4H 3RSGA 4UTRA 2Y68A 1F8FA 5C7LO 4ESOA 2G5GX 1OFHA 1U9YA 4Z54A 4KQCA 4G25A 5D3MB 1KMQA 3OMWA 4E5PA 4EGAA 3RS2A 5JPCA 3NDRA 2CFOA 1BMFA 1Y4AE 2A58A 4MRAA 4YIKA 4YY3B 1NY5A 1F0YA 5TQVA 2F1JA 3WBFA 1W4CA 2CFTA 4BB5A 3K9LA 4O2AB 2CZQA 4NRDA 3SKXA 2MSNA 3GRYA 3WGMA 4ZJPA 3HCRA 1MDFA 3GRRA 2I2XB 1NQ5A 1XTJA 3RKSA 5L45A 1FNCA 1VJ0A 3EUWA 3F90A 4IRXA 2HNKA 1G8SA 4F8JA 5F7JA 4X8MA 1G2PA 1OD6A 1P5RA 3BK7A 5ES4B 5KCZA 3AJRA 2ZS9A 1ETHA 3FYTA 3L7YA 4X24A 4OLJA 2ATIA 3RWOA 1PNRA 1AQUA 5K4HA 2ILVA 2EOAA 2LDXA 4B71A 1ULTA 1M76A 1KSJA 1TQDA 2B4KA 2I7VA 4IDBA 1XVTA 2OFWA 3PDHA 4U8GA 5HGJA 3NDIA 1JVSA 3DH0A 3UJDA 2YXEA 2VL7A 3C1TA 1Z08A 4IHAA 1TD1A 4I36A 3AETB 1PJBA 3OEHA 4L3VA 2BFBB 1UF9A 4LXGA 4BCCA 1B6TA 1CY6A 2XT9A 4DLPA 4MQ5A 1ZICA 1VLVA 3OE4A 4KR0A 4U8HA 4F1WA 3JS5A 3MUFA 1ISPA 4JT8A 5TT1A 4FLEA 3HJCA 4QO8A 2V1XA 4I1OA 2J59A 5E6SB 1C1XB 3FFXA 2NTVA 2RIPA 3RVRA 3RRYA 4CEIA 4MWGA 4D96A 3ADKA 4RTOA 4GPTA 4F8YA 2FSHA 5DTQA 5F2EA 3G89A 1N2CB 1G5PA 1OIXA 2Y76A 1ZD4A 3H2IA 5HTKA 3RS5A 3B38A 3PPYA 4J3FA 1UBMS 1XCJA 3U13A 4P9NA 3OFJA 2YW2A 4UUPA 2ZRCA 4XPIA 4DC0A 3W5CA 4AY2A 5LCXA 3Q41A 4MVYA 1GEGA 4UUNA 2NW6A 2PG3A 4ENVA 2FPIB 3P97A 5DRYA 4QDXA 3SM3A 3B1KA 2DPHA 1GNPA 4IIVA 1TCAA 4NU6A 4Q3OA 4XVHA 1IZ0A 1IUNA 3DPSA 1T29A 3GFBA 1E6LA 4Q1DA 3EXAA 4NE2A 1P1HA 4R01A 4Q9HA 3FGZA 3RAPR 2WSBA 4EL5A 2ZIUB 4LAFA 2PMEA 3RVMA 1ZDMA 4KG7A 2RG1A 1T3TA 2HH9A 4TV9B 1FDOA 4AP9A 3LUBA 4J0IA 3P0HA 1J33A 3KQYA 1CF2O 3Q7IA 4R6WA 2IYFA 3GAMA 4IEEA 1NXQA 3DEAA 2BDTA 4G4SO 5KINB 1SXJE 2GTIA 3N28A 4KDCA 1U98A 2J3DA 3R3ZA 4M1YA 3TH5A 1HV8A 1B41A 2O2IA 4X62B 2O2JA 1N5DA 1RAEA 3EVZA 3AQIA 2ZTHA 3LW8A 2QLNA 4JIMA 4XYMA 5J63A 1A9ZA 1EDEA 1O95D 3HBMA 1B1AA 2ODEA 2V7UA 4MIKA 1F0KA 1M0TA 2WD7B 3A3NA 3AV3A 4GI2A 3RNLA 2IHNA 3TO5A 4NI5A 1ZK2A 2PUHA 5JISA 1V7CA 2CY0A 2I66A 2QNBA 3SSNA 1PL0A 1C81A 4ZK6A 2ATVA 2IKSA 3F3MA 1DAIA 2PD4A 2E9SA 4KX3A 4JGBA 1MJFA 4MUYA 3NB0A 1XT6A 1LW7A 1JR3A 4UUBA 3IUQA 1T24A 2H59A 1BS9A 3UXEA 3JZDA 5EHIA 3SD7A 5JAQA 5M29A 3LC0A 3OCYA 1EFTA 3Q8WA 5CLIA 5EWLB 5A9RA 3RSZA 3ID6C 3RUHA 3ZH9B 5KC9A 1FQJA 2G17A 3GLSA 4BLPA 4PAQA 1VL2A 1VBKA 1EM8B 1WOMA 5F9FA 1WV1A 2AFHB 2FK7A 1DAGA 3KSAC 2ZRQA 4EUKA 4R5HA 4UEWA 3QVKA 4V24A 4Q82A 3WLEA 1TPZA 4TLLB 1M5RA 3JQ7A 2RGNA 1N77A 4XR9A 1RWQA 5CDYA 2BZGA 4QJ4A 4RKQA 4A7PA 1U2SA 3UK2A 1WHTB 2MSKA 2UVDA 5FD8A 2AZTA 1UODA 2VH1A 1CJBA 4OHWA 1ICEA 3D2AA 2W9XA 3KQVA 1Q7CA 2ZQYA 1YVRA 1M1XB 1IK4A 4AX4A 3VPSA 3T9DA 2I54A 2P3LA 3FPGA 4RKYA 5FLXA 3WXMA 1G8PA 2NN3C 2ZE5A 2Q6OA 1RXYA 4YIHA 2XKKA 2EBWA 1U7UA 5U9CA 3IUEA 5THQA 3HP4A 4BNZA 4LYEA 3ESAA 5HKKD 2HYDA 3AWIA 1R12A 1BMQA 4OXQA 1HWYA 2JDIA 2RK6A 3HVUA 2MYTA 3PDJA 2D6FA 4C1NA 5GAJA 4XDYA 4CF3A 4DZRA 5DM2A 1KI6B 4Y9RA 2DBVO 4LY3A 3B6KA 1J39A 3QKSB 5B37A 1O0SA 1RFGE 1EK2A 2G9NA 3TIGA 2ZTVA 2JJ2A 5HPYB 4MDFA 1RTKA 3IPLA 3D81A 4QYIB 4MW0A 5CNMA 5BSRA 3LQKA 4LFBB 2XUZA 4L0CA 2HFKA 3CKLA 1NONA 3AR8A 1U0BB 4WZAB 4DLKA 3E1GA 3V8BA 1SVIA 5LWQA 2NTNA 3Q8MA 4WUVA 1UH5A 4DIFA 2CFCA 2VSOA 4KIWA 3UC5A 5J59A 3VDMA 4ZDJA 1BXRA 2GZDA 2OK7A 1UWLA 3EXEB 1C9EA 4F4UA 1ZZGA 1HK7A 4HFRA 3E2PA 5HDQA 5HILA 3MTAA 4RQBA 5AVOA 3WR5A 1NXPA 4CT5A 1JXQA 5CFRA 4LZNA 3IEVA 5HMMA 3N5KA 4L5BA 4XARA 3FAZA 4OP1A 4LHSA 4FYMA 4I5IA 4PBSA 5J9FA 3V4LA 3QHAA 4C5AA 1U8XX 1KDRA 3JQ8A 2DH6A 3UC9A 1YQEA 5J2TA 2R7AA 1MW9X 2R47A 5FFFA 3K71B 2GJSA 3MCWA 1L7XA 3A1VA 4F9FA 2QYSA 1O5IA 2VATA 4A2QA 1I3OA 3EGVA 4RV5A 2G0TA 2PJDA 2H2IA 4KCGA 4IF4A 1DCFA 1TU3A 2O0KA 3C6XA 5DXFA 2MWMA 1SVSA 2IYEA 3BS4A 4GUDA 5EHZA 1D0IA 2P8JA 1IN6A 1GCAA 4IL5A 4ZT2A 2QE7A 3LL4A 3W2FA 3GLGE 1YF3A 1YOBA 1FFDA 2C2YA 2C2BA 4ARZA 1RWVA 2I4MA 1PKXA 4EO7A 1F6DA 2AG8A 2XUIA 3ZTWA 4LFCB 4P58A 5EJIA 2QAJA 3PUYA 3VKUA 2Q4BA 3ABZA 3V1TC 4B85A 4YLYA 3QLJA 3ZWPA 1YB7A 2V4MA 1J2RA 1NP6A 2BFDB 1VKOA 1RXEA 3ECSA 1OXBB 4IMRA 2N1BA 2I7DA 5I5GA 2OA0A 3K4HA 2ECPA 5HA5A 1KQ3A 2UZ4A 3WNCA 4PPQA 2OVBA 3QE0A 4YUVA 3WGYA 1FQOA 3ZVNA 5AIBA 3ZQKA 1DIOB 1YZQA 3P9RA 5BOSB 2A9RA 3GXOA 4GVLA 4Q4AA 5CIYA 1CRPA 5TF4A 3N8IA 3T7CA 1MOZA 1E3QA 2CNLA 5DCUA 1TAQA 4WD3A 4ML3A 3A26A 3QPUA 4CKBA 3JYQA 4BFYA 2H57A 3OQVA 1U7OA 1YZLA 3I92A 1I3LA 2VZ9A 3N0VA 3PC8A 3SLGA 3A32A 4KEAA 2A9KA 3EA4A 4BYMA 1GQRA 1NVDA 3IEXA 4Y9SA 4DC9A 2W93A 1ECLA 1RBZA 1L3IA 4IZHA 5E38A 2HGSA 3D1JA 2C98A 2KLHA 2O7NA 1PX0A 4HCJA 4FCCA 3ZXIA 5J5CA 3X1JA 2FW0A 3E22A 3VYWA 2V7GA 5HK8A 3O9ZA 4MCJA 1XK6A 2XWPA 5DGTA 4JJEA 2R8XA 4EY5A 1UDBA 4OQMA 2W6IA 4AJIA 1ADCA 1LJ8A 1BO6A 1AGYA 1NIJA 3PC4A 4AN0A 3NGXA 2W58A 3NWEA 4C6TA 4XE5A 4WBXC 1E5DA 2CCJA 1KYTA 4D4KA 3GGDA 1JWAB 3CNLA 3EGCA 4XJVA 4ALMA 1E3DA 5IM4F 2H1WA 2V5VA 2QD5A 3NTUA 4WJZA 2H8GA 3LPMA 3ZDXB 1VI2A 4AZWA 5BPFA 2NP6A 3VNRA 3HEMA 4R2MA 4LJYA 1GADO 1W96A 5FO0A 3JTMA 4ALKA 1PTKA 1F5NA 1T36B 2HMAA 1MPXA 4LV8B 4ZZ1A 1H1LA 1RU3A 2JHGA 2R85A 3DL0A 2VJDA 3F6SA 4A0FA 2G9QA 2ZLBA 4JP5A 3VFDA 1OH6A 1X7YA 1ZGGA 4RVFA 2YWGA 3BL6A 2AK3A 4TYNA 5A4DA 4JNCA 1MJNA 3G2KA 2ZJ7A 3CHYA 1R10A 3KEFA 3PSHA 2OPHA 3Q85A 5T7BA 2F3SA 5KSZA 5JSZB 2PH5A 2HHAA 2H08A 5FIUA 4D3XA 4MIYA 1SZPA 2H5IA 4CV1A 5IC6A 1J2YA 1UEIA 2GAIA 1CQJB 4FPXA 4Y2HA 3FNRA 4O4JB 1VPDA 2NU6A 1G0OA 1DUIA 4L0DA 4Y6PA 4GM0A 5DLEA 5F5LA 4HR7A 4GBGA 2FZCA 3A3OA 2WYWA 2ZYIA 3ABIA 5DYTA 5DI3A 1AC5A 1U2DA 5AI5A 2ZRNA 1NJ2A 4O2LA 2RHBA 4BFLA 1ZOSA 3B60A 4QTUB 4CCYA 4JASB 4O3MA 4Y2JA 1AXGA 1R5NA 1Q7GA 3AP2A 3HVHA 5G3YA 3G5TA 3HL4A 3SS7X 5GADl 3RADC 1AUPA 1YSCA 2AH5A 3E9MA 3X1KA 5KOIA 1N92A 1XXHB 2FPUA 3M6IA 3SYTA 1IHPA 3E9RA 3MM4A 3AOEC 3QNWA 2J31A 4XUEA 5JYEA 3DKVA 1B74A 3WGUA 5ELLA 3UJHA 1DP4A 1WDWB 3AF2A 3DO5A 4NG5A 2WE8A 1FDUA 2ZSKA 3WAGA 4BE9A 2AUNA 1TO2E 1L5GB 4QUJA 2YDXA 4M1QA 5FH9A 3NJRA 4G4GA 1YA4A 4CRWB 3H75A 3N0TA 4JI3B 3TD6A 3W9UA 2XNDD 4YYEA 4NV3A 2QTGA 1SVKA 2RSLA 4CLRB 1D4AA 5BQ3A 1AUOA 3EZ2A 4WLFA 2WUGA 3BE5A 5ES3A 3ZWBA 2QAIA 3IIJA 1QYXA 4OI1A 3U16A 4BMZA 5CA0F 4JVOA 3DO8A 4KIFA 4DRZA 3GLHB 3ESCA 3HCWA 3GV0A 1JIXA 4Y67A 4KWHA 1YASA 3TTWA 2B4RO 3WYFA 3VU9A 4DRYA 4YRSA 3K5WA 3K0HA 1E3JA 1NFRA 4H7IA 1DX9A 5JIBA 4XYEA 3K9FC 3A2MA 1PSWA 2FZEA 1QX3A 2HRQA 3M1AA 2Z2XA 2CJWA 1RXCA 3KJHA 2HWWA 1BS2A 4U00A 4C2AA 3AUUA 1AK9A 2MT9A 2C4NA 4RK5A 4IYJA 3AJDA 4UDYX 4BJ1A 1KSHA 1QYCA 3ZNPA 1A9RA 2QTWB 3VR6D 3I9V1 1UKAA 2WWIA 3AR6A 4K6MA 3FYDA 2X6RA 3MMSA 1NMEA 4HT3B 1QGOA 1WXFA 2GK6A 4QGFA 4GM4A 1IFXA 2BFMA 5A06A 3PKIA 3RKRA 1G8AA 2EQAA 5LKAA 1VG0B 3RV3A 3K8QA 4MITA 4Q4JB 1RP7A 2GZSA 1G20A 4B6JA 3A2KA 1OREA 1ZCBA 1PGOA 2NADA 3IVRA 3O2JA 3NPAA 4PC3A 4XIJA 3UT0A 1ZVQA 2DHCA 3MWDB 2OQVA 4ZIRB 5F23A 2PJRA 3IT1A 3PFIA 4QTZA 2FN8A 1SB9A 2IYUA 2TS1A 2H4FA 2WAXA 1DV2A 2ZFUA 4IJ5A 1FYWA 5JJCA 5BQPA 4P84A 4MRRA 2WKQA 2B1QA 4RF5A 4KOEC 4CIDA 3LRPA 1KPIA 4NDAA 4MR7A 1H6DA 3IXLA 4MAMA 4CTKA 3WA7A 2O23A 2GN8A 2NXEA 2E6UX 1OA1A 1JQLB 3GQBB 5AUQA 3HWSA 1I30A 2YV4A 1Z07A 3B1VA 2Q3CA 4RD0A 4F97A 2CD7A 1V1MB 2WTBA 1Z0IA 3G2QA 5KKAA 1GTZA 3EFOA 1H1DA 2VQSA 2IP2A 3W1EA 4BX8A 4DDVA 3TQHA 5KYYA 1TU4A 2M6LA 3UCEA 4AURA 1NG9A 3HMKA 4QNRA 3PQCA 5E7JA 1SZCA 1RM3A 3ASZA 2XYGA 2A0FA 3BK2A 3QPWA 1J20A 2VVTA 1OYOA 1OTYA 3IIMA 4H7DA 1QS0A 4JUIA 2PIAA 2AZXA 5LMZA 1LPOA 2ALJA 1JYSA 4DSNA 5FL3A 1H4TA 2QIPA 3S0JA 3HHPA 5GZ3A 3QOWA 1CJSA 4OOEA 2FX2A 3G0CA 3KHSA 4IUBS 3NHLA 1EU1A 2JFWA 1MAUA 1VI6A 4INJA 1HTWA 5T5QA 1AKVA 1OX4A 2OHVA 3OBBA 4OSOA 4HNUA 2VP6A 3HE3A 1TU0A 3KKQA 1L5HB 4G41A 1DIGA 4HKTA 4I0WB 3W4IA 1TM2A 3PGA1 2VF8A 3GG9A 3HACA 1AK2A 4C7BA 3BUSA 2D5LA 5LNK6 3Q12A 1NXTA 4OK6A 1QIKA 5DHSA 1EFCA 2WFLB 2GPNA 4M6WA 2W2LD 1VECA 3DZDA 2REBA 2JH9A 3NBFA 1A9XB 3QBEA 1V5FA 4K5QA 2I65A 2PT9A 4DCNA 2XB8A 2FCAA 2UVPA 4RULA 1NXWA 3GVIA 3L9WA 2W5UA 3OKCA 4GAEA 4Q19A 2VDQB 4QGSA 2NXWA 3ZHYA 2C9CA 3VYSB 1MO6A 1H2RS 1YRYE 3LHFA 5AESA 3C24A 5I7OA 1J9GA 1XRRA 1STOA 1JHQA 3MJCA 4NJMA 1E2EA 1PDOA 2PUTA 4XWTA 4C87A 3Q6IA 2VDMB 3M6XA 3HWX1 2QLBA 4HLUA 4CLEA 4DWWA 1K8QA 1E7QA 1V6AA 1O3YA 1TE2A 4KR2A 2B34A 2HBYA 5PNTA 3CH4B 4I1VA 5ALSA 1ZNZA 2EGUA 2XA2A 4IIJA 4R9SA 2D8AA 4YLEA 2XWJI 1YS1X 3D8BA 4BVLA 2G5PA 4HQNA 1I2DA 2WVHA 3NV9A 2Q6LA 4K46A 3VXKA 5AVYA 2IYYA 9MHTA 4RYDA 3RU9A 2JGMA 4NDNE 4ZI7A 1C14A 5H9WA 4P0QB 1EX1A 4H4DA 1EGAA 1NZDA 5YASA 1N5OX 2OP0A 2HSZA 1XNHA 1H2XA 3OZUA 4CF6A 2ID7A 3BSWA 1QPZA 1W6RA 5DN6D 3RRFA 3KZKA 5CYFA 1LS1A 1E9DA 1HKHA 1V6CA 1IQUA 2XGGA 4RA9B 4WXEA 1KOLA 1K06A 3HJFA 3AVVA 2QTMA 2JKVA 5AI8A 3S70A 2DKOA 3WKDA 3W5BA 2R0QC 1QQ6A 1M67A 1T8UA 4KO2S 4EGCB 3DQPA 1OXSC 4AJ2A 4E0BA 4B7ZA 4G1VA 3WL5A 2NAPA 3CZ4A 3MEQA 2VK1A 1OLUA 3E15A 3T35A 1VKJA 2ZBPA 3IPAA 1P3DA 4GXTA 4AMZA 3TF5A 3FMGA 3MWFA 3D6HA 4JBIA 5KMGB 3WB1A 4MVXA 2NT3A 4ND2A 4F3YA 1QYRA 4PICA 4RO0A 4LYFA 2XCSB 3L6EA 1UJNA 2ZTLA 5TMPA 1CK4A 2IYRA 4HATA 5GJVC 1GPJA 1IL0A 3FGOA 5A3SA 3VUFA 2BGGA 3DHEA 3KQTA 3P2MA 1U1DA 1IN8A 3HM2A 4GZ5A 4QPPA 1XJCA 1Y6ZA 1S7GA 2F2TA 5HKBA 1L7BA 1NUTA 2BE9A 4KMOA 1MIHA 2OV8A 2ZBQA 3DD5A 5AT1A 1WEKA 1KAHA 3WWYA 1Z2DA 1SXPA 4AKIA 1SXJB 2RGXA 3MWLA 2NZ8A 1NE2A 2QXTA 4R0NA 3ZWVA 1MO4A 1H2WA 2WMOB 2ZQ5A 3VZBA 4F11A 4FFDA 4BWYA 5DWQA 1Z2CA 2NZ2A 4LOAA 1O9GA 3SFVA 1L3CA 4EFLA 3U4DA 3UB3A 2XUGA 1O95A 4S24A 4C0KA 1SC6A 2MCFA 2HSEA 1WMDA 4XM1A 1SUWA 4OL9A 1P6QA 3LC2O 1RJ9B 1ZC3A 4DV1B 4EMUA 3L3BA 5G0SA 3TM4A 4HGZA 1JQ5A 1P6XA 2JD2A 2QR5A 4EB8A 4BGEA 5ICSA 4J3JA 4DBVO 3FHLA 4Q9LA 4JOQA 4GUAA 1TK9A 1XZJA 3M83A 1I5EA 1EA7A 4RANA 2GBFA 4RDCA 4CKEA 3I83A 4DYHA 5KVSA 2QJTA 3P9QA 4MB2A 3SFTA 2FGKA 2CWWA 2PK3A 3KLNA 1JZTA 4UFPA 1ML3A 2C5BA 4CWAA 1DZ3A 2P75A 2HCBA 3N8KA 2GF2A 3SSOA 1AHPA 5GINE 2IYWA 3DKIA 2UAGA 2NUAB 1LLQA 4Y7CA 5EVJA 1RPZA 3SHVA 3O4JA 4N6OA 3CW2A 3KWMA 3RABA 4RZXA 2IOQA 5FOQA 4PO3X 3AFGA 4PO9A 4EJSA 1QNLA 4S3MA 1SXQA 3KJXA 4PIVA 2GUWA 5TJHA 2FE4A 1C9JA 1FYFA 2F3QA 2VYFA 3QXGA 4TT3D 3KB1A 4PWYA 1XFDA 5T6MA 3HLTA 1APBA 1ABEA 4ZOAA 5EZYA 3VNBA 1AZLA 3JQ6A 4LMPA 3W6OA 1MRSA 2GK4A 2W6JD 3FIUA 3RO7A 2H4JA 5EXPA 3UV6A 1H0KA 3R6GA 3CVWA 4C7XA 4QEZA 1JWLA 4YH1A 4UPVA 4OFXA 2OG2A 3E0QA 3GT7A 3NW9A 3DAFA 4O02B 5JE8A 1Z73A 1RADA 2QW0X 5IFLA 3MWKA 1Q11A 2OB1A 4BVFA 1G6HA 1R0LA 3HHEA 3JVIA 4H16A 4KP7A 3FA2A 1ZGCA 2Q0XA 2XIJA 4O0MA 3UUFA 1MAWA 3GEDA 1WUJS 4HTFA 2O3TA 4NOMA 1L4HA 3SMQA 3DMGA 4GGPA 4Q18A 3G9XA 5HKKA 4KB5A 3GJXC 4XD2A 1S3FA 2P91A 1ENZA 4DCTA 2GPTA 2HHJA 3BZUA 4QUGA 1QU2A 2A5JA 4Q3KA 4X64B 3SSAA 4MULA 2VWQA 1FLDA 3P8ZA 4DQUA 4EB6B 3LI2A 4FGKA 4X91A 2JK1A 2AK2A 4TMZA 1UPAA 4N3NA 1NN0A 4OA5A 2Q3JA 1C1DA 2YYAA 2Y0PA 1J7JA 2XJ9A 1U8EA 3UGJA 1R27A 2QAGA 1TK2A 4NC9A 4QREA 5EWJA 3DHVA 4F9EA 2HIMA 3K70B 1DIHA 4PLZA 4PIMA 5F21A 3FLMA 3V3KA 1XQ6A 4KR3A 3ULKA 3RHZA 4BLTA 4G5XA 4MMXB 1EH5A 1Y8CA 2R48A 4KLNA 3ZZ0A 4JJ4A 3BXEA 4HAOA 4IEIA 2PQ2A 2GXQA 4FOLA 3Q3GE 4KJXA 4RPHA 3LD9A 3KQPA 1Z68A 1AZWA 1W5TA 4FS8A 3GFQA 4YMUA 3E9DA 1JFSA 4HTAA 1SU8A 3WQHA 2VSQA 2HTEA 2ZI9A 5A9SB 1YRAA 2DBQA 2VJYA 3D6NB 1QIEA 5JCXA 4LSWA 4Q3NA 1PL7A 4C2TA 1VE9A 2O5EA 5DBOA 3BIXA 4B6GA 4W6ZA 1H65A 2NZUG 4N0QA 4B6FA 5GONA 4AB1A 3B5IA 4QVIA 1W9HA 3AF6A 4KUGA 3FKJA 2KW5A 4Q3BA 5EEGA 3UPTA 2VDLB 2CZGA 3STVA 1MC5A 3MJSA 4QEDA 3D6MA 4F3TA 3WLIA 2IHTA 5IAEA 1VYHA 1D03A 3CG4A 3LUAA 4J4BA 2PL5A 2C5SA 1Y82A 1OXVA 4TRMA 4X92A 5DNAA 3EH2A 3R2JA 4Q39A 1QGZA 4G9BA 3Q6MA 1PYOA 1VXOA 4DREA 1E5TA 4F72A 1TRKA 3FYSA 2I71A 3LOQA 3OPNA 5CH8A 2C54A 4C0QC 5I47A 1GL9B 1FRFS 1GA4A 2UKDA 5DEOA 3M6MD 1JN0A 2H11A 5HJEA 5B4UA 2PL1A 3HCOA 4J07A 4N0PA 1SUAA 3TMAA 5IAGA 1THGA 2AD1A 3CLTD 3RRNA 4CG1A 3SJUA 4G8DA 4FBLA 1ZIYA 1N9ZA 1SIUA 2UZAA 4FQ8A 1A2BA 4ZO9A 4YAGA 5BXYA 2A0YA 1U6KA 1Y48E 2F7SA 2GCEA 3LUDA 1QLJA 3KVRA 5ECYA 5FRDA 3W5UA 5HXAA 3GU3A 3N8HA 1TOAA 2VKTA 3X2SA 1NQXA 4KPUA 4K3UA 2CUNA 2BYTA 4DR2B 2BFOA 3FF1A 4DSUA 3V4FA 4TSRA 2XR1A 1J07A 1JB9A 1E7SA 1NN1A 3QLUA 1H8ED 3RNOA 4CFYA 5EJ6A 3LP5A 2DB3A 2QRGA 4FP9A 1GGHA 2DCUA 5BT9A 3FZGA 3I76A 4NE7A 2J0SA 4MV3A 2IDZA 4HQ0A 4LN1A 1NW3A 2FOIA 2DPMA 3GIDA 3LQYA 4RSMA 5FO1A 1AM4D 1UQRA 3DMHA 1YJCA 4GP9A 4Q02A 1KSFX 3MA0A 5AI0A 3W5HA 2VRWA 2YX1A 3E7PA 3KOUA 3VM6A 3LT5A 3N0WA 1UBGA 2EWVA 4XXHA 1C1HA 5FTWA 4A3SA 1T3HA 3R41A 4G09A 4DPMA 1Q0PA 4WN9A 1VLZA 2IUTA 3HNPA 1XZEA 2AXNA 4PSCA 3HYTA 1Z3CA 3H04A 4HGQA 5IDXA 3CZRA 2QGZA 2Y1WA 3RK0A 3PXDA 4L9RA 3W2GA 1K7SN 1YB5A 1YRQA 2HQOA 1CUVA 4U39A 2ZCJA 4G89A 3U3ZA 1XP5A 3MYRA 1YL5A 2H7YA 2QTHA 1OBCA 5KVCA 3V1YA 1GPH1 2GF0A 1V95A 1BN6A 1P44A 1RHQA 8MHTA 4OI4A 4JYZA 2VZEA 1YS7A 4JI6B 5KKCA 4TWZA 4MROA 1FJXA 1QP0A 1P9WA 4I4LA 3PCTA 1ZNXA 3KSMA 3UA3A 2M2IA 2W8BB 1KZ7B 2C3MA 2HOQA 4S12A 2O7QA 4UVGA 2HDOA 2IELA 3EVFA 5EFOA 5I7HA 4FUTA 1Z15A 2L42A 2FUKA 3P1JA 3RLIA 4OMCA 4ZOBA 2QXYA 2W2MA 3PKZA 2HX1A 2YV1A 4LQ4A 5F73A 4HSEA 5AM1A 1NU6A 1J23A 1E4OA 1ZUIA 3DQQA 3NAZA 5ADUS 1WMFA 2GBPA 1A5ZA 4R40A 3ON5A 5EI5A 2NXCA 1DLIA 4ZGBA 4S2UA 3PXBA 1HNWB 3C3JA 3A6KA 1I3MA 3M4ZA 2V4UA 2H16A 3OZDA 1GG8A 2GNPA 4L8LA 4LPSA 1FMFA 3ZWCA 3H7IA 4MGZR 2W22A 2YICA 3ZCUA 1JIKA 4QBHA 3OJCA 4P36A 4JV5B 2O1EA 3ZN2A 2A5GA 3MPUA 4FWIB 3A4TA 4G2NA 4HEQA 4A6PA 3DVLA 2FSPA 3EGWA 5IVHA 4BFWA 3ZCPA 4DLTA 3WLSA 3GNTA 5TMBA 4GD3Q 2P5UA 2VPZA 4MS1B 1YE5A 3A10A 3FCOA 5FXMA 3NAQA 4BVAA 1W4ZA 2XADA 3OEED 3THSA 2PFGA 1YJXA 1RQLA 1GSOA 2WMYA 3FSRA 3OMXA 3W5SA 4CMEA 4DXDA 2NZVG 1KU6A 2GUGA 4ND8A 1L1RA 4X61A 3SJZA 2JLCA 1MTZA 3L8ZA 5AVVA 4LJ4A 4HDMA 3EZ6A 1DLJA 3WYNA 1WXXA 1E4EB 3GLTA 2O8NA 3HXKA 4CIYA 3O95A 4ZVQA 4P3PA 5FQOA 2M9MA 4KDFA 3O8QB 4U6SA 3ZWAA 1GNQA 2JEOA 4ZEOA 2H1OA 3L4EA 1Q44A 4P98A 1BAPA 1W5AA 4QYXA 2UDPA 1QH8B 4J29A 5CJJA 3T41A 1B14A 1UMDB 3A2NA 3G2HA 4JOBA 3N2GB 4ZC8A 1PJSA 1FVXA 2WWHA 5DEIA 3R7DA 2UYOA 4X7BA 1GR1A 2GD6A 5AVJA 3EG5A 2XNDA 4OLHA 3TOXA 2R87A 3LGSA 1W85A 3VR5H 3FH0A 1Y8RB 4L8FA 4DIUA 1XMVA 3M4NA 3DE2X 4C6RA 4DGSA 1KJYA 1KU0A 3NNNA 4LECA 2FLVA 1XQYA 1ELOA 2QAGC 1P4SA 1ZMBA 4X44A 4BVGA 3WB9A 1DSSG 1IMJA 1YACA 4FYWA 5AXCA 1KFBB 1WE2A 4D0NA 4B33A 2JGFA 1Z0SA 3MWGA 5EKXA 3RPEA 2ZTSA 2BH9A 3FFWA 4H2DA 1R6XA 1B8PA 4I5FA 2LRHA 1USIA 5CDTA 3FOCA 5AW0A 2VAXA 4XWOA 1XZNA 4R3WA 3W7AA 2E48A 2J33A 3AC0A 5REQB 3T3NA 3AXSA 2JKZA 3P26A 1N6LA 4EY7A 13PKA 4ERNA 4W8GA 5J2UA 2VHCA 4D6YA 2XAUA 2VDKB 1IWBB 1CETA 2XHZA 4LX8A 5TF0A 1U3TA 1X7ZB 2BI7A 2CL5A 2RI6A 2X1MA 2ZJ1A 4NH4A 3C74A 3KXDA 1PR2A 5CT6A 4EO9A 3OQJA 4WVLA 2CSXA 2D74A 1FFEA 5HF9A 4YLGA 2FB9A 3AJEA 3GFFA 4PAOA 4R6XA 3IALA 1OGJA 3JD1A 4PX9A 1A2OA 1N2EA 5CPFA 5K6AA 1K5DA 5EP4A 4W9MC 1Y8QA 3VGPA 2GCNA 1CTQA 1F6WA 2EV9A 2TMDA 1GFSA 2VHEA 3SZUA 1HE1C 5LIPA 1NZFA 3WK8A 4NPCA 5K6RA 2OMKA 5J43A 1R4MB 2AQKA 4R05A 1RHKA 4D3FA 1B3RA 2CL0X 1IYZA 1HT3A 4KQMA 5E7IA 1VBFA 4GZLA 5L7YA 3LAWA 1MN6A 2C0QA 3LCJA 4YROA 3ZJ5A 1FSGA 3HCDA 1GTMA 1QUFA 1K2WA 4I50A 2AWOA 1TEZA 2C92A 2DFKB 1I7SB 2BGWA 4U2DA 4GR9A 1E5XA 2QE6A 4JELA 3EX7C 1S8NA 1ONSA 4U1RA 1WP4A 3PIIA 5DCLA 3LE8A 5JLJA 3QLUC 2PKEA 2IPLA 4XM0A 5CU7A 1GQSA 1N1EA 1LDYA 4GPIB 1V1RA 1ADGA 1EFVA 3CUYA 3SCZA 3SMVA 1JXAA 4M7WA 4DUYB 3JRNA 5BN3B 5FV7A 4I1RA 3PX2A 4LZWA 2NNLD 4LCEA 3AM5A 4E5UA 1JG3A 3KTOA 2QT0A 3PFBA 4C04A 5CK4A 2JGRA 1D1QA 1OILA 2YXLA 3P5BA 1Q5PA 1I6WA 2WINI 5TARA 1SK8A 3ACBA 2ZIVB 1TFRA 2J5BA 2X2EA 3IKTA 1XN4A 2P1RA 4J91A 3NHWA 4KE9A 2MMCA 2QSJA 4B7XA 4F8EA 4RNCA 1FK8A 1ZU4A 4G86A 2ACEA 5C8XA 3ENVA 4XASA 1B8OA 1SWWA 3ZBUA 1GLVA 1DBIA 5NULA 1NW8A 3SXPA 1IY0A 2G04A 4FFBA 3CONA 4O1HA 3EF3A 3UWDA 3FM9A 2JD1A 1N5KA 2JRCA 4L4RA 4RK6A 1IBCA 2NACA 1A88A 2NYAA 3H13A 3PNMA 4ALLA 3OTHA 1GRQA 1MOQA 1U31A 2TMKA 3OSUA 2OC4A 2VAPA 2KM1A 2ZYRA 3BQNB 1L5LA 4OY3A 3R9XB 2W2LA 2JFBA 4EHIA 3GUZA 1NOJA 4V0QA 1V47A 4Q7QA 4RFSA 4HNRA 2R6CA 1T1EA 1L7VC 4UE3S 3IJEB 1C7JA 1HYHA 2C9OA 1SC9A 3EVEA 4AJNA 2D13A 5K5EA 2B21A 4P2GA 1O87A 3P9CA 1IN7A 3QX7A 4MINA 3F4BA 3T7RA 2PO5A 4CDMA 4IDDA 3K9BA 9GPBA 4AVYA 2VP3A 3CCFA 4PTLA 1WAMA 2HQ1A 2YVAA 3CXRA 3I5AA 1N5IA 3WYGA 2ODNA 3HBFA 2BPOA 1ENPA 4O29A 2CMKA 5JD5A 1AV7A 3NR2A 2VDOB 5B4TA 3SEZA 3OQ6A 5AJTA 4CYMA 4CQLB 5C46F 4DXAA 3JALA 5K3CA 4H4EA 1J7KA 1WZIA 5LQMA 4J4HA 3ML1A 5G4KA 3OESA 1QFSA 5AVQA 4I9GA 5MFZA 5EE3A 4QG3A 1U2TA 2FEWB 3W2HA 4RNDB 4WCFB 4MA4A 2VHQA 1Y37A 3UHFA 4DM4A 4DSZA 3B7GA 3FPCA 4Q1EA 1J09A 3U7EB 2P6UA 4LDRA 1XIVA 2YY5A 1TGVA 2O2ZA 2PD3A 1FDVA 2PWAA 3L1VA 4ISBA 3KVVA 2F8LA 3SR3A 1Q6YA 1PFWA 4QVKA 5DIFA 4FI3F 1DOZA 2AXQA 1KP3A 3NHKA 4JCOA 5DN6A 2CKDA 5CT4A 4LSZA 4KNVA 2BTQB 3I2YX 3OZAA 1OCEA 1EJBA 5F52A 1ECPA 1OTXA 3SC2B 5CR9A 5BMVF 4I7EA 1DTWA 4IF6A 4MRSA 1VIMA 4LRTB 2O2YA 4QL3A 3R3VA 1IE3A 1QHGA 1W36B 4GKJB 4Q1BA 1ZD5A 4POOA 5EP2A 1GDDA 1ZP6A 4B82A 5AWFC 2NOAA 3LX5A 1CVRA 1ZCFA 3Q7EA 1N32B 5FOWA 3LT1A 1XSEA 1F8GA 2P8SA 4FMPA 1ZMRA 3W9YA 4L51A 1ZC4A 4HG2A 3QMMA 5HYVA 3VKFA 1ARZA 1YC2A 1NGSA 3G3EA 4B43A 3U37A 5B57C 2ZWMA 3ICQB 1CC1S 3ZJYA 4Q4DA 1M2VB 3TKAA 1SVWA 3GUCA 2DTDA 3IT3A 2J4FA 2CL7X 2NO6A 2Z3VA 2Z83A 3N2IA 1KZGB 4L7QA 3DE7X 3O7MA 4F6RA 3PFWO 4MP3A 4KOAA 2MSWA 4EDFA 3RFCA 4ZPXA 3RT9A 1KWKA 2IGBA 2AI1A 4D0LB 3P0JA 1YO6A 4FFSA 1ECCA 4R84A 2WFMA 2F55A 4AUKA 3O0TA 4JT9A 4MKGA 3CUKA 3QFRA 3FFBA 1E8DA 1KJIA 2ZM6B 2V0NA 4MUKA 2LGJA 2WT4A 3PICA 2QL9A 1UC8A 2BV3A 3QYAA 3V1LA 1NR1A 2PMDA 4X63A 1R8QA 2DR2A 1Y80A 4D9BA 2BBOA 3EZFA 4P4UA 4RCZA 1GZUA 1L1EA 1VQ1A 1AS2A 1RZUA 1UUFA 2DHEA 3A1TA 3BB3A 3IOBA 2CCKA 4JC8A 4KXMA 4L75A 1K4YA 3O8NA 4DJAA 5LMUB 3ZG6A 3KZVA 3KR2A 2GFHA 2Q4TA 5CB4A 3QHPA 3LT2A 3UHJA 4EFMA 1R5OA 2WPNA 3CY6A 1G21E 2H6EA 4UM5A 3R7BA 1V7PC 3VOBA 4EB0A 1KEKA 4CZ2A 4CI0B 4Q1FA 3RTDA 1AQJA 1ZEMA 4N48A 1J0XO 1M2HA 2BGRA 2O3SA 5K2MA 1C0LA 3VVBA 1RCFA 4UTNA 1PGJA 3D2CA 4QEKA 1QXSA 2MYNA 2DLNA 3OFND 4LRYA 1T2VA 1XRLA 4YAEA 5SYMA 1U0JA 2D54A 4YJHB 4BO4A 5EIFA 1P7PA 4O4HF 3M82A 4A8JC 3A7DA 3C45A