1UK6A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with propionate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 105
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk6A00
4BP9A 2XMRA 4LIPD 2XUFA 3FYUB 4M0MA 2UZ0A 4UBIA 5K3AA 1J1IA 3G8YA 2GYVA 4ZGBA 1QLWA 3C6XA 5AKZA 4NVRA 5LZ4A 3NOXA 2JGKA 1FSSA 2H7YA 4W1SA 1LPOA 3C5WP 4AB1A 1LZKA 2DQZA 3O4JA 1XZJA 1N5MA 2CEKA 2WU4A 4G4IA 4EY6A 2J4FA 2VT7A 2ONCA 1E66A 1EDEA 1XFDA 5JALA 3G9ZA 5FXMA 3C43A 1H23A 3C70A 3V1NA 3G9TA 3BDIA 5AKXA 4BZWA 3R3UA 3DYVA 2O2IA 4G8BA 4C4XA 5FDFA 2V9ZA 3KDAA 1BU8A 5AI0A 3RLIA 2PVSA 2QM0A 1DX4A 3FLEA 1VXOA 1ZJ5A 4J0CA 3C8DA 3O4HA 1CUZA 4DNFA 1SCIA 2WUGA 4DMHA 4HTAA 5LZ5A 2PUJA 2ZSIA 2C5GA 1IUOA 1G4HA 4KAJA 4PQEA 4ETWA 3ZWQA 3H2JA 3AIOA 4IQ4A 1A8QA 3EBLA 3CXUA 2QR5A 1MN6A 2WLSA 2XMBA 2EDCA 4B6GA 2GZSA 1EK2A 3IURA 3R3ZA 1DWPA 1KU0A 1OXMA 2B61A 2AJCA 3AILA 1DWOA 3RK4A 4LYEA 4BCBA 1RWQA 5C7YA 3WWCA 4Q3KA 2XQKA 1MPXA 2Z3ZA 4C87A 3ED1A 1CUWA 2G63A 2HA7A 2GBCA 3LCRA 4O08A 2WUEA 5K3EA 2XUDA 2XUPA 3IB3A 4DNPA 4GBGA 4UHDA 2QS9A 3LIIA 5ALKA 1DQYA 2C58A 5H3HA 3H0CA 3PFBA 5ALVA 1TQHA 1PV1A 2OLEA 4QDTA 5D3ZA 4DLNA 1EVEA 3R3VA 5DTIA 2OGTA 5AKGA 4BE9A 3UMJA 5AK4A 4AQDA 4UPDA 2RIPA 2VT6A 2H1IA 4QA9A 6YASA 5FPPA 4EY7A 3G0CA 5LIPA 5HQ3B 4H7FA 1DINA 2QXTA 5BOVA 1EI9A 5ALSA 1EDBA 1VZ2A 3IUNA 3IUMA 5AI6A 4F0JA 4MWSA 4B82A 2J3QA 1XQVA 2HRQA 4BC0A 1Y7HA 3O95A 1VKHA 2HL6A 1U65A 4ZXFA 4FFWA 1E89A 1BN7A 4HXEB 5C8VA 2OQIA 1Q84A 4A5SA 5DWDA 3ZLTA 4UBMA 5HKAA 2ACEA 3C8HA 1UKAA 5CMLA 1GKLA 3HEAA 3DEAA 5I8PA 4EBBA 2PUHA 2RONA 1XZEA 4KR0A 2WG2A 4F5ZA 5HK9A 4Y9SA 3DNMA 3G9UA 3M3DA 1TK3A 1LPMA 1G42A 5AKHA 1T4MA 2YH2A 4J03A 2HA3A 3DJYA 4BAGA 3AJAA 3VJMA 3Q0TA 4U2BA 3PUIA 2X8BA 4U2FA 4J3JA 4DSAA 2WSLA 3KD2A 1UFOA 3VJKA 1VA4A 3FYUA 4AO8A 2HFKA 1RYYA 3NGMA 3AUKA 4KAFA 3W9UA 3N0TA 4K2AA 1G5FA 1H2WA 1YB6A 3V1KA 4MQMA 3WIOA 1WB5A 2JGLA 4NS4A 4B9AA 2Q0XA 4FHZA 1CUGA 1ZIYA 4Y2YA 1QIKA 1C7IA 2WHQA 1B41A 1THTA 3V48A 3WJ1A 2DHDA 1YB7A 3A2LA 4X91A 1ORWA 3IVMA 3H2IA 4RE5A 3F9CA 2GBFA 1CUBA 2Y6UA 3C6ZA 2JEYA 5K3BA 5DJ5A 2WFMA 1NU8A 2R11A 3EF3A 3WYDA 5AK5A 4GXNA 3TEJA 1CUJA 2GBIA 1UK9A 2ZJFA 4QZVA 5LLSA 4DNOA 2HU7A 1DU4A 3IUJA 3G7NA 2V96A 3O4IA 3DCNA 5AM5A 5LP1A 4XJVA 2E3JA 3I6MA 1IUPA 3K6KA 2GZRA 5FKJA 2EDAA 4AX4A 5IH7A 1QIJA 1XQYA 5E4TA 5FLKA 1TCBA 1AGYA 3F97A 2V98A 1P0QA 1DWQA 1R50A 2B20A 5ALLA 5DYWA 1XZLA 2FJPA 1N1MA 2O7RA 4KE8A 5AP9A 1U2EA 1X70A 5JIBA 4UHCA 2Y2UA 4OB8A 4UHHA 1QO7A 5KWJA 3A2MA 5AK6A 1P0PA 4UBNA 3ZI7A 3CCCA 1UWCA 2IIVA 1VLQA 3WKDA 2RGUA 4DNQA 3WK8A 3FNBA 5HQ3A 1CUSA 2QKYA 4MQLA 5ALDA 2WG1A 4XVCA 3WJ2A 1CUHA 3QM1A 2HA6A 5JZBA 3STXA 3R3XA 5ALJA 1R88A 3WZMA 1XROA 3K9BA 4JYPA 4QDZA 4QE3A 4H7HA 3I1IA 2WIDA 1SCKA 1EB8A 3F96A 5K3FB 3M81A 1SC9A 4N8SA 3W05A 2VJDA 3B12A 1QFMA 1ZGBA 1EHYA 1IVYA 4N5IX 5E2IA 4MYDA 1CUEA 1CV2A 1ACLA 3BL8A 3I28A 3RKSA 5AI8A 2ZYIA 2FX5A 4CI9A 1R1DA 3AZOA 1GQRA 2QZPA 5HFNA 4B7ZA 1O6GA 4N8EA 2CUTA 1J07A 2XUGA 4CFSA 2DHEA 1TIBA 2PSEA 4HVTA 1XZDA 4FFVA 1ODTC 3DL4A 4W1QA 4GECA 3HLKA 4JUIA 5ALQA 2D5LA 1XZBA 5LZ2A 2PSFA 5A6VA 2JEZA 3ESBA 1VXRA 3DDUA 3ZLUA 3L1HA 2VSQA 3HZOA 2C0PA 5FOQA 3T4UA 3G0GA 3WWEA 4KACA 1GQSA 2W22A 3R3WA 4AN0A 2IX9A 3R40A 2DR0A 3ESCA 4U2EA 4DYHA 3FLBA 3OC0A 1HBJA 3HRHA 2HM7A 4G9EA 5LZ7A 1PJAA 4PSCA 4ZI5A 2I03A 1A88A 3W04A 1JJFA 1FFDA 5FP0A 5JZSA 1CFJA 2DSNA 1XLUA 3WK9A 1RP1A 1CUUA 2ZYRA 4X90A 3PF9A 3H19A 5CH3A 3CCBA 4CCWA 3JWEA 4GHWA 1VE7A 1DTEA 5HF9A 1YAJA 5JANA 3UUFA 1MU0A 4K6HA 5C81A 2ZSHA 3JW8A 1XKTA 4OB7A 2CB9A 1YS1X 1WHTA 4G8DA 2XLCA 4W1RA 5YASA 4Q3OA 2G5TA 1L7AA 5HKBA 5IKXA 3HJUA 1JI3A 1MAHA 5K5EA 2ZJ7A 3WK5A 4WCVA 3KWFA 1DQZA 2JGMA 4Q34A 1XZMA 5CXUA 2IITA 1MNAA 4GEGA 4X93A 1BEZA 1XRPA 1CLEA 1QTIA 4N8DA 5I7UA 1W75A 3O9VA 5ALRA 3FVTA 2FJ0A 5EHNA 1LLFA 4AMYA 2WJ6A 1K8QA 2LIPA 5ALNA 1E8DA 3R0VA 5HF8A 4C4YA 1O6FA 4ZWNA 4L9AA 3WK6A 5A7GA 3W2TA 3I2GA 2ZYHA 1CVLA 5C8XA 1LGYA 3H2HA 3FAKA 5K3DA 5CH8A 1HDEA 4Q3LA 3G0DA 3F98A 3WQHA 2QJWA 4FMPA 5JAHA 4JNCA 4WFKA 2Y6VA 1N5RA 2WTNA 3I6YA 2WIFA 5CW2A 4OUKX 5LKRA 4GLBA 5AKJA 5FUMA 2CZQA 1EH5A 1YR2A 3NUZA 2OAGA 2PSJA 3QITA 3QMWA 4FNGA 4H0CA 1XZIA 5K3FA 4QDXA 2RI6A 3FSGA 1QE3A 1BCRA 1Y7IA 1ODCA 1UK7A 1EVQA 5J3JA 4F60A 3WK7A 4KEAA 1C7JA 4ZV7A 3STVA 1K5PA 1XZAA 2G5PA 1CQZA 4UFNA 3FWHA 3STTA 5A62A 2QRUA 1LPAB 2B4KA 3FVRA 4G5XA 5JAOA 2Y2VA 2XQIA 1QIDA 2XMSA 4HZGA 1LPBB 4KE6A 2QTBA 1YASA 2WJ4A 4E11A 3I2JA 1JU4A 2XMCA 1CUFA 3ZV7A 3RM3A 2B9VA 3E3AA 4AZ3A 2GYUA 1ETHA 1XZGA 2WJ3A 2YASA 5AIBA 3VXKA 4EZIA 1UZAA 1UK8A 5JAPA 4JYMA 4J0IA 3D2AA 1GGVA 1ZD3A 3WI7A 1HKHA 4KRXA 2WHRA 1MNQA 5A71A 2OCLA 2XB6A 2OCGA 4X6YA 5D3KA 1UKCA 4H7KA 1OILA 4QWWA 3AINA 4H7JA 5AKKA 5AM0A 4KAAA 1W4LA 2WIJA 4B83A 5JASA 1F6WA 3TRDA 4X7BA 4LXIA 1QIMA 1H2XA 1TCAA 4OD0A 5EGNA 3QMMA 5CBKA 4I19A 5JAUA 5DYTA 3D5EA 3M83A 4IH4A 5CT8A 4MEAA 4E46A 2OCKA 4L3WA 4EY5A 4Q1VA 4DMFA 3STYA 5ALWA 4GDMA 3D0KA 1JMYA 1QTRA 1GZ7A 3ANSA 4BRZA 1IZ8A 1YSCA 2X5XA 4PO3X 3PICA 5F4ZA 3CN7A 4EUSA 4KJXA 4CG2A 3WL8A 2CBGA 5HF5A 3KXPA 2JIDA 4XWGA 3ESAA 4GW3A 1LBTA 4DGQA 2RHWA 4FDMA 1CUXA 4L72A 3R3YA 1B6GA 2CJPA 3SC2A 3OOSA 1JU3A 3WWPA 3VKFA 1K63A 4UUQA 4EY8A 4BC1A 3I6ZA 3KSRA 5ALTA 4RGYA 3M82A 1SOMA 2PSHA 4LKOA 5ESRA 3DOIA 2VAXA 2ZJ6A 3G0IA 3C6YA 1MX9A 2JGEA 3H18A 1AKNA 3BJMA 4Z49A 4XX1A 3U0VA 3GFFA 1AURA 1ZI9A 1XRRA 2AXEA 3AZPA 1IZ7A 5ALGA 5AM1A 5BV7A 4BBZA 2OQVA 2VJAA 2XUOA 3BDVA 3O0DA 3U1TA 2OGZA 5KBYA 5AHXA 2XUKA 1AC5A 2YYSA 4WFIA 4CIAA 1VOTA 5T4EA 3DKRA 5CT6A 2HIHA 1EA5A 4Y2UA 5AO9A 4G4GA 2H7CA 1F8UA 1FJ2A 1WB6A 1EDDA 3O9MA 3QPCA 2JGFA 1EB9A 4KE7A 2X76A 1XRLA 4EY4A 4PSDA 1YA8A 1GT6A 7YASA 4FNMA 4J0GA 2VATA 2XQGA 3G9XA 3WMRA 2HHAA 4Y2PA 4M0EA 2VAVA 3WWOA 1A8SA 5HCUA 4BZZA 2PM8A 3QPDA 2GBGA 1BS9A 1MAAA 5CT9A 5IVIA 4Y2RA 1SCQA 4OYLA 3C87A 5AKIA 3A6ZA 2VA9A 4J0DA 2FUKA 3STWA 4RNCA 2XUIA 1WOMA 1GXSA 4ROTA 1IUNA 1NX9A 3LP5A 5HFAA 4Q05A 4ITVA 4P93A 3V1LA 1H2ZA 1E8MA 3HYSA 1K6EA 5D6OA 1CR6A 2JGJA 3EIOA 4MEBA 3UUEA 4F21A 5A7HA 2J4CA 3OURA 3PDCA 2BFNA 2HA2A 3H04A 3AIMA 2OCIA 4AZ0A 3B3QA 1ORVA 3D59A 3C6BA 4UFOA 2ZYSA 1TCCA 1QGED 1MO2A 2XMGA 1KEZA 1R4ZA 4JEIA 5AOCA 3AZQA 3I1YA 2WHPA 1GKKA 4B9EA 4AXBA 3ZLVA 2VJBA 3IULA 1Q83A 4MJ3A 3BF8A 4P92A 4BAUA 4DMKA 4X94A 3WZLA 1U8EA 2C4HA 4MWTA 1QIFA 5FPQA 3YASA 4ZRDA 3FYUC 5AK3A 2JBWA 4PW0A 4OU5A 1W1IA 5EIEA 1XKLA 2OG1A 3I2HA 4DSZA 1AZWA 1BEEA 1LNSA 4X3CA 3S2ZA 2Z3WA 1L7RA 5JYCA 3GUUA 2H7XA 4NMWA 4TVKA 1MTZA 5LZ8A 4INZA 2ES4A 2XMQA 3EQ8A 2OXEA 3X3HA 2XMDA 5KREA 4BE4A 1GPLA 2PU7A 2YXPX 1ISPA 1JKMA 2ROQA 3WL7A 2HU5A 3DKKA 3TGLA 1ZD4A 1MX5A 1K4YA 3KWJA 1JT2A 2BGNA 5EFZA 3IA2A 5AI9A 3QPAA 4N5HX 4U2CA 5FRDA 2QT9A 3QZUA 1Z68A 4G1FA 4MYSA 3EQ7A 4HS9A 3RARA 4WFJA 2OPHA 4J0KA 3PI6A 1QIIA 3MUOA 2C7BA 2DHCA 1Q0ZA 4WDRA 3PE6A 5CTAA 5IVHA 4J7AA 3QVMA 5AM4A 4X6UA 1XQWA 2O2GA 5CT5A 4ARAA 1ODSA 4IH1A 2G4LA 2PKYX 1DX6A 3WK4A 4BYMA 1XRNA 3W06A 5ALIA 2XUJA 4U2DA 2V97A 2OAEA 3VVLA 3PUHA 1J2EA 3FBWA 4NZZA 3WKCA 3HI4A 4BP8A 5AKYA 4CG3A 5JADA 4WJLA 4OSEA 4HRXA 1QONA 4KE9A 3FCXA 2PL5A 4G4JA 4PV7A 3EQ9A 3PF8A 3VISA 1KU6A 4BDTA 1UKBA 1WPXA 2PU5A 4P9NA 5AI4A 5LYYA 4LXHA 3HACA 3GA7A 5SYMA 1UK6A 5LKAA 4U2GA 1A8UA 2XDWA 3BWXA 2JF0A 2XUQA 5ALOA 1CEXA 2HA0A 2BJHA 1VE6A 1YA4A 4OU4A 1W6RA 1CPYA 5BWCA 3JYHA 1JFRA 4ARBA 1QZ3A 3ZPXA 3MGAA 5EHXA 1AQLA 1WPRA 4BTVA 2HA5A 1CIJA 1J06A 4W63A 5LZ9A 1ZIXA 5AH0A 3MVEA 1Y37A 1ZD5A 1YAHA 4AO6A 5AM2A 3GBSA 4Y2SA 4C4ZA 2WKWA 4PF1A 4YX9A 3WKEA 5ISMA 3IDAA 1CUDA 1WCYA 5AM3A 1XZKA 3H1AA 2PPLA 1UXOA 1BROA 2CMFA 1JMKC 1R9MA 5K3CA 4E14A 4DMCA 2GYWA 4GI1A 3Q8WA 5AOBA 4AN1A 4BVKA 4FWBA 4BB0A 4CIBA 4K5QA 3HC7A 1FFAA 4BCCA 1BE0A 2WIGA 3VDXA 3DD5A 3L1JA 5HK8A 5JATA 2DCMA 1S8OA 3OPMA 2QVBA 1E8NA 2VJCA 3C5VA 1BN6A 4W1PA 5SYNA 3DYIA 1ZOIA 3D2CA 2XT0A 2I78A 4ZV9A 1I6WA 3E0XA 4JH0A 4GWLA 2AJDA 3WA6A 3BF7A 3P2MA 4CG1A 2Z8ZA 3DQZA 4G8CA 3GELA 4BCDA 1CUVA 5AI5A 3W9BA 2QMQA 4BAZA 3D3NA 1R9NA 4Y2VA 2WIKA 1UOOA 3ANTA 4UHBA 5AKLA 5ALZA 5ALPA 1XRMA 3B5EA 4S0XA 3V1MA 3BJRA 2WUDA 2C5FA 1QO9A 1HL7A 3HXKA 2WHPB 4OCZA 3DLTA 1A7UA 4LHEA 1WM1A 3DOHA 3GROA 3WKBA 2NW6A 5D7BA 5BWBA 2RAUA 5DYYA 1BCSA 2PSDA 4V2IA 2XUAA 4FBLA 3SX4A 3BE8A 4HXGA 5AJHA 1VZ3A 1HQDA 2R8BA 4H18A 1YCDA 2OGSA 1MX1A 4TGLA 1FFBA 4L0CA 4QLOA 1AMNA 3OG9A 1JJBA 2I3DA 5EIAA 2WM2A 1XLWA 3WLAA 1IMJA 1DT3A 4H7DA 1W52X 4UBKA 1FFCA 4FOLA 4WDQA 1LBSA 1QJ4A 3ILSA 4YASA 1ZGCA 2XQJA 2BGRA 5JD5A 1XZCA 1VA5A 3QMVA 1BRTA 3STUA 4YPVA 1ZI8A 1GPKA 1X2BA 2DQYA 5DNWA 5DLPA 4YK7A 2BUBA 1DT5A 1CUIA 2WFZA 4QEKA 4A23A 4B81A 5AIAA 3HABA 3D7RA 2O2HA 1U4NA 3AIKA 4CCYB 4OPMA 4FBMA 2PBLA 3WKAA 4XIIA 4UBJA 1QOZA 5IVKA 4DTCA 1QFSA 4B84A 5EHQA 5I9IA 3FOBA 4K6GA 5CXXA 5DNVA 3OTQA 4OYYA 3IIIA 3QBJA 4OB6A 4MXDA 1LPSA 5AICA 5T4FA 5FV4A 1TAHA 1N8SA 4D9JA 4IO0A 3HSSA 4DIUA 1AX9A 1VJ5A 2HDWA 2WILA 2O7VA 1P0MA 2QJRA 4H77A 4KRYA 5T4HA 1E5TA 1LPNA 2HRRA 1WHSA 3PFCA 2I3ZA 4C88A 3T52A 3G0BA 1HPLA 4DM7A 1CUYA 2WFLB 3FCYA 4BVJA 4W9RA 1TKRA 3A2NA 2AJLI 4M0FA 4IH9A 3KOOA 4TPKA 1C4XA 1HLGA 2WG0A 3IBTA 5A2GA 4B80A 3FYTA 5C8ZA 4LXGA 4RE6A 4I4CA 4X92A 1XZHA 4PNZA 4UHFA 4C01A 4Y7DA 4X97A 4HAIA 4EHBA 1ZD2P 3QYJA 2RHTA 4ZREA 1QIHA 1LPPA 4C6HA 5EIHA 2BUCA 4AMZA 4QLAA 1EX9A 4FLFA 4H35A 1EINA 3N2ZB 1T2NA 3VVMA 1D07A 4B0OA 1ACJA 1Q0RA 3WL6A 1USWA 5IVDA 4K6KA 5ALXA 4G9GA 2H9YA 3WL5A 3BIXA 4BTLA 4B85A 1EXWA 4Y2TA 3R41A 1MT3A 3BXPA 4FTWA 1W76A 2DFPA 2K2QB 2Y1KA 3A70A 3E1GA 1QIEA 4C89A 2XUHA 4HRYA 4WY8A 3E4DA 2CKMA 2XE4A 3D2BA 5DNUA 2Z5GA 2HADA 1F0PA 1ZJ4A 3H17A 1ZICA 2JGIA 5AOAA 1H2YA 1TRHA 4QDOA 3WYNA 3O4GA 4X85A 3SWWA 3LIPA 1QIGA 1XQXA 2WQZA 4AO7A 1AUOA 1MJ5A 4P08A 4QWMA 2XMZA 1L7QA 3F8SA 4X95A 2XI4A 3QH4A 4FKBA 5JD6A 4UFPA 2HA4A 2WTMA 3WA7A 2P8SA 3WWDA 1SFRA 2HU8A 4Y2XA 3LS2A 4Y2JA 5DTJA 3ICWA 4Y2QA 2WU3A 3TJMA 5ALHA 2Z8XA 5T4BA 3SK0A 2AJ8A 2VQ6A 4PSUA 3I2FA 4IHAA 2ACKA 3CN9A 4X6XA 5A7FA 5EHZA 5HF6A 4H7IA 1CUCA 4FLMA 5ALMA 1XRQA 2QXUA 1P0IA 2QUBA 1X2EA 3FSGD 3F67A 2BKLA 3MUNA 1G66A 1NU6A 2QOEA 5ALUA 1E3QA 3ESDA 4UBOA 4UHEA 1PFQA 4BATA 2BAGA 2C0QA 4RPCA 4A16A 3C45A 3VJLA 4Q82A 2D0DA 2VTVA 4CCYA 4I3FA 1LZLA 2ZVDA 2ECFA 4UBLA 3H2GA 5ALYA 1F0NA 4BDSA 4X00A 4BVLA 1GPNA 2PX6A 4EA6A 3H1BA 4QNNA 4B0PA 5AKEA 4WY5A 5KWIA 4QDUA 2VEOA 4HXFB 5JZ9A 4H7EA 4J0JA 3I2KA 1R3DA 4E15A 5CRIA 5EI5A 3I2IA 4EB0A 4LYDA 5E4YA 2QUAA 1THGA 2WUFA 1UOPA 3OM8A 3GZJA 5JD4A 3D4LA 2AJBA 5ALFA 3AFIA 5CT4A 3L1IA 4KYVA 4J0HA 3S8YA 1CRLA 5JARA 1H22A 3BIWA 5CH5A 2HFJA 2W6CX 3V9AA 2BUAA 3IUQA 2WFLA 1CQWA 2BCEA 1OCEA 1M33A 5E4JA 3FLAA 1EK1A 5ALEA 1UT6A 3G02A 3DL7A 1FFEA 1XLVA 1ZI6A 2XLBA 3NWOA 2VF2A 3K2IA 1CUAA 4FLEA 1UOQA 3ICVA 2XQFA 3H2KA 1JJIA 3LLCA 3DS8A 2ORYA 4X71A 1YS2X 5HZGA 5CURA 4BRSA 1WB4A 2EEPA 2J3DA 1XZFA 3WIBA
chains in the Genus database with same CATH superfamily
1KDRA 1RVV1 2ISCA 4WZAA 4G6ZA 3GRZA 1N2HA 4MW6A 1KGSA 5AQ1A 1MLDA 2ZSUA 1EA7A 1T6YA 3MXOA 1G4AE 4OJKA 4J7CA 4LWOA 1P7YA 1JAHA 2XVYA 4ENUA 1ZU5A 4UBIA 4XWKA 5C51B 3FI0A 4HUQB 1YQ9A 3V4LA 2AI2A 4ZYZA 3A6PC 5EJ6A 2EVWX 4JBNA 3R8XA 4B40A 3KKOA 2GYVA 1Z63A 2P79A 3SQDA 3ESYA 2JIBA 4OTZA 5AKZA 2JLZA 1W4ZA 4NVRA 5LZ4A 3WGZA 3TNJA 3NOXA 5FNVF 2IPNA 2IOYA 1AE1A 4KN8A 3L6UA 4NE7A 2H7YA 4CFYA 3WAGA 5CLJA 3C5WP 2D0OB 4AW9A 3TRFA 1T9KA 2DQZA 2ZGVA 1YB4A 3C7DB 3CNBA 4WZ6A 4LFCB 2EGGA 5JXGA 1R0LA 3FPCA 1XZPA 4YRFA 5IG2A 1HNZB 1R0WA 2E5WA 1OSNA 1SCUA 1QLHA 2VT7A 3PP8A 5C7IO 5F4BA 5HQTA 5IFKA 3I5XA 2O1WA 3ZHOA 1ENPA 3AEYA 4NFLA 4ZTBA 1EDEA 3UCFA 3KU1A 4PLVA 1DG9A 3TG8A 1NW5A 1A9QA 4E5PA 4NK5A 3G9ZA 4GOOD 3TW8B 1HE3A 1Q57A 3C43A 2GERA 3GYGA 3H1PA 5CD9A 6ADHA 3M2TA 3V1NA 2WBLC 3R9WA 2DWPA 1MB4A 4B3GA 3G9TA 3BDIA 5AKXA 1NPYA 3U19A 4YO7A 3O91A 3SGLA 3KDAA 3ELWA 4BUZA 3UT5A 4JYZA 2ZBDA 5AI0A 3RBVA 3EYAA 3D5QA 3O2SB 1EFDN 3TPZA 5KTMA 3JAWB 4QVKA 3HVUA 3QQPA 5KYKA 3FLEA 2ZSAA 1KI6A 4ETMA 1ZJ5A 4J0CA 4CEJA 2X6TA 1ULTA 2GKGA 4YECA 4F72A 1O95C 3IVXA 4GLLA 2PT7A 4HH0A 4IICA 5IAOA 4IRMA 4HTAA 3O90A 3GT7A 1GL6A 4MS1A 2FSUA 2I7CA 4TT8A 5LZ5A 2FE1A 4ZODA 4BFWA 1G4HA 2VJYA 3NIWA 2YN0A 4ETWA 1Z4KA 4AG5A 5FOSA 5JCJD 2GHIA 2QIOA 3H2JA 3DXYA 4IQ4A 5DNCA 4KXWA 3GBPA 2ODNA 3LDUA 4MW2A 4DJ5X 3EBLA 3FOZA 3CXUA 1IWOA 2EWVA 2A78A 2B3DA 3IHTA 1L4EA 5FBQB 1AG9A 3AEZA 4YRKA 5F7ZA 4PCUA 1GYRA 1MO3A 1YJXA 2ERCA 2QTGA 1H42A 1SKYE 2QBYB 4Q4LA 2EDCA 4B6GA 3DMFA 4QBHA 3RYIA 2DGDA 5DM70 2BN4A 4PCLA 5J40A 3B1VA 3BGSA 1FMJA 3IQGX 4C4SA 2GCOA 2IHVA 2JCXA 3KKMA 1R6AA 2IYQA 1KU0A 4YCLA 2W6ZA 4HVAA 4EJSB 3FETA 3RVSA 4LYEA 4UNSA 4FW8A 4LC1A 1KOLA 4EI8A 1ORDA 1PYGA 1X1EA 3ZDRA 2RARA 2XQKA 7MDHA 2P9HA 5ADUS 1SOAA 4ZEOA 1CUWA 1RJFA 2BM9A 4HS4A 2I9KA 4D97A 1OTHA 3D6HA 3PNQA 3ZE8A 1SQ0A 5G3ZA 4RFVA 3PFNA 5IHPA 5REQA 4MW1A 3GP8A 2BF7A 1J21A 1UXGA 3IB3A 2I4RA 1J1ZA 2Q46A 4DY6A 5CB4A 2DPHA 2JIZD 2LVBA 1GQQA 2P9FA 3Q88A 4OI2A 1JPJA 4DANA 4ZQEA 1KVTA 2Y8EA 3NR2A 1U28A 2PIAA 4IL5A 5KYUB 4IVRA 1XEFA 1ONBA 4M49A 5ALKA 5FOUA 5HSGA 5GZ6A 3NPMA 2HX1A 3JYLA 5FCDA 3V6MA 1DQYA 4FCWA 4QOGA 2AOUA 3L18A 3DXFA 3NDIA 4FQ8A 4OL9A 1XHLA 2J7KA 2NPIA 4R4JA 3JQ8B 1J0DA 3QTLA 3FMVA 3ABOB 2VA8A 3ETJA 4BMNA 1KDYA 4QKQA 3HGMA 1EVEA 3R3VA 5DTIA 4BFTA 1W0CA 2OGTA 3RHSA 1G20B 3ZBQA 1JIQA 3GD7A 3KVOA 4AQDA 2DBVO 2RIPA 4KO4S 6YASA 4U5QA 5A9TA 2FB9A 3MJVA 1B43A 4YRCA 3UBMA 4DGSA 4EGJA 5D1NA 4OH1A 3R7BA 4R3WA 4RZ3A 1GQ2A 5LIPA 4RLQA 3TPCA 4HAOA 4W6QA 1DINA 4E09A 3ZK7A 1JG1A 2PMKA 4OSOA 3DAFA 1JLHA 2QD2A 2YDYA 3PUJA 5BOVA 2QU7A 3NP9A 4D81A 1EI9A 3M1YA 4WGGA 5C31A 1EDBA 4MEJA 4GGPA 1RYMA 4K26A 4YRTA 2WJWA 3IUMA 4FOTA 4R3NA 3T3DA 4E7PA 5DYGA 3CX6A 2YYZA 1AMOA 3DLHA 4KBYA 1VLLA 3N2YA 2FPWA 4E70A 5EZYA 2HIMA 3TBKA 4GAEA 2GARA 2J3QA 3KZKA 1B26A 4B82A 4B3TB 4KL8S 2VAWA 3EC1A 3W6NA 2R00A 3J81k 5K45A 1QH1A 2CV2A 1JEQA 1MQ9A 3GEPA 4KUEA 4P3XA 2C03A 3P9ZA 4PTYA 1GADO 1Z25A 2Z5VA 1KXJA 3VYSB 4Q15A 3SNKA 2FF7A 3C7KA 1BN7A 2FWPA 2AFHA 2J48A 2P6PA 2Y1FA 4PHGA 1CF4A 1QE5A 1TT5A 4MIEA 5B3JA 4ZJPA 3D54D 1S5PA 5EWMA 4R5HA 1CR1A 3H9BA 3CZ5A 2F2TA 4GICA 1ZCZA 4BEBA 4DCNA 2F3RA 3C8HA 4EI9A 1GKLA 4NU8X 3DEAA 4N3NA 1J0XO 1NQAO 1EWRA 3JALA 5LP6C 1L5HA 4BOYA 5DHUA 1OBHA 1UPCA 3TH5A 3R0XA 1Z88A 2I5PO 4GI2A 5A4FS 4YY3B 3E3NA 2PUHA 2O3JA 3TF5A 4F5ZA 4A26A 3QK7A 3HU3A 1XNJA 1UFKA 4Y9SA 1TM5E 1EEXB 2WE7A 4U9UA 1JV2B 4X5OA 3P9KA 1HT2E 1YUBA 1C2YA 1KQOA 3E9RA 3W8FA 1TK3A 5HCNA 1LPMA 3LJKA 4X45A 3ZVLA 4AJIA 4AZTA 2AE1A 1X13A 1T4MA 3AL2A 2VUSA 3VKUA 2X7XA 4LDAA 4YEDA 4GEKA 1RWOA 3LNCA 2G8LA 3QVTA 3EY9A 1NBAA 3U4CA 2YHIB 5TE9A 1H4QA 2GVDC 2MJLA 3DJYA 2ETVA 3QG1A 1TM3E 2Q0QA 1HGXA 3OWXA 3O82A 4G0ZA 4WBNF 1ORHA 3F90A 3VJMA 3HEMA 1SXQA 3LG2A 4A8HA 1PQPA 2YWJA 4BLVA 4H1VA 3EZNA 4U7JA 4CDRA 4CTMA 4EUFA 3ODGA 4TWAA 1NYRA 2GBPA 1VA4A 2QJOA 3DZGA 3K53A 4HRAA 4OHXA 1C0IA 3B6KA 4HN4B 3T94A 3IYLW 2E4YA 5KO2A 1DBRA 1L4BA 1ZBDA 3H3FA 2GJ9A 4HUQA 4J0QA 4HK4A 1OWMA 2CZCA 1E3SA 1ZYUA 3N0TA 1X3SA 2WZDA 5EPOA 2NO1A 1G5FA 5THKA 1OFUA 2P3LA 3RAPR 2I91A 2D5AA 4QYIB 4D9GA 4YPOA 2I3AA 4M9UA 3RK4A 2E5FA 2PA0A 4MQMA 4TKMA 4LK2A 4RTKA 2QVZX 3E2IA 4MUJA 1Z6GA 2HLHA 3RYHB 3N3AC 5HA5A 1I0LA 3UPUA 4YAOA 2DLCX 4WKGA 4TWZA 3SY8A 2R8ZA 4F4JA 3P9SA 5L3SB 3AVQA 3GDWA 4B9AA 4DSOA 5K0FA 1W6UA 3I5AA 1POXA 4D82A 3D1VA 4FHZA 3NIFB 4E1VA 2GI4A 1GPMA 1Q7BA 2NU8B 4ND6A 2J8ZA 1WSAA 3WRYC 4F5WA 2O5RA 2XKJE 1H2BA 2PS9A 1C7IA 2C7RA 4EYSA 3TW8A 3MBOA 4MLDA 1KI8A 2WD8A 3NLLA 2FOXA 3QV2A 2FPKA 4YP6A 1KE2A 4ZT7A 1GM5A 3WJ1A 1VMDA 4G5GA 5FPQA 4YP5A 1NJ2A 2X0DA 5T41A 1I1QB 3S81A 4FEAA 2NTNA 5BN4B 1HH4A 2XRFA 4F4CA 3NFYA 1DCKA 3I6IA 4QFMA 2CCJA 4LZZA 2GXUA 2H4JA 1F38A 1AB5A 3EVTA 3KB1A 2XAUA 4X91A 4BUCA 1E0AA 3HMQA 1ORWA 1XPRA 3BB3A 2XODA 2NZVG 3F9CA 4K1LA 3SI7A 4NXMB 2WVHA 3JAWA 1BG6A 5LR6A 1KSFX 2GBFA 4WXEA 1L4YA 3CZMA 4K6CA 4NCJA 4OK5A 2XXBA 3LX5A 3W6OA 2F55A 3S3TA 2Y6UA 4Y1EA 4F9TA 1DCFA 3EN0A 3OLZA 3U7EB 3WWYA 5J5CA 5DJ5A 1D2HA 1D3AA 2BSAA 1JHAA 2E4VA 2TMYA 2YVKA 1TMYA 4LWQA 4OMFG 2OYCA 1LJ8A 4EKGA 1NP6A 4MS3B 3EF3A 2F17A 4EATA 1JI0A 2G88A 3UEOA 3WYDA 3H2SA 1MQSA 1ULAA 4GXNA 5AK5A 3E53A 5EY5B 3EK2A 4F11A 4NNPA 2G71A 5ICEA 2FU5C 1MD9A 1FTSA 5HDQA 3TAUA 3TVYA 1WHTB 2REXB 4IGEA 1RZUA 4XDZA 2RKOA 4QZVA 5IYZB 3LLMA 4FYPA 3WGQA 1O87A 4UDYX 2H0AA 2QF7A 2JIQA 1P2BA 3G7NA 4KLAA 2QBYA 1WXGA 4K87A 1TUIA 3WWZA 1WQ4A 4EHLA 4LGCA 3ZD6A 4PG8A 1FS6A 5BPFA 1AZLA 2Z43A 4JBWA 1TJ4A 2FPLA 3MK31 4II2A 4TMFA 4CN8A 3C7AA 4B17A 4EVQA 5LP1A 2C9ZA 2E3JA 2VUHB 2FV8A 3PUZA 3QELB 2GZRA 4IFEA 1GAEO 4XJVA 4YLGA 4O2AB 3AESB 4AX4A 4C3VA 4JBXA 4EJSA 4ZZIA 1P60A 1QIJA 3KSUA 1P7ZA 1QMPA 2JGRA 5I6DA 1D2EA 4AP5A 3HP4A 3I64A 4NARA 4FFPA 2I7TA 3WHLA 1R27A 5A5FA 1R8JA 5DPMA 4BNHA 1V71A 3B6IA 2I6SA 3RFXA 3R4VA 1BTOA 4R71A 2GCEA 1F17A 1IJKA 2IYZA 2G83A 2H07A 4BZPA 4R0VA 4QG3A 1VYUA 2IOQA 1JSLA 4EKNB 4IIEA 1R50A 1JG6A 3BCRA 4RVNA 3R7DA 1UAGA 2B20A 2AMFA 5ALLA 3PGJA 5CA1B 4OJQA 3QLVC 1O8CA 1V5FA 2PZBA 4KNVA 5FTKA 1UDXA 2QJFA 3SIRA 1NQXA 3NTXA 5KYUA 2OQRA 1E9RA 3PD7A 3TMYA 3U4DA 5I9SA 3KWLA 1QF7A 1NF3A 1RS0A 3H11B 4HLCA 4KE8A 1U2EA 2ZUBA 1X70A 4ZJZA 5BRAA 1ZITA 2XKAA 4IPTA 4UHCA 1IBSA 4YJ3B 3AM1A 3U49A 3E84A 1BS1A 3WBKA 3JQ8A 4UHHA 1FU4A 1ZHFA 5KWJA 3A2MA 1OLUB 4PAMA 1OYVA 5AK6A 5IKOA 3S99A 2R8XA 1P61B 1WPQA 3OE7A 2QSJA 3EGCA 2WTXA 4UBNA 1G20A 2N0SA 3CCCA 1DJMA 4RACA 3B3JA 1U7XA 5SZIA 1M1YE 2ZRKA 3HJRA 2H1LA 3OSUA 4BUJA 2IS2A 1VPDA 3GNTA 4M8LA 2VO1A 1N5OX 3OEED 4D56A 4BMYA 4WEOA 4FWTA 1CY7A 3B85A 4TTJA 2ZJBA 1K3TA 3OOHA 2QKYA 1PL0A 1J00A 1COZA 2FMXA 4ID3A 4MQLA 4MI3A 5F5NA 3TGWA 3WJ2A 3QM1A 4DWVA 1HDIA 4EHAA 3KUUA 3OI7A 2B7BA 1HX7A 3JSAA 4P82A 1NASA 4P7GA 5G2OA 3NHLA 5IT0A 5CIQA 1PW7A 5EZ5A 1H6BA 5IVPA 1BJRE 2AJTA 2I6UA 3H7AA 2HMWA 1LRLA 1NL3A 4JYPA 5FBLB 3VH2A 3NJ4A 3KZOA 2XGJA 4OLAA 4H7HA 4MV1A 5CIWA 3E9DA 3AGQA 2WIDA 3GRKA 2Q3MA 3D43A 3TSWA 4IZOA 3LWNA 5H59A 5KEIA 1SC4A 3SZLA 4PZCA 2JJ1A 3U62A 3LWDA 3IEMA 2QI9F 1OVMA 3W05A 4RL4A 1CJVC 4HGZA 2M6KA 1T3ZA 4RAOA 2L17A 3NH6A 1ZGBA 5E6UB 2ZR7A 3IOYA 4PGHA 5KHLB 1EHYA 3S6JA 5BN5B 5BT8A 5JNWA 4WBXC 5E4FA 3EH2A 3GCGA 5E2IA 3SYTA 3PFFA 3HN2A 3UAGA 3T7DA 3QVWA 2BH2A 3PX2A 3W5CA 2CYAA 2D7CA 4MQUA 4UU7A 4QELA 1PDOA 3RKSA 1GQFA 2YMLA 4FYWA 3O1IC 4MHOA 4RPLA 4CI9A 1R1DA 3LAWA 1FXSA 5BWOA 1KRWA 4X7RA 3W1VA 1L5RA 1KA9H 5LQRA 1C3LA 4G1MB 2CXPA 5DGXA 4ZU3A 2QZPA 2ANCA 1XKQA 1TECE 1ZNQO 1T5TA 2WAAA 1V8FA 1DAIA 2AD5A 2IHBA 1O6GA 1RZ3A 4JHXA 4PHCA 3ZCXA 2V59A 1F8YA 1AHIA 2RKBA 4QUEA 1E1QA 2A0KA 1EP1B 1V1RB 2E4XA 2BSQA 5ED4A 1WNFA 3UMRA 2PSEA 3KSZO 5FQOA 4UREA 5TDHA 3NBAA 3MB8A 3E5MA 1ODTC 3HG7A 4X63A 4EUHA 4LXUA 4R9VA 2YHIA 2QAJA 2QGZA 3HLKA 3ENQA 4L16A 2D5LA 5LZ2A 5TMPA 1TTHA 3ZV3A 3MJFA 3AJDA 1K5GA 1PFYA 4MITA 2G4CA 4L4UA 3ESBA 1PR9A 2V6FA 2QYSA 4JBLA 3IP5A 3VDRA 2GF0A 2POCA 2XAAA 3LM8A 1L4HA 3UC5A 1JNYA 1HG1A 2OBXA 3FPEA 5B7NA 4AECA 2OC9A 1GR1A 1P75A 1YC5A 4IOLA 3GMDA 1C3EA 4R2KA 3REFA 3T4UA 3O8BA 4A9AA 1YB2A 4IW3B 2W22A 3H5TA 3HP7A 4NBRA 2XNJA 3KJQA 2Q1TA 4Q47A 5IAAA 4QYIA 4AN0A 1XK7A 2B1GA 2W4QA 3T7TA 4B75A 2BLLA 3H8VA 3R40A 4YMUA 2F67A 2HPVA 3RYHA 3WLKX 1NW8A 2NTVA 3QNMA 2ZBVA 5KKAA 5L3SA 4H3VA 1HBJA 1XKXA 3M4YA 4N4AA 3BSYA 3DMDA 4Q9LA 2EHDA 4C0KA 1GOTA 1PP4A 5BUQA 1W73A 1Z7YA 3MTQA 4JJ6A 3CJQA 1J2RA 3FKJA 2NU8A 4DZRA 4W5OA 1Q1ZA 2CJFA 4PSCA 2G82A 1SRRA 2NX2A 4Q02A 3AB7A 1V8OA 1K66A 1KAHA 5EINA 1ZZGA 1ADFA 2GXQA 3FTQA 3SXPA 1ENZA 1PR6A 1TUEA 3PGA1 3QE0A 5H0IA 1FF9A 5EKSA 1JJFA 4ITUA 1SUCA 3FTNA 5DULA 5FP0A 5L45A 2I6QA 2PXCA 2BKUA 2BRUA 1GYPA 2NYRA 3VR2A 1R5NA 1WXWA 1CFJA 5BQPA 5BN4A 4UD6A 3PGVA 3KQHA 2DSNA 5EJIA 3MS4A 1XLUA 2VTEA 3VR0A 3WLFA 1D5WA 1UM9B 4RY0A 4XASA 2I3BA 1OZHA 4C1NA 4GDFA 4MSUA 3DXZA 4CDNA 3O8NA 4D0LB 4Q24A 1RWVA 3H5RA 2GTIA 3L8FA 4B7CA 4ERNA 5DI9A 1ID8A 1ODFA 1RFGE 2ZB2A 5FPHA 2A57A 1EE1A 2G0NA 1XQ6A 2QUIA 2HQRA 3L5OA 4GHWA 3ZLJA 2GJ8A 4NAVA 2VDWB 1AS3A 1E18A 1VE7A 4HAZA 3K9LA 1CVRA 2W0MA 3TD6A 1PWYE 4B34A 1YAJA 3ZK8A 3REQB 2P41A 3RWOA 1WEKA 3UUFA 3ZWDA 1O97D 1I1NA 2DHQA 2HQOA 4IDHA 2CXNA 4K6HA 1CNMA 3VU8A 4M99A 3Q2IA 1K2VN 2Q21A 2DT5A 2FUCA 4MUEA 3ZHRA 2RSLA 5DCUA 4Q37A 3W7VA 4QIHA 4V0SA 3LPAA 1IATA 4B74A 1JAXA 1NMQA 1RPNA 1YS1X 1WHTA 2W70A 3W77A 4DHWA 5IYZA 4G8DA 3ISTA 1CNFA 2H31A 3DUFB 4ZAGA 1G2OA 8ATCA 4ZT3A 3TBHA 1XN1A 3PT9A 3DO8A 4ZOBA 2G5TA 2CSUA 2PX5A 4K9MA 4JI8B 5HKBA 1PDVA 3K35A 3R77A 4MVJP 1PL7A 2A58A 3MJTA 4UM5A 4KQGA 1C80A 4JKYA 1U7ZA 2YRFA 4FDUA 3ELDA 4PLFA 4KWTA 2IIQA 1MAHA 4WV3A 2J9YB 3EDCA 1ZRMA 2C9YA 3QELA 4BWGA 5CYGA 3L49A 4O2AA 3CH4B 3AESA 1SKUA 2PUVA 1KP9A 1QK3A 1DAKA 4X1KB 3CEHA 3KLBA 3MW8A 3E7DA 3FA2A 3LD9A 4YDSA 1EXMA 3L6BA 4AJKA 4YV7A 3UAZA 3OEHD 2ZSDA 2R79A 3GIDA 4QULA 1UPAA 4BIIA 2XTJA 4YRPA 2C8JA 5IT9A 2OO5A 5JPCA 1H4VB 1QHGA 3JX9A 4GEGA 5IN4A 5B30A 4EZEA 1XRPA 3IOCA 1CLEA 1QTIA 4YUVA 3QSGA 1JKIA 1LV7A 2VSOA 5KX5B 4BGUA 5EHNA 5CA1A 1OREA 3VX4A 4ARZB 5HJEA 4YJFB 1UEXC 4XM2A 2A0FA 1K8QA 2LIPA 2AR7A 2QVGA 4NZYA 4KXXA 3RGWS 1DDGA 5AW3A 2EERA 5TQ2B 5AVSA 2VNKA 5KINB 1E8DA 2W2TA 4E5MA 1DEHA 3H11A 4KZPA 4LJ7A 4A3SA 4YJ3A 1CQPA 3HDGA 4U7WA 4EVIA 2Z0MA 3OQVA 2WINI 4JQZA 4B79A 3U39A 3MFYA 3ZS8A 5HKOA 1SC6A 4DILA 4E6PA 3KQLA 4WBNB 1J20A 1NVEA 4NE2A 1KSJA 4MUFA 3OLVA 3T5GA 1GDTA 1H9CA 5C8XA 1LGYA 2YVLA 1OLUA 3H4MA 4GYKA 3DE0X 3H2HA 2H5IA 3E2MA 4DR1B 1ZISA 3FAKA 4PC7A 3EZ2A 1Q92A 2BHNA 4TLDA 3CVOA 3UXHA 4D9FA 1SXJD 2CCKA 4QYXA 5A03A 1MZPA 4JSTA 2PO5A 2AZMA 2IDZA 2C78A 3LKZA 1WDKA 1U04A 1BIFA 5AHRA 2QJWA 3V4VB 3AF1A 3GAMA 4JNCA 4WFKA 2WTNA 2P78A 3DAGA 1XZ8A 4GUDA 4AU1A 1FUUA 1F7UA 4CT0A 3E3LA 4NQRA 4UM8B 2YHSA 4EO4A 5AKJA 3L6OO 1WV1A 1DB3A 5BQ3A 4YQYA 2WD9A 1AKMA 3T3IA 2W58A 2ZITA 1Z0IA 4WADA 1U1GA 5ESWA 1VJRA 4PEVA 1YR2A 3NUZA 4IOJA 4OAQA 3G2HA 4Y6RA 4C14A 3QSYA 3HBJA 3BJIC 5EAIA 1T9BA 2B1JA 2MR5A 1M2WA 3KTDA 4QOJA 4WXRA 3WJAA 2YZ2A 3D2LA 4YRIA 3T1TA 4TRRA 3IJPA 2IYEA 2B0JA 1KNQA 2XXJA 5KI6A 1D6NA 3A1UA 1RBYA 2H48A 4N7MA 4OP3A 3GJZA 3MOGA 1SXIA 1KBQA 5E6UA 5EWJB 1SM4A 3PA6A 4FFNA 5BN5A 1W0KA 2SECE 3GFOA 4P0PB 1F1JA 4YFVA 1YTUA 1U5AA 1XGKA 4L8WB 3EMVA 2IYFA 4WLNA 1R16A 3HCBA 3FN4A 4KEAA 4OQPA 4JEUA 5FEMA 1Z35A 3VZSA 1FBNA 1XTSA 2KLBA 3BXFA 1V35A 2K7FA 1HRKA 5GIPE 2PFSA 3KVNA 5JPDA 1K5PA 4FM9A 5JFGA 3GW8A 1ZEMA 1SKAA 3A32A 3E23A 4N3AA 2D1FA 5EJ8A 2I7DA 1I7LA 2H9IA 3SQNA 2SBTA 4UCFA 1UMBB 3DE1X 1Y8CA 3INYA 3I73A 3NBFA 2H2FA 3QX8A 1A9SA 1CQZA 1K4KA 1V1RA 1N8TA 1YDHA 3BCHA 5TMBA 3LPMA 4GPTA 4U9IS 3W5JA 5DMXA 1JHPA 3TX6A 1V37A 2QRUA 4UNRA 2A5YB 5A62A 3DMRA 5F2OA 5IXYA 1SUBA 2RAPA 4IRUB 4D96A 2EBFX 3FVRA 2UZIR 4PLGA 3EZ9A 4Q3BA 3K6SA 2XQIA 1H4TA 4UUOA 2J9GA 1XTQA 3ZCSA 1QBKC 1SJ9A 4ENVA 4KE6A 1LPBB 1OXXK 2QTBA 2ZTMA 3MAAC 4MPJA 2YVUA 2WJ4A 1Y33E 3GQBB 5BQXA 2IUUA 1J2JA 5KYWB 3BPSA 1T5HX 3I2JA 3P20A 3PITA 4R69A 1GUFA 3ZG6A 2XMCA 3DE3X 5E8RA 3INGA 2XDAA 2B9VA 2LXNA 1H2EA 2WW8A 1Y6QA 2UVQA 3FFWA 5EA2A 2GYUA 3NEPX 4KV9A 3LBYA 2V58A 2HB6A 2GZ2A 3TOVA 2PUDA 4JJAA 4D42A 2ZSFA 2DECA 1YRYE 2GAFA 4L7QA 3RGGA 4B5KA 5LYJB 3PSHA 2GO1A 4JYMA 3FMPB 1CW2B 3CR3C 4A8JB 5BPHA 1Y6RA 2UVPB 4F5YA 1MH9A 2GGSA 2DPMA 4BXOB 1GGVA 4MRVA 121PA 1NJ5A 2YW2A 3WI7A 4KRXA 2OL4A 3H9JA 4EO9A 5EJ9A 4KO3S 4G37A 2XB6A 4W5JA 1RQ2A 1RJGA 2CW5A 3G59A 3VR4D 5G4KB 5GP1A 3S5UA 2EJWA 1UKCA 3B5JA 2H1RA 2XWSA 2EZ4A 2GXSA 1NT4A 3Q85A 1R00A 5F2NA 4QWWA 1HE8B 3R44A 4TS1A 2NXEA 3J7TA 1YU6A 1KO7A 3AINA 5K09A 3EGEA 2VXYA 1YRLA 3Q12A 5AKKA 2O2EA 5B4UA 1S2GA 1OXTA 4RXMA 4Q48A 2AMYA 2GS9A 3N28A 3RT1A 1MRNA 4CHTA 5JASA 2VSYA 3UK1A 2AHRA 4BFZA 2OENG 4LXIA 4ZZ1A 1QIMA 4WFQA 1UM9A 1Q17A 4I50F 3A6DA 3C3WA 4NYIR 4AXXA 3OQOA 5IP5A 2JAQA 2C2KA 5DLYA 2VPYA 4LJSA 5T8KC 5E9QA 5B1EA 3U7GA 3JPYA 3VHLB 4D6YA 2F62A 1UMCB 2FI1A 1Q44A 2QNIA 2YJ6A 3QMMA 5DHFA 4MJXA 4EIWA 1B23P 2PMDA 3AMVA 2JJMA 1TEZA 2VDWA 4EECA 1B3BA 1Y82A 2MINB 4ARCA 3M83A 3U2QA 2QMHA 3REQA 4FR2A 4L9RA 3UMYA 2HWWA 3RVLA 3ZY3A 3LUGA 5D51S 3OAAD 4I2VA 1OJ7A 2F1HA 1YOBA 2VNHA 1DO8A 4QFCA 2QY9A 3AEKB 5AK0A 1O3YA 5H83A 4EG8A 3B7PA 4QUAA 3Q2KA 3TQOA 3AR2A 5BNZA 3SQWA 3CKYA 3LBHA 5ALWA 1N2OA 2RJNA 4GDMA 1GILA 2ZDQA 2P9CA 2W0SA 3DUFA 3G5UA 5TGDA 3BTOA 2OXCA 1C50A 2YWRA 2Q7XA 1KIMA 4I3HA 2DB3A 5J9FA 1PJ3A 1PGNA 4GX1A 4L6IA 4RSMA 5L3VA 5MF6A 2ADMA 2JFOA 4LXTA 1RXEA 4OHBA 1USKA 2NZJA 1ZOOA 3OOWA 4OBWA 4E07A 3W5UA 1OAOC 2PR7A 3RRNA 2CFCA 3LYLA 3ZDCA 3UK2A 2ATCA 3AU8A 3FVQA 1QV6A 2X5XA 4JN6B 4MWBA 4CNBA 5C37A 3FFXA 4Z2AA 2IYAA 4EUSA 3N8KA 3TL6A 4KJXA 3KZCA 4X1KA 1M76A 3WL8A 2JAWA 2CNWD 1V5EA 4LRWA 3JRWA 5HF5A 3WBJA 5DM4A 4DDVA 1Z17A 2JIOA 4YBRA 1N9ZA 2JIDA 4XWGA 4HD8A 1C9YA 4GBJA 2OCYC 4GW3A 4RENA 1XTVA 2I9PA 2QP4A 3O1JC 3RI3A 3IIEA 2UUOA 5FEUA 4RA9B 1XEWX 1AA6A 2J46A 1KAMA 4BGIA 5KYTA 1OU4A 2YHUA 3ROTA 3ZCTA 5KX5A 2NV2B 1M8PA 1MVLA 1XF1A 2B21A 2VYCA 1BC5A 3LDAA 4ARZA 2LDBA 3LVRE 4YJFA 4QGSA 1V9SA 4J16C 1T34A 2PLAA 5DDIP 2PS1A 1U1FA 4K8RB 5TQVA 5JXWA 4RDXA 4I99A 5TQ2A 3RD5A 1HRDA 5HKKD 3P45A 1QVVA 4XCXA 2HNBA 4XRGA 4FUQA 2J3MA 2CY0A 1TX4B 3B38A 3EGWA 4G5SA 2MOKA 2RHGB 5LWQA 1SOMA 2P6OA 1ZD1A 3WLOA 2ORED 3HKEB 2PZGA 4WBNA 1T5IA 3DOIA 4C6RA 3AJ8A 4D43A 2P35A 3GN2A 2C9CA 4FIDA 3PC8C 1TTQB 2XY4A 3C15C 3T5CA 4QJ3A 4YR9A 2HRCA 3KWMA 2ZUVA 2JGEA 2FP4B 5FOTA 4F1WA 1B15A 1N1GA 4RKEA 4C5AA 4UQLA 2Y3IA 4LRQA 3P7MA 5FL7A 5T64A 1W4RA 1U0EA 3GFQA 1XQ9A 4XX1A 4Z49A 1R9GA 3DWIA 4TSRA 4U2KA 5JJCA 4HLQB 4DV2B 2F3UA 2H2GA 1YE3A 3RS2A 3SHTA 1AURA 3IO3A 4C20A 3DZBA 5L7WA 2XOKA 2V7BA 4XQ9A 1DC4A 3NC4A 4IXMA 5ALGA 2G04A 1E1KA 4II7A 4RQAA 3A8TA 1Z4QA 3EZLA 1EFRA 1MG5A 4JR2A 1C0EA 2IZ6A 4F91B 1FXWF 4ETIA 1PF7E 1WLYA 3RRMA 1RLOA 4ZEVA 5KBYA 3ZU2A 13PKA 1HWYA 2F43B 1OYOA 1YJCA 3L0CA 5AHXA 1XDUA 4MS4B 4MRAA 3AI7A 1KVUA 1X7WB 1R5BA 3IS3A 1H2FA 2RBKA 3AR8A 3SFZA 3B89A 3OX2A 2HIHA 1ST2A 1EA5A 2IEYA 3FR7A 3SVZA 4TXNA 3HKDB 3L6EA 3ORRA 3DVQX 4IDEA 1M66A 1ZX1A 3LHDA 4ZCLA 2YNMA 5EWJA 2D8AA 1GP2A 1Y4ZA 2JFXA 5FL3A 2PH5A 3H65A 1PJQA 4PXAA 3FE2A 1Z2OX 3PCXA 3D8UA 2JI4A 1EB9A 3TNFA 1KRXA 4JI4B 3EUWA 1OGIA 3HHPA 4OIMA 1D9ZA 2JNWA 1ZSNA 4JLOA 2BGTA 4LVOA 3MD9A 3K1TA 2A9OA 4PSDA 1TW3A 3T3NA 2VP5A 5B7PA 5ADHA 1PVOA 1YA8A 1JLLB 1GT6A 2BFOA 3PNMA 1UMBA 4FNMA 2VATA 4BO3A 1SBZA 3RQSA 4LF7B 1C4OA 1I1OA 3DYBA 3WMRA 2WSSD 2HHAA 3IBGA 4P4UA 1RQNA 3TOSA 3WWOA 4AJOA 2HDHA 3GZTB 3IQIX 3QPDA 4FILA 4MPRA 4CKXA 1MJFA 2FEWB 1CY8A 3HB5X 2GBGA 5GM1A 5CFMA 1BS9A 2CJWB 4LNHA 4R31A 2HYIC 3JD2A 2O8EB 4O5AA 5CT9A 5IVIA 1YD7A 4OYLA 3UB4A 3TQCA 1PWEA 2H06A 3C87A 2G40A 3OIWA 4D7AA 3GLRA 1XWIA 3BD7A 1GNQA 2Z08A 4XPIB 1ZQ9A 3BD9A 2FUKA 1B2LA 1YJ5A 3GQBA 1M10A 1YL5A 2CHUA 4WUVA 3P96A 4G5YA 2XUIA 2YZMA 3VR6H 3W2HA 5KYWA 1WZCA 4TLLB 1A7AA 2IOFA 2NG1A 1Z13A 3PYMA 4IIHA 3K9WA 4NZOA 1KYWA 1L5SA 1HE1C 1FLVA 1JTEA 1TMOA 1SG6A 2WKSA 3G8DA 4BFSA 4BV8A 5I8WA 1L5NA 1E6EA 2VN8A 1OFTA 3PV0A 4XM1A 4IVQA 3RHZA 3STHA 4F7WA 9ATCA 1SG0A 3WFIA 5CNKA 2B83A 1R6TA 2RMKA 1YCFA 3TZ6A 4P31A 3DOOA 5LYJA 3TKAA 2ZW9A 1PZNA 3HYSA 4A8JA 2BEJA 5E6RB 2ZJ5A 4HT3B 1VBFA 2UVPA 4XZ3A 4YUAA 1LD3A 4BXOA 4UDOA 2A9KA 3FSRA 1MO4A 3AHHA 3QX7A 4GLFA 4M1YA 5JBIA 3FIUA 4F21A 4LF6B 4M9XA 2FEAA 2IGTA 4JBIA 5A7HA 3OURA 2F1OA 2ZJAA 3PDCA 1YH3A 1M8KA 2BFFB 2X2PA 2EX0A 4QXAA 1NP7A 3A6HA 3K9GA 4MUGA 5DXFA 3UW1A 4K3UA 3AETB 2CUNA 4LRTB 3I62A 1QOPB 1VBMA 2CVPA 3PFIA 3EMKA 3RTCA 1E3MA 4U4AA 4KLCA 621PA 3OJCA 4LZWA 4MW9A 1ZFNA 4IKOA 2ASVA 3LCCA 1LVUA 2V4MA 3NYWA 4FCTA 4DC9A 1MO2A 1P18A 1PHRA 4URWR 2VK8A 4QM7A 3NDJA 4HDRB 1QGYA 3ZJTA 1RJDA 2IXTA 2GZHA 1WF3A 1C14A 2CLIB 2IWRA 3DDWA 2JJ8A 5HUHA 1XBTA 3C4JA 4EGFA 2OD2A 3B60A 1UMCA 4DA7A 3C41J 1U0SY 2R751 2ZQ5A 3BWYA 3RRFA 3AKCA 4MJ3A 3K4QA 3RVRA 4F84A 2MINA 1BGVA 5FNZA 3UJAA 2MSKA 1F48A 3FCCA 4P92A 3KJIA 3WZLA 5TARA 2D2FA 3W34A 4KITB 4JZYA 2XGOA 1QIFA 2AZTA 4ND8B 2VHUA 1SCNE 4GM0A 3IQXA 4QECA 4M22A 1U9IC 3WMXA 4B71A 4MDEA 1U3VA 3FGZA 1AB6A 1YI0A 3QOYA 3VKWA 1PTJC 3AEKA 3QNWA 3UWMA 1EM8B 5D8DA 1LDGA 4HEA6 5B1YA 4FZRA 3GEHA 1L3CA 2J3JA 5AK3A 3WNVA 3N3BC 2PX3A 3AM5A 3DAPA 2HJGA 1ZMOA 3V7FA 3TM4A 1SVSA 1AJEA 5AVRA 1CXZA 4MVJH 4RH1A 3HYTA 2C42A 3F8TA 1HY3A 4DSZA 1CY4A 1BEEA 1XYGA 4RTMA 3U13A 4N41A 1NONA 4EEZA 1Q1QA 3IQWA 4Y9RA 2HT1A 3GGOA 1EDZA 4MV9A 1PQUA 4U63A 1DEOA 5DM60 3D7NA 1ZMXA 3A9VA 4FN5A 3UANA 1E2KA 4BVFA 4IWNA 2DR2A 2IYWA 1U0RA 1UBSB 4P4NA 5FUWA 2BR3A 2A9PA 1DXYA 1QQ6A 1RABA 1XL1A 5JYCA 4NMWA 5LQMA 1NW7A 4DAEA 1E9VA 1Z7BA 1JHYA 1MTZA 1E9DA 2C5LA 2GN1A 2ZIUB 2XE8A 3CVJA 1R5JA 2O2YA 4RA9A 4BNWA 5FUXA 3HUTA 2PMWB 2O7SA 4INZA 3X3HA 3LOQA 9ABPA 4D5EA 4R1SA 1FRNA 4IDNA 3FJYA 1ZM7A 2N47A 3NTVA 3SZUA 4I4LA 2D7DA 4Z3KA 5ERXA 2WWTA 2IPOA 1JKMA 3AFMA 3W1EA 2BE7A 1ZD8A 3WL7A 9LDTA 2J1LA 2ZI3A 2IKSA 4D9MA 1FUYB 1RZRD 2GN0A 2GD0A 4H3KB 3CY6A 1Q5PA 3K2QA 4BKPA 3V8EA 3JQ7B 1KP3A 4H7PA 4K3VA 1ZD4A 1MX5A 1UDRA 4JP5A 1OB5A 4OFBA 2UUAB 3HKEA 3IJEB 4A0GA 2TECE 2ZWMA 1JJVA 3UK0A 7REQB 1JT2A 2G9QA 3HVKA 2C82A 3OO1A 1GIAA 4IJWA 4PFSA 2JVIA 5KSPA 1MB9A 3IXQA 2FP4A 3QPAA 5FRDA 3D9QX 1VMKA 1QR2A 2ECPA 2QT9A 3NORA 3TXXA 4R84A 1ORTA 4Z99A 3RC3A 4V0ME 3TZCA 5GPBA 2O8VA 1M5RA 3M1IA 2XGSA 1OX6A 2Z9CA 4FE4A 1G3QA 1YBAA 2NQ8A 3EQ7A 4H1TA 4MYSA 4AJHA 3K3PA 2ZRMA 3DB2A 3JQBC 3RARA 3LYHA 3HWRA 1P1RA 1QG4A 1HYEA 2NYVA 3B9RA 2VZ9A 5BVHB 3TE6A 2FEPA 2Q0SA 4JC8A 4IQFA 3DDNA 3FB4A 1NBIA 3KNZA 2EW2A 1K2WA 3WGJA 3OPYI 1RYEA 6ABPA 4WK2B 3TG2A 3LQFA 1SBIA 5TF4A 3QENA 1E60A 1Q0ZA 3EIEA 4P3OA 2AEFA 2H4ZA 3FZYA 4Z8XA 3ZY4A 4UVGA 1G5RA 2F43A 2YHBA 2RJOA 1N0UA 1U94A 4MS4A 1TRKA 4O4LF 1M6WA 2Y0CA 3HA5A 3QVMA 1X7WA 2X6QA 2V3VA 4A91A 2KJQA 5L7TA 3PHGA 5KJCA 2LKCA 5EESA 2O2GA 2DH5A 4TXHA 2D2IA 3HKDA 1AKRA 4JJZA 3FF1A 4D6XA 1WVGA 4IH1A 2B5OA 3KHTA 4HWGA 4IJQA 5KTTA 1CU1A 2VRWA 1U8XX 4FQ7A 5JTTA 2VKQA 3GDOA 2PKYX 4FI3F 1DX6A 2LWIA 2C59A 3I34X 1XJ5A 1Y89A 2OBNA 2NU7B 3RU9A 4XDYA 1IHXA 3EVGA 4ZT5A 4M55A 4BJ5A 1WR8A 1E7YA 2BHRA 2ZT5A 4WN3A 1QKJA 2QB5A 1RBMA 4J2OA 2XUJA 3D0QA 1EZZA 1OXKB 1BCSB 3NKVA 5FBHA 2Q27A 1Z16A 1UZUA 1QCYA 3OM9A 3HDYA 4XIGS 3CZ4A 4EELA 4EP1A 3PEWA 3FBWA 2EFDB 1JLLA 2HHCA 3IBYA 1P9RA 3PE4A 1G7CA 2AXNA 1M83A 3ZIAD 1YACA 1RXUA 2WYIA 4TRJA 4ZVMA 3UF0A 4CG3A 1GCUA 4I4TB 4K9QA 1EVIA 4OSEA 1K9SA 1LU9A 3BGVA 3GVPA 4LVCA 3U31A 4MVWA 4A27A 3RODA 1XT6A 4W82A 5DBOA 4DZTA 1M1UA 5IARA 1W8IA 2CJWA 2O7NA 1CC1S 2OK7A 3K92A 4BX3A 1G7SA 2I34A 2PL5A 2AUNA 3FCXA 2CLMB 3MCZA 4HJRA 3EQ9A 4IZIA 4YCMA 2AOXA 2VFAA 5GONF 5C5DA 1FQOA 4QYWA 1KU6A 1I9CA 2P9BA 5AJTA 4HTFB 4ZQGA 5FPYA 3TOCA 8ADHA 3KL2A 3V4SA 5IBCA 1CULC 2OZKA 1NBMA 1Y5NA 4L85A 3ZXXA 2XZOA 4XPIA 2FR0A 4RHUA 4KWIA 3PTAA 1FLDA 1GAJA 1QVRA 1S1MA 2HGZA 2JCVA 1SC3A 1NG1A 1ZLXA 2Z2YA 1JQAA 3K09A 4X6LA 1TC1A 3UWSA 2X0FA 3IE1A 5IMBA 3UMCA 3ZHBA 3AP1A 5CDSA 2R3SA 4NEHB 4YCBA 3NOOA 4G0MA 3GHYA 4A0FA 4DEVA 3ET5A 2HXSA 4NU6A 3VPXA 2JARA 5LP6F 3HPRA 1RRMA 2UU9B 4JWKA 3NT5A 2NAPA 4YAIA 4AF6A 1KAOA 2BEKA 3PWSA 4IS3A 5IM5A 1TJPB 4IQ8A 3RUFA 3BWXA 4D6PA 2P4UA 2ZYDA 4I66A 2W2LA 5E6RA 1XVTA 1AQYA 2JF0A 2IZ7A 3FROA 2H16A 2QV7A 3M4XA 4AP9A 4BNGA 4ENRA 3OFND 1W88B 4YMHA 4QODA 3IE2A 1JH9A 5ALOA 2ZB3A 1Y34E 1ZH2A 2VEDA 4W5NA 1TO6A 1Y8QB 4JOQA 1AY0A 3Q8LA 1WF6A 4Y67A 3TO5A 5IZ4A 1W6RA 2BFFA 4DC0A 2IHUA 5F73A 1NA5A 5IK2D 1DBQA 2B1IA 2ORVA 3AETA 2QMYA 3MAGA 4HGYA 4NNJA 2PEZA 1JEEA 1SUFA 3KD3A 4RVSA 1CRQA 2FX3A 2IOFK 1ZN8A 3S2YA 2Y93A 3R6TA 3MGAA 4NBKA 3UN1A 1G3IA 3B6ZA 3FSEA 1ADBA 3TXAA 1ZRHA 5K8UA 2RG1A 4JGBA 4MIKA 3RC8A 3ET4A 1U1IA 3C3EA 4FZJA 4MV6A 5CDHA 2NZXA 1CIJA 1KPIA 2X8AA 2I6FA 3GWGA 3KVVA 3MMPA 3H0EA 4HDRA 2PLWA 16PKA 4W63A 3LF2A 5LZ9A 4HC4A 4GOXA 2O2CA 2HV9A 2JRCA 4F2DA 4JCCA 3OU6A 3RG2A 3VKVA 4KK3A 1SRQA 1T9ZA 3OQBA 1ZD5A 3IEKA 2L2QA 5KUTA 5AM2A 2WF5A 5LNK6 2WE8A 1DKRA 1CB7A 5KQRA 1TLTA 1R3UA 3GBSA 1JXOA 1NKTA 3QVSA 1X80B 1JBEA 1DRJA 1QCCA 4FXOA 4WINA 2XD4A 3AFNA 1WMFA 3LT2A 3L05A 3WKEA 4ND8A 4DADA 5ISMA 2ZQYA 1Z74A 1SD1A 2R7NA 3DKVA 1WXHA 2P2CA 1CUDA 1EUZA 1EM8A 3CEMA 1RHMA 1TADA 2BFCB 3H1AA 5LA6B 5BNWA 3DMTA 1ESEA 1Y4SA 1XNGA 4X1YB 2OSVA 2ZJ0A 2J6BA 3BORA 4UTXA 3GUZA 1JMKC 1TDJA 1Y3BE 5G0TA 3KCQA 3OT5A 4DMCA 1QO0D 5JJBA 1NBWB 3EIWA 4GZLA 1TQ4A 4HI0E 2JCSA 2IV7A 4EKIA 2QTVB 3RCBA 3A31A 5BSFA 5HWSA 2IRWA 4BVKA 1ZSVA 4EHIA 5ITVA 5A05A 1KXZA 1UJMA 3RU7A 2G7ZA 4UE3S 4MA0A 4LXYA 3FOWA 3KP1A 1DUIA 1ZXLA 2G7MC 2GM3A 2PN1A 2VXOA 2RGYA 3WLPA 5DO9A 3BIJA 4IQGA 2VDPB 1I4OA 4F97A 3LKVA 3EF0A 4URVR 3ITKA 2A1IA 2PJUA 3TDKA 4M9CA 1G8AA 3L1JA 4DUZB 1B74A 1TYDE 3EZ7A 4QTTB 3IMCA 5HYVA 2HZBA 5HK8A 2Z6VA 5HOEA 1ISRA 5BVGB 1THMA 4GM1A 1MOSA 5JATA 3KQMA 4ZC8A 3SM9A 2V5AA 3OPMA 2QR3A 4L51A 1A5AB 3MWGA 5HFJA 1PQWA 3B2NA 2FEMA 4BFCA 4FYIA 2NAFA 1NM5C 4MA5A 2MCFA 4JP3A 2B5WA 3F74A 3WBBA 1KBOA 3QU4A 1BN6A 2CUZA 3FNIA 1YQTA 5SYNA 4PBTA 3WLRA 1ZOIA 3D2CA 3JQ7A 3JQCA 4P5DA 1ECGA 4MKRA 2XT0A 2KYRA 4F2PA 2J3KA 2O1EA 3BA1A 2GRUA 4MUIA 3E0XA 3LVFO 1QLJA 1Z4OA 1ZN2A 2R7LA 4JH0A 2JFUA 3HU2A 4PIPA 7REQA 5JCOC 4NP6A 2ETXA 2INGX 4LTNA 3AFGA 1RM4A 2QYHA 3WDMA 1P29A 4OXQA 1YE5A 3RKRA 5FBVB 1L4LA 1L7XA 3KPUA 4Q18A 1VM6A 3WGTA 4JX8A 1C7FA 2EJTA 2P0EA 1SWWA 3MT9A 4OQZA 3E81A 4PGMA 5KDOA 4PX2A 1F5NA 2GN6A 4LOJA 3PVZA 4XW2A 4X1IB 5BVHA 1T36B 5IKMA 1HYHA 1SWVA 4RH3A 4ZI7F 4YALA 2R1VB 4A2QA 2VJQA 3UHPA 2FSVC 3D3NA 4KXVA 3OOEA 4C5BA 5JSFA 5K0JA 2X14A 4LYJA 5C9ZA 1LF0A 2Q3HA 2XZTA 1NY6A 3LRPA 2D4HA 2AGVA 1OT5A 3MJSA 4LXXA 4QC2A 4TRNA 4UVEA 3KDSE 4Y2VA 2G3YA 3ANTA 3ZBPA 3ZOZA 4DWWA 4EGCB 2P90A 1U8FO 2O05A 3GFRA 5ALPA 5TS3A 2C83A 3BGOS 3I8XA 4I8IA 2JD1A 3JAKB 1NXVA 5DHQA 1E7WA 1DQNA 2WEKA 1Q3KA 2WUDA 3BJRA 1AHHA 4WVFA 4JQCA 4QSHA 1HL7A 1HTBA 4OCZA 4DMGA 3NBZC 3AX6A 1PT6A 5C34B 4RMGA 4RD2A 4ASUD 1PNQA 2ZS8A 3ZVMA 3GMTA 1RC0A 4O29A 5HG0A 3IUEA 4K9PA 4YRGA 2PGLA 3WISA 3CU5A 1SUEA 2B1RA 1UBMS 3DOHA 4RHCA 3KAKA 5A02A 4TV9F 5FPTA 3BC1A 2AEJA 5H7XA 1JQJC 2NU7A 3X1DA 1QG2A 2B9EA 4BLOA 3O8OB 4CBVA 3K2EA 5D7BA 1ZD9A 5JYBA 1NXXA 2JK1A 2DBRA 4NICA 3F71A 5JW6A 4PNPA 1BCSA 2IFTA 2CLSA 2PSDA 4CMIB 3G17A 4UOZA 4M76B 4UM9D 3SX4A 2XNSA 3BE8A 1II0A 5AJHA 1RRFA 5I4BA 1PWHA 2P4SA 2BDTA 1OVGA 3EQ6A 1Z6PA 3NWJA 2BFMA 3T3MB 4PN3A 1EIWA 1QTNA 1GNVA 3NNSA 5K6TA 2IV2X 3VTZA 3Q4GA 4QUDA 4AS2A 4I4TA 1GEEA 1X77A 4IGKA 2R8BA 3JZMA 1E2UA 3QUCA 3MYRA 5LWHA 3BL6A 4DJDC 2JAOA 4NOLA 3J80A 1FDVA 4RCYA 4QLOA 1AN0A 2NGRA 4ANFA 4OGWA 5M29A 4GPEA 4R05A 1NV8A 1L5QA 1S02A 2YQZA 2ZJ1A 3CIOA 2JFFA 3MQ4A 2HLPA 5CA0F 2JCYA 2DFDA 3T4PA 4Q3NA 2ZIGA 3I0ZA 4HTFA 4WJKB 5CJJA 5TQ0B 3DJFA 3L9XA 1POWA 4ILKA 5JDCA 3HYNA 5LMNB 1IMJA 3A9RA 1K98A 1DT3A 1W52X 1NVVR 1VJCA 4Y1RB 1FFCA 1QJ4A 1PT8A 1T9DA 1KTIA 1IWBB 1DARA 3Q41A 1FEZA 4HPJB 1KYZA 3R5TA 5DN9A 5T57A 2AH5A 3IXLA 3KSAC 2Q6OA 1CR2A 3ZJYA 2R7AA 3KEMA 2BJVA 1ZI8A 5FORA 3ED5A 4OMCA 3OLWA 2JH3A 3HN7A 3PC2A 3FDZB 1U0BB 3KOWA 5A0TA 1XCJA 3E58A 2C5SA 3HDQA 4DDHA 5DLPA 1WV0A 4YK7A 4CM8B 5A4DA 1ZVMA 4JI2B 2GPAA 3FPSA 1W88A 4JFAA 2V6JA 4NDNE 5E1DA 3I12A 3TW4A 5KCZA 1W49A 1JAZA 1E2EA 4TWRA 4WBSA 1Y8QA 2R8RA 3IJ5A 3MGKA 5AIAA 4E22A 4OM8A 2J41A 2LDXA 3CHYA 5FUYA 1L6RA 1WXDA 2C77A 1CK4A 1T9GR 5CR9A 3I9FA 4QICA 3VX3A 4HNAB 3LFUA 4GR4A 3BXOA 4I1PA 3D7RA 4I08A 5C5IA 2O2HA 4CR7A 1U4NA 2HHHB 4B8WA 4Q9IA 3GXOA 3BWCA 1I7QB 2XPCA 3I2YX 5DTQA 2ZIXB 1V11B 3AIKA 2ESRA 4PSKA 3RYCB 4OI4A 1ESCA 4R54A 4ZHQB 1J1UA 2QMZA 5GJVC 2BZ0A 3ADKA 4LRSB 1FP6A 2VZEA 4RU1A 3UG6A 4BNLA 5JXIA 3I45A 5AUNB 1XCMA 4MOWA 1LTHR 4X0EA 1VPVA 3IP9A 1SN7A 4HF7A 5CX4A 1STOA 2ZUFA 5TX7A 1GTMA 3FCSB 1CZNA 1W87A 3PHCA 1ZUNB 3HY4A 4E1AA 2O8CB 1KORA 1C9NA 3BMXA 2HJWA 4TL9A 4B84A 1MJGM 2HJSA 4Q4AB 3V97A 3W3AA 2LV8A 1EVLA 5H70A 1X80A 3KOUA 4CTNA 2GLTA 3KJFA 4MR9B 1Z4IA 4QT0A 4B47A 5H4GA 2PRJA 4QUGA 2RK6A 2CWWA 1P1HA 2IEGA 4Y0AA 3MS7A 5CBPB 1LK5A 1F6DA 1RMYA 4G9BA 2Q5IA 2YFYA 3AUXA 3JQFA 2ALJA 4L0QA 2BFCA 3RSGA 4WWHA 5LA6A 4X1YA 1AHPA 1T6XA 5CX1B 1TAHA 2CVZA 1E5QA 1N2SA 1TVEA 1BQ4A 2NO6A 3BDAA 1VJ5A 2HDWA 5LB4A 5LQSA 5J5VA 5B7QA 1KTVA 1K97A 4L15A 1P0MA 1COWD 2WVAA 2QJRA 4O4LB 3V8BA 4H77A 4PXSA 2J30A 1NMSA 1NR5A 1PJ8A 2GQ0A 4IFIA 2QTVA 5T4HA 4IDGA 4ZALA 3VZBA 1QAOA 2Z4SA 1C5KA 3GLKA 2I3ZA 4I5IA 1FDRA 1Z3IX 1I32A 3GIWA 5ETJA 3TNLA 2FW9A 3ZVRA 1TYAE 2R4UA 3NHAA 3HUFA 3LLUA 1K06A 3V00A 3PNLA 1GZVA 3GAFA 4BYMA 4CMAA 3D8BA 3ZE7A 5A3JA 4GKVA 4DM7A 1CUYA 2WFLB 4ND3A 4BVJA 3NDPA 4W9RA 3IBSA 2X1VA 3D64A 3GJ0A 2J0UB 4IH9A 2A35A 2JLWA 1P4JA 1O1YA 2VXCA 1T6ZA 3FUXA 1HLGA 3AR3A 3GMIA 1V7ZA 1EP2B 4FYYA 1O97C 4XAQA 1ZJYA 2B92A 3BK2A 4IXDA 4MVJI 2OZEA 4BWVA 5BVGA 1PX0A 2Y0EA 3CR8A 4B80A 4FT2A 3NVDA 4B6QA 5C8ZA 2OXTA 3E7WA 5B7GA 5F7OA 4X92A 3LZCA 4PNZA 2BJWA 3U3RA 4D0SA 5JDIA 4BMPB 4D98A 4AQ7A 4X97A 2UZAA 4EMBA 2O07A 4CMEA 4Y18A 4R3UC 1ES9A 1RKQA 1ZD2P 3QYJA 5AJXA 4TZ6A 1HI9A 1LPPA 4ZVLA 3AF0A 3K1YA 3S2IA 3WAJA 5J4VA 4C6HA 4BWFB 1TNDA 1Z45A 2O3UA 1TYCA 2BUCA 4RK6A 1QORA 4R16A 4MIYA 3MFQA 5KHAA 1CT9A 2EKLA 3ADBA 4RZUA 3INTA 1EX9A 1KBZA 3DT8A 4FJ2A 1T1JA 4PRZA 4QTYA 3M2PA 4A36A 4H35A 1SU6A 2IF0A 2ZDGA 3WX0A 1Y1SA 4AYXA 3N2ZB 5BSTA 3KDPA 4HLDA 1JR3E 5MN5A 4PIMA 4QU5A 1WABA 4WRRA 4PS0A 1HR0B 3A9UA 3EXHC 2QG4A 4RTOA 3MCAA 3W5AA 1RKUA 4JJGA 2WF6A 5CLQA 3OCJA 1WULS 3REOA 4XSHA 2ADFA 2BOVA 1FPMA 4K6KA 1RE0A 2HSGA 4OBBA 4X1IA 3ZY6A 4BO8A 4D4KA 1XXHE 1T36A 1Y3HA 1Q15A 1IQPA 2PEYA 3BWVA 1KH3A 1KH2A 3R5SA 4K9SA 4RPJA 3DWGA 3VBCA 2AFRA 3CISA 2R1VA 5AXDA 5KQMA 1GN8A 3DEIA 1X7HA 3BXGA 3DEFA 4L8GA 3CSUA 3RC1A 3LF1A 2EV9A 3W9YA 4MVJD 4MTLA 2VP9A 2B6NA 4ACAA 1OIVA 3BCUA 4JK3A 1ZLYA 4R1LA 5EVJA 4ND1A 4B85A 4E0BA 4ZMRA 5LMUB 2NMVA 3IILA 3DMHA 4MP3A 4Q6WA 1E1RD 1P9OA 1TAGA 5K0TA 1M3SA 4ZOCA 3JAKA 3BXPA 3O7WA 3TTYA 3WS7A 3IE0A 2K7ZA 1V26A 4BKMA 3A70A 3E1GA 5KNDA 3ECCA 2BH9A 1FCJA 2XGGA 4H4EA 4NC9A 4WY8A 3SZOA 3SYMA 5CIYA 2DKNA 5K01A 2CMHA 3SSMA 1JVNA 1SXJC 4Q7EA 3HJCA 2RHLA 2Q2VA 1CY2A 4HNTA 2C54A 2QV0A 3RDPA 1MA0A 3GO4A 2JGIA 5AOAA 1J56A 2FRDC 3O8OA 4Y7CA 4B6SA 2R4QA 1P73A 3T5BA 3C3CA 4ZKEA 3WYNA 3KHUA 3V3TA 4BNDB 2G77B 5B5SA 2VCYA 4CMIA 3GH3A 3B1WA 2P4EA 5LMZA 2VDUE 5FI1B 5BSUA 4FX5A 2X58A 3IBFA 3QU7A 4HVLA 1XQXA 3MJEA 3EARA 5J58A 1MJ5A 2XNCA 4P08A 4MICA 5HR5A 1OWOA 1MGPA 3NBMA 5JS1A 1KJ8A 3EGIA 3MTDA 1GTZA 2H1CA 4BN5A 4CMBA 3OLYA 4OGFA 3QH4A 3R0QA 4L5YA 3V3KA 1ZIOA 4ZO4A 5E1MA 3Q9UA 2HA4A 3I3OA 3OPVA 5DTMA 2OA0A 2PD6A 2H5LA 5HQJA 4B3DA 3WNDA 3IKTA 3IQFA 1G8YA 2MSCB 2BM0A 3UWKA 1Z4NA 3WWDA 1NI5A 1U0FA 3D3EA 2ZYTX 3LQQA 4QTUB 5DTJA 1S3GA 5ECYA 5ECGC 2QPTA 4UPEA 5TQ0A 3SEQA 3OTGA 7GPBA 1RHQA 3ICWA 4Y2QA 2H4XA 2PXXA 3K05A 3TJMA 3KM0A 1SG9A 5IWAB 1ITZA 4DSNA 4DLKA 4Z4HA 2AYXA 3I2FA 3QUBA 3KTFA 5C4MA 4Y1RA 2RD2A 4X6XA 4MUNA 1AXEA 5D3QA 2IY8A 5JPIA 3B6EA 4HMPA 4ZOEA 2I2BA 3CCFA 3CIFA 1JGTA 3HWWA 2VHWA 4LJLA 1HC7A 3WIDA 2W6IA 1L9KA 5E0KB 3N6XA 5KAMA 2G6BA 1T1SA 1C9DB 5ALMA 2A1UB 4DIEA 1O57A 2DMRA 2O20A 4IDBA 4Y3UA 1U2TA 1KO8A 4RD3A 2JA2A 1P0IA 2J9XB 3L4KA 4KNWA 1T2EA 3B3FA 3FDZA 1XE3A 4GC5A 4N12A 1WJGA 4XE5A 1DPFA 3F67A 1MTOA 3VRHA 1KEWA 1D2NA 2C2BA 2JFNA 4RHXA 4CM8A 3QVJA 3QXSA 1I3MA 5HP4A 5EUQB 3CV3A 3T4EA 2AUTA 4R9SA 1XVIA 5CB8A 4CM5A 4MUBA 1O95A 1GA6A 1E3QA 4Y0NA 5EGSA 1KDPA 4JT2A 4UBOA 1LSOA 1Z5WA 3DFZA 5JI2E 3NWEA 3AY3A 1HYGA 4DKXA 2FFJA 2NP7A 1OFHA 3KYIB 4BGEA 3HJNA 4A16A 1A1SA 2QRHA 3AUAA 1RBQA 3LBNA 1ML4A 4RIHA 3UV7A 2HRZA 1KI4A 5EWLB 2ZIXA 4MGKR 2C96A 4HEA1 2CLHB 1JZSA 1V11A 4O4JB 3N53A 2V3CC 4YUWA 3AKEA 3RYCA 4EY3A 2P9YA 3PI7A 3D5TA 4ZHQA 4S2UA 2YWDA 4WASA 4Q3DA 5AVVA 3KKLA 5COQA 4E1BA 3LU1A 1MEOA 2PMFA 3ECSA 2D1RA 4BDSA 2C9OA 2IYUA 3LC1O 1N57A 4UXJA 4DCJA 4X00A 4BVLA 4F96A 2OGUA 2PX6A 2F1RA 4QNNA 5BYBA 1WUJS 4FGKA 5F23A 4N7JA 1KKUA 1X7XB 1NI4B 3DW3X 3GP3A 4WY5A 1TZMA 3G49A 3BAFA 3MIZA 3CZRA 4QDUA 5EJFA 1ZUNA 3B36A 4MQEB 3VHXB 2O8CA 3OQ1A 3ZW7A 1E0JA 3LHIA 4MVXA 3INNA 1FFWA 2Z1MA 3NHKA 4Q4AA 4LOHA 4D3YA 4MR9A 3I2IA 3EIFA 4AKGA 1BZYA 2Q50A 5CBPA 1VMAA 1N36B 2ZU0C 4AULA 2GBLA 3CRRA 5TVKA 3S0JA 1UWVA 3OM8A 4L2IB 3QOFA 1SVWA 5CX1A 1I0IA 2K4MA 2X7JA 4N5NA 5EXDA 4DB2A 3D4LA 3N0XA 4J49A 1LS1A 3TEMA 2TSYB 3CLTD 4O4LA 3KKKA 3L8DA 4U8GA 4BX2A 5TGTA 2LKDA 1JHUA 1JEOA 2I33A 3BTVA 3MJCA 2C5HA 3B1XA 3PPXA 4BNNA 1PR2A 2QAGB 2Q9UA 3JYQA 4Z7JA 1FYDA 3BIWA 3CINA 1Z9BA 3HCPA 2PY6A 2EJUA 4R2LA 3ZWKA 1UBTS 4F5DA 1KJJA 4LZAA 2GA8A 1M34E 1I4WA 2W6CX 3WXBA 3ZNQA 4CKYA 3PHJA 4ER7A 2EARA 1V3VA 1XN4A 3V9AA 4DW8A 4MA4A 2WFLA 3AGPA 4MRSA 521PA 1YZTA 4TOIA 1RAAA 3BERA 5ELXA 4BJ6A 3TCXB 2CXOA 1M33A 2J0UA 4DLWA 3K8ZA 3CSDA 1TQ2A 4KO2S 4M98A 4QDJA 4M0UA 4B3JA 2MDTA 5ALEA 4CUZA 5HJ7A 3OPQA 5JEDA 2WJYA 2EG5A 4HNSA 1MHTA 1UBOS 3G02A 4AY3A 2JAHA 1TM2A 2KHZA 2F3PA 1XLVA 3A3PA 2ZPAA 3MJDA 4I55F 4KR9A 3ZU6A 2AZDA 1FP7A 4TMWA 4WIAA 1KO4A 3SBDA 3TTSA 4R83A 1YZHA 4BKUA 4MAMA 5JLAA 2E1PA 2G1KA 2HTFA 2XDYA 3K8OE 4GOLD 4B7AA 4TTRA 3HU1A 1NVTA 1YDGA 2H1SA 1TM1E 4MRRA 4PPQA 1E5XA 1RLMA 4CI0B 4OHCA 3LUCA 5LD2B