1UK6A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with propionate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 105
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk6A00
1CUEA 3O4GA 2OG1A 1X2BA 1WPRA 4AMZA 3ICVA 1UKAA 3O0DA 4CG1A 2HA6A 3R3XA 1A8QA 5CXXA 4H7DA 4BCDA 3GBSA 4BTVA 4I19A 4BP8A 4BAGA 4KEAA 3M82A 4ZV7A 3O9VA 5C8VA 1WHSA 2GBGA 3HABA 3HZOA 5AOAA 3WWPA 2DCMA 1X2EA 2RHTA 1U4NA 4JEIA 3STUA 4TVKA 3F97A 1H2WA 1QIGA 3F98A 1VLQA 5ALIA 2X76A 2BFNA 4X3CA 1JMYA 1CVLA 3OPMA 1BE0A 5K3CA 3W2TA 2ES4A 3F67A 1QIIA 2GYVA 3IULA 5AKJA 4X97A 2WFMA 2OGTA 3G0IA 4PV7A 1DQZA 4OCZA 5DTIA 1XFDA 3QMVA 1UKBA 2WIKA 3ANTA 4AQDA 5AOCA 1BEZA 2WU4A 4H0CA 1CUSA 3A70A 3ZWQA 5IVKA 2XQGA 2ZVDA 4L0CA 5LZ4A 2I03A 3OC0A 4NZZA 1HQDA 4X93A 1RP1A 4P92A 2VT6A 4IHAA 5CBKA 1DWOA 3X3HA 3FNBA 4GLBA 2XUIA 4B9EA 5AM0A 2VAVA 1IMJA 3O4IA 5ALHA 3G9UA 4NMWA 1YSCA 1JT2A 3KSRA 3VVMA 5J3JA 2HM7A 3WL6A 4MEBA 2BCEA 2XUPA 4GEGA 2OCGA 4J0DA 5A62A 4J0HA 1LPOA 3WKEA 1H2YA 3BDVA 4ARAA 4CIAA 2WUEA 1QGED 4E11A 2HA5A 2WUFA 4KYVA 2VJAA 1EXWA 4E15A 4M0MA 1IUPA 1GT6A 2C5GA 5AI5A 2OGZA 5SYMA 1ZOIA 3R40A 1JU4A 1E89A 1QIDA 2PUJA 4MYDA 5C8XA 1SFRA 3V1MA 2Y2UA 2WQZA 1YB7A 1W52X 3G9TA 4Q05A 4BATA 2J3QA 5EHZA 5ALYA 5HFNA 5CH5A 4EB0A 4MXDA 4FLMA 5A7HA 4BVJA 1QTIA 4MYSA 4DM7A 1RYYA 2XMBA 3WL7A 3L1JA 1J07A 1QONA 1TIBA 5EIAA 1YAJA 3FBWA 3C5VA 5T4FA 1KU6A 3G02A 4J7AA 4AB1A 3W9UA 2IITA 5EIHA 5JANA 5ALWA 1ORVA 3HLKA 1KEZA 4DGQA 1MN6A 3HXKA 2E3JA 4I4CA 4U2EA 1BRTA 2Q0XA 4G8CA 1EB8A 4LHEA 1DTEA 2QZPA 3C43A 4FWBA 5ISMA 1E66A 1ZI8A 3QITA 2JGLA 3AZOA 3WIOA 4TGLA 1DX6A 4KRXA 3BL8A 2YH2A 5BV7A 6YASA 4CIBA 1A8SA 4QDZA 5HF6A 1TCBA 5FPQA 4QNNA 5DYYA 1LPAB 2BJHA 4C6HA 3FLBA 3I2IA 2VJDA 3O4JA 4C87A 3M83A 4W63A 5ALXA 3BJMA 2WSLA 3KWFA 3LIIA 1L7QA 4Q82A 4A16A 3BE8A 5BWBA 2VATA 4DMCA 4EHBA 4DNPA 4H7IA 1QOZA 5ALRA 1XRLA 3H0CA 1GPNA 1N5RA 2PKYX 4OB8A 1H23A 1U8EA 3RK4A 3WWEA 4LYEA 3GZJA 3E0XA 2D0DA 4G9GA 4BAUA 2O7RA 4G4IA 1PV1A 4BCCA 4UHCA 4H35A 4C4ZA 4KAJA 1CEXA 5HF8A 4AO7A 4G5XA 5AI6A 3JW8A 3HYSA 4B0PA 3I2GA 3WA6A 5LYYA 4X94A 1K6EA 4YK7A 1MX1A 1DWQA 4HRXA 1X70A 2DHEA 3WZMA 3QMWA 5AIAA 1GGVA 4U2GA 1UZAA 4BZWA 5AKGA 4UFPA 1CUIA 4V2IA 2ZJ7A 2Y6VA 4HZGA 3A2LA 3I2JA 5JIBA 4CFSA 3BF7A 4U2FA 5FOQA 1R50A 2FJ0A 5AH0A 1JU3A 3DS8A 2XQJA 4PSDA 3DYVA 2ZSIA 2QMQA 2XMGA 4ZI5A 4J0CA 2XUAA 3A2NA 3W9BA 2PM8A 1E8DA 1QIKA 4IQ4A 2Z3ZA 1AGYA 2CKMA 2C4HA 3G0GA 1CUXA 1YASA 3IURA 5AM3A 5D3KA 4INZA 2HFKA 5H3HA 4MQLA 2HL6A 4Y9SA 4ZXFA 2QS9A 2WFLA 4W1SA 4Q3LA 3QM1A 4BC0A 4KACA 1A8UA 4C01A 3KXPA 1LLFA 1OCEA 1QIFA 1XZKA 1JKMA 2OLEA 3PE6A 1EVEA 3C5WP 2CB9A 4FNGA 4PW0A 5AKLA 3GUUA 4KE7A 1XRRA 2QJRA 2JEZA 4J0JA 2WKWA 3WK8A 2O2GA 1UK6A 1QO7A 4GHWA 2XE4A 4E14A 1BS9A 3IUQA 1YR2A 2XUOA 2B20A 2JGFA 3ZI7A 3FCYA 3GA7A 1EI9A 2R11A 2XT0A 1ORWA 2PX6A 4FLFA 4K6GA 3I2FA 2Z5GA 2JGIA 5CT4A 1CQZA 1PFQA 1XQWA 3DOHA 3ESDA 4QDTA 4G8BA 4WFKA 5DLPA 1XQYA 1E5TA 3DEAA 4EY6A 2WLSA 3WK9A 1DQYA 3PFCA 2ONCA 2PU5A 3QMMA 3R3UA 1JMKC 1MAAA 3BIXA 3CXUA 3CN9A 3G0CA 1Y7HA 2IX9A 3BXPA 3AZPA 2GBIA 3CCCA 5AK4A 1QO9A 1FFDA 1O6FA 3SK0A 4L72A 3PUHA 5HF5A 3RLIA 3L1HA 2OQIA 4GWLA 2Y1KA 2XUGA 3FLEA 5IH7A 1UXOA 4B0OA 4BCBA 4PQEA 3MUNA 4XX1A 1CIJA 4OD0A 2J4CA 4N8SA 4BYMA 5I7UA 4U2DA 1BN6A 2G5PA 4FNMA 4UBNA 3K6KA 3ESCA 3HRHA 5HKBA 1MJ5A 3FAKA 4D9JA 5HKAA 1C4XA 4QEKA 2QR5A 5CT9A 4IH9A 1ZI9A 4JH0A 1L7AA 5LZ2A 4WDRA 2X8BA 1BU8A 4DNOA 3H2IA 5AJHA 4Y2JA 1LZLA 3JWEA 4P9NA 3KDAA 4PF1A 1CUFA 1THGA 1JFRA 4FBMA 3TRDA 4RE6A 1BROA 5ALTA 2H7CA 3AINA 3BIWA 1MT3A 4AXBA 3C8HA 3FYTA 2HADA 2HA4A 5C81A 2VJCA 4DMFA 3STYA 1MNQA 2FUKA 5HZGA 5AI4A 2HU7A 1GQRA 4WFIA 5AK3A 3H2HA 5A6VA 3ZLUA 2V9ZA 1N8SA 4X6XA 2AJBA 2VF2A 2OPHA 4OYYA 3WWDA 1ZGCA 3WJ2A 4FOLA 3R3ZA 4BVLA 1IVYA 3BF8A 3PFBA 2WU3A 4DMHA 4X85A 3G0DA 4QZVA 5CRIA 3R3YA 3WKAA 1JJFA 4KR0A 4LXGA 3DQZA 5EI5A 3U1TA 3D2AA 4J0KA 5AICA 4X91A 4K6HA 2BGNA 3WI7A 1MNAA 1P0QA 3AZQA 4BB0A 5T4HA 4BZZA 1IUOA 2QXUA 1ZJ4A 3E1GA 5JAHA 3BDIA 5AO9A 4X6YA 4DYHA 4H18A 4UBOA 3VDXA 1GQSA 4Y2VA 4J3JA 2OXEA 2OAGA 4HRYA 3H2KA 4KAFA 2DSNA 2ZYRA 1E8NA 1VE6A 1U65A 1CPYA 1GPLA 2ZJ6A 2QRUA 1CUBA 3LS2A 4K6KA 5DNUA 4XJVA 3C70A 1W4LA 4FFVA 4BRSA 4B80A 5DNVA 4X95A 4MWTA 1QFMA 4UBKA 4WJLA 3MGAA 5AKZA 1AQLA 5HQ3A 3EF3A 5AI0A 4HXFB 1XZGA 1BCRA 1MPXA 2V96A 1IZ8A 4QWWA 5CW2A 2I78A 1F6WA 1UFOA 4P93A 4XIIA 3WZLA 3WMRA 4Q3KA 3DKRA 3ANSA 4EBBA 4AZ0A 2HDWA 5FRDA 3QBJA 1LGYA 1ZICA 4H7EA 3WK4A 4FTWA 1G66A 4B81A 4QE3A 3K2IA 4FLEA 4HVTA 1QZ3A 4QDUA 2GBCA 1DU4A 3D5EA 2DQYA 2WHRA 5AKHA 1SCIA 4YX9A 1WPXA 4A23A 2XDWA 3R0VA 2ZSHA 3ESBA 1ODCA 2FX5A 4Y2YA 3DD5A 1P0MA 4BDTA 1EX9A 2JEYA 5JYCA 3PF9A 5JZ9A 1D07A 4EZIA 2BAGA 5FV4A 3HSSA 2WUGA 1CUHA 2XUQA 3WL5A 2CEKA 4OSEA 3V9AA 1GKLA 2ZYIA 5D3ZA 4B84A 4HXGA 2BUCA 1LPBB 3DJYA 4H77A 3RKSA 5CH3A 1ZD2P 4EA6A 2O7VA 2W6CX 4Y2TA 3FWHA 1CUAA 2RGUA 1SC9A 1O6GA 3T52A 2VT7A 1H22A 5I8PA 1AMNA 5LP1A 2EDAA 2NW6A 4P08A 5EIEA 4AO8A 4M0FA 3G7NA 4G4GA 2GYWA 2CJPA 5ALQA 5HK9A 4DSZA 1UOQA 3WA7A 3IUJA 1QTRA 3WQHA 4B6GA 1XKTA 2X5XA 3EBLA 4N8EA 4MJ3A 5ALEA 1YS1X 1LBTA 2ECFA 4EY5A 5LKRA 5JALA 5JAOA 3VXKA 1XZBA 2VEOA 4DNFA 2PPLA 1Z68A 1NX9A 4GECA 1ZD5A 1AURA 5LZ8A 3H19A 1THTA 5JZBA 3BJRA 1PJAA 2QVBA 1FJ2A 1EB9A 2Z3WA 3ESAA 2XMCA 2LIPA 1CQWA 5LKAA 2XB6A 1EINA 3OG9A 4DTCA 4BTLA 3VKFA 1TK3A 3FYUC 4AO6A 1E3QA 2AJLI 4HTAA 2YASA 3D59A 5FXMA 4NS4A 1IZ7A 4PSUA 2WM2A 2VAXA 2XUFA 2DFPA 4U2CA 2PBLA 4Y2PA 1MO2A 1HLGA 2WG2A 3IB3A 4BBZA 3MUOA 1Q0ZA 2HA0A 5AKEA 5DNWA 5K5EA 5A7GA 4OU5A 1F8UA 1TCCA 1UK7A 1AZWA 4Q34A 2AJDA 3STVA 1R3DA 4Y2RA 2VJBA 3KD2A 3H2GA 1S8OA 1XLVA 1W76A 1Q84A 1JJIA 5CT8A 3L1IA 2QXTA 3Q8WA 1XRPA 2WIGA 5ALUA 1XZJA 5K3BA 2XQIA 3CN7A 3VISA 5ALDA 3STWA 2OCLA 4OB6A 3FVTA 2C0QA 2H1IA 3C87A 4LKOA 2XUJA 3U0VA 4NVRA 3R3VA 4N5HX 3SX4A 3FCXA 2RONA 3V1KA 5AM4A 4G9EA 2BGRA 3C45A 5ALSA 4H7JA 3H04A 2V97A 5ALNA 2C5FA 1TKRA 5CT5A 2HA7A 4K5QA 3UUEA 3WK6A 1FFAA 4LXIA 4WFJA 2C7BA 3RARA 3I28A 2XLCA 2FJPA 2JBWA 1R4ZA 4J03A 1XZDA 1K5PA 1VXOA 3TJMA 3NOXA 1CUCA 1LPNA 5K3EA 2Y6UA 1XLWA 4UBIA 3G9XA 3V1NA 5EHNA 3WKCA 2WFLB 1FSSA 5AKYA 4ZWNA 5A2GA 3OM8A 2DR0A 3GROA 2PSJA 2RIPA 4Y2SA 4CG2A 3GFFA 4EY4A 3EIOA 2WJ4A 1GXSA 4M0EA 4GW3A 4LYDA 2PU7A 4C4YA 1DINA 1K8QA 2EEPA 5JD6A 5ALZA 1XLUA 5AI9A 1ISPA 3TGLA 5LZ9A 1CUJA 4OU4A 3WK5A 1EH5A 4F5ZA 1W6RA 1XZHA 2Z8XA 1EDDA 4A5SA 4DIUA 5DTJA 2B9VA 2BUAA 4DLNA 5JADA 4X92A 1VOTA 5AM1A 5ALMA 3NGMA 4ARBA 2J4FA 2O2HA 1ZD3A 5C7YA 2HA3A 4IH4A 4QLOA 1WM1A 5ALJA 3FLAA 1U2EA 5AKKA 1F0NA 3STXA 5K3FB 2GZSA 3ZPXA 3PF8A 4B9AA 5I9IA 3E4DA 2AXEA 4KRYA 1XQXA 4BVKA 2WTNA 1QFSA 5K3DA 5A71A 5ESRA 4X90A 3DNMA 3FSGA 1MU0A 1EA5A 1Y7IA 3IA2A 5LZ5A 2B4KA 4QA9A 1VKHA 4L9AA 5AIBA 3PDCA 2ZYHA 1T4MA 2R8BA 4X7BA 3QPCA 4MEAA 3WYNA 4HAIA 4DNQA 2CZQA 1YA8A 2RAUA 3WWCA 1CUGA 2AJCA 5ALFA 2WG0A 1AKNA 4W9RA 3W06A 4FKBA 3AFIA 2JGKA 3D2BA 2DHDA 1CUZA 1QJ4A 3H1BA 1AUOA 2XMZA 1QIMA 5JARA 1VE7A 3AIMA 2H7XA 2JF0A 5HFAA 1R9NA 5BOVA 1HBJA 5HCUA 1ODSA 1UOPA 3NUZA 4IH1A 2WIDA 1B41A 4WY5A 2WHQA 1NU8A 4ETWA 5AK6A 5E4YA 3DL4A 3S8YA 1CV2A 5JATA 4AN1A 3ZV7A 3W05A 2HU8A 1QIHA 2K2QB 3F8SA 5EHQA 4B7ZA 3FYUB 2DHCA 4ITVA 5FPPA 4C4XA 5HQ3B 4OB7A 3WWOA 4W1QA 3A6ZA 3PUIA 2WG1A 3EQ9A 4CG3A 2HRRA 1SCQA 4LIPD 2GYUA 4TPKA 1KU0A 1A88A 2GBFA 4WCVA 5AM2A 5AK5A 3H2JA 3QYJA 4RGYA 4N5IX 2QOEA 3I2HA 2HIHA 5LLSA 4JUIA 5LIPA 1TRHA 1P0IA 2G63A 4XVCA 1XRQA 1DT5A 2PSFA 2HU5A 1TAHA 4JNCA 5ALKA 5JD4A 4ZRDA 3OOSA 4WDQA 3HC7A 1AX9A 1XQVA 4OUKX 2WIFA 3GELA 5T4BA 3HI4A 2OQVA 1CUWA 3I6ZA 5ALPA 1I6WA 4Q1VA 3C6BA 5KWIA 1ACJA 2V98A 1F0PA 4FDMA 1JJBA 1YS2X 1UK8A 2JGMA 4FBLA 2C58A 2XLBA 2Y2VA 3DKKA 2XMRA 3F96A 4EUSA 2XUDA 4N8DA 4BE9A 1VA4A 2PVSA 3N0TA 3WK7A 1IUNA 2ACKA 4I3FA 3AIOA 3STTA 5ALLA 1K63A 2ZJFA 4BRZA 4UHEA 2OGSA 1ETHA 4FMPA 1R88A 2XUHA 2WFZA 1XROA 4F21A 1T2NA 3AUKA 3S2ZA 1MAHA 3H1AA 2VTVA 3QPAA 1YCDA 1J06A 4EY7A 2QUBA 1MX5A 4LXHA 4U2BA 5CH8A 4RNCA 4GDMA 3I1IA 1FFBA 3IIIA 1CRLA 3LIPA 5AKXA 1C7JA 3FOBA 1Y37A 3LCRA 1R1DA 2WHPA 2G5TA 2YXPX 1UWCA 3QH4A 2ROQA 2XMDA 3O4HA 2WTMA 4FFWA 3F9CA 5JAPA 3R41A 4F0JA 2AJ8A 4OPMA 4KE8A 2DQZA 3T4UA 1FFEA 3C6ZA 4QDOA 1J2EA 1TQHA 1ZIXA 4UHFA 4MQMA 3V48A 4QLAA 5CURA 5BWCA 1LPMA 7YASA 2D5LA 2VA9A 4BE4A 2XQFA 5HK8A 3VJLA 1LPSA 2QJWA 5AHXA 5IVHA 1CUVA 1QE3A 3WKBA 3AJAA 3C6YA 4AX4A 4UHDA 4L3WA 1WB4A 5DYWA 4UBJA 5AM5A 4Y2QA 4RPCA 4KJXA 4GBGA 3P2MA 1GPKA 4Y2XA 1VZ3A 2JIDA 3H18A 3WKDA 2JGEA 3K9BA 2PSHA 1UT6A 1XZLA 2HA2A 3QVMA 3VJMA 4GI1A 1G42A 5KREA 4S0XA 4ZGBA 5KBYA 3VVLA 1EHYA 3E3AA 5SYNA 5E2IA 1VJ5A 4UFNA 1XZCA 5DJ5A 3HJUA 1HPLA 4UFOA 1CLEA 3B3QA 1JI3A 5FKJA 4YPVA 1SCKA 3HACA 3M3DA 3ICWA 4FHZA 1P0PA 1G4HA 3JYHA 4UBLA 2C0PA 1XRMA 1NU6A 3W04A 1WCYA 2J3DA 3I6YA 5DYTA 3M81A 5JD5A 4JYPA 4CCWA 2HHAA 1Q0RA 1XZMA 2XUKA 3OURA 3IBTA 5DWDA 3IDAA 5ALGA 1ZJ5A 2XI4A 1ZGBA 4PNZA 3ZLVA 2PSEA 5F4ZA 5FLKA 1USWA 1OILA 2QUAA 1HL7A 2VSQA 4CCYA 2ORYA 5CT6A 4GXNA 1SOMA 4UHHA 1ACLA 3QZUA 3C8DA 1ZI6A 1J1IA 5IVIA 4HS9A 5EGNA 1CUDA 4G4JA 1EVQA 4OYLA 2P8SA 3ILSA 4CI9A 2XMQA 4C88A 1UOOA 4Q3OA 3CCBA 4QDXA 3IUMA 1GZ7A 2GZRA 1AC5A 3D0KA 1EDEA 3AILA 3A2MA 3UMJA 2G4LA 1Q83A 1UK9A 4ROTA 3I2KA 2WJ3A 1G5FA 2WUDA 3YASA 4H7FA 4K2AA 1DX4A 3DCNA 2ACEA 2WILA 4RE5A 5AP9A 5K3FA 3WYDA 4PO3X 5AI8A 1ZD4A 1MX9A 1DWPA 1H2ZA 1LBSA 4G8DA 1GKKA 1W1IA 4BC1A 3DOIA 2RHWA 4X00A 3D3NA 3N2ZB 5AKIA 3V1LA 5JZSA 2IIVA 1TCAA 3DYIA 4AMYA 4H7HA 3FVRA 5D6OA 3G0BA 4Y2UA 4QWMA 3LP5A 2QT9A 3AIKA 3G8YA 1HDEA 3ED1A 4BAZA 3BWXA 2HRQA 3EQ7A 4ZREA 4KE6A 3H17A 1N5MA 3FSGD 2BKLA 4PSCA 3OTQA 1VZ2A 3KOOA 2VQ6A 3I6MA 2EDCA 5E4TA 3D4LA 2QM0A 5IVDA 3ZLTA 1K4YA 4UHBA 5K3AA 3NWOA 4H7KA 3B5EA 5FDFA 1HKHA 1B6GA 1EDBA 2CBGA 2PL5A 1XZIA 4JYMA 5LZ7A 3O95A 1XZAA 3WLAA 1YA4A 2QKYA 3Q0TA 1OXMA 5CXUA 5JAUA 3SC2A 5ALOA 5A7FA 1WHTA 3FYUA 4W1PA 3LLCA 4UBMA 4WY8A 1FFCA 2I3DA 1WB5A 3C6XA 1LZKA 2Z8ZA 2PSDA 1VXRA 4ZV9A 4Z49A 1QLWA 1VA5A 2BUBA 2ZYSA 1EK2A 4YASA 5CMLA 3RM3A 1M33A 1XRNA 4AZ3A 4MWSA 5ALVA 5YASA 1BEEA 4C89A 4DMKA 1WOMA 4F60A 4EY8A 3EQ8A 1E8MA 3WL8A 1CUYA 1LPPA 4G1FA 1R9MA 1W75A 1QIEA 1YAHA 1XZEA 5E4JA 4BDSA 3KWJA 2WHPB 2XQKA 4KE9A 1H2XA 3TEJA 2CUTA 1EK1A 1DT3A 2HFJA 2WJ6A 4B83A 3DDUA 3HEAA 4HXEB 2XMSA 2RI6A 3O9MA 5T4EA 4W1RA 4UPDA 1YB6A 1XKLA 2B61A 2H7YA 2OCKA 4O08A 5EFZA 4B82A 1UKCA 2UZ0A 3IVMA 2WIJA 1LNSA 4X6UA 3SWWA 3G9ZA 5FUMA 2W22A 3DLTA 5D7BA 1A7UA 4J0IA 4CCYB 1RWQA 2QTBA 4BP9A 5EHXA 4XWGA 3UUFA 3QPDA 1ODTC 2H9YA 1C7IA 1XZFA 3PI6A 4DSAA 1QIJA 3VJKA 3WIBA 5IKXA 3D7RA 2CMFA 1ZIYA 3MVEA 5HF9A 1MTZA 4E46A 2YYSA 5FP0A 5C8ZA 4UUQA 2OCIA 3I1YA 2JGJA 3R3WA 2OAEA 4AN0A 2PUHA 5AOBA 5KWJA 1CFJA 4Y7DA 4J0GA 3IUNA 5CTAA 3WJ1A 2I3ZA 4KAAA 2O2IA 1BN7A 1CR6A 3D2CA 1BCSA 1N1MA 5JASA 3PICA 4X71A 4B85A 3B12A 3DL7A 1WB6A 4IO0A 1CUUA 1L7RA
chains in the Genus database with same CATH superfamily
2J46A 1ZUNA 3GXBA 1CUEA 3AK4A 2GZHA 3O4GA 3ROZA 1RXIA 3NX4A 4UM9B 3TIXB 2IYOA 3VKVA 1PUXA 1M8GA 4HC4A 5LDGA 1J8MF 2HJHA 4M1KA 3ZQ4A 4WOJA 5J2TA 1PSWA 4XIJA 2JFBA 3F2VA 2NU7B 5KX5A 3O0DA 1U7DA 2LUOA 1HE3A 1P2TA 1J49A 3R7FA 3G23A 3O8BA 3DTTA 3HFJA 1WSBA 3R3XA 3ASUA 3ABIA 3TPCA 4XPIA 3RF6A 1MVNA 1EA7A 2X0NA 3KPUA 3HWRA 3C1AA 3QLTA 1ZEMA 521PA 2GGSA 1EP2B 2XBUA 4AW9A 4V1CI 3QFHA 5HBGA 3KD3A 5E0KB 4L9WA 1PNRA 1JLMA 4TQ9A 3RGWS 1V3QE 1PTJC 1Z8DA 3AF4A 5IAKA 3T5TA 5AUNB 1NATA 3IELA 1QFYA 1ZJYA 1Z2EA 4O3FA 5FEUA 2B2CA 3A31A 3BPSA 2ZBFA 4PLVA 4D92A 1W88B 2VNIA 4QO8A 2FZVA 4NU8X 4BAGA 4KEAA 7AT1A 3RG8A 4CLOA 3V46A 3TO5A 3TLJA 2P7IA 3KU4A 3LE8A 1EIZA 4E2ZA 5C8VA 1BQ3A 3PEUA 4JOSA 2YMMA 2DCMA 3EZ6A 2BTQA 4U9HS 2B1JA 4XH9B 3RSZA 3LBIA 1M0SA 1H3NA 1ZMTA 3IVRA 3MTBA 3D3JA 3UC9A 2DLDA 3IQGX 3TLKA 4AKEA 4M7PA 4AMGA 1YCFA 2CWWA 2DC1A 2J9YB 4L4YA 2HCFA 3QXHA 2A9JA 2C57A 2PAFA 1JXMA 4CHGA 1O6CA 2BFNA 3E9CA 1YBMA 2JIPA 1CVLA 1F2VA 3G2KA 4X3CA 5F1PA 2FI1A 3T5PA 4N39A 5AVWA 3P9SA 1HDGO 1RYFA 2DBQA 3CWZA 5E7QA 2PFKA 5JSHA 5TSDA 2OZPA 2FN3A 4MUEA 4QQFA 3RKSA 4MGIR 3IULA 3KZOA 4Z3DA 4C4SA 1QAOA 1S9HA 3TRKA 3WMFA 3MOSA 4KSCA 1P74A 1K88A 2WFMA 2QM3A 4H0FA 2P9GA 2Y1FA 3EG9A 5HGJA 1VGVA 2AX3A 5FI3A 4PV7A 3ZUGA 5BNZA 5C51B 2H2WA 1Z45A 1XFDA 3A9UA 2XKKA 1LSUA 1J25A 3PQCA 2X8WA 2JFPA 2QD1A 1R0XA 2X0KA 3KDSE 5DI3B 2D13A 2EBHX 4V24A 3RGGA 3ANTA 3L2OB 4C5CA 4NAUA 2WU4A 4URXR 3P0FA 1WBDA 1MO6A 3F5QA 3MJFA 1CUSA 1EGAA 1OXXK 2X4LA 3ZWQA 2XQGA 3CZ5A 3E3OA 2XF2A 4ZCMA 2ZVDA 2WU8A 3G8BA 3U4QB 3ZHUA 2EGUA 4L0CA 5LZ4A 5FPHA 1NA5A 4G0MA 4OREX 1V4VA 3WQSB 1Q1GA 2GTHA 1KKMA 4S24A 5KTKA 5CB4A 1KY5A 2ZCUA 4RH1A 4AMVA 4TV9B 5I4KA 1B93A 1ZH0A 1LX7A 1HQDA 3DMTA 3ZZMA 1N2JA 5TMEA 2HWUA 1Q0PA 3AX6A 3R8FA 4GOKA 2QTVA 1W0JD 3FI0A 2I6FA 1VI6A 1WA5A 3I5AA 1CE8A 3F9IA 4NBVA 2N47A 2XDYA 5F7JA 1MT0A 4MI1A 3RS3A 7ADHA 1UQUA 2G9VA 4P98A 3UC5A 1CD5A 3BMOB 4HDCA 1ZD1A 3ABRB 1L8XA 1GUDA 4E2FA 4KZPA 3U56A 2FGJA 1MXHA 3U3XA 4DM4A 2ZYWX 3TDMA 4KLAA 4C4TA 3AKEA 3D1VA 4QGFA 5KDLA 3O4IA 1X1EA 3MT8A 3TDNA 3E70C 4EW1A 4NMWA 5H3CA 1JKJB 4DR6B 1YC5A 1W47A 3GLFE 1U2GA 2Y8EA 3ZOKA 3UK2A 2E87A 3MWGA 5EYPA 1THZA 4YYZA 3OHPA 1YSCA 1N2CA 3V4VB 4D8TA 1J0DA 1U0BB 1O77A 1Z33A 2FW9A 2HBZA 1GVHA 4R2XA 4LE1A 2BCEA 5EMNA 5A62A 3UT5B 4FEYA 1JTEA 1E2NA 2Y3IA 2VCHA 3DMYA 4J0HA 5IUNC 4WLEA 2NOAA 2FY8A 3WKEA 1B2RA 1YACA 1W88A 1YQXA 1MC1A 3BDVA 2ZRNA 4KQIA 1HR0B 3QVTA 5EUBA 5T7BA 1EFHA 3H9CA 4IIGA 2VJMA 2F90A 4CIAA 3CH4B 3UOGA 3PXUA 1EK0A 2WUEA 3GVXA 2ZUVA 3VRHA 4E11A 1OYOA 4KWHA 4G0PA 4D3XA 2GEKA 3PRKE 3D64A 5LQSA 4JC8A 2ZTUA 1MJFA 3RTAA 1P17A 2P0AA 1EXWA 1T8TA 2JHCA 1QYXA 4M0MA 2RB4A 2C5GA 1Z4KA 3TPFA 2OGZA 2PR2A 5ES3A 2BP7A 3M5PA 1E6EA 3F71A 1BXGA 2Y0DA 1DMRA 3R40A 3SF0A 3KQLA 1AF4A 4B7UA 4MYDA 1RCFA 4TXNA 4HAYA 4BFWA 4PTLA 3UZUA 2Q99A 4YBRA 3KYDB 3RTCA 3T7TA 5C1BA 4XQ9A 2GXAA 3H6KA 4F1JA 2OAQ1 4GOXA 1Q12A 5C0OE 2H59A 5K0TA 2WQZA 3DCIA 2A0UA 4LRQA 3E8XA 1GZVA 4R83A 3OPYA 1V37A 1HDIA 2ZM5A 4J90A 2HK6A 4KN6A 4KN9S 1RQLA 2KPOA 3QKIA 2R85A 4EHAA 5IJ9B 4RKQA 4N0MA 4JVLA 4EJSA 4F2PA 1KI8A 3UCFA 5AVKA 5BUCA 5I7WA 4R7GA 3FZGA 1SG9A 1UKEA 2WV7A 1NVVQ 2WYHA 3PXCX 1RYYA 1QQBA 1Y8QB 3PCRB 3KAQA 3SJBA 3WL7A 3GRFA 3L1JA 5JYEA 4DCVA 2IUYA 1M66A 5LDHA 1GGKA 3SIXA 4TMTA 3LKVA 2Y1DA 3O84A 2QVCA 1VHWA 1C3VA 5LWHA 3K96A 3NBZC 1NYQA 3MJRA 1K27A 1X7DA 1USUA 2EG9A 3SXJA 2FP4B 3LPDA 5GONF 1PS9A 3IIKA 4YJ2B 3U16A 4Z2YA 3AM4A 1WTCA 4BLSA 2BFBA 3OF2A 1UXHA 4AB1A 2PZAA 4X45A 1W25A 4TQUS 2IITA 5JANA 2JATA 3J7AC 3HJCA 5ALWA 2E4UA 2YV5A 5IN4A 4IHQA 2E9SA 2PA3A 3CXRA 4DGQA 4HWGA 3ZDBA 1MN6A 2E3JA 2W2MA 2C0CA 3TSCA 1E2KA 3EIFA 4YQFA 1ESDA 3VC3A 4Q3DA 1JFFA 3LG2A 4WZBB 1EB8A 1SOWA 4LHEA 8OHMA 1DJMA 2FPIA 2P3LA 3AFMA 2YJTD 3TSZA 3EASA 2QZPA 1XNGA 1Y0BA 3C97A 2GHQA 2O1SA 1FYFA 2G67A 3C43A 3KLBA 4IUDS 4L1KA 1E66A 3PDIA 4BP1A 3GLHA 3SFTA 4B8YA 2JGLA 3HVRA 4NCNA 4K81B 3QU2A 1NXSA 3QFRA 4CQLA 2JZOA 1Z2PX 1ARZA 2IYYA 4FHFA 1F1BA 3UEOA 3WIOA 3A1DA 3UAOA 3GBPA 4BNDA 4EEXA 4EFMA 3P26A 2ZWAA 4KUGA 5KTYA 1QF6A 3GZ4A 2VF4X 3PXEA 1UF9A 2J3IA 4KRXA 4A0RA 3R7BA 2ADMA 3DDHA 5BV7A 6YASA 3SQLA 4QXRA 2Z5VA 3U61B 5TQVA 1TZBA 3E2PA 1A8SA 1KDTA 2QN9A 3EC1A 3EVEA 5HF6A 3P9RA 3PENA 1DRJA 3NZEA 3BB3A 4D02A 2GZAA 3FKQA 1LPAB 4UNSA 4C6HA 4M0KA 4BMSA 3O4JA 3RNLA 4H6WA 3JQ9C 3M83A 3DT6A 3E8MA 3GRCA 1P91A 1WUTA 3L4SO 3LT5A 1CY2A 2A9QA 4HWKA 4QJBA 3PPYA 3RBAA 5TRTA 3BZUA 1N5KA 2V0NA 3KWFA 3B52X 4ZOLF 1E2UA 1UJ5A 3LIIA 4Z1OA 2YCBA 5IZCA 1UPBA 1WUHS 1NRWA 3SVLA 4E5DA 4DMCA 3B1JA 5IWAB 4RTRA 3HGQA 3SXUA 4CF6A 1G291 2ZUDA 3R74A 3OI7A 1H9BA 2JANA 2XIQA 2EJVA 3PRJA 3WAKA 1E5DA 3ZIAA 2ECQA 4P8RA 3DAPA 2HNBA 2Y1XA 2QLFA 4PSVA 1XAIA 1X92A 3CNBA 5JUWA 4UC0A 4IV0A 1GPNA 2PA0A 1N5RA 4G85A 4OB8A 4I9UA 1VPTA 1KPHA 5B7NA 3RK4A 4IDDA 4Z4GA 1RWBA 1GAWA 3FBGA 3IAFA 2GPSA 1MV8A 4IFBA 2G28A 3WB2A 5CBPB 4YRJA 2PTHA 5MF6A 4BY9E 3E0XA 1MP0A 2D0DA 3N7AA 4RY8A 1OZ0A 2O7RA 3C4JA 1PV1A 1S2DA 1TEXA 3GJ0A 3OHMA 4X9XA 4B3GA 4IIFA 1GEGA 1T2AA 2A84A 3HCEA 2WZDA 2EP8A 2XRFA 4UUOA 4C4ZA 1VIAA 1WPGA 3P9PA 2ZWOA 1Z22A 5JS6A 4KR6A 4RM2A 4Y6LA 3ICCA 3QHPA 2FQXA 4ZRMA 3THYA 2QUHA 1B15A 2VVTA 3O1IC 4HYYA 3ZHOA 1H1LB 5CXQA 1GTG1 1FDIA 1RPAA 2HEGA 3IIMA 3PKIA 3B85A 3G0OA 3PNVA 4BMYA 1S01A 3JAWB 3ZE0B 2YW9A 4C6TA 5LYYA 4EAQA 4Z9YA 1ULUA 1DG1G 4HRXA 1YRBA 3CLSC 4YAUA 4MVJD 4URWR 4ZICA 3MC1A 3CVYA 4FKZA 1VL5A 2Z0MA 1K4KA 3G68A 1G3QA 1UZAA 1QPZA 3ZD8A 3HVIA 4B3JA 1SZJG 1U8AA 1UQRA 1WXIA 4UFPA 3W5DA 1EG7A 4BO0A 4H60A 2XYPA 3LY9A 1Q21A 4K6FA 4MI9A 1OGYA 4RF3A 1GGJA 3S2SA 3HA2A 2PKRA 1XALA 1LV8A 4C7XA 3WGLA 1X38A 4B4WA 3EXFA 2ZJ7A 4WLVA 4O1HA 1NW3A 1A98A 3A2LA 3P96A 2W70A 2G80A 2NYVA 1QF7A 2F43B 2YXBA 3E5NA 2KBFA 3VAAA 3QPWA 5EJ5A 5JR3A 1W94A 1ZGHA 1N9ZA 4CUJA 3MUFA 4CFSA 4FOPA 1JSCA 1ZVKA 2IODA 4WA7A 5AH0A 4RXUA 3UO8B 1J2RA 1A72A 1ZGJA 3KWLA 4YQYA 4PSDA 4EL0A 2W83A 3ZCXA 3SX0A 2GNPA 4IIJA 3TBKA 4C5AA 4ISBA 1E99A 1JHDA 1E1YA 3CTMA 2R4UA 4DCGA 1K6XA 1WKBA 3PDHA 3GA0A 4OQMA 4FGZA 4TSFA 2JFQA 5BR1A 4DCSA 3NYIA 4UEWA 5CM9C 3EDOA 4N01A 3WNBA 4F4CA 3FPJA 3LPAA 2O3TA 1XJ0A 3UNXA 3UB3A 3TD6A 3W9BA 4D26A 4JJFA 2PJRA 3PD1A 1GTL1 3RAJA 1Z2AA 1LKZA 5KNBA 1UJ4A 1ADFA 3QU9A 4GMDA 4KMSA 1PJCA 4PSKA 2J48A 1OU4A 1YBHA 2AW5A 4JWKA 2Y05A 2J67A 2YJ5A 4IQ4A 5FULA 3T61A 5B12A 4IXDA 2Y0BA 5BN5B 4DY4A 1WL8A 4MKGA 4FC6A 1V7PC 1EJ2A 2ASVA 4DLZA 3TG2A 2RMKA 1N2EA 1DJNA 3NWEA 4MVCA 3HDYA 1D7AA 1YB4A 1XVUA 2HWKA 3EVFA 5DX0A 5JJBA 5AVYA 1EP9A 3UK7A 5CLGA 4ZAFA 3D81A 4MQLA 5ICFA 4RHUA 3I6QA 4LY9A 1BIFA 1CJBA 2QS9A 3DHEA 3I34X 1W7AA 3N07A 4OAOA 1XD2B 1BC5A 3DFIA 3KSUA 4M8SA 3WGJA 4BC0A 1RZVA 1M6EX 3AB8A 4I4IA 4C01A 5KO2A 3W77A 5G1NA 1IN7A 1SC1A 4UUAA 5CLLA 1IXSB 4PLWA 1JKMA 3KZNA 3PE6A 4TL6A 2BFDA 2CB9A 2QQGA 2XJ4A 3I0MA 4FCTA 5GY7A 3DZJA 5AXAA 3PZBA 1XUOA 4I7EA 4MS3A 3L8YA 3GUUA 2HB6A 4KE7A 2BGTA 3FDFA 4AY5A 4MH0R 2XGSA 1IZ9A 4J0JA 2UDPA 3ML1A 3WLQA 4HDQB 4ENTA 4YJ2A 2NUBA 2XWPA 1UK6A 4MUAA 4C6TB 4B5KA 3MMPA 2XE4A 1P7VA 1TI7A 1CULC 3MB8A 2IV7A 1T0JB 4KWCA 4ZZIA 4D74A 3HA3A 4Z4HA 2GT1A 1ATIA 3ZR4B 2ODNA 2QTAA 1EM6A 1C30A 2DHQA 3DCJA 3UCXA 1H42A 4NENA 5H4GA 1US8A 4YP6A 3SKVA 3QY0A 2XT0A 1V96A 3VAZA 1VRCA 4I1SA 1ORWA 2PX6A 3UG6A 3AOGA 3M70A 3AP1A 1KQNA 1ZHHA 2FR8A 5F9HA 3ORRA 1W5EA 1FCJA 1NOIA 2GEFA 4IEFB 4D4HA 2I2FA 1L4GA 1TFRA 1VPVA 5K05A 5LLDA 2JLCA 1JG7A 2E6UX 4DWVA 4Z51A 1Q92A 2FPGB 4MV6A 3RYFA 1K7SN 1PFQA 3ESDA 1O0BA 1QR6A 5JMWA 3DZGA 4PGFA 1B6SA 1UWKA 1HFJA 3L0DA 4KQ1A 1GNSA 1WHTB 4RKWA 3WK9A 1MF7A 1OHHA 3A1UA 1TC1A 4RVOA 3RVRA 2DUJA 3WGIA 2AKEA 2ZZMA 3N86A 2HGZA 3PFCA 1YMQA 5EKXA 5G1OA 2DFNA 4M87A 3H9GA 3OQOA 2PU5A 4L28A 4R1LA 5KNCA 3QMMA 1VE9A 4BYGA 1MAAA 3CXUA 1GSIA 3E9MA 3G0CA 3HSYA 4F3RA 4BVBA 4E70A 3F49S 2A88A 3D7NA 4I50F 5BWOA 5BW8A 1Y5RA 3VNSA 3A7DA 3R0JA 5C46F 5BSRA 2PZ8A 4KIUA 4GMHA 5K8JB 1Z36A 5E3HA 1JIIA 5AK0A 2PS3A 3GHHA 4JHLA 1Y3HA 4UU7A 4Y9RA 5CB6A 1FEZA 2X3UA 1ESCA 2MYNA 2PT6A 3CW8X 3IOBA 4NMLA 4AUNA 1HT0A 3MMNA 1FFDA 2ZG6A 1A95A 1VG0B 1GNVA 1I5OA 1RJGA 1T1GA 1U9ZA 2HQRA 2RGGA 3NIGB 4IJ5A 4X1IB 1O6FA 4X54A 4BO6A 3RVLA 3T6KA 2XAUA 1GZ6A 1IATA 2CVPA 1VDMA 4FMDF 1G9XA 3H1PA 1OYYA 4HWOA 4JKOA 5HF5A 2FZWA 4H1VA 4GT1A 3L1HA 2GAAA 3DO6A 4ID3A 5JWHA 2C61A 2B69A 4B0OA 1E0AA 1MJNA 3NIFB 4S05A 3D8BA 2IK8A 3MUNA 4IIYA 1NJFA 2J4CA 4NU0A 3WHPA 4BYMA 5CFNA 3DB2A 2BGMA 1A7JA 3BMCB 5LMNB 4OV6B 1ESNA 3PUYA 2BW0A 3OFKA 4JA2A 1KOGA 5K45A 3GCZA 4W9MC 2PCJA 3OIFA 4WLFA 1SAYA 1NF3A 4MA4A 2ZYGA 5FUWA 3DFKA 4QPZA 2B4QA 2Q27A 3H8VA 4JYCA 3OU2A 3E53A 3HV0A 2PYZA 5HKAA 4QEKA 3W78A 3RIHA 2FDXA 3V3KA 1UBMS 4JLWA 3A6PC 2BZSA 2LNDA 1QQTA 1QV9A 3I12A 2AOUA 2HLHA 2GVNA 1T5LA 1G5HA 1ZI9A 1WY5A 4M55A 4JH0A 3E22B 1OWNA 3BFVA 4Z8YA 2NVUA 2HD4A 3IAXA 1L7AA 3ADPA 1AHHA 2Q4BA 1W4RA 1M6VA 2I1WA 1ZJJA 4J6FA 3IO5A 2JCSA 3BH7A 3QEKA 1RD4A 2DJ5A 3MCZA 2RKBA 4XPIB 1VLLA 1P2VA 1W4ZA 2JA2A 3CF4A 4KWEA 4QGAA 5G0UA 5CB4B 4YALA 1NSFA 4DV5B 4D3YA 4DABA 3RRFA 3L8EA 3DOOA 4N7JA 1R66A 2RHLA 3L7BA 3LA8A 4IDQA 3BK1A 3JQ6A 2IXGA 3TNYA 1BA3A 4Z2AA 1BWRA 4KJZA 4PG7A 1E94E 2PMFA 3Q8MA 4Z9AA 1SU8A 2FPGA 4ALLA 4NBNA 2Z8YA 1VGRA 3ZTWA 4LJ4A 1KARA 5DO9A 1AS3A 3BIWA 4M0CA 1E3TA 2J6HA 1NXTA 1BDIA 2VP6A 3NGXA 4Q3NA 2V65A 4TWZA 1ZJZA 4IS3A 4TUYA 1Z07A 1Y5IA 2OLJA 1ECPA 1T3HA 2BKXA 2P90A 4KWTA 3LI2A 5KAPA 3C3AA 1I9GA 1IY8A 3CB4A 3FNRA 1QNFA 4A10A 2EARA 1X1SA 2BKUA 4GPD1 2YS7A 4KODA 4OM7A 3BIFA 5FPYA 1T0IA 3QVUA 1GFWA 3BSSA 3K1AA 2VAWA 3PWZA 5K7SA 1O95D 3T0IA 3CVVA 2JD1A 2PMDA 3QLEA 1I4LD 4L0DA 4WQMA 1R4NA 3FMOB 4OUDB 1LRLA 3HJBA 3T7IA 2G7ZA 4B46A 5FQOA 3EFOB 4YR7A 3UMYA 5I7HA 3GRZA 4E4TA 2A7XA 3ZLUA 3DOJA 4PANA 5F78A 2GKGA 1N8SA 3E9RA 3INRA 4E5MA 4U7GA 3ZHSA 2XVMA 3GFSA 4RXTA 5IHXA 1P5JA 2FX3A 3OO0A 3BWVA 3SQMA 2XXAA 3U81A 3BK7A 2C96A 3WWZA 2OPHA 1VL8A 3MK31 2ZRDA 1I24A 3DE5X 4WXMA 1T1RA 1C0EA 1CR4A 1LU9A 3GPDG 2WMNB 1NVKA 2GXSA 2QPAA 2WKSA 4BLQA 2Q3DA 5DNYB 1VI5A 5JO0A 3OZSA 3L0ZA 5CM8B 2JAWA 3OP1A 1RWPA 3QFCA 2WR8A 5GAJA 1CY4A 1SO8A 2C92A 2OLKA 3CGWA 3G6KA 2CMGA 2Q1UA 4RJJA 5E7JA 2MINB 4DMHA 5FBWB 2A5GA 2SICE 3WKAA 3EC2A 5D5PA 3K9LA 4QL3A 2AI1A 2IP4A 4LXGA 3B8HA 3D6UA 1JXOA 2FFAA 5EI5A 3V97A 2JIRA 4YJGB 4MYTA 3I37X 4XGIA 1L8QA 3C8ZA 4YB8A 3V7FA 3WL4A 1BOOA 2OTCA 1LJLA 1KNQA 1P9RA 4OMFG 4PC3A 1Y8RB 1E9SA 4BQIA 2A6PA 3LT0A 4RK0A 3CEHA 3OA2A 2DZDA 3GRKA 3I9JA 3IV9A 3OJWA 4A8HA 3WI7A 4BV9A 1XTJA 4LZOA 2G0NA 2Y4OA 4MDEA 1MNAA 4IJ6A 3WVNA 1U8XX 4DAEA 1EVLA 1W49A 2HMAA 4MS1A 3KKLA 2HI0A 4ETNA 3W90A 5T4HA 1QHHA 1U8CB 2G71A 2IEGA 3IR7A 2Q1WA 4LDZA 3FOCA 2PUGA 4A7PA 1P4SA 1Q5PA 2PD4A 3A3YA 3GAZA 1YIAA 1ZJ4A 3E1GA 4I6GA 4R9UC 1Z8NA 5AR1A 4UTVA 2FNAA 2G6TA 1VSBA 2YV4A 5E2AA 4DYHA 4DB4A 3GUVA 3TNDA 3A37A 3ISVA 4IHKA 3HBMA 1XTVA 3VDXA 5CA1F 4TTQA 4Y2VA 1U0LA 3RRMA 3BEDA 3I32A 4R2LA 2Q5HA 4Q01A 1PYDA 3M8KA 1UMBB 5K3OA 3RYIA 4MP6A 3QEAZ 4G0OA 2YRWA 3OWXA 4LF4B 3HPRA 3GDOA 4XPZA 4YDSA 3THSA 4AYXA 2ZYRA 4F86A 4WZ6A 2J3KA 3KTOA 1ORRA 4HGQA 2GCOB 3E15A 3S2UA 1O4VA 2IZZA 2VAPA 3OECA 2B7BA 3HZRA 3P71T 1RWMA 1GPLA 1HYHA 1ZLYA 2CFRA 2E0IA 2ZJ6A 3K0HA 4OHXA 4XQ0A 4BECA 5LNK1 2I6SA 2W43A 3GDFA 3KJEA 4P84A 4PRZA 3U5TA 2VO1A 2ZYAA 3H99A 5DNUA 3VR6D 2C5EA 3CLTC 2W4MA 4C0WA 3P9NA 1GUZA 2GD0A 3OJXA 5IBRA 3SAJA 1TM4E 4DARA 5EIWA 3IPRA 4OKIA 3UAVA 4JC5A 1M2JA 4F8JA 3QVKA 4Z6KA 5TQJA 4AX8A 1VKOA 4N5NA 4B80A 3R5JA 4US1R 3X1DA 1HLFA 3EGEA 4H4DA 3I9OA 2O2ZA 3RJZA 2ZTMA 1KERA 1UJNA 3A9SA 3FCEA 2AN3A 4GM1A 2HHLA 4QBFA 1PG5A 2HV9A 3MGAA 1GV1A 3GFOA 2JNWA 3E1SA 3Q3CA 2MYPA 3KKQA 1U3CA 4UQPA 2M32A 1LBEA 1HY3A 2BFAA 2BZ1A 3FF4A 3IUEA 2OAP1 5CFQA 5DHAA 4AQ7A 3FZNA 4K1LA 1QHGA 4MQBA 2BMWA 4M0PA 1GYQA 3BMNA 1UPTA 3SIRA 1VDZA 3JATA 1Z6GA 1O54A 3JD1A 2X0RA 4RMJA 1IZ8A 4YGYA 3SD7A 4L51A 5CW2A 2YQ5A 1BDBA 2I0FA 3AF0A 3BTSA 4MVJP 1A9ZA 3UQYS 5KDDA 3LGAA 2I78A 5E95A 3PSHA 2X6RA 2HF2A 3KQPA 4FSXA 1JFLA 5IT9A 2V7EA 1X8LA 4R1QA 4II2A 1AH2A 3AP2A 5LQDA 4P2BA 3WMRA 5M2QA 1PE0A 2WICA 4TRRA 2O8DB 1KZYC 5G4LA 3L82B 1L1FA 4N3BA 1YRQA 4D5GA 1TEHA 2ZEJA 2DWUA 2HY7A 2Z5LA 3ZS8A 1OGIA 4GZ6A 2PVCA 4YO7A 3L7MA 4DMRA 1LLQA 7GPBA 3GLFB 2QTVB 3F78A 4EX6A 1U8FO 1XVTA 3P94A 1X86B 5SV2A 3GV0A 2B7LA 3V2UA 3FPKA 2H08A 2O3SA 1UJCA 2Q6VA 4QFMA 3UGKA 2X8LA 2C31A 3HVJA 4Z8XA 2O06A 5CB8A 1Z28A 2XOXA 3NHZA 4P4UA 4QE3A 3T9EA 3WBKA 4W5TA 1M74A 4LHXA 4XCVA 1TJPB 2MR5A 3ASZA 3D4OA 1GCGA 3F1KA 4ALIA 4JJ7A 2C9OA 3OOEA 1GTVA 5AESA 5P21A 4HQ6A 5LVAA 1Y8ZA 1OFTA 3AESB 4EFLA 2DQYA 5AHOA 3WR5A 1ADBA 1MHPA 4EI2A 1CVRA 2OZLA 3G1UA 1XTUA 3U60B 2ZSHA 1BZYA 3OAAD 2TYSB 3GJTA 4IKEA 4Y2YA 4CDNA 1UPXA 3B7WA 1P0MA 1YQDA 1XMPA 1U8TA 2Q2OA 3FTNA 5DHPA 1IPEA 3T5GA 2JEYA 4YRNA 3NEYA 3EGVA 2D1QA 5HX7A 4PZPA 3PF9A 3UJNA 5DGDA 1LFDB 1W0JA 2WNIA 4AG5A 2K6GA 4F6RB 2F1JA 1FJGB 1D07A 3ZU6A 4G2NA 2WJPA 1W6UA 4EZIA 2A4KA 5G0WA 4Z3OA 1DIHA 3M5WA 1JEEA 1YDHA 4J4BA 2ZROA 4RU1A 4MRNA 4YMVA 4HLDA 1P1IA 3HCAA 5DM1A 1RKQA 3FPEA 3FHLA 1VJGA 3O93A 3W6OA 4A8JC 3NTUA 3OLWA 4QU9A 4DW8A 5E7MA 2CEKA 5ES4B 1P7ZA 4OHZA 4DZRA 1RLOA 2PQ6A 2I5PO 2HPVA 1LRJA 3GFGA 3GJ4A 1F48A 5GADl 3MWFA 4GR4A 1OI2A 1J70A 1OXKB 1J8YF 5FO1A 4E2WA 1Z2NX 1V6AA 2L18A 4G0QA 4JXJA 3RQSA 4W5QA 4JSYA 4AZTA 1EZ4A 3C3CA 3F7MA 3DJYA 1VC2A 1IG0A 2LZ0A 3NYRA 2BVNA 1WD5A 2W8BB 4JQZA 1PQWA 2E5WA 1NI4A 4M89A 4H4EA 3UTDA 2WSSA 1PJ8A 1GD1O 1IEWA 3FWHA 3FZQA 3I64A 1NRXA 4D3ZA 4W5WA 3GGPA 1D4FA 5BYKA 1E3WB 1E6LA 1U1FA 3ENNA 2J07A 3LC0A 3LRXA 4I14A 5FQNA 4COOA 4QOEA 5HGXA 5GINE 1P3DA 2GEBA 2VT7A 4LZWA 5I8PA 2X42A 1I30A 5FUYA 3WB1A 3RR2A 3MBKA 1UJBA 2I99A 2P9CA 5D3MA 1RHMA 1JP7A 4H1TA 2ZBGA 1SWWA 5EIEA 4WNIA 2A67A 1ZNZA 5TV2A 1NDQA 4MR9A 4CR8A 3RC8A 5EZYF 1MJGM 1IEXA 3DEZA 2E55A 4KXXA 3BSWA 1MVLA 2D54A 2JBAA 1PR2A 4JLUA 4M9SA 3KX2A 1M9NA 4BN4A 2QRVB 4FGSA 2FRXA 1VKZA 3GIWA 1T8YA 4IKOA 1OFGA 1J9ZA 2AYZA 5DI9A 3AP3A 1JR3E 3CVWA 1N6NA 1W8IA 421PA 1YFJA 3JAMA 1UOQA 2LVBA 1XQ6A 4UVIA 1H4TA 1U0GA 1ID1A 1YS7A 4XEHA 1AKEA 2PD6A 2PNFA 4BIMA 5I7SA 4HNAA 1BJRE 2PUEA 1VBMA 1G19A 1QWOA 2Q46A 4AJNA 3MWYW 1TIPA 3SOZA 4PG5A 5ALEA 2OZLB 5B1EA 3E5MA 2XRZA 1X1CA 3QEMB 1S2GA 5CA1A 1L7PA 1G8PA 2ECFA 1IH8A 4EY5A 5JALA 1AQNA 2JRCA 1EFUA 3ONWA 3DAHA 3L84A 3D1JA 1HOXA 2C3OA 4NL4H 1XZBA 2IOQA 2BCGY 2RK4A 5C8YA 2CMDA 3V7NA 5JVDB 1GVNB 1KZ9A 1ZD5A 4KKXB 2ADOA 3IHLA 4RPHA 4ITUA 2V4UA 4K9RA 3ICQB 2HSZA 4FS8A 1OVGA 3U4AA 4P36A 1L5MA 2BMAA 3IC5A 4BJ6A 3N7TA 3SR4A 4Z86A 4XFJA 4FDAA 2LRHA 2PMWB 1P3Y1 3C7DB 4R5HA 1ODLA 1P72A 4RF2A 4IRUB 4XIFA 3IOMA 1C4KA 2IXTA 1PJAA 2BZGA 3NP7A 3ORSA 1NG1A 4MMZB 5U4QA 5KNLA 5A4MS 4ARZA 3P32A 1JHRA 5FBZA 4DSNA 5EJEA 2BN4A 3HLYA 3JD0A 3UA4A 2DF8A 5EEGA 3R8XA 2R8PA 2XMCA 1S1MA 3KWMA 4MUMA 1VMKA 3M1AA 3VKWA 4LTNA 3GLGA 1US8B 2XB6A 1TM5E 4L7VA 3Q3GE 4NJEA 4C3ZA 3TOCA 4DTCA 4BTLA 2FZ4A 2GJKA 4UEOA 1KC1A 2UYOA 1A76A 3ZXXA 5J2UA 1NMYA 3LV8A 1QKIA 2ZSEA 4KWIA 5LXTA 4EHKA 4HTAA 4EKNB 1MTOA 2BF4A 2G9UA 4LGCA 3IQHX 4CGZA 1I3CA 3NHLA 3UKJA 3BZBA 5GTDA 2WTBA 2D7DA 2YMPA 1J39A 4PSUA 3ZQJA 2VAXA 4ND8A 4U2CA 5LBTA 3N74A 3JD3A 5B53A 1CJUC 4MARA 1AXEA 3KFXA 3OT1A 3IB3A 3T4PA 1GQOA 1YJBA 2ZE6A 1OZAA 1OLSA 3EVTA 3AVVA 1VMDA 1DAKA 4TMXA 2FSGA 4S1OA 3BBPA 1XP8A 1YZUA 1FNDA 2ZTVA 2GK4A 3IEIA 5M3BA 1KGSA 4JUFA 2X9NA 5DNWA 1I4OA 3THWA 4OU5A 5TE9A 1F8UA 3BH6A 2CLLB 4GPIB 4N49A 2JVKA 1L4LA 4D3SA 1UK7A 1DQNA 1NI4B 1ZO8A 4LC0A 1G0OA 5K3SA 5KNDD 2P4UA 4Q34A 4ARUA 4NE7A 1UC8A 4PYNA 3GJ8A 1KZ1A 3L49A 1C7EA 1TO2E 2F1HA 4PY2A 1R3DA 4QQRA 2NQ8A 5EERA 4LF7B 5J9FA 3H2GA 3VC2A 2AWNA 4M0LA 1RADA 2TMYA 2YHUA 2DPXA 1XLVA 4IX9A 1Q84A 1VL1A 2GM9A 2BRUC 2H17A 3HFRA 5TVKA 5JLAA 3JR7A 3L1IA 2FPRA 3JZDA 3NT5A 3Q8WA 2BE9A 2JLYA 2HK7A 4A9AA 3VDNB 2GJ4A 5JVDA 4NC9A 2ZXFA 2QN7A 2N75A 5FOWA 3F73A 3D3WB 3QGMA 5EL0A 1BU5A 3EDYA 3GG9A 3LY8A 2WIGA 2JS7A 5L3ZA 4KDEA 1J5EB 5MDHA 5EMMA 1SXHA 5DCUA 4B4KA 2OYSA 2GILA 1SKUA 5JEEA 4KGXA 1T1EA 1W85A 3HDGA 3IQWA 3KPYA 5EIBC 5E6RB 4DPLA 1SVIA 2O8BA 4OGLA 5CFLA 1T3GA 4LK2A 3SXPA 4FB4A 3W1WA 2IV3A 3VISA 3QRWA 4HNAB 4URHA 4ZEOA 2D59A 3KZ1E 1VMAA 4MV9A 1G8FA 1MA0A 2BSXA 1JAXA 4H16A 3BMXA 5DBHX 2AMYA 4MEJA 3DV0A 1L6RA 3UMSA 1YZVA 4V0NA 4B31A 1AA6A 1X87A 2C0QA 1VPEA 2H1IA 5B7GA 4LF8B 3QTLA 2Q3LA 3T0FA 1ML4A 1FVXA 2PFSA 4TTTS 4B48A 1P75A 1NXOA 3SX4A 4AKTA 3LDGA 2C2GA 1DBIA 4QPPA 3D6AA 3MJSA 2IKSA 5EUCA 1EIWA 5K20A 1VL2A 5JBNA 1ZAYA 2NWQA 3R44A 4F4HA 5HIAA 3EC7A 2Q50A 1A5TA 1FFXA 4Z53A 5AW7A 3F8WA 4PTZA 3AR8A 2AOUB 4QRDA 1K3TA 3TSYA 2ON6A 4BLVA 3NKVA 4V0LA 1H1DA 3T3HA 1KOFA 4ZZ2A 4HPJB 1X7YB 3S2IA 5BR8B 1HE2A 1ZG3A 3QUAA 2NUPB 1JJ7A 2GR9A 5JCJA 5C31A 2HQ1A 4Y8VA 1QTQA 2C9MA 2QORA 1CZKA 3LUDA 2H7VA 3MYRA 5HS6A 1T8UA 2VXYA 4LXIA 1LI4A 2I4RA 3CKKA 4LNUA 5BV0A 1KWKA 2XLCA 3ELYA 3O4RA 1JLRA 2YMLA 4P5DA 3W5SA 1FLAA 1R4ZA 1K7YA 3WV4A 3ZUPA 4BFXA 4ZIRA 4UUPA 1HNWB 2R6DA 3NNDA 3TJMA 5F7OA 1B8VA 1WXHA 2YBEA 3JD4A 3ZYCA 2V6MA 2FPLA 1PFGA 2OXFA 3UKOA 1USVA 3EWAA 4YUXA 5DM70 1NVUQ 1KVUA 1YK1A 4NXNB 4GWKA 1L7BA 4OP3A 2BONA 1T8SA 3KB2A 1JKXA 5FBVB 4L9SA 3RTBA 5CAEA 1XQ1A 5DOZA 4OHWA 4UUNA 1LDGA 1OOEA 1SCUA 3QBVA 1KFCB 1PG0A 3WL3A 3EPPA 1F2TA 1MMFB 2WFLB 3DEYX 4GVLA 4GU5A 4ZWNA 2VQEB 4MS3B 1BE1A 3COJA 3S28A 1UFVA 3OM8A 3Q41A 2RGRA 4D8YA 1II8A 1AKTA 2VRCA 3OU7A 4HSEA 1M73E 2DR0A 3N2NA 5HOEA 4B3FX 2RH4A 4X3PA 1ORDA 1PCXA 1RYNA 3G5TA 3GP5A 3LK6A 5ELMA 4EGSA 2PSJA 2WABA 2Z3VA 2LV8A 5EZ5A 4A0HA 1F8YA 1O3YA 2BL4A 4G5RA 4KDCA 1QHEA 3UMCA 5F3WB 2XB8A 2QW1A 2FFRA 1SHKA 5K8VA 1Z0SA 1RAFA 1UPUA 3DDNA 2D2XA 4MRSA 2HF9A 4G9BA 2GN9A 2PZLA 4HWRA 3HNOA 4LI3X 4UEQA 2C8LA 1O9BA 1CSEE 5GM1A 2B8TA 1H0HA 4HDKA 2FYTA 3CRVA 2F3RA 4BB5A 1GL9B 1P8JA 3OZCA 1KAOA 1KHTA 2Q2VA 1L3BA 3A10A 2C84A 3IAUA 4XCQA 5JJKA 1XRSB 5IJ0B 4Z0HO 2OCYC 2ICAA 2R79A 3CEPB 4BPRA 4C4YA 2H1SA 3L07A 5LNK6 2FEPA 1VJ0A 4QECA 3USCS 1M76A 4RORA 1TF7A 3EEFA 4KHPB 2EEPA 3KVRA 3O8OA 1EQ2A 1VCOA 4NICA 5I3CA 3X44A 3FROA 3RODA 4IG4A 2VZ0A 1Q6ZA 3EA5A 4LPKA 2QWXA 2E4VA 2VXCA 4DJ5X 1K9VF 2J0SA 1BX0A 1H6BA 2EERA 3FSJX 1G5TA 1T4BA 3CZRA 1YOVB 3MQFA 3GH3A 4O2BF 5ADWA 5HS4A 2VP3A 5C53B 2GN6A 1BCSB 3BIOA 5AYVA 4N5DA 3SE7A 2PEYA 3U7RA 3UMRA 5JNRA 3T3OA 3LHDA 4AF6A 1C30B 1KI3A 2WYVA 1ECCA 2CK3A 1BEUB 4EJSC 3V6LA 4NG5A 2B7CA 1L5VA 2BBSA 4DLNA 5JADA 3QKWA 1VOTA 4X92A 2X14A 3EJWA 1PNOA 4TXLA 5E6UB 3COVA 1NNSA 1UM9B 5FOXA 3NGMA 3OLYA 3VR2D 2VJOA 2O2HA 2QD4A 1ZD3A 5C7YA 3I30X 5ICCA 1T9ZA 3JATB 3R3SA 4ESHA 4ZAZA 5IJAA 5BRAA 2R3SA 4K9DA 3A58B 2HLDA 1AM4D 3MT0A 4FQ8A 5DEIA 3BXXA 3DEJA 3LUPA 4YXFA 1JR6A 5AKKA 2QTNA 5K2OA 2IW3A 1ZJWA 3OZXA 4MR8A 5K3FB 2GZSA 3BGVA 3ZPXA 3ZBQA 1D8TA 2IXFA 1CS4C 2IY7A 3OUZA 2FRDA 2PWPA 2AK2A 4P33A 3U9SA 1MHTA 1EHIA 4YAFA 1Y4SA 1DKNA 1K97A 4P81A 4BVKA 4LF5B 3FZEA 5EWMB 2WTNA 2FN9A 1ZIOA 3RVKA 1RWXA 1KIAA 2VYCA 4X90A 2REBA 3FSGA 5C4IA 2MT9A 1RHQA 3ITNA 5IUJC 1TXGA 3WFIA 3W9YA 1YFLA 1YGYA 1MUUA 1KQGA 3GDWA 3U7HB 3LT4A 4M46A 4EMBA 3AY7A 5BMVB 2VKQA 4EO9A 1R0ZA 4PLYA 2ZBDA 2EFDB 2R8BA 1CWUA 2J0UA 4OGWA 3UXMA 4F72A 1YKFA 1KRWA 4S1WA 3ENKA 4ASUD 5D7NA 1O5OA 3MTEA 4AS2A 3HDJA 4FIDA 3R3HA 3HN7A 1NW9B 1JG6A 2ST1A 3EPRA 3W3AA 3WWCA 2AJCA 3I76A 1A4RA 1AKNA 2ZI9A 3CO0S 4W9RA 4AAYA 2O1EA 3W06A 4S1NA 3AHGA 4CKXA 1X80B 3U3KA 2O7NA 3DP7A 2DHDA 1QJ4A 3E4CA 3E18A 3GFQA 5K0GA 2ZP1A 3NNSA 1TTHA 4ZQGA 3BICA 4YAJA 1AUOA 3GLHE 1G6Q1 4LXXA 4IOJA 4F71A 1QIMA 5H9VA 4B6FA 2YHIB 3P97A 1V5WA 2H7XA 3ASVA 1P62B 3HBLA 5F5LA 1EK5A 1Q0QA 3IMFA 5BOVA 4B6QA 5IPFA 3GEGA 1XU7A 4IOMA 1OZFA 2FEWB 5B1SA 4KLZA 2G8NA 5CW1A 1ODSA 3ZBPA 721PA 1SURA 3C3XA 4WBXC 4QAQA 4EARA 1RPNA 2J33A 2P5YA 4P4LA 2W8ZA 2WHQA 4WN3A 2C3MA 2X5NA 4QQNA 2H4JA 4BQSA 5KVVA 2O59A 4QLBA 3IVXA 4L73A 1REQB 3CUKA 1BMTA 4E51A 3LPMA 3G2MA 4BX9A 4YRRA 4RFSA 2VZEA 5ERGB 5A3RA 4B3SB 3ZV7A 2W6ID 1V16B 3EQ6A 4OF4A 3D7KA 2ZTHA 1GAQA 4P4NA 5L3SB 1VYUA 3M6XA 2K2QB 4DJEC 1GNTA 2VJPA 1VG8A 2YNMA 3KVYA 4C0BA 1I3LA 4I1RA 2BYTA 1SKBA 4B7ZA 5EYPB 4P0TA 3JWJA 5CFMA 2WAXA 4HGNA 3AM5A 2DHCA 5IWCA 4XGRA 1P4JA 3R76A 3H86A 2HNKA 4YRPA 3NBAA 4MVJE 3SC2B 1E3EA 3KE9A 3OCUA 1PNVA 1Z82A 1NX6A 1U28C 1ZA2A 1QOQB 4IHJF 2QT1A 5FUQA 4JU9A 4W1QA 4NEQA 3BTUA 3T9CA 4AM8A 3UJ3X 3N2KB 4HLNA 1DAMA 2A3NA 1EQAA 1OXVA 4CG3A 2CXNA 4IMJB 3LBAA 1ETUA 1DCTA 1NZFA 2HRRA 1SCQA 4N7MA 1FTGA 2J9ZB 4BLTA 4TKVA 3I5UA 1RI5A 4W7HA 3K8OE 2C00A 2H29A 4TPKA 1KU0A 5AVQA 3E9QA 3COSA 3QU4A 1CCWA 4RACA 1TJYA 2NUAA 1TTQB 5ER9A 1X1TA 3HVHA 3LWBA 4O4IF 3TQRA 3VYRB 1Q7BA 3DE4X 2VZ9A 1PHPA 2FK8A 1ZCZA 3QYJA 5H4HA 5D87A 4RMNA 4BFTA 4AF7A 2A9KA 4QGHA 3VYWA 4E3WA 4TV8A 1IBLB 1QORA 5EP3A 1KDZA 2H8GA 3FETA 2O20A 2FSVA 1TRHA 3UW1A 1S5PA 4GLOA 5IXYA 3QUCA 4FFPA 2WVHA 2E5LB 4KW7A 2Z1NA 4OLBA 2G63A 1BHQ1 1ZONA 4PX2A 3W2HA 1Z83A 1O95C 4K9KA 4C1NA 3ZZTA 5CYPA 1DT5A 3BD8A 3JQ7B 4WVLA 1G5PA 2A1TR 5DTMA 4WLUA 4E2XA 3BM5A 4JNCA 3T41A 5JD4A 3ZDZB 5UKDA 2BFCA 2BR3A 4ZRDA 3EXG1 3OOSA 4WDQA 1BMQA 1R5BA 1TZKA 2HUPA 2ZSBA 3L1VA 2YJNA 3ODGA 4KQJA 3HDHA 4RZ2A 4WNAB 3GX1A 3ENZA 2OY0A 4RKEA 1KY3A 1XQVA 3WLPA 2PZGA 4OUKX 2IELA 5KC8A 2CXSA 2FZ5A 5T4BA 2OQVA 3KR2A 4PGGA 3ZGYA 5KWEA 2G0AA 1PWEA 2YICA 4HGRA 5G53C 2ZTLA 1G9TA 2ZAOA 2FWRA 3CZAA 5DULA 5E8RA 5HQJA 4A4DA 2OFWA 3KJXA 1JTVA 5A4KA 1Z6AA 4D1YA 4TYMA 4EW2A 3C6BA 3IQEA 4RVSA 3K0SA 4IOLA 3I9V1 4MUGA 2CY0A 1PL6A 1QX3A 2FLWA 3A4YA 4NDZA 5KWIA 1FRZA 1YFKA 2B8EA 4LYHA 2RFLA 3HJHA 3ZNNA 1IOVA 2G83A 5FR1A 1EWQA 2IU6A 1F0PA 2ATIA 3CF4G 1W29A 1GPH1 5AW8A 2OEPA 1NUHA 3LWZA 1UK8A 3FPSA 5CNJA 4D97A 1GG8A 5D3MB 2VQFB 1H4SA 4I5GA 1PW7A 2CUKA 3DKKA 4RKYA 3C7KA 2NP6A 2ZRFA 1KMHB 1DBVO 1VYTA 2RARA 3OQMA 4LJLA 1IUKA 1C8LA 2GPJA 2YHBA 2FUG1 2XUDA 1G8KA 4REMA 1B16A 4BUZA 1I3MA 3SBEA 2Q3BA 2Q5OA 2LXNA 3W6PA 4MPJA 4BE9A 4BX3A 1SKQA 1SHZA 2AOXA 1SC3A 3EXAA 3IBSA 1VA4A 2PVSA 1Y9DA 1ZRHA 2IYUA 4LYYA 1R74A 1FXSA 1SD2A 2OD7A 4HATA 2OBYA 1WR8A 4M8NE 3VSBA 4E31A 2XXBA 3K71B 3LT2A 2OT3B 3IDZA 3UB2A 5FL7A 2ACKA 3VU8A 4I3FA 1YOBA 1J0AA 1UM8A 4OK3A 5KOYA 1ULTA 3LQ2A 5DHUA 1B26A 4DJJA 4R8SA 5JMPA 1T9GR 1JILA 4HI0E 4YXWD 5KDOA 1MG0A 5ALLA 2NXEA 2ZXEA 2GYYA 2RHHA 2G72A 4GS5A 4DMLA 5CDGA 3MRTA 4D4KA 4UHEA 3VBCA 4DLXA 1FFGA 2ZQ5A 1GPUA 1ETHA 2OGSA 1SVNA 5C7IO 5JHHB 3ND9A 1E6UA 1WX1A 2RHBA 3AVPA 4IDBA 3KYIB 1R88A 2FSPA 3PV0A 2I1VB 1BFDA 4EM6A 2HQBA 2Q0QA 1YR7A 4WK2B 1MAHA 5CVJA 3CEMA 3OMXA 2VTVA 2O50A 5F7XA 1RWOA 3CX7A 4AJHA 3CLSD 3LD9A 3NKLA 4PLPA 1U6KA 2ODAA 5KHAA 5JMTA 2GCEA 2QUBA 1ORHA 1MX5A 4UD2A 2VTEA 1JTFA 4JFAA 1EUQA 4J2TA 1NTOA 1FQOA 4RXMA 3ODPA 5E6SA 4EI7A 1NYRA 2H5IA 3LIPA 2O8CA 1ZWKA 3H9UA 4P7KA 3W2GA 2QAGA 5AKXA 3Q3IA 2ZKIA 3IDOA 2JLUA 2R25B 3E2MA 3I6BA 3LOQA 3MCUA 4II3A 4CLRA 3QEMA 4JQCA 1R1DA 1K6JA 4CV0A 2FZEA 4PC7A 2VYNA 4F56A 4YROA 1UL1X 3NBQA 2YQZA 4BN5A 2VJNA 2XA2A 3I0ZA 3MFQA 1K7CA 5EQJB 4DJTA 4ILEA 3W4JA 3H84A 2G1KA 1QG6A 1Z47A 3PC7A 3NHYA 5AJWA 1RAIA 5CTJA 2GZ1A 3H05A 3ROXA 4EGQA 4EKEA 2H2AA 4OPMA 5HDQA 4NX2A 3O94A 1RYZA 2FQQA 2JCXA 2C04A 4J9UE 1FFEA 3C6ZA 3WGQA 2C2MA 3P7MA 1EFTA 2QYOA 4EYEA 5ECDA 1IQPA 4UHFA 2ZPAA 3GWZA 4MQMA 1GO2A 1BCRB 2VYND 5HE8A 5DVZA 2Q1SA 3ECSA 4JGBA 4EA8A 4EDHA 5FR2A 2XGJA 1BKYA 1LS6A 1R0LA 2J7PD 3FTDA 2GM5A 1N8NA 2AMLA 2F62A 5KJFA 3HSKA 4JT9A 4C43A 2VA9A 5DRTA 1X19A 4O2AB 2JH3A 4HDMB 4I55F 3I8SA 1RKVA 5TEWA 3VJLA 4ZYYA 1MOSA 4MW4A 2ZIXA 3UIEA 1CUVA 1G64A 1QE3A 1Y7LA 1YBAA 3HUUA 3HYNA 3O2JA 5F51A 3U3ZA 3GLUA 5B1DA 3C6YA 3OCCA 3WIDA 1GQQA 1V16A 4NYIR 4AX4A 4UHDA 4L3WA 1WB4A 3VSDA 1JQBA 5DGHA 2QD2A 2E18A 4UBJA 2X4GA 3HH8A 4JY7A 5AM5A 2JAHA 4JX9A 1NVVR 4TKZA 4I8XA 4Q4CA 1J23A 1HYBA 2IVFA 2O3RA 4RPCA 4DILA 1SVMA 1RR6A 1JWLA 4HDOB 2GA8A 3VUFA 2ZRBA 3P2MA 4RHTA 4WERA 3VZSA 2C03A 3DLHA 1GPKA 1XXHA 3GHYA 4U7WA 4LZPA 3HWSA 2FUEA 3I1JA 3QHQA 4ZYZA 3UV6A 4U7TB 2CXTA 2H4XA 4B2YA 1DFHA 1ZIPA 3GVCA 1ZH8A 2GCPA 2HTEA 3C5CA 3L8DA 1DCFA 4Y2XA 3VV3A 3IKJA 3RRXA 4D4IA 1Z63A 3QJ5A 1AT1A 3R6TA 1EJBA 3TM4A 1GRRA 1ZVVA 4KRGA 5TT0A 5F9FA 1RSZA 1JEDA 5K0JA 3GLGB 3PCTA 3CZPA 3CPJB 3NO4A 3VKUA 4ZGBA 1EXVA 1XVLA 1KJIA 4CFZA 1ND6A 4EF6A 2PUCA 3OVMA 4ZAGA 3N0VA 4YWJA 3M34A 5F98A 2WM8A 3OLXA 2WFAA 2P6UA 4RO0A 4G0YA 3IQXA 4MZXA 1FW8A 2QAIA 4NCIA 4ZVUA 3I0NA 2OSBA 4LZZA 1TZJA 2E4AA 1KY4A 2IEDA 2VHVA 3HJUA 3W8EA 1DUVG 2Q7DA 4AD8A 1R6VA 5FKJA 1I7PA 1Y7TA 1SCKA 2JFXA 5DBEX 3T1NA 1P0PA 2JPDA 3FLMA 1NL3A 3R09A 4TWRA 4DR7B 2I7DA 2YQ4A 2C0PA 4PAMA 4UBLA 1ITZA 2SECE 2Q5FA 3TKLA 1NU6A 2OKCA 3W04A 1GKIA 4BHTA 2J3DA 3JQ8B 1FLDA 3M81A 1FNMA 1QKKA 1AK1A 1QO0D 2Q0HA 3BD9A 5DIFA 4N41A 4LSMA 4U9IS 4C2AA 1KS9A 4G5FA 1P2BA 5IYZB 3OZFA 2HHAA 1Q0RA 5CYOA 4CDRA 1WW8A 3GZNB 3L5KA 2JDIA 2QIOA 4KLRA 2O0KA 4N9WA 4PC1A 4RIGA 1RXVA 7MHTA 4EPTA 4YIHA 2CHFA 4OX9Y 2CE2X 2R5NA 3R2JA 4RV9A 4PAWA 4IILA 4QHSA 3P9QA 1CY1A 3IBTA 3K05A 5E9QA 1PJRA 5C34B 2W2VA 2VJLA 4B47A 3RANA 5ALGA 1G6KA 3LCUA 2XUZA 4JVNA 3KEFA 2PUAA 3PFIA 4B6EA 5FUVA 2PSEA 2GZ3A 3ADKA 1USWA 1DXHA 3CBQA 1GAJA 3PS9A 4GOND 1Z4NA 4DUGA 4EI8A 1KZ7B 4PBTA 5BYAA 2X8JA 4G5OA 1P4HA 1P9WA 3Q7PA 4RIHA 5AVRA 1AUVA 2ORYA 4IPTA 1OA0A 1RJEA 3O8NA 4LGMA 4BOYA 2I91A 4X8LA 3ZWWA 2YN0A 5REQA 4BWGA 3L8GA 3VOAA 4UHHA 3N0XA 2H31A 2BJWA 3C8DA 4D42A 3NHJA 4I5EA 1NDUA 3ZZ0A 5KTSA 3C1UA 3FCUB 1P5RA 2XVXA 3RSFA 4MSUA 1RAHA 1MQSA 3UXHA 3S8EA 1C14A 4DB2A 3UJ7A 3VNBA 5KQMA 1E5VA 2YC2C 1G8MA 2PH7A 1W5SA 1QVWA 2GAFA 3ILSA 5C8YF 1K8XB 1YH3A 3OHSX 5L7YA 1SQGA 4WXYB 3PNPA 2B82A 2YOHA 5KMGB 3IVAA 4QDXA 4E7PA 2ODPA 3IUMA 1V95A 2M6SA 5AT1A 3CF0A 2SCUA 3TZKA 1RTKA 3WTCA 4GQIA 1VPDA 1B1AA 1CF2O 2IS2A 4D0SA 3D0KA 2I4TA 1TT5A 1OYWA 3PXAA 4R6WA 4D44A 5L3SA 3H5RA 1X13A 3NM4A 3B3FA 4EKGA 3LVQE 4L2IB 2QMHA 1NXQA 2HRCA 3II6X 4N6GA 3JQAA 1LI5A 4M9QA 1EDZA 4NU5A 5IKPA 5J47A 4X63A 3HGTA 1NR5A 1VFNA 3QENA 3FHTA 2HXYA 5KYVA 2V9PA 2G4LA 3TW4A 1JAYA 1RMQA 4ROTA 1E4VA 4NMMA 4P2GA 4QGGA 4EKDA 5LU9A 1G5FA 2P1DA 2I22A 1LY1A 2WUDA 3AVWA 2IZ7A 2R1ZA 5FHQA 3RC7A 2DFKB 2QN3A 2V59A 5BT8A 4K2AA 5D2CA 1DX4A 2SKDA 4OKNA 2M6KA 5H8WA 2CVZA 2CSUA 2WNHA 3EIUA 2Z5FA 2VP4A 2DFLA 3S29A 1NWHA 2ACEA 2WILA 4HYTA 5DI3A 5BWLA 1EXDA 1LV7A 4RE5A 2WQ6A 1ZRNA 3EEQA 3RQIA 4GRAA 3UHAA 4G1MB 4FYJA 2QK4A 1UEIA 4CXMA 3RVOA 4D79A 3JZAA 4FT2A 3G5AA 1IONA 1HRKA 2X2EA 3PBKA 3TSWA 1LLCA 4NFYA 4AFNA 1TGYA 4G8DA 2D7CA 3SI7A 4DDVA 2KLBA 3W6ZA 4ZVPA 3Q7IA 3RSGA 3KAPA 1H5NA 3I9NA 1YMVA 1Q15A 3QOFA 4UAJA 3DFMA 3WNQA 3ZJYA 1U0OC 3SDBA 3RS7A 3ZK7A 4DMMA 1H3FA 1I7NA 1O96B 1SCDA 4BC1A 4EW3A 3DOIA 5EZQA 5U9CA 4YJFB 3ELWA 1ISGA 2O8NA 3D3NA 1QP7A 3BWEA 2HSDA 5AKIA 1TU4A 1HX7A 1CHNA 5EC8A 3ORQA 3LSYA 1SQ5A 4YONB 1P18A 4D6PA 3DYIA 4QOFA 2QJTA 5IAAA 2R1VA 1EGHA 1XPOA 3HP1A 4RTKA 2F8SA 3WBFA 3X43A 4QWMA 1WMAA 3ZCTA 4JI5B 2AC2A 4WRRA 4RJIA 1XD9A 1PT9A 2LD4A 4C03A 1FLNA 3SHWA 1ZHFA 2IYWA 3AI3A 2WTEA 2ZJ3A 1F7VA 4QU5A 3EQ7A 2Q0SA 1A7KA 1ZA1A 1I2CA 4QXOA 5CVVA 5M34A 4MRPA 3H17A 3LU1A 4U7PB 3LPNA 1GM5A 3PL1A 1CNMA 3WP0A 1TM3E 2WWTA 5AXDA 2VNSA 2X40A 4BEWA 2DERA 3R23A 3HXPA 3U9LA 3TLYA 5A3VA 3B1YA 2W58A 1DPGA 2C4NA 3JQRA 3OTQA 3SKYA 1N7IA 2IF0A 1EFCA 3QK7A 4FW8A 3UT6A 4BQRA 4C0SA 1ZOLA 4ZU3A 4CODB 2VQ6A 2XYGA 3GLIE 4LMAA 2FR8C 1PSDA 2CL7X 3GUYA 2WJHA 2J0EA 2BEUA 3A4NA 3O2NA 3Q8XB 4GX5A 4D81A 3H3FA 4PQRA 1J42A 3CM0A 2V55B 1K4YA 3ORYA 4UHBA 1SUEA 1OSNA 3E7WA 4KSYA 4RBNA 3B5EA 3B13B 1FTYA 4RWEA 2FN8A 3SOPA 1GZHB 3SC6A 4H3VA 3W4IA 1Q2XA 3SEQA 2MYUA 2FG5A 2IBTA 1GUYA 3NAQA 1GNPA 1KI6B 4RX1A 2H9AA 1UC9A 2HNAA 5JV5A 5KJCA 1XMQB 2WPDD 2XZTA 3LUKA 4RGBA 2GVDC 4ENUA 3DBOB 3IJRA 4AT1A 2JCBA 1QHIA 2O2DA 3QY9A 3C4VA 3VC7A 4ABYA 1YZGA 4FFMA 4X20B 2GN8A 2NQTA 3EZFA 3A32A 3P27A 4I1PA 2A33A 4MVJI 4B74A 1Z74A 5CXUA 2I2DA 2Q3JA 1HT3A 1T4GA 1XCMA 2X7JA 1KC3A 3DONA 1E1CA 3R24A 4U39A 4OIFA 4J1TC 3DA8A 3HWX1 1BDMA 4FHEA 1LUAA 4TMVA 5ALOA 4CQJA 4HK4A 3DMRA 5IH3A 1C2YA 4F6CA 4CYMA 3ANXA 4EG6A 4NJMB 3I9MA 2IPNA 2WJWA 2H2DA 3IP9A 1PIWA 2W0MA 2J08A 3HKBB 4YAOA 3ESQA 2G7MC 2ID8A 1HM5A 4IICA 4UVDA 1JFFB 1OKKA 3DLIA 4JK3A 4CUZA 2RJ3A 2PKCA 1LZKA 4LOIA 2R5WA 2PZJA 4PAQA 1I2ZA 1Y6JA 4R1MA 4ZV9A 4Z49A 3FYSA 3M0EA 3ZWKA 1JJVA 1A2OA 3KUKA 1M2VB 4MJ7A 4AZ3A 3NMUF 1XMSA 2XSZA 4MWSA 2OXTA 1WWKA 1D6NA 2HEIA 4Q18A 5AQ1A 3EMBA 3MINA 1BEEA 1YDMA 3ONDA 4QARA 1JFTA 3P0HA 3KQHA 1BSVA 3NS7A 3R4CA 1C9NA 3TIIA 3VHLB 1YIDA 1O4WA 3KVVA 2HLPA 3RU9A 4EY8A 3EQ8A 4FOOA 2GZMA 4MMXB 3WZ2A 4NXMB 3EXHB 3GBVA 1K8YB 1M0TA 4GMGA 2CLHB 4RPGA 1W36D 4CKWB 1SQ0A 5D84A 3HCOA 2QD5A 3KL2A 1JYFA 4Y3UA 3A1CA 3AUSA 4ACAA 4C7OB 4NMHA 4OSPA 5KOJB 1W75A 3DE3X 3IUYA 1U0HC 3ZLJA 2G4VA 4OQXA 4N9QA 3TMAA 3LMKA 4BDSA 4KYIB 5LA6F 2Y68A 3HL0A 4DDMA 4L5CA 2D7JA 2YY7A 3PNYA 5CFPA 2BELA 1Q17A 2WT9A 3U44B 3QU5A 4YHBA 3G13A 3TEJA 3NAZA 6CHYA 2G07A 1GPBA 4K46A 3K73O 5GZ6A 1OBFO 2MDTA 2VCEA 2Z95A 4ZVRA 3ZNQA 2XD4A 1WMFA 4B83A 3ZZNA 4CPDA 1DHRA 2AZMA 2B3DA 3HEAA 4ATNA 2P9HA 3ZHRA 4JI1B 2GOYA 3V4LA 1Q74A 3AERB 1UANA 4QYIA 5ADVA 1C9MA 1S2MA 1ZW6A 1RWKA 3MUEA 3ADCA 5EVJA 4AKSA 1RHJA 4O4LA 4MPTA 3N0WA 1PQPA 3K0AB 1UBSB 2CLMB 1J56A 3MGGA 3VOSA 3W2EA 3NVKI 3NH9A 3GGSA 1L4YA 2WPDA 3OE1A 1C1XB 4W1RA 1IOLA 3NOVA 3WRYA 4N3GA 5EP4A 2JLQA 4Y67A 2JFYA 3WOVA 4MPPA 1OREA 3AU9A 2VLIA 4ND6A 2H9IA 1YB6A 3EF0A 1BXRB 3GJ3A 4MWOA 3U7QA 3JZFA 3LVRE 3ZK8A 2OCKA 1X1DA 1Y5MA 6ABPA 1VP9A 4JLVA 2V45A 3DO8A 2A1IA 3VR3A 2GQ0A 4JLKA 1ABFA 4RYLA 3NWBA 1FBTA 1IB0A 1GRCA 4MLCA 1YHYA 4JR1A 2AHRA 2EOAA 2WIJA 4FVTA 4WADA 2X0DA 1FYDA 4KXMA 4HAVA 4DIOA 3FG9A 4H59A 4BFLA 3CG4A 4UMEA 1F4LA 3TKYA 1YDGA 5D7BA 4EJFA 3FRJA 1MRNA 3IL2A 1NQXA 2R6R1 2GH1A 4H4CA 4RCYA 4OHVA 4J0IA 4YDHB 3IP6A 1RWQA 3V7YA 4BP9A 4CCYB 1YQTA 2WJIA 5EHXA 2QVXX 3B6EA 1RI2A 2ZWIA 2FA9A 4UTPA 1XCJA 4PHTA 1JZQA 3T0GA 5CEFA 2YVQA 4Y6SA 1U63A 2ZRAA 4M1MA 5KSYA 5LQMA 1Z6PA 2HRBA 2HBRA 2IEAA 3DGFC 1KEWA 3AW8A 2E2WA 5KVSA 1H3EA 5EIBD 4CZ2A 4E4YA 1Z6TA 3K6SA 1ECGA 4PXYA 2R44A 4YJHB 4UPEA 2VK1A 5CXSA 4YRFA 4Z0NA 4KKVA 3GMTA 2MSNA 3IALA 4TRJA 2VG8A 4L6CA 4B8ZA 2FPKA 1C9YA