4GMDA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
203
Chain Sequence
b'TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/inhibitor
total genus 77
structure length 203
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmdA00
4PPQA 2GVDC 3CO5A 1H65A 1IXRC 2J59A 4OJQA 3ZZ0A 1RRFA 2C95A 4ARZB 1OLOA 1XFAA 1H8HA 4OHWA 1GKYA 2OFWA 1OE0A 1HQYE 3ZH9B 4EFMA 2AD5A 2LWIA 3DL0A 4LZZA 4S35A 3EASA 2ZPTX 2IHYA 3KDSE 3U3KA 4JLVA 4BLSA 3G0HA 1U94A 5CDFE 4Q9KA 1E1QD 3TIFA 3K70C 1UDWA 2G1JA 5EE0A 1DAHA 1JB1A 3ZYCA 1FP6A 4PPNA 4GP6A 2PZGA 2Q9AA 3D8BA 1DADA 1N6RA 4CEHA 3QSYA 4C7OA 2ZSBA 2GNOA 5J4LA 2JJ2D 1Q1ZA 2DFKB 2NO9A 4NYIQ 5BQ5A 1Z07A 2CMKA 4JLMA 1SKYE 1NVVR 4KODA 1PLKA 3AVWA 3SHFA 1XMVA 2UZ3A 3PIRA 1KI3A 4PQYA 2J0UB 2VHTA 4Q4JB 2AHOA 1E0KA 1OXUA 2PX0A 2WJVA 4IOJA 4I1SA 4RD3A 4RZUA 4FMCF 4B43A 1WMSA 1UBEA 1Q20A 5CK4A 2O8BA 1VPLA 3NBFA 1UDXA 1XD2A 5AJVB 4A0GA 4HLUC 4E03A 5GADl 1LB1B 1TQDA 1PV4A 2NZJA 4D4LA 1S3GA 3CZPA 4MA4A 2AD1A 4YC7A 4DWJA 3LW8A 4IW3B 1G3RA 2YC4C 3U7GA 2ZYUX 3AEZA 5C4MA 4NCHA 4ITRC 2PBRA 4OBEA 3IIKA 2IYYA 1AKYA 2Z5FA 3P27A 4EJSA 2QP4A 3R7WB 2CJWB 1MABA 1E99A 2NQ2C 2ZJZA 3CR7A 2CVFA 3MCAA 1U98A 3K0CC 4P4SA 3RRMA 2YZ2A 1XD8A 3I4LA 3IPXA 2CLDX 4TTRA 5IT5A 1Q1QA 3K53A 4RFSB 3K0SA 5LD2C 4PXAA 2NO6A 3TRFA 4P31A 2ZUCA 1TQ2A 1FNMA 5DIFA 1KJYA 1LW7A 2GXQA 3ZVLA 4ZDWA 5J4KA 2WKPA 1NLZA 3Q3JB 4OHYA 4Y0AA 5FUXA 2AKAB 2DBYA 2GCOA 2FGKA 4PPGA 3W34A 2CDNA 3FGNA 3IBYA 1E2KA 1E2NA 1P2SA 1AM4D 1KI6B 1RE0A 2B8WA 2XOKD 4W5JA 5AUQA 4XIGS 2O8DA 4ZCLA 2DYKA 1NBMD 3OAAA 1W36D 1NP6A 3S1AB 5AUOB 2IX3A 3K0EA 3U60B 2JLVA 2E87A 5KPJA 2IK8A 3WBJA 2KB0A 1TQ4A 2QGNA 1WCV1 2ONJA 3U4QB 4A0RA 4B3GA 4E09A 1Z6GA 5TMPA 4TQAA 1MH1A 1P62B 2QMEA 4KFRA 1GG2A 2WKQA 4B33A 4Q7LA 3L8YA 5JEEA 1HE8B 4TL7A 1XX6A 3HU1A 1XD9A 2PEYA 4KI0A 5EUMA 1CJUC 1L4UA 1RKBA 4JLBA 3WHKA 3IO5A 4Z1MD 2D7DA 5UKDA 5CJPA 3U2QA 1YQTA 1YRAA 4RCZA 4AC9A 1Z6TA 3F0TA 4E5UA 5L3VA 3HWSA 3EARA 3KKQA 3L43A 1W5TA 4HEJA 2QG6A 4R2IA 2GEVA 2HF9A 1YHNA 3C7KA 1M8PA 2L0XA 3SBDA 1COWA 3RHFA 4M22A 1KO8A 2YWHA 4B71A 3LO5A 3U5ZB 1JEEA 4ASUD 5JHGB 3EPJA 1OIWA 1QF9A 1V43A 4B35A 1SVKA 1A4RA 3ZJYA 5FTLA 1IJFA 5JJLA 2WWIA 5JCPA 5GJBA 3AF2A 1YRBA 3DVLA 3RABA 5FOWA 1GTVA 1VG9B 3GJ3A 3GJ6A 3KB2A 3BFKA 1KK3A 1DVRA 2FFBA 1G19A 2RGDA 1OXVA 2IYZA 3AVYA 4LV5B 2ZRMA 4QM7A 4TLCA 4M9ZA 1QRAA 2ZIAA 3BWDD 3G5UA 3HP1A 5TXGA 5GJVC 1XB2A 3RS3A 2N1BA 2CLSA 3PUYA 2F9LA 4FWIB 4QGHA 2AFHE 3DKPA 4WW0A 3THWA 1TQ6A 1UBGA 1L8QA 3GPLA 4W9MC 2WPDD 2GEDA 3O8DA 5KDDA 2YWGA 5D3QA 2BMEA 3ZIAA 4BPBA 4KBGA 1OIVA 2QZ4A 4EJSC 1HV8A 2RGGA 4URWR 2F55A 1XPRA 1E9SA 2W6JA 1UADA 3FYHA 3T61A 2KJQA 2TMKA 2C9YA 1E9EA 2ANCA 3GCGA 5LB2A 5FBQB 3GLFB 1E2PA 3UPUA 1XF9A 2D2EA 3X1YA 4URVR 2BMDA 2LKCA 4JLOA 5JWRA 4Q7KA 1P2UA 5EP4A 4ZKEA 1HT2E 1G7TA 2A9KA 4I99A 4DLWA 3TE6A 2DB3A 2WJIA 1DAIA 4AG6A 1W0JD 4J0QA 1A82A 3W3ZB 4V03A 2A78A 2RGXA 1SHKA 5G41A 1W7AA 3UIEA 1AQYA 3HU2A 5IF9A 2NMVA 2YWEA 1BMFD 1NVUQ 1ZC4A 4NMMA 1ZNZA 1T8UA 3RVBA 4TZ0A 3ND8A 4WAUA 5TB5A 1XEWX 1TAGA 1GP2A 3Q5EA 4G0NA 2IYUA 2X2EA 4DLZA 1DOAA 3I1FA 5DSZA 1A1VA 2WIBA 4KLNA 4CEJA 1JR6A 2BEKA 4X8OA 1F60A 3U7HB 4DZZA 3NTUA 1W5SA 4B3DA 3KFXA 1SXJD 4Q47A 1DELA 5A0FA 4JZKA 4PAMA 2WWFA 1SULA 4MGIR 2XZPA 3I92A 5EXSA 5DI3B 3VHLB 4Q4AB 4Z8YA 2FWRA 3FTQA 621PA 3B82A 3AF4A 2WMNB 5DISB 4ERNA 4Q1EA 5LB4A 1G5RA 3LNCA 3KUCA 1P6XA 1XXHB 4TYQA 4BE7B 1TX4B 3IUYA 3I73A 4C0LA 2B8TA 1JQLB 2QL6A 2RHDA 1YZUA 1V5WA 2D06A 3T1OA 5BN3A 4P0TA 2ZRIA 4NYIR 2K5UA 2DY1A 4B32A 1NL3A 3RWMB 3EIEA 2I1QA 3FHTA 1OFIA 2KSQA 4ZV4A 1OT3A 1OB2A 1IN8A 2C03A 3GEHA 2J0UA 2FA9A 2VP5A 3L0IB 4HATA 4V0ME 2Q0HA 2P5TB 2V8OA 4B2PA 2QTFA 4A8JB 4NHOA 3IIJA 2ZSFA 4FMDF 5DHAA 1H8EA 3EX7C 4JVMA 1RJ9B 1UBFA 2QAGC 4PSKA 4C3ZA 1RW4A 1LS6A 4AG5A 1S4QA 4MRPA 4W7SA 4LPSA 3TQCA 3Q8XB 2G1KA 5TDHA 1VCOA 4AD8A 3GLHB 2P6NA 1NSTA 4MKHA 3SJCA 4ACAA 3GLGA 2W0SA 4QGFA 1AQUA 4LBYA 5L3RA 3R7WA 2VP4A 4UXJA 2ZRPA 4ZDJA 3TGPA 4FMCB 1MKYA 1O3YA 5KTYA 5DYGA 5D3MB 2EFCB 2JLQA 3PITA 3SEAA 3DM5A 4BASA 5IRCD 1E69A 4DEYA 1BOFA 2PMDA 2QNRA 4TYWA 5CLLA 1KK2A 2QRZA 5KO2A 1Z22A 3C16C 3C15C 2HXYA 2OXCA 3K70D 4M1KA 4XJXA 2F6RA 2ZYTX 4WZ6A 3TKLA 2HYIC 2VIIA 1KAOA 1JR3A 1U0LA 4LDJA 4QFMA 2NO7A 3SYLA 1FP7A 3KXIA 4BEBA 4HZUA 2VH5R 3SJBA 4IEIA 4RCYA 5BW8A 1IM2A 4B48A 5E7MA 3O8CA 1DO0A 2H8KA 4V0OA 1NY5A 1E32A 3ONWA 4EPYA 2IUTA 5FPTA 5KHOC 5DI9A 5JJIA 4GI7A 1KI6A 1KTVA 4O0MA 4C30A 1OV4A 4Y0VA 1CIPA 2J45A 3PXGA 5K8LA 3IEVA 1JAHA 2IYXA 2QTVB 1E1RD 3THXB 2D3WA 2FSFA 3U3MA 1B0UA 3S1AA 1PZNA 1XEXB 1Z06A 1T6NA 1LF5A 2GJAA 3AP1A 1XP8A 3T1TA 1YKSA 5H68A 3SQXA 3D31A 4LWZA 4U00A 3UANA 3FDIA 5KOYA 1ZNWA 3REFA 1XPOA 1IN5A 1GITA 2AN9A 3T5GA 4AKGA 3A37A 4S2EA 4M53A 3BOSA 3TK1A 2ZJBA 3QKRB 5HE9A 2VYFA 4XVQA 4NL4H 2C99A 2VP6A 721PA 5J40A 4DC9A 1KI4A 3LQRA 4LJ8A 4NP6A 3ZS9A 1FUUA 2JA1A 5P21A 5H70A 4IHQA 1SVWA 2ORIA 4BZQA 1R2QA 1ELOA 1OH8A 1S2MA 2BJWA 4HDQB 2AK3A 2CK3D 1F2UB 3NH9A 1GAJA 2H7VA 3V00A 3TJZA 3AF0A 1G6OA 1AK2A 2VF8A 2J7PA 5J47A 2RAPA 2QSYA 1Z47A 3B6EA 2KI5A 1YU9A 4KVGA 5G53C 2YC2C 1G8GA 1XU4A 2JATA 2OE2A 1RPZA 1XTKA 2BMFA 4NPHA 3NWJA 1D2NA 2XTNA 1SHZA 4TMWA 4B47A 3MLEA 4LSGA 2GZHA 3L2OB 4LYJA 2G0NA 3BB1A 3ZS8A 4LBVA 1Q1EA 4D0NA 2FFHA 4NKRA 1KOFA 1LY1A 4FCWA 1UKVY 1YR9A 2A7QA 3BXZA 2PEZA 4MITA 1WB9A 1W4CA 2RGAA 5AUNB 3TSWA 3MD0A 4JBYA 4QHTA 1KI7A 2XSZA 1NF3A 2NPIA 1Q12A 1YZKA 2WWHA 1NY6A 3R8CA 3DMDA 2BDTA 2H57A 2IC5A 2QROA 3UATA 3LV8A 4TZ6A 4NZYA 3QG5A 4PQRA 5CDFA 2MSEB 4OQXA 3H4MA 5BWMA 1E3MA 5C46F 2XB4A 3GLFA 1VHLA 1H8HD 4ZIRA 2GJSA 1E2QA 3NC1C 2QT1A 2V9PA 2PZEA 1QHNA 5BYJA 3RYTC 4KFUA 1RYHA 2ZVQX 5C18A 1M7HA 3EC2A 3FHOA 4DCVA 4B2IA 1NG9A 1ESMA 1NJFA 1MO4A 1LVGA 2RHMA 4LJ5A 1F2TB 1GILA 2CXXA 4BFYA 2DHRA 5C1BA 3KJHA 1UEIA 3OE7A 2XNDA 3K1JA 4TMZA 1UPTA 1N3BA 3TQFA 2QM8A 3OEEA 3VNUA 2I4IA 3SNHA 1QHGA 3VR1A 5L3SA 3GJ8A 4OKSA 1KSGA 1HT1E 2R65A 4C0BA 4NONA 2QBYA 1ZCBA 3NHAA 5EP1A 1DG1G 4M4SA 4BQSA 3FOZA 3LBHA 1CR0A 4LC1A 2OO7A 3QVUA 4Q7MB 3SOPA 1J90A 3CR8A 4M9SA 4RD1A 3NKVA 2J1LA 2EWWA 2WBLC 3QKSB 1YE8A 4DDTA 4XD7A 1G9XA 1VIAA 1KY2A 2FZ4A 1OYYA 1OHHA 3KKOA 1W1WA 1T0HB 1TNDA 3CWZA 3DO6A 3FMPB 1P72A 3NHBA 3DEFA 3A1VA 4M21A 4WVFA 4GMDA 1HUQA 2OSBA 4HAWA 4PO8A 4UJ5A 3W9YA 4FI3C 3LXXA 3AH8A 1GRRA 4Z54A 1E0SA 5G40A 4TMKA 2GK7A 2JEOA 3KKPA 4DSNA 3OF5A 4Q1AA 1I2DA 3KZ1E 4PC6A 5FPHA 3QXHA 1KKLA 3ND9A 2DFLA 3GD7A 2JAQA 1N25A 5FPKA 1EFRA 1P4SA 2ZAMA 4HB2A 2YHSA 2J3EA 4KO8A 1EK0A 3W6PA 3IO3A 5E7IA 4A8JA 2BKUA 1GL6A 2BM0A 2J0QA 4GRAA 4MKGA 2W00A 2MSDB 4M9QA 1VMAA 5F3WB 4HLDA 4LHYA 3AVUA 5FTJA 1QG4A 3LQQA 4PANA 3P1JA 3RS2A 1S3SA 4LJ7A 2C2HA 3H1TA 3OAAD 2XGJA 1C1YA 4Z8XA 2FV8A 2Q21A 3QKUA 3VU9B 1E2JA 2ZSDA 1IBRA 2KE5A 1M6NA 1XBTA 2NIPA 5HZKA 2P0EA 4HUQB 2WWYA 2ZJ8A 4FMDB 3E1SA 3L0OA 4TYYA 2EFGA 3IHLA 3U44A 3FMIA 5KSYA 1NRJB 1ZP6A 4GFDA 4NYMQ 2QORA 3QXCA 3PJRA 1CJVC 4IDOA 2Q3MA 1SVOA 2OLKA 3CX7A 1RIFA 2H16A 2PLRA 2ZE7A 2ZYVX 4HYYA 1KK1A 5KDOA 4B73A 1DAFA 3Q9LA 1COWD 1XTSA 2A5DA 4IOMA 1OH7A 2HLDA 1YR7A 3N2IA 5DHFA 1GUAA 1I2MA 4LC0A 5HPYB 1OH6A 4JLAA 1G8HA 2P6RA 5IK2A 1ZM9A 1W2HA 4IVRA 5SZIA 1ONBA 4CEIA 2O8FB 4DEXA 1UKZA 1WRBA 2VTKA 3IILA 5ANRB 1CU1A 5F2EA 4CT4B 4D2IA 3PFIA 1S9HA 1YVDA 1TU4A 4JLJA 1XZQA 5FBWB 4QBIA 4EFNA 2OFOA 2FFAA 5DLQC 4BFXA 5JRJA 3THXA 4JVNA 3AGQA 1W44A 3LVQE 4OYHA 2R8RA 1T3SA 1XEXA 1T5LA 4IDNA 3ZD6A 1KDOA 1RC8A 6Q21A 3WHLA 1Z2AA 4GL2A 4ON9A 2RGBA 2QPAA 2ZUDA 4N0DA 4DDVA 4P4TA 1J8MF 2W58A 4OHVA 1G5PA 1TMKA 1MOZA 4JLDA 2C78A 2QY9A 1VG8A 4DT1B 4AIIA 5FOXA 3VR4A 2W2TA 3NBXX 1Q44A 4QJ4A 3GLFE 1E9BA 1XDBA 3QKRA 4GNKA 1P75A 5CK5A 3LX8A 2G9NA 4DVGA 4GDFA 2YVUA 2OILA 2JASA 3UWOA 2A5GA 3QVVA 3EW9A 3ZIAD 4A36A 2DPXA 4JBWA 4QNMA 3DMNA 1OB5A 3TW4A 1JEDA 2W6JD 5H8WA 4UNQA 1KSHA 4D0LB 2J7KA 4B3CA 3NDPA 2E1RA 1MR3F 5GJWC 1OIXA 4QGGA 2VF7A 3QF4A 4JLKA 2GILA 2ZI4A 1II8A 2V1XA 2OFXA 4EPRA 3AKYA 2ODEA 4KFTA 3ICEA 3KUDA 3NIBA 1T91A 2YINC 2EW1A 2GWHA 4KYUA 3PUXA 3FMOB 1P9WA 1ZD8A 3K0AB 1KGDA 1KJZA 2D7CA 3B1XA 4GOXA 4LHZA 1KO4A 1HA3A 2FEMA 4RJLA 1X6VA 5BXQC 4M1TA 3JVUA 2PT7A 4A8JC 3QNUA 4A82A 4AK9A 4F4JA 2QPOA 2BVNA 3L8ZA 1KAGA 2B6HA 2ZRLA 1IAQA 2ZETA 5B2ZA 3ZVNA 1B23P 1S8FA 4KAXA 4HZIA 2IWHA 3KKMA 1CXZA 3EPHA 4I4LA 1ZNYA 5FTNA 4IVPA 2ATXA 1G21E 1YR6A 4M2LA 3FKSA 2A30A 1XXHE 5EP3A 3X1ZA 4B3BA 2BCJQ 3W3AA 4B76A 8OHMA 2GBLA 4EPWA 2I1VB 4FMBB 2J41A 1J99A 2ODNA 3PV0A 4L15A 1YZNA 2EFEB 1QHIA 2FMXA 2XTMA 5CB8A 1F48A 4Q1DA 4JVLA 2G77B 1CBUA 3WXMA 1G1MA 4NH0A 2IS6A 4LV6A 1N5JA 4II7A 1I4DD 3VFDA 1P7CA 1IN7A 2C98A 1TUEA 3WRXC 5FOVA 3D3QA 2BBSA 4RKFA 2BOVA 1GNQA 4X8HA 4UXIA 2R9VA 2GCPA 4U5XA 4V0MA 3NC0C 1T4GA 2XJ9A 4L9WA 3AKDA 2WJYA 4KYIB 1E94E 4GPTA 5H1YA 1GFIA 3KQNA 2O8EB 1E9CA 1RYFA 3IQXA 3K9NA 3CIOA 1CRPA 3LBIA 3LY5A 3O47A 4TL8A 3CNLA 4AWXA 3CPHA 1G7SA 3H0KA 4LPKA 2ZREA 3GLHE 4P32A 1A2KC 4FD2A 5DE3A 2I3BA 3LD9A 4IVQA 4Q5IA 1H8ED 2PCLA 2W6IA 3EPKA 1KI2A 1L2TA 3L0SA 1JXOA 2ZXUA 1VDZA 5FBVB 2FDCA 2QU8A 4GOKA 4JS0A 1U99A 3L82B 3I5YA 3LH5A 1YJ5A 2CL0X 4JLPA 2QT0A 2JLUA 3ZLJA 1OSNA 1DE0A 2JLSA 2N42A 4DIDA 1ZJ6A 5DNYB 3QKSA 3MG9A 2DCUA 2C8VA 4DDWA 1ZCAA 4WIAA 3KXLA 1NMYA 2CHGA 3AQ4A 1E98A 3W6NA 3E5HA 4O3MA 1NIJA 2IF2A 4PX9A 3ZDQA 4PZZA 4MDEA 5FR2A 4I1VA 4I1OA 2R6GA 3TVDA 4Z51A 2CL6X 4CZ2A 1ZIOA 1ANKA 3A1TA 2QAGA 4CVNA 1EWRA 1XMJA 1OYWA 3Q7QA 4R98A 4PHFA 2ATVA 1Q3TA 3QI2A 1TU3A 2GJ9A 3GJ4A 1TF5A 3JZAA 4BFVA 2C04A 2CVHA 4JYCA 4RZ2A 1JPNA 3QPUA 4PSVA 1ZBDA 3O8BA 1JR3D 2GZDA 3VTKA 4HB0A 4US1R 2EU8A 1XZPA 1T0JB 2CCGA 1HY3A 1GVNB 4TLAA 2NZ8A 1KJWA 2MSCB 3HU3A 1UKYA 1Z29A 1D5CA 2GXSA 3LX5A 3W8RA 1OF1A 4AYXA 4ZDIA 1R0ZA 3SR0A 2CCJA 1G291 2P65A 1SXJB 3BAFA 2ERXA 2QI9C 3H86A 3ZZUA 1E9FA 4M8NE 4LCBA 4A2PA 5AUPB 5KSPA 4Q01A 4NCIA 4EPVA 1IY0A 4LYFA 3RAPR 5M04A 1DAGA 1KO7A 4NYJR 2WJJA 1Q0UA 5EE1A 4F92B 2A2ZA 4TT3A 2ZS9A 4Q4LA 5AJWA 2OG2A 2RGCA 1XMIA 2Z6VA 3DHWC 4JYBA 3WYFA 2HUPA 3MMPA 4LY6A 4YLGA 4JLNA 3AVVA 1E79A 3QPWA 1HH4A 4Q4HB 4HAZA 5E3HA 4JVSB 3OIUA 1ZINA 2WTUA 2YYZA 2FG5A 2GBLC 4AYTA 2HXSA 1Q21A 2JLXA 1Z6XA 3EWSA 2DWPA 2EFDB 1GRNA 2ZR9A 3KQKA 1J2JA 1W46A 2ANBA 1Y63A 2ZU0C 3EA5A 4LOAA 3TLXA 1KYIA 1X86B 4RD4A 4EAQA 3LBNA 5HCIA 2G83A 1D9ZA 1FTNA 1E4YA 3CWQA 1A7JA 1R7RA 1TEVA 5CM9C 2RCNA 3AVOA 3I32A 3LA6A 3PUVA 3AGPA 3LW7A 2O8FA 2C77A 4Q9IA 4PPFA 4IXNA 5K8UA 4PC3A 2J7PD 1KSJA 5GVRA 2IBMA 2JIZA 1E2EA 5J4VA 3QKTA 1ETUA 2H17A 1FQJA 1FNNA 1FX0B 5CYPA 3VR3A 2OM2A 1LNZA 3QUSA 4JJZA 3C5HA 2ZROA 1X1SA 3THOA 3UMFA 4DJTA 4ARZA 3WYAA 1QHHB 4RY2A 3VKHA 4MRNA 4LJAA 2JLWA 4XSGA 2GXAA 5DN6A 3GJXC 2XNSA 2IXEA 3AM1A 3F8TA 1NG1A 3SBEA 1N6IA 5F9FA 3K70B 1Y3AA 4FIDA 4MYUA 2NO0A 2JLZA 4GZMA 3AF3A 4BLQA 1ZUNB 3ADDA 1WF3A 3T34A 3MFYA 4D6PA 2KBFA 2XSZD 4JL6A 1KSFX 2FZLA 3J81k 2ZRDA 3KX2A 5B30A 3KJIA 821PA 3TUIC 2UVQA 2B7CA 2WZQA 4DLVA 1IHUA 1NVXQ 1OXTA 3G82C 3FPAA 1Z6AA 1BH2A 3RLFA 4BFWA 3GP8A 4AY2A 4Q4JA 1AGPA 2PLFA 1E4VA 3IDQA 1U0HC 2G88A 4Q21A 4XWAA 2Z4SA 4MGZR 2IS1A 2ZJ5A 4G01B 3OHMA 4DCNA 1Z3IX 1C9KA 1TTTA 1M7BA 5TY0A 4US2R 5JSZB 1ZAKA 2UZIR 3WRYC 5CIQA 5KDLA 1FPMA 4DCTA 2FPMA 4OK5A 1CJKC 3TVTA 1VECA 4TL9A 1W2GA 5G3ZA 4DLYA 1DG3A 2WMOB 4MQBA 4PQFA 1JJ7A 1CRQA 1WQ1R 3M6AA 2D2FA 3OE7D 2XNDD 4DLUA 2CJWA 3BORA 4IKEA 3ASZA 4G1UC 1G8FA 4D0GA 2F43B 1LV7A 1P9RA 4PSAA 2ZRAA 3OEED 4NCKA 4FWTA 2W83A 2ZUBA 3B7GA 1KDPA 3WMFA 1Z2CA 1OW3B 4DLTA 1G5TA 1Z0DA 3EZ7A 5IDVA 4LJ9A 3REGA 4RFSA 4YMSA 2XTZA 2VBCA 4C9BA 3THYB 2IXGA 1D8TA 2R6DA 3GJ7A 4M1YA 1NJGA 1KDTA 3EA0A 2EFHB 1VCNA 4LK2A 3VNVA 4QHSA 3RRYA 4B3XA 3U3OA 4PHHA 1S96A 4Q18A 4XD7D 2NOAA 2QRNA 4DSUA 4N3NA 3HR8A 3WP0A 3GLIE 2ZJOA 1OHHD 4U02A 4P3YA 5FTKA 3DM9B 2FN4A 3KTAB 2VSFA 3SJAA 5LDDC 4D81A 2BCGY 5GVSA 1N6PA 221PA 4IFEA 3EZ6A 2F3RA 1VHTA 3UXMA 1G8YA 4A2WA 3KQLA 1E9RA 1GKIA 2CLCX 3ZGXA 5FUYA 4PZYA 1P61B 3TW8B 2AWNA 2NO1A 1KI8A 1VYVA 3TR5A 4IEEA 3Q85A 3BRWD 2V4ZA 2Q9CA 3CF6R 3A6PC 4CW7A 5JZVA 3U4QA 4PAQA 4TTQA 4QXAA 1L7VC 4TQUS 4ABYA 4FCTA 1EFRD 5JI3E 2GXUA 4MH0R 5FI1B 2ZM5A 2CEAA 3BH6A 3X1WA 3IHWA 2AK2A 4HAVA 1KZGB 2HCBA 4MRVA 4H9GA 1SGWA 2XJ4A 3K0FB 1E96A 2IYSA 5TARA 4KITB 3LFUA 1XMSA 2VHQA 2V6IA 5EP2A 2BJVA 3B13B 1AJEA 4V0NA 4Q00A 4URZR 3I61A 3ZD7A 1NNEA 4URYR 1SVIA 4TMTA 3NEJA 1XRJA 2PL3A 2OEPA 3AKEA 4HB3A 4MUAA 4MGYR 3FMFA 1Q3HA 4P4UA 3P32A 4MRSA 5DYIA 3B85A 3BIFA 2AFIE 4BLOA 1X3SA 4WA7A 3LLMA 5EE9A 4QJ5A 3OIYA 1P3JA 3TH5A 2IYQA 5L8VA 4A1FA 4HAUA 4C7OB 3FVQA 1DO2A 2Q6TA 4MUBA 2R6CA 4M1OA 2X2FA 3T35A 5DH9A 4US0R 2R6FA 1NVVQ 2C9OA 3PEUA 2CL7X 2GKSA 3RC3A 4KJZA 1S0UA 4D82A 4ZI3A 5JS8A 1PLLA 4PC2A 2O8BB 3NEYA 4WOPA 2HLDD 1RRGA 1XD2B 1AIPA 3SU8A 2IYRA 4LJ4A 2QE7A 4TLDA 1KMHB 3Q72A 4YMUA 2VSXA 5IK2D 2ZRCA 1N0WA 3HR7A 1K8RA 1XEFA 3QJYA 2ASEA 3FKQA 1ZU5A 2OCYC 2ZI5A 2J0SA 3RANA 2PX3A 5EXPA 3QIAA 4EJSB 2P2LA 2ZRBA 1AKEA 1Z08A 2HCJB 3BK7A 4LBZA 4PZLA 1MABB 1M2OB 4R71A 1L4YA 3BB3A 4XTCS 2JDIA 2O5VA 4YDSA 2ERYA 3JZMA 4P4SB 4BUJA 2X8AA 1S1MA 2H18A 3H2YA 4Q4HA 2OUKA 3T06B 3AF1A 1O87A 4QBHA 1ZM3A 4CRWB 1J8YF 4GMXA 2WIAA 3SS8A 5EE5B 521PA 3RS5A 2UKDA 2V3CC 3BGWA 1KMQA 4B3FX 2ZSAA 4KVAA 2MMCA 4LI0A 1NMXA 4URUR 4JSYA 3QEOA 1EFCA 2ZEJA 4A15A 1NI3A 2WVJA 4A4DA 4Q48A 1VTKA 3D6TB 2F1IA 3LDAA 2OAQ1 1SVMA 3SFZA 3F5FA 4HDCA 1XCMA 4DIEA 1QHXA 2XAUA 3B9QA 2O8DB 2E9SA 2OESA 4MGKR 4ILEA 3U3RA 3AVQA 3ADCA 1CJMA 1DAMA 1NN0A 1X8LA 5IHPA 4DUGA 2YKGA 1KHTA 1E6CA 4OI2A 3QENA 2CCKA 3QY0A 5B58C 2ZJ2A 4OI1A 4D4JA 1G17A 3PENA 2HT1A 1DARA 1GRQA 4O2RA 4W5WA 3EZFA 2ZANA 3I62A 1PLJA 5DI3A 3CRVA 4PAOA 4Q4AA 3RS4A 2O8CB 2O52A 2VEDA 2QTHA 4RZ3A 1R0YA 2CE2X 1XXHA 1Z28A 2JJ1A 2WWWA 4GZLA 4UNPA 2C96A 3DOFA 4XVUA 3VR6A 4ESVA 1P5ZB 4O2LA 1ZM7A 4C0KA 1EWQA 3K09A 1LFDB 4B6EA 1FMLA 3GLIB 1X8KA 1F5NA 2P3SA 1XJQA 4CYMA 3BFVA 4L16A 3FKSD 3KJGA 2IEYA 1XNJA 1ZC3A 2KWIA 2O0JA 1QG2A 4NU0A 4YXWA 4FN5A 2A5JA 2ZE5A 1JPJA 1R10A 3B9PA 5HE8A 4RSGA 1US8B 3ZQ6A 2DR3A 1WDTA 1UKEA 1A2BA 1G3MA 1R0WA 2GCNA 2PZFA 3GEEA 1II9A 2IT1A 3WYGA 3SZRA 1E2IA 4W5HA 3DZ8A 5FUWA 1RJ9A 1PVOA 2ZSEA 1DTSA 4R7ZA 3BERA 3H84A 3CW2A 1R5NA 4AURA 3CNNA 2EQBA 3NXSA 5KNBA 3NVAA 3AVTA 2QAJA 1EX6A 1G41A 3FWYA 3GLHA 1VCMA 4Q9JA 5JS7A 1RZ3A 1C4OA 2OBMA 2ZVPX 2W2VA 3THWB 4BGDA 4LUCA 1EFUA 4R9UC 2J46A 1MT0A 1GNRA 5D3MA 1JBKA 5EE3A 3RSLA 4PHGA 2W6ID 1FFHA 4OJKA 3UWKA 1E2GA 3BH0A 3U7EB 2A5FA 4WXRA 2FJUA 4OHXA 5AWFC 2BM1A 2WM9B 5JRZA 2OBNA 2PJRA 3CUEF 4MYCA 2FE4A 4BLPA 3N2EA 3FFAA 2NPFA 1ESNA 3MWJA 2J5XA 3NBYC 4JJKA 1T8TA 2EYUA 2NG1A 3AUXA 5KU1A 3SE0A 1ZD9A 1E0AA 3KQHA 1EFHA 3LXRA 3CNOA 3BB4A 4G5RA 1M74A 4TWZA 2IA5A 5A4JA 3P4YA 2ZI7A 3ICQB 4LRWA 5J4HA 3A1SA 2GF0A 1P2TA 4C0AC 1F3OA 4B34A 3DZDA 1TUIA 1EFTA 1R6BX 4EKDA 4Q9HA 4LYAA 4Q7JB 1OJLA 4G5GA 2FPLA 3V4RA 2VHUA 4K8OA 1HURA 4QOSA 1OXSC 1SXJE 4HAXA 3T5DA 1YZQA 2ZRNA 2QEQA 1OFHA 2OV2A 3LLUA 121PA 2AXPA 4HSEA 2B7BA 3VR2A 1KI9A 1DEKA 2RGNC 2GVZC 2V7QA 4GOJA 3UG6A 5KNDA 3AKCA 1M34E 1JJVA 2VA8A 2BIFA 4JMPA 4RZXA 5HKKA 2R6AA 3GMTA 2IWRA 3CKLA 4G3XA 4Q19A 1KI1A 2QP3A 3MSXA 2FOLA 1GL7A 2F1HA 3QQ5A 1I4LD 1N6LA 5KSZA 2CNWA 2IS4A 4TSFA 3R9XA 1G20E 2BEJA 5FL7A 2GAOA 4M0LA 3AVXA 1SVSA 4LX0A 3ZZTA 4YMTA 1XTRA 5EZ5A 2X1VA 2W2XA 1ZIPA 2B21A 4DBLC 2GRJA 2JLYA 4ZI2A 2HJGA 1G4UR 4U7DA 1TL7C 2ODBA 2FH5B 2ZTSA 1K5DA 2ZYWX 4OK3A 4TT3D 3MWYW 4PO9A 4C0SA 3QXJA 5L3QB 1T9HA 2XXAB 4OQLA 2P67A 4L9SA 1F2UA 1E79D 2OAP1 3M0EA 1W36B 2EYQA 2GK6A 3K09C 1JALA 3BD9A 3KKNA 4NBSA 2QENA 3CONA 1FOEB 2ZRKA 3EIHA 4IOLA 3OEHA 2WJGA 3Q5DA 1HE1C 4XVRA 4Q03A 3AUYA 3WP1B 1ZUHA 4LJ6A 2G3YA 2VO1A 3CX8A 4L8GA 5JLJA 2YWFA 1Z0IA 2AWOA 4C0HA 1Z0KA 3X1XA 2G0TA 1WP9A 1U81A 1Q1BA 3EPLA 4F7WA 4JT4A 4M1SA 4M9XA 2ZI9A 5E7JA 1OFUX 4KV9A 4Q1CA 1KMHA 5JWOA 3EXAA 1ZW6A 1GNPA 3K8YA 2QMHA 1XPUA 1G3QA 2QPTA 4OHZA 2VHCA 2BBOA 1KO1A 1R0XA 3FB4A 2V55B 4PFSA 4O25A 5HCNA 3VX3A 2JIZD 1X8JA 2GZAA 3OZXA 3P20A 1VYUA 2GTPA 4UQOA 3GLGB 1XTQA 3IGFA 5DO9A 2BHRA 5JMTA 4CT5A 1AS3A 1N5LA 1YZGA 2FSHA 1W0KA 1N0UA 4PO1A 4POAA 5KUTA 4TMVA 2FFQA 4CIDA 3PQCA 5DN6D 4NE2A 4ZKDA 3AP2A 1U9IA 4GSYA 5EQTA 3BC1A 1G6HA 4QKQA 3LAWA 4QNRA 1OH5A 4TMXA 4BLTA 4XWKA 4X8LA 4C0QC 4PR0A 2B92A 3B78A 1P9NA 2QM7A 1KNQA 3CM0A 1F2TA 5LBIA 2R44A 4TYNA 3BH7A 3WNDA 4G5OA 4TN1A 1NIPA 3A36A 5CITA 2QMUA 4HZUB 5K8IA 4QL3A 4C2TA 1E9DA 1XCPA 1UBCA 1NKTA 2ORVA 3X2SA 2IXFA 3PEWA 4UXHA 1MO5A 2GAAA 1I4TD 2GF9A 3E2IA 4QGAA 2ODWA 2RB4A 4FCVA 3PCRB 4A6XA 1AGRA 1QBKC 4OI4A 2MMGA 4MDFA 2IF0A 4CGZA 3EG5A 5TV2A 4D80A 4E07A 1WE2A 3CPEA 2PT5A 4ACBA 4IXMA 5KYKA 4HDOB 4QM6A 4FXPA 5FOTA 4LV8B 1G3IA 1NLYA 2IYWA 4XH9B 2ZE8A 1GSIA 1AS0A 3MJRA 5KSOA 4OQFA 3V4FA 4DCUA 2O8CA 2VL7A 1N6KA 2FNAA 3I5XA 3A1UA 1AN0A 4EQ6B 3OFNA 1ZUIA 2EVWX 1Z8FA 1MRSA 1RVDA 2WSSA 1OKKA 1EXMA 2Q9BA 2QA5A 3HPQA 5FPSA 2ZR7A 1N5IA 4L4UA 2YJTD 2ZAOA 4D4MA 5KPDA 4QBGB 3CRQA 1CLUA 2V1UA 1Z6YA 1JI0A 2CE7A 3BBPA 2P6UA 5AR1A 3GLIA 3IPYA 3BS4A 4OK6A 5CM8B 3RRNA 4UNRA 3X1DA 2VLIA 2GESA 2QMOA 2QN6A 2R62A 4JL5A 2ONKA 3KXKA 2F7SA 4A92A 2YOFA 2PH1A 2J9RA 2Y8EA 4FINA 1SVLA 1FZQA 5FR1A 1D2EA 1US8A 3CRMA 1FW6A 2W0MA 5EJEA 3QBVA 3VHXA 4PC7A 3T1QA 1QVRA 4DLRA 1E9AA 3A4LA 3TR0A 1MV5A 2G6BA 2IYLD 1CF4A 1NMZA 2HF8A 1MO6A 2LKDA 3QE0A 2D62A 2WICA 2VPPA 3EC1A 1GM5A 1ZMXA 2ZJYA 1VG0B 4LHXA 4AKIA 1MO3A 2QGZA 2ZRHA 3TBKA 2ZR0A 3GQBA 3HYRA 5JHHB 5EUQB 1BS1A 1T3HA 5FL3A 1AZSC 3VU9A 2ZRGA 1R8SA 3OESA 3RWOA 2X77A 5JCZA 2FF7A 4YMVA 3SFVA 4HUQA 3C8UA 4R2HA 1E1QA 1P73A 2VP2A 3PR1A 4BRUA 4NYMR 1LS1A 2ZITA 1WBBA 1W47A 2OT3B 2Q3FA 4K46A 1G64A 4EUNA 2JJ2A 1QDEA 2J0VA 2WWGA 4JSTA 4EFLA 2HYDA 3U6BA 2FEOA 2JJ8A 2V6JA 2BBWA 1YR8A 4ZDKA 5LPNA 2HT6A 4CDGA 2LCFA 5CJ2A 4F38A 4PC1A 5TVKA 3B8HA 4ZIRB 4DHEA 1CR4A 2ZS8A 3OIWA 2GETA 4BZXA 2D74A 4LGMA 4P33A 1Q57A 4V02A 3PG5A 1U9IC 5EXTA 1UM8A 1SKYB 3U61B 1IXZA 2ZJAA 3ADBA 1IY1A 4YONB 1Z0JA 2AKYA 3CZQA 4PTLA 3VAAA 1U8YA 5E4FA 4LYHA 2YV5A 2RGEA 1HEIA 2J87A 5KNCA 1R5OA 3RNLA 4EIWA 2DWQA 3TSZA 2QQ0A 4KHZA 3B1VA 1U8AA 2ZRFA 1VKJA 4DSTA 3I8XA 3NG1A 1GL9B 4RFVA 2CHVA 4F93B 5L3SB 4NDZA 5FBLB 5JEDA 3U7FB 2PCJA 2N46A 3PEVA 5EXXA 3UMSA 4DT1A 5HZHA 2QBYB 2WAXA 3NBZC 2BWJA 3SDZA 5F98A 2QE7D 2GA8A 1YZTA 2SHKA 3FFBA 2OCAA 4BFTA 4WZAE 1R4AA 2FX3A 1DBSA 2WJHA 3CRRA 4MKIA 1KDRA 1GOTA 4DLSA 3TUJC 2FGJA 1Z5ZA 2ZE6A 1BYIA 2BV3A 4IRUB 1JQJC 3CBQA 3TAHA 2ZU6A 1GDDA 3NH6A 4BLRA 3AP3A 1FMJA 2OXRA 2HV8A 5AJYA 2FSGA 1XCGB 4JIMA 3RDPA 1LF0A 4GT1A 1EGAA 2GDJA 5L3QA 2XXAA 3K9HA 2JDID 2XOKA 1NSFA 5FTMA 3V9PA 1OXXK 1CS4C 4KFSA 3PEYA 1NBMA 3RC8A 4EPTA 2AX4A 4HLQB 2ECKA 2C5LA 3T12A 4A2QA 4WZBE 1UAAA 1IXSB 2OHFA 3O8RA 2AXNA 1S1CA 4MKFA 1VG1A 3UKDA 5K8TA 2O0HA 2PJZA 1UFQA 3JVVA 5JI2E 4JL8A 3VMFA 3K0AA 5CB6A 3B1ZA 1S9DA 1IJEA 3BJIC 3W90A 1W4BA 4ZPXA 1GKUB 2XX3A 4AI6A 1II0A 3CLVA 2IUUA 4UKDA 1R5BA 4Z1MA 4BZPA 4DXAA 3N5CA 4HI0E 5JFGA 1FTSA 1Z0FA 4C4PA 4HUTA 2REOA 1MRNA 1VYTA 4OL0A 3Q7PA 5LD2B 4X8MA 3QPVA 2JGNA 2VQSA 4DUGD 2DFTA 4HAYA 2GHIA 4HLCA 2XZOA 4ZO4A 1FQKA 1N2CE 2XB2A 1G16A 4Q9LA 4IDHA 4ASUA 4WBSA 1UF9A 3VQTA 4YMWA 3U44B 3WMGA 3B5JA 3RSOA 1G4AE 4IFBA 1DPFA 4NTZA 1WBDA 3A4MA 1BIFA 4AKHA 3KL4A 4RD0A 3IBGA 1Z63A 3U6KA 1CTQA 5JJKA 1BO6A 2JJ1D 3A58B 5EZ6B 3TAUA 5GJCA 3PVSA 3B1WA 4TTPA 4FW9A 3SYNA 3F3YA 4KCGA 4BRWA 1BYUA 4RVCA 2AL7A 3LVRE 3SYKA 2H5EA 1UJ2A 1N5KA 3RRZA 1GIAA 2O8EA 1E2MA 1Z83A 3KB1A 4YXWD 3R9WA 1E2DA 1ZNXA 4NCNA 4QJ3A 2Z83A 4DDUA 4CEIB 1M7GA 4KLZA 2VP0A 3QXSA 3BFXA 2WPDA 1TADA 3C5CA 5SZHB 1XJCA 4BFZA 1TEXA 3C41J 1IONA 3VR5A 1JECA 1JNYA 1P60A 3WMEA 4DSOA 4URXR 4DCSA 3E70C 3W8NA 1OFTA 1KIMA 4F4IA 1NN1A 1ZM4A 1KKMA 2RMKA 5BN4A 3ZQJA 1FL9A 2BKEA 4TQ9A 4UNSA 1VIYA 2IYTA 5CIWA 3M1IA 1N0VC 4MYTA 3AB3A 4GP7A 4EQ6A 2OZEA 1E0JA 2A3RA 4EPXA 1W0JA 4TLBA 3KJEA 3FE2A 2F9MA 1E2FA 4Q02A 3I3SR 2ZRJA 5FBRB 3A4NA 5BYKA 4M1MA 4CEHB 1KK0A 2NTYC 1KY3A 2VHJA 3WBKA 3NDBB 1TPZA 5B64A 5AJXA 1N6OA 1BMFA 2ZQ5A 4EDHA 2OCPA 1J7KA 3HYTA 4HB4A 3PUZA 4B2LA 3I8SA 3CB4A 4RKEA 4F4CA 1CKEA 3W6OA 4YQFA 2QSZA 3MWKA 2GJ8A 3RS0A 3QF4B 5A5GA 4N0EA 3C4JA 4A0FA 1II8B 2X19A 4TLEA 1W36C 3CRW1 4ZCIA 4TL6A 2WSMA 5FFMA 1QHYA 5FUVA 4DB2A 2BBTA 3SJZA 1SXJA 3MGCA 3P26A 5AJZA 5CLQA 4ZCMA 1E2LA 1N6NA 2AR7A 4QC2A 4G5SA 1KZ7B 2Q3HA 2XITA 2YOHA 2ZI6A 4QG7A 5F9HA 4KU4A 4E22A 3TNFA 3ZVMA 1EESA 4A9AA 4H1UA 2XZLA 1W49A 1T5IA 1W4AA 2P5SA 4MRRA 1OPXA 1IQPA 4KBFA 1NN3A 1KNXA 2C9CA 5JECA 1AZTA 2IEZA 1W48A 2V7QD 2VSOA 1DS6A 1TF7A 3HJNA 4QBFA 5AK0A 2BC9A 4UJ3A 3R9IA 1U2RA 5HKKD 3AV0B 3IEUA 2JLRA 1SQ5A 4NCJA 4IJMA 4TYPA 4I1UA 4WXPA 3W5IA 3IQWA 2CNWD 4TSFD 3TSOA 2OLJA 1IY2A 1G18A 5FL7D 3SI7A 3CX6A 3CF2A 2HEIA 2WWXA 1GWNA 2WAYA 1LTQA 4OQNA 4C2UA 2VRWA 4JKIA 4BWYA 1NBME 3SQWA 2DWOA 4KXFB 2WKRA 3B60A 5SZJA 2GCOB 3HPRA 3W5JA 4XSHA 5JBQA 2HDNB 1CP2A 5B57C 3KQUA 3EAQA 3EIQA 2O0KA 3A8TA 2WHXA 1W4RA 1HYQA 2DFNA 2YOGA 4C0JA 4MYHA 2XEXA 1ZD1A 2H92A 1WA5A 4OI0A 2RGNA 2RKOA 1PJRA 2F1RA 4LJYA 3IIMA 1G3UA 3A1WA 4OQMA 3B2EA 5BN5A 1EX7A 2WV9A 4D4KA 1Z0AA 3OEHD 5J5CA 5SZKB 4B6FA 1FX0A 4XWOA 3CPJB 3DKVA 4D26A 1P2VA 5FOSA 1ZYUA 2Z43A 4V0LA 1NKSA 4BECA 1NVWQ 1J70A 1QHSA 1YZLA 1HQCA 2F3TA 2VP9A 1QHHA 3B1YA 3K9LA 3MRSA 3T1VA 2QP9X 3VX4A 5ELXA 2V54A 1HTWA 4A6PA 5HR5A 4A0HA 1RFLA 3GLGE 1DAEA 1EG7A 1XWIA 2Z0MA 4Q1BA 5C4GB 1D2MA 1CJTC 2A5YB 1DAKA 2IYVA 4G5QA 3SN6A 3R8FA 4GBMA 3I72A 1T3LA 4N1AA 3MWLA 4H1VA 1CEEA 3P4XA 3QBTA 1CR1A 5C2JB 1IOZA 4QRHA 3EZ9A 2IS2A 1BKDR 4JBXA 4IDQA 1X1RA 3TUZC 1IN4A 3UMRA 1K6MA 1KO5A 2WOOA 1GZSA 2CBZA 2IUSA 1Q22A 2REBA 3N70A 4RD6A 1K5GA 1R8QA 3KFVA 1JR3E 1W0KD 1WXQA 1XTIA 3ADKA 5J4YA 421PA 1D9XA 1CULC 2QQEA 1E1RA 2FSIA 3CH4B 3GEIA 4KSBA 2QAGB 1G7CA 1NLFA 5FI0B 4HLUA 5JSZA 4IOKA 2ORWA 2CHQA 4Q66C 5FPYA 3U3JA 2R2AA 1M1YE 4ESHA 4KSCA 4YDHB 3VKWA 3IKJA 3QXXA 3BE4A 3WY9A 2WOJA 3CF0A 3GFOA 1ODFA 1U8ZA 2FPKA 4XTRA 4AYWA 4BFUA 4JKYA 4B75A 4QHYA 3TMKA 3GJ5A 1A5TA 2D4HA 4IDPA 2IW3A 3MAAC 2PMKA 3UK6A 3QG1A 2F43A 1G7RA 3LRPA 1JXMA 1SXJC 4PHTA 1U90A 3GFTA 4B44A 2NGRA 5E95A 1D6JA 3WNCA 2HJVA 4AKEA 4LBWA 3K0CA 4V0KA 4UNNA 4CF7A 4DB4A 1RRCA 2ZI3A 3D7MA 3VKGA 3ASYA 5FOUA 4BEJA 5JWHA 4F91B 3THYA 2OCBA 1XJ0A 1ZVQA 2H1LA 1F6BA 1ZRHA 1PUJA 1TF2A 1XTJA 3R20A 4Q1FA 3MJHA 4LHWA 3C14C 4NYJQ 5CYOA 3RS7A 3T15A 1UEJA 2CK3A 3QEJA 3QF7A 2FU5C 3OIVA 1CR2A 3L0PA 2KBEA 4BFSA 2BMJA 1RRPA 4I81A 3M4YA 1XEWY 2IL1A 4JT2A 1QVAA 3SHWA 2QUZA 5HTKA 5FH9A 3OFND 2YNMA 3KTAA 3QOFA 1ZM2A 5G3YA 2GEUA 3DOEA 1AA9A 2WSSD 4RD2A 1PUIA 1OKKD 3DDCA 2OBLA 4XOIA 3ETLA 1JAIA 4B74A 3CH5A 3GJ0A 1U0JA 3GFPA 4K81B 3UG7A 1NN5A 3ECCA 3K9GA 3ZVRA 1G8PA 2F1JA 1FUKA 5DGXA 3PUWA 2JCSA 4L5BA 3DPUA 1SZPA 2IHBA 4D25A 3SC3A 4DRZA 3EZ2A 1N6HA 3FHCB 2GJKA 4DKXA 2EWVA 4LHVA 3MUFA 3AVPA 2ZS7A 1AS2A 4M1WA 4DLXA 1SKQA 3EWAA 1VCIA 3WNBA 4CEJB 2RH5A 2Z4RA 1QZXA 1IN6A 2REXB 3HDTA 3LWNA 3K0FA 1E2HA 1ZU4A
chains in the Genus database with same CATH superfamily
1AF7A 4ICIA 2J59A 5IUNC 3SE7A 4R3WA 3ZLUA 4EHHA 3ZY5A 2EBWA 2AFHA 2W2OA 1CE8A 3HRIA 4H31A 4MUKA 4B3HA 2BR4A 1GKYA 1OE0A 1HQYE 1TM2A 1Y7PA 2LWIA 3SQMA 4X3PA 4LZZA 4AM8A 4MVJI 2ZPTX 2IHYA 3KDSE 4G24A 4LX8A 5AFSA 3ZW8A 4AG3A 5A04A 5CDFE 3P7MA 1LRLA 4YCNA 5JS1A 3E8MA 3JQ6A 4BL5A 2VJOA 3F6YA 1OA0A 2OWEA 5CA0B 1FP6A 4PPNA 2G06A 4O2AF 1Q74A 1UMBA 1NAIA 1N6RA 1PVVA 3IQHX 3DT6A 4MUEA 4EKGA 3IJEB 5HF6A 2FEPA 4J16C 4C7OA 4ERXA 5DV9A 5J4LA 4YCMA 1Q1ZA 5GM1A 3A2KA 2GLUA 3MYYA 4JLMA 4DR3B 1ZN9A 2C31A 2ZJ4A 1OWMA 2HD4A 2OC4A 4LMBA 5BW5A 2JIDA 2PPLA 3TFWA 5K4GA 3PIRA 2UZ3A 4HVCA 5IAAA 1ONOA 4Q4JB 5K0ZA 2M6LA 2JHGA 3IAM1 3IDSA 4B43A 1T3ZA 3BHNA 4RBNA 2GKGA 3EGWA 1OXUA 2WJVA 1CUFA 1LLFA 1W9MA 4R8SA 4RD3A 4RZUA 1E20A 4DCNA 1LDNA 2O8BA 1VPLA 3ZKAA 2IELA 4JI4B 2JFNA 1XPJA 1KBZA 1OY1A 3IB3A 1M2NA 1TQDA 3HV2A 5TQ2B 4E03A 5GADl 3V4ZA 3EBLA 1Y4SA 4YY3B 3CZPA 4KPFC 1P17A 4MA4A 1NVGA 2AD1A 4YC7A 1C7QA 1K89A 3LW8A 4IW3B 5JD4A 2W7TA 1ZA1A 3BSFA 3U7GA 1X7XB 2ZYUX 5DGCA 2O57A 4NBUA 3IIKA 2XUKA 2Z5FA 3AI7A 4RENA 3P27A 4KBYA 3CZ4A 1ZCFA 1UC5B 1TO1E 3CE9A 3V1NA 2Q4OA 3I04A 3R7WB 1XKTA 4EUFA 1C3OB 2IH4A 1FNBA 3KOWA 3A6JA 4WZAA 2O0LA 1BZYA 3BWVA 4QXQA 4DCMA 5A5EA 3DV0A 3TKYA 4CU5A 1QC5A 4N5MA 5MN4A 5K51A 3K0CC 3RRMA 4ZK2A 1THTA 2EATA 4HH4A 5EUBA 3BM5A 3I4LA 3ZU6A 1Q1QA 1UQRA 2OVFA 4PXAA 1E8NA 1PW7A 1WEKA 5CVVA 5JE8A 3KQVA 1LDGA 3IXLA 3KTDA 4LGYA 5DIFA 1PR0A 1K5HA 1R5JA 2G9RA 3OZCA 4G5FA 4I5DA 3OLXA 3QE4A 3DP9A 5IARA 4QGSA 5BW4A 2VEOA 2B25A 2VUHB 4UUMA 3E03A 1H6DA 3OCXA 1Z7EA 4HSGA 4YWHA 5KOIA 4Y6PA 2WKPA 1NLZA 1Z3CA 3LT0A 2OA0A 4Y0AA 5DGHA 2GBGA 2DBYA 3SVZA 2GCOA 4Y8VA 5BNWA 4TWRA 2B0CA 3UFXA 1U7DA 1TMOA 4MR9B 3CN9A 3MT7A 1SC6A 4WZBA 5LUAA 4QOIA 3LYAA 2SKCA 3CW8X 1E3IA 3UV6A 1M1YB 2PE5A 1W34A 1NRXA 4U9UA 4YB8A 1JKJB 1XO1A 1E2KA 2VTDA 4IY1A 5LZ2A 2XUDA 4MR7B 3S7TA 4FEAA 4JENA 4RAQA 4YRAA 2C2MA 1FDVA 5EQJB 1GCGA 4JYPA 4QASA 3S1AB 3M9WA 1NHGA 3FX2A 2FPXA 2KB0A 1YVUA 2DSNA 4L27A 3HSSA 3JU3A 3G85A 1ZRMA 2R66A 1FTQA 2QQGA 5CURA 4WKCA 1C1XA 2X4GA 4I9HA 4E09A 1Z6GA 3PKJA 3CWCA 3ER6A 4INJA 4K3VA 4TQAA 2A0KA 1JA1A 3WGTA 2WKQA 3D64A 4Q7LA 1HE8B 2GTIA 4TL7A 1BKYA 2PGLA 4KI0A 3DAYA 1W19A 1CJUC 3GEPA 1KC3A 1VKOA 1TJ3A 5UKDA 2PGXA 2HWUA 3GDHA 4K5QA 1YQTA 1D0IA 4XCVA 4D9NA 5I4BA 3F0TA 3AR6A 2PD3A 3MC1A 3NJRA 2VYQA 3HWSA 3DFZA 4G86A 2Y1FA 1DQRA 3EARA 3C8HA 4JC5A 3A10A 4QQKA 1W5TA 2YWJA 2GEVA 2UVPB 1Z4OA 1COWA 1PRYA 1IUKA 2CNDA 4OJTA 2AQ8A 3VH4A 5CLGA 4E7PA 3ZTTA 2GJ4A 3U5ZB 3ON5A 4ASUD 3ASUA 5JDCA 3EPJA 3FPKA 3AHGA 1A9XA 3BRCA 4DRXA 1SVKA 3WMWA 4BBPA 1XU9A 2PA0A 2FKNA 2R0QC 4L5IA 3ZJYA 2UUBB 1IJFA 1SXIA 1XUOA 1VOTA 1YULA 1T4CA 3AU9A 5GJBA 4YUVA 1GQFA 3E1KA 1ZJYA 1GPMA 2PSHA 2QVCA 3EXHA 3GJ3A 3GJ6A 3KZKA 1F1JA 3A7EA 3RE1A 3VGJA 2HBZA 2ZOSA 3A0RB 4OHMA 1UJNA 3S2SA 4KV7A 1OVMA 3VR0A 2PV0A 2ADFA 3AVYA 1IBLB 4H3KB 3WL8A 5LU9A 4AMBA 1W9HA 1L9XA 4QM7A 1WW3A 2DKOA 4TUYA 4M9ZA 2ZIAA 3DBIA 3CZ5A 5I9LA 3HL4A 4FYYA 3OA0A 4LK3A 5GJVC 3GC6A 3S44A 2AOUA 3PUYA 4PZUA 3AJAA 4I9FA 2QL7A 1D7AA 4OUKX 3C7DB 3DKPA 4WW0A 1NNI1 3RKSA 5AVSA 1TQ6A 1HETA 1UBGA 3A6FA 3P9KA 4HN2A 4JGBA 4W9MC 1CYEA 3IERA 1RXYA 3IMEA 5B1SA 4CMJA 3CB2A 3N2KA 2EFYA 1GPUA 2YWGA 1RJWA 2CFIA 2IDZA 2JKVA 2Q3BA 3RAFC 4BPBA 3WGZA 4I8XA 2RFLA 2CZGA 1E8MA 3G17A 4P2BA 5TQ0A 5CVTA 3CZ9A 4PN7A 2DUMA 2F55A 3BMQB 2XMRA 4MWZA 1V45E 3J7TA 3GCGA 3GQVA 1HG1A 2O1EA 3FIJA 5E1MA 1PX0A 4Y9UA 5I7AA 4DXHA 4EM6A 4HNQA 2Z6UA 2BJHA 5F73A 5DOZA 1JHOA 2LKCA 4JLOA 3V2IA 3D4OA 1PEDA 1P2UA 2EX1A 2Y6UA 2QLTA 3Q4GA 2VWHA 3RSQA 1G7TA 3TE6A 3HCAA 2WJIA 4FQ8A 4IL5A 4F5YA 2DB3A 3G3EA 3HM2A 3PRJA 1W0JD 2H0QA 1Y8ZA 4J94A 2Q1UA 4HVLA 1T0BA 1IZYA 1X1CA 2BFFA 3IQIX 4KQ2A 1XRSB 2I5PO 1R8XA 1NV9A 3PQDA 5GWXA 2IYNA 2RH8A 4B79A 2A78A 5JJBA 1DCKA 3QA9A 4RIHA 5LN1A 2A8YA 4C78A 1L7NA 3HU2A 4L22A 3MOGA 4QYTA 1TD1A 5IF9A 1RVV1 1V7PC 4JNCA 1YBMA 1NVUQ 1PT8A 1OBVA 2P4HX 1ZNZA 3HP7A 1PAUA 1OTXA 5ETJA 5LBUA 4TZ0A 1NASA 3ND8A 5JH7B 4FIZA 4OB7A 1VL6A 2ZSIA 3VNQA 2EKLA 3LS2A 1F51E 4GM1A 4RQBA 1QYRA 3I1FA 2I91A 5F1KA 4OLJA 1NZFA 3H2ZA 4CEJA 2I7DA 4V3CA 4JEUA 4BB6A 4BMPB 2YDYA 3NTUA 1PGJA 4B3DA 2C7PA 1HNWB 3HKEA 4XQEA 3R0ZA 1UFOA 1TFUA 1DELA 3PQ8A 5K0JA 2PXCA 2VDVE 5DCLA 3KYIB 3RYIA 2JJYA 1MO2A 2XZPA 3DCYA 3L0DA 5LLTA 4YJ3F 4A8TA 1XDSA 2J85A 4NK5A 3RJMA 3EEOA 1U1IA 1SR8A 2BGLA 3AF4A 2DRIA 3AI1A 1EDZA 1RM0A 1G21B 3JQAD 2VPWA 5L51A 1BCRB 4PGGA 4X90A 3ROZA 1DQNA 1P6XA 2KS6A 1NPDA 4MPDA 1L4FA 4ZV7A 3OZTA 5AW0A 4C4SA 1TX4B 3IUYA 3P52A 3HL0A 4KMSA 1SXHA 4MHOA 1N1DA 2RHDA 2OB1A 4C0LA 4NLLA 1IULA 2D06A 5BN3A 4LDPA 5H4HA 4JB0A 5MFPA 1TA0A 2O3JA 4NYIR 4B32A 4KH1A 5G4KB 3T3PB 1BFUA 1SG0A 2VVTA 5E38A 4QAQA 3FSJX 2IZZA 3O73A 4II3A 4X61A 4ZV4A 1OT3A 2CL5A 2F2TA 4BVKA 1TFRA 1GTSA 2IXTA 4KO4S 1PUXA 2C03A 3GEHA 1HSZA 2FA9A 4HBZA 4V0ME 5AYVA 1VRWA 2VDNB 4B2PA 4C6TB 2QTFA 5LCXA 2ZIXA 2ZSFA 3FOCA 3UK2A 5DHAA 1H8EA 3U16A 2PWYA 3K73O 4TWIA 4UEKA 1THZA 1V9CA 4Q3OA 5FB3A 2W22A 1RJ9B 1UBFA 4P5EA 1NJ6A 1LS6A 1ECCA 3GRRA 2VF2A 4YCJA 5ALPA 3QKWA 4GIBA 1C7JA 4W7SA 4AG5A 4ZREA 4G0PA 5CFQA 3QE2A 1GL3A 3GJZA 4ZVOA 4M83A 5I8ZA 1FP1D 4ZP1A 1T6XA 4Z7OB 1WCWA 3WO1A 3IPAA 4MPTA 4CMAA 2BFEA 2R4TA 3OH8A 4ACAA 3PA6A 1F9EA 2NU7A 2D5BA 3H1GA 4G1MB 4GMHA 4QGFA 5DW3A 2OK7A 3KAQA 1PGPA 3C3KA 2VP4A 3DDHA 1ZIXA 2HQ1A 2ONYA 5J43A 3DULA 2EOAA 4BX2A 1MX1A 3KPWA 3CJRA 4H15A 3GAFA 5AVXA 1XU7A 1P1RA 3ZHZA 3ZLVA 1T6YA 5JATA 2JLQA 3F3KA 4R2LA 4R7TA 4WLNA 3TN7A 1YDEA 4UHDA 1RM5A 4EOGA 5IRCD 1E69A 3KWLA 3NRCA 2L19A 3JXEA 3K70D 1GKKA 2OXCA 3FNBA 3PXBA 3MAGA 2FLKA 4QODA 1D5WA 5BURA 3W5DA 3UMGA 4XJXA 3GD5A 1LDMA 4X45A 2HYIC 1GA4A 3ZNPA 4LDJA 4NHEA 3LKVA 1VE3A 3Q0IA 5B1HA 3ABRB 3I9V6 1I0LA 4BEBA 1TIKA 2HSWA 2VH5R 1W52X 1WNFA 4QYMA 5BW8A 3D5TA 1IM2A 1FFDA 4CG1A 2H8KA 2QTCA 3LCCA 1NY5A 3DUFA 5A71A 3VNRA 1RWQA 3G7NA 2PAAA 2R7NA 4ZZ2A 1JR4A 3PFWO 3QVTA 3FF1A 3I9LA 1KTVA 3PQ2A 1OV4A 4YA6A 3IKTA 4GRIA 5K8LA 4I36A 5EXEA 1JAHA 4RHEA 2IYXA 3EISA 3THXB 2D3WA 4LOKA 4QT4A 3K2IA 2H2AA 3OOJA 1B0UA 3Q7IA 4S1WA 4OAQA 5TT0A 1UBUS 1T6NA 2BHNA 4G36A 2XZDA 4L8WB 2W70A 5KYTA 3F6EX 4U00A 4EMUA 3NDIA 2BEWB 3SBXA 3FYUA 1EGHA 2PH5A 1FUIA 3LWDA 3WHIA 1U5CA 4FYIA 2P77A 2SNIE 4IMRA 3CVWA 2EWMA 4J2HA 4D41A 1FU8A 4MV4A 4MP8A 1PGNA 4BNIA 1JKIA 1NTRA 3BOSA 3TK1A 3AFNA 2C07A 4UBJA 3RK1A 4GQIA 1JXQA 3F6PA 4IIEA 4MV9A 1D09A 3STVA 1O6FA 3KYBA 3GG9A 3QKRB 4P3KA 4W5NA 2VYFA 2J9FA 3N2GB 1PJ3A 2ECQA 4N65A 4NATA 4DC9A 4KFCA 3HUUA 1NE7A 3R7LA 5KKAA 3OT5A 2CLFB 2EJWA 1WMDA 3WLQA 3WWZA 4JDUA 3TQRA 3ZS9A 1NVKA 1AVTA 1KZ9A 4QE3A 5KTKA 5H70A 1WW2A 1OH8A 3ZXYA 1NYRA 2AOWA 4ENUA 1S2MA 4A1OA 5KYXB 4MNTA 5I4KA 1P44A 2CK3D 1AE1A 5CU7A 1BJTA 1GAJA 1X74A 3NP9A 3QFHA 5J5VA 5T41A 3W7BA 4Y2PA 5A9SA 1KOLA 4E32A 4M89A 2XPCA 1G6OA 3FXAA 2Q7DA 4EB6A 2J7PA 3OX2A 1TYZA 3PC6A 2QSYA 5J47A 1DWUA 3B6EA 3VOAA 4ZOLF 1J21A 5CBPA 4MIEA 2IGBA 1VIMA 2Z8ZA 4R8VA 1RPZA 2DKFA 2GN1A 2NUAB 5A4FS 1EA5A 1DHTA 1U0NA 2ATIA 2XTNA 5CPFA 5FBHA 5H16A 1ONSA 1DI0A 3G2PA 4B47A 3W2IA 1JHYA 1JEQB 4ZCSA 3D8UA 1TKBA 3J7AC 1IQUA 4LSGA 3A1CA 2PTHA 3L2OB 2G0NA 2VXCA 2YWCA 4OIMA 3DWGA 1RQRA 3EZYA 4QYIA 4D57A 3FNGA 1LY1A 4NJEA 1VE9A 1YS2X 3AM3A 3E27A 3SZMA 1VE7A 2A7QA 3BXZA 4MITA 4RV9A 4DYDA 2A9QA 5HK9A 3M33A 1ZWKA 2YXEA 4MQ4A 3JRNA 3MD0A 1LPPA 4JBYA 3A9UA 4IJUA 4LYDA 4QHTA 1Z5PA 4E5NA 3EDMA 1NF3A 4XQ9A 2ADOA 1K1EA 2NPIA 3P0HA 3RYHA 2P78A 1UJ4A 1WUIS 4TRRA 2BDTA 2H57A 3EHEA 1GCAA 3H8VA 3LV8A 3QFCA 2R1UA 4IYRA 4W99A 3UGKA 4JI0B 4CWAA 4ETMA 5F23A 4DNPA 2MINB 4X41A 3O38A 1D4FA 2IDJA 3H4MA 5E0KB 3EIUA 2BZ0A 1E3MA 3G13A 2ATCA 4MUGA 1ULZA 2GBFA 1YB2A 5EKTA 1K66A 5HQ3B 4BGEA 5K9ZA 5B1IA 1QGYA 5BPHA 2GJSA 1OILA 2I66A 3N8KA 4I5EA 3QA3E 1GLGA 3RADC 4Y1GA 1T5BA 2XDAA 5BYJA 5DLPA 1RYHA 2GEBA 4HN4B 1XK7A 3EZXA 2I6GA 1UBHS 3FHOA 4OFBA 1GEEA 5K0NA 1P1FA 4BATA 3LKDA 3ZXUB 1IVSA 2ZBUA 2P9GA 1PR5A 2BH9A 2IHKA 4G0QA 4KUHA 2RHMA 5DX0A 3ZWBA 4WRRA 1MEEA 4E5PA 2PBFA 4FX2A 1R9MA 4L8VA 1GILA 4U3JB 4GLOA 1O77A 3PDJA 3KJHA 4CFZA 3FGOA 1B8OA 1UEIA 5FHRA 2XMZA 2XNDA 3U7JA 5HJ5A 4AJ2A 3OZAA 4UUBA 5C7IO 3AILA 3V6MA 1VIDA 1FW8A 2I4IA 2YWDA 4WNAB 1VMKA 1N36B 3I9FA 4OKSA 2I4RA 3SEZA 1UWLA 4RULA 1VHQA 5EIHA 3GEBA 2MSKA 2R65A 3B1FA 3I42A 1P7VA 4NONA 2QBYA 3NHAA 4K6HA 2AOTB 1SCDA 1PWEA 1CR0A 1MGOA 1QH1B 1UQUA 3IT2A 3LBHA 3QVUA 4NOJA 3SOPA 3KOUA 1L7PA 3CR8A 3FRIA 1QYIA 3M6IA 5E0OA 1QRSA 3TGWA 3TNDA 1P74A 2FR8A 1E8DA 3BL5A 2WKSA 4GE0A 3TLYA 1CUWA 5IVKA 1PL6A 1I6WA 1UZAA 1Y8AA 3O4GA 1OHHA 4D0RA 1CZRA 2FG7C 3IX7A 5SYNA 3H1FA 5CCEA 2OXFA 3DO6A 3V8EA 3OI7A 2X4DA 4BLVA 4U2DA 2VPXA 4KEAA 1HKUA 1F6DA 1YRYE 5GOTA 4J0JA 3DEFA 3A1VA 2KLHA 1JQDA 4AXXA 4E0BA 5BSEA 5IJZA 4Q6WA 5KREA 3MD9A 3U1BA 2A9JA 1TZBA 1QFZA 1H9AA 1SOMA 2OSBA 1NF2A 4ND5A 3W9YA 5D7NA 3W7AA 4R7GA 2AB0A 1NT2A 4K28A 4AT1A 4Z54A 1YIDA 4ZAFA 3HJGA 3VZSA 2JEOA 3NJ8A 4YJ3B 1EDOA 3HACA 2ZT8A 1PT7A 2EJCA 3O3CA 4PC6A 5AK5A 3ND9A 3UJDA 2DFLA 5LQNA 1OBCA 3WLJA 5EHZA 1WXGA 3KJNA 1P4SA 1BDJA 2P6PA 5A7GA 5E8JA 3DAPA 2YHSA 1M2JA 3VYWA 4KO8A 1EK0A 3SR4A 2H1VA 4G9GA 4FDVA 4A8JA 4DQXA 1JAZA 3K4QA 3OUTA 4G1CA 4RO0A 5E4JA 3ONDA 4MKGA 2HWYA 3OTHA 1HL3A 4CHGA 1UINA 2VDWB 1VMAA 5F3WB 3AVUA 3R0QA 3UV3A 3C6ZA 1DV1A 1G60A 3RS2A 3B9RA 3A0UA 3N07A 5A6VA 1FRZA 1U0TA 4JUCA 2IJGX 1C1YA 4ZFNA 1LPNA 2Q21A 3HLKA 3DNPA 1E4EB 3OFJA 3Q2OA 4IKPA 1ZK2A 1XBTA 1R64A 2NIPA 1L5VA 2PTGA 3H5NA 3KSMA 4F46A 3EUAA 2JGRA 1BD3A 1KGSA 2Z2KA 3GRZA 1ZSYA 1NU8A 3I23A 3MWGA 4FUTA 5H4GA 5D5QA 2P0YA 1HKHA 4MB6A 4E5VA 4KWIA 3R76A 5AIBA 1A71A 1NP7A 1ZP6A 1CZLA 4ZOQI 3QVKA 2YN4A 4JI2B 4XZ3A 4NYMQ 2QORA 4GMGA 4V3BA 2F17A 1P8JA 1SVOA 2D00A 4FNAA 5GZ3A 1MMFB 2PGNA 2OLKA 3JPYA 3OFSA 3LQKA 2H16A 2ZYVX 2FK8A 2AFIB 4AZWA 3ILXA 1TUBA 3RW9A 4YDQA 1VL8A 2QTGA 3N7TA 3QQPA 1XTSA 2HPAA 3OUZA 2BKVA 3I2JA 1YS4A 1YIAA 2Q49A 3N2IA 4EGAA 5K3AA 2BM9A 4LC0A 3U09A 2I2WA 4LMRA 1G8HA 1K75A 2QHXA 3CT6A 4GOND 4I08A 5SZIA 4FC7A 4IVRA 1ONBA 1MJHA 2R11A 4JR2A 5C8YA 4KPEC 1OWNA 1YB6A 3CLHA 2W48A 1YVDA 2IDMA 2F4NA 1ZLXA 2LV8A 2X5KO 4EA9A 4CM4A 4M0DA 4EFNA 2J9ZB 2QTVA 3HB4X 4YI5A 1JIXA 4BFXA 4EI7A 4WBNA 3AGQA 5K0CA 3GI1A 4RXMA 1QDLB 2R8RA 1T3SA 1XEXA 1TM3E 4IDNA 1A8IA 4Y9RA 3ZD6A 1DZIA 4DYVA 1IXKA 6Q21A 3DEYX 8LDHA 2IPMA 2QPAA 2RGBA 2XMGA 3JVIA 4JU9A 4G09A 4N0DA 2MR6A 2VJKA 4D4HA 2HQOA 4XVCA 4DDVA 4IJ5A 3CNQS 1G5PA 2VHZA 4MARA 3T5MA 1VG8A 1YCHA 2SKDA 3ENWA 2P79A 3NI2A 3VR4A 1CQZA 2GD6A 4J1TC 1PI3A 3UH1A 3IPRA 3OKFA 3HV0A 1UEXC 3NBXX 1TVKB 4QJ4A 3SDBA 5CK5A 1WTCA 1IB6A 1XDBA 1P75A 1BEUB 4GNKA 1XRMA 4DVGA 2NXCA 2YVUA 2G63A 3CV3A 3FGZA 3IA2A 1NGSA 4BNDA 3FCAA 1GAEO 3FGPA 1IYZA 4UU7A 1P5JA 2PMBA 3R3VA 5HTOA 1RP7A 3VYUB 3C3DA 1EUYA 1D2CA 2BMWA 1TD9A 2DPXA 3CMCO 1FY2A 5IAOA 3DMNA 3O31A 1TAUA 3R3JA 2RJOA 2TECE 5H8WA 4IS2A 4O33A 2WLTA 4D0LB 3LFHA 2J5RA 2J7KA 3RR2A 1C29B 1NC3A 1ZGGA 1SC4A 3C3XA 3P9SA 4PLPA 4WKNA 1MR3F 9LDBA 1OIXA 4QGGA 2FMFA 2L82A 2YFQA 4J7CA 4PFQA 3R6TA 3HI4A 4BV9A 4CI0B 1KH1A 4C01A 1JHQA 1T9BA 2OFXA 3EUEA 4RGYA 4KFTA 4EKNB 4BFCA 4LJLA 5CNMA 5T3UA 2ZAYA 1CDEA 4I3FA 4BU1A 3NIBA 5EIAA 1V1MA 2YINC 3AHIA 3OWHA 3GMSA 3R7SA 4YLYA 1T9GS 3IRUA 1XTVA 2Q6VA 3TBHA 1THGA 1P9WA 3FMOB 1NQTA 2F64A 3K0AB 2V3VA 3O8NA 4FD3A 4G0ZA 3WL7A 4BO8A 1KO4A 4ZVTA 4FFMA 1OXKB 1X6VA 4C89A 1S7CA 2A88A 2OD7A 2JC3A 1A72A 4M1TA 5BXQC 9GPBA 1J8DA 2X1MA 4UOQA 4JA2A 3WK6A 5GV7A 2X15A 1MPTA 5A9TA 4BNVA 2QPOA 1CZUA 1JKFA 4MR8B 3U4CA 1DLJA 4DDKA 7ADHA 3OM0A 1F4VA 1IAQA 3JWIA 2FZKA 3E53A 2IUYA 4OMDA 2IWHA 5KC9A 3PWZA 2R7MA 4I4LA 2ZZNA 5JXHA 3DPSA 1AU9A 2ATXA 3V32A 3OIFA 1Y0BA 3DZHA 2A30A 1DEXA 4G2NA 1XXHE 1DUVG 1WLYA 2BCJQ 3WL6A 5L7WA 3N0RA 3OPYI 2XQIA 4RV5A 1MX3A 1QIHA 2P4UA 4OA8A 5GPBA 5JYCA 3ZGOA 2M2IA 1AKWA 1X8XA 2G8NA 2WFMA 3R5KA 2I2CA 1QHIA 2FMXA 2XTMA 3KYJB 4KXWA 1F48A 3KT0A 2CXNA 4N3BA 2G77B 1PO7A 3HTXA 4BO5A 4NH0A 2OG1A 2IS6A 3QXGA 3D43A 1KXZA 1I4DD 4II7A 3LDFA 1P7CA 1ORIA 1SOAA 2BBSA 2BZ1A 4RKFA 5GM2A 3MCZA 3AB8A 1BDIA 2ZDHA 4BMSA 5EJMA 1T4GA 3OCJA 6AT1A 4X6UA 2AQKA 2QB5A 4MCJA 3R7AA 3AUKA 3NHJA 4RWZA 2YXNA 4NZOA 3TTTA 2NV2B 1WXEA 3OO1A 4O29A 1XP5A 1LSSA 3H8WA 3K9NA 3AW9A 1HE2A 3CIOA 3MELA 4YRTA 3TE7A 2XRFA 5F7OA 3LBIA 3BMCB 5AM3A 5ENDA 3W5SA 4EDFA 3HGTA 1G7SA 3QX3A 4E11A 2B2XA 3K15A 5DE3A 4P32A 4F5EA 1XZIA 3WOHA 3PNVA 2PCLA 3KVNA 4DY4A 3EPKA 2FDCA 1JU3A 3L0SA 3WKDA 2CT8A 3AK4A 3KD2A 5LUBA 2QU8A 4FQ7A 4L4ZA 4JS0A 3IHKA 4KAJA 4J6FA 5E1OA 3I5YA 2HFKA 3QM1A 3PFGA 3PXCX 4ODIA 4DLAA 4KP7A 4QUDA 2VNJA 1NONA 4PNZA 4GMKA 1E6KA 4EW2A 1NX6A 3KPJA 4ZT4A 3FR7A 2HI0A 1ATZA 1I3KA 5JNWA 4XB2A 1CDZA 1EM8A 2C8LA 4NOKA 3OLQA 2MIIA 5EMJA 3RSGA 3ZOKA 1AMUA 1NMYA 3JQ8B 4FWBA 1TO2E 3KEQA 3IALA 2IF2A 3L7IA 5BQXA 1Z5UA 5FR2A 4I1OA 4EB8A 3D6NB 3F46A 4ZANA 1FXWA 1AUVA 4YP1A 1M2GA 3KSAC 2IBSA 2KM1A 1LUAA 1ZIOA 2YASA 3A1TA 2H63A 2J9YB 2QAGA 5AK6A 4CVNA 4DMLA 1Q3TA 3HO6A 2EP5A 2GJ9A 3CF4G 3QI2A 4MS3A 4OYLA 3FAKA 4WY5A 4EZIA 4CR8A 2QD5A 3IKMB 1HDIA 2H11A 1MFZA 3RHZA 4EJFA 1JR3D 2Z5VA 2HNKA 3M3HA 3OPNA 1K6IA 3L0YA 4LEIA 3WBFA 4BMXA 1HY3A 1P4AA 2R5WA 3E61A 3PWKA 4BJHB 1KJWA 2MSCB 4ME6A 3QLJA 2PRKA 4IILA 5DMHA 3I9KA 1R0ZA 3P2MA 1G291 3HUFA 3BAFA 1UT8A 1L8XA 3H86A 2PDAA 4EVSA 3GPBA 2YHBA 4UD2A 4A2PA 4E14A 3VYRB 1HZZA 2GFIA 1LLCA 4KLCA 4Q01A 1DJMA 4EPVA 2CLEB 1IY0A 4K40A 4EFDA 1DAGA 2HHAA 2WJJA 2AI3A 1OX4A 2E4YA 3W4KA 2UYHA 1QAOA 4Q4LA 3GFGA 3KSDO 2RGCA 5GMOA 2Z6VA 4JYBA 1Q95A 4DV5B 1J0CA 1ZO8A 5JQGA 5MGNA 2IOHA 1T36A 2VF5X 1E79A 3LPLA 5J3JA 1I1QB 4MWDA 4B8WA 3HDYA 3MWDA 5DK6A 2WFLA 4DG8A 1YGPA 3VR4D 1K9VF 2NO4A 4E5SA 3OIUA 3ND7A 2QZPA 3U17A 3GDGA 3QOWA 4ZVKA 2ZPUA 5HIJA 1SVUA 2HJ9A 1SM4A 2I6UA 2OZLA 3D5QA 1R16A 2IPOA 3BJMA 2JLXA 2DWPA 2ZJ7A 3QTTA 4F3KA 1ZR4A 3CNHA 1Y63A 3WA7A 4LOAA 3HXQA 4DV3B 3DMTC 1WUKS 3KQOA 3CLTD 4L08A 3SQOA 1GNTA 3LBNA 4BWFB 1NM5A 5HCIA 1D9ZA 5JCJA 4R51A 3TOXA 4N76A 1T8WA 4I2NA 1XVAA 2CY0A 2EJUA 2GZ3A 3E7DA 4UE6A 5CM9C 2RCNA 3FNFA 3I32A 2P9QA 2DQKA 2IU0A 4F6LA 5JAZA 2VTBB 2C29D 3PGJA 3ZDFA 2XR1A 3C87A 4P82A 3AGPA 1LPSA 3LW7A 3AYZB 5HJ7A 5BWOA 3IL2A 2O8FA 4I7EA 1OZHA 4PPFA 5G1NA 3WGOA 1CW2B 4JUFA 4XWGA 3HA3A 4EYQA 3A14A 1Q1GA 4QEKA 5DASA 5AJUA 5C5EA 4FGUA 3WGIA 1E2EA 5CNIA 3S29A 2EZ9A 4F9EA 1U6KA 2H17A 1TJYA 2OCKA 5LXTF 1DCFA 4KQ1A 1L1QA 2WVGA 1ZPDA 4G8CA 1KAHA 1EH5A 1QR6A 3QUSA 3OUUA 3THOA 3UMFA 4DJTA 2A0WA 3V42A 2AR0A 1P1CA 2CYAA 2Z1DA 1XZLA 3O95A 1JILA 4MRNA 3F5MA 4R1SA 4OLAA 1MXHA 1C7IA 1PF7E 4LRYA 4XSGA 3KLPX 2RBEA 2VAWA 4DJ5X 2JLWA 4JP3A 1U31A 2HQBA 1DT3A 1E6UA 3DVQX 1M8GA 3ESDA 1Z8NA 2YMPA 1JFRA 4MSUA 2WUDA 2IXEA 4EG7A 1PQ4A 4M55A 3PSAA 4XR4A 1N6IA 1RAIA 2VH2A 2NO0A 2WA2A 6ADHA 4TXJA 3I1YA 4PN3A 3AR5A 5CA0A 5IFLA 5K2OA 1OI2A 5AXAA 4R8RA 4DJDC 5DSTA 3KX2A 3NHMA 4HQOA 3KJIA 2JIRA 3DAGA 3O8OB 1FP2A 3LUKA 3FRHA 3Q0TA 4X97A 3E3MA 3L7CA 3URMA 1OXTA 1A50B 1F38A 4IWYA 1N5RA 1JSCA 2DT8A 1JMKC 4Q4JA 1H1LB 2HQSA 1E4VA 2PLFA 3IDQA 3VSAA 3GL9A 1U0HC 2J6BA 1Z82A 4UM9B 2GERA 4MGZR 1YOVB 1A5ZA 1SCJA 4OXNA 4YT5A 3HXOA 3OHMA 2IS1A 4JHXA 4FKZA 3O91A 4JYZA 4FFSA 4FONA 5TQ2A 1M7BA 2W37A 2WE7A 2DBZA 1MAUA 3IE0A 2UZIR 3NRJA 4IFTA 1EX9A 4TZTA 2QNBA 1KEUA 2C54A 5A05A 4J6EA 5CIQA 3HP4A 2X0KA 3TSCA 4MMYB 4JBNA 2AC4A 2MTBA 3ZGYA 2CDRA 1BJRE 1X7XA 3PF9A 3VDMA 4F9FA 1QGOA 4QUGA 1TTTA 2C82A 2C3MA 4MQBA 2QUHA 3SQLA 4PQFA 5D86A 4RKQA 3KJZA 3OE7D 3DS8A 3LNTA 1M5RA 4M0KA 1AD2A 3OEED 4G0WA 4LGCA 4ZO6A 3C1AA 3LSTA 4G5XA 1RYMA 1Y7LA 3QSGA 1ZVMA 3WMFA 1YS7A 3EQZA 4DLTA 3JYOA 1VE5A 2YJ4A 3RC1A 3FVVA 5L53A 1EXDA 2CYCA 2VSQA 4C9BA 4P4LA 2DEUA 4QFBA 3O5AA 4KGXA 3PFNA 4P7JA 5I3CA 2RSLA 2NZXA 1ZA2A 3A3OA 3RRYA 4DNQA 4UATA 3GFQA 4B3XA 3SFTA 4AP6A 3KZXA 4KQXA 4N3NA 3WADA 1CUBA 2PS0A 3WP0A 4BN4A 3GLIE 3Q11A 1UP6A 2ZJOA 3VBCA 3KTAB 4MR9A 2VSFA 1TCAA 3R6GA 4KSYA 2DJIA 4EBFA 3NUZA 1JKJA 1O8BA 1GGMA 1HDOA 3L6DA 1E6WA 3G6KA 3HCRA 4R9SA 1QX4A 1VHWA 2F3RA 3RODA 1GQSA 2IHTA 2PR2A 1TTPB 2OD9A 1GKIA 2O05A 3LDHA 4MQMA 4ZQFA 4QTTB 1H0SA 1P61B 4Y9SA 5EIOA 1HR0B 2IZ5A 4ZI5A 2AWNA 2NO1A 3DMGA 5KAPA 3Q85A 3EQ6A 5EJ7A 3IYLW 3JQ9A 2VK8A 1B76A 5FDFA 3GXBA 5AVQA 3H5AA 3UMMA 4TQUS 2WIJA 1YUMA 3UQYS 2I6QA 4AKTA 3Q88A 1TXGA 2GN8A 3O2JA 2GN4A 4UULA 4BV3A 2FUCA 3T5CA 4BJ5A 3NYIA 1NOIA 2BUBA 2PLNA 4BQRA 4UBIA 4YAGA 4XOUA 4HAVA 2FPWA 4RIFA 1KZGB 3EHDA 1QFXA 2IZ0A 4J90A 4MRVA 5TGDA 3A1FA 3E5NA 3LXUX 1DDIA 4P83A 5EY5B 5TARA 1CIJA 1QOZA 2JAWA 2SKEA 5FLXA 3IPCA 2E7ZA 2VHQA 2XVAA 1DX4A 5ER9A 4FDAA 2XDQA 4LDAA 3B13B 1AJEA 4JWTA 4Q00A 2QJOA 4I1RA 4NZMA 1NNEA 2UVPA 3ZD7A 2JGMA 4TMTA 4URYR 3HDGA 3O9MA 2BFBB 2FW7A 1EVLA 1XRJA 2PL3A 3FLMA 2OEPA 3AKEA 3NEJA 4HB3A 2HUNA 4RSRA 3W9UA 1SCIA 1ZS9A 5BSKA 2BKAA 4P4UA 3UHAA 4XUDA 3EEYA 1PNTA 1JG1A 2JFXA 4HPWA 5KZMB 2XMSA 2NU8B 4TROA 4WA7A 3IAUA 5K1ZA 2XTJA 3TH5A 1XRNA 3D3EA 3FVQA 4LDRA 4MUBA 3O4HA 2R6CA 3JX9A 4M1OA 3WB9A 1NF9A 2WIDA 2FF5A 3OBIA 1UPUA 2JF0A 3I5UA 2B4YA 4GX0A 1N9ZA 4S1VA 2CC2A 3K92A 3L4EA 3NWEA 1PLLA 2OMEA 1GPWB 1PZMA 3GROA 4OX9B 1G2QA 4R1OA 3KU4A 4IHKA 1FFXB 2M6SA 4ND7A 4QVIA 1VL2A 2Q3LA 4TLDA 1BU8A 3Q72A 2VSXA 3F9IA 2NYRA 5IK2D 3IJPA 1MA3A 2EEPA 1K8RA 4WACA 1SD5A 4RVGA 4J43A 5JHHB 1M5UA 1XEFA 1ZJWA 1RD4A 3KB6A 1ZU5A 2OCYC 3HXKA 2J0SA 2C4TA 2E89A 1M34A 2FRVA 2YN0A 2PX3A 2ZAGA 3ED1A 3F74A 4QDUA 4CKCB 2EL9A 1PZFA 5KINB 4EYGA 2DHCA 2HCJB 1Z08A 2IV3A 2PIAA 4PZLA 3BMQA 1RXWA 5DZSA 3C43A 2QRVB 2DMRA 4IG9A 3NATA 3TLKA 1JPVA 2JK0A 3BB3A 2FZEA 1B16A 1YB5A 3N74A 4HFNA 4XTCS 4DV1B 3KEOA 2Y99A 2FR1A 3I45A 5ECYA 2ON6A 3GUZA 4ZYLA 1S1MA 5C1PA 2PWBA 2I8AA 3H2JA 3AFMA 2OUKA 3T06B 4QBHA 4KGDA 2X6RA 4M9RA 4MDHA 5CJJA 2GDZA 3AHJA 4GMXA 2JGDA 1LDYA 4FJ0A 5EG5A 2WIAA 3E4CA 3SS8A 4BBAA 3CA8A 1KMQA 3L8FA 5KTRA 1H3FA 3GCXA 4B4KA 4EO9A 5IZ4A 1ZW1A 5DIZA 4DZTA 2M6RA 2IODA 4W5OA 3QEOA 1QIKA 3VR5H 4TXLA 3I2HA 1NI3A 2WVJA 3C48A 4F3RA 3D6TB 1GZ4A 3LKBA 4OQZA 5HJEA 3SQNA 1ENYA 1L7MA 2OAQ1 3LDAA 2WQ6A 1SUCA 3I6IA 3F5FA 2J3MA 2BP7B 4TXMA 3UJCA 1XCMA 3PXEA 5JH7A 1TT7A 4I1PA 1QHXA 3B9QA 3LPMA