4GMDA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
203
Chain Sequence
TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/inhibitor
molecule keywords Thymidylate kinase
total genus 77
structure length 203
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmdA00
1K5GA 2CL0X 4A0FA 2H18A 621PA 4QRHA 3SHWA 2JJ8A 2ZRHA 4UNNA 4O3MA 1ZM2A 3OAAA 2ASEA 4RCYA 3WRYC 2QT0A 4DLSA 3PEVA 4KITB 3K70B 3S1AA 3LQQA 1ZIOA 3KL4A 5EJEA 1TADA 4ZDWA 3MJRA 3IKJA 2XSZA 2WMOB 1T8UA 3WP1B 5B30A 2X77A 4TYQA 5LD2C 3K09A 1GNQA 3TNFA 1ZNYA 4IOJA 2CE2X 3U3JA 1BYUA 5BN4A 4JT4A 2Q21A 1NN1A 4PX9A 3QBVA 4NHOA 3NXSA 2N46A 2WJVA 1W5TA 1ZC3A 4LYHA 2OSBA 2PZEA 2GJSA 3RC3A 4TTRA 1OPXA 2QA5A 2KE5A 1EFHA 3RVBA 4JLOA 2IS4A 2VP4A 5P21A 1VG1A 3EZ9A 4G5QA 3PENA 1F5NA 3PUYA 2VP2A 1P9WA 2A5YB 2BEJA 2CK3A 4IVQA 1RW4A 4M8NE 4QL3A 3QXJA 4EPWA 4BLQA 4FMDF 4FW9A 3WP0A 2GRJA 1W0JD 4WZAE 2Q9AA 3WYGA 1KI4A 2HT6A 2QUZA 4Q18A 4I4LA 1W36D 1JEDA 2CHVA 4TYYA 4POAA 3DMDA 3H1TA 1QBKC 5KNBA 5FL3A 5KUTA 2WJJA 1HYQA 3IPYA 1GTVA 1L4UA 1BMFD 2VF7A 2JGNA 3FKQA 1FX0B 1SVSA 2ZRCA 3A8TA 3IIJA 3QXHA 1OXSC 1MO5A 1EGAA 1E96A 3Q9LA 4Q4LA 1IOZA 1S9HA 4PHGA 3KXLA 1J90A 3R8FA 1W0KD 2D74A 4B3FX 3DEFA 2ZM5A 3FE2A 2Q9CA 5E7IA 421PA 1Q1QA 4DDTA 4EQ6B 5L3QB 2F1HA 4TLEA 2CDNA 1C4OA 3A1UA 1NKTA 4LHZA 5FTNA 1M74A 3MFYA 4B48A 2UVQA 1GZSA 4GMDA 2DBYA 2RGXA 1NBME 1NVXQ 1WE2A 1HY3A 2P6NA 2VHUA 4JZKA 1G1MA 4BLTA 3A1VA 1NLFA 3W3ZB 2G1JA 1B0UA 1KDRA 4JLMA 3G5UA 5JSZB 1D6JA 2ODBA 5H70A 1Z6XA 4TLDA 4MKFA 4DEYA 1U0HC 1AJEA 4Q47A 1AN0A 3HYRA 2O8FA 5HCIA 3GLGB 2QZ4A 3RRMA 4DEXA 4RZ3A 4WXRA 1XB2A 4OYHA 2AKAB 2QMHA 3Q85A 1WP9A 1XTQA 3EWSA 1UEJA 2VSOA 2OBNA 4W7SA 2WZQA 1Y3AA 4AD8A 1KK0A 5H1YA 1VDZA 2XTZA 4PZYA 5EQTA 3UWOA 3B2EA 4NP6A 4RD3A 2J0VA 2XXAA 3X1WA 1W4RA 3VR3A 3M0EA 1BO6A 3QY0A 2N42A 1QHYA 3BXZA 3U7HB 1R8QA 4PZZA 1ZCBA 1II8A 1XTJA 4BLPA 1TEVA 2VLIA 2SHKA 2XNDA 5HZHA 3FKSA 4BRWA 2CE7A 2D2EA 4LCBA 1OH6A 2KJQA 3CPJB 3TKLA 2VHTA 5BN3A 2WKPA 3DDCA 1GKIA 4R7ZA 1VHLA 1U0LA 3LQRA 4OQMA 1IAQA 5CK5A 3MG9A 2QPOA 3VHLB 4TQ9A 5FFMA 2PT5A 4QGHA 1D8TA 2YINC 5BW8A 1J70A 4UJ5A 2ZI9A 1KTVA 4K81B 2RGNA 1KMHA 2QP9X 3GEHA 5B57C 4KLNA 1WRBA 2GXQA 1ZCAA 4Q03A 4OKSA 4G5OA 5LPNA 1AA9A 4A2QA 1AK2A 3EPKA 4QGGA 2IYLD 5DLQC 4D80A 1Z6TA 3VFDA 1GL9B 1E6CA 2FZ4A 4WZ6A 3AVOA 3KB2A 4F91B 1E69A 2BHRA 2ONJA 2WJGA 2JLYA 4MRNA 1OB5A 1YR7A 4IDQA 3MRSA 1EG7A 2ZE8A 3UXMA 2IYRA 3EPJA 5JI2E 2AN9A 4M9SA 3FB4A 1YZNA 2OAQ1 2ZXUA 1E2NA 4DVGA 1AS3A 4S2EA 5IK2D 2J41A 5E4FA 2ZI5A 1FPMA 4B47A 5FPKA 3TUJC 3JZAA 1S4QA 4AYTA 4C0QC 2D4HA 2ZSDA 4CEIA 2O0KA 2ZUDA 1R0WA 3AKEA 3MGCA 5J4KA 1KMQA 1SHKA 3RSOA 3LNCA 2ODEA 3CO5A 4MUAA 1NSFA 3QXCA 4BFXA 5JFGA 3QXXA 3CRQA 1M34E 1AKYA 5H8WA 6Q21A 2QORA 4RD4A 2AD1A 1VTKA 4D26A 4DT1A 4XD7A 1ZNXA 3BB4A 2MSCB 4NH0A 2G3YA 3TRFA 4AYWA 1E9DA 3EAQA 5FTLA 2O8FB 3UATA 1UBFA 3U6BA 4O25A 2Q9BA 2NGRA 1MV5A 3SJBA 1ZU4A 5K8LA 4CEHB 2HLDA 2PH1A 1P72A 2BV3A 2IYWA 5B2ZA 3PEYA 1FL9A 1U8AA 2H5EA 3U3MA 1MH1A 3LBHA 3LX5A 3T15A 5KDDA 2PJRA 4DLRA 3BS4A 4XIGS 1HE8B 1T6NA 1XXHA 3NC0C 1KDOA 2OXCA 2FDCA 1GKUB 1VCOA 2J5XA 4GFDA 2IYTA 1T5LA 4JLNA 4BLSA 2A7QA 4URUR 3MWYW 3EZ6A 1MRSA 4WOPA 1AGPA 3T61A 2WPDD 2IEYA 1YRAA 1ZNZA 5A4JA 4FCWA 4B2PA 1ODFA 3FMOB 1ZD9A 2OXRA 1YZTA 2OE2A 1DAGA 1Q20A 3NH6A 4EJSC 2FN4A 5JMTA 2ZSBA 1JECA 3HYTA 4MH0R 3BD9A 1EK0A 1YR8A 5HTKA 3I5YA 4A2PA 1GKYA 1YZQA 4PTLA 4WZBE 2QL6A 4PR0A 2CJWA 4M53A 4XWKA 4DB4A 4LV5B 4KFRA 1YJ5A 2IXGA 2D2FA 2IYZA 3SI7A 1G4UR 1S0UA 2JCSA 1Q57A 2JJ2A 4R9UC 4EPTA 4RD2A 4M1SA 2IYQA 1JEEA 3NIBA 3LD9A 4LC1A 4LRWA 1TQ4A 4TMWA 1XFAA 1ONBA 4H9GA 4LHXA 1WA5A 5JEEA 521PA 3X1ZA 1KGDA 1UADA 2NG1A 1W2GA 4H1UA 3QIAA 4Q7JB 2Z0MA 1TNDA 1SKYB 4NYMQ 3KXIA 2EFCB 5IRCD 1KK1A 5C46F 4HLUA 2C99A 3ETLA 1OFHA 1RVDA 1X1SA 1R6BX 3EG5A 4QJ5A 1VYVA 4X8LA 4CEJB 1Z0DA 1ZM3A 2PEYA 2J7PA 1FZQA 1CS4C 4EUNA 1UBGA 3MWJA 3A6PC 4NCIA 4US2R 1Q3HA 3AV0B 4PSVA 1S9DA 4LYFA 4BFZA 1CIPA 2IYYA 1LS6A 5HPYB 1U81A 5DN6D 5HCNA 5JI3E 4PPQA 2EFHB 3THWB 3RC8A 5GADl 1RJ9B 2EQBA 4BE7B 4V03A 2CCKA 5CB6A 4LDJA 2B6HA 3T5DA 2MSEB 1P3JA 3H4MA 1PLKA 1SVWA 4Q4AB 2O52A 2IC5A 2J46A 1RC8A 1IN6A 1TMKA 2ZRNA 4OHYA 4AKIA 2PZGA 4NKRA 3B1ZA 3L0PA 4HB2A 2XGJA 1CU1A 3KKQA 2IYSA 2ZU6A 4JLPA 4ARZB 5IF9A 1JAIA 2BCGY 1KIMA 2AXPA 2YVUA 4NCHA 3TQFA 4BWYA 3P4XA 4LJ9A 2FFAA 2HF9A 2AWOA 3W6OA 4RD1A 4PQFA 2FFHA 3SEAA 1FUUA 2FSFA 5TB5A 5C4MA 4D81A 2G6BA 5CDFA 1KAGA 1IY2A 3EIQA 1NP6A 2ZROA 4PHHA 3AP1A 4IOKA 3T34A 1W47A 4OJQA 3FDIA 3CRW1 4AY2A 3K1JA 1FNMA 2V1XA 4DIEA 2NO9A 3ASZA 3ZS9A 3KKPA 1UDXA 1H65A 3MUFA 2VF8A 3P32A 4LJ8A 4KJZA 3ZQ6A 2OLJA 3BB1A 3QVVA 4EQ6A 1IY1A 5L3QA 4K8OA 2VHQA 1OXUA 2B92A 3I32A 1NNEA 3OAAD 2A5GA 2FSHA 2YV5A 5JLJA 3U4QB 2OM2A 3DVLA 4TLCA 1ZP6A 4R2HA 4DB2A 4QHSA 4GOXA 1CJVC 2ATXA 1JXOA 1K8RA 2CLDX 2P0EA 3UMRA 4FMCF 4MRRA 3THYB 3QKUA 4DIDA 1NIPA 2GXUA 1SULA 1XMJA 4IDNA 4A15A 2VSFA 4EPXA 3NG1A 1KK3A 1W5SA 3DKVA 3KJHA 2CNWD 3SC3A 2JIZD 4P33A 3SFZA 3TAHA 2KB0A 1E0KA 2CVFA 1UEIA 3TSOA 3GJ5A 2ZIAA 4XTRA 1KI3A 4KBFA 1K6MA 1A7JA 1CBUA 3OIVA 1A4RA 3OESA 3F8TA 1IY0A 1WDTA 2GZAA 4HSEA 1KMHB 1VECA 4HUQB 2OFWA 4X8HA 1X3SA 4Q4HB 1XJCA 2A5JA 2REOA 3Q8XB 3L8ZA 4DXAA 5BYKA 1E0SA 2BEKA 4I81A 2A5DA 1E2LA 1UBEA 4HATA 4B2IA 1CR2A 1NY5A 2ZYUX 3B9PA 3C16C 3ZJYA 2YOGA 1TAGA 3L43A 2OFOA 3IHLA 2ZAOA 2Q3HA 3LXXA 1QHHB 3A36A 2OBMA 2ATVA 3EIHA 1FUKA 1CRQA 4IHQA 1RRGA 1VPLA 2PCLA 4HI0E 3KQLA 3ZIAA 2HXYA 2IHYA 1OV4A 4BLOA 2W6JD 1T9HA 1JR3D 4HDQB 1KKMA 4EPRA 1UBCA 3WNCA 3DOFA 5AJWA 3O8CA 1X8KA 4DLVA 5F3WB 4B3XA 3UMSA 2KBFA 1D9XA 2DWQA 4RVCA 4M1KA 3K0FB 3J81k 2OCYC 1ZYUA 3BFVA 2H1LA 1Z6GA 4FI3C 1SHZA 3LBIA 3OE7D 3CF6R 2W6ID 4DLWA 4H1VA 4G5GA 1HE1C 2CLSA 5LDDC 1SGWA 3TVDA 1M7GA 3K70C 3DPUA 3N70A 4ZIRB 1KJYA 1CJTC 1V43A 2HCBA 3B82A 3K09C 3QPVA 3SFVA 2RGNC 3TK1A 3G0HA 2WSMA 3BBPA 3F5FA 2PX0A 2ZITA 1BKDR 2G0NA 2NTYC 4A1FA 3QSYA 4M4SA 1N6KA 1XD9A 2D62A 2JDIA 2WICA 3CZQA 2J87A 4FINA 4CW7A 4BQSA 1BIFA 2ZREA 5HR5A 2BBSA 4B3GA 3B9QA 1GOTA 3UANA 1NN0A 1IN4A 2GZHA 3TLXA 1JR3A 1JXMA 4B33A 4N0EA 3GPLA 4UJ3A 2BMFA 3B5JA 4OQLA 3TSWA 4RZXA 2IS6A 2B8TA 3EW9A 3KUCA 4ON9A 4XSGA 5FR2A 3ADCA 3MJHA 1N0UA 2QY9A 3BERA 5FTMA 1JB1A 5TMPA 4LHVA 1OSNA 1W7AA 2BIFA 4I1VA 3ZYCA 1N6OA 5AUQA 3QKRA 2DYKA 4ABYA 5FOVA 1SVLA 2VL7A 1VG8A 5FOXA 2IWRA 4LC0A 1EFRD 5AJVB 3U4QA 4JBXA 4Q02A 4YMWA 1G8YA 3T5GA 1E9FA 2DPXA 1E32A 2CVHA 1OB2A 4IVPA 4QBFA 4U5XA 3THXA 5CJPA 1IJFA 1UKYA 2PBRA 1UFQA 4BZPA 2XB2A 2R6CA 3QEJA 3A58B 2ZJBA 3W3AA 4ILEA 4JYCA 2RB4A 4FWTA 1E3MA 2XTMA 3N2EA 5FBRB 3IEUA 4IVRA 3THYA 1UJ2A 4TMTA 1NG1A 1L4YA 4RJLA 1Q1ZA 1Q1EA 2G77B 3TGPA 1OH7A 4OQNA 4PQRA 2R6DA 2JLQA 2P3SA 1G18A 1LV7A 3P4YA 3FVQA 1NVVR 1II0A 2ZRFA 4PAQA 1DAFA 4HLDA 4OQXA 2ZUBA 2QQ0A 2GEUA 4NYJR 4TSFA 3DZ8A 2QE7D 1I2MA 1E2JA 1YKSA 2A78A 3WBJA 3Q7QA 2R65A 3TUIC 2WKQA 3UIEA 1GUAA 4EPVA 5DI3B 3M6AA 5SZHB 4Q7LA 3QNUA 3QVUA 1E2PA 2L0XA 4Q1AA 3CBQA 1E2DA 1G19A 1XTRA 1GSIA 4RFVA 4Z8XA 2PZFA 2FGKA 4EDHA 3U60B 2QGNA 2V7QA 4PFSA 5SZIA 3CLVA 3FWYA 1N6NA 4AKGA 2F7SA 1TU4A 2VRWA 3VR6A 4JVLA 3LA6A 4PHFA 2RGCA 4PPFA 4MGIR 3LBNA 4CF7A 4MKIA 1P2VA 2IA5A 5B64A 2O8CB 1YZGA 1FTSA 1R10A 2J1LA 2AX4A 4WA7A 5TARA 4E5UA 3A4LA 5TDHA 3AF4A 3QQ5A 2ZRMA 5FPSA 4GOJA 3SHFA 3C7KA 3HPRA 1OW3B 4HUTA 5DYGA 1ZU5A 1T8TA 3RS2A 3MCAA 4YMVA 2QMUA 4MDFA 3ASYA 4DLYA 1W4CA 3PFIA 3K0SA 2OCAA 2AL7A 2W2XA 1GRRA 1JQLB 2Q3MA 4PPGA 5BQ5A 2FG5A 2P67A 4DCUA 3SJZA 2EYQA 2R62A 1E2MA 3HWSA 2P6RA 2ANBA 3EA0A 1Z28A 2QTHA 3AF1A 3EASA 2REXB 3H84A 1Z83A 4Q1DA 2IS1A 5CJ2A 1TQ2A 3BC1A 1E98A 3QOFA 1QRAA 4Y0AA 3TIFA 3U6KA 1R5NA 2V4ZA 4HAYA 4MGZR 3I8SA 3RANA 3TUZC 1ZUHA 3FFAA 3I61A 4GNKA 4JVNA 1L2TA 3R9IA 4M21A 4ZKEA 1RKBA 1SXJB 1VKJA 4B75A 1TTTA 2WWYA 3IO3A 4ZCMA 1XWIA 2ORIA 4MYHA 1QHIA 1KI8A 1G3UA 5E7JA 3GLIB 1N6IA 1QHGA 2HDNB 5DYIA 3RS3A 3CR8A 3IPXA 3RS4A 3K0AA 3BH0A 3IILA 5K8TA 3LLUA 3CB4A 4KV9A 4JLDA 4O2LA 2FFBA 3ZIAD 4DSNA 2QU8A 2W6JA 2PT7A 4TL6A 2C98A 5FOWA 1TX4B 4HLQB 3A4MA 1ZW6A 1T0HB 4LJ5A 4OHXA 3ADDA 4JVMA 4OJKA 5JWHA 4P4SB 4LPKA 1ZMXA 3SDZA 4MRVA 4OQFA 4KLZA 1FP7A 3GFOA 2QMEA 4IOMA 3SYLA 4E03A 4HEJA 1DADA 1NVWQ 4K46A 3KQUA 4NCKA 2C9CA 4PC2A 3VAAA 3PJRA 1SXJA 2RGGA 2R6FA 1OT3A 1TEXA 3R7WB 5D3MB 5JBQA 2NZJA 3GJXC 4DDUA 1ZNWA 3HU3A 1Z6AA 3P26A 1CKEA 2QAGA 1LY1A 1HT1E 3VU9A 2QM7A 2VQSA 1EFTA 1TPZA 1E9BA 1DE0A 1UKEA 4X8OA 3RS7A 4PC7A 4WAUA 4QC2A 3RS0A 3FHTA 3AKYA 1KJZA 1Z06A 4QBIA 4R2IA 1DAKA 4HUQA 3THOA 5GVSA 1OJLA 5GJBA 3PR1A 3NHBA 4P0TA 4NPHA 4DUGD 1FOEB 1MT0A 2P5SA 1Z0AA 3LVQE 4J0QA 4Q7KA 2EVWX 1U9IC 2ORVA 3P20A 4BFWA 2JDID 1XPRA 2VEDA 1OHHD 2H7VA 3NBFA 4XH9B 4A8JA 1XZPA 1JBKA 2J9RA 1OIXA 3AVXA 4RCZA 5CIWA 2NPIA 5KNCA 4JLBA 3VTKA 1F60A 2NOAA 2YWHA 4URXR 4LBWA 4RKEA 4LGMA 4A9AA 3Q5EA 4ZI2A 5HKKD 4II7A 2IUUA 4GSYA 4A0GA 3S1AB 1AQYA 1XMIA 3THWA 1PJRA 4A2WA 3KB1A 4W5HA 3RNLA 4A82A 4IEIA 3RSLA 1JR3E 3OZXA 5CLLA 1Q21A 2F55A 1NIJA 2V9PA 1FQKA 1G6OA 3ADKA 3W34A 1EXMA 4LPSA 4OI1A 1NI3A 1UPTA 2E87A 2P6UA 3IQXA 1CRPA 1DAHA 1CJUC 1V5WA 2ZRDA 4FXPA 3B1YA 2C96A 3T12A 2BBOA 1PV4A 3NDBB 3DM9B 2YWGA 3MWKA 3QKSA 2GCOB 2OLKA 3H2YA 4P3YA 3VNVA 3ZVMA 3MWLA 4Q19A 2WM9B 3ICQB 1LVGA 1NN3A 1L7VC 4D4LA 1GFIA 2AWNA 1Q1BA 4RFSA 5FI1B 5JJKA 1JALA 3CX6A 2ZS8A 1CJKC 4YONB 4GL2A 3T1QA 1PUJA 3CF2A 3AUYA 4LWZA 4TLAA 2ORWA 1XBTA 1EX6A 3EA5A 3FTQA 2Y8EA 4P31A 1KKLA 5C18A 1F2UA 3QENA 1IXSB 3U61B 4WIAA 2YC4C 1UDWA 1JPNA 5CDFE 4LV8B 2QPTA 3T1TA 3AVUA 1ESNA 3EZFA 2R2AA 2ZJZA 3KJEA 1XCGB 3Q5DA 5AUOB 1NMZA 2IK8A 2FGJA 3I62A 2Z6VA 1F48A 1QG4A 2BKEA 3FHCB 1K5DA 1E99A 4LBZA 5D3QA 1B23P 2W6IA 2G83A 3QKRB 4FCTA 4IFBA 1AIPA 4F93B 3EPHA 1N0VC 1QHXA 2IL1A 2G88A 3PIRA 2YWFA 5GJWC 1COWA 3UG6A 3LW8A 4Y0VA 2R8RA 1JJVA 2CMKA 2PMKA 4HDOB 4LX0A 5KO2A 1MO3A 3FOZA 2XSZD 4OI2A 2JLXA 1PLJA 2QTVB 2YWEA 1BOFA 1WBBA 3A1WA 1Z8FA 3F0TA 4NYIR 4IRUB 2V3CC 3GQBA 2J0QA 5EP4A 1S1MA 5JCPA 2XTNA 3WHLA 1R0XA 2GBLA 2PLRA 2AXNA 3NH9A 4S35A 2BJVA 4BFYA 2GNOA 1HQCA 2V7QD 2O0JA 3KZ1E 4OI4A 2JATA 4HAXA 4QFMA 4BRUA 4CRWB 5BYJA 1ZD8A 3B78A 1P2SA 4M1MA 1T4GA 3W5IA 4PO9A 3C8UA 4B44A 3GMTA 2C03A 3PUVA 5EE1A 4CYMA 1TU3A 4XJXA 1CR4A 3DMNA 2GAOA 1Z47A 1TQDA 3GLGA 1XD2B 4V0ME 1ETUA 4HAWA 3CWZA 3PV0A 4LZZA 4URVR 3SN6A 2IX3A 1RRFA 4ZDIA 2QGZA 2CBZA 1GRQA 4NONA 3I5XA 3RRNA 3FPAA 5J40A 3CRVA 1EFRA 3LO5A 1KDTA 2IBMA 3C5HA 2NO6A 4PAMA 2OESA 2WWFA 2WBLC 1KO4A 4YQFA 4B3BA 1W46A 1IJEA 1PZNA 4KI0A 4TYPA 2FSIA 4KFUA 3KKMA 3FMFA 5AJXA 1N5JA 5AJZA 3CF0A 2W00A 3U2QA 4A92A 4OHWA 3HJNA 4FIDA 4AKEA 2DR3A 4Q9JA 1KSGA 2FWRA 3SQWA 2WHXA 3RS5A 1M6NA 3D6TB 3OEHD 2ODNA 3O8DA 1LB1B 2J45A 4RD6A 4B43A 5C2JB 4D2IA 4JLVA 3BB3A 3SBDA 3WNBA 1LS1A 2IUSA 1G7SA 4XVUA 4TL9A 3B6EA 1DARA 3C4JA 3X1XA 2ZSEA 5A0FA 2QG6A 5F9HA 3M1IA 5FBQB 4Q4HA 1ZINA 4PPNA 3KDSE 1CEEA 1S2MA 1XEWX 2DY1A 1QVAA 3K0FA 2W83A 4JL8A 1HUQA 5J47A 2VTKA 3HDTA 4M9XA 2F43B 4FWIB 3ZZ0A 3HR8A 3U7FB 2Z43A 1XEXB 1ZIPA 3K0EA 3QKSB 4IJMA 2GCPA 1DAEA 4G1UC 3GLGE 1RRPA 3UMFA 1XCPA 1GNPA 4L16A 3WRXC 2A9KA 2BMEA 1A2BA 3NBXX 1I4LD 2QBYA 2FX3A 2CCJA 1U98A 1YQTA 2ZE6A 5LBIA 3AB3A 1OIVA 4UNQA 3NBZC 4YDHB 4ESVA 1XPUA 1Q3TA 2J0UB 3SOPA 4LUCA 3NC1C 1SXJD 1YE8A 2GK7A 5GJVC 3QPUA 2DFNA 4W9MC 2WSSD 2YOHA 3CKLA 3QF7A 4HYYA 4BGDA 1KJWA 4D4KA 1G4AE 4MDEA 1P2UA 1MO6A 1SXJC 3K9HA 3U3KA 3K8YA 1GITA 1XZQA 4C0LA 2FMXA 4V0OA 2BMDA 4AC9A 4KFSA 4LJ6A 4M0LA 3W6NA 4A0RA 3GLIA 3IHWA 3RWMB 1ESMA 2G0TA 2JA1A 2ZR7A 2R6AA 1KSFX 1RE0A 3ZVLA 2C8VA 2D7DA 2BKUA 3GJ0A 3GEEA 5IK2A 1OFIA 3GLHE 1N6LA 1KSHA 2EFDB 2JEOA 5L3SB 1S3GA 3BORA 5FOSA 4A4DA 2VP5A 1WBDA 5FTJA 4Q9IA 1OIWA 2FEOA 3C14C 1EWRA 4HB0A 3AQ4A 3PQCA 4MQBA 5EE3A 4BEBA 4JLKA 4EKDA 3PEWA 2C04A 2RKOA 4Q66C 1U90A 2XEXA 1AS0A 2BBTA 4NU0A 4W5JA 3LV8A 4TMKA 5D3MA 4UKDA 4A8JC 3ZZTA 2ZRPA 4V0NA 1H8HD 3Q72A 2HXSA 3BRWD 5TY0A 1G8GA 2ECKA 1Z07A 3MLEA 5KPJA 3GCGA 4X8MA 1N2CE 5AR1A 5K8UA 5TXGA 2O8EB 4WVFA 3DHWC 2GESA 3RABA 4D0NA 1XP8A 4NMMA 5JWOA 2ZJ8A 2QP3A 4L5BA 5FH9A 2WOOA 5JWRA 5JEDA 1DO0A 4BFVA 2WWIA 4CEHA 3IIKA 1U8YA 2GKSA 1O3YA 1OXXK 3IBGA 3ZZUA 2RGBA 1TL7C 1U2RA 5BWMA 2VIIA 3ND9A 5CM9C 3SZRA 2OILA 2AD5A 3DO6A 4DCSA 2DFTA 2HF8A 2DFLA 2J59A 3K9LA 2KWIA 4AG5A 3KJGA 3QF4A 1E9AA 2YKGA 2O8DB 1XD2A 2ZPTX 1SVOA 3CX7A 2IXFA 5EXSA 4V0MA 4BZQA 2PX3A 5A5GA 2ZJAA 5F98A 1Q0UA 1G64A 1FNNA 2AK2A 1KY2A 3AGQA 4WW0A 5DI3A 3ND8A 2BBWA 2ZTSA 1A1VA 1XTKA 2GCOA 3ZS8A 4CT5A 4LBVA 1JI0A 4Q00A 2QAJA 3BH6A 3TMKA 1DVRA 1T5IA 1QDEA 1E4VA 4JL6A 2IF0A 1EFCA 1SVIA 2MMCA 1KYIA 4M2LA 2ZI7A 2QPAA 1Z2AA 2OHFA 3VNUA 2IYXA 4GI7A 1DELA 1FQJA 2Q3FA 4GRAA 2VO1A 4LOAA 1OH5A 4DT1B 5KSYA 3ZDQA 1RYHA 4KSBA 3SS8A 4CDGA 1CXZA 5EE0A 3DKPA 5J5CA 5LB4A 1YVDA 3TR0A 1XXHE 1DG3A 2XITA 3B1VA 2ZRJA 4XVRA 2KBEA 3RYTC 3EC2A 5CK4A 2OEPA 3B60A 3WNDA 3KQHA 2HYIC 1W36C 3PCRB 3EC1A 1E1QA 3VR4A 1W49A 2OUKA 1MRNA 3F3YA 4TTPA 5JRJA 3LH5A 3SYKA 1NLYA 1G5TA 4B73A 2BVNA 2WWHA 1G6HA 4ESHA 1Y63A 5CYPA 4C0KA 4ASUD 2PMDA 2LKDA 2A3RA 2D06A 4ERNA 5B58C 3W6PA 1KI2A 4HZUB 4JKYA 4W5WA 4F7WA 5BXQC 2REBA 3GJ4A 5DN6A 1ZBDA 4US1R 5CIQA 1XD8A 4WBSA 4QM6A 1G8PA 3ZLJA 3N2IA 2NO0A 4JJKA 3LRPA 2XAUA 2J7PD 3UPUA 4O0MA 2C77A 4MGYR 4B71A 4JSYA 4DSTA 3CH4B 1MO4A 1W4BA 3MMPA 5EE5B 1YZKA 2BWJA 4CEIB 4MKGA 3RRZA 3B85A 1A5TA 2QRNA 4M1YA 2I1QA 2J7KA 2ZS7A 1N5KA 2JLZA 1CP2A 1WQ1R 2IT1A 2OCPA 4OHVA 4KYUA 4JT2A 1S8FA 1SVKA 4ACAA 5JRZA 5FI0B 3H0KA 3MAAC 2J0SA 5DSZA 1G9XA 4D0LB 1W4AA 1SKYE 3KXKA 2O8EA 1E94E 4TL7A 5KSOA 3P1JA 2IHBA 4JVSB 4XSHA 4YDSA 3IEVA 3CM0A 2IXEA 4JLAA 2ERXA 1XXHB 3QPWA 3PVSA 1RYFA 5AUNB 2V6JA 1LF5A 4GOKA 4Q21A 2YHSA 1Z6YA 3AKDA 5J4HA 2ZI3A 2IF2A 3P27A 4HAVA 2CXXA 4PAOA 3WXMA 4BUJA 1EFUA 4NCJA 4QHTA 2V1UA 2XJ9A 1NMXA 3PUWA 2NQ2C 1X1RA 2ZJOA 4GP7A 2GAAA 4MRSA 3Q7PA 1JPJA 1ZM7A 3SU8A 4RZ2A 3CIOA 2XNDD 3BGWA 3CNOA 2QN6A 1SXJE 4IKEA 3SR0A 4KBGA 3RAPR 1J8YF 2GEVA 4BFTA 1T3SA 5EP3A 2G1KA 4QJ4A 5FL7D 2WIAA 4E09A 4YC7A 5DIFA 1T3HA 2QENA 1QG2A 5KSZA 1G8HA 1KZGB 3FMIA 1R8SA 3OEEA 1CR0A 4OK3A 3TVTA 3AVYA 1OE0A 2B21A 2AR7A 1AKEA 4DWJA 5FOTA 4BFSA 1RPZA 4OK5A 2QSZA 1E79A 4NCNA 3QEOA 1KOFA 5AK0A 1KSJA 1R0YA 1ZC4A 3AGPA 1KAOA 2I4IA 3KUDA 2WIBA 1P61B 2QP4A 3KX2A 1F2TB 2X8AA 1GAJA 3AH8A 4BASA 2IEZA 2XZOA 1E0AA 2ZJYA 1UKZA 4RFSB 2E1RA 2X1VA 1SZPA 2XX3A 2QBYB 5LB2A 3L0OA 4C2UA 2IUTA 2J3EA 3GJ7A 5BN5A 3EIEA 4LHWA 3AF0A 3I72A 4M1WA 3ZD6A 1RRCA 2AK3A 2ZRGA 3H86A 2FJUA 2P65A 3QKTA 3OE7A 5FBWB 1W1WA 2V55B 4TYNA 4YLGA 4ZCLA 2H8KA 1NG9A 1WMSA 2QT1A 8OHMA 2C5LA 3LAWA 5JJLA 4ZO4A 1KO5A 221PA 3VX3A 1CTQA 4LBYA 1TF5A 4IDPA 1Z29A 2R6GA 5ANRB 5DO9A 4G5SA 1VIAA 3NKVA 5L8VA 2DFKB 2NZ8A 1W2HA 1XMSA 3FFBA 4RSGA 1AQUA 2VHCA 1GM5A 4U00A 721PA 4JMPA 1QZXA 2FU5C 2OO7A 3OIUA 3R9XA 1KZ7B 4XWAA 3Q3JB 5EP2A 2N1BA 2JLRA 4C0SA 1UM8A 3AF3A 4LHYA 4MYTA 3KQNA 1XX6A 3FHOA 5TVKA 3U3OA 3W5JA 3A1TA 1OYYA 3LDAA 3KQKA 2ZYVX 4PC1A 2Q6TA 3T1VA 4IDHA 2GEDA 2YNMA 2YC2C 1NJGA 5SZKB 1G16A 3C5CA 3UG7A 2CHGA 2ZE7A 2OZEA 2HUPA 4B76A 5UKDA 1AZTA 4HB4A 1E1QD 3AM1A 1VCIA 3AP3A 2WMNB 3B13B 3MSXA 2GVDC 3E5HA 3OEHA 2Q0HA 1N0WA 2DCUA 1Z0FA 4DDWA 2H57A 2ZVPX 3BFXA 1VG0B 2I3BA 4FN5A 1HA3A 4TL8A 1MABB 3TQCA 4RD0A 4IEEA 4Q5IA 1D9ZA 4HZIA 4V02A 4I1OA 3QXSA 4RZUA 2OV2A 1QF9A 1Z3IX 2FPLA 3ONWA 1YU9A 3ZQJA 121PA 5J4LA 1XF9A 1II9A 1G7CA 4DSOA 2ZU0C 4QKQA 4EFNA 1ZUIA 4ZDKA 4I1UA 2GJ9A 1P7CA 5L3VA 2GJKA 3TE6A 1HTWA 3K53A 1XEWY 1D2NA 3LWNA 5JS8A 3JVUA 1J7KA 5KPDA 1CULC 3X2SA 1E2FA 5IDVA 4YMUA 4FD2A 1GP2A 4QBHA 3TH5A 3K9NA 3AVPA 4L8GA 4DJTA 1FP6A 1KO1A 2K5UA 2QI9C 2GJ8A 3D7MA 3L0SA 1P75A 3WY9A 3ZVNA 2GILA 3VQTA 1GILA 1KI1A 2XNSA 5FBVB 3GLFA 1FMJA 1GVNB 1XTIA 4AURA 4FMBB 4AK9A 4PSKA 2CHQA 1G7RA 3CPHA 4CIDA 4KVAA 1OXTA 1KI7A 1NSTA 1T91A 1ZUNB 5TV2A 2HEIA 4NYIQ 3IO5A 4TLBA 1Z2CA 1F3OA 1HEIA 4DBLC 4UNRA 1W48A 3OIYA 4CEJA 2QE7A 1TF2A 1FMLA 3G82C 4D0GA 2QROA 5KHOC 2J0UA 2B7BA 4DCVA 4JL5A 1Z22A 3VKHA 5DE3A 1Q44A 1U8ZA 3SJAA 2HCJB 2GJAA 3HU2A 4OBEA 1BS1A 4N0DA 4TWZA 3U3RA 1XEXA 1G5PA 3CW2A 2KI5A 1NLZA 4G5RA 1OFTA 4LI0A 2FF7A 4TT3A 4L9SA 3EX7C 4IFEA 1E9EA 3PEUA 4ZKDA 2BDTA 2WKRA 4C7OB 4D82A 4TMZA 3N5CA 4Q4AA 2GBLC 2R44A 2AHOA 1VYTA 1W0KA 1X8JA 4NE2A 2O8BB 1Z0JA 1RJ9A 1D5CA 3GFTA 4AG6A 1N6RA 5CLQA 2FSGA 821PA 2ZQ5A 4DC9A 1P6XA 1LNZA 2EFEB 2GETA 4HAUA 3GJ8A 2OAP1 2YYZA 1HURA 4GMXA 4RY2A 5CYOA 5HE8A 3K70D 2WWWA 3TR5A 4PSAA 5DHAA 2CJWB 1E9RA 2F6RA 1DEKA 1N5LA 3BOSA 4FMCB 1KDPA 3ZGXA 3ICEA 3B1XA 1MR3F 1NMYA 3VHXA 3OFND 4HDCA 3BK7A 4UXJA 1N25A 1S96A 2RGAA 2F3TA 2EU8A 3I3SR 1HQYE 2VHJA 2H16A 3GJ3A 4DLTA 3SE0A 2OG2A 4P4SA 2ZRBA 3AVTA 1N6HA 1ELOA 1TUIA 1IM2A 3BJIC 4ZIRA 5FL7A 5F2EA 5KDLA 4GDFA 1Q12A 3HP1A 4LK2A 1Z0KA 1US8A 4V0KA 4RKFA 2JLSA 4Z51A 1Z63A 3GD7A 3V00A 1E2QA 3LLMA 4PHTA 4URWR 3UKDA 1GL6A 4A6XA 4AIIA 5SZJA 1DAIA 2JJ1A 1H8EA 1G3MA 2ERYA 3PXGA 1IN5A 2RH5A 5L3SA 4AKHA 4QXAA 4BECA 1FTNA 4TQAA 2ZRAA 3ADBA 2ZRKA 1PLLA 1GRNA 4C0HA 3KKOA 1MABA 1AZSC 3CR7A 2JIZA 4A8JB 2XZLA 3NWJA 1VMAA 3GLHA 2EWWA 2JLUA 3A4NA 2FFQA 3HU1A 4ARZA 1IN8A 2ZRIA 3IBYA 3R20A 1S3SA 1E0JA 1T3LA 3AP2A 4GPTA 2LKCA 4URYR 1KY3A 3LY5A 4DUGA 4Z54A 5FOUA 2I1VB 2ZS9A 4U7DA 3AUXA 1EX7A 5DI9A 1OHHA 3AVWA 4PO8A 4DKXA 3TSZA 3VKGA 4R71A 4F4CA 5JS7A 4QBGB 3O47A 4B3DA 1R2QA 2JJ2D 2EWVA 1VG9B 4WXPA 2IW3A 2C95A 5JSZA 4QHYA 2X2FA 1GL7A 2F1RA 5AUPB 5HKKA 5G40A 4KFTA 3CNNA 1TQ6A 1YR6A 3PITA 4I99A 1X86B 4JLJA 3HPQA 2VA8A 4PANA 3EWAA 3JZMA 2CCGA 3T1OA 3KJIA 4Q1FA 1IHUA 4LY6A 1CLUA 5CB8A 4JBYA 2RHMA 4M1TA 2ZUCA 3KFVA 4I1SA 4GT1A 3CH5A 2EYUA 4MGKR 2WV9A 1JJ7A 3WYAA 4YXWD 1M8PA 1N6PA 1XCMA 4OL0A 1UAAA 1U0JA 1XU4A 3C41J 1VCNA 2ZR9A 4JYBA 4TSFD 3R9WA 3B8HA 2WJIA 3WMFA 3WYFA 1DPFA 1OF1A 1G20E 4D25A 3U5ZB 3GLFB 1KO8A 5EZ5A 4YMTA 2GF9A 2ZANA 3EPLA 1E1RA 1P5ZB 1G291 1TF7A 2GVZC 2OT3B 2F43A 2ZRLA 4FMDB 2NIPA 1Z5ZA 2V54A 2W0SA 3UK6A 4P32A 5IT5A 2WWGA 1NJFA 1GWNA 4JBWA 2GWHA 4UQOA 1YZLA 2D7CA 4L9WA 2AFHE 2C9YA 5EP1A 1P9RA 4M9QA 4Q7MB 4QNMA 2HYDA 3CWQA 2QEQA 3O8BA 2W0MA 3WBKA 3FGNA 1NF3A 4C0BA 4LSGA 2ZJ2A 1IBRA 1DO2A 3AVVA 1N5IA 2GXSA 1COWD 2V6IA 2X19A 3U44A 3OHMA 2WJHA 5DH9A 1E2EA 3PUXA 1E2KA 2X2EA 3NEYA 4Q1CA 2O8BA 4NTZA 2NO7A 1IQPA 1G41A 2XJ4A 3PG5A 5FR1A 1R5OA 3RDPA 3KTAB 4TMXA 2WAXA 4UXHA 4ZCIA 4V0LA 1M2OB 1I4DD 4B34A 4DCTA 1Q22A 3R8CA 4B6FA 2ONKA 1VCMA 1R7RA 2DB3A 2EW1A 1YZUA 5DHFA 2FV8A 3BE4A 3LFUA 1E1RD 4ZV4A 1G8FA 4PC6A 4CT4B 3BIFA 3V4FA 1XPOA 5E7MA 1M1YE 3OFNA 2FH5B 4LV6A 4XVQA 3IQWA 3RLFA 2MSDB 4C3ZA 3NBYC 4LYAA 4Q48A 3GLFE 2GHIA 1P60A 1AGRA 1ZD1A 3VR2A 2YOFA 4URZR 2YZ2A 3K0AB 2OBLA 5GVRA 2VSXA 2ZYTX 1KNQA 4DDVA 2F9LA 1IXRC 4KODA 2FE4A 4JS0A 3WMEA 5KDOA 2A30A 2F3RA 4EPYA 3I92A 2GZDA 1ANKA 2FPMA 1GNRA 5EUMA 2QNRA 4ZI3A 5EUQB 2QSYA 4TTQA 2CL7X 1C1YA 3NDPA 3R7WA 4D4MA 4G01B 3CZPA 2NPFA 4NYMR 1J2JA 2GK6A 2HLDD 4CGZA 3MD0A 2JAQA 2WAYA 4UNPA 5FUWA 3I73A 1DOAA 1OKKD 2WWXA 3EZ7A 1OFUX 1PUIA 1G3QA 2ZSAA 4PO1A 2FEMA 2ZVQX 2QMOA 2ZETA 2HJVA 3L0IB 4KXFB 3D31A 3W8NA 1P4SA 3REFA 4M1OA 4LJAA 1D2MA 1LTQA 4L4UA 2BJWA 5IHPA 3DOEA 3OIWA 4BLRA 3CX8A 2A5FA 2JASA 2QRZA 1XMVA 1QHSA 2YJTD 4LJ7A 1ZM4A 3GLIE 4MITA 1WF3A 3E1SA 2JJ1D 2NMVA 2LCFA 2RGDA 4JKIA 2WPDA 1KHTA 2ZR0A 3V4RA 1KNXA 4F38A 3UWKA 1W44A 3QF4B 1QHNA 5E3HA 4AI6A 4D4JA 1R0ZA 4A6PA 4NDZA 5M04A 2W58A 4TMVA 1AS2A 1RIFA 4JJZA 3RWOA 1BYIA 1DG1G 2ZI6A 5KTYA 1JQJC 4P4UA 3K0CC 4F4JA 4EFLA 2PL3A 1XNJA 1VIYA 1ZVQA 2TMKA 1OYWA 1F2UB 3NHAA 3TAUA 1JR6A 1OKKA 2F1JA 2WJYA 3LXRA 3TW4A 1XTSA 4A0HA 2C2HA 1A82A 5G3YA 4C4PA 3JVVA 4IXMA 2IYVA 3EXAA 4KVGA 4EJSB 3W90A 2ZAMA 2QQEA 4KO8A 4E07A 4TZ0A 1ZRHA 3EZ2A 1Z08A 2ZYWX 4MRPA 4MUBA 5G41A 4PC3A 4P4TA 4DLXA 2PCJA 4AWXA 4BPBA 1XJQA 5EXPA 3I8XA 5F9FA 2ODWA 2C9OA 4B32A 1WXQA 3IIMA 4NBSA 4UNSA 4Q4JB 3VR1A 2D3WA 1SKQA 4ZPXA 3M4YA 4Q9KA 4TT3D 3ZD7A 4U02A 1U94A 2FOLA 5KYKA 3VR5A 2JLVA 2GF0A 2HJGA 3DZDA 4MYUA 3SYNA 2R9VA 2FPKA 1II8B 3B7GA 5H68A 5EXXA 1YHNA 2IS2A 4FCVA 3SJCA 2CLCX 2Z4RA 4YMSA 1SQ5A 1LW7A 2ZJ5A 4HAZA 4Q9HA 4L15A 4C7OA 2O0HA 2VPPA 3O8RA 4QGAA 1P9NA 2P5TB 4E22A 1Z0IA 5JZVA 4KAXA 4TN1A 2UZ3A 3RRYA 2F1IA 4XTCS 4Z1MA 1OLOA 4CVNA 3AEZA 3T06B 2P2LA 1SVMA 3D3QA 3NTUA 3TBKA 2RAPA 1US8B 1KO7A 4R98A 3SQXA 3W9YA 1O87A 2QAGC 5FTKA 1ZJ6A 4C0AC 4ITRC 4GBMA 5AJYA 5KNDA 4KU4A 1PVOA 3E2IA 2XB4A 2LWIA 4IDOA 2XZPA 2WVJA 1GG2A 5C4GB 2XOKA 3VU9B 5DNYB 1JAHA 3FYHA 2WOJA 4Q01A 5JJIA 4TYWA 4BEJA 1TUEA 3A37A 1VHTA 4B3CA 4C9BA 2VP6A 3GLHB 4GP6A 3KKNA 5EZ6B 4QGFA 4HLCA 2C78A 1U9IA 1E9CA 1NL3A 4KHZA 2BMJA 2HT1A 4AYXA 2CL6X 5G3ZA 2O8DA 1E2IA 2CNWA 3BFKA 1VYUA 3LVRE 2O8CA 3ZH9B 4US0R 4OK6A 2MMGA 1WB9A 2QTFA 3AVQA 3LX8A 4EFMA 1WCV1 2E9SA 2V8OA 3RHFA 1UKVY 1A2KC 1DS6A 3L82B 2BC9A 3BWDD 5ELXA 1G17A 4Q1EA 1IONA 3QUSA 2IYUA 1MOZA 4IOLA 4B6EA 3CONA 1E4YA 3C15C 4F4IA 1FFHA 2OFXA 5FPHA 1I2DA 4NYJQ 5FBLB 5FUVA 2PLFA 4G3XA 2GDJA 3KFXA 1LF0A 1M7BA 2XOKD 4DLUA 2EFGA 1HV8A 2WTUA 5JCZA 2NO1A 2RMKA 2W2TA 3CUEF 3GJ6A 5FPTA 3VX4A 3X1YA 1CJMA 3CRMA 2UKDA 3E70C 3TW8B 4B74A 4OI0A 2GTPA 5JHGB 2AFIE 3L8YA 1D2EA 2ZEJA 5E95A 2CK3D 1H8ED 3W8RA 3QG5A 3K9GA 1H8HA 2Z5FA 1NKSA 4D6PA 5GJCA 3K0CA 1BH2A 1T0JB 4DRZA 4Q1BA 4NL4H 4XD7D 4TZ6A 1EWQA 2H92A 4EIWA 1LFDB 4IW3B 4M22A 4QG7A 5CITA 3QI2A 4A36A 2QM8A 4IXNA 4Z8YA 1EESA 3QJYA 3IDQA 4DSUA 4XWOA 4ACBA 1X8LA 3NVAA 2OCBA 1HH4A 1KI6B 2RCNA 1F6BA 3IUYA 4QNRA 5HE9A 4ZDJA 1CF4A 3CRRA 4LJ4A 1QHHA 4MKHA 5DGXA 1BMFA 2ANCA 3VMFA 4C0JA 1XDBA 3EARA 4MYCA 1ZM9A 1DBSA 1NBMD 2Z83A 3PUZA 3CPEA 5FUYA 1M7HA 1W0JA 1AM4D 1RZ3A 2BOVA 2DWPA 2VP9A 3BAFA 1E2HA 3NEJA 4HZUA 1OH8A 3D8BA 1P73A 3CNLA 3QBTA 3BH7A 3AF2A 2O5VA 5JECA 4UXIA 4OHZA 3QE0A 4N3NA 3REGA 1OXVA 3OF5A 1L8QA 2VP0A 4QJ3A 2ZE5A 4NZYA 4Q4JA 1P62B 4KSCA 2B7CA 4LJYA 4LYJA 4M9ZA 3KTAA 3VKWA 3AKCA 5KSPA 3I1FA 4ASUA 3B1WA 2FNAA 4B35A 2JLWA 2GA8A 4BFUA 4O2RA 2GXAA 3U7EB 2DWOA 5FPYA 1KI6A 1E9SA 1DTSA 2BM1A 2UZIR 1G3IA 1YRBA 2Z4SA 3DL0A 2RHDA 2KSQA 5CM8B 4YXWA 1ZAKA 1NVUQ 2IWHA 1XEFA 5G53C 3SBEA 3T35A 3A1SA 4QM7A 1NY6A 1DAMA 1P2TA 5FUXA 4KYIB 4B2LA 1W36B 2A2ZA 4KCGA 1JNYA 2WSSA 1FX0A 1NBMA 5JHHB 2AKYA 3I4LA 5K8IA 4JIMA 1R4AA 1S1CA 1KK2A 2FZLA 3FKSD 1YR9A 1X6VA 1G7TA 5L3RA 4Z1MD 2CEAA 4DLZA 1MKYA 4PQYA 2DHRA 4Q9LA 3WMGA 1QVRA 3LW7A 4GZLA 3ZVRA 1XRJA 2W2VA 3L2OB 1C9KA 3TJZA 1IN7A 1NRJB 5EXTA 2H17A 4C30A 2VYFA 4JSTA 3WHKA 1I4TD 4HB3A 3ECCA 1E2GA 4PXAA 2VBCA 3U44B 1CR1A 4N1AA 3X1DA 4MA4A 4EAQA 2B8WA 3DM5A 1NVVQ 2ZSFA 4TQUS 4XOIA 1NN5A 1F2TA 5KOYA 3FMPB 3OEED 3GEIA 5HZKA 2HV8A 2G9NA 5C1BA 1G3RA 1G21E 1XJ0A 1G5RA 1J99A 1GIAA 2RGEA 5KU1A 2QAGB 1N3BA 3THXB 1E79D 5J4VA 1U99A 3SNHA 1J8MF 2F9MA 5DISB 1GDDA 5J4YA 4GZMA 3HR7A 3QG1A 4BZXA 4F92B 1RFLA 2ZI4A 5EE9A 1FW6A 2VH5R 4DZZA 1HT2E 2FA9A 5AWFC 1R5BA 4DCNA 3V9PA 4EJSA 1IXZA 1UF9A 2XXAB 3IGFA 5LD2B 2BCJQ 4QOSA 4C2TA 4DHEA 4PZLA 2BM0A 4HLUC 1KI9A 2GCNA 2PJZA 3GFPA 4CZ2A 3GP8A 4G0NA 2PEZA 3U7GA
chains in the Genus database with same CATH superfamily
3IKVA 2M6RA 4YFVA 3QLJA 4XGIA 2O0MA 3PHLA 3GHYA 2HBZA 4P98A 3OAAA 4YCBA 3AJ9A 3GI1A 3Q6IA 4RCYA 3VNQA 4IIBA 5JG7A 3D3EA 1A71A 4EHLA 1N2ZA 4EEZA 1FFEA 1GN8A 5I9NA 4OGWA 5EJEA 5AK6A 3PC2A 4XPIB 2JFVA 1BX3A 1T8UA 2H7XA 1E1YA 1P1FA 1S02A 3JQDA 2ZULA 4LA4A 3TRIA 3VDXA 2X77A 4R2LA 4TYQA 3PYLA 1VKHA 2C5SA 2QRUA 1E1CA 1FW8A 5JS2A 4IOJA 3C48A 3HBJA 3ZWQA 4E31A 3FFTA 3N8DA 1G2IA 1NN1A 4PX9A 4REOA 1RACA 1ZN2A 3Q4GA 4DCMA 4TXJA 1ZC3A 3ZY5A 1FMFA 3EDOA 1Q14A 3PQFA 1DT5A 4H7HA 5AVKA 4URFA 5FFNA 2QA5A 2KE5A 4OCZA 3SYRA 4Z7NB 1M0EA 4DTCA 3F6EX 4CG0A 4DM7A 4W5TA 3O7MA 2IS4A 1KZHA 4N9QA 1VG1A 1XR3A 3EZ9A 2YRWA 3PENA 4G5QA 5F1KA 2VP2A 1ZKDA 3EDMA 3K6RA 5C32A 5EMKA 3D1JA 2YWRA 4ZO9A 2Q7DA 1T10A 3QXJA 4BLQA 1V6SA 2QL7A 2PT9A 1OX4B 4FMDF 3H8WA 4LRSB 1LDBA 4ZALA 3VYSB 4EG6A 5I45A 1W0JD 3V97A 1GG9A 2QX8A 1Y3CE 2H9AA 2Q9AA 4UHEA 4WK4B 4ZD6A 2QZZA 4YGYA 5LA6B 3WYGA 3ZCPA 3L4JA 4I4LA 4ALLA 2AC4A 1MVOA 1MOSA 1P7VA 2DC1A 4NAVA 4MW2A 4B6JA 1DC4A 4X1OA 1JEDA 2R4TA 4B7AA 3NNSA 8ADHA 1Z4MA 3L6CA 5L6LB 2JF0A 1UDCA 2NZUG 4JUAA 1B6GA 3RBVA 1VIDA 3EC7A 2CFRA 5LU9A 3K71B 1L4UA 4HWGA 4GI3A 2W2LD 3IESA 3PUIA 4DY6A 4LYDA 1M6WA 1OXSC 3GFVA 1SCNE 1VHWA 5AVOA 1NVDA 3IXLA 3QRWA 1E96A 2OA0A 3VDRA 3RFFA 5FPQA 2NXJA 1PR4A 4IHJA 2QJWA 1ZRSA 3KQOA 3VH4A 4B40A 2BEUB 2OMEA 4X63A 1J90A 3MNFA 3R8FA 1E20A 1X7ZA 4B3FX 1QWOA 4HNAB 1ZGZA 5IAJA 1M67A 2Q9CA 3T9AA 1PL6A 1YZYA 2G8NA 3M7IA 5DX8A 3MBOA 5BPFA 4DG8A 1CUSA 1XCBA 3FUUA 4K6GA 5EGNA 2JHCA 3K30A 2AG5A 4FX2A 2H63A 1C4OA 1KYYA 1RKVA 3LE8A 3MFYA 1GZSA 1H4TA 1BJRE 1YOBA 1SVNA 1NVXQ 1WE2A 3U1VA 4RV5A 3W8DA 2P6NA 4RTQA 2OO3A 1PK7A 2Q1SA 2VHUA 2VTVA 2ACWA 3IDOA 4JZKA 3TTYA 4RTKA 3DOHA 2NAFA 3HXQA 3B7PA 1NLFA 1RTTA 3FPJA 2G1JA 1KDRA 1Y5MA 4NBLA 4JLMA 3HXOA 1RI4A 3IP9A 3G5UA 3OLXA 4J3FA 2ODBA 1ODKA 3GG9A 4RVNA 4TLDA 5H70A 2VSQA 4DEYA 2PKQO 1U0HC 2XEDA 5FWNA 4EF5A 1G20A 1I4EB 4UTZA 2AZ4A 1AN0A 5IUJC 2JGIA 3GLGB 3RRMA 1ADFA 1QS0B 3C3JA 2V5UA 4WXRA 5L6MB 4OLFA 2VQFB 1WP9A 1XTQA 3DW3X 4DBVO 3D6FA 3EWSA 3P9SA 3A3PA 5AW0A 4W7SA 3ASVA 2YVKA 1DC7A 3EAFA 4UCWA 3PD0A 1VDZA 1T0BA 3N8IA 2CNLA 3BXHA 1LW6E 2J0VA 1QGOA 4AXXA 3OZDA 1LBEA 3VR3A 3COSA 1R18A 3HEMA 4C4AA 1M6VB 1ZK1A 3FI9A 1LK5A 1H5NA 1NASA 4XASA 1KVTA 1QHYA 1ODCA 2HMYB 3GH1A 3DUFB 3HCPA 4CTNA 4EI2A 5EHZA 1TEVA 2VLIA 1U0GA 2JEZA 3ABIA 3OMWA 1DJNA 4BRWA 2CE7A 2OUIA 3HZZA 1DU4A 2KJQA 3RTBA 1LNQA 3TKLA 2VHTA 4CR8A 4KIUA 1OH6A 1USWA 3DDCA 3GPCA 4H3KB 1XU9A 1VHLA 1U0LA 3OT1B 4QVGA 4OOEA 3KUUA 3VUEA 3L1JA 1CQIA 1QWSA 3TSAA 4DFDA 4DPKA 1SXQA 2E85A 2JIRA 5FFMA 2HU8A 2PT5A 3L6EA 1X38A 4X6XA 3KYCA 1X3LA 5LZ5A 3WLNA 4CMGA 4QGHA 1D8TA 2X7HA 4EL0A 3ETDA 3NM6B 4LJRA 4LCJA 4J8PA 5FBHA 1PYDA 3P7MA 4TSRA 1J9ZA 2C8KA 1J70A 5KEIA 4A8PA 2VTDA 1ICEA 1M2FA 2YXEA 2YZKA 3F8SA 4K81B 2VI5A 4Q3OA 4ZANA 4EVQA 2GB4A 3PXCX 1KMHA 2PVCA 3GRAA 4QAQA 4I3GA 4NOKA 3WK8A 2ESRA 2P30A 1R4NA 3L3BA 4Q03A 5YASA 3VR6H 3M9XA 1GFZA 3CCCA 3D3WA 4OTZA 2RK6A 4A2QA 1Y3FE 3MAJA 5LIRA 1Z6TA 3FCOA 2JZCA 1MIOA 5FT9A 4B9EA 5ITSA 2FZ4A 3DYIA 2AMLA 3EEYA 2AZXA 1E69A 1WJGA 2UAGA 4CR7A 3UJBA 2B4TO 1TTQB 2I3AA 4MRNA 4UU1A 4DNOA 5KC9A 5HWSA 3MTGA 5JNRA 1ICIA 5K09A 3IJRA 4TV9B 4RTSA 3EPJA 4NFYA 2AN9A 3MMXA 1ETHA 1H23A 1YZNA 2QTLA 2ZIZA 4DQKA 3DE6X 3Q7TA 1BXRB 3GUUA 3PI7A 2GRAA 2GM3A 1OLSA 1OWPA 2ZI5A 4B6GA 1RWXA 5JNVA 2D54A 3W1VA 3ZU5A 1DEHA 3TUJC 1Z73A 3JZAA 4R6XA 4AYTA 5EFZA 2IGTA 3UMVA 2A88A 5FHQA 1YVEI 2H31A 1X7XB 3N0XA 3DYBA 3OICA 1TCCA 3D4IA 4FGZA 4XIFA 3UOWA 4HNVA 2H52A 2FW7A 5AKYA 5ARDA 2KS6A 3BDVA 4GP9A 4BQQA 3VH3A 1NWHA 4FNMA 5JFGA 4IIUA 1NSFA 2HWUA 2CDCA 4C7MA 4RULA 5KTRA 1Y6ZA 1C3XA 2Q5CA 1I80A 2EEZA 3CRQA 3T1YB 3DUWA 1JPUA 1BU8A 1QV6A 4FONA 5F73A 4D26A 3OCUA 4I4NA 2W7TA 2R97A 1ZNXA 4WJZA 2CMGA 4CMEC 2MSCB 4NH0A 1BMQA 2DQKA 3SNKA 3TRFA 5BWBA 1IEQA 1M2WA 3EIUA 3Q3HA 3DZHA 4KK3A 3EAQA 4DWWA 2AEFA 4EA7A 2FMTA 4TV8A 3H5OA 1E66A 3OFKA 2FN7A 1XDZA 5FXMA 3GT3A 3E1KA 4OLBA 3IL2A 4Y98A 3FNGA 1X1QA 3HLYA 1P72A 2IYWA 1VLHA 3EVEA 4Z49A 1O94D 4TKUA 5I7RA 1PHPA 2R7KA 1NR5A 3K0BA 1YUMA 2FVYA 4BAUA 1SU4A 2IH4A 3LX5A 1KP3A 5FP0A 2TMYA 2VNHA 1GGEA 2B1GA 3O3OB 4QICA 4X5OA 5JV5A 5HIMA 5IUNC 4GFDA 1VCOA 2J5XA 2IYTA 1T5LA 1Y89A 3VVCA 3WNQA 4DUYB 5ETJA 3EQ7A 4LN1A 4URUR 2WFZA 2GYWA 3DFUA 2P4HX 3SZUA 1AGPA 1U80A 4INZA 3LKVA 1A9ZA 1PGPA 4PM4A 1H5QA 3UAYA 4J0IA 4MR8A 4RMNA 4L28A 1WMAA 2BHSA 1Z26A 3IBSA 5FJJA 1QGAA 1ZD9A 4UMVA 1JQBA 4YAKA 3GFFA 3PDJA 5HHTA 1DAGA 2BONA 4XIIA 2GN6A 4F3KA 3CT6A 4MV9A 4L85A 1Q20A 5CU7A 1Y4UA 2YW9A 2ZOSA 1VSBA 2CSXA 2BTQA 2W6QA 5FLEX 1JECA 1BWRA 2D4AA 3K9QO 3BXGA 2IPOA 1EK0A 1YR8A 3BD9A 4NLLA 4A2PA 1GQSA 1TYEB 2JFGA 2XUDA 4PTLA 4WZBE 1BDIA 5G1NA 1M34B 2XB6A 1OC4A 5FAXA 4XWKA 3U3DA 4DJAA 4DB4A 1ND5A 1XHEA 2VQ6A 3PC8C 3E3NA 4QLAA 4RXUA 1S0UA 2PU7A 4WGFA 2FN3A 1X1AA 4QEZA 3WWEA 1KH2A 1MA3A 4A5SA 3WI7A 1NZJA 2JFBA 1JEEA 3PQ2A 4FP9A 4PG5A 1H4SA 3LD9A 4L8WB 1M66A 4MI1A 4S1TA 4Y9DA 4WKOA 3TW6A 4ZAGA 1ZJWA 4KOEC 4B85A 1U7ZA 3U1BA 1WA5A 3WKBA 2AR9A 2IZ7A 2QPLA 3X1ZA 5A2QA 2NG1A 4MLZA 2JRCA 1VPWA 4QPJC 3VR4H 3N3AC 1XZKA 1SKYB 4WD3A 3ZX5A 4CKZA 1C8VB 4MHOA 2VHWA 3WL7A 3EVDA 4IICA 2CVZA 2M6LA 3Q0IA 3C1UA 5IHXA 3K7EA 3RE1A 5ALZA 3PLNA 2V5VA 4JQZA 4KQ6A 3OO0A 3B20A 1BGWA 1JT9A 3GZ4A 4U7GA 4ARVA 5IVDA 2P4QA 3OQPA 1VE9A 3K5IA 3WAJA 1Z0DA 3E9MA 1NR1A 1ZM3A 3EN0A 2VPWA 1JV2B 1FZQA 5LLSA 3W78A 4PLFA 1N2CA 3FTFA 1BVRA 4UVEA 1FNSA 3V7YA 1Q3HA 3AV0B 1S9DA 1CIPA 3ROKA 2B9VA 4NMLA 4HNGA 5GONB 3L5OA 4TTJA 2ATIA 1LPBB 2IOFK 4DADA 5B55A 2O5CA 1VI2A 4C89A 4HS9A 4BE7B 4V03A 2O3RA 2WSLA 3L04A 5IBRA 4Q4AB 2DM6A 2J46A 3D7SA 2O6LA 4OHYA 5JYEA 1W93A 4AKIA 5BSTA 3L5KA 3STWA 2PYZA 1QP4A 3B1ZA 2H2AA 3C4VA 3M6FA 3L0PA 4HH1A 2XGJA 2ZU6A 4JLPA 4KR9A 5IF9A 3C24A 3LTNC 1UKAA 3GMIA 3JSXA 4B9AA 1KIMA 1FRFS 2VP3A 2X9QA 3ST7A 4CLOA 1FS4A 2CF5A 3P4XA 4LJ9A 1U0EA 3EZXA 4UMFA 3GUZA 3SBOA 2HF9A 4D3ZA 2DFPA 1DTWA 1WZUA 3C7CB 2FFHA 3JQPA 1VPTA 1LVHA 1FYWA 2PPLA 3WLIA 4V39A 4GKVA 4QPZA 1QQTA 2E4AA 4YRTA 4BVFA 4IG9A 4PHHA 4L76A 1DHTA 3OKAA 1UAYA 1MIHA 4MUJA 3AP1A 2GLTA 3FOCA 1IIRA 5DN9A 3T34A 2PA3A 3BA6A 3DV0A 3TZKA 2QIPA 1W47A 1SQ0A 4KE6A 4ALJA 2XMZA 2EFJA 4WY5A 4AY2A 2OECA 3O31A 3PRYA 4LVNA 1NU6A 2ZBQA 2NO9A 4JI5B 4DIEA 1SFRA 3ASZA 3GA0A 4FGLA 1UDXA 2H51A 3RU9A 4KJZA 1VDMA 1C29B 2O7SA 1PGNA 2I33A 1A9PA 4ND2A 5IF3A 5EJ8A 1OXUA 2WF9A 3VO2A 2YV5A 2HEGA 1IM5A 4MP6A 2OM2A 2AN4A 3DVLA 3T3MB 3DV0B 1VB5A 4R05A 4OF4A 2OKGA 4R2HA 1W25A 3LLVA 4FT2A 4UPDA 4UHFA 1AT1A 3TNYA 2UYYA 1JXOA 3MTIA 5AW4A 4FMCF 2PO5A 3N2ZB 3NCHA 8ATCA 4U7HA 3JRXA 3HKBA 2GXUA 5ENZA 1QLJA 1XMJA 1FYXA 2V7WA 4JEUA 5D84A 5LNK6 2JJMA 4HFNA 2O50A 2VSFA 3LA8A 3Q8MA 3SKXA 5T4BA 3DKVA 1BRMA 1C1XB 2JIZD 2CB0A 4JFRA 2RHJA 4UHJA 2P9ZA 3WGVA 2KB0A 4TV8F 4I6JA 3HS3A 3OIFA 1GYRA 1RLOA 3PVZA 4IMRA 1P7ZA 2TYSB 3PQEA 3VYWA 3AUJB 3H9EO 3DE2X 4JT8A 4K9SA 3IMCA 2GZ3A 3CHYA 5K2MA 2B8JA 4CDRA 1Z35A 4KBFA 5BRAA 2VJCA 3OESA 5HVNA 4MV0A 4DM3A 3F8TA 3DCIA 2WINI 3ORSA 5H4HA 3ZU3A 1UPBA 5DHUA 3ZDFA 1KMHB 1JUDA 1OFUA 2A0UA 2FK8A 2JVIA 3DP9A 1ENZA 4R3UC 1F38A 1C4WA 4HUQB 3ZE1B 4JK3A 5H9WA 5I48A 1BA2A 1X3SA 4X8HA 1XJCA 2A5JA 3SXUA 4U2EA 2YIMA 3CG0A 4LQ4A 4BGUA 4DAOA 5HZGA 4PYJA 4XRRA 4N0PA 3L8ZA 4DXAA 4E6EA 1JRLA 1E58A 3ZQKA 5DMHA 5F7ZA 4YRLA 1BE1A 4JUCA 1NDQA 1UBEA 4B2IA 5KYXB 1GA4A 1A5BB 3OT1A 4O4LF 3P2MA 1OGYA 4GKAA 5AVSA 3I4FA 4X7BA 4JGIA 1AO3A 1I9CA 4WCVA 4E4RA 3L43A 4RMIA 3KT8A 2NTJA 1QHHB 1RHJA 2P8SA 1X14A 1D1SA 3ONFA 2F48A 1S2LA 5CG2A 2BLNA 1L5YA 1GQYA 4FDLA 1RM3A 3ZXXA 4UAVA 4ENVA 4BNHA 1IZZA 3ZIAA 2QLBA 4D7AA 2IHYA 4UU7A 2W6JD 5DT2A 1KZ9A 4L2IA 1V3VA 3QNWA 3LCUA 3VSDA 4EPRA 5AW1A 1O0CA 1QQBA 3V46A 1TECE 2XQFA 4DLVA 2O48X 1PF7E 2W4IA 1PG5A 4HCJA 4R8MA 2DWQA 3PPXA 3PHGA 4YLYA 1YASA 3ZHBA 2PHZA 1TPYA 1IVYA 2QVZX 2QNBA 3TFWA 3J81k 4Z53A 1U3CA 1V8FA 1ZYUA 3BFVA 1NFFA 4YT2A 1BCRB 5JQWA 2I4NA 1N9GA 2Y3IA 3CUYA 4IGAA 4QAJA 1QJ4A 3CF6R 2AJLI 3V8NA 4TWAA 5LP6B 2CXRA 2I7CA 2OTCA 2Q5FA 1HE1C 3ICOA 3LRTA 4YGXB 4CQJA 4EYKA 3QW4B 1R12A 1JQAA 4JP2A 4LZLA 1CJTC 2HCBA 3EEQA 4RGYA 3MMSA 3G2LA 4GW3A 3E9QA 4ZAWA 2P2NA 3PL1A 4HR7A 5BNWA 2JI4A 1XLVA 3G0HA 1J25A 2AOTA 4JYBA 3AL3A 1YDHA 3BBPA 1QR6A 2PX0A 2ZITA 1BKDR 4LQDA 4BDTA 2AZDA 2JDIA 3KAPA 2FW8A 1JFRA 2J87A 1ZONA 3FLMA 1JXAA 1BIFA 4JCCA 4Y6RA 5F2KA 5HR5A 1T3ZA 4KMOA 3B9QA 1GOTA 4RK4A 2PA0A 4R2WA 3W2EA 4FYPA 1UC9A 3TLXA 3DOCA 1JR3A 1JXMA 3GPLA 4UJ3A 3DLTA 3VOAA 5TMEA 3B5JA 1KEEB 1DX9A 3WOVA 4IO0A 5FR2A 4O5AA 1LBQA 4DMKA 4GEGA 3M34A 4LJSA 4NX2A 3ADCA 3LP6A 1UAGA 2QY9A 4N0QA 5TMPA 1OSNA 2J3LA 1J5XA 3RI3A 3NLLA 3COVA 1EVQA 4QO8A 4BX8A 1RMYA 2F1OA 2OKCA 1AKVA 4HQNA 4I1VA 4YWHA 3NWBA 3ZYCA 5BN1A 5FOQA 5ERXA 2DYKA 4RJKA 4KN5A 3U40A 3ZQ4A 1AN9A 4IILA 3BZWA 4INJA 1K4MA 2WD7A 1VG8A 1VHJA 5ALLA 3LGSA 3H1PA 5AJVB 5LP1A 4JBXA 2XMQA 3ELWA 5KWSA 4CTJA 3ENNA 2P2CA 4IIVA 4BVHA 5U9CA 4D9HA 4QBFA 5AKJA 3THXA 3BMQA 1ILEA 5CJPA 1UKYA 5FJIA 4FWTA 3QEJA 3W3AA 3ER6A 2RB4A 3MWGA 2W6OA 5TVGA 4D3SA 5AIBA 3N2EA 3R7DA 3O26A 3MTAA 1A4IA 3C3WA 1ZPDA 1K66A 4TMTA 2XA9A 1L4YA 1X9IA 1Z4IA 4RKYA 1Q1ZA 2G77B 3V8EA 1OH7A 4OQNA 2V0CA 2IITA 3B48A 1PNTA 1LV7A 3P4YA 4FW8A 2NUBA 3D4BA 4QOJA 3UK7A 5J2TF 1Q3KA 1DIOB 3H42B 2FZ5A 4OQXA 3ACDA 3EZGA 4QUJA 4TSKA 3TSYA 1CQXA 2Y05A 3SS7X 4CMAA 4NYJR 2CHEA 3PC8A 3RC9A 2QE7D 1V3UA 1EHIA 5BYBA 1E3IA 2H0RA 4X1KA 1DC8A 1A04A 1FJ2A 1GUAA 1VCHA 2WKQA 3CT4A 4WZAA 1KH3A 3M6AA 5JT1A 3QNUA 1IZ0A 2C7BA 1E2PA 2L0XA 3VO9A 1QOQB 1SKAA 3CBQA 4CCSA 5HS4A 2BZGA 2FGKA 2WFMA 1GQRA 4EDHA 3U60B 3H1BA 4PFSA 1ZI9A 1L7AA 1JTVA 3KELA 4BNDA 1QBGA 4ERXA 3R5JA 2FEXA 1F14A 3LBNA 1A9YA 1GU7A 2H2WA 3DBLA 1DCKA 4CN9A 3RSHA 2QLNA 3ULKA 1DEAA 4NRDA 2VTBA 1YZGA 1QYXA 1ZD5A 4RO0A 4DWVA 3LRXA 4B8YA 4JYZA 1V9SA 3IEKA 3EGCA 5TARA 4O4HB 3DZKA 2BLLA 1WW2A 3PE4A 4RDHA 3RVRA 2GPYA 1N5RA 4J94A 3SSAA 3UKJA 4YRBA 4OSPA 4HUTA 1C4XA 3ROGA 2FPPB 5ALMA 1ZU5A 3E9NA 3FROA 4G86A 2CDBA 1NRXA 1DEOA 1XL1A 3HB7A 3SOZA 1PW7A 3PFIA 1R4MA 3HJGA 1VRWA 2FR1A 1PFWA 3EK2A 4PPGA 2FG5A 2P67A 2Q8QA 4IV0A 1CUJA 4BN0A 3UGQA 3SJZA 1JIKA 1H93A 4XX0A 1L9KA 1ZOLA 2MSWA 3OWOA 3WNVA 3EASA 3KIPA 4ARBA 2VDWB 3ONVA 3ESDA 4NK4A 4KQFA 3DZBA 1I3OA 3FLEA 3KP1A 3ZTYA 3TIFA 5HQ3B 1NJ8A 2H2IA 4C87A 1HT0A 1R5NA 2ETVA 3ZCQA 4HN9A 4PXSA 3DTYA 1YJQA 1P91A 4AJHA 4P7JA 1L2TA 4BO9A 3GG2A 4M21A 3R9IA 4C4ZA 2B6NA 1YL7A 3NOVA 3OI7A 4JLSA 4RKQA 4BUCA 4HVLA 1MJHA 4IUBS 4ZCMA 1RYDA 2YFQA 3SHTA 2JHAA 1VLVA 2B99A 1W6RA 2ORIA 1QHIA 2OVFA 1GU0A 2PKCA 4MYHA 5E7JA 5EXDA 3RIXA 1N6IA 3G0IA 2FG6C 3BJMA 3QVOA 4KQHA 5DYIA 1G8AA 3G7NA 3A3OA 4BMCA 3QI7A 3TTUA 3RS4A 3V3TA 3K0AA 1DC6A 1I6WA 1VMIA 4FEYA 5DHRA 4B31A 4BKOA 3V7WA 1Q7CA 4JLDA 1GTL1 2FRDA 5JATA 3AFGA 5LDGA 2ADMA 3WQQA 3GJTA 5B1SA 1U0OC 4DSNA 4F85A 5FOWA 4HLQB 4Y0NA 4BX9A 3A4MA 2BFOA 3VPXA 4EWLA 1WHTB 3BTUA 1T0HB 2Y0DA 4LJ5A 2R8YA 4ONEA 4Y2GA 2IZOA 4JVMA 1AMNA 4JBLA 2YY5A 1QV9A 1XDDA 5EIFA 1XKTA 4FFDA 3SDZA 4QVIA 2B30A 4IAOA 2A9PA 4A23A 2FJ0A 4ZT6A 2QMEA 5F21A 2GARA 1EI9A 2A84A 4HEJA 5JZMA 1DOZA 1KC3A 1J0AA 3C7DB 2C9CA 4PC2A 3VAAA 5AW2A 1JDPA 1ORDA 1SXJA 2RGGA 2V3WA 5JBQA 2FRXA 2JIMA 2GUGA 2NZJA 1C3OB 2RKWA 4ZEXA 5CXQA 3TOVA 4DDUA 3N8HA 3EDYA 1WDKA 5E3JA 3LX4A 3P26A 1ADYA 1SU7A 3TQRA 3RAFC 2Q5OA 3PDIA 3H2JA 1RTKA 3W8EA 1LPAB 2QM7A 1F4LA 4BJ3A 1TPZA 1J00A 1E9BA 4X8OA 3HGQA 4RW0A 5EWLB 1ZHFA 3V7UA 4PC7A 5HMLA 3CW9A 5JNLA 2FJPA 2HHLA 1HZZA 3K9WA 1I3LA 4GPAA 4B45A 3MT0A 2FOXA 4MQEB 3LQYA 1KJZA 1Z06A 3W05A 4QYIA 1FRZA 3QFFA 3EIFA 2QRVA 3RYFB 3O21A 1ZHOA 1HGXA 3HP7A 2QD3A 1ITZA 3ZCSA 3CE6A 3PR1A 3NHBA 3LVQE 1Z0AA 2EKZA 1RYYA 3ICCA 3VPSA 4DJEC 4LF9B 2EVWX 1RXEA 4MDYA 3WWDA 4BFWA 1D8AA 2I2XB 1PKEA 2NPOA 2H7VA 1OWOA 2LUOA 2R5NA 3DB1A 1JBKA 3NYRA 4BJHB 4BQIA 4HC4A 2NPIA 2IHUA 4RK5A 4JZYA 1YA8A 1ZJZA 5K3FA 2WNIA 3ZHRA 4URXR 4R8RA 4RKEA 1EVEA 4ZYWA 2BHNA 5HKKD 1WU7A 4K8RB 3SVLA 1O95D 1Z18A 2QRHA 1AQYA 3E9EA 4MIYA 2C84A 1M1NA 2VDJA 1GZVA 2I7TA 4HDKB 2ZJ6A 3NV9A 4D3FA 2QV7A 3IOYA 4G4SO 4IEIA 2ZCJA 2YMLA 3VJKA 5ALVA 5FQNA 5CLLA 1M1YA 3X3HA 1ZHHA 1GTMA 1NIJA 5AM3A 2V9PA 5LJLA 5IC6A 1G6OA 2P77A 3OJLA 3W34A 3QZUA 1E5XA 1ULHA 1E7RA 1NI3A 3WQSB 1UPTA 4IL5A 5AM1A 3LQ1A 5IASA 1F9EA 1S2NA 4FXPA 3SQOA 1O03A 1VIMA 4IJQA 1INLA 3ETNA 3PLRA 4ENRA 1G63A 2BBOA 3QV2A 3UW1A 5CW2A 5I7AA 2GCOB 3DZCA 2OLKA 2WVAA 4LHSA 3VNVA 2O1WA 2WM9B 3CGWA 1SIBE 3F9RA 4ZRMA 3TB6A 2N3ZA 1NN3A 1B8UA 1T4DA 3CLKA 3IE2A 3LYHA 4DLNA 1TVEA 1ORRA 3AESA 1HYEA 5DNAA 2OV1A 2EW8A 1PG2A 4E12A 5H16A 5BNTA 1TEHA 2HA3A 2J9XB 5EYPA 2CXOA 2I7DA 5ALFA 1CJKC 4YONB 3U4IA 1USVA 2CLFB 4A8TA 2C61A 3WJ2A 4LWZA 2WB2A 1Y4AE 3LWBA 2ORWA 3K2IA 3P9RA 4ZCTA 1T34A 6ABPA 2H3HA 2Y8EA 4P31A 1F5SA 4N3BA 3C7AA 2X41A 5C18A 4KWCA 1Q7TA 2WT4A 1DIHA 2YC4C 4WIAA 5BQXA 3U61B 5ALOA 1UDWA 1QFXA 4LV8B 2OSVA 1S5PA 3GRFA 4EUKA 4D9KA 1L3IA 2R2AA 2UYCA 2ZJZA 1JEQB 1TYZA 3UTDA 1BE0A 4A16A 4CKEB 1UEXC 4OYRA 2PKQP 3G0DA 2Z6VA 3FHCB 2QE6A 4ZTUB 3I62A 3FDFA 2I3GA 2I6XA 1QH1A 3MT9A 2H7YA 2BH9A 3IPAA 3NB0A 2W6IA 5D3QA 5DTRA 4CM8B 4ZJPA 1AIPA 3EPHA 2Z8YA 4ZOLF 5I7OA 2G88A 2ISQA 4FR5A 2DHQA 1GKKA 3UG6A 4O1MA 2R8RA 1XI2A 2VKQA 5GWXA 2PMKA 4HDOB 4DARA 2PQMA 1YCHA 2GO1A 3KVVA 4G89A 2QTVB 2YWEA 3AEUA 3A1WA 2CVQA 5IC4A 3BL8A 3SC6A 2DRIA 4F60A 5GAJA 1EVLA 2HSDA 3AHFA 1S1MA 1YDGA 4KREA 1VHDA 1A7AA 2AXNA 2PLRA 3NH9A 4Q3KA 4LXXA 3DL4A 1C14A 1RYNA 2V7QD 5F1OA 4R4JA 3R3UA 5CEFA 1CV2A 1JKIA 1VL0A 1ZIYA 1R16A 3P9XA 4DANA 3VSBA 1P2SA 3KVOA 1L5WA 4PO9A 2X6TA 4CYMA 2OLEA 4W7HA 1SOWA 1CR4A 4XJXA 4ZEMA 1XDGA 4ZZ2A 4C6RA 1GGMA 4AW9A 5FRDA 4XLZA 4HAWA 4J90A 4ETMA 3PV0A 4GPEA 3WLFA 2HC9A 4URVR 3SN6A 1RRFA 2BEUA 4ZDIA 1XRNA 3M5PA 3JRWA 3RRNA 4I9GA 1Y9EA 4B17A 4MR9B 3KQVA 4Q9NA 4PAMA 4V24A 4DR3B 2OESA 1AXEA 5EQFA 2V98A 4NJEA 2EL7A 2H4YA 1T9DA 3CNEA 1PZNA 4KI0A 4TYPA 3GR6A 4ZQGA 3FMFA 5AJXA 4QG3A 5EJ6A 1C1DB 1GUDA 5HKBA 1CUEA 1H3EA 1OX6A 2FETA 2A0XA 2P5UA 4CL0A 5LXTB 4RF4A 5AKIA 1JLLB 3U2QA 2L69A 1PJSA 4DVJA 1MB9A 2ZTMA 4AKEA 2DR3A 1KSGA 3L1VA 4O2BA 4PYMA 3WWPA 4REQB 4CIWA 1QIJA 3D1LA 5CHYA 3C5EA 3D6TB 3K35A 4OG2A 4TM7A 1FFCA 2ODNA 3F5DA 3I0NA 4RD6A 5LA6A 1J24A 1ZOOA 5IN4A 4CFZA 1JJBA 1QYRA 1RBZA 1IL0A 2Q2NA 3HUEA 5E1OA 3H8SA 3OUZA 1O57A 6GPBA 2BH2A 3DOOA 3ETEA 1WX1A 4XVUA 1CZKA 3URKA 3X1XA 1DARA 4ZU1X 5A0FA 1Z7YA 1EQ2A 4NIMA 2I03A 2VNKA 4GR4A 1A0OA 1RXIA 1V35A 1S2MA 3R7FA 3K0FA 3GXBA 4G0PA 1HUQA 3IC5A 4S1VA 3KOXA 5BNZA 5EHIA 1HLGA 3HR8A 1P0IA 1WIWA 2XHZA 4JP3A 1L4GA 4NS1A 3D2CA 4QUGA 4BUZA 1XEXB 4LJKA 3QKSB 3FTDA 1W52X 2Y77A 1Y9AA 3JAWB 4MHSA 4G1UC 1CB7A 1RRPA 3KXDA 3MVEA 4I14A 1XCPA 1GNPA 4MV4A 5DTJA 5EERA 3L0BA 2A9KA 1B0ZA 1KBQA 5AHOA 2QBYA 1KZ4A 2H4ZA 3QTBA 3F97A 2CCJA 2ISCA 2H5JA 4JOCA 2XQVA 3CLRD 1MJFA 2DWCA 5LBIA 2Z2YA 5AXDA 3U0VA 3ZXIA 5B6IA 5CAEA 4F04A 3NBZC 4ESVA 1KS2A 3QYPA 4PRZA 1C0EA 3CX4A 1PGQA 5SYAA 2XRYA 4NU8X 2G4LA 5GJVC 4QWMA 1TM7E 4GXNA 5E3IA 1X7DA 2WSSD 2YOHA 3CKLA 1FNDA 3I04A 4J2OA 1LLUA 2GVNA 4LQCA 4H6WA 4UTRA 1MJNA 2HBYA 2PV0A 3MOIA 4MWGA 4EKIA 3LYLA 2B98A 4WZBA 3U3KA 4MEBA 3WQBA 2GPAA 2GYUA 1YBAA 3LGXA 4C0LA 2J4FA 2FMXA 2BMDA 3QUBA 4LJ6A 5EQDA 3T99A 5C8ZA 4BCCA 4ZPJA 2YTZA 3IHWA 4Q34A 2G0TA 5CPBA 2YMQA 4WEQA 3KQQA 3PU6A 2D7DA 1XZCA 3AUUA 3JR3A 1WQ4A 3MZ0A 4EEXA 3JASB 4HH4A 5EMHA 4AJ1A 4M8KA 5L3SB 1PT7A 2EFDB 4MV8A 4YCCA 2C4WA 3BORA 3F6RA 3TW0A 1WBDA 4E33A 1ZK3A 4W6QA 4AZ0A 1U02A 3FDXA 4Q9IA 2V6MA 4J3NA 5K8TA 4HB0A 4B3MB 2C04A 3G6KA 3DA8A 3I37X 1EBUA 2C9DA 4Q66C 4XCQA 2HFJA 2PZKA 4H4CA 2XEXA 2RI6A 1KHHA 4XX0B 3TEFA 3LV8A 3GVXA 1FUIA 3AEYA 4IX1A 1QZTA 4WN9B 4A8JC 4DQXA 1H8HD 3B3FA 3Q72A 2ZIFA 3UFXA 4E0BA 5K0EA 1TCBA 5TY0A 1V8PA 1WTCA 1B1CA 3OZRA 3GCGA 4UBLA 3FNRA 3ITDA 5AR1A 5K8UA 1CT9A 4WVFA 1A69A 4D0NA 3H1GA 1XP8A 1ISFA 3AXTA 4PFQA 1RYEA 4AWAA 3HCCA 3NW9A 4GMHA 4AF7A 5JWRA 1GJRA 4ZOLA 4BFVA 2WWIA 2FX5A 3EFOB 3IIKA 4CEHA 1O3YA 1P1HA 5ECYA 4F4FA 1X0XA 1Q6YA 4MVJG 2RGBA 1TL7C 2EBFX 2PAFA 2VIIA 5K7SA 1XZIA 3M3HA 2OILA 3KETA 3ODPA 3DO6A 2DFLA 4NULA 5BNFA 2KWIA 3DGEC 3DVQX 3WL8A 4LNUA 4P34A 1IVNA 3FFWA 1Q92A 1E9AA 2YKGA 1XD2A 2ODTX 2K4MA 3WWYA 5MDHA 4B2YA 1SVOA 4IR7A 3CX7A 2KLBA 4LOIA 5A5GA 3CIFA 2ZJAA 1D2GA 4D9CA 1Q77A 1G64A 2C59A 1FNNA 4M0DA 2WUFA 4H0FA 2EP7A 2EATA 4PLHA 4OAQA 2PV7A 3KEMA 4WZAB 2GMWA 5TX7A 2WJAA 3KQPA 1XTKA 2EERA 3W5UA 2Q50A 3TFQA 4BP8A 3OZWA 4DR6B 2BYTA 4F8JA 3VRHA 1QVZA 3OD5A 2CXNA 1Y3DE 2I2WA 3BH6A 4N12A 3TMKA 3WLLA 4DLPA 5K8CA 2PGJA 4F5EA 1FEZA 2YFHA 4U6QA 2FE1A 1YA4A 1HT3A 1E4VA 1UJ4A 2YR0A 3UWSA 3FA2A 2IF0A 2G9UA 1SVIA 2OM6A 2VF2A 2OGZA 5F1YA 5K1ZA 2QPAA 4YCMA 2B3TA 3IELA 3PXAA 3VNBA 5IMBA 4DSAA 3R0VA 3H2HA 2ZTLA 4I8XA 4XM0A 1F0PA 4LOAA 1FQJA 4AJ2A 4EQZA 4YDQA 1OH5A 4WK0B 4OAPA 3L8CA 4FYHA 3WFIA 1YT5A 4CDGA 1GN9A 1K0FA 1CXZA 3ZJTA 5LB4A 1YVDA 3EE6A 3G6WA 3N5KA 5FEMA 1XXHE 1JQ3A 1H0HA 5FPKA 1XNRB 2L42A 1U8XX 3A2KA 1PZXA 1E1NA 2ZRJA 2W8BB 2KBEA 3V55A 3HI4A 4UATA 3TCXB 3LL7A 4K0KB 3BSFA 4MMYB 2OEPA 4AMBA 4B6SA 3ZZNA 4E5KA 2BR3A 3WNDA 3WDLA 4U2GA 2K7FA 3VYVA 4F46A 2VXOA 4FKZA 5K20A 2OUKA 4HGOA 4NK5A 1E1DA 2IKQA 4AY5A 1IBMB 3BAZA 3I53A 2AKEA 1IY9A 1LX6A 3GT7A 1Z33A 3WQRA 4B73A 5KHLB 3UB3A 3FSRA 4C0KA 2ZB7A 2WU4A 4RY8A 5FDFA 3AL2A 2LKDA 3LC1O 2D06A 2K2QB 2WUDA 3IYLW 1QYVA 3PHIA 4K0RA 4JKYA 4W5WA 4ZTBA 4ERNA 4F7WA 3DO5A 4IBOA 2BGJA 2XWBF 3WA7A 1ZGBA 3GJ4A 4HNRA 5DN6A 4US1R 5DPMA 4QM6A 1ISIA 2YMMA 3OJWA 5JE8A 4NS4A 3FWZA 1Z5OA 1VJTA 2Q4OA 4XR4A 2J7PD 5T64A 4O0MA 4PZAA 2CW5A 3WGGA 4TWRA 5G0WA 3TNDA 3KYIB 2DSTA 4U0JA 1GQQA 2ZIXA 1PL7A 1HO3A 1Y1PA 2OCIA 3A10A 3O1JC 3RIGA 3DF9A 3UM9A 1JHRA 2QRVB 2QSJA 3H13A 1O54A 1FFAA 5CBPA 3DDOA 3GLKA 3RRZA 3Q8KA 3B85A 4G5FA 5GV7A 2J7KA 2W2OA 4M0CA 1XOIA 2XUAA 1PR2A 1CQZA 3EGWA 3CURA 1WQ1R 3QHPA 4O8CA 4JT2A 3BHJA 4G8CA 1VOTA 4ACAA 5JRZA 4OMFG 4ZMRA 5FI0B 3MAAC 1JH8A 5HX7A 3CV3A 3BJZA 3PI6A 2PMFA 1E94E 1JHYA 1SR8A 4G67A 2W42A 1PJQA 4FZRA 4I2NA 4JLAA 3VDQA 3W4KA 4I66A 3QPWA 2YYYA 3PVSA 3A9UA 1E5LA 3AJ8A 2L2QA 3IKMB 4FR2A 1NBWB