1UK6A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with propionate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
molecule tags Hydrolase
source organism Pseudomonas fluorescens
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
total genus 105
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk6A00
1ORVA 3IURA 2PL5A 3YASA 3R3ZA 2E3JA 1NX9A 4XJVA 4W9RA 1QIIA 2XUJA 4AZ3A 1GGVA 4QDXA 3GBSA 4BDTA 4TVKA 1EDEA 2Y1KA 3QM1A 3F98A 2VEOA 2G5PA 4IH1A 4XWGA 4WJLA 5E4TA 5AI5A 5AK4A 1XZIA 2H7CA 3W05A 1U65A 4EY7A 4U2EA 5AKIA 2XMDA 1ZIYA 3LLCA 4NZZA 4FFVA 4U2CA 2HRRA 3BL8A 3DYVA 3N0TA 4FWBA 2ZSIA 5FLKA 3PF8A 3T52A 5I9IA 5AM4A 2WJ4A 4J3JA 1CEXA 3I6ZA 3ZLVA 1XRPA 4C4ZA 1ETHA 1WOMA 4QWMA 4BYMA 4N5IX 4WCVA 3FLBA 3TEJA 3WKCA 3I2IA 1FFDA 2HM7A 4BAGA 5ALOA 4U2DA 1JMYA 1CQZA 3LP5A 5I8PA 2ZYSA 1TK3A 4HRXA 4J0IA 4LXIA 4W63A 4BAZA 3C43A 3H19A 1ZI9A 4G8CA 3M81A 2PUHA 4PF1A 1YSCA 3BJMA 5ALEA 5J3JA 4J7AA 1B6GA 3AZOA 2HA6A 5HF5A 3GUUA 1XQXA 4DYHA 2WFMA 4J0JA 1YR2A 4H0CA 5JAPA 4FNMA 2VT6A 4QDOA 3WWEA 2WSLA 3R41A 4DMFA 3I2KA 3ZV7A 5ALZA 4K6HA 2WUDA 5JD4A 1XLUA 4DSAA 2HIHA 2O7RA 2HU8A 1MT3A 3FYTA 4JEIA 2WM2A 4P9NA 3B3QA 1LPBB 4X7BA 3BWXA 1YA4A 1XKTA 5JIBA 1CUSA 1VXRA 5K3EA 3W04A 3G8YA 4BDSA 4BTLA 2ES4A 7YASA 1IZ8A 3NWOA 3DL4A 4KE7A 5CTAA 4X6UA 5AM1A 3QPCA 3WZLA 3W9UA 3D5EA 4FKBA 5AKKA 4BATA 3WQHA 4L3WA 3FVRA 3JW8A 5ISMA 4RE6A 2XQJA 3WLAA 2LIPA 3FYUA 5JZSA 2ONCA 3C45A 3D2BA 2XMBA 4C4YA 4X94A 4F0JA 1JI3A 5AOAA 4DNOA 4G1FA 2ZYIA 1AUOA 1K4YA 4PW0A 3EQ7A 1LPPA 3WA6A 4Q1VA 3C87A 3GFFA 1ZICA 4HXFB 1XRRA 4XX1A 4OB7A 4MWTA 4GDMA 2GYVA 2VTVA 2IIVA 4D9JA 3V9AA 3I2JA 1EXWA 1ZD5A 4X92A 1C7IA 1OXMA 4G9EA 3UUFA 1IUOA 1H2WA 1MX1A 1XFDA 2XQKA 3PFCA 4E15A 4WFKA 5ALDA 2V97A 3WWPA 4ZRDA 2PKYX 3PI6A 4H77A 5JZBA 5DYWA 2PSHA 4BZWA 4GW3A 4EY4A 5LZ4A 4K6KA 2XB6A 1VZ2A 2QKYA 1LZKA 3A2NA 3SWWA 3STTA 4G4GA 4KYVA 5AK3A 1EK2A 2WUGA 2XMRA 1CR6A 5H3HA 2GYWA 5K3AA 4J0KA 3FLAA 3E3AA 4KE9A 2CB9A 5LZ9A 5A7HA 1LPOA 1CUFA 2ZJFA 2NW6A 3VXKA 2QXUA 1AZWA 1VZ3A 5ALJA 2OCKA 5FV4A 1HL7A 3STYA 4GXNA 1CUHA 2QMQA 4UFNA 3WK5A 2FUKA 1ZD4A 4G4JA 2PSJA 2Y6UA 4G8BA 4Y9SA 3VVLA 3FCYA 2BFNA 2R8BA 5ALRA 1XZAA 5AI0A 1WCYA 1RP1A 1WPRA 1HDEA 2XUIA 2JGEA 3F97A 2JGLA 1IVYA 4S0XA 2PX6A 1S8OA 1IUNA 3WJ2A 2Z3ZA 3Q8WA 3L1IA 4OU4A 1QIJA 5ALGA 4OYYA 2HU7A 1R9MA 4CCYB 1MX9A 5DWDA 4DNQA 1ODTC 2ROQA 1F0NA 3RM3A 1ZD3A 4AO6A 2BKLA 3DOIA 1YAJA 5ESRA 1N1MA 5ALIA 3STWA 4YK7A 2WFLB 3R3WA 2OXEA 3QYJA 3HACA 1W75A 4I3FA 4EY8A 1QO9A 2C5GA 4WDRA 2FJPA 4UHCA 3H18A 3LIPA 5DNUA 3I1IA 4LIPD 2CJPA 1QONA 2OGSA 3D3NA 4EHBA 1T2NA 2AJBA 4IH4A 4BVKA 4EUSA 3BIWA 3F96A 3AINA 3G0DA 1CUDA 3PDCA 1USWA 3QPAA 4MQLA 4DMHA 1DX4A 4FLFA 1KU6A 4AX4A 3QBJA 3BXPA 1WB4A 5AKGA 1H22A 2P8SA 1VA5A 2YXPX 1YB6A 4MEAA 5ALVA 4A5SA 1MPXA 4ITVA 2ZYRA 1T4MA 3UUEA 4LYEA 5E4YA 2Q0XA 3AZQA 5C8VA 1DT3A 1LPAB 2CMFA 2VF2A 4ETWA 3A2MA 1UKCA 1CUCA 4KE6A 5ALSA 3RARA 1O6GA 1XZHA 1QIMA 3C70A 3R3UA 1F0PA 4OB6A 4AMZA 1QIFA 1RWQA 1ZOIA 1XZMA 3H1AA 2VA9A 5BOVA 2RI6A 1ZGCA 3I2HA 2ZVDA 1QOZA 4NMWA 3B5EA 4AO8A 5A71A 1A8QA 1R1DA 1Q83A 4X93A 5E4JA 3FCXA 2XUGA 2H9YA 2Y2VA 1XQWA 1LZLA 1OILA 2WG0A 1TQHA 4Y2SA 1TAHA 1X2BA 4B82A 1VKHA 1EX9A 3FNBA 1VE7A 3IUMA 5CT6A 4F5ZA 3LS2A 4PO3X 2D5LA 2DCMA 4QDZA 5AKYA 4N5HX 4JYMA 3V48A 3IDAA 3WYNA 3F9CA 5LZ2A 5CBKA 2AJLI 2XDWA 1WHSA 1FFAA 5K3FB 1DX6A 3EQ8A 5ALLA 2OPHA 3DKRA 1MAAA 1QFSA 1AMNA 2HADA 5CH8A 4J0GA 3M82A 2Z8ZA 1JJIA 4KAFA 2WIFA 1JT2A 6YASA 5T4HA 2XUFA 3WK4A 2GBGA 3TGLA 1CUVA 2V98A 1YB7A 2OCIA 3F8SA 1XKLA 1M33A 1TKRA 2VJAA 3ZPXA 2WHPA 2GBIA 5DNWA 4BVLA 1CUEA 1P0QA 3IUJA 5K3DA 5K5EA 2HA4A 3W2TA 4EY6A 4AO7A 1JFRA 4ZREA 2VATA 4DSZA 1SCKA 5FPQA 3DS8A 1MNQA 2Z5GA 3QPDA 3I6YA 1QIGA 2I78A 2XLCA 4W1QA 1ZI6A 5AJHA 2OCLA 3V1KA 2DHDA 2RONA 1KU0A 2BUAA 1JU3A 1GXSA 5LP1A 5HK8A 3V1MA 1LPSA 5AI6A 4BBZA 1XZLA 2OAEA 2HRQA 5JASA 5LZ7A 1ODSA 2PSDA 1ZI8A 3HSSA 1TCCA 1F8UA 3BF8A 4EBBA 4X85A 4DNFA 2FX5A 1QFMA 3LIIA 5CT9A 4PQEA 1YCDA 5LZ5A 4B7ZA 5AKHA 1QJ4A 1UOQA 4BVJA 3ILSA 2OGZA 2BUBA 2ORYA 2JEYA 4X90A 5K3FA 4RGYA 4DIUA 2PUJA 1H2ZA 1HBJA 1K63A 3E1GA 4EA6A 5CXUA 1GPKA 1DINA 4DMCA 4G9GA 4QLAA 4HZGA 1YAHA 1P0PA 4XIIA 2WG2A 3T4UA 4GEGA 2C7BA 3PICA 2BAGA 2PU7A 4AMYA 4JH0A 1K6EA 5BWCA 1QGED 1ODCA 2B9VA 2QT9A 2QS9A 4UBLA 2ZSHA 3HYSA 1MU0A 5AI4A 2YH2A 4LHEA 1A8UA 4J0HA 1E66A 2PPLA 4PSCA 5AM3A 2QUAA 2CEKA 1QTIA 2WKWA 2W6CX 2CKMA 1CIJA 4UHEA 4Y2UA 4QWWA 5ALTA 2XT0A 5CRIA 2WIGA 2O7VA 2C5FA 1XZEA 3V1LA 1VA4A 3WK6A 4GWLA 2C58A 5EHQA 4UHFA 1A7UA 1E3QA 4UPDA 5EHXA 4KACA 3CCCA 3KWFA 3G9XA 4L0CA 1RYYA 1W6RA 4J0CA 4TPKA 4C4XA 5EIEA 4B80A 1JKMA 1Q0ZA 1WPXA 3KSRA 2XQGA 2G63A 1XZCA 3WWOA 2O2HA 2HL6A 2ECFA 3DJYA 2XUPA 5AK5A 2GZRA 1MJ5A 1DTEA 3ZLTA 4H7DA 4HAIA 1LGYA 4Q82A 3I2FA 1GKLA 5ALPA 1QIHA 2B61A 4U2GA 1NU8A 3HC7A 1MX5A 1VOTA 1EB9A 2IITA 4MYSA 1AURA 1NU6A 3R3XA 3QITA 3BF7A 3ESDA 2QRUA 4CI9A 2PSEA 4CG3A 2RHTA 1CLEA 1UKAA 4C6HA 5T4BA 3PFBA 1HPLA 2CUTA 1XZGA 1UK9A 1DWQA 3H2IA 5JADA 4DGQA 3WIBA 4Q3LA 1N5MA 2PBLA 2VQ6A 1UWCA 2BJHA 2XMZA 3H17A 3VKFA 3AUKA 4M0MA 4LYDA 3WK7A 4X97A 3WL5A 5CH3A 1SFRA 4AXBA 5D6OA 2BGNA 3FYUC 5HF6A 4BB0A 5EHNA 3O0DA 3AILA 5IVDA 5DYYA 1ACJA 5EHZA 1ZJ4A 5AO9A 1BROA 4EY5A 2QOEA 4HXGA 3R0VA 4Y7DA 1CUAA 1JMKC 1R50A 4MYDA 5JARA 3S2ZA 1ACLA 1CVLA 1DQZA 1EK1A 5FXMA 3VVMA 4JYPA 1QIKA 4CG1A 2R11A 5AM2A 4B81A 3C8HA 3STVA 2Z8XA 3VDXA 4IO0A 3I1YA 3EF3A 1W4LA 1EVEA 4KAAA 1XZJA 3IUNA 1XQYA 3O95A 4BCCA 2AJ8A 3A6ZA 3AIMA 3G7NA 3DYIA 3H2KA 5YASA 5F4ZA 2WLSA 3WJ1A 4B6GA 5DYTA 2DHEA 1F6WA 1QO7A 2JGFA 2VJCA 4YPVA 2V96A 3BDIA 4E14A 4G4IA 2QTBA 5ALQA 4J0DA 1N5RA 4E11A 5AIBA 1XLVA 1Q0RA 4OU5A 3H0CA 4Y2QA 5CURA 1W76A 1YASA 1AKNA 1UK6A 2QXTA 2DFPA 2O2IA 4FFWA 1GQSA 1GZ7A 1R88A 2DQZA 2HA3A 2XQFA 1QIDA 4FDMA 1UOOA 3ESBA 4H7FA 2VT7A 4TGLA 2K2QB 4UBOA 1J1IA 4Z49A 3D2CA 4IHAA 3WZMA 4C89A 4DTCA 5SYMA 3IIIA 3CXUA 1CV2A 3K2IA 2WJ3A 3STXA 3WA7A 4WFJA 1AQLA 4YASA 3V1NA 4P08A 1D07A 3IA2A 2XMCA 3IBTA 3U1TA 3FYUB 4CFSA 4HS9A 1Q84A 1TIBA 3FLEA 3GA7A 5I7UA 2OCGA 1GT6A 1UT6A 5D3ZA 1Y7HA 1HQDA 5FDFA 1C7JA 1LLFA 3CCBA 3PUHA 3JWEA 4QDUA 1CUXA 2W22A 2AJCA 5CXXA 1E5TA 5JANA 3G02A 1R3DA 3W06A 2OGTA 3O4IA 4MWSA 3SX4A 1CFJA 4IH9A 3DEAA 2J3QA 3OM8A 1XZDA 5HCUA 2D0DA 4IQ4A 4C88A 4E46A 1ZJ5A 3MUNA 4H7JA 2C4HA 4OB8A 3RLIA 5CW2A 5CT8A 2UZ0A 3GELA 3WKDA 1DU4A 4B0PA 2PVSA 2HA2A 1Y37A 2PU5A 4Y2RA 1BEZA 1XRQA 4W1PA 5LKAA 3G0GA 3PF9A 5AIAA 5A6VA 1PFQA 3WL7A 3ZLUA 3RK4A 3W9BA 4CIAA 1SCQA 3ESCA 1B41A 2GZSA 4GLBA 3BJRA 4G8DA 2JGJA 1KEZA 4DM7A 3O4JA 3QMWA 5C8ZA 1O6FA 2QR5A 4AN0A 4L72A 1PJAA 2JBWA 5FKJA 1SOMA 1QIEA 3D2AA 2HA7A 2WUFA 1BN6A 2WTNA 4UBMA 4PV7A 1AC5A 2BGRA 5SYNA 1VLQA 1ORWA 2WIJA 2DR0A 2B4KA 2ZJ6A 4AB1A 4GBGA 1ISPA 4BRZA 3BE8A 5LIPA 3VJMA 3HLKA 1DT5A 4NVRA 2CZQA 2HA0A 5HKBA 2QJRA 5ALFA 3F67A 3H2GA 4WY5A 3C6YA 1E89A 4B85A 2GBFA 4ZWNA 2H7YA 5FPPA 3TJMA 2WIKA 2XLBA 4B83A 2V9ZA 4M0EA 2BUCA 1X70A 1XRLA 3EBLA 3KD2A 1EH5A 3DCNA 1XRNA 4UBJA 1UXOA 3VJKA 4BCBA 1TCAA 3DDUA 1LNSA 2DQYA 3WYDA 5LZ8A 4WDQA 5C81A 2EDAA 1CUZA 2OQVA 2HA5A 2QM0A 1K5PA 5AKZA 3SC2A 3MUOA 3NGMA 2JGKA 4OUKX 2WHQA 3CN9A 1BCRA 1DWOA 4AQDA 2YASA 3A70A 5ALNA 4HVTA 3ANSA 1FFCA 4I4CA 3WKAA 3G0CA 2XUOA 2X8BA 4EB0A 2XUKA 3STUA 3UMJA 2DHCA 3KDAA 2AJDA 3ZI7A 5ALMA 1CRLA 3M83A 4QA9A 5LYYA 3DNMA 1GPLA 3A2LA 3MGAA 4OSEA 1JJFA 5D3KA 3DD5A 5DTIA 1FSSA 4K6GA 1HKHA 1XZKA 1CQWA 4HXEB 4Y2JA 4KEAA 2X5XA 4BE9A 3H1BA 5IVHA 1OCEA 3QH4A 2WTMA 3I2GA 1BN7A 3ICWA 4FNGA 5AH0A 5HF9A 2WHRA 1PV1A 3K6KA 2WUEA 3DQZA 1LBTA 5LLSA 3IVMA 5JD6A 4PNZA 1I6WA 3H2HA 1QE3A 3C5VA 4FLEA 1EDDA 5AI8A 5EIHA 5HFAA 3QMVA 4Y2PA 4MQMA 4CIBA 2OAGA 3L1JA 4CCWA 4Y2YA 1BCSA 3FSGD 2IX9A 1N8SA 5D7BA 1LPMA 4Y2TA 3E0XA 5K3BA 1AGYA 2XUAA 3AIOA 4YX9A 3HI4A 4INZA 4LKOA 5FOQA 4FBMA 5IVKA 3WI7A 1QLWA 4QZVA 4U2FA 5KBYA 4ZGBA 5JYCA 4JUIA 1WHTA 5AI9A 4LXGA 1CUBA 3D0KA 3IULA 5ALHA 4KE8A 1ZGBA 5ALYA 5AKLA 3FBWA 3R3YA 4MEBA 4DMKA 3Q0TA 5LKRA 5CMLA 5AOBA 4H7HA 1MTZA 4OD0A 5A2GA 5HQ3A 3WL8A 4QNNA 4OPMA 1W52X 1IZ7A 5AKXA 3SK0A 1L7RA 4NS4A 4ZI5A 5A62A 4RPCA 3VJLA 3AJAA 3O4GA 1DQYA 5AM0A 2XMSA 4Y2VA 5JD5A 1G42A 1WB6A 2CBGA 4AZ0A 3WK8A 1WM1A 5KWIA 4Q3KA 5AKEA 5DLPA 3CN7A 3WKEA 3OTQA 4X3CA 4U2BA 3G9UA 2HDWA 4BRSA 1VJ5A 5AHXA 3G9ZA 2RIPA 5JAHA 3MVEA 4KR0A 1UOPA 2QUBA 2Y6VA 4ROTA 5EIAA 2JGMA 4ARAA 4A23A 3NOXA 2G4LA 2I03A 4FBLA 4KRXA 4AN1A 4ZV7A 4HRYA 4H35A 4J03A 2WHPB 1BS9A 1THTA 5AICA 4Q05A 1Y7IA 1UK8A 1EDBA 2WIDA 4O08A 4QDTA 4BC0A 2WFZA 5ALXA 2VAXA 3E4DA 4PSUA 2VJBA 5HFNA 4RE5A 4OCZA 3C6XA 1QZ3A 3EQ9A 4B84A 4BZZA 4B0OA 5FRDA 1MO2A 3I6MA 1E8DA 3FSGA 4L9AA 4H7IA 3M3DA 2VAVA 4X71A 4M0FA 4X6YA 3G0BA 3KXPA 1J06A 3O9VA 1GPNA 1FFBA 5K3CA 4BTVA 4KJXA 4W1SA 3X3HA 3OPMA 3QZUA 3PUIA 1SCIA 4KRYA 1X2EA 3R40A 4UHHA 3WWDA 2H7XA 1EB8A 5DNVA 5C7YA 4CG2A 1DWPA 1Z68A 2HHAA 3HJUA 1SC9A 3WK9A 5T4EA 2XMGA 5ALKA 2JF0A 2RAUA 1UK7A 2QZPA 1E8NA 3AFIA 1CPYA 5A7GA 3FOBA 1TRHA 1A88A 2G5TA 1C4XA 1WB5A 2VJDA 4QE3A 2WJ6A 2B20A 3S8YA 5A7FA 1HLGA 5HF8A 4F60A 3FVTA 1ZD2P 4BP9A 3OOSA 3WL6A 5ALWA 4WFIA 4P93A 3C6ZA 1EI9A 4DLNA 5EFZA 4UBIA 5CT4A 3LCRA 4UHBA 2PSFA 3QMMA 3WIOA 1CUJA 3FWHA 1MAHA 4ARBA 1AX9A 1H2YA 4JNCA 1UKBA 1FJ2A 2H1IA 2WILA 3K9BA 5JAOA 5IVIA 2Z3WA 3WKBA 1TCBA 3B12A 4N8DA 4QEKA 3WMRA 2JGIA 4UBKA 2J4CA 2XUHA 2WG1A 5DJ5A 3O9MA 3ED1A 2DSNA 1H23A 5AP9A 3R3VA 1BRTA 5AOCA 3OURA 5CH5A 1YS2X 1H2XA 4C87A 2GBCA 5FUMA 4RNCA 1XROA 4XVCA 1UFOA 3QVMA 3KWJA 5HK9A 2ACKA 2JEZA 5KWJA 1YA8A 2EEPA 1LBSA 1ZIXA 5EGNA 4X6XA 1P0MA 3O4HA 4GI1A 4N8SA 3G0IA 4KAJA 4GHWA 1E8MA 4OYLA 1G66A 3FAKA 5BV7A 5FP0A 4Y2XA 4FHZA 3IB3A 4B9EA 3N2ZB 3U0VA 2XUDA 5ALUA 1GKKA 1XZBA 1BU8A 5EI5A 4W1RA 1CUIA 2OLEA 5AM5A 5BWBA 1W1IA 3H04A 1IMJA 2O2GA 2ACEA 4MJ3A 3HABA 1EINA 1THGA 4WY8A 1BEEA 1XRMA 2BCEA 4H18A 1MN6A 2HU5A 5IKXA 1EVQA 1QTRA 2QVBA 3BDVA 1CUWA 4B9AA 4H7KA 3OC0A 4K5QA 4ZV9A 1U4NA 4G5XA 1J07A 2QJWA 5HQ3B 4CCYA 2VSQA 3D7RA 5CT5A 2J4FA 5IH7A 1L7AA 3VISA 4UBNA 3KOOA 2C0QA 1GQRA 1EA5A 1JJBA 2XI4A 5T4FA 1A8SA 3D59A 3L1HA 1XLWA 3DKKA 4DNPA 3DLTA 1G4HA 2Y2UA 1VXOA 2XUQA 2C0PA 4UUQA 4GECA 1EHYA 2ZJ7A 4BCDA 5JZ9A 4N8EA 1IUPA 1UZAA 4Q34A 2X76A 4HTAA 4PSDA 2WU4A 2ZYHA 2RHWA 1L7QA 1YS1X 1BE0A 3ESAA 5JALA 4C01A 3HXKA 5KREA 2JIDA 3PE6A 1CUYA 3AIKA 4Q3OA 5E2IA 2WU3A 1U8EA 3H2JA 3C6BA 4X00A 4BC1A 1K8QA 1R9NA 1G5FA 4H7EA 4P92A 4UFOA 2YYSA 4MXDA 1XQVA 4K2AA 1R4ZA 3GROA 3P2MA 3TRDA 1JU4A 4BP8A 3HEAA 3BIXA 4UHDA 5JAUA 3I28A 4FOLA 4EZIA 1XZFA 4I19A 3HRHA 2RGUA 2AXEA 5DTJA 4FLMA 3HZOA 2OQIA 3DOHA 4QLOA 4ZXFA 1P0IA 3D4LA 2FJ0A 2HFJA 3JYHA 5AK6A 5HKAA 5C8XA 3RKSA 3G9TA 5JATA 2WQZA 4V2IA 3WWCA 2XE4A 2WFLA 4FTWA 3ICVA 2EDCA 2OG1A 1FFEA 3DL7A 4A16A 4F21A 5AKJA 4FMPA 2XMQA 2GYUA 2I3ZA 1VE6A 5HZGA 3GZJA 4LXHA 4X95A 4BAUA 4X91A 1CUUA 1MNAA 3C8DA 3ZWQA 3ANTA 1U2EA 2J3DA 2XQIA 3AZPA 2HFKA 3OG9A 4UFPA 1LPNA 1J2EA 2PM8A 3C5WP 3IUQA 4BE4A 2I3DA 3NUZA 1CUGA 3EIOA
chains in the Genus database with same CATH superfamily
3YASA 3O21A 2W2NA 3AJEA 4GL4A 2YDYA 3KQMA 5DX0A 4AMVA 1WNFA 2X6RA 4CFZA 4G85A 4W9RA 2IV3A 4FNAA 3FHTA 3E7FA 1C7RA 2JARA 2HWYA 3ANXA 3I9NA 2ZIGA 1XBTA 2D54A 2OBYA 4I55B 4CV2A 1GGVA 1EVLA 2QTFA 3CUEF 4QDXA 3SE0A 4ICIA 2I7CA 1WSAA 4PG5A 3IAEA 1EDEA 5AVUA 1ZA2A 1NPDA 4I1YA 4ETIA 4ZVOA 3F98A 5JH7B 3FYSA 4EL0A 4MV8A 4Z7NB 3A1CA 2NO6A 4XUGB 1FRQA 4GM1A 5EKUA 1WW3A 4ESOA 3LDUA 3TPZA 1SCAA 2A30A 2O3QA 1HA3A 1PU2A 4RU1A 3H8WA 3W05A 1EVIA 3MWGA 5B12A 3HHEA 2PIAA 2Y0BA 4K28A 1U65A 3KE8A 3GUYA 1JVSA 4EY7A 3UBMA 4B87A 2XMDA 4TMYA 5DW3A 4O2BB 1QHHA 4PYNA 2VDOB 5K6RA 2YWHA 2H0QA 1ZM2A 2R00A 3R4VA 1PLLA 2NTYC 1MABB 3WFJA 2JVKA 1X19A 4FFVA 3C3KA 1HMYA 3DYVA 2K5UA 3R5HA 5BSGA 4K8OA 5FLKA 4BFVA 1DIOB 4HWTA 2GYYA 4MVJD 4ENPA 3PF8A 4G4SP 5K0TA 1TF5A 3EXG2 4IDAA 3UXMA 2V6FA 3VAZA 4WKOA 2CSUA 3PUJA 4GYYA 3UT6A 5B3JC 1DRKA 1ZA1A 1V71A 3GT3A 3RT1A 3K9LA 2Y3IA 1CEXA 4OGFA 2BMFA 2FPMA 3IAS1 2GRAA 3NT2A 3KZXA 5B6IA 4LYJA 1ZUWA 1MVLA 2P9YA 3ZLVA 1L3IA 4GOKA 1XRPA 4WI1A 2GZDA 1SIOA 4AJIA 2HGSA 4UUAA 3WDSA 2KMLA 4BYMA 2DP4E 3ETHA 4MR9A 5D87A 1L3BA 1YRBA 2QQEA 2Y68A 3FLBA 4WCVA 2ZE5A 3I2IA 3RRBA 2E18A 3FOWA 4YRLA 3G5LA 4MUMA 1Q44A 4BAGA 3TD9A 3EPJA 3S1AA 4Q0MA 1QPZA 4X8OA 1RDFA 3RBAA 3ONWA 1H85A 1ORRA 4NAHA 5G0VA 3T4PA 4FCTA 5CFRA 5HUHA 3LP5A 4PYQA 3T3MB 3HFGA 4QO8A 4J0IA 1QVWA 1TK3A 4HRXA 3NJRA 4PRLA 1Q1NA 3LYLA 5PNTA 1ZI9A 2EP7A 4CDGA 1T4GA 2GHRA 2OC4A 2WYIA 3NH6A 2C95A 5J3JA 1PTKA 2H5LA 1C81A 2GQ0A 4AKIA 4XM2A 2J9ZB 1TW3A 1A95A 3V8VA 1XCLA 4C2AA 3CY6A 4EX7A 1Z4LA 4HAYA 4KQ6A 4CMIB 1UBGA 3AI7A 4EABA 1RACA 1QUEA 2C4MA 2X9GA 4OSPA 4FEYA 4OUDB 1AQ6A 1RTTA 2IYAA 4FZ5A 4H0CA 3SJCA 2HJRA 4BQFA 5GADl 1S2LA 1R16A 2HSZA 2OK8A 3IPAA 3FB1A 1DG1G 5IHPA 1VKZA 1G291 1YZYA 3BDAA 3L7DA 3PD0A 3BSSA 2VRCA 2I2DA 4PC7A 7ADHA 3WWEA 1IY0A 4ZVLA 5E1MA 4X41A 1FPQA 1YVPA 2W2KB 2XKBA 3ROMA 3WV4A 2GHTA 4KYUA 1YCFA 1EXDA 1US8B 4IXWA 3KQQA 1YJBA 5DW0A 1NG1A 3LQYA 3OFJA 4MPDA 1BMQA 4UU8A 5ALZA 2NU8B 3R9XA 1GSOA 1QORA 4KXYA 3BA1A 4WESB 2WUDA 1O5IA 1TU3A 4QU5A 5CGZA 1WV1A 3LQ4A 4WMLA 4ZMRA 3GH1A 2VWPA 1KYXA 3JATB 4R2MA 4ABYA 4DSAA 2HIHA 4RELA 3GOQA 1AY0A 2O7RA 2O8CA 1MT3A 2Z6VA 1EFCA 1EPUA 3FCEA 5J5AA 3FYTA 1E79D 2A1UB 4JEIA 2Y1EA 4P9NA 5DZSA 5EIBD 2IHNA 1JR6A 1BW9B 3IR6A 3U7GA 1XKTA 3P20A 3T5PA 5IHXA 2HRBA 4PYJA 1O6CA 1DHRA 4PNPA 1M8JA 1P91A 4RA9B 1VXRA 2ZW9A 3EXAA 4PQYA 2ZDHA 4CTJA 4NY1A 3OX4A 1DMRA 4LSGA 3R44A 5L53A 1HDOA 3NHUA 2A57A 3MCAA 3PE4A 4JNKA 1I01A 4E2ZA 5JSZB 3THWA 4A26A 4DLBA 2BCJQ 2ZIXB 1PSZA 3GFBA 3P9SA 3R6WA 5TQ0A 3T3NA 7YASA 1FL9A 1YTUA 3IVXA 1NMYA 4HDKB 3W3ZB 2B8EA 2ZJ8A 4ZCIA 5JBQA 4DMKA 3MHTA 3GJ6A 5CTAA 1JS1X 1Q0SA 3JD3A 3T9BA 4A7PA 5K6AC 3Q98A 4X6LA 3ZWVA 1U4OA 3I6BA 3IAHA 3HGTA 4IOLA 4JWTA 4E6EA 4UTRA 2Q28A 3MWLA 1MRSA 1XUOA 3CE6A 2XYGA 1L5YA 4AF6A 2O8BA 2PYIA 4L3WA 3RUDA 3HU1A 1EJ2A 2WAMA 3FVRA 3ZQJA 4N5NA 4KRGA 2WV9A 1T3GA 4GX1A 2M1ZA 3S4YA 5A4AA 4JVNA 3WLAA 4GOJA 2IIPA 3PUWA 5TARA 3FYUA 2EKDA 1FW6A 4AKGA 121PA 2FDXA 2AEMA 1WQ1R 3ZQUA 3BFJA 2DWQA 3RRXA 2XMBA 3JWGA 3BCUA 4X94A 4XD7A 2WSYB 3USZA 5B4VA 5E9WA 1QGYA 4M38A 3I83A 1Q0QA 1FS4A 2FW8A 2VNKA 3K72B 3TCKA 3GGSA 3X1DA 1PR3A 1T9GR 4C08A 5IC4A 1JW9B 3DMDA 1SBCA 2GJ9A 3KR2A 4TWZA 5L95A 1AUOA 1PJQA 1K4YA 4PW0A 4DQXA 2P7IA 3UGJA 2OILA 3KKMA 3NT4A 3SR3A 2FTKE 3OSUA 1S3GA 1LPPA 3WA6A 5KOIA 2OO3A 2C07A 2IDZA 1SU4A 1OQAA 2IEZA 5DM1A 3A26A 4LDRA 1GYPA 4OHPA 5IUKC 1ZICA 3O2QB 2O8DB 2D62A 4J6EA 4S1WA 1G1AA 4TS3A 2OTCA 4OB7A 1F14A 4MWTA 2H5EA 3SZLA 1U3TA 2J9GA 5TT0A 3R5SA 2VTVA 1F12A 4D9JA 3UG7A 3P2IA 1Y3CE 3OOJA 3DTTA 1AXGA 3IUYA 2O0JA 1ZD5A 2GWHA 1WD5A 4MYTA 4MCHA 5FJJA 1D2CA 2NO1A 1EFRD 4J7XA 3VR2D 5HJ7A 1OXMA 3M6VA 4G9EA 1E1QD 1OZAA 3OLXA 1W94A 4GOLD 4K9PA 1U3VA 4IRXA 3PFCA 4L73A 3R75A 3W4IA 3T7DA 1PLKA 3FAZA 5A04A 1AK1A 5CDFE 4GYJA 2ENUA 4RETA 2R2AA 3WFIA 5LP6A 4ZVMA 3PI6A 1QV7A 4XCQA 3NM5A 10MHA 2I99A 4MVJA 1G2IA 3MIZA 5EZQA 3PGLA 2PSHA 1ILWA 1PNOA 4BZWA 5HGJA 3BQ9A 1JR3D 1SUBA 4RD1A 3TX6A 5E38A 1I2AA 1VZ2A 3L4EA 4YNBA 1ULUA 3STHA 3BHIA 5L3SB 4MQFB 3NIDB 4LFAB 1HYHA 1OX6A 1UP7A 4J90A 4G4GA 1N5OX 4R3UC 2GCIA 1EBUA 1EK2A 2PRJA 3I09A 4YONB 1R4AA 2B21A 4NJOA 6PFKA 3S2YA 2B5WA 3T7CA 2R8YA 1Y8RB 2ZLBA 4Q01A 4CUKA 1YZHA 1NW9B 4XKJA 4ZARA 3DMGA 4C3UA 2D7JA 2WM9B 3EULA 4NBKA 1TPYA 3FLAA 1MEJA 2EFCB 4YP1A 4OM8A 4WBXC 1MENA 3V1YA 1E1DA 1PT8A 2XWSA 3LGSA 4CCAA 4YJ2F 2C4UA 1M2VA 4Y0VA 4LRTB 4QYTA 5L4LA 4DLWA 5A7HA 3S40A 2ZBEA 4FR0A 2AYXA 4HZUB 1CUFA 2R00C 3EMVA 2NW6A 4M1MA 3EC1A 1Y9AA 3JYLA 1DRVA 4IICA 5KHAA 4LPSA 5DBHX 1ML3A 4BO9A 4Q21A 1AZWA 3VHQA 3LLSA 3PXBA 4OFZA 2F43B 2OWDA 1DCFA 2QBYA 2QT1A 4GL2A 2JI4A 3M1LA 4H3HB 3EDMA 5EWLB 1CLUA 3UPTA 4ZCLA 1P4HA 2X1VA 4PXYA 1RIFA 3PQEA 1D2RA 3IEIA 5K6TA 1TC1A 3EA5A 1TUEA 1TYCA 1Z0FA 4L76A 3UCXA 3WK5A 4G4JA 4DUYB 2ZYVX 5MHTA 3NOQA 4H4CA 4B1FA 2WWWA 2Y6UA 3FE2A 3OETA 2DAPA 2O8CB 1UZNA 4JB8A 4R7ZA 5B3LA 4BX8A 1P1JA 3OQOA 1E3LA 2AL7A 1Q77A 1Y9JA 1M8FA 3KJNA 4E5SA 2R8BA 4RA6A 3KJHA 5AI0A 1KMHB 1RVDA 3DE2X 1KAOA 4RSHA 4QGGA 1VG0B 5AK0A 3LFTA 3TSYA 4NTZA 3MRSA 3T06B 4JI8B 2AQIA 3NBYC 4S0XA 1V6SA 1FQJA 3F49S 4EJ6A 4Z9XA 4JA0A 1P7WA 1A76A 5IJWA 3DR5A 1Z7GA 2HCFA 2HI0A 4X8MA 2DPGA 4XLTA 4Z4HA 4OOEA 1LSJA 1U7TA 3ZVMA 4BKOA 3DC2A 3O83A 1SEPA 3ZHQA 1BWSA 1QIJA 4TWBA 1GFIA 1KRWA 5E3IA 2M6KA 3R0QA 4BU0A 1WETA 1JBQA 5NLLA 5KTMA 4H60A 2MIIA 3TNLA 1XV5A 2B25A 3CONA 1PEYA 4FE4A 1TQ6A 1WUTA 4D45A 4CCYB 1MX9A 1FS5A 2JVIA 3M1YA 4ZAYA 3F71A 3FWYA 5DWDA 4UOEA 1SJ9A 3FETA 1ODTC 3GJ7A 3GLIA 2ROQA 2FFAA 5BYJA 3UKOA 2FZEA 3BAFA 1PUIA 1RZ3A 5FPTA 3JQ8B 4CM6A 2IVFA 2VRWA 2UZ4A 1Q7GA 4CIDA 2B2XA 2WKPA 1AXEA 1KF0A 1YAJA 1QU3A 1NUQA 4FFRA 4A6PA 3PXCX 4NEQA 1N1MA 3VQTA 1JFSA 2P6OA 3KVNA 1VQ1A 4BB6A 2EX0A 4HDCA 5TVKA 2JKVA 2V4MA 2WFLB 4WZ6A 3D8HA 3ABQB 3HACA 1CJBA 1KOJA 1WF3A 2CD9A 2OORC 3LYAA 4E0BA 3KXLA 4KYTA 4N3GA 3D8SA 1N2ZA 4P2BA 4EY8A 2RD2A 2VF5X 3JWIA 1IL0A 1PWZA 2R8EA 2FJPA 4IJ5A 4UHCA 3H18A 4UVEA 4G89A 2AGVA 1CW2B 1KMIY 3I1IA 4LIPD 4ZAZA 5GIPE 3JAMA 2VYVD 5HM8A 1RZUA 4AI6A 4BQQA 1FMLA 3BIFA 4IJKA 3DT8A 1LB1B 1RI2A 1T2NA 3EVNA 3DKVA 1G8MA 3PEEA 1KMQA 4IDGA 3GLIE 1Y48E 2QN1A 2DPMA 3VH2A 2W2QA 1ST3A 3DE4X 3PXAA 2AFHB 3F96A 2GJ8A 1F6BA 4Q4JB 3E9NA 4QHTA 4Z1OA 4DBVO 1AA9A 1U0LA 1MJNA 3BREA 3PDCA 4AP6A 1NRIA 3CUWA 4ZVTA 1MBZA 2Y71A 5DFAA 2P9HA 1KO7A 3WQQA 1XDBA 4MQLA 3S28A 5EYPB 4A5OA 4M1SA 2EXXA 5LCXA 2VLIA 2VJLA 5BYKA 3AP1A 4LV6A 1FNNA 1T35A 1R5OA 2P8SA 2ZYGA 4UTZA 4OJMX 1P9WA 1RYNA 5JAZA 1WU7A 1B26A 4YR7A 3M9LA 2H31A 4G1VA 4P3PA 3MMZA 3ZHTA 1ZGJA 3LQ2A 1UC9A 1Y5RA 4GC5A 4GKKB 2ZYRA 3ZIAD 3ZEIA 1QHHB 3K92A 3FLMA 3ELDA 3E1SA 2B35A 2A9PA 4FFSA 3AZQA 3GW8A 4EHKA 2H85A 2CMFA 1TD9A 2OUKA 4JLVA 4LZPA 4V38A 4B4UA 2GXQA 3EZXA 3U0BA 1O6GA 2E48A 4C3OB 1JIJA 3CKMA 1R4MA 2QB5A 5CHYA 3R3UA 5GONF 2YFHA 5DNDA 1G4UR 2GK7A 3S5JA 4AMZA 4M1WA 1IIRA 1RWQA 4O4LB 5JH7A 1GSIA 1JEYA 2XE7A 1XZMA 1RKUA 3B6ZA 3H1AA 4HWPA 2VA9A 3VMFA 2PCLA 1Q3TA 2PS1A 1N9ZA 1QP8A 3UC5A 3KJZA 4YP9A 5HSGA 4R2WA 5GOZA 5BUZA 2QTHA 2LCQA 1QOZA 4M46A 4RJ2A 3N6XA 4ZDIA 4I1PA 3IQEA 4AO8A 3WVNA 1MIHA 2O1WA 3OEEA 2XQVA 1DKQA 2NVWA 2OZLA 5J40A 5I5GA 4QRIA 1ONOA 4ENQA 3BFXA 1NVFA 4YRKA 2H9YA 4FFDA 3OSZA 5FBLB 4A0GA 3B20A 4P83A 4ENSA 5D51S 1W2HA 2IELA 1VHWA 1KA9H 4P3OA 1UMDB 1XQWA 2I65A 2IA5A 2SCUB 3EIEA 2YZ7A 3LT4A 4MPPA 2XNJA 2G88A 2CVHA 1TAHA 4BGUA 2XCOA 4IX1A 4PPQA 1VE7A 3I5UA 4I50F 3T35A 1D09A 4YCSA 3WQRA 3MAJA 5JUWA 3T5TA 2Y0PA 3LS2A 4EGFA 4O0LA 1KI8A 4IM7A 1GCAA 3NT5A 2WJAA 4JYMA 3NBUA 2OQRA 1AQUA 2YICA 2I71A 1FSFA 4KBGA 3USES 3F9CA 1X0VA 3TW8A 3WYNA 4DSOA 5LD2B 4TSFA 4EMSA 5BSVA 2A0UA 5C1IA 2QN9A 3GAMA 1T1EA 2WNIA 1A8HA 1WZNA 2WSIA 2GRJA 1WHSA 1KIMA 1A7JA 1RXUA 2CJFA 2BH9A 2XDWA 2B78A 2PVCA 3JASB 4M9UA 2PT6A 1I1HA 4L0MA 4QG3A 1DX6A 4Y7CA 2Y27A 1QVZA 1YBVA 3EQ8A 2OPHA 3NHPA 4KTVE 4CNQA 4CIXA 1R64A 4PFJA 3VO1A 3CPHA 4U0KA 2GPAA 1KI7A 3G8BA 3RAJA 3PGKA 621PA 1SXGA 4P31A 2HADA 4E12A 2WLTA 4MV4A 3LBYA 3BICA 1CK4A 1T36B 4L5JA 4RVCA 2DWUA 2A94A 2OHIA 3M82A 3HPRA 4J0GA 2PZ8A 4RH0A 4R3NA 4RO0A 3RRMA 4NYMR 1JT2A 5LQCA 3PV0A 5SICE 3QLVA 2PN1A 2DH6A 2HLDD 1RW4A 1JR2A 3BE4A 3T9FA 2ZCJA 3P0EA 4ARZB 4AKSA 1UJCA 4AF7A 1YB7A 1VMDA 2IGTA 3GRVA 2GPWA 1AKRA 3O4RA 4GXRA 3TM5A 5JY1A 3LC2O 4CFYA 1E1YA 4M8LA 5I7AA 5J2TB 3K9WA 4O02B 3G89A 2GVDC 2PK3A 3FOFC 3FUWA 3SEAA 1D1PA 3ZDZB 1YVEI 4MS3A 4XD2A 4C7JA 4GP6A 4FFMA 4LV5B 2FG6C 2ID9A 3L79A 3T94A 3VZCA 2FZCA 2O7SA 3QF7A 2DKNA 4JLDA 1Z07A 4L27A 1BKYA 4KV9A 5HHTA 4US0R 1PBNA 5K0EA 4NQZA 3HVRA 3K6JA 4US2R 2FUG1 2Z57A 1U5CA 3PU6A 1C8LA 1E4OA 5K5EA 4MMXB 1NXQA 3KZMA 3W2TA 4YLYA 2JBAB 4IDEA 4Y30A 2B8TA 1JLLA 4WCFC 4OL9A 4BNMA 2IH4A 4GO1A 4XGRA 3RUHA 3W8RA 3U09A 5ITZA 3LUJA 1J2YA 4BKQA 2QROA 3FXAA 1OFGA 1K2VN 1FEZA 3UAYA 2YWRA 2P5UA 4W9MC 1MNQA 2HSGA 5KU1A 2H17A 3UPUA 4UKDA 3I6YA 1QIGA 5DRTA 4NZ9A 3S5UA 3C3MA 2XLCA 4JZKA 2ADOA 2G70A 4W1QA 1R27A 2OBLA 2QPTA 1G21A 5CAEB 1Z74A 2A7XA 3TQRA 5ADVA 5L3SA 4D92A 2I6GA 4DARA 1MO4A 1F2DA 2RONA 3UWMA 2GDZA 2Z5VA 2OZKA 3AUUA 4IDHA 1W2GA 3SE7A 2Z5FA 3MB8A 5HTKA 1XSEA 4AXXA 1GPDG 3D4BA 3V1MA 2JGNA 3IT1A 4G0YA 4YCCA 3ZH9B 4CQMB 5TJ9A 3TLBA 2E0IA 5K3OA 2J3JA 2NP7A 1JB1A 1HO3A 1X1CA 3PC7A 4GEKA 1X15A 2EERA 2QE7A 5KOYA 1UBKS 2BFBB 1V47A 3OOEA 4HQ6A 1NBOA 5LZ7A 4LGVA 3ENWA 2ZRJA 2YS6A 2PSDA 1TU4A 4PWZA 2G1KA 4TKUA 4RFSA 4C7OA 2P67A 2Z98A 2JAPA 1WEHA 2RHGB 1NLFA 3P2KA 3QU4A 4KN9S 3HU2A 3BCHA 3RQIA 1HE2A 4MO9A 2O2CA 1ZVMA 4A8JC 5AW1A 5CGQB 5BRJA 1NOIA 3LIIA 4K81B 5CT9A 1FMTA 5DXJA 3JAWB 3HJCA 5DK6A 5LZ5A 3VDRA 2X0FA 4PHCA 2O5VA 4BVJA 3TPCA 4OI2A 3L8DA 2X1MA 4XDGA 1YHZA 4NJMB 2H0AA 1VE3A 3GFTA 3HKBA 4ILEA 3ZXXA 4AJ1A 2NVBA 4C6SA 5KIAA 2BUBA 1M67A 4P53A 3INTA 4V0NA 3NDBB 5JLJA 1DEXA 1GTMA 2JEYA 4EF4A 4IRMA 4LF5B 5H9VA 4HEA1 5BR4A 4NC9A 1M66A 2PUJA 3LGXA 5AUNB 3D6TB 3E4CA 1NT4A 4GP9A 3PKZA 1P7ZA 2AN1A 2QORA 2OM2A 4X8LA 1SRRA 4BGVA 3TLCA 2W8ZA 3LUAA 1U11A 1JECA 2QSYA 4QXAA 3T3DA 3IEXA 4RLSA 3NH9A 4DMCA 4QLAA 4OQNA 3UIEA 2GETA 2OO5A 4N5MA 1JP7A 4XIIA 1O5OA 3RS9A 1HTTA 4FD2A 2OBMA 1EGVB 1N8TA 3G82C 3L46A 3PICA 4F3NA 3IQGX 4Z0PA 5CFPA 2PU7A 1SCDA 1I14A 2NUAB 3EX7C 4JH0A 1ZK4A 2QVZX 5GM2A 3MK31 3QE0A 1XP8A 2W6NA 2NSLA 4Y1RB 5EEGA 1Z12A 2X0DA 1BXRB 2ZRLA 4DWVA 2GN4A 3C3XA 2QT9A 4RM3A 4PC6A 2O5EA 2ZSHA 2FSPA 1MU0A 3O8RA 3D0QA 4UUPA 1XTTA 4O4JF 5LNK6 1G20B 1FUUA 1MFPA 4LHEA 5JJCA 2ZUFA 4DIEA 2YOHA 1TUIA 3DAFA 4RV9A 5K45A 4IV5A 1BCSB 2PPLA 4CLXA 2RCNA 1M2OA 4CM4B 2FSHA 2WKWA 4KQMA 8MHTA 1A9YA 1DDIA 2CKMA 3ZGOA 3C3BA 3WLPA 4D0GA 1GPAA 4Y2UA 1OE0A 4LZWA 4O3MA 4DCMA 1HNNA 1YVUA 3BHNA 3Q2OA 3RF6A 4B45A 4M9XA 3KM0A 3JPWA 3C7KA 3COVA 3LWNA 4MWBA 5IM4A 3IFSA 4XWAA 3GBVA 3IAFA 3BVPA 4R98A 4JN6B 1XZEA 1UM9B 1SXJC 3V1LA 3OJCA 3KQUA 5B64A 1SAYA 1AKEA 5IW8A 3WIUA 4QYMA 2C58A 1GVHA 5JFGA 2MYUA 4MMZB 5CX1B 2WJGA 4YWHA 4CIWA 4UHFA 1FVXA 4CQNA 3AX6A 3EFHA 3DVAA 3QBDA 3ICEA 1E94E 4RPIA 3GCXA 3ECAA 4UPDA 4XOUA 2HMSA 5F73A 2W6QA 1UF9A 4KACA 4XWWA 1AJEA 4MIOA 3G9XA 3U44A 1P5HA 4L0CA 4PIMA 2JK0A 3LSYA 1J42A 2YFQA 4BKMA 2BEVB 3D6UA 1JKXA 4DLYA 1O08A 1TYAE 5EUQB 1JKMA 2OAQ1 3PCTA 3JVVA 2QVYX 4L6AA 3U4GA 5IJ9A 3KSRA 4PYKA 2IOHA 2DKFA 1XMVA 1UJ4A 1Y9ZA 3OEYA 5CLIA 5TJHA 4IMIB 1RSZA 1XYVA 4LJAA 3B7GA 3FPFA 5DCLA 2G7MC 1YIDA 2DFLA 2O2HA 4ZAVA 1RXSA 4GOMD 4HNUA 4E5UA 3T5BA 1DARA 4D9BA 3G0HA 3B3JA 5AW2A 4XR4A 4QFCA 4ZEOA 2VAMA 3SYLA 5CYGA 4YAJA 4WZBA 5J47A 4F12A 2DR3A 4LC0A 4LXUA 4JT9A 1PQ4A 1SCJA 3N39C 4FEAA 4LI0A 1WCIA 2PT9A 1VSVA 4FC7A 3WYCA 1MJ5A 1DTEA 2H65A 3KG2A 4U1RA 1UDRA 5CFZA 3EVZA 1L2TA 3F6EX 2ETVA 4RPHA 3RROA 4YREA 1GKLA 4IPTA 3NEJA 1QIHA 1YB4A 1CF2O 3PNVA 4GQIA 2YNMD 4A73A 4BMDA 4RTQA 2XF8A 4FGZA 3FPKA 1EE2A 2WE7A 3PKIA 4NAVA 3FUVA 3BPSA 2IXGA 2CFOA 1RRGA 2GDJA 3P9PA 4ISBA 5F21A 3VAAA 4U63A 1MX5A 1VOTA 3IBYA 3MBKA 4X63A 1I24A 2BZ0A 2FZLA 1WV0A 2G83A 3RVKA 4DV6B 5JWOA 3K7EA 5E1OA 5I7HA 1VLLA 4ZO4A 3BGOS 1GZHB 1K97A 3BF7A 2FN9A 4LZLA 1KKLA 3JQRA 4RS3A 3I64A 4QNMA 2QRUA 4JQOA 3RF7A 4CI9A 4EPTA 1KXZA 2Q4TA 4DV3B 1A0OA 2PBFA 1VRWA 1M0TA 3DT9A 3OY2A 4RCYA 3R8CA 3ZE2B 1DBIA 1E7QA 2P3LA 1CLEA 4N0MA 3VSBA 3VZQA 1GXSB 3LCCA 1F2TA 3BWDD 1QH8A 4FS3A 2CMDA 5F2OA 5REQA 1W88B 3COZA 2PMCA 3OMXA 5T4BA 1EWKA 4B6SA 4DMGA 2I1VB 5HCIA 2H59A 4Y9UA 4B3RB 2Q5FA 2DKOA 4JI6B 3V5NA 2UXCB 1N0HA 1I4TD 2AG5A 3W5JA 5FX2A 1KI6B 3JQ7B 5JADA 4INAA 3UK7A 3C4VA 1L5KA 1EJBA 1EEHA 1ZMOA 4KO2S 2Q6TA 1NTOA 3D3WB 3G2IA 1I7LA 3MS7A 5EVJA 3TVDA 2G9ZA 2VQ6A 4CRWB 1XXHB 3MTDA 4RD4A 3EPLA 1OC2A 1UWCA 1R5NA 2NV0A 3N5KA 3KZKA 5IXYA 1KQPA 1N2CA 3FVQA 3KLNA 3PT9A 4MLZA 3AUKA 4JBNA 3W3AA 4BRWA 4F5WA 1ZSVA 2ACWA 4H17A 3KYCA 3TIIA 3WK7A 3ZBUA 1JZTA 3G79A 4BX3A 2K87A 1E99A 1PZXA 3OOHA 3SEQA 4D3SA 4HUQA 4LHXA 4DCGA 2E5FA 2IYVA 3DXZA 4GE0A 2A0YA 4MW1A 4QXRA 5D6OA 1ZOSA 3FYUC 5TY0A 5HF6A 1JV2B 1KZ4A 1QNLA 3S1LA 2V7VA 2QNRA 5DRYA 4FFBB 1O58A 1RNLA 2BGGA 1XZNA 3L6BA 2BL4A 3INGA 5KVAA 4RVFA 4A8HA 2BCGY 1RHKA 2QLTA 3C41J 3MC1A 4QREA 3IBSA 4RLHA 5IVDA 5DYYA 5HUQA 2GASA 2YXLA 4B3MB 5EHZA 1ZJ4A 2OL4A 1IZYA 3WGQA 4DZZA 4M86A 1JXQA 3CWQA 4D96A 4M0PA 4B6EA 5AQ1A 2TRSB 3GLKA 2X40A 4WK0B 1Z4MA 3S2UA 5IKEA 3GAAA 1D4FA 1H3NA 1IONA 5F1PA 4NABA 2A92A 2R84A 4Y7DA 5IMBA 2IDMA 1O0BA 2HWKA 1JMKC 3DDWA 4BVGA 3BMXA 5JRDS 1GZ3A 2REXB 5K8VA 3RIMA 1LDGA 2RGDA 3TD6A 3I9OA 4MW5A 4EDFA 1CVLA 5ED0A 2WWIA 3Q0IA 2NVOA 1YU6A 4CZ2A 2P4EA 3E9CA 3TM4A 4BMNA 5JNUA 4EM6A 2BHNA 3PNOA 5THXA 2EF0A 3U37A 5DCUA 3N1UA 3PX2A 2J87A 1DI0A 2GPSA 4HGPA 4JYPA 2G9VA 2R11A 5HR5A 1RXIA 4K9NA 3BN3A 4XD7D 3JYQA 4HQ0A 5LA6B 3RPEA 3C8HA 1AUXA 1NSTA 3OZGA 3STVA 1DO2A 4IO0A 2R6GA 4IUDS 3X2FA 2VBFA 1PJBA 2BE9A 1ZQ1A 3EF3A 3LX6A 3GUVA 5G1PA 3KQYA 1S8FA 4INPA 4XCXA 2I34A 2UUPA 4N82A 2EFDB 2I4IA 3IUNA 2PLAA 2OOKA 3DPIA 4BCCA 1DJOA 4KH1A 4F4CA 4TSRA 3OZSA 2JFOA 6Q21A 5EUBA 4FK8A 5KSZA 1K3FA 5CCBA 3BGSA 1OY1A 3CB2A 2X4LA 1N9GA 3AIMA 3DWFA 4HQKA 1VCNA 1Y6FA 4LGYA 4P98A 2PMDA 2J32A 2ZGVA 3FJOA 1H6CA 4G0OA 1PUXA 3B3GA 3K3PA 2ZRMA 3M2TA 1R15A 3SFTA 1TEZA 2LP4Y 1M2VB 4FSDA 2IX3A 5C7LO 4YUVA 3PIDA 4AJJA 2NZUG 1PG5A 4EYSA 4IDBA 5DGTA 2FMFA 1Z06A 2DHEA 1C80A 2B2CA 1OYYA 1OVGA 5DX1A 4IBOA 1G59A 2JFBA 2AMFA 4R2KA 4C7BA 4IGKA 5FYDA 3FWKA 3I2YX 4N49A 1GA6A 4WCFB 3VV2A 4EMUA 5BVHA 3BSFA 2UXBB 1E9CA 3FNRA 2F3UA 2OFFA 2X8JB 5A3SA 3KUUA 4HUTA 2O8VA 3U80A 3WV5A 2IV2X 3F7TA 5GV8A 4L4SA 1O6ZA 4EECA 2VH5R 4Z4FA 2JI9A 3M49A 2C4TA 4MJ7A 4KPYA 4JVOA 1PL7A 3DTNA 4RY0A 4KLAA 4GUAA 1KE1A 3DNFA 4KWEA 4UVHA 2E4AA 5KKCA 3BWMA 1E2BA 5CURA 2QSUA 4GZMA 3KZOA 1CR4A 3N28A 1QAQA 2CYCA 4EKNB 2NO9A 2JRLA 2C92A 3PQ5A 3V4RA 3QHPA 4ALMA 3JQAB 1P9RA 2I5PO 4C9BA 4CLDA 2OV4A 4FE7A 4W4TA 3N7TA 4DCVA 5GGYA 1YRQA 4A0QA 3ITNA 3LAWA 3RHTA 2AC7A 3N2IA 4DLUA 1LFAA 2R1VA 4G0MA 4YN3A 4JI2B 1KR5A 1PN3A 1YI1A 2O2IA 1FBNA 2H4JA 1MMFB 3EIQA 3VV3A 2VDJA 7REQB 2R5FA 2HA3A 1EFHA 2R8PA 2WJYA 2X8AA 1EBFA 3TZBA 1GLNA 2OPBA 3QF4B 1G5RA 4FDMA 3D64A 2W71A 2DCUA 4H3KB 4LVOA 4TLAA 4E5DA 2DE0X 3EB9A 2VT3A 4LYAA 2BBWA 2VT7A 1K7XB 3GDFA 4YB8A 5LD2C 4KREA 2JJYA 1OLSA 4TGLA 3TUZC 2JLWA 3QHQA 1V3VA 1XFAA 1RM5A 3U3MA 1MJFA 4C3ZA 2NXJA 1FNBA 4YECA 2GTPA 3WFZA 3K6SA 2RI0A 3SVTA 4R01A 1VSUA 3CEAA 5FTMA 5SYMA 4EKYA 2QMOA 1C7FA 2MSNA 4DF3A 4EJ0A 4K0RA 4M9QA 2WJ3A 5BXYA 3EPHA 1Y8QA 1JDBC 5EWJB 4LY6A 5TQ2B 3STXA 1LDMA 3SX0A 4DYDA 3WA7A 2JJ2A 2W4QA 3TTUA 3N5CA 4WFJA 3UAOA 5I4BA 5KMGB 1GNRA 2P9QA 3E6AA 3ECSA 3IHTA 1U0BB 2VDRB 1GU0A 2DPLA 2BD0A 3SQXA 1MIOA 2YUIA 1S2IA 1XTBA 1KTIA 1K5HA 1NPYA 1I2ZA 3HBFA 2X0RA 4JD5A 3W0LB 3I9V6 2WA1A 1OKKA 3FYUB 1G3RA 1E18A 2FUCA 4PAQA 2JI8A 1IG3A 3CRNA 1J0AA 1RABA 4XR9A 3A3OA 1TLTA 1M6EX 4FZ3A 1P9NA 4NLLA 3Q8MA 1TEHA 3KPUA 4NYJQ 3QMPA 4RV4A 3D3JA 2OK7A 3BXXA 1J20A 4G0QA 1AO3A 1GT6A 1UT6A 2IJGX 2ZE6A 4KNVA 4UUOA 4X24A 4Z8YA 4YMTA 5JS1A 4DR5B 3OZWA 2XKAA 3G7SA 3HADA 3MTJA 2XDYA 3UW3A 4UZFA 2QMZA 1ZX1A 3ADCA 3KKLA 3AY0A 4RX1A 1T6XA 4XGIA 2OP1A 4LY9A 4CEJB 2H7VA 1T25A 3K5PA 1QYWA 2IPAB 4INOA 3CTPA 1OBCA 4IZHA 5G53C 3VR3D 3W90A 3K4HA 3FI9A 4LDQA 2H2FA 2B5OA 3H9UA 4QUBA 3UMRA 1KJIA 4LN1A 3FHCB 4PEVA 4WVLA 2GZ1A 5KJEA 3EHDA 1ZH0A 2Q3JA 2XGJA 2C42A 1H0RA 1TVKB 3PQ3A 3B7PA 3PVZA 3H83A 2IVZA 3K0FB 4BQOA 4ZRNA 1SUSA 3DMPA 2AJCA 2X2OA 1Y1SA 1N6NA 1B8NA 4EI7A 2KJQA 1QQTA 7MDHA 2E85A 3VDQA 4BGEA 2FP3A 4EIWA 3MRTA 1BW9A 4J0EA 1KQFA 1NJGA 3L8ZA 3W06A 2X2FA 4E1VA 2IPOA 2JCSA 3IHLA 4NBWA 4GI7A 2UUAB 1WO8A 2X77A 1CWUA 4WBNB 3KHSA 4QVKA 3P5SA 4JENA 3T95A 2P27A 2FPUA 1SUCA 3KZCA 3LQKA 4LC9A 1XDWA 5KTNA 3KU4A 3O4IA 4MAFA 1DKUA 1CYDA 3SX4A 3GRRA 3ORYA 2I4RA 1S2DA 2J3QA 3IPLA 3OM8A 2O2ZA 5CEFA 2ZETA 4JQYA 3CZPA 3CX3A 3AEQB 1UPTA 4C88A 3FMGA 4YRPA 2ZRDA 1ZH2A 2YV3A 5GAJA 5BMVA 1ZJ5A 3PS9A 2INGX 4H7JA 1KS9A 3V7NA 4QUAA 1AK9A 5T41A 3TEFA 2NSHA 1HUQA 2UZ0A 3BXZA 3HSYA 3OM1A 3W4JA 1UWVA 3HDQA 4R2IA 5H59A 2J3IA 3H0EA 4B0PA 3VU3A 4F6RA 5H9WA 4HGYA 5BW4A 1PV4A 2EGHA 4RJLA 3ZE6A 5KTKA 2HA2A 4ESHA 1PP4A 1LF0A 1Z17A 3GIWA 4IXNA 3A6PC 5FNVF 1J8MF 3JD1A 3TE7A 1QHEA 1BWPA 5FOVA 1UMKA 4JYBA 4RVNA 2BZSA 3HXOA 4BNGA 2SNIE 3LVQE 4AT1A 2RG1A 4ZVSA 5K0NA 1RBZA 2EG5A 1BEZA 4MS1A 5TLSA 4PC1A 2ZBRA 2Q5CA 4GPBA 4UPEA 3TLEA 2ZB3A 1BFDA 2X3UA 3PF9A 4FC6A 4ETMA 5A9RA 5CB0A 4RH1A 2WI8A 1Z63A 1NQTA 2PKCA 3DHEA 1UMBB 3L8FA 4HTFB 2OHGA 3WL7A 2YW2A 3K9CA 5F76A 4N65A 1W9HA 2NAFA 5C8YF 5E1BA 4GPD1 1GEEA 3DLBA 2O05A 4R1MA 1YU9A 2FHPA 2X0IA 1F48A 2ZUVA 4Q9LA 2OBBA 3A28A 1P3Y1 2LR0A 1DXYA 1L4EA 2VHCA 3BKWA 1QJCA 3CIOA 3PITA 4GLBA 3TLXA 5ESDA 4G8DA 3BRSA 4QBGB 4JC4A 2JGJA 2FPIB 4G4SO 5DT9A 4KOEC 4TUYF 3KJXA 2VDMB 4DM7A 1W5FA 1IQ0A 1Z9BA 1FX0A 3DO8A 4N6GA 1O6FA 2JFGA 1SPXA 3QWIA 4AN0A 1KAQA 4L75A 2YXDA 1SXJB 3EOAI 3KT0A 5FUWA 3VPCA 5AW4A 1ZH4A 3HVJA 3QVGA 2JBWA 4P4UA 2HTFA 2XGSA 2YKGA 1V43A 2HRCA 3D2AA 1Y3HA 4KNYA 1RXEA 2FWPA 4PNHA 1BN6A 3HKCB 3KYBA 5KNDD 2C88A 4IOJA 3VU9A 4PE5B 1A9OA 4PV7A 3E48A 4EI9A 5LIRA 3SZUA 1UCFA 2BGRA 2J8ZA 4BVFA 1FF9A 2XBLA 3MOIA 1G8PA 1HRKA 1W8DA 5B1IA 3AHFA 4Q4CA 5JPIA 2ECQA 3VH4A 3ELBA 3T1TA 4YJFB 1DQSA 1UPFA 1JYFA 2BBTA 4F45A 4ZDJA 4RULA 2R8ZA 1OB2A 1EZZA 1X1QA 3NYRA 4BRZA 1V11B 3H86A 2BGKA 1BDIA 1X1SA 2WSBA 3CSSA 2ISSD 2LGJA 3K9QO 2CDBA 3H9QA 1J7KA 3I6IA 1J22A 1DC4A 4A6EA 2A88A 3GC6A 3RYHB 4LK2A 1QHIA 3IHWA 5HIJA 2X4IA 3C7DB 4RABA 5L3VA 3SP1A 1E5XA 4RK6A 3SCZA 1JDUA 3TI9A 4AMBA 4ZCPA 4JYCA 4PAMA 4COKA 4J0QA 2O2YA 2JHGA 1GAXA 5BQ5A 4U9UA 5HKBA 3B6MA 3KAKA 4TN1A 4WEQA 4B75A 4X1YA 1M5TA 2NV6A 2P1DA 1QVRA 3L8CA 3ADOA 5LVAA 5A6SA 4MX8A 3MAAC 3IKVA 4RDHA 3NJ8A 2P62A 4IOMA 3BJEA 5AXAA 1L0BA 4M99A 4RIFA 1UBEA 3JQCA 3UJ8A 5A6SB 2DHRA 2XZTA 4BFCA 2GBFA 1FLVA 1I1NA 1QDUA 3QOXA 4IG9A 4XOIA 3RVQA 3SIXA 5EC8A 4QIHA 3UHAA 5JXGA 1SVMA 1B23P 1M5RA 1P5RA 3PNQA 1N2SA 2V9ZA 2V1XA 3A6JA 1KL7A 3IEMA 2RGWA 4JFRA 4V39A 1T8RA 3H75A 5MN4A 1B4DA 5EMHA 1XRLA 1MA3A 1C30A 2OVBA 5DTRA 4FEEA 2XECA 3AEQA 3IP8A 4BNYA 1UQRA 4QD3A 4AJ4A 1E9RA 1EVKA 1YOBA 1OX4B 1C4OA 1SK8A 3F9RA 4BMOB 2PMKA 4DT1A 1YQUA 5KPDA 1A2OA 4ZVKA 2J33A 3NDIA 2NZXA 3C39A 3OUZA 1TCAA 2YXNA 3AFNA 3D4IA 3DDUA 4ZQEA 5FUYA 1LNSA 2DQYA 1V8OA 1JKIA 3AEXA 3W8DA 4BFSA 4BX0A 3PPVA 2IH2A 3AFGA 3O26A 1ACMA 4PBSA 3RI3A 5DBEX 4WDQA 1E2DA 1LRKA 2POQX 1PT7A 4MVJE 3H7AA 1SU6A 1E2JA 3DWEX 2HA5A 3EIUA 4EVIA 1YL6A 4R1PA 4BMSA 1MZPA 3WNVA 1O87A 3BIOA 1AE1A 2QM0A 3RIEA 5JSHA 2AOTB 3K0FA 3WDMA 5JQGB 3ZOKA 4R2XA 3MUEA 1ISIA 1SD2A 2VDKB 4ZQFA 2V58A 1CJSA 4XE5A 3TBHA 4JJFA 3VPDA 1BTOA 2CK3A 4V2UA 2HF7A 3HJHA 3RC1A 1DKOA 1E1RA 2JIRA 3K1JA 2XOKD 2ZYDA 3KKPA 1RHJA 4MTCA 1XP5A 1L4MA 2Q1XA 1UQTA 2YHSA 3G5MA 3FVWA 3QKRB 3L8MA 1V2HE 2QTVB 3L6OO 2VH2A 4TMZA 3IIKA 3QI2A 1QRSA 1DWOA 2F4VB 1GNTA 1RYEA 4C5BA 2VR1A 3QNMA 5KTSA 3DOUA 5ALNA 2Z58A 3ZWCA 3MJVA 1XD9A 4FR2A 4IV8A 1GAWA 1EE9A 1KR2A 4PCUA 3SR4A 2WUWE 1FFCA 1NUTA 4R8RA 3Q7IA 2QD5A 2ZDQA 3C3YA 1H1LB 3M6MD 1G21E 3KX2A 5CEJA 4WE3A 4UUBA 2C2GA 2XUKA 5KVVA 2W2OA 3E9DA 1S6YA 3OKPA 4LUCA 4MVJG 4O4HF 4YIHA 1GYQA 1TDJA 4S05A 1Z62A 4NNOA 1KFCB 3ZI7A 2PGJA 3C0KA 3QG5A 4JCOA 1SHKA 3KCNA 4DCUA 5ICSA 4FMDB 3DL0A 2OO5C 2HF9A 3M83A 2ZOSA 3NV9A 3A04A 3KKEA 4N0QA 3FJYA 4X60A 1AGXA 3W3AD 1RJ9A 1C1XB 1UWKA 1V3TA 2CT8A 4RHYA 1SXHA 1EM6A 8GPBA 1E5QA 2DUUA 2VP5A 2OV3A 3OTOB 3BQNB 1BD4A 2ORVA 2WTBA 4ACAA 4AECA 3A31A 3UV3A 1U2TA 2PMWB 4ER6A 1U7OA 2V7XA 3M4ZA 5A5GA 1UC8A 2NVUA 1XZKA 3NIBA 3CVYA 2PL9A 1T8YA 2QQ0A 1AD2A 3IDQA 1J23A 5CEEA 2WZDA 1GG8A 2JCYA 3NFYA 4OHXA 2X5XA 4BE9A 2D0OB 2FEOA 2O3UA 3JZIA 3LL7A 1DKNA 1SC4A 2WE8A 1CQIB 1V1JA 3AFOA 1ZXLA 2BN4A 3O2SB 1N6OA 2PVPA 5FO1A 3S70A 4BLOA 4WBNA 3KZ1E 5J5VA 4EFDA 5LQKA 4F3KA 4B32A 3ONFA 3GAFA 4MGYR 3QX9A 4PTYA 2XH8A 3LCVB 1GTSA 1XTKA 2FRDA 1PV1A 1HETA 4JSYA 4LEIA 2G9RA 1ZOPA 2EU8A 3DQZA 3KBBA 1E3WA 5LLSA 5K51A 4IIHA 2DBZA 1J6UA 4M7OA 2CWWA 3CEPB 1TVKA 4ZT3A 3TIXB 5DSZA 3WIBA 2MSCB 3IUSA 3H11A 4MO2A 5JD6A 4PNZA 1I6WA 3H2HA 1QE3A 3TN7A 1N7GA 1G5HA 2RGNA 3IO3A 1ZQ9A 2Z5LA 1RYZA 1OFIA 3EG5A 3BRCA 4KFRA 1P31A 2VCHA 4LZJA 4MQMA 2A9KA 3WRXA 4QPNA 3BWCA 3TINA 1T8WA 3FSGD 2OXIA 4ZJUA 4IFBA 5D7BA 4U7TB 3BK1A 3R23A 3E0XA 3EAQA 1BVUA 5K3BA 4XFJA 4D26A 2A9OA 1N6PA 1II8A 1OPRA 4EHHA 1E3SA 1NNI1 3AIOA 3HI4A 4ND8A 2Y1CA 5B1HA 1I0IA 3LKVA 4INZA 3Q6IA 4LKOA 1T1JA 1Z5OA 5K6AA 3C8ZA 1VIAA 4FBMA 1P2GA 1RZRD 2C8LA 3DOEA 4Q48A 3OF3A 3FWPA 1W85B 3IEUA 2UYQA 5JMTA 1GUYA 1ZCZA 5E3HA 2BM8A 4I36A 4C0LA 3OQMA 2IIBA 3L5KA 3F2VA 3NBQA 4RZHA 3SG0A 4BMCA 4KI7A 4CJXA 4RZQA 5DK4A 3DPUA 4DPLA 4KPUA 3S8MA 1V1MB 4F3RA 5KQPA 3B3FA 2QW0X 2P0AA 4EK9A 3T7SA 1ZGBA 2PTHA 5ALYA 1W30A 4IXMA 4IYJA 4TQUS 3SIPA 1EU1A 3GNSA 4O2BF 1A9ZA 2PH1A 4OQQA 1E2FA 1LK7A 2GFQA 2GLXA 3FKJA 1ZRNA 3LW7A 3Q0TA 5CMLA 3IPXA 5AOBA 5LKRA 2C3PA 1ZDMA 3HGMA 3NONA 8LDHA 1KBOA 2CJXA 3WO1A 4DREA 1MTZA 3DVQX 1CQPA 2CFRA 2LD4A 2PWBA 2BHLA 2XNHA 3T8YA 5D1NA 4CKWB 3TQTA 5HQ3A 1FSPA 3VOTA 3IYLW 3LUDA 4UMVA 1OLSB 1ISFA 3WL8A 3S29A 1RADA 2VPXA 3TIGA 3C6QA 4JJAA 4OPMA 3EQ6A 2YFYA 3VUFA 5D86A 1NVEA 1B3RA 2Z1MA 5BUQA 3O74A 2IXTA 3WR5A 4KH0A 1N6HA 2XSZA 1ABEA 1P0CA 2ZJ2A 3PHJA 4J3NA 2FCAA 4AM8A 1BKDR 4C76A 4DJ5X 5L6MB 3ZU6A 4J2HA 3SZGA 1DG3A 2PA0A 3L06A 4NS4A 1M75A 3H8VA 4RPCA 1NQXA 3KT3A 4KFTA 5JSUA 3O4GA 5AM0A 1NJ2A 4Y2VA 3AWDA 1CZNA 2Q3FA 1PE0A 2P2LA 2ZRGA 2NTVA 2QAIA 4R1NA 1E6WA 4AZ0A 3WK8A 1M5UA 5FORA 1WM1A 5BN5A 3RABA 4XQ9A 3ACCA 4A2QA 2ODNA 1LNQA 4MHOA 4JQCA 5DLPA 1UXIA 5EJ5A 4PLVA 4C0AC 3BE5A 3CMMA 3DH0A 2JZOA 2P2GA 3RS8A 3RK0A 3G9UA 3OEHD 3UQYS 4S1TA 4EG1A 1X8JA 1HNXB 1EFRA 2AQ8A 2Q4OA 2ON6A 4BRSA 4KN5A 2OHXA 2HV9A 1VJ5A 1NLMA 5AHXA 4HEA6 2QRQA 3KUDA 4PLZA 5E6SB 1Q95A 2R6CA 4R1UA 2RIPA 3CLKA 4YCMA 2AYYA 5JAHA 1JXAA 1MHPA 1VLHA 1FTNA 1X7YB 1LEHA 3CFYA 1JG2A 1EUCB 2O57A 3IV6A 4ZT2A 1G2QA 1GLGA 2Y6VA 2QN8A 1XMSA 1A27A 3KAJA 1ZHFA 3AVVA 4TT3D 4BB9A 4XUDA 4QASA 1IXZA 2OBFA 1NMZA 4XJSA 2RJOA 1XXHA 4PQGA 5I51A 2A3RA 2NUBA 4MHSA 4CHTA 1V37A 4GPAA 1RIIA 4AL4A 4LMPA 5JNVA 2DR2A 1DDOA 1P75A 4GUDA 1TLLA 3ENKA 2EWMA 2OV1A 3CVOA 3NOXA 4QXPA 4YMWA 2I03A 3QPBA 3LBIA 1P62B 1VIYA 4N3CA 2JI6A 5GM1A 2CNNA 4MQ4A 1VLJA 2GF2A 3SMVA 1CS0B 1O96B 3LM8A 3FDFA 4E2YA 5BUSA 1FJHA 2WHPB 4BV2A 4CE6A 3L0CA 4COOA 1U6KA 4O2AB 4P6VF 1JNYA 4DV2B 4OI0A 1EIZA 1SIBE 5FUQA 5IU6A 1UK8A 2AWNA 1UPBA 3O1JC 5HQJA 3VOSA 2OCXA 1A69A 1CZKA 3I4FA 4MR8B 1EDBA 1NX6A 2IPLA 1X8KA 1UBRS 2C57A 3JARA 5JG7A 2OYCA 1AHNA 4KXFB 3GU3A 3THRA 5F2EA 1ZHOA 4FHCA 1TO2E 1DC8A 3I0ZA 4ND4A 3K8OE 4F93B 5DP1A 3BRWA 2DU8A 3U9TA 4UARA 4LZAA 4ED9A 4Q9HA 1E4EA 3ZNQA 4ZHQA 5KO2A 4R1LA 1NWHA 5TXGA 4PSUA 1RZRA 2CSXA 2QYOA 3FWNA 4RE5A 4RZSA 4BNDB 1T4CA 1U7WA 2B7BA 2YV2A 3C6XA 3RIHA 5EQDA 4E4TA 5COQA 4DLZA 5FRDA 4O5OA 3CC8A 3OPYA 4AC9A 4C05A 1MO2A 4K9MA 1ZW6A 2C1XA 5FIUA 1SEVA 4ZHQB 5IFLA 1KZ6A 4RY8A 3LD9A 3I6MA 1VKOA 1E8DA 4QPDA 3WWYA 4DM3A 4ZQIA 1X6VA 1FJGB 2Z3VA 2GLUA 3AMVA 3EDYA 3RWOA 3U31A 2XDQB 3L9WA 3HSKA 3L4BA 4QU8A 3VR4A 5CCDA 5G0TA 4BJ5A 3KB8A 3OOWA 3I76A 1XPOA 3SKVA 4HL6A 1Y5IA 4B4WA 2UUCB 2C54A 1G3UA 1N7IA 4LF8B 2FY8A 4Q3NA 4RMJA 1USUA 3MMXA 4BTVA 3IXQA 4MULA 3PEVA 4PZZA 1V2GA 3MSXA 3X3HA 2FR1A 4XYLA 1V4BA 3QZUA 3QRWA 1WWKA 4I1IA 3IHKA 4HDAA 3HM9A 1EQUA 2O4CA 2XE8A 3TRFA 1EFTA 1VHDA 5BT9A 2XDAA 2A7QA 2PV7A 5IJ9B 5IABA 2H7XA 5ARCA 3REFA 1PHPA 4CKBB 1K88A 3KYCB 4S2UA 3K8QA 4CF5A 4TL7A 3COYA 1E3EA 1E92A 1PFVA 4RWZA 1E1CB 4MRRA 2F1KA 3DO5A 3OQJA 1CJKC 2JAQA 4CMKA 3IIMA 1G8GA 3W9YA 4NULA 1U63A 4FFOA 3O1LA 4PLHA 2QV0A 5D2CA 2VTEA 1QCYA 3LXMA 2F6RA 5ARDA 3GDHA 3KNZA 4FYXA 5CVCA 3DDSA 3L0IB 1SVLA 4FGLA 1Y8ZA 3NBZC 1E8NA 2JIMA 3NJ4A 2YBDA 2CF5A 3S55A 1I8TA 3FHLA 3AFIA 1CPYA 1PSDA 1W88A 3D8TA 4Q9NA 3PL1A 1TRHA 3I1JA 4QQRA 2VBCA 4LJSA 2WF7A 1A88A 4WKGA 3DULA 4NMLA 1XMPA 1X1BA 4KQIA 1NAIA 4G97A 5T64A 4MAAA 5DHPA 4ZICA 2BLLA 2SKDA 3QV1A 4QE3A 3QYFA 5EKTA 1TUBB 3PXXA 4UTPA 1HLGA 2XZDA 3DA8A 4IVQA 5F7ZA 3PTLA 2QVXX 3FZEA 5LUBA 4AIRA 1ZD2P 4OMDA 3MGGA 5TSDA 4ZTZB 4E7PA 1P3JA 5JAMA 2X0NA 4BEJA 4QG7A 3TZLA 2FPOA 2B1IA 3RC7A 4EHAA 1G20A 3C6ZA 3NUQA 5HZHA 1J9GA 1EI9A 2I9KA 2E37A 4DLNA 3BMNA 4LTDA 1OH7A 4UBIA 2YHIA 4QL3A 4RANA 2AVNA 3RSSA 1YZVA 4N3AA 3ZV3A 5ECDA 1SIUA 4ZEXA 5LJIA 1XCMA 5HJ5A 3PSHA 4JR0A 3ZWMA 2V45A 2RSLA 3JD4A 3N58A 5ED4A 4ZMSA 3QY0A 2ODTX 5K1ZA 1WCIB 1C3OB 5ESWA 2G67A 2ODBA 2N47A 3C3PA 4UZSA 3I73A 3WGNA 3GB9A 1V5EA 2HSWA 4UNPA 1L8OA 1RLUA 1OZFA 2HB6A 3ET5A 3P9RA 1B8VA 5C18A 4PC3A 4DRZA 4FONA 3G5UA 4RC9A 3A37A 4KUGA 3KCQA 1EFVB 2WILA 3LUGA 5JAOA 3RT9A 1JVBA 4OQFA 2ECPA 1J70A 1GTZA 1T9CA 4YRBA 1U1CA 4LK3A 5A4IS 2WT9A 3F8WA 1NJ8A 2I7XA 4KPUB 1TCBA 2TSYB 4F7WA 1H1TA 2WZBA 4RHXA 1W49A 2GAOA 2E9SA 3SJBA 2IQIA 5AFSA 4HX9A 3GLHE 3NOOA 1P2TA 2VYFA 4KGVA 4AZWA 4YRAA 1Z47A 1WZUA 2GCOB 1CRQA 1ZEMA 3PXEA 1NM5C 5CYOA 3RASA 4ZZ0A 1Y6QA 2JGIA 2FP4B 4RTSA 2QX6A 2FFBA 4HQLA 4UBKA 1DX9A 3PJRA 1OD6A 1GTVA 1CR1A 1EBBA 2CLOB 3NAQA 5L3QB 3LTNC 2XCIA 4FUTA 2QI9C 3R3VA 5AP9A 3QXXA 3MJHA 3T3HA 1I2CA 1Q0HA 1RWOA 3F78A 3JQGA 3OF5A 4PRYA 4YT5A 1PDVA 3ZI4A 1C3EA 3Q87B 3RUEA 3DKIA 3PC6A 4PLWA 1DLIA 1E6UA 1U7DA 3I5MA 4JLSA 3S2SA 5C32A 5KWVA 4L02A 5GJWC 2RGNC 2J9XB 1NNLA 3QJGA 4AICA 1SVSA 4L15A 4M1OA 3ILVA 3CYFA 1U02A 4E2WA 2FUNB 4BPRA 1V4VA 2QE7D 3C14C 4BO6A 4HLUA 1SG6A 2EW1A 1E3WB 2P9JA 1OZGA 1A72A 2V5VA 3OQHA 3Q40A 3WG9A 5KYYB 4MV9A 4PAWA 4P35A 4Q9IA 2VJMA 3FI0A 4YJKA 1QGZA 3EOBI 1YR6A 3HP1A 2H57A 3PP8A 5CLJA 4X5OA 1SPBS 2H18A 4L8VA 5GVRA 2IU3A 5IUJC 2B7LA 2JEZA 3TTWA 3I39X 2IOFK 4F2HA 2QM7A 2AN4A 4LNAA 3QUAA 2D5IA 3AF2A 1YZGA 2D2VA 3A3NA 2J5QA 4Q00A 1P0MA 2Z56A 1WU8A 2YC2C 4MOWA 4QJ4A 1C0EA 3EK2A 4X6XA 1YDGA 3G2PA 4GI1A 2FQQA 5FFNA 4FZJA 3RB8A 5L3RA 1LS1A 1EK0A 1ZRHA 2VN8A 2PL3A 1E8MA 2G1JA 2CNBA 1N0UA 1RQGA 2VHZA 2Y9PB 3FAKA 4FX5A 1F2UA 4OYLA 1XR3A 2HMTA 4NCJA 1E9AA 4OHFA 1NBMD 2BSXA 4QODA 1Q0UA 4TYWA 5K8CA 3KPJA 1OBFO 2WD7B 3KJIA 4OHRA 4YT2A 3RC8A 3VNVA 3IB3A 2X3FA 1AXRA 4JJZA 2DF8A 4X3OA 4ERXA 2OKCA 4LBWA 4RMGA 5DLYA 3AHGA 1UKZA 3ELWA 2V55B 6AT1A 2RARA 1E63A 3CRW1 3NM6B 4OLBA 4Z4GA 3HN2A 5H16A 2J4DA 1Z4JA 5CNIA 1NATA 3H1PA 4M9RA 3L0OA 1OI4A 3NTXA 3OLVA 1W1IA 4NJMA 2IWRA 3ZKWB 3E82A 2O2GA 5K03A 2ACEA 4DV5B 1BHSA 3P27A 1AHIA 5IVPA 1H1LA 5HDQA 3O2NA 2XW6A 2JFUA 4GR9A 4WXEA 4WY8A 3WB1A 1QE0A 1N57A 1WUIS 1LU9A 3KB1A 5ERGB 2ZAGA 3QU2A 4B6FA 1MN6A 1Z6PA 3E18A 2N46A 3QVVA 3LPDA 4LYYA 1EVQA 4LX8A 4QU0A 5H70A 1TE2A 1XTIA 4TSKA 1E77A 3V4LA 3ZZ0A 4BVBA 4D44A 5I3CA 3BDVA 1IBRA 3RTEA 4H7KA 1X8XA 2UZAA 2ZP1A 3MINA 4OIFA 3OC0A 4K5QA 3OJFA 4Q03A 2CMKA 4NJEB 3MJFA 3DMNA 1B8OA 1DPGA 4FHEA 3K9FC 2JJMA 3DWIA 4G5XA 4NF2A 1FNSA 1SUWA 1PHRA 3PBKA 1KXJA 1UT5A 3CVXA 5CNJA 3PHCA 2CGEA 3I9KA 4YJHA 3W8FA 5LOVA 4A0SA 1AGRA 3H99A 1K3TA 3D7RA 3L7AA 4QRDA 1SVKA 3KOOA 2C0QA 2OGUA 4FDUA 1PNRA 4LJ7A 3H1FA 5K8TA 1YBHA 1XF9A 1ZK2A 2XI4A 3HVIA 1F2UB 4II7A 3D59A 5TPWB 2WY2D 4WBNF 2P11A 1XLWA 1PQYA 4JEHA 3C1TA 3H3XA 3NCTA 4DNPA 3L6UA 5EUCA 3BBPA 1X1DA 4LCBA 1G64A 2Q9CA 1VG8A 2HEGA 1EP1B 2WKRA 3QELB 1ULHA 1MRZA 4E7OA 3DZBA 2BFDA 3EH2A 4OKSA 5EY5B 4GECA 5BR1A 5C2JB 4RCVA 1QAMA 5KYXB 1MAUA 1FMCA 3OU2A 3V1TC 1P4SA 1VI2A 3GEHA 4HFMA 5JZ9A 1BDHA 1QX3A 4QU9A 3GV0A 1OX4A 3F4LA 3R6LA 3KEGA 4R3WA 1LCIA 2R2GA 4HTAA 3ZD9A 1HFEL 3M7IA 4PSDA 1LLUA 2M6RA 3QIAA 4IDPA 1K6IA 4JVLA 4Q1EA 3SSNA 1IG0A 1JHDA 2A35A 2ZYHA 3HBMA 2RHWA 3H87A 4MKXA 1GO2A 4WKPA 5IEBA 2GCGA 1J24A 1GUAA 3IT2A 1WOYA 4UU7A 3CURA 1Q2XA 4CMEC 3FUXA 5HIIA 3K4PA 2FMXA 3RBVA 3CH6A 2DERA 1YS1X 1ZRSA 4MRMA 3ZX4A 4UDNA 4BO4A 1ZITA 2P4HX 3D1VA 5KDDA 3ZNPA 4C01A 1WA5A 1TF7A 1TUBA 3CM0A 3HXKA 3LQRA 2PL1A 4LVCA 1I6MA 1TTTA 3M89A 1KMMA 4GZ3A 1DKRA 4CM8B 4ZYUA 3B9BA 2JASA 1MDFA 1TVMA 4N01A 4JI4B 4ENVA 1D4AA 4MUYA 4BLPA 1Q6YA 4ARZA 2QK4A 5FLEX 2E1RA 4RM2A 4Q3OA 5C0OE 5E2IA 1UPXA 3D8RA 3H2JA 1QQ6A 5I7WA 3WGGA 4UC0A 3C6BA 3SQOA 1AS2A 4TYPA 5K8LA 1BA3A 1XCOA 4BC1A 2HW8A 1NY6A 1G5FA 1R9NA 2H4ZA 2IEYA 2ZSJA 4JHLA 3T7TA 2RGEA 4JP1A 4P92A 1T34A 3R2JA 4MXDA 2BM0A 3MWFA 3FTEA 2PJRA 3BBLA 5DI9A 1R4ZA 2M32A 1NHGA 1ADYA 2ZJOA 3FMFA 3AGPA 3OE5A 3VR6A 1G2PA 2ZUSA 4B3TB 2RB5A 1UFQA 1Z88A 1LTHR 1VMEA 4KDFA 4BP8A 4ZTUB 3MTGA 2XEDA 3F2IA 3L7NA 3H6KA 2GPBA 1OI7A 4DCSA 1V35A 4HGRA 4B2PA 5AIBA 4WN9A 4HVCA 1D7OA 4Q02A 5JAUA 3H8JA 4YJFA 4WLVA 3CVVA 1T2AA 2NQ8A 3NHAA 3RUCA 5EYPA 4EZIA 3V42A 1BIFA 2PD4A 3HRHA 2RGUA 1DAIA 2NLOA 1DAOA 4JB0A 3BEOA 1J9EA 4YPOA 2WZQA 1E5VA 1K8ZB 2IUFA 1RQRA 2V7EA 1OFVA 3AHIA 2OZVA 2FU5C 3HKCA 3OZ7A 5CM8B 1BH2A 3RKUA 2H52A 2FSGA 1KORA 2QEQA 4ZXFA 3PQDA 4YI5A 2KB0A 4BO7A 5GZ3A 1PK8A 4RVGA 2FJ0A 4WIAA 5B1YA 5FNVA 4N5DA 2HFJA 1OYWA 3JYHA 2FSVA 2Z2JA 4H6XA 5HKAA 2GUWA 4GC9A 1L1FA 4RXTA 1LX6A 4C0XA 2QGNA 2B37A 2PDAA 2V9CA 3G9TA 5MGNA 5JATA 1M6HA 2VCEA 4E2FA 4O4IB 2OUIA 1WRBA 3ZWDA 3GRKA 2Q45A 2BSQA 1RAEA 1Y1PA 3N2GA 3OPYB 1E9FA 2XE4A 4MUHA 5I9MA 2BC9A 4LHSA 1QC5A 3DTYA 4FTWA 4JOSA 2ATEA 2HCBA 1KZHA 3BWYA 4XPIB 5JSFA 1UDAA 4NG4A 5MDHA 1FFEA 3HVKA 3NNSA 4ENTA 1T4BA