4GMDA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
203
Chain Sequence
TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 203
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmdA00
4KI0A 1OW3B 1E1RA 2AWNA 2XNDD 3ZVMA 3BB4A 1EWQA 3A37A 1LF5A 2WSMA 2WWWA 3CWQA 4BLSA 4R71A 4FWIB 2QAGB 1E2PA 3AP2A 2QTVB 1GIAA 1GL7A 4HLUA 4CDGA 4L16A 3VAAA 4EQ6A 2ZRHA 3EZFA 4QC2A 5BN4A 4IFBA 4II7A 4GBMA 2BMDA 2BBTA 1UFQA 3MGCA 3QIAA 1G6OA 2X2EA 1S3SA 2XAUA 5CITA 3CBQA 1D2EA 2F1JA 2ZSBA 3REFA 3MUFA 4Q4JB 4DLTA 2WAXA 5HCNA 3T34A 4DT1A 1V5WA 4JBXA 1TNDA 1RRCA 3KB2A 5AR1A 2O52A 3TW8B 2WWIA 3DKVA 1A82A 4BECA 3RS7A 3T35A 2ZRKA 2W00A 1VYTA 4NCNA 1H8EA 3LH5A 2GCOB 3WY9A 4AYXA 1ZIPA 2BV3A 1U9IC 2QBYB 2IUSA 4AG6A 2YWHA 4D6PA 1RJ9A 1OFUX 1CJMA 2QROA 4C2UA 3CUEF 3TUZC 3Q7PA 4F93B 4CEJB 5CJPA 5M04A 3BRWD 5GADl 4BUJA 5CYOA 4PZLA 3WRXC 5HPYB 1XTJA 4I99A 1Q1ZA 2IS6A 4Q4HA 1COWD 2JLUA 4QHSA 3RS3A 2WSSA 1G8FA 1XB2A 2DFNA 2IX3A 3HPQA 3KJHA 1PZNA 2GJKA 3SYLA 2CJWB 1E9DA 4JT4A 2X8AA 3K9NA 5E7JA 3HDTA 3F8TA 3KUCA 4JS0A 2JLXA 4NYJQ 2WJVA 1G16A 1SVKA 1OLOA 4GFDA 5HCIA 3R7WA 2ONKA 4W5WA 4C4PA 4GP6A 3GLGA 1FMJA 5AJXA 2GJAA 1E9RA 1WMSA 4DZZA 4TYQA 2OT3B 1GITA 1NVXQ 1QBKC 2XTZA 4FCTA 2F1IA 4KYIB 4ZDWA 1D8TA 1XTIA 5DHAA 1N2CE 1OXSC 2Z6VA 4GMXA 1CBUA 1BOFA 4C0QC 4ILEA 1FUKA 5E7IA 5HE8A 2ZE6A 3IQXA 5EE1A 1R5BA 3TAUA 4DSUA 1G291 3LVRE 2QL6A 1DOAA 2FU5C 3G5UA 4IOKA 4A0FA 5D3MB 2XGJA 1JXMA 4B3XA 4O0MA 3R9IA 1XTKA 2NO6A 1KO5A 3BIFA 1CLUA 1N6PA 2QENA 1K6MA 4IDQA 3NBFA 2REXB 2WJJA 3EZ2A 1BMFA 1R10A 2YOGA 2DYKA 2ZYWX 3RSLA 2GK6A 3FKSD 5DISB 5EE3A 3O8CA 2RGCA 1E0AA 4BLTA 1U0HC 3R8CA 2C03A 2CCJA 4YMTA 4BZQA 4MKHA 3CX8A 2BVNA 4A36A 1CXZA 3CF6R 3U3MA 5FTNA 3ZZ0A 1Z63A 1JXOA 2QORA 4XD7D 2EYQA 2QP3A 2WZQA 5JJLA 1U94A 3CM0A 2QU8A 2R62A 4PO8A 1N25A 5C2JB 4LJAA 3M4YA 4V03A 2I1VB 4EUNA 1EG7A 3B78A 4EIWA 1AA9A 3Q85A 2EFHB 4NCKA 5L3VA 4B32A 2BC9A 1W46A 1HUQA 2FPMA 2MMGA 4XSHA 4KXFB 1ZINA 4Q7KA 4JIMA 4KO8A 3PFIA 1P62B 2IK8A 5AUPB 2WWFA 1DELA 2IT1A 1GP2A 2G77B 1G41A 4Q19A 3MCAA 4KV9A 1QVRA 4Y0VA 4E07A 4MRVA 4LBVA 4OI1A 4IVQA 5JHGB 3SQXA 2GF9A 1E1RD 4ON9A 1GKYA 1YZUA 2ODEA 1U0LA 1ZUNB 3BE4A 1ZNYA 3KFXA 1OXXK 4Q7MB 4OI2A 5A4JA 2XZPA 2C77A 4D4MA 4GP7A 5LB2A 4DIDA 4Q00A 5KNDA 3QQ5A 2NZJA 1W48A 2H1LA 1Z3IX 2GILA 2JGNA 2UVQA 2O8CA 5CB6A 3VKHA 4BFUA 1Z0AA 1E9FA 2PL3A 3K0CA 4IXNA 4DLRA 2UZ3A 1ZYUA 5JBQA 2WKPA 4PX9A 4DUGD 4TYPA 3C41J 2QE7D 1KK0A 3Q7QA 5E4FA 2J0UB 3OESA 2ZE7A 3E1SA 2GTPA 2HLDD 4N1AA 4OBEA 3IEUA 4YLGA 1H8ED 1CR4A 2GHIA 4K8OA 4PSVA 1M74A 3KB1A 1CR0A 4BE7B 2C78A 4LJ6A 4I81A 2A5GA 1E79A 2QT1A 4AG5A 4GT1A 1SXJC 3CONA 2RGBA 1US8B 1JI0A 421PA 2G3YA 3PVSA 4URVR 2ZRIA 1UKVY 2QMHA 2G9NA 4MYHA 4DLVA 2QY9A 4MDEA 4BQSA 3Q8XB 2PT7A 2WSSD 1G3RA 1NVVR 5JRZA 1WBBA 4G0NA 2DWQA 2GK7A 1PUJA 1DTSA 2IYTA 4QBHA 1MO3A 1WF3A 5DGXA 2ZANA 3WMEA 1Q22A 2YINC 3MRSA 3TAHA 4DJTA 3QF7A 2QA5A 2ZSAA 1N6HA 4N3NA 4Q5IA 4PTLA 2QI9C 2HYIC 3H0KA 3PEVA 2ZSDA 1IN7A 3GLFE 1TQDA 4C0HA 3LLUA 4MUBA 2PT5A 3CNLA 4FCWA 4DSOA 3AKCA 4B6FA 1TQ4A 1TADA 4BEJA 2VBCA 2VF7A 2ZJZA 4A4DA 3B1YA 1Q12A 1ZC4A 3FHCB 1JECA 3X1DA 1G64A 3HU3A 3NEYA 2AKAB 3QXHA 1IAQA 1C4OA 2B6HA 3C7KA 2D74A 3P4YA 1EXMA 4Q21A 1C1YA 4TMKA 1E2FA 4OK3A 4L15A 4FMBB 1R0YA 3U3JA 1ZCBA 2CHGA 1TX4B 4JVNA 4UNNA 4TSFA 3TSWA 5EE9A 1AIPA 1AS2A 3TRFA 2KE5A 1Z6XA 1MV5A 2X1VA 4LCBA 1XWIA 4V0OA 4PC6A 2IYXA 2D4HA 2QZ4A 3DL0A 3KXIA 1L4YA 5E3HA 4DCUA 1BMFD 2DR3A 1L2TA 3GLHA 2RHDA 2PLRA 3LBIA 3AKYA 1XNJA 4TZ0A 3LD9A 4M1SA 1G6HA 1XCPA 1XJQA 4V02A 5FPHA 2Q9CA 2BWJA 4P3YA 3KTAB 1IJEA 1N6NA 3FMOB 1XPRA 3KX2A 1ZBDA 2H18A 3IPYA 3LWNA 4M9QA 3QKSB 5HKKA 2OCBA 3ASZA 4TLEA 1EFRA 4N0EA 2L0XA 3UANA 5EP2A 1A5TA 3FMPB 4LJ5A 2HV8A 4C0AC 2VP4A 3ZD7A 4KVGA 3VKWA 3HP1A 2YV5A 3H86A 4LWZA 1II9A 2F43B 4LV6A 1M2OB 1CRPA 3MD0A 1QHIA 1NVUQ 4MYCA 2UKDA 5F9FA 2ZI3A 5KSZA 4BFYA 4B73A 2ZRAA 3E70C 1Z6AA 5TVKA 2XOKA 2CHVA 4HDOB 3NH6A 4DCVA 1I4TD 2ERYA 3OIVA 2GEUA 3I1FA 4PXAA 4DDWA 4LRWA 1IJFA 2FOLA 2ZI6A 2IS4A 2R6AA 1GNRA 2EYUA 2FE4A 3BJIC 2NZ8A 1X1SA 4KODA 2AX4A 3QG5A 4QGHA 1U8AA 4IHQA 4WZAE 4HB0A 3OIUA 3CR8A 3P4XA 4WVFA 1W36B 4JJZA 3IBYA 4C30A 3SHFA 4D80A 4D4JA 4DLZA 5LD2C 1CKEA 4TYNA 1M7BA 4RCYA 2ZRCA 1S9HA 4XIGS 1KTVA 5EJEA 1IN8A 4J0QA 2CVFA 1KGDA 2WIAA 4IKEA 3BGWA 5FOTA 4GZMA 1L8QA 2OSBA 1OFTA 1ANKA 5FOWA 1VG0B 1XU4A 3GJXC 2PBRA 5EXSA 5IRCD 1P2SA 4MDFA 3UPUA 2C04A 3GLFB 3K09C 4A1FA 4K81B 4D81A 2VHTA 1KIMA 5JEEA 3R9XA 2A5JA 1BKDR 1N6RA 2IYUA 3CW2A 5JWRA 3KL4A 3QKRA 3ZVLA 3A1VA 5CDFA 4CW7A 4G5OA 1XTQA 1MKYA 4NONA 2WM9B 1E79D 3RWMB 3EWSA 4HB2A 1IN5A 3QBTA 4KITB 1KI8A 3FE2A 3T12A 2QN6A 4HSEA 1OH8A 3AP3A 1QDEA 1J8MF 5AJWA 4G5RA 1NLYA 1FMLA 4Q9IA 4IVPA 3C14C 1OFIA 3T5GA 2FSHA 4CEIA 1FZQA 3NBXX 3VU9B 2JA1A 1NKSA 2Z4RA 2PMDA 3L0OA 1ESMA 1UEIA 4FMDB 2DB3A 1FP6A 4CYMA 2OO7A 4RFSB 1NY6A 5AK0A 2EFGA 3B5JA 3RRMA 1GG2A 2OE2A 721PA 3FDIA 2QMOA 1W49A 2VP5A 1W4CA 3ADKA 3QY0A 4BASA 2V1UA 1Q21A 3NHAA 1Z0DA 1KY3A 4CT4B 2O8FA 2N1BA 5JRJA 3PENA 3W90A 2V9PA 1RRGA 1ZM9A 1MR3F 4XVRA 3THYA 2N42A 2LWIA 3SC3A 2HT1A 2YHSA 4UKDA 2D2EA 1TEXA 2WAYA 4M4SA 1Z0JA 4WZ6A 1F60A 1FTSA 5GVRA 4PQYA 2CMKA 4EFNA 3R8FA 2OAP1 4UNRA 2GKSA 4NKRA 2GBLC 4TSFD 1Q3HA 5G3YA 4NBSA 4LHWA 2MSCB 1KDTA 1G5RA 2HDNB 3GJ6A 4PQRA 3KKOA 4A6PA 3THWB 1Z07A 1JJ7A 2FF7A 2CE2X 2R6FA 1AQUA 3DEFA 4NCJA 1T4GA 2C9CA 5FBQB 4JYBA 4LGMA 5BN3A 2BHRA 1ZUIA 4P33A 1I2DA 1G7CA 1XXHA 5AJYA 4O2RA 1Z47A 3CH5A 4G5QA 2XNDA 4HLQB 4NCHA 1AK2A 1SVSA 3TH5A 4OJQA 2WMOB 4JLBA 4G5GA 2NPIA 2V6IA 3WNDA 4BRUA 1MT0A 1U81A 2V1XA 3QI2A 5EP3A 2FDCA 1Z6GA 2G6BA 3PR1A 3RRNA 3EW9A 4QNRA 3KKQA 4R98A 3QEOA 1VIAA 1EFRD 2P6UA 3BH6A 1E2DA 4Z1MA 1R6BX 2RAPA 2VH5R 1JPJA 5EE0A 4EQ6B 5JS7A 5FTLA 1XD9A 5KPJA 2A78A 3IDQA 1UAAA 2ZR0A 4CZ2A 3TQFA 4JLOA 5FL7A 3SQWA 1E2IA 2AXPA 3BC1A 4DIEA 3U44A 4EFMA 2FA9A 2XOKD 4IXMA 1K5GA 3X1WA 4DT1B 4Q66C 4XSGA 4LJ4A 2J5XA 4DSNA 3GQBA 5BXQC 3K0FB 1NG1A 4IOJA 4AK9A 4OHWA 3Q5EA 1RIFA 2O8DB 4RD3A 3A36A 2GAAA 4C0LA 1G3MA 4IDNA 3P32A 3I5XA 2IUUA 2IA5A 1N5JA 2OFWA 4OI0A 1GTVA 2DPXA 4LYAA 1I2MA 1FNMA 1RJ9B 3IO5A 4TL9A 4ARZA 3K70C 4JLDA 1N6LA 2IWRA 4B3BA 3TGPA 5KSOA 4RFVA 1VDZA 2EWWA 3LW7A 3H84A 4M1MA 2CL6X 3OEEA 2ZUCA 4B6EA 1NIPA 3DZ8A 5B30A 4AKGA 4PPQA 1WDTA 4KSBA 2ORVA 1NNEA 2RMKA 4E5UA 5B64A 3KQLA 1SVLA 3GFTA 4MRNA 4Q4HB 2O0HA 5CK5A 1QF9A 4I1VA 4E03A 1M34E 1T8TA 1OJLA 2RGNA 4NL4H 2ZRDA 4C7OA 1TQ6A 4LPKA 1KSFX 3HPRA 2XXAA 1VTKA 2GRJA 2QAGC 4JJKA 3WMFA 1P75A 4TQUS 2PEYA 1ZNWA 2RGXA 4OK5A 4RKFA 2XB2A 4PC7A 2J7KA 1R4AA 4BFVA 1NMXA 2GXAA 3GEHA 3R7WB 4QG7A 2CHQA 2Q9AA 3BXZA 3ZH9B 2VIIA 3GMTA 2QP4A 4YONB 4DLYA 3PEWA 4A82A 3WP0A 3QEJA 5TXGA 3W6PA 1W4RA 3QENA 3Q5DA 3L8ZA 2OZEA 2ZE8A 4TTRA 5AWFC 3K0EA 4XOIA 4ZKEA 4DBLC 3AF4A 5B58C 1V43A 2I1QA 4QJ3A 2ASEA 4HLDA 1YZTA 2FPLA 4PHTA 4LJ7A 4M22A 2ZSEA 3DPUA 1OXUA 5CM9C 3MWLA 3NEJA 2KB0A 2WHXA 1HTWA 3CH4B 4PHGA 1E1QA 2ZJ8A 1H8HA 1Z06A 2ZRNA 1S4QA 3K0AA 1NG9A 5FH9A 1OV4A 1OXTA 1YR6A 2YC2C 1W5SA 4DDVA 4FMCB 521PA 4JLPA 5EUQB 1KO1A 3AGQA 3THXA 2VA8A 3T06B 1GUAA 1KSJA 3M6AA 1E99A 1G3IA 3HU2A 5FFMA 1E96A 3CWZA 3FB4A 4HYYA 1IXRC 3U5ZB 4KFUA 4ZPXA 3PJRA 1G8PA 1WXQA 2FPKA 1MO5A 3A1TA 5C1BA 4OYHA 1NN1A 2J0VA 4JLJA 2ZS8A 4LJ9A 3DO6A 4JVLA 4KFRA 2AK2A 3EIHA 1O3YA 4V0ME 5EQTA 2X19A 3TJZA 3TQCA 4CGZA 2D62A 4MA4A 1S9DA 1N0WA 4KVAA 5BN5A 2OLKA 2WTUA 3CNOA 3QJYA 1XD8A 2JAQA 2WWHA 1U8ZA 2C9OA 3LRPA 2ATXA 4HUTA 1VYUA 3X2SA 4GI7A 5JJKA 2REOA 3GLHE 1IY0A 3SFVA 5JJIA 4ITRC 1MRNA 1JEDA 3R9WA 3SDZA 3I8XA 3V9PA 4URXR 2CEAA 2OXCA 4HI0E 4MQBA 2ZQ5A 2O8EA 1U90A 2Z5FA 3F3YA 2D7DA 1IOZA 1G3QA 4GOXA 3U7GA 4Z1MD 4MGKR 2DY1A 2IYYA 4A0HA 4OKSA 1ZP6A 3SI7A 2QM8A 1XD2B 2XNSA 3IIJA 5J4LA 1XMSA 1N3BA 4DUGA 2O8CB 4JZKA 1G4UR 2QE7A 3A58B 2E1RA 2OBNA 4F4JA 4FIDA 4Q1FA 5FL7D 3A4NA 5H1YA 1R8QA 2JLQA 3REGA 2C99A 1KHTA 2HLDA 2VHCA 4MRSA 2FSGA 4KU4A 3B8HA 3NBYC 3O8BA 5G3ZA 3VMFA 1AQYA 5C4MA 1SXJD 1A2BA 2HF8A 5KOYA 3GLIA 4CEHA 2R6DA 2CNWD 1E6CA 1NLZA 3MSXA 2QPTA 3K9GA 1NBMA 3QXJA 2JIZA 4P31A 5SZKB 1JR6A 3UXMA 2P65A 4AIIA 2KBEA 2HCBA 2Z43A 3TSOA 3MWKA 4DKXA 3OEED 1CIPA 3IHLA 1NN3A 1FQKA 4IEEA 4DXAA 4MKIA 5BW8A 1N5IA 1Q1QA 2QQEA 3K53A 2W6IA 3Q72A 5B2ZA 3RNLA 3SEAA 3BORA 3AVQA 1GM5A 2J87A 1YR9A 4MKFA 1VECA 3BS4A 4JLMA 1LV7A 2VSFA 2LKDA 4URUR 1RC8A 3AV0B 2WIBA 2A2ZA 4ZIRA 1FQJA 1N0UA 2BM1A 1VKJA 3EIQA 5KSPA 2ZRLA 2JLRA 4TQ9A 2WWGA 2RGEA 1N5KA 3HWSA 2JLWA 1YRBA 1N6IA 2IXGA 2RH5A 2J59A 4OI4A 2ODWA 1UF9A 2JJ8A 3EPKA 3HR7A 4AYTA 5CDFE 1JR3A 2OAQ1 3KUDA 4BFXA 1IXZA 1TTTA 1FNNA 4ESVA 1OXVA 5IDVA 5HZKA 2OFOA 2IL1A 5H68A 4Q9KA 4B33A 3RHFA 1Z6TA 5CIWA 3EZ7A 3BERA 1IN6A 4PFSA 2GZAA 3VNVA 1G8GA 1HA3A 3WYFA 4F7WA 1L4UA 3I92A 2F7SA 2XX3A 4OQMA 2O8BB 1KK2A 3BB1A 1G4AE 1K5DA 1KI9A 4L9SA 1NJGA 5DN6D 2RB4A 3CPJB 3RRYA 1UKYA 1E1QD 1Q44A 2VSXA 2ZJAA 2WMNB 3GEIA 4H1VA 1H8HD 1KSHA 2NPFA 5JSZB 1SKYB 1QHNA 5KPDA 2BMJA 2J0SA 4PPNA 1FTNA 4LSGA 3SS8A 1D2NA 5J4YA 3UMRA 4L4UA 1UEJA 1AGRA 3GLHB 1OH5A 2GA8A 2EVWX 2YWEA 2Q3MA 3M0EA 4Q9LA 2ZIAA 1A7JA 2G0TA 3EZ6A 4JVMA 3BH7A 4TLAA 3ONWA 3DM5A 4Q1BA 3D8BA 1F2TA 2W2TA 1H65A 1MO4A 1CF4A 4PC2A 2G83A 1KJZA 5FUYA 1B23P 1AKEA 5JFGA 1HE1C 1YR7A 2VHJA 3FTQA 4KBFA 4NZYA 1ZJ6A 1GNQA 1CU1A 2YKGA 3CF0A 1D9XA 1KAOA 1MO6A 1YZKA 3PEUA 4LJ8A 4QJ4A 3DMDA 4M8NE 3FOZA 3SOPA 4HUQB 4RZ2A 1OT3A 3KXLA 2H17A 4KFSA 1JAIA 3L0IB 1E0JA 4Q48A 1JQJC 1XEWY 3NHBA 3GEEA 1UKZA 5J4KA 3RANA 2C96A 4W7SA 1Z0KA 4JKYA 2ZI7A 1IN4A 1ZAKA 1T5LA 2XZLA 2QMEA 1Z83A 2LCFA 2H7VA 3MJHA 4AD8A 2FH5B 3CRMA 4HDQB 4URWR 5H70A 3LX8A 1M7HA 3C15C 1LB1B 4QHYA 3SBEA 2JLSA 4A0RA 4DEYA 3K9HA 3L43A 2J1LA 1ZNXA 1RW4A 3BFKA 1CTQA 3MAAC 1E2KA 2ZI5A 3OIYA 3MWYW 2F1RA 2GETA 3HYRA 4D2IA 5JHHB 2YVUA 2ZJBA 3DDCA 2ZETA 4D4KA 5EE5B 5GJWC 4LDJA 4BLQA 1UJ2A 2P6RA 1VHTA 4BFTA 1DAKA 4IFEA 1WRBA 5SZJA 5ELXA 2X2FA 5JS8A 3KJGA 2A9KA 1S0UA 3AVYA 1GKIA 1CJTC 3PG5A 2ZU6A 3PUWA 5E7MA 4UJ3A 4MITA 3B1VA 3NTUA 3SN6A 4DCNA 3VQTA 1BH2A 1NBMD 1T3HA 3ZVRA 2JIZD 3BAFA 1Y63A 1TL7C 4DLWA 3QKRB 2V4ZA 3FYHA 1E4YA 4TLCA 4TL7A 2QG6A 4TTPA 2NMVA 1T5IA 1W2HA 2V7QA 1E3MA 4CRWB 5F3WB 3IUYA 3EPLA 2CE7A 1GNPA 1M7GA 1EFUA 4MKGA 3DKPA 1XF9A 4EPTA 1RPZA 4IVRA 4BLRA 3DM9B 2QSYA 4LUCA 2GZHA 3NIBA 4Q02A 1NF3A 4NYJR 5BQ5A 1DAIA 3LY5A 2F9LA 2W6ID 5AJVB 1KKMA 5FI0B 4A8JA 4C2TA 1XEFA 5FUWA 4YXWA 4DB2A 3Q9LA 1CR1A 4CEIB 3T5DA 2IS1A 3IPXA 1Q3TA 3LV8A 3CPHA 2OILA 5HTKA 5TARA 1W36C 4ZCLA 2QT0A 1ZVQA 3U7EB 1HYQA 2W0MA 4NHOA 5DI3B 1XCGB 4PANA 1ESNA 1X8LA 3EASA 2EU8A 1X3SA 3IQWA 3AM1A 4ZCMA 2P5TB 4NYIQ 2YOHA 5TB5A 3W8RA 1R7RA 1SVWA 4HZUA 1HT2E 2XTMA 2O8FB 2FSIA 2B8TA 3GFPA 1K8RA 1WA5A 3SZRA 1F2UA 2CL0X 4NYMQ 2QSZA 4RD2A 1EFTA 1JR3D 2GJSA 4F92B 1G19A 1QG4A 1S2MA 2IXEA 4TMZA 1SVOA 2WOOA 4Y0AA 3THYB 2AWOA 1XP8A 3PIRA 4L9WA 1QHXA 3TSZA 1NLFA 4XVQA 4MYTA 4ZDIA 2Q3HA 3FKQA 1TU3A 4TL6A 4Q1EA 2AD5A 3GFOA 3CPEA 3AF3A 1XEXB 2VQSA 2W0SA 2GEDA 3ND9A 2FSFA 3AEZA 1GILA 3B60A 3IBGA 1YHNA 3RDPA 1WCV1 2QMUA 1DS6A 4B48A 2EW1A 1XMVA 1U0JA 3Q3JB 3NDBB 3QXXA 4RSGA 4NU0A 1BYUA 2FGKA 2PH1A 4WAUA 3U3KA 2XZOA 4OHVA 4YMSA 5P21A 1XXHB 1AM4D 4JVSB 2QPOA 1GWNA 4A9AA 3IILA 2GVZC 1IM2A 1FOEB 1NY5A 3SFZA 2PCLA 2WWXA 2HJGA 5K8UA 2WKRA 1ZMXA 2Q21A 3BFVA 2QEQA 4TT3A 3V00A 1NJFA 5EUMA 1CEEA 4K46A 1E2MA 2W58A 1LNZA 1RKBA 1OB2A 2MMCA 1NN0A 2GEVA 2BCJQ 2I3BA 5KU1A 1YRAA 1YZNA 5GJBA 2R44A 3AVUA 2BM0A 4TLDA 4ZKDA 4DLSA 1U9IA 3OIWA 1P2UA 3UK6A 2B8WA 2IYLD 3WHKA 2XJ4A 1KZGB 4PO1A 2EFEB 3CRQA 4BFWA 4QOSA 1OIVA 1HH4A 1UBEA 221PA 2OBMA 3T1TA 4YDHB 2IC5A 4Z51A 1HY3A 2RGAA 2ZJYA 1S1MA 2CLSA 1FL9A 2P67A 1G7SA 3FFAA 3QKTA 1E0KA 1JJVA 1E98A 3LLMA 3K1JA 3SYNA 4I4LA 4RD0A 3QUSA 1KI3A 3C16C 2JDIA 3G0HA 1PLLA 1ZIOA 4U7DA 2Y8EA 3BOSA 3NXSA 2H8KA 2R6GA 1EX6A 2D2FA 3AF1A 4UNQA 4ASUA 4MUAA 1QHSA 2DCUA 1E69A 3WMGA 2IBMA 1CJVC 2IHYA 3AUYA 4P4TA 4C7OB 4LX0A 2XXAB 2VPPA 4P4SA 2FZLA 2H92A 5TV2A 3FMFA 4KBGA 4L5BA 3CLVA 1TUEA 4FN5A 2JJ2A 1A2KC 2BBSA 4L8GA 1Q1EA 3B1WA 4ESHA 2ONJA 4LI0A 4RCZA 4X8MA 4PPGA 1KZ7B 3KKMA 4CVNA 4QM7A 1X8JA 2VSOA 2V7QD 4M1KA 3ECCA 2W2XA 5SZHB 4UJ5A 1W0JA 2IYSA 3ZQ6A 1XMIA 5C4GB 1RZ3A 1US8A 1EX7A 5EZ6B 1T91A 3IO3A 4YXWD 1HEIA 4A2QA 2ZS7A 3D31A 2YWGA 1Z08A 6Q21A 2O5VA 4RJLA 1NSTA 5GJCA 4B2IA 3J81k 4QM6A 4OQFA 1OE0A 3HR8A 3W3AA 3UATA 1MABA 4EJSB 1OF1A 3FWYA 3D3QA 2ZAOA 2AFHE 3DMNA 2ZEJA 2FFHA 2FGJA 2ZROA 3GLGE 2HF9A 3K0AB 2OHFA 3CRW1 1G18A 3PEYA 1O87A 1QHGA 2DBYA 3QPUA 2ZAMA 4TZ6A 1SGWA 1DARA 4TYYA 3TBKA 4Q4AA 5DO9A 4KLZA 3THXB 2FEOA 3NWJA 2EFDB 4NCIA 1EESA 3S1AB 3O8RA 2GESA 4C3ZA 5FL3A 2QGNA 2R2AA 5LPNA 5IF9A 2G1JA 3QXCA 2WJGA 4QBIA 5CYPA 4C9BA 1GL9B 2R65A 5DHFA 4KAXA 5FUXA 2C98A 1KK3A 2IYWA 1GRNA 3ASYA 5JMTA 1SKQA 3LVQE 1TF2A 2OXRA 4O25A 3TE6A 5EP4A 4A2PA 1XPUA 1Z28A 2KI5A 5L3QA 1DG3A 2I4IA 3U4QB 3KJEA 4IDHA 5FI1B 4Z54A 3BBPA 2QP9X 1CJUC 1CS4C 1P4SA 3DOEA 3CNNA 2ATVA 5L3SA 3I61A 2BEJA 3A1WA 3TW4A 4Z8XA 3AVPA 4WW0A 1Z2CA 3KKPA 1YZGA 2HYDA 2PCJA 2JEOA 1DO0A 2Z4SA 1KY2A 1OKKD 1VIYA 3C5HA 4EDHA 5F98A 2WOJA 4FCVA 4TT3D 3EWAA 1DE0A 3FMIA 3O8DA 3TK1A 5HR5A 5FTKA 1YZLA 4Q7JB 2CDNA 4NTZA 4ZI2A 3P27A 3VTKA 4QKQA 2NTYC 1JQLB 2WICA 2O8EB 4LOAA 1GSIA 1VYVA 4DSTA 3QKSA 1T3SA 2FMXA 2QAJA 1IY1A 2C5LA 2JCSA 2ZUDA 1G8YA 2EQBA 4PHHA 1E2EA 1E2LA 3VR2A 2GJ9A 2OCAA 2GVDC 2Q6TA 2ZJ5A 1SXJA 5IHPA 1WB9A 1A1VA 2ZI4A 1KI1A 1XCMA 3TUJC 4F38A 2CK3A 1QZXA 2CNWA 2ORIA 2Z0MA 5FR1A 2FN4A 1XZPA 2ODNA 2DFLA 4U02A 3U7HB 1IHUA 3GLIB 4WA7A 1M1YE 3QPVA 4POAA 4ZDKA 4CEHB 1OH6A 2P3SA 3B6EA 1YR8A 1P9RA 3I8SA 3K8YA 2IEYA 4CF7A 2G88A 4OL0A 1QHHA 1RRPA 4AY2A 1R2QA 4OQXA 2NQ2C 3VR1A 2OV2A 5JWOA 4LYHA 4Q01A 4DB4A 2PEZA 2FEMA 4DLUA 2JDID 3QE0A 2RGGA 1P61B 2F3RA 4Q1AA 4RVCA 2CCGA 5G53C 4O3MA 4M9XA 1XRJA 3KJIA 3RABA 4P4UA 2CLCX 4UXHA 4Q9HA 3TLXA 5CLQA 4A2WA 4ASUD 4D0GA 2FFAA 3FHOA 4V0NA 4TMWA 2PJZA 1XJCA 2IF2A 4JYCA 2O0JA 3VR4A 1T0JB 1SHZA 1F48A 2D3WA 2V6JA 3IEVA 3O47A 1II8A 4QL3A 1AN0A 1F3OA 1NMZA 1JPNA 2XSZA 4JLVA 3ZGXA 4TYWA 4S35A 1TF5A 3UKDA 1GOTA 4ZIRB 3BH0A 4Q1DA 4US2R 3GLGB 2XTNA 1TUIA 3RRZA 2ANBA 2JJ2D 2KWIA 1T9HA 3GD7A 4MRPA 1E0SA 1NL3A 3K0CC 4ACBA 3QNUA 2BKEA 1UM8A 1YZQA 2RGDA 3ZDQA 1VPLA 2AL7A 1OPXA 3K9LA 5A5GA 1U2RA 4LYJA 3B13B 1R0ZA 3SR0A 1KI2A 3SJAA 4M53A 3ADBA 3X1XA 5KDLA 1W0JD 4G01B 3HYTA 4JT2A 4S2EA 4TMXA 4WXRA 4GNKA 4Z8YA 2D06A 2A3RA 4QBFA 5JLJA 2BEKA 3TR0A 1PV4A 2GWHA 2HT6A 5DN6A 4XWAA 1NRJB 2YZ2A 1J70A 3SBDA 3OFND 3TVTA 4PO9A 2R6CA 3NC0C 1G21E 1NMYA 3RYTC 2IYVA 4RFSA 3UMSA 1KJWA 4P32A 4RD4A 4EPVA 1KI7A 3W5IA 2F55A 2D7CA 4LJYA 5HE9A 2GCNA 2OM2A 3FPAA 4LHYA 4GZLA 3PUXA 4DCTA 1RFLA 3RWOA 1J7KA 1Q0UA 5FUVA 3VFDA 2OFXA 3AB3A 4YMUA 4MGIR 5J40A 5DH9A 2ZRJA 1RVDA 3EG5A 4Q4LA 3ZS8A 2O0KA 2BBWA 1F2TB 1LTQA 2A5YB 1ETUA 1OIWA 2BJWA 2FWRA 1J8YF 2NO7A 3NKVA 4AKIA 4YC7A 2JJ1D 4QRHA 3WHLA 4LV5B 1KNXA 2FFQA 4B3CA 4RZ3A 3T61A 4M1OA 2ZPTX 1J99A 1XZQA 4R2IA 1SKYE 2VP9A 4DHEA 3KQHA 3EAQA 2GCPA 3C8UA 4HATA 3THWA 2OUKA 2DHRA 1X6VA 1XFAA 1N5LA 3QG1A 3VR5A 3KQKA 1KOFA 4R2HA 5JI3E 3EARA 3B82A 2EWVA 1DVRA 1RE0A 3LQRA 5CB8A 1T0HB 2GJ8A 4PSKA 4TL8A 4LBYA 1AZTA 4BWYA 4YMWA 2PZEA 3CRVA 3N2EA 4QGFA 2RCNA 1NSFA 3AUXA 3HJNA 1G17A 3AKDA 3K09A 1OB5A 1P60A 2ZRGA 5IK2A 4AKHA 4LHZA 4W9MC 3LNCA 5KO2A 2Q0HA 3UMFA 4MRRA 5SZIA 3H1TA 1R8SA 2C8VA 3NG1A 4B35A 2ZM5A 2AN9A 2HJVA 3DVLA 3AKEA 1TQ2A 3UG6A 2JATA 3JZMA 2NG1A 1P2VA 5UKDA 4HAVA 2WPDD 4O2LA 2CK3D 4RZUA 4KCGA 4PQFA 1GFIA 1OFHA 1Z6YA 3WRYC 1CRQA 1UDXA 4EAQA 4F4IA 621PA 1E2NA 2W83A 4M0LA 2A5FA 3U3OA 1EFCA 3CZQA 5KTYA 3K0FA 2VRWA 5CK4A 4BZPA 3LQQA 1JALA 3PUZA 2O8DA 1G3UA 5AUNB 3U7FB 2XITA 4G3XA 3KQUA 3G82C 2UZIR 3ZS9A 3THOA 2PZFA 1VCOA 3X1YA 3TMKA 1CR2A 4HB3A 4URYR 1W36D 3PITA 3QF4A 5JEDA 2KBFA 4NDZA 1E4VA 1S8FA 2XEXA 3SJCA 1W1WA 4A8JB 4PR0A 2AXNA 3W5JA 4C0KA 4CT5A 3KZ1E 4M2LA 3VX3A 2WJYA 2FJUA 2NO1A 3OEHA 2NIPA 5FPYA 2XSZD 1KK1A 2ZYVX 2OBLA 4NMMA 3VHLB 1OYWA 1F5NA 4BLPA 3ICQB 2J41A 5EXXA 2P5SA 2VHQA 1L7VC 1OHHA 2GXSA 3B1XA 3L2OB 1KNQA 4M9ZA 4MYUA 2WKQA 4PAQA 1VCIA 4Q1CA 1QRAA 1NVVQ 5AUOB 1W44A 1Z0IA 4JMPA 2J3EA 2ORWA 4UNPA 4JBYA 2GBLA 4H9GA 3WBJA 4HZUB 1NN5A 4IDPA 2Z83A 1PJRA 1LVGA 2CLDX 4U5XA 1X86B 5TDHA 1IQPA 1XTSA 5J5CA 2IHBA 2IYZA 4JSYA 1F2UB 2BIFA 3TKLA 1N6KA 1OSNA 2J9RA 1HQCA 3W3ZB 4UXJA 5CM8B 1SVMA 4HAZA 4OHXA 4Q18A 4XTRA 2SHKA 4PHFA 1R5OA 3N2IA 1AZSC 4NPHA 4LHXA 4ACAA 1FP7A 2F1HA 1YU9A 4RD1A 4KLNA 5JCPA 1IONA 1UADA 3ZZUA 1Z22A 1KMHA 1C9KA 2AHOA 4PZYA 4C0SA 4FW9A 2F9MA 3QVVA 5FBLB 1SVIA 1DEKA 4AYWA 2FG5A 3RS4A 4YQFA 3GPLA 5TMPA 2ZITA 3E5HA 5G40A 3UWKA 2QTFA 2KSQA 1GVNB 3BK7A 3DHWC 3IIKA 4GOKA 4N0DA 4DEXA 1KDPA 3VR6A 1MOZA 4LY6A 2OEPA 4OHZA 4AC9A 1JEEA 4KFTA 5GVSA 2PLFA 1KI6A 1YE8A 2P0EA 3IKJA 1PLJA 2OLJA 3D6TB 3VHXA 2H57A 1T3LA 4UQOA 2BMEA 3ZVNA 1Z0FA 1GRQA 3VX4A 3AVWA 1ZUHA 1DAEA 2ZJOA 1W47A 3L8YA 3B85A 2IWHA 3U61B 2ZRFA 4U00A 4XVUA 4URZR 4HAXA 3ZQJA 1OH7A 2RKOA 3EZ9A 1G5TA 4H1UA 3LFUA 2ODBA 1FFHA 1ZW6A 1GAJA 1A4RA 2HXYA 1EK0A 2ZSFA 4GMDA 4B47A 4FI3C 2WWYA 2PZGA 3CF2A 5LBIA 3W8NA 3B7GA 2BJVA 2DFTA 4WBSA 1ODFA 4DVGA 1GZSA 5DIFA 5FOUA 3WP1B 4FWTA 1G8HA 1KI4A 4ABYA 1E9CA 4GOJA 4PPFA 2E9SA 3NDPA 2P2LA 4BFSA 2H5EA 3GJ3A 2WJIA 4TMTA 4BZXA 1XXHE 1FX0A 3PCRB 2F6RA 3WYAA 4YMVA 2C95A 4OK6A 5C46F 4PC1A 1E2QA 4UXIA 1E9EA 2YWFA 4TQAA 3QPWA 4Q03A 2E87A 3QXSA 3T1QA 5JCZA 3ADCA 4X8LA 2QAGA 3W34A 2CCKA 4MGYR 2FFBA 5DNYB 3QVUA 3RAPR 4G1UC 4XWOA 5IK2D 3IGFA 4HAWA 2HXSA 2VTKA 2XJ9A 5DYGA 4B3DA 3H2YA 4HLCA 4Q9JA 4B3FX 3AVXA 1AKYA 2GXQA 1JB1A 1P6XA 2C9YA 5DI9A 4NP6A 4M9SA 1XD2A 4KYUA 3B2EA 3M1IA 1U98A 4Q4JA 1TU4A 4US0R 1XDBA 1S3GA 3A8TA 3UWOA 3K0SA 4A15A 5AUQA 1KMQA 1TEVA 3DZDA 4LC0A 1M6NA 3LDAA 2IYQA 1YJ5A 3A1UA 4P4SB 5FPTA 4DWJA 1SXJE 3I5YA 1BS1A 2NGRA 4C0BA 1UDWA 2QBYA 2GCOA 1RYHA 3TR5A 2GXUA 2ERXA 2ZXUA 3TIFA 5JI2E 4R9UC 2QUZA 1DO2A 2HUPA 5FR2A 1FW6A 4CEJA 1GL6A 5HZHA 2HCJB 2JLYA 3RC3A 3MMPA 4FD2A 1KSGA 4GL2A 2ZR9A 4IOLA 4PSAA 1JBKA 4JLNA 4RD6A 1E94E 3DOFA 3LX5A 3KKNA 3SHWA 3OEHD 2CJWA 1AGPA 4JLAA 2ZU0C 4WZBE 2TMKA 2WV9A 4PAMA 4QFMA 2VHUA 3QOFA 4YDSA 3TNFA 3PQCA 3LA6A 4MH0R 3GP8A 1OHHD 3EA5A 1MABB 3H4MA 1X1RA 4G5SA 1G9XA 2GZDA 3EC1A 5CJ2A 3GCGA 1P9NA 2IUTA 3AQ4A 2FX3A 1ZC3A 1WQ1R 2RGNC 4ZDJA 1S96A 3B9PA 4Q4AB 5FBVB 5DE3A 1W7AA 1ZM2A 3OAAA 4C0JA 1WE2A 4I1OA 1Z5ZA 1J90A 4OHYA 2PX3A 3B1ZA 4LHVA 1ZNZA 4KJZA 4AWXA 5J4VA 1XBTA 5DSZA 2QGZA 3WNCA 1W0KA 2GNOA 4D0NA 4E22A 2ZUBA 3R20A 5EZ5A 3MG9A 4BGDA 5KNCA 1XJ0A 3OE7A 1JNYA 1N6OA 4PZZA 4JSTA 5D3MA 3T1VA 2CVHA 2O8BA 2VF8A 1Z29A 4QGAA 5L3QB 4NE2A 1P5ZB 4A92A 4V0MA 2YYZA 1VG1A 2ZVQX 4ZCIA 5BYJA 5JSZA 4WOPA 3I73A 5CLLA 1OKKA 5L3SB 3AGPA 5DYIA 3LAWA 3P1JA 3QSYA 4IRUB 2VYFA 1HV8A 4HAYA 2KJQA 2ZTSA 3VKGA 5FBWB 5A0FA 1NKTA 4BLOA 4OJKA 4GDFA 2QRZA 2ZYUX 4EJSC 4BEBA 4WIAA 3P26A 5KYKA 1EWRA 1Q57A 2IXFA 2VP6A 2BBOA 3WXMA 2FZ4A 2J7PA 5E95A 3IIMA 4EPWA 1WP9A 3AH8A 2QTHA 4Q47A 2AD1A 2MSDB 2N46A 5D3QA 1II0A 2WVJA 2P6NA 4LBWA 1MRSA 3E2IA 2DWOA 2YJTD 1DAFA 1VG9B 3A4LA 3U44B 1LS6A 3K70D 2WBLC 3RC8A 1BIFA 4DRZA 3JZAA 4W5JA 4V0LA 5FPKA 4BFZA 1NI3A 1SXJB 3AP1A 4HUQA 4DCSA 2C2HA 1Q1BA 2IF0A 4B76A 1IBRA 2BDTA 4IJMA 1U99A 2B21A 1VCMA 2AKYA 1LS1A 4D0LB 1G20E 2JLZA 3ZD6A 3HU1A 1PVOA 3OF5A 1XMJA 3NBZC 1R5NA 4ARZB 1W4BA 1U8YA 1AS0A 4DDTA 1UPTA 4IEIA 1E32A 3WYGA 5KDDA 5KNBA 2YC4C 1J2JA 4QGGA 4ERNA 4F91B 2CL7X 4EFLA 3SJBA 1W2GA 5H8WA 3W6NA 1QHHB 1BO6A 3MJRA 4KSCA 1NP6A 1D9ZA 1HE8B 1TAGA 1G7TA 4B71A 4OQNA 2JLVA 3NH9A 3FVQA 5BWMA 1P2TA 2VP0A 3A1SA 3RVBA 4RZXA 2AR7A 2OG2A 4B2PA 4D25A 4LPSA 1VG8A 4HLUC 4MGZR 2J0UA 2GF0A 1II8B 4TTQA 3AVVA 4QBGB 3P20A 3N70A 4M21A 5L3RA 1KDRA 5EXTA 1D2MA 3GLIE 2BMFA 2IS2A 2QRNA 3PUYA 4Q7LA 3WNBA 1KYIA 1KAGA 1P72A 2IYRA 3BB3A 1NBME 3PXGA 3TVDA 1YQTA 5KHOC 3MLEA 4FMDF 2J46A 4B34A 4DC9A 4BPBA 4LV8B 4GRAA 4JBWA 5CIQA 1TPZA 1DAMA 1E2GA 5FTJA 2ZVPX 1UBGA 3CO5A 3KQNA 1P9WA 2H16A 4M1WA 4E09A 2NO0A 5G41A 2CBZA 4F4CA 1JAHA 4P0TA 2PMKA 5F9HA 4X8OA 4NYIR 5FOXA 3OFNA 3U6KA 2ZI9A 4NH0A 2MSEB 5EP1A 4NYMR 4B75A 1DAHA 5FTMA 1RYFA 3GJ7A 3ZIAA 1T8UA 1FUUA 2AFIE 4WXPA 4R7ZA 3U60B 1QHYA 1GDDA 2B7BA 3UG7A 1R0XA 1R0WA 1HT1E 2A5DA 5DI3A 4LZZA 1ZCAA 8OHMA 3EIEA 3RLFA 1P3JA 2A7QA 1ZU5A 2VLIA 4BRWA 1YKSA 1JR3E 1OYYA 2NOAA 2YOFA 5KDOA 1M8PA 2BCGY 2PX0A 4AKEA 4EKDA 4HAUA 3OAAD 5K8LA 2VL7A 4X8HA 4IDOA 3CX7A 2PJRA 4FXPA 5GJVC 3RS0A 1Y3AA 2JJ1A 3D7MA 1SQ5A 5J4HA 2V55B 4B43A 1W0KD 1XEWX 3LBHA 3FGNA 3ETLA 4M1YA 4US1R 1OIXA 2JASA 3OHMA 3OE7D 3QBVA 1DADA 3FFBA 1LY1A 4HZIA 2OCPA 1XEXA 3LBNA 3QKUA 821PA 2QM7A 3AVTA 5JECA 1UBFA 4AURA 1VMAA 2AK3A 5J47A 1G7RA 1HURA 5B57C 3ZYCA 2QQ0A 3NVAA 2B92A 1XTRA 3N5CA 1Z8FA 5LD2B 4HB4A 5LDDC 2B7CA 1SULA 3GJ8A 3RSOA 3JVVA 1UKEA 3AF0A 2W6JA 4B74A 4ZI3A 3EX7C 3L0PA 3L82B 1SZPA 1TF7A 3U2QA 4V0KA 2V54A 2QPAA 2BKUA 1UBCA 2FV8A 3KTAA 5FOVA 2OESA 4XTCS 2DFKB 1AJEA 1E9BA 1GKUB 3GJ0A 3LW8A 4B2LA 2CXXA 2J7PD 2NO9A 3C5CA 3EA0A 3NC1C 1NVWQ 4TWZA 2LKCA 3SE0A 4W5HA 2VEDA 3AVOA 121PA 1CP2A 1ZU4A 1I4LD 1ZD8A 2EFCB 5FOSA 3CX6A 3LXRA 5HKKD 1DAGA 4AI6A 1LFDB 2ZYTX 2F43A 3GJ5A 4D26A 4GSYA 1BYIA 1AS3A 2DWPA 4EPRA 2V3CC 2F3TA 1ZD9A 2WPDA 3ZLJA 1EGAA 4IW3B 4IOMA 3SJZA 4B3GA 3U3RA 1VCNA 3GJ4A 2IEZA 3KDSE 3I62A 3RS2A 4JKIA 4EPYA 3KXKA 2ZREA 3I4LA 5ANRB 1ZM3A 1KO8A 1X8KA 2HEIA 1E2JA 1E2HA 3ZZTA 4DLXA 3BWDD 3CB4A 3PUVA 4D4LA 4D82A 3X1ZA 4GPTA 1SHKA 4A6XA 1IXSB 1XPOA 5LB4A 3EPJA 3I72A 1W5TA 4TMVA 3FHTA 4JL6A 3RS5A 1N0VC 4LC1A 3TUIC 3QF4B 4EPXA 1LF0A 2ZJ2A 3OZXA 1COWA 3ICEA 3KFVA 3VNUA 3C4JA 5K8TA 2ECKA 2FNAA 2R8RA 3CR7A 2ANCA 3A4MA 4HDCA 4CIDA 4LBZA 2ZRMA 3T1OA 3GLFA 1LW7A 3ADDA 5K8IA 1QVAA 3BFXA 4JL8A 3V4FA 4A0GA 1P73A 1P7CA 1PLKA 2BOVA 5JWHA 3V4RA 1Q20A 1ONBA 2W2VA 1F6BA 3CZPA 3L0SA 2J45A 1HQYE 5KUTA 1W4AA 1KO7A 2YNMA 2Q3FA 1CJKC 4FINA 1KJYA 5F2EA 5IT5A 2J0QA 1QG2A 1G1MA 1PUIA 4KHZA 1EFHA 3LXXA 4M1TA 2ZR7A 4LK2A 3VR3A 1ELOA 5TY0A 1DG1G 3CIOA 1S1CA 2OCYC 2XB4A 4I1SA 3AF2A 4FMCF 1ZM7A 3I32A 1D6JA 3VU9A 5C18A 5KSYA 3EXAA 2V8OA 4PAOA 5AJZA 1DBSA 3CRRA 3I3SR 1KMHB 3MFYA 2ZE5A 4QJ5A 3W9YA 1VHLA 2WJHA 3PV0A 2K5UA 4DDUA 3WBKA 4OQLA 4TN1A 3ZJYA 3W6OA 3ZIAD 4TLBA 1RRFA 1Z2AA 1G5PA 4JL5A 5JZVA 4JLKA 2ZRPA 5FPSA 3UIEA 1KDOA 1XX6A 2VO1A 3ND8A 3U6BA 3MWJA 2GAOA 4EJSA 3A6PC 4A8JC 1ZD1A 1FPMA 1KI6B 2RHMA 3F0TA 3SNHA 4RY2A 5BYKA 2GDJA 1IY2A 1GRRA 3FKSA 1NIJA 1T6NA 5L8VA 3EC2A 4XWKA 2X77A 3F5FA 1MH1A 2G1KA 3LO5A 1ZM4A 1I4DD 3CKLA 3B9QA 4PC3A 2G0NA 2ZRBA 4XD7A 1DPFA 1KO4A 1B0UA 4QNMA 4XH9B 3T15A 4B44A 2REBA 3S1AA 1WBDA 4HEJA 3SU8A 4RKEA 4QHTA 1E9AA 2R9VA 3JVUA 4I1UA 5EXPA 4ZO4A 3EPHA 1ZRHA 4UNSA 1D5CA 2VP2A 4LYFA 2ZS9A 2IW3A 5DLQC 3IHWA 3K70B 3U4QA 1E9SA 2A30A 3BD9A 2QNRA 3SYKA 2W6JD 4QXAA 1FX0B 1TMKA 1CULC 4XJXA 2Q9BA 4ZV4A 5FBRB 1KKLA 1YVDA
chains in the Genus database with same CATH superfamily
1UBHS 1IPFA 4XPIA 2XNDD 1XVLA 3V1LA 3C5VA 1EWQA 4ZEXA 2C9DA 3L8FA 5A7HA 4B8WA 2WSMA 5CXSA 3V5NA 4BLSA 2QAGB 2PRIA 2GRAA 1GIAA 3ZE6A 3OFJA 1U3VA 4CDGA 4EQ6A 4GQIA 2ZRHA 3EZFA 4QC2A 4W7IA 3A14A 2DJ5A 1CZOA 5DTEA 4GBMA 1L5VA 5HRUA 1SNYA 1GPKA 1UFQA 3QIAA 1G6OA 2XWJI 3QMPA 2OR3A 3R4CA 1D2EA 1X42A 3UH0A 2ZSBA 1X80B 4DLTA 1RADA 2FFJA 2WAXA 2ST1A 3NEAA 2D0DA 3GUVA 4I0WB 2WE8A 5HCNA 5IYZB 1B2LA 3ZX4A 3C1AA 2AMLA 3KB2A 5AKXA 3TW8B 3N6VA 1GGEA 2MSWA 2WWIA 4M98A 4R3WA 3DKVA 1Z12A 2XKBA 3DCYA 5DGTA 1A82A 5IW8A 4BVBA 1YRLA 4V0QA 3RS7A 4BNFA 4X71A 1NVTA 1VYTA 1H8EA 2XOEA 2ACWA 3K1TA 4AYXA 2BV3A 4FYXA 3H1AA 4R1LA 4X97A 4Z2YA 1N5DA 2IUSA 4B6PA 3DOOA 4ZHQB 2YWHA 3WZMA 5FAKA 3TRIA 4IZHA 1UJMA 3SS7X 1RXIA 2EEPA 2P2DA 2QROA 2WG2A 3OT1B 3SXPA 4EBBA 1SBNE 4ZAWA 2PAAA 4C2UA 1YIOA 2XY4A 5CYGA 2CY0A 1PG5A 1T5TA 2H51A 5M04A 2VT6A 5CYOA 4FGLA 4PZLA 3WGQA 2BFDA 1UFVA 4QWMA 4I99A 4ZOLB 5HPYB 1Q1ZA 3G8DA 2IS6A 3VUEA 4WERA 2QL5A 5ALYA 1G38A 1B8NA 5DX1A 4M0UA 4ID3A 2DFNA 2IX3A 1I5EA 1NE7A 3DZCA 4YRRA 1X3LA 3RHZA 1VM6A 2FKAA 1QV9A 4ND4A 1QGAA 3QPCA 3WNZA 1E9DA 4JT4A 4XVCA 2O1SA 4K1XA 3KLOA 5F4ZA 5LQAA 3F8TA 1UQUA 4E2XA 2JLXA 5DCUA 1EM6A 1L4LA 3V4LA 5B3LA 5FEUA 2I29A 2ZCVA 5HCIA 1SB9A 1EB9A 1E3EA 3B48A 2GJAA 4DZZA 1JPVA 5JNRA 2VPXA 1GITA 1NVXQ 4X1OA 3IULA 2CJPA 3ANTA 1QBKC 1ONNA 2XTZA 3NBUA 1RBQA 1WLYA 2FX2A 4C1NA 1TA4A 1OZ0A 2P4QA 2CUZA 2PD3A 2ZBPA 1D8TA 4RENA 4QOIA 2YMQA 4ND7A 5DBGA 3AUFA 1NQOA 1MDBA 1XTIA 2BMVA 2ZCUA 3E84A 5DHAA 1VPTA 1OXSC 2Z6VA 4BWVA 1BOFA 1QOZA 2YXDA 1UBJS 2QZZA 3VYRB 2H1RA 4QDOA 1SWVA 4RM3A 2HNAA 2I9PA 4DSUA 1G291 1VI6A 3LVRE 2G5CA 4BGIA 3G5UA 1FPQA 2WHPA 3WIUA 1SCUB 4KX3A 5HKOA 3SQMA 4AMZA 4F96A 1XTKA 2FJ0A 2I7DA 3FWHA 2ISSD 1VZ3A 4BJHB 1CLUA 2XODA 4RVGA 1JAYA 1MVNA 3EEIA 2GI4A 1N9KA 2C0QA 2M1XA 1PFGA 4I3GA 5AVVA 4CQLA 4IDDA 2ZYWX 4D3YA 3N0VA 2DX7A 5LA6A 5DISB 3O8CA 2RGCA 3ZG6A 3DD5A 4YXFA 1K7YA 3EY9A 4FD3A 5A5EA 3VPHA 3UKJA 4QUEA 2Q8NA 4QJIA 3U3MA 1HC7A 1N4DA 1X1QA 4X7PA 2PRYA 1U7PA 2HTFA 3MPUA 4L4SA 4RBNA 1KEPA 2EYQA 2QP3A 2WZQA 3HCBA 4N4AA 1N7IA 2V9CA 1EHCA 3WIVA 1U28C 1JWAB 2HJ9A 3C3WA 4Y6PA 2HU8A 3GMSA 4C7JA 1DFIA 1FJGB 4EYOA 4EIWA 1AA9A 5HKLA 2NVOA 4NZZA 1TM5E 5L3VA 4B32A 4BQFA 1GGNA 2WP8J 1QXSA 2OQ2A 1HUQA 2FPMA 3VNQA 2GZSA 4J03A 4FZJA 1P62B 1R50A 3R7AA 4RQUA 3IUQA 4UVEA 1WB5A 5BOSA 4JEIA 2B35A 2IT1A 2HK7A 2G77B 4CKEB 4AMYA 4IXDA 2HMWA 4RSRA 4WMLA 3KT0A 3EPRA 1PR2A 1EK1A 4OI1A 1I1HA 2H3EA 4WI1A 2PJDA 4KPYA 5F3DA 2GF9A 2VT7A 4FWBA 5AHXA 1GTL1 1U0LA 1GDHA 1UPCA 2G5GX 1FDWA 3THSA 3ONNA 1ZNYA 4C78A 1CSEE 3CA8A 4WVLA 1DRUA 2VJCA 1U1GA 1T3GA 4OI2A 5AKLA 3V1UA 1IB0A 3NAZA 4H3VA 2J3IA 3OJOA 4NU5A 2NZJA 2P4SA 1TKBA 3LT2A 4UUPA 5I8PA 2GQ0A 3EXHB 3FBWA 2ATIA 3WISA 2JGNA 5LQRA 1OLXA 2ZWMA 4BU0A 3VKHA 2PL3A 1P7YA 3ZQKA 3ZX5A 2GUWA 4MV8A 3G2QA 1ZVJA 1SBIA 2WKPA 4QTUB 3NGXA 4DUGD 4HNHA 5CA0F 4AF7A 5KTRA 4GC9A 4Y2RA 1SXIA 1J0XO 4OJTA 3ESZA 4RL4A 5FNZA 2W11A 1Y3CE 5E4FA 4YREA 1SUCA 2J0UB 3OESA 4RPLA 1T8YA 1RXVA 4WK0B 4YAFA 1NUQA 3GJTA 4BYMA 5LDHA 2GN0A 3VSEA 1SUAA 3IEUA 5A2GA 1H8ED 1CR4A 4PSVA 10MHA 2D54A 4GRDA 3TOCA 3H1GA 1OWMA 1Y6JA 1DXHA 1RLIA 2VHWA 4CF3A 1MHTA 4UCWA 4AG5A 3O4RA 4GT1A 1RT9A 2O3TA 4URVR 4MUJA 2QMHA 3ZWNA 1HFWA 2G9NA 1XELA 2ZSJA 2FUCA 4MYHA 2QY9A 4GSLA 1C3JA 4PIMA 4BMDA 3NB0A 4BQSA 4PCVA 4EOGA 2JVKA 2DJIA 3D4BA 3U7QA 4NU8X 1G3RA 5AKJA 3EEOA 1MW8X 3C3EA 3WFJA 5ITSA 3KZCA 1CY7A 2P5UA 1IH8A 1WF3A 2WFAA 4MGEA 2ZANA 3ANSA 1LV8A 3TAHA 4DJTA 3AJAA 1BZYA 1A8HA 3ZJ4A 4B4OA 2IU6A 3WWPA 4Z6KA 1N6HA 2VDWB 1Q1AA 3HA5A 4JXJA 4Q5IA 1EWTA 1KQPA 5F2NA 5AOAA 2C92A 5CLGA 2RC5A 3HI4A 4DKJA 3PEVA 1BX3A 4JUDX 5DCWA 2FG6C 3GLFE 2C3OA 1Q7BA 4YV0A 4MUBA 3SIPA 5HF5A 1L1QA 1N7HA 5DT9A 4W6ZA 3V8MA 5ESRA 1BS2A 1TQ4A 4I55A 1TADA 1T4BA 3QHAA 2VF7A 4GYWA 4JQOA 3WAKA 4DEVA 4BMOB 4U39A 2YQ4A 1PQPA 4BVKA 2HPHA 1Y3HA 1M6VA 2BMAA 2WDZA 1G64A 2W9XA 5HMLA 2IIQA 3JTEA 1LDNA 3NEYA 2AKAB 3INGA 2ECPA 3EEFA 2QVLA 4KIFA 2HM7A 2JCVA 4U4AA 4UMEA 4KDEA 2B6HA 4DG8A 3C7KA 3X1JA 1DU4A 3K0KA 1EXMA 1B6RA 2DPMA 4TMKA 4YAKA 4YK7A 2WG0A 2W2KB 4FMBB 3VTFA 2XGSA 4C7VA 3H7IA 2YMLA 5ALGA 3U3JA 4YR9A 1AMUA 4TSFA 3TSWA 3G0DA 3ZWMA 1CUAA 5AW7A 1AIPA 1KR2A 4ZYUA 2X1VA 4ZO6A 1QLWA 4PC6A 2G82A 2IUYA 3GMDA 5DBOA 4MQEB 1DUIA 3WIBA 3C3KA 3HDVA 4IIBA 4DR5B 1MX5A 1SXHA 1VL8A 3DUFB 4XWTA 2HGSA 3Q41A 1PL0A 3RK1A 3VC1A 2RBEA 5KWSA 1XNJA 4QU9A 4WT7A 4WLFA 5FUXA 4M1SA 1CUBA 3IXMA 3WBFA 5KS2A 1J5EB 2DETA 1N77A 5FPHA 4JI4B 3V8VA 2VK2A 4LZAA 4X20A 4DJDC 4TTAA 3SS9X 3OZDA 1IJEA 2YIVX 1C0LA 3BRSA 3SPXA 4KN5A 1NBIA 5FBHA 2OCBA 1YL5A 3QU2A 5IEBA 3TZCA 4TLEA 1DCKA 3RPEA 3T34A 3F96A 3TZ6A 3WG9A 3WL6A 3IVMA 2FDXA 2DHEA 5GQSA 2QX8A 4L0CA 2YJ4A 2L0XA 2D2IA 4YS6A 2H65A 3UANA 1A5TA 3TLMA 4IHAA 1EK6A 4EQZA 1V0JA 3AMVA 3HP1A 1RR6A 4LWZA 3CS3A 3MGKA 1M2OB 4PLYA 4H7IA 2XVAA 4FJ1A 1UCFA 4B40A 1JH9A 1BX0A 1NVUQ 1IFXA 3FMVA 2RK4A 2HRZA 2RAVA 3T54A 5KSZA 2PYIA 2H9YA 2WKWA 1POXA 4OMCA 4MA0A 4R54A 2PH7A 3ZHYA 2IDKA 4KGVA 2PNJA 5HUJA 5I4KA 2UYHA 2B9VA 2UYCA 1GXSB 3NH6A 5LOVF 2VJDA 1I4TD 1M2NA 3IBTA 3OA2A 1C1XA 2PDAA 4TMFA 3I1FA 4PXAA 4R3NA 2FOLA 3FHLA 4ESOA 2IS4A 3F9RA 1F0PA 2EYUA 4KODA 1CDDA 2FE4A 4PS0A 4TS4A 2AX4A 4FHFA 2WNIA 1HRKA 1K3TA 4OP3A 1QRUA 3NAMA 4FFSA 5KQGA 1NXQA 3OD1A 4WZAE 1FFAA 1RWWA 3CR8A 3O6VA 2NU7A 4I4TF 1ZOIA 2EWMA 2DZDA 3HRIA 1W36B 4IJKA 2O2XA 3SHFA 2B4YA 2V65A 2WA2A 4IDCA 2Z9DA 1F3LA 2EJUA 1U5AA 4B80A 5E9QA 1ABBA 3F67A 4XIGS 1KTVA 1PJ4A 1IZ7A 4J0QA 1JHZA 1KGDA 2WIAA 1KFCB 3C6YA 4TXHA 1VHWA 5BN1A 1L8QA 1I32A 1QRDA 2EFYA 4IL5A 5JPCA 2FPPB 1FC0A 4HQFA 1VG0B 1Z0UA 3GJXC 2V7EA 4HH4A 1K6EA 2C04A 2P62A 4BYGA 1A5ZA 3GLFB 5MHTA 3K09C 2VF2A 4D81A 2QOEA 1QFJA 3GGOA 1I01A 4IIEA 2GCGA 1UFOA 2W4IA 4QTZA 4U7GA 3M83A 4YRMA 3NJRA 5AOBA 1KDYA 3QKRA 2E4VA 3A1VA 5CDFA 1W2WB 5AXAA 4EKGA 1MKYA 1VKOA 3ZLBA 3RWMB 4HB2A 1VKZA 2O07A 5F21A 1UP7A 3Q3EA 3UJ9A 1LK7A 1TZ2A 4HSEA 3AP3A 1QDEA 5B4UA 5BSEA 5JS1A 2CNOA 4TXJA 5I45A 1FMLA 4MHOA 3HABA 1OFIA 2QRVB 3LGSA 1ZG3A 4A73A 2X1LA 2FSHA 2OZLA 3OY7A 3NBXX 5E4JA 3FN4A 4MP6A 5CFPA 2Z4RA 3H8WA 4G1FA 2QD2A 1V41E 2PMDA 4OP2A 5LZ5A 1FYEA 2VAPA 4I3FA 4G5HA 2XHEA 1VE7A 1TA0A 4N3GA 2RGRA 1QFYA 1FP6A 4MW7A 2ZTLA 1NY6A 1Z0ZA 2WFZA 5AK0A 4POOA 2PUDA 1E77A 1KFBB 1QIMA 4HGNA 2E85A 2R3SA 1ZIDA 3FDIA 2H4HA 2VP5A 1OFUA 3ADKA 3P9PA 3QY0A 1SOMA 1Q21A 3B9BA 4BASA 2V1UA 2G63A 4RDXA 4J43A 3DBLB 2N1BA 2NLOA 3N05A 3KZOA 4JODA 1M2VA 1FXWF 3HCEA 4H7JA 3REOA 3C3XA 1CUZA 4MW2A 1ZM9A 5JD6A 3ZWOA 4CFZA 3ABRB 4XVRA 2N42A 2YRFA 2I2FA 2SCUB 2I3AA 5DP2A 1W9HA 4KXLA 1UK8A 3TAXA 4X00A 2YHSA 2YVQA 5E9AA 4UKDA 1M2KA 3VISA 3N28A 4CU5A 1G4HA 1X2EA 4B6GA 1F60A 4LMAA 4ZMBA 5GVRA 1DRJA 1O6FA 2XMZA 3EVAA 3ZHTA 2OAP1 4HDRA 5K8CA 2F8SA 2GKSA 3ILSA 4IXWA 1DJPA 3NYRA 4TSFD 2J9ZB 3I9LA 4NBSA 4UBKA 4IEFB 3W5UA 4HWSA 5U4XA 1YZ3A 2HDNB 4IMPA 4A6PA 1Y34E 4PRLA 2Q41A 1Z07A 2R6FA 3BWYA 2MYUA 2PZ8A 2ZT7A 4GSKA 4HDMB 1HDEA 3CX4A 1AQUA 3ADPA 3HKEA 1WO8A 4IZOA 1PGQA 4OLBA 3E2MA 4KQ6A 2CXQA 4JYBA 2P9GA 3BMQB 2BZ0A 3FSJX 1NFQA 3HFRA 4WFIA 5BN3A 1OI4A 3ZBPA 5C3MA 1E5XA 3EUAA 3C5WP 1ICIA 5AJYA 1KR5A 1Z4PX 2QW8A 3TH5A 1SVSA 1BEEA 4LQ4A 1CP3A 2WJPA 4WZAB 5ALEA 3ESBA 3M3DA 5KYNA 3BE6A 3B6ZA 1GTZA 3L02A 2AUNA 4O6VA 5EP3A 1JV2B 4LN1A 2FDCA 1Z6GA 4NV0A 2G6BA 3RRNA 4CF5A 5I8WA 5EPOA 1VIAA 1UDCA 2WYWA 3DUWA 3BH6A 2A4KA 4DNFA 4DV4B 5E3IA 2RAPA 3ONVA 2VH5R 3NU1A 4CG0A 3GEDA 1QTIA 1YJQA 3C7DB 5JS7A 5FTLA 1AXRA 5KPJA 3KIPA 2FSSA 2QD5A 4F12A 3O4IA 3B12A 3IDQA 2Y0DA 3RT9A 9LDTA 3RUEA 1DFHA 1NW6A 3MAJA 2UU9B 3SQWA 4PCUA 1E2IA 4QDTA 4PIPA 2ZFUA 4DMLA 2Z6UA 2AOXA 2QV7A 5AKKA 1F7UA 4U2GA 2Q6VA 4MVYA 3U44A 4IXMA 5CFOA 5T5QA 2R2GA 3PF8A 3AHDA 4TPKA 4F8EA 5KMGA 1WDMA 3C45A 2UZ0A 3K0FB 4UCQA 1Z4LA 3VC7A 4C6TA 2VAXA 3UV3A 2BP7B 3Q5EA 2P77A 3L1VA 2O8DB 4RD3A 1O5TA 4MI1A 4HNTA 1G3MA 3SAJA 3Q3CA 4IDNA 4F2PA 2IUUA 3UGKA 5G2OA 3I5XA 4FHDA 5IF3A 2YIMA 1BG6A 1GTVA 2OFPA 1FNMA 4CLRB 3KV3O 1SUFA 1N6LA 3WLAA 5LIPA 3ETHA 3CV3A 4RFVA 1H23A 3T1NA 1NZFA 1QR2A 1EJ6A 1RZVA 5HX7A 5LP6F 1H9CA 1ZGHA 1H0KA 5AVQA 1GUZA 4KSBA 3EXG1 2KM1A 1OLSB 2EIXA 5FQNA 4ZO9A 4E5UA 5B64A 5T4HA 3GFTA 3SEZA 3BXPA 1JR4A 3VNSA 2XMRA 3AEYA 2IVFA 4I1VA 1W6RA 1B76A 2ZKLA 3E48A 2GO1A 3IJRA 1PGNA 4G9GA 1XI2A 4J7CA 4LSMA 3UW3A 2I3GA 4E03A 1S5PA 4N49A 4WBNB 4UMFA 5K09A 1TQ6A 1JFLA 1AMOA 3HPRA 2XXAA 3FPKA 4QAJA 1KZYC 3ROZA 4HFRA 4KPUA 4EF4A 1TUBA 1S4MA 2RGXA 4RKFA 1T8RA 4E46A 2J7KA 2D5LA 3V8PA 5C8DA 1N92A 4HADA 4ARSA 2H1SA 2GXAA 3OG9A 1MD9A 3GB9A 2IV2X 3R7WB 5HUHA 1ONOA 3PHCA 5DP1A 3DOJA 1TA9A 3BXZA 3D9QX 3ZH9B 2P6OA 5BMVF 1QIGA 2R4QA 4KUHA 3JQAB 4RABA 4AN1A 1FFXA 4Z0HO 2QBYB 4FGSA 3QENA 5DXJA 5T3YA 2BGWA 5AWFC 4RSMA 3ZCTA 3TRKA 2HPVA 4F9GA 3DTNA 1JSLA 3F9CA 1SUIA 4ZO8A 1SOVA 2Z3WA 5B58C 1KZ9A 3I1JA 4FOLA 2ASEA 1YZTA 4JJIA 4IUYA 3H9UA 3BEDA 2E21A 3AEKA 1T0UA 3PZRA 1IBLB 3IP5A 3FTCA 3IA7A 2F17A 2VSNA 2ZSEA 1ZK3A 1JDVA 1OXUA 2NU9A 4Y1GA 3D6HA 3B1KA 1HQDA 2H52A 2V6MA 2DBQA 3BCRA 3M5WA 3MWLA 3NEJA 3OZEA 4FE3A 3UMGA 1HTWA 4M0DA 1WM1A 5ECGC 3WK6A 1E1QA 2ZJ8A 5LQJA 3IODA 1C7QA 5LYJA 4MQFA 3GCWA 1SBZA 4RHYA 1WCWA 2FQXA 3UICA 4YV7A 3B3JA 4J7UA 2B4TO 2LR0A 1OV4A 1B15A 1YR6A 2H4XA 2HY7A 2IZ1A 4DDVA 1ULZA 1Y4AE 2AYZA 4JLPA 3EIXA 3OU2A 1WV1A 4BB5A 3QHQA 3T5TA 5THXA 4EGQA 4BMXA 3RTCA 1AV7A 1TM3E 1Z4JA 4ZEOA 4K6FA 1KAHA 1KYWA 4U2CA 3HU2A 3R7SA 1L6IA 4JLWA 5FFMA 1RQNA 3CWZA 3BCUA 1IXRC 2KMLA 1QZ3A 5TGTA 3U5ZB 1VBFA 1CQZA 4N7BA 2I99A 4ZODA 1LI7A 1WHTB 3HKCB 3WJ1A 2QYOA 3A2LA 3LPLA 4EJ0A 3KYIB 5ICFA 1TYEB 1E1CA 2FPKA 3HKBB 4XRRA 5BO5A 1E8MA 3IR5A 5C1BA 4FHGA 1NN1A 3IT2A 2HIMA 5DPMA 1EGQA 3V2UA 3TX6A 4UDNA 1GTG1 3RUIA 5KC9A 3NDIA 4LJ9A 4HDKA 4JVLA 3ZBQA 4KFRA 1SCNE 3B1FA 4YVFA 3R5HA 3QQPA 3TJZA 5KOJA 5IPFA 2C0PA 1A1SA 4OLFA 4DQXA 3FB1A 2EV9A 1P81A 9ABPA 4UD2A 1XD8A 2JAQA 2C9OA 1O6CA 1VYUA 4OA8A 4FR2A 1JIIA 1UPBA 3GLHE 2VDOB 1IY0A 5EZYA 1TJ3A 2ZTVA 5JJIA 4FGZA 1BXZA 3IXLA 3G8BA 1JEDA 3RFUA 3SDZA 4WCFB 2CEAA 1DWOA 1PO7A 4Q12A 5LU9A 4MMYB 4MTCA 5IU6A 2V7BA 2ZQ5A 4WNCA 1MC4A 1W87A 2O8EA 1U90A 4ZGBA 2HW8A 3X0DA 1SD5A 2LD4A 4MGKR 4R9NA 1ZP6A 2NTVA 2YDYA 1JSXA 5HXAA 1MMFB 1VIDA 3O4GA 5LYYA 4YIHA 2UYGA 2R7KA 4QUDA 3UCFA 2HSZA 1W85B 1G4UR 2I76A 2QE7A 3DC7A 2OBNA 3PFGA 1QJ4A 2OLEA 3A4NA 1W8IA 5DN9A 3U4AA 1R8QA 4QT0A 3SIWA 4COKA 3L8EA 1A5SB 2VHCA 4RK1A 4YLEA 3RSCA 1QYWA 1I2ZA 3KVRA 2B69A 3V1NA 1XMXA 4G0OA 3WICA 3WZ2A 4YRAA 3QYFA 3VMFA 1AQYA 4OEHA 3UTCA 3UOWA 2IXDA 4N41A 3GLIA 4CEHA 3OPQA 3E81A 4BTLA 3U16A 3V80A 1FW8A 5G02A 2ADMA 1JHXA 2AEEA 3JW8A 4A8TA 3K9GA 4K9RA 2PZMA 5DTMA 1NHWA 3GRPA 3CJRA 1ORHA 5SY9A 1TJPB 5LZ9A 3L9XA 4YHHB 5C7OO 3TBHA 2PX4A 3ESCA 2Z43A 1YA4A 2FRDC 4O3FA 1YGYA 1CIPA 3GHHA 1USGA 1ZN9A 3KWMA 4MW6A 2D0PB 4DXAA 2GEKA 5H9VA 3W2GA 3JQEA 4HD8A 3KS9A 3SEAA 2QTBA 3SLKA 5BW8A 2XE7A 3TIXB 2E82A 2JFGA 5A71A 4R3UC 1EFVB 3ZLTA 3SDBA 4Z4CA 4MKFA 2OTCA 1V16B 5GP1A 3BS4A 4WECA 1LV7A 5DX8A 2AJTA 3ZXIA 1XZJA 3QW2A 4OB8A 3VBCA 4ZIRA 4OREX 4KGDA 4QDJA 4Z7JA 3TFWA 2NSHA 1WTCA 5KSPA 1NYRA 5EGNA 5IVIA 4PEVA 5HRAA 4TQ9A 2WUGA 3I9MA 4DLPA 2RGEA 3RUCA 3HWSA 2GCEA 2JLWA 1YRBA 1N6IA 4GKKB 2IXGA 3O74A 1Q7GA 1C80A 2ODWA 4FQ8A 2C8KA 1PEKE 4RIHA 1XZGA 1AZWA 1VPDA 4Q3EA 5GONA 3HKDB 1IWPB 2V5VA 3KUDA 1CZHA 1IXZA 2HK6A 3L7MA 1TTTA 1QNLA 3TLGA 3LQ2A 3VOSA 5DSTA 5BY2A 4DMKA 4NEQA 4R8MA 1VP3A 1Z6TA 4BN4A 2HA0A 2YHIB 5LL6P 2FSVC 2B5OA 1JZQA 2DHCA 3FZYA 1GLGA 1LCIA 2X9QA 4X64B 1JIKA 3I92A 3ITEA 2WZCA 1H9BA 1KI9A 4IV0A 2H8GA 4RTSA 2HPZA 1NJGA 4JEUA 2R47A 4KACA 5CH5A 4F5YA 5DN6D 5JW6A 1DC8A 3RRYA 3KHUA 1BGXT 4NV1A 1E1QD 1G2PA 2G70A 4LI3X 1ZH0A 2VJKA 4RTMA 4BKRA 1B74A 2VS1A 5JSZB 3DL7A 1DLJA 4HWKA 1BWPA 1DRWA 2BMJA 1FTNA 3PC3A 3KHTA 4LSGA 3SSNA 1FUEA 3SS8A 5BV0A 5J4YA 1C50A 4EVQA 5IYZA 3HJTA 3TRHA 1D0IA 1AGRA 1OAKA 3LCJA 3GLHB 1OH5A 5CEEA 1OILA 2JHAA 1B6TA 1UMDB 1H4SA 2C00A 2OHIA 4DV6B 1YE5A 2G0TA 1BW9A 3GVPA 1SEPA 1C9JA 1DBWA 4JVMA 4CM6A 1HETA 1A97A 3IELA 1JB9A 2CN1A 4Q1BA 3M7IA 3PGMA 4WA8A 2W2TA 4DQDA 1Z13A 1G2QA 3GZ4A 1YRYE 3TTSA 1HDOA 4ZVSA 2Q8QA 3Q15C 2VWPA 2G83A 1KJZA 1XVVA 3IAS6 3OOYA 3UA4A 4BO0A 5JFGA 1TO2E 1HE1C 1YR7A 2JGDB 4RZSA 1ZH4A 1GNQA 3PE4A 4BQQA 3QP9A 1SVUA 1MO6A 3ABIA 1LPMA 4GO1A 2W6ZA 3P4UA 1PK7A 1RQ7A 1XLWA 3FOZA 4KHPB 3SOPA 2HWUA 1LC3A 5HFNA 2B2NA 3CHYA 1XTZA 3NLLA 1OT3A 4YB8A 5TGDA 3B53X 1RQGA 1YV9A 1ZMRA 4ML3A 1JAIA 1TT5B 2BI4A 4YCCA 4S1PA 2YN0A 1XEWY 4N5MA 3GEEA 3VXKA 4E11A 1UKBA 4N65A 4KN9S 1XCJA 2PUWA 1RLMA 4V39A 5EIHA 2C96A 2DR0A 1KMIY 3GRAA 3O7MA 3EOAI 4ZQFA 3RVPA 3WGJA 4JKYA 1ZAKA 1HORA 2QQ5A 2WJ4A 2QMEA 4MMZB 4M0CA 4O8ZA 1QZTA 4Y6QA 4CF4A 5KTKA 3EBLA 1NMSA 4UHCA 2ON6A 1CZKA 4DQKA 3SBEA 4QHYA 1LB1B 4AAYA 1FF9A 1T8SA 3L43A 3A10A 5AVWA 3ZWBA 1CQPA 1ZNXA 4F11A 1IHYA 3ROPA 1RW4A 1SXPA 3GFQA 2X42A 5DTRA 2ZI5A 2UV8A 3IUPA 4JLUA 4OM7A 1XWWA 3SZMA 2FXVA 4D9GA 4V0SA 1TGVA 4LF6B 1FX1A 3K16A 1NOJA 4DPMA 1KA9H 2J9YB 3HYRA 4IDAA 5JHHB 1KYZA 3LP5A 1NVGA 1RXWA 2YXNA 1VXRA 1E61A 1EUCA 2ZETA 4D4KA 4JB2A 3NGLA 4LDJA 1UJ2A 4BLQA 4C01A 4GEKA 4YT4A 4BFTA 4BMYA 3LOQA 1WRBA 2QM0A 1V8PA 3QPBA 4IFEA 4HXGA 5K4AA 3DXZA 2X2FA 4Z9BA 2A9KA 4PWYA 1H5NA 1R0BA 4RYLA 1YOBA 4YLYA 1XHLA 3SN6A 4FP9A 4HJRA 1T3HA 3CGGA 2PHZA 3BQ9A 4DLWA 5IH7A 1E4YA 2I03A 3OLCX 4GZ5A 3KE8A 5AKYA 1MHPA 4S04A 1QJCA 1W2HA 4KGXA 1O2DA 2G7ZA 5BQPA 4BTVA 1ZFNA 5ICGA 3DE1X 3QFRA 1M7GA 3UW1A 1WVIA 1DC5A 1XF9A 4EPTA 4BLVA 5EZQA 5KEIA 2O2CA 2FKNA 2W6QA 4P36A 5TNXA 5LFAA 1DNPA 1UAYA 3FLAA 1DAIA 4NYJR 4RO0A 3JRNA 1HE3A 2A1UA 3OQIB 1KKMA 6Q21A 2A86A 3CZMA 3ASVA 3PFNA 2JIQA 4YXWA 1J0AA 4DB2A 1JDBC 3Q9LA 4CEIB 2G08A 1F2DA 1KBOA 1E8NA 3CVVA 1RAIA 3VC2A 4UM7A 1QCZA 3TGWA 5JS2A 1N5OX 4H4DA 2OHXA 3G7NA 3GN2A 1Z2PX 3OPMA 4PICA 1U7UA 4WFKA 1HYQA 2W0MA 3G5TA 4NHOA 3SMVA 2VJNA 1X8LA 3EASA 4G1MB 4OQYA 4E6PA 2OK7A 4L2IA 3AM1A 4B7UA 3W8RA 4NYIQ 4WGGA 1TYBE 4JP2A 5EVJA 4FQ7A 4QUIA 4Z3DA 3DHVA 5JNVA 4INZA 1MB3A 5A9SA 5JD5A 2B8TA 5AVKA 2W48A 1EUDB 5IM4F 1F2UA 4NYMQ 3C3AA 1SZDA 2B34A 2QSZA 4QE3A 3G88A 4RD2A 5K01A 1FFGA 1WUIS 4NF2A 2W2NA 4DIUA 1MB0A 4GL4A 4TMZA 3RF6A 6REQA 4DA8A 1SVOA 2WOOA 1NATA 3B3FA 4ONEA 1CUSA 2AYXA 2AWOA 2FFRA 4XZ3A 1T9ZA 3ZWDA 2PIAA 4WJLA 4UVGA 5JYDA 4HGOA 4CUKA 4MYTA 1F14A 4YUYA 1HLGA 2Q3HA 3MTGA 1ZK4A 2VF5X 3M9WA 3UF0A 2Q3BA 3STXA 2AN3A 4Q1EA 3GFOA 2YNMC 2VQSA 3W2IA 1REQA 5C31A 4EMBA 2O54A 3JWGA 2GEDA 5CB4F 1YVUA 3KTDA 4MGHA 4XM0A 3V8QA 1IB6A 5B3JC 1P2BA 3SXUA 2JI7A 2BH2A 4B31A 2OPBA 4BKQA 2HUNA 3RDPA 1WCV1 3GN1A 3N74A 2EW1A 1XMVA 3Q3JB 1E1NA 4BDSA 3QXXA 1G1AA 3D0QA 1YS1X 2D1FA 1CV2A 2FGKA 2IH2A 1NBOA 2PH1A 3QGMA 3QVXA 4HG2A 3UT6A 2I2AA 3JD0A 1YRWA 4OHVA 1XXHB 3LTEA 4JVSB 4TWJA 3MLAA 3UGQA 1IM2A 1NY5A 1R8XA 3SFZA 2PCLA 4EKEA 2HJGA 5C8XA 4J2HA 3TG8A 4FSXA 3ZV5A 1ZMXA 3TLCA 3E9ZA 2O4CA 4X45A 3V00A 4J7XA 4KG7A 2O3JA 5IWAB 1KIFA 3Q7RA 3H7AA 2GEVA 4A7PA 2CYCA 2R1VA 4MYDA 4UCXA 1YRAA 3IX7A 5FWNA 1O0BA 4EI9A 4L50A 3E9RA 2LV8A 2MDTA 1USWA 3I9NA 4LG1A 4P38A 5GGXA 5H5JA 4I4IA 2OAGA 2XVZA 3MVEA 1P2UA 3AZPA 3OIWA 3R2JA 5ALHA 3JY6A 5FA5A 2IYLD 2YHAA 2C20A 3PQ5A 3WHKA 4J0FA 2ZOSA 1U7XA 3NHRA 4BV2A 5IJ0A 2GPJA 4QOSA 2ONYA 4Y6GB 3MWFA 2LNDA 4WLUA 3ACDA 4ARIA 4BCBA 1F9EA 5BQOA 4S05A 2CVQA 1XSEA 2QJRA 3M49A 2Q4DA 4GNRA 4IF4A 4M99A 4AJEA 1Z38A 3OZUA 4P7BA 5KQMA 3HXMA 5ALWA 1HLDA 1NXVA 5FWXB 2VCHA 3LBYA 3GQBB 2Z08A 1AOXA 2CLSA 1FL9A 1MQ8B 2I7VA 2XH8A 3PDHA 4GM4A 5E9WA 3A25A 3FFAA 1JAZA 2RI6A 3NTVA 4BQEA 1JJVA 1TTHA 4ZEVA 3H5RA 4E08A 1E98A 4EKNB 3PKIA 2O05A 4JMLA 5K6AC 3BSFA 3CKKA 2OPHA 3GGJA 3K1JA 1I5OA 1B16A 3ND7A 3SYNA 5M2QA 1Q17A 1ZDMA 4IF6A 1KI3A 1WIWA 3NTRA 2OCLA 2JIRA 3FYCA 5FAXA 3FYSA 5G0TA 4X93A 4EK9A 1BFUA 1MIHA 2BSXA 3BOSA 2G07A 3KLBA 1U6KA 1P0MA 2R6GA 2BCEA 4NV3A 1JLHA 2R1UA 3AF1A 3KO8A 3S6JA 3CNBA 5KJ1A 2V03A 3F90A 2DXIA 2QIOA 1OOEA 4LYDA 4D6XA 4OXIA 3ZKWB 5ECWA 5HIKA 2TRSB 3BTSA 3HJCA 4P4TA 1V8BA 1GV0A 4LX0A 4P4SA 4KOEC 1YFZA 2HSWA 4HHEA 4Z7OB 1JEJA 1GCGA 1K7FB 4DUPA 3EF1A 2AF4C 3L6BA 4CIAA 2P7HA 4L5BA 4FN5A 3Q5GA 2BBSA 4G67A 3W77A 4DRXB 5JAOA 2ONJA 2OENG 5FCDA 1P5FA 2ZDGA 2AVDA 2XA1A 4PPGA 1KZ7B 4WK2B 1TU0A 3RIXA 4CVNA 3FPBA 5J3JA 4QM7A 4BAUA 2KQUA 4QU8A 2FSVA 2PKQO 4CDMA 3D59A 2YY6A 1PU2A 1SWWA 2Q4RA 4KW7A 3E03A 2BFMA 1GFSA 2BL4A 3PJFA 4B4UA 1N2BA 1WNFA 2PYZA 4INPA 5KJEA 1XMIA 2HRCA 5C4GB 3UQZA 4KXUA 1EX7A 1ZOSA 4MWTA 3U56A 1IHXA 1T91A 3IO3A 4YXWD 3NHUA 1HEIA 4A2QA 3WKAA 1KJ8A 2G9QA 3K9WA 2D6FA 1VKHA 4DTCA 3FOFC 2DQZA 5GJCA 2C07A 2VKQA 1Q7TA 2IV3A 2JH8A 4AKTA 4YO7A 1O9HA 1Z9BA 3UATA 1MABA 4MULA 3NQ41 3D3QA 1M1ZA 1Z35A 3DMNA 3RVDA 3ENKA 2FFHA 2ZROA 2XCSB 2HF9A 1WD7A 4EUHA 4JKOA 2OHFA 3I2JA 4MUEA 4BO4A 2H5LA 1YBVA 1G18A 1H1DA 2FWBA 3P2MA 3GOQA 5JQWA 3I1IA 3PEYA 1TCVA 2C84A 1EVYA 4QBKA 1UZUA 1PZXA 4F21A 3V6MA 1NONA 1C1DB 1SGWA 3M3HA 4NQZA 4TYYA 3TBKA 3FNIA 3AEQA 2M6LA 2AMFA 1VB3A 1W5AA 2FEOA 3VZQA 3L7IA 4Z0PA 1VHDA 4A8PA 3QFSA 3GYBA 3TRJA 8LDHA 1H42A 1AN9A 3A6GA 3E53A 2RH4A 3GPDG 3O2QB 5IF9A 3ZDAA 1G42A 1PR3A 2B0CA 2P2SA 2WJGA 3QXCA 4MK4A 5JD4A 5CYPA 5GINE 3Q7EA 1UEXC 3TXXA 4ZTBA 3FFXA 4JSRA 4PLFA 4D4HA 1GPWB 1AKWA 2C7BA 5EP4A 4A2PA 4CM8A 1IYZA 1EZZA 4KXXA 5L3QA 2C2YA 4L7VA 2I4IA 1FTWA 2YV3A 1X9IA 2VQDA 4M7PA 4ZJYA 3U4QB 1S89A 5FI1B 4Z54A 3D4PA 1QG0A 1VRCA 3BBPA 3O8QB 5I7WA 2I22A 1CJUC 3B2NA 3CNNA 4RW0A 1LWOA 2OO3A 3JQ8A 1UPFA 2GK4A 4TRMA 4KZPA 5DTJA 5U1PA 4DMFA 5L3SA 3I61A 3JASA 1F4PA 3SQNA 4FGKA 2VK4A 2PUAA 5JPDA 3NVMB 2PCJA 2EJWA 3B6IA 3DDHA 3KYDA 1BNCA 3R3SA 5BYBA 3RASA 3EIUA 2AMJA 5BV7A 1PZMA 3JD3A 4H0NA 2Q3EA 1RBMA 3QU9A 3OZSA 1KZHA 5HR5A 5JBNA 5BSTA 3IUNA 4NZ9A 3P27A 2WICA 4YCBA 3K35A 8ABPA 2Q1YA 3IUBA 1STOA 1GSIA 1VYVA 4DSTA 4J49A 4FIZA 1O54A 4HSGA 1WP4A 3DFZA 3JAWA 2FXIA 1ORWA 1NULA 1XWFA 3OC0A 1GPAA 2O2HA 5DK4A 5DOVA 2I6SA 1G8YA 3K0HA 1Z4MA 4PHHA 2AN4A 2NVUB 1BX1A 4CLHA 3IE2A 2ZJ5A 1YMVA 1G6Q1 1N2HA 1SXJA 4IMIB 3MNFA 4MAAA 4N5NA 1WB9A 3DCJA 3TUJC 4UEJA 4YR7A 2ORIA 3C43A 3JYPA 3NHJA 5HFAA 3UUEA