4GMDA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
203
Chain Sequence
TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/inhibitor
molecule keywords Thymidylate kinase
total genus 77
structure length 203
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmdA00
1VG8A 2VP4A 2VF8A 1D2EA 5DN6D 4P4SA 4NYIR 2YYZA 3ASYA 3P4YA 1IY1A 4UNRA 1J2JA 4FMDB 3BAFA 4GOKA 4O25A 5FI1B 5KSPA 2P6NA 4ZKEA 3WMEA 5DISB 2BJWA 2C5LA 3HR7A 4KFSA 3ZS9A 1AGRA 3DDCA 3SQXA 5HTKA 1Z3IX 2C9YA 1P9NA 3LXXA 4AK9A 1XXHB 4JKYA 2VHQA 5DHFA 4I1SA 3LA6A 4IHQA 1BO6A 1ANKA 4NU0A 4PPFA 2FN4A 4W9MC 5FBVB 2I1VB 1UDXA 4D4KA 3QXHA 1XD2B 3GCGA 4G5OA 2OFOA 4JL5A 4QGGA 2I4IA 1XJQA 3O8CA 4MYUA 4EDHA 3QBVA 2O52A 2WV9A 1GL9B 1D8TA 4KODA 5FBLB 1EGAA 2QP4A 3MG9A 2FZ4A 2V1XA 2OEPA 3R9IA 1PLKA 1HT2E 3AUYA 4XWOA 2VP6A 3QXSA 1LY1A 4G0NA 1WMSA 4NCNA 5DYGA 5JSZB 3VR6A 4TMKA 3A1VA 2J0QA 2ATXA 3ZS8A 2AK2A 3PEUA 4P31A 1ZUHA 4OKSA 4F38A 1Z6GA 3T12A 2EFEB 2ZRNA 1JBKA 4KV9A 3KFXA 3NWJA 1X8LA 5EXXA 4MH0R 2DYKA 2KI5A 2J0VA 2PZGA 5AJWA 3CX8A 2QA5A 3UMSA 1CJVC 4PQFA 3M1IA 1MT0A 1SXJD 5BYKA 2FOLA 2PT7A 4CT5A 1VG9B 3IIKA 3GJ4A 4A4DA 1G3MA 2BMJA 4DUGA 4CGZA 5C46F 3Q3JB 1E1RD 3CNLA 3CRRA 4G5GA 1QVRA 2BJVA 4LBZA 4QJ4A 5K8TA 1DAIA 2NO1A 2RH5A 4ZIRA 5E7IA 1XTKA 2FGJA 2A7QA 2FE4A 3CF2A 2WTUA 2ZUDA 4FD2A 4GFDA 4LBYA 5HCIA 3GLFE 4HDCA 4DCTA 4KBFA 4OK6A 1ZBDA 2JJ1A 4NTZA 5EUQB 2NPIA 5JECA 3W6PA 1DADA 2XB2A 4RFVA 5G3YA 1ZU4A 2OAQ1 4IEEA 4QJ5A 2YOFA 1QF9A 1S8FA 2LWIA 3W5IA 3H86A 2ZE7A 4JLOA 1QBKC 5AUOB 5E4FA 1UKVY 1W4AA 1KI6B 2W00A 4MKHA 3ICQB 4MRPA 2G77B 3VKHA 2Z83A 2VTKA 1JEEA 5CK5A 5EE0A 1A2BA 2C8VA 3OAAA 1M1YE 5LD2B 1XMVA 3MMPA 1GL6A 3P4XA 1H8ED 2RGXA 3C5HA 3K53A 2XZOA 1R8SA 2IXEA 1T5IA 2A5FA 2RMKA 2GVZC 3U2QA 1VCOA 3AVXA 2OT3B 1E9SA 2GESA 3GJ5A 1NVVQ 1VKJA 2AXNA 2WMNB 4Y0AA 3ZGXA 3IIJA 1X1SA 5FTJA 2AFIE 3WNDA 2H17A 2Q9BA 1OB5A 4OQMA 4Q19A 3EC1A 1CS4C 2Y8EA 2UVQA 3AVWA 5J4YA 3RWMB 4AURA 4URZR 2PCJA 4LK2A 1NBMD 1S3GA 3L2OB 1T5LA 2R6AA 1V43A 2FFHA 1G3UA 3FVQA 3R9XA 1KO4A 1Q21A 3QPUA 4Q5IA 4AWXA 4KSCA 2Q9AA 1UAAA 2OCYC 5BN3A 1N6RA 4NYMQ 3WBJA 1RZ3A 2YWHA 4PZZA 4PZYA 4US2R 2CLSA 1N6NA 3K9LA 1FP6A 4IVQA 4JLKA 5JBQA 3SJCA 5JLJA 3U6BA 2GZHA 2O0JA 3B9PA 4ZDWA 1ZJ6A 2EYQA 3C14C 3WBKA 4JLPA 4K8OA 3KKNA 1AA9A 3TUJC 4DC9A 2XZLA 2C03A 4XVQA 2EW1A 1E32A 4XWKA 3VU9A 3HPQA 1TNDA 5FL7D 1XWIA 4DEYA 3PEWA 2O8EA 4NONA 1UKYA 3HR8A 4TYPA 2JCSA 3A58B 4GZLA 1GITA 1IJEA 4KCGA 1Z83A 3A6PC 5EP1A 4DCSA 1XTJA 4IDPA 5DYIA 3VR2A 5CYOA 4U00A 4F4IA 2F9MA 2ZJOA 5IT5A 1QHHB 3EPLA 2AKYA 5AJXA 3WRXC 3HYTA 2PJZA 2QN6A 2B7BA 4Q4HB 1Y3AA 2H57A 4A6PA 3PUWA 4PFSA 2IS2A 4AY2A 3E5HA 1NJGA 3IEVA 3TUZC 5J47A 1GRQA 3CX7A 3OIWA 1JR3A 2F43B 2WJIA 4KI0A 2VLIA 3MAAC 4KLZA 4KO8A 2IW3A 3GJ3A 3NC1C 4JKIA 3AVTA 4AKEA 4V0OA 5EE3A 1C1YA 5A5GA 1JR6A 4OBEA 1JNYA 1NMZA 4PHHA 5E95A 5KU1A 4KLNA 4QM7A 3WP1B 2LCFA 1JI0A 4AYXA 3QKSB 1E9CA 4NYIQ 4UQOA 2ZE6A 3EA5A 1GL7A 5D3MB 3T06B 1QHXA 1M7GA 1WCV1 3LFUA 3Q9LA 4UXJA 4QBIA 1E2QA 2CHQA 3D7MA 3SU8A 4AD8A 4Q4AB 3B1XA 2CDNA 3NH9A 3SZRA 3TQFA 3B1YA 1OXSC 2GKSA 2WJJA 1RYFA 2JLRA 5F2EA 3SJAA 5FL3A 1DS6A 1SQ5A 3RC8A 4Q7JB 3K09C 1YRAA 4LJ4A 4V0KA 3L0IB 3VR5A 1CKEA 2IS1A 1N5LA 5FI0B 4DCUA 3GQBA 5BYJA 2HXSA 1K8RA 2WOJA 1KO1A 3H84A 1II0A 3VTKA 2CBZA 2YJTD 2ORIA 4PAQA 3AF4A 4FCTA 4US1R 4PHGA 1OF1A 2GVDC 3SYKA 4HAXA 3BK7A 1QHNA 1XCMA 1Z6YA 2R6GA 2ZRPA 3D6TB 4R2HA 4Z54A 2WKPA 3PIRA 4DDUA 1VDZA 3IBYA 4JYCA 1ONBA 3ASZA 2H8KA 2BHRA 1GOTA 2P5TB 2ZJ8A 1Z63A 4D25A 4KFUA 2D3WA 1MKYA 1G5PA 2Z6VA 1FOEB 1LTQA 2CLCX 1SXJB 3U44B 4E5UA 5FTNA 1VCMA 1GG2A 1P62B 2W58A 3EPHA 3IQXA 3KJIA 1CJUC 4PO1A 4DEXA 1M6NA 1T8TA 4TZ6A 1S1MA 3FGNA 1Z08A 2IK8A 3WHKA 3B78A 3MWYW 5AJYA 3TJZA 2QE7D 3SFVA 1XTRA 1XEWY 3V4FA 3EIQA 1A4RA 4UXIA 1Q1BA 2ZS8A 4DLYA 2X77A 1EFRD 2D74A 4AYTA 3OIYA 1E2IA 3RNLA 1P4SA 2GF0A 3DM9B 3Q5DA 3IBGA 4DDVA 1GNQA 4FCWA 1NVUQ 4H1UA 1KO7A 2RGNA 2ZRMA 3AVPA 2NPFA 3BERA 3GLFA 3AF3A 4B3XA 5FTMA 1CP2A 4C0HA 1DTSA 4N0DA 1ZCBA 4JBXA 2A78A 1FZQA 3DHWC 3TNFA 2E1RA 2ZEJA 4CEIA 2JATA 2QAJA 3NVAA 3QSYA 2FEOA 2YINC 2I3BA 1IN8A 1Z0AA 3U60B 4DBLC 1TF2A 4AI6A 2ZE5A 2WSMA 4JLJA 1US8A 2H1LA 2P3SA 4OJQA 2YKGA 5LBIA 3R20A 1E99A 5FUXA 1PUJA 3EC2A 4C9BA 3WP0A 1TX4B 4D82A 1R7RA 1U0LA 2QORA 1JEDA 1XRJA 2ZU6A 5DE3A 3QUSA 5DH9A 5C18A 2WJVA 4MRSA 1CR4A 1OYWA 2BBWA 4JVLA 2CEAA 3X2SA 1S9HA 1J99A 1CU1A 2ZJYA 3DOEA 2ZJBA 4B2PA 4UNQA 4JIMA 4A8JA 1T6NA 1P60A 1KO5A 4DKXA 4DZZA 4IW3B 4JLAA 1U0HC 2C96A 3UPUA 4DUGD 4DHEA 3BGWA 2FG5A 2REXB 3QY0A 621PA 4HLUC 3R9WA 3IO3A 5H68A 3UXMA 4P4UA 5KOYA 1WP9A 3H4MA 1J90A 4NZYA 4OI4A 1JECA 5H1YA 5FOVA 1G19A 2J45A 3TAHA 3RC3A 4OK3A 3S1AB 2NO7A 1N25A 2UKDA 1TPZA 2ZYWX 3QJYA 2WPDA 1IONA 1Z2AA 3EZ9A 1W5SA 3AF1A 2OZEA 4P3YA 3ZVNA 1G3RA 2B8TA 2W2VA 1D5CA 1TAGA 2GJ8A 5EE1A 5IK2A 5J4KA 2DPXA 4TMWA 1XD8A 5JI2E 1G17A 2C78A 4TMVA 4E03A 3SJBA 4QGHA 3M0EA 2ZJZA 3KFVA 1H65A 4Q21A 5HE8A 3GLHA 1SHZA 3OAAD 1EX7A 1N0UA 1U8AA 3ZVRA 4DLRA 2CL0X 4DWJA 3FWYA 2VHTA 1XEWX 2HLDD 2WICA 2ZE8A 2EWVA 4URYR 1AS3A 4JVMA 4TL9A 2KBEA 1HURA 1XZQA 1F2TA 4XIGS 4U5XA 4HDOB 4WIAA 3THYA 1LVGA 4Q48A 1LB1B 1GM5A 1SVIA 3CZQA 1KGDA 4O3MA 2PBRA 3EZ2A 3LQRA 5HKKD 4JT2A 2L0XA 4NYJR 2AKAB 1R6BX 4FMDF 3X1WA 1FFHA 3W9YA 1E9BA 1GWNA 2RHMA 4MA4A 1ZNYA 5EJEA 4Q9HA 1KI9A 4F4CA 5E7JA 2JJ2D 4Q4LA 1GNPA 4XVUA 2X2FA 1PLLA 4M9QA 3I62A 1QG2A 4HAUA 1OFUX 1Z0DA 3BH7A 3B1ZA 2QT1A 1G4AE 1DAMA 2ATVA 3AKCA 4AIIA 5F9FA 4C0JA 1OHHD 4TYNA 3MD0A 1T8UA 4Q4AA 1ESNA 4XWAA 1BYUA 2FFBA 1QHGA 1G7SA 2V7QD 4QNRA 4RCYA 3TAUA 3VHLB 2J7PD 1MRNA 2PX0A 2C9CA 2J0UA 4HYYA 4ZV4A 5JS8A 1ZU5A 3HU3A 5EZ5A 1KI3A 2IYQA 5JEEA 2VP5A 3ZD7A 1EWRA 1IAQA 3EPJA 3B6EA 2ZRBA 5C4MA 1E1QA 1GTVA 4UNNA 2BV3A 1WB9A 3WYAA 4IFBA 3KKPA 3KQNA 1KSJA 2HYDA 2QP9X 3TRFA 2JLXA 3TGPA 1TQ4A 4LHWA 2C98A 2H7VA 3PENA 2ZR7A 3FHOA 4LJYA 3CF0A 2EWWA 3A1SA 3F0TA 3SNHA 2XITA 3OFND 4B75A 4FWTA 4LHYA 3U44A 2AK3A 2FFAA 4QJ3A 1KI7A 1OYYA 1QRAA 2B8WA 5ANRB 4B43A 2QBYB 2GCPA 5EXPA 5EE5B 4HB3A 3ZD6A 2ZYVX 2J87A 4L15A 3QPVA 4EKDA 2OXCA 4OI0A 2BWJA 3CX6A 1X6VA 1HE1C 2W0MA 1CTQA 1JJVA 2PCLA 2FEMA 5HCNA 4MGKR 2DCUA 3AH8A 3U7FB 3NBZC 1ZAKA 3QKRB 1UADA 1L8QA 1VECA 2ECKA 4LYAA 5F9HA 4OQXA 1OV4A 1ZC4A 2D62A 2BMEA 2JLQA 2GF9A 1J70A 2V6IA 2ODBA 3CPEA 3HP1A 4WZAE 3W6OA 3EIEA 4DRZA 2QENA 2OV2A 2UZ3A 2FPKA 3O8BA 4LV6A 4WXPA 4B3CA 1F60A 5KSZA 4F92B 1COWA 2ZRGA 3H0KA 1U81A 5TY0A 3EARA 4HLQB 4LC1A 3BS4A 1JAHA 4JLVA 5GJVC 1NY6A 3CWZA 4E09A 1RE0A 3QF4A 5G41A 2QM7A 2CMKA 3EZ7A 2HF9A 2A9KA 1YZTA 2QI9C 4TTRA 4TZ0A 1MABA 4YDSA 3VHXA 5F98A 1YZUA 4C3ZA 4YXWA 5K8UA 4M1TA 3X1XA 1G7CA 5L3SB 3K0EA 4CF7A 3AQ4A 4I81A 1CXZA 1U90A 2J0UB 4YMWA 3TKLA 1M34E 1UBFA 2CCGA 1WQ1R 4HLUA 4YMVA 4ZDJA 1HE8B 4LBWA 1Z0KA 4I4LA 2O8FA 1GDDA 1U8ZA 1YVDA 3O8DA 3EXAA 3LV8A 3EASA 3Q72A 1G8GA 4N3NA 1A2KC 2YHSA 5L8VA 1D2MA 3WY9A 1XEXB 4XTCS 1VPLA 3LH5A 4GPTA 4RFSB 3GJ6A 4EIWA 5JSZA 1O87A 4QM6A 4RVCA 2IXFA 1JJ7A 2ZVPX 4ZI2A 3QE0A 4CT4B 1P73A 1CIPA 4IOLA 3K0CA 4HSEA 3CM0A 4RD0A 5TXGA 2AXPA 2QTFA 2PLRA 1AM4D 3C5CA 3U7GA 3V9PA 1CJMA 4A8JB 2VIIA 3PUXA 4FIDA 2O8CB 5CYPA 4QHYA 1XJCA 2OILA 5IK2D 3BFKA 3OHMA 3TW4A 1SVLA 5AUQA 4V0MA 4OHYA 2AR7A 2IS4A 1E9RA 4J0QA 1GKYA 3DMDA 2QGZA 4ZI3A 1J8MF 2IYXA 3PITA 4D80A 2QE7A 4Z51A 1KMHB 1MH1A 5FPHA 4M1KA 3T61A 5UKDA 1N6PA 3CPJB 3UMRA 3LDAA 1RC8A 1IJFA 4MYHA 2GXUA 3FE2A 4LJ5A 1E2MA 3SE0A 3FFAA 3VAAA 1RRCA 4C0LA 2BEKA 2A3RA 3MGCA 1EX6A 4LYHA 4HEJA 1UM8A 2ZETA 4H1VA 1XJ0A 5AWFC 1WBDA 2WWHA 3LBIA 4V02A 3TK1A 3N2EA 2IF2A 5IHPA 1C4OA 1N0WA 2REBA 4RKFA 4S2EA 1HYQA 4NE2A 4LJ9A 4MGZR 1U8YA 5TVKA 3C41J 5FFMA 1E9FA 2CJWB 2OE2A 3KJEA 1XTQA 1Z0FA 4BECA 1L4YA 3TBKA 1IN7A 3BH0A 4FMCB 3ZIAD 1VG1A 1OH7A 2P6RA 5H70A 1EFTA 1SXJE 1HQYE 2O8FB 5GJWC 2GEDA 3GLGA 2ERXA 1GP2A 1Z47A 4CDGA 1G7TA 1W36C 4D2IA 4Q00A 4PR0A 2P67A 2XJ4A 1EXMA 4TQAA 1I2DA 2G83A 3MWJA 4JLNA 4MDFA 1G7RA 2R9VA 4TT3D 3PJRA 3K70C 1KTVA 2ONKA 3CLVA 3WYFA 1YZQA 4LPSA 5AUPB 3W90A 3B7GA 2RGAA 1T3LA 2JLYA 1W2HA 3BH6A 5JCZA 2ZR0A 2WIAA 5BN5A 3RANA 4D26A 2QP3A 1W49A 1OB2A 3V00A 1WA5A 1JQJC 3B8HA 2IYVA 4V0NA 3R7WB 1U99A 2ZI3A 3UANA 5C1BA 1EFRA 1NSFA 1TMKA 5FPYA 5BXQC 4EPVA 1ETUA 2X8AA 2VQSA 1T3HA 2JLZA 4LSGA 2ERYA 3FYHA 3PCRB 1KI2A 3QKTA 5DI9A 1VHLA 4O0MA 4RZ3A 2HJGA 4IJMA 521PA 1T4GA 1T91A 3LBHA 1W48A 2GWHA 1KJWA 3I61A 2ZAMA 5KDLA 2BKUA 4LPKA 3KXLA 2AL7A 2QROA 1M7BA 5G40A 2NIPA 2YC2C 3GD7A 1G9XA 4Q47A 1U98A 1FQKA 4ZKDA 3B13B 5FOXA 3RS2A 2WZQA 3MFYA 4LYFA 5KSYA 2OFWA 2QBYA 4G5QA 1E0JA 2R62A 3CONA 2GETA 2WKQA 1X1RA 3NBYC 2KWIA 3W8RA 2XOKA 1YZNA 3LO5A 4KFTA 3FMPB 4MKIA 4JS0A 1ZINA 2CK3A 1RYHA 2OM2A 4URWR 2ZJAA 3RRZA 2HUPA 3BOSA 1YR8A 4JT4A 5TARA 1G1MA 4B74A 4B73A 2CHGA 1FMLA 1TEVA 2GCNA 3CRQA 2O8BB 1MR3F 1AN0A 3EIHA 4QC2A 2ZUBA 3OEHD 2W6ID 4LJ8A 1DOAA 3IEUA 4NYJQ 2ZYTX 4DSTA 5DHAA 1VHTA 2NO6A 1A5TA 1T9HA 1KAOA 1YU9A 2AWNA 2F7SA 3T5DA 2J3EA 4URVR 1M2OB 2VSXA 2GBLA 1P7CA 1WXQA 1KK0A 1TL7C 3I73A 2V54A 3NH6A 3RRMA 4D0GA 3LRPA 2JA1A 1G8HA 1MO4A 1TQ6A 2MSDB 1G6HA 1G3QA 1KZ7B 3VKWA 3DVLA 2ZS9A 1GRNA 4ZCLA 2QT0A 4EJSA 3OFNA 1UF9A 1E9DA 4YQFA 1XPRA 4KVAA 1F6BA 1Z07A 4BRWA 3UMFA 2QNRA 1H8HD 1E4VA 2IWRA 1NVVR 1FMJA 3C16C 1DARA 3KKQA 3ND9A 2JDIA 4Q66C 1M7HA 2CCJA 4WVFA 4O2RA 1LFDB 5KPJA 4X8HA 4PAOA 1XPOA 1E69A 2B21A 1AZTA 3RYTC 5KHOC 2BIFA 3VNUA 2VP2A 1KI1A 2GEUA 2ZJ2A 5GVSA 5TB5A 2BBOA 2P65A 4ZDIA 1DEKA 4HUQB 1ZUNB 1UKZA 2YZ2A 2ZUCA 4FMBB 3PEVA 4XH9B 4XSHA 3RABA 5FBQB 1NN3A 3BD9A 1DE0A 5GADl 4MUAA 2IUTA 1W47A 1W4RA 2IYWA 4BWYA 4DLZA 1AK2A 3IDQA 2WWGA 3AP1A 4BPBA 3K9NA 1G16A 2IEYA 1R0XA 1RRFA 3I8SA 4HB0A 1JQLB 4EPTA 1H8EA 2O8DB 1G3IA 3C8UA 4CEIB 5KDOA 3QF4B 2C04A 3QF7A 2WOOA 4GBMA 1NMXA 4Q7MB 2AHOA 4OL0A 5KTYA 3BB3A 1RW4A 1U2RA 3CUEF 3BC1A 2XTMA 3A1TA 1F3OA 3AP3A 2OLKA 4ZO4A 1KMQA 4A6XA 4I1UA 3BJIC 1JXMA 3LVQE 2O8EB 2A5YB 2C99A 3FKSD 4Q1AA 4HZUA 4M2LA 2JJ1D 4ASUD 2GZAA 4QGFA 3K0CC 4ARZB 2VSOA 4Q1BA 1P6XA 4MUBA 4XTRA 4BFVA 3GLIB 1ZC3A 3HYRA 3E1SA 1COWD 3GFTA 2ODNA 4GMXA 4PX9A 3UATA 4MGYR 3W8NA 3KB1A 3AUXA 4OHVA 1HTWA 2IEZA 3GPLA 3AF0A 1OH8A 1PVOA 3UKDA 3N5CA 3RS5A 3ETLA 4MQBA 4DLSA 4X8LA 3O47A 2ZSAA 3GJ7A 4GRAA 4NP6A 1KI8A 2GA8A 2DWPA 3PUZA 1N6KA 2CCKA 5SZHB 2Z4SA 5JEDA 1KDPA 4XD7A 4IDOA 5CDFA 5DGXA 5EP2A 1BMFD 2ONJA 5EE9A 1G21E 4TLDA 1SKYE 1ZNZA 2BCGY 2EFDB 2O0KA 1ZNWA 1E2HA 4RZUA 5AK0A 5FOWA 3DKVA 3CH5A 4PPQA 1XBTA 2IT1A 4Z8XA 4IDQA 4Q9LA 3ZZ0A 4MRVA 4ARZA 2JJ8A 3QIAA 2CE7A 2Z43A 2WKRA 1W2GA 1SKYB 2QAGB 2ZTSA 4M8NE 1G18A 1S4QA 3PVSA 4D4MA 1GILA 4M9SA 5JJKA 1YKSA 3VQTA 2EFCB 2WWXA 4HB4A 5E7MA 4ACBA 3FMIA 2IHBA 3OE7D 3UIEA 4ESVA 2XSZD 4HLDA 2G88A 5SZIA 4A0RA 2BVNA 4Q03A 1NLYA 2D06A 2PZFA 4YMSA 3TR5A 2DFKB 4TYYA 4IXNA 4TWZA 2DHRA 1MABB 5FUYA 2FX3A 4PC6A 4OJKA 1NVXQ 1N6OA 4LY6A 4GOXA 4D6PA 1UKEA 1W4CA 4PZLA 2IXGA 2CVFA 4M1WA 4A1FA 1G8FA 2PL3A 2VHJA 2P5SA 3I8XA 5HZKA 5FOUA 1GUAA 3QNUA 5FL7A 3SR0A 2VO1A 1UPTA 3ADKA 4G5RA 3RDPA 1I4DD 4B48A 3NG1A 3Q7PA 4PTLA 4Q9IA 4DDWA 3TQCA 4DT1B 1Z2CA 2WWFA 4RFSA 4HUTA 4LBVA 3K09A 4FCVA 2OSBA 4UNSA 1SVKA 3PUYA 4V03A 3GLHB 4YXWD 2GJ9A 2Z5FA 2FSFA 2GHIA 2W0SA 5EZ6B 4BLTA 4N0EA 4DSOA 4BLOA 2I1QA 1G8PA 2BC9A 1G6OA 1P9RA 2V55B 2NGRA 3FTQA 4BLRA 5KSOA 2KJQA 4C2UA 4M21A 1SGWA 1V5WA 4F91B 1F2TB 4Q9JA 4EJSC 3P27A 1SKQA 4B33A 4XJXA 1E2NA 2OCAA 5L3SA 4A2PA 3AVUA 2D7CA 1X86B 2F1RA 1NVWQ 2BMDA 4FW9A 4R2IA 2WSSA 3IPXA 5C2JB 4HAYA 4IOKA 4NKRA 4P4TA 3MWKA 3NHBA 1R0ZA 3Q8XB 5DI3A 3ZH9B 4Q9KA 3WNBA 2BCJQ 2D4HA 2VP0A 2GK7A 3QXCA 1OT3A 1E79A 1R2QA 2XJ9A 2ZRLA 3P26A 5KPDA 2PLFA 1JPJA 5CIQA 2GTPA 4LJ6A 2IF0A 3KKMA 1NLFA 1SVMA 2CL7X 2P0EA 1E0AA 3X1ZA 2Q9CA 1EFCA 1XMIA 1BKDR 1IN4A 4N1AA 1ZVQA 1W5TA 5B2ZA 3LAWA 1CR2A 1XD2A 4BFYA 1JAIA 1H8HA 4HI0E 4A0FA 1PV4A 3KDSE 1JR3D 2NZJA 1NJFA 4CZ2A 1XB2A 2R44A 4Q7LA 2G6BA 1Z6AA 3CR8A 2NTYC 1ZM4A 3K1JA 4OHWA 5HE9A 1ZW6A 4D4LA 5JWOA 1KK3A 3KTAA 1G5TA 2HF8A 1HV8A 2HXYA 2IYLD 4YC7A 3UG7A 4GL2A 2JIZA 1T0JB 4AKGA 2CK3D 2OCPA 2WVJA 4XSGA 5DSZA 2C77A 1TADA 1KKMA 3SHWA 2IX3A 1CRQA 1DAFA 4IOJA 3MLEA 3KKOA 1IXZA 2CNWA 2GAAA 2Q0HA 3B2EA 2PX3A 4QFMA 1K5GA 1M74A 5FPSA 4DB4A 2O8BA 3J81k 1LNZA 4OI1A 2F1JA 3VX4A 2XOKD 1IY0A 4LX0A 2R6FA 4WAUA 1E9AA 4Z8YA 5FR1A 2RGGA 4OHZA 3UWKA 3H1TA 4BFSA 4B3GA 3QI2A 2DWOA 3IO5A 4OQNA 3ZQJA 4B2LA 2AN9A 4URXR 4GMDA 5LPNA 4G5SA 2IUUA 1BH2A 4KHZA 5FTLA 3O8RA 3B85A 4ILEA 121PA 4QBFA 1CULC 2FFQA 4JJZA 2MMCA 1E2FA 2C9OA 3SQWA 1NG9A 3AVYA 1IY2A 1XXHA 3GLIE 1OKKA 4IDHA 4WOPA 4L5BA 1N2CE 1YZGA 3R7WA 4MITA 2WWYA 3IGFA 3FHTA 3HPRA 1YZLA 5EUMA 5JZVA 2FDCA 1NKTA 2VHUA 5FOSA 1NIPA 1KJZA 2FMXA 4PPGA 1G64A 5B64A 1N6IA 4BLSA 1OHHA 2FH5B 3GEIA 5AJVB 2KSQA 3THOA 1KDOA 2W6JD 2ORVA 3OEEA 5EXTA 5FTKA 3I32A 2IYUA 4R7ZA 2ZI4A 1PUIA 1KI6A 2ZRFA 2Q3MA 1S9DA 3NTUA 4Z1MA 2RGDA 2A5JA 1W7AA 1KKLA 3AV0B 3THXA 2JDID 4L9WA 4LHVA 3LBNA 4IFEA 4RSGA 1G20E 4US0R 3BB4A 3CR7A 4K46A 3U3OA 3VR4A 4C7OA 2JAQA 2YC4C 4YONB 4ZDKA 4D0NA 4EFLA 2GCOA 2HJVA 1VIAA 1XDBA 3FFBA 3GFPA 4DSNA 1P72A 3UK6A 1OPXA 2F1IA 1N0VC 1YRBA 3TVTA 3ZDQA 1XP8A 1IM2A 1KNQA 1OFTA 2YWFA 3N2IA 3GJ0A 2KE5A 3RS0A 4WA7A 5B58C 2QM8A 2ASEA 2DBYA 4AG6A 2FPMA 4ACAA 3KQHA 2WHXA 3EWSA 5CITA 4QHTA 2VHCA 1P5ZB 1OH5A 4M0LA 5TV2A 1MOZA 5CJPA 4CEHB 4TL8A 2VL7A 2OHFA 1E2GA 1DVRA 1E96A 4E07A 1KDTA 4FWIB 4Q02A 5KYKA 1ZM7A 3FKSA 2OBLA 4LYJA 1Z5ZA 1SHKA 3QG5A 1DPFA 3QXJA 1G291 3SEAA 4ASUA 4DJTA 3EX7C 3TH5A 3WMFA 3DO6A 1XMJA 2FF7A 3NDPA 2CNWD 3TSOA 4BQSA 2G0TA 2IA5A 4V0ME 2O8CA 4FMCF 1XCGB 3T1VA 3CB4A 4R98A 5LB2A 1NN1A 3TLXA 2EFGA 2EYUA 2RGNC 3PEYA 2YNMA 3PV0A 3CNOA 3VX3A 1XMSA 4JVSB 3K0FB 4TMZA 4PXAA 3QEOA 4DLVA 1IXRC 2GEVA 4BUJA 2BKEA 2RHDA 1WF3A 2EVWX 1GNRA 2VA8A 4LI0A 4KYUA 4LC0A 3A4NA 2NOAA 8OHMA 1NRJB 2QEQA 2ZANA 4EPYA 2ZR9A 2JLWA 4RCZA 4DT1A 2ZM5A 1EWQA 3HU2A 5BWMA 2HV8A 3M6AA 5DNYB 4EPXA 4K81B 5A4JA 2OO7A 1TTTA 3PG5A 5G53C 1FTSA 4R71A 2FSIA 4B2IA 3IKJA 4TQUS 2NMVA 1AIPA 5KNBA 3TUIC 4KAXA 2AD5A 1LS6A 3FPAA 2GJSA 1J8YF 3MWLA 4X8OA 1FL9A 1GKUB 2A2ZA 5FPTA 3I5XA 1KIMA 2ZRHA 2VF7A 5L3VA 2ZYUX 2R6CA 1DBSA 4DVGA 3L43A 3BRWD 2QGNA 3LWNA 2XGJA 4RD4A 4BEBA 5JS7A 4XD7D 4L8GA 4QHSA 4D0LB 2OESA 4IOMA 2F43A 1SULA 2AWOA 2QZ4A 4PO8A 3IPYA 4NDZA 1S1CA 2H18A 3KXKA 2P2LA 2F3TA 1ZIOA 4EQ6B 1OW3B 4WW0A 5CLLA 3WHLA 5A0FA 4QKQA 5L3QB 1MO3A 2ZI7A 3QPWA 1JPNA 4OHXA 3IQWA 4NCHA 3W3ZB 1QG4A 2IYTA 1NIJA 1RJ9B 1GVNB 5D3MA 1NN0A 4LOAA 4ERNA 2JJ2A 4BZXA 1W0JD 4W5JA 1GZSA 3REGA 1ZD8A 2ZREA 1F2UB 1KO8A 2QL6A 3V4RA 1ZNXA 2DR3A 1VG0B 2HEIA 1MO5A 1Z29A 2QAGC 2Z4RA 3DM5A 3T34A 3FMFA 2V4ZA 4M53A 1GKIA 4AC9A 1DELA 4NBSA 2CVHA 2J7KA 1C9KA 3DEFA 2R65A 1FNNA 3K9HA 3VKGA 3AGPA 1FX0B 3U3KA 1E2JA 1S0UA 4A82A 4CEHA 3LX8A 1RRGA 4TYQA 1LF5A 1IBRA 1KSGA 3HU1A 3R8CA 3SS8A 4CIDA 3RAPR 3U3RA 1CLUA 1W1WA 4B6FA 1E1RA 4LJAA 4EAQA 3RSLA 5JRZA 2ANBA 3OZXA 2R6DA 1XXHE 3GLIA 4JL8A 1YHNA 1P2TA 4Z1MD 3X1YA 1LW7A 2OLJA 4C30A 3MUFA 3QEJA 4B3BA 3GLGE 1ZM2A 1YJ5A 3I72A 3KUDA 3RRNA 2W6JA 1OIXA 2QSYA 1KY2A 3D3QA 1PJRA 4HLCA 4EFNA 4ABYA 3Q7QA 1EG7A 3P20A 4BZPA 1GIAA 1KYIA 5LD2C 2X1VA 1QHSA 3U3MA 2AFHE 1N6HA 4PC1A 1XEFA 3ND8A 2ZVQX 1P9WA 2WAYA 3B1VA 1XX6A 2FNAA 5KDDA 2GZDA 3ONWA 1KI4A 3OIUA 3QKUA 3GMTA 3WNCA 4ZPXA 2XX3A 3AKEA 3C15C 3TSWA 4LRWA 4UNPA 4BFWA 4M9XA 2YVUA 4GNKA 5CB6A 2VSFA 4OI2A 4R9UC 4NCKA 2RAPA 1NSTA 1NY5A 1OXXK 3F5FA 2DFTA 1K6MA 1R0YA 4HATA 4DCVA 2R2AA 1ZYUA 4BFZA 1AQUA 2V6JA 2XB4A 1KDRA 5LB4A 3JZMA 5P21A 1E6CA 1S2MA 4GT1A 1EFUA 2HDNB 2IS6A 3CH4B 1TF5A 5J4HA 2J0SA 1O3YA 4C7OB 1N5JA 3CO5A 3SI7A 1P61B 3C4JA 4GP6A 4JLDA 2OCBA 3TE6A 1NBMA 4Q1DA 4X8MA 2WJYA 4BZQA 3TR0A 4M1OA 2QMHA 3VR1A 2Q21A 2SHKA 4MGIR 2XTNA 2MSEB 1J7KA 4DLWA 3I4LA 4CVNA 1IN5A 4II7A 3RS4A 2W2XA 3AKDA 1NL3A 4DDTA 4HUQA 1UBCA 4A0HA 1R5BA 2GXAA 2RGEA 3DZ8A 4Q7KA 2ZPTX 3ZZUA 2GJKA 5FOTA 3ZZTA 4C2TA 1YR7A 1VTKA 3PXGA 1DO2A 4GZMA 4B3DA 1W0KD 1L7VC 1SXJC 3AM1A 4M1SA 4Q01A 1P2VA 1XF9A 1XFAA 5EP4A 2O8DA 3RHFA 2GJAA 4OQFA 5AR1A 5F3WB 4LGMA 3BBPA 2WSSD 2IWHA 4RZ2A 3TSZA 2ZIAA 3I5YA 1FW6A 4GP7A 4YMUA 2Z0MA 1WRBA 1EK0A 2X19A 1XZPA 1CJKC 2FGKA 2WWWA 5HR5A 4C0QC 2MMGA 1IQPA 3M4YA 5JMTA 1OH6A 3CRMA 2J5XA 3KUCA 3VR3A 2RGCA 5DI3B 4U7DA 2ZRCA 2JGNA 4XOIA 3ZVLA 3RS3A 1T3SA 3U5ZB 1AKYA 5BN4A 4TL6A 1LV7A 4LUCA 2KB0A 1DG1G 2VPPA 3PFIA 4LHXA 4BGDA 1ELOA 3TIFA 3A36A 3BB1A 2FWRA 3T5GA 2DB3A 5H8WA 2QTVB 2FU5C 3E70C 4F4JA 4PO9A 4TLCA 5HPYB 3SJZA 3QVVA 2GILA 1VIYA 5BW8A 3MSXA 1YQTA 221PA 2IYYA 3A4MA 3GLHE 4JL6A 1B0UA 1DAHA 1PZNA 2JIZD 4I99A 4CEJA 2IUSA 1GAJA 2OG2A 3TVDA 4F7WA 1R0WA 2VEDA 1ZIPA 3QG1A 3MRSA 1XTSA 3GP8A 6Q21A 1ZP6A 2REOA 3THYB 4A0GA 2K5UA 4DLXA 1CRPA 4DXAA 5JI3E 3G5UA 1KSHA 2QY9A 1HY3A 4DIEA 2F55A 1R8QA 3EZFA 3K0AA 2Q6TA 4IVPA 2JLVA 5LDDC 4JZKA 2CHVA 4QBHA 3LX5A 4TMXA 2AX4A 4PSKA 4JBWA 4EQ6A 1ZM3A 3LY5A 2RGBA 4NL4H 1Q22A 1E3MA 4ITRC 2WMOB 5IF9A 3SOPA 4Q18A 2G3YA 3KL4A 1JB1A 1S96A 2WIBA 1ZUIA 3THXB 2FSHA 2XNDD 3L0PA 3THWB 4PC3A 1T0HB 4BRUA 2H16A 2BBTA 2W6IA 2HT6A 3SC3A 4BEJA 1AKEA 2B92A 2NQ2C 3L0SA 1G4UR 3LLUA 5DIFA 1F2UA 1I4TD 1HUQA 5EP3A 3AVVA 5TMPA 3OEED 3F8TA 1UEJA 4LHZA 4LZZA 1GSIA 4B34A 4G1UC 4W5WA 4AKIA 1VYVA 3VU9B 1Y63A 1DAEA 2ZRIA 2QPOA 1NP6A 3B5JA 2Q3FA 3K0AB 5GJCA 2R8RA 4UJ5A 3IUYA 3LNCA 4QRHA 3IILA 1D9XA 4JSYA 2ZSDA 3NXSA 1UBGA 4LV5B 2VH5R 4KXFB 4Q4JA 1IHUA 3GEEA 2ZQ5A 3H2YA 4TSFA 3P32A 2IBMA 4ON9A 2A5DA 4BFUA 1I4LD 4I1OA 1FP7A 3AGQA 1RKBA 4LDJA 1KZGB 5AJZA 1CR1A 1YZKA 3AVOA 4A92A 2FV8A 3B1WA 3NHAA 1A1VA 4WBSA 3ZLJA 3I3SR 1W0JA 3MCAA 4WZBE 2VP9A 1FPMA 1ZM9A 4QOSA 3LW8A 4TL7A 3KTAB 4DIDA 1OJLA 5JRJA 1N3BA 2J46A 1KSFX 3OE7A 1HQCA 3REFA 3SDZA 5JWRA 1RPZA 2QRZA 3VNVA 2G1JA 4YDHB 4PHTA 3QBTA 2VYFA 2NG1A 4G3XA 4DCNA 5FBWB 1E2LA 4TTQA 2GXQA 4BFTA 1HH4A 1WBBA 2BBSA 4KSBA 3AB3A 4JJKA 2ZROA 4A36A 1D9ZA 3DKPA 3QQ5A 1OFIA 1P75A 1Q20A 2P6UA 2B6HA 3HJNA 3SYLA 2ZSFA 4BLQA 4YMTA 3NKVA 3SBEA 3EW9A 4KFRA 1TQ2A 5HKKA 1E94E 3T1QA 1TF7A 2O0HA 3KJHA 3EA0A 4TMTA 3KJGA 3JVVA 2X2EA 3B9QA 4TYWA 2WWIA 1MV5A 3EAQA 3HDTA 4L16A 3DMNA 4PC7A 1P2UA 2QUZA 4WZ6A 4RZXA 4TLEA 3T35A 5JHGB 1DAGA 1E98A 1ODFA 4HAWA 2GAOA 3G0HA 3QENA 3K0SA 1B23P 5KO2A 3PQCA 1BMFA 2QRNA 2WJGA 5DLQC 2BM1A 4WXRA 1Z6TA 3OF5A 2YOGA 5KNDA 4OYHA 5CM8B 3IHLA 2XAUA 4G01B 4RD1A 2W2TA 4P4SB 4URUR 2WM9B 1OFHA 2CXXA 4A2QA 5BQ5A 3GFOA 1R5NA 1CF4A 3DOFA 4V0LA 1W0KA 1UFQA 1Z6XA 3KX2A 1KK2A 4C0KA 4ZCIA 3FDIA 1KHTA 3G82C 2PT5A 3U4QB 1Q3HA 5FH9A 5J5CA 3GLFB 4A9AA 1YR6A 2ZRAA 4JBYA 3JZAA 1E0KA 2E9SA 3KQUA 1UBEA 2GCOB 2QSZA 4HAZA 2WJHA 5CDFE 1SVWA 3B60A 5L3RA 4MKFA 5FUWA 4TN1A 3K70D 3KQKA 1AZSC 2FPLA 3SFZA 5C4GB 2FZLA 4OK5A 1US8B 5FUVA 4E22A 3HWSA 4RD2A 4RD3A 4NCJA 4B44A 3DZDA 1FX0A 2XSZA 3NBXX 3U61B 4F93B 1YE8A 3ZVMA 2XXAA 2XTZA 1N5KA 3AVQA 3KZ1E 4LCBA 1TEXA 2N42A 4PSVA 2N46A 5FR2A 4D81A 2RKOA 1SVOA 1FTNA 2YV5A 4XVRA 1G8YA 2DY1A 1ZCAA 3F3YA 3U7EB 2C2HA 1RJ9A 2NZ8A 2W83A 3K9GA 1VCIA 4RKEA 5EXSA 1CBUA 1N6LA 1QHHA 1Q57A 1OIVA 2BMFA 3NBFA 4FN5A 5CJ2A 1JXOA 3BFXA 5EQTA 1QZXA 2ODWA 2IL1A 2GRJA 3BFVA 1OE0A 2PZEA 4JSTA 3CNNA 4B47A 3Q5EA 1EFHA 2AD1A 5GJBA 2B7CA 1W4BA 1L2TA 3GEHA 1N5IA 2J7PA 4TLAA 1OXVA 1M8PA 2UZIR 1OKKD 1U9IC 1BOFA 1DAKA 1WDTA 3BORA 5J40A 4C0BA 2PJRA 3U3JA 3GLGB 1KOFA 1FUKA 4KYIB 5DO9A 3A1UA 1E1QD 2GDJA 2WPDD 1LF0A 4YLGA 1QHYA 4DSUA 2GBLC 2YWEA 3E2IA 1TUIA 4QGAA 1E4YA 1OLOA 2E87A 2FSGA 2BM0A 1DO0A 1AGPA 1VCNA 1KJYA 4JLBA 1Q0UA 3QVUA 2ZI5A 2ZXUA 2CE2X 3OESA 4GOJA 5J4VA 1QDEA 1E2KA 4IEIA 3W5JA 4C0AC 1VMAA 1XPUA 1OSNA 5K8IA 1CJTC 4M4SA 1ZD1A 2PEYA 4BFXA 3B82A 4NHOA 4PQRA 2ZSEA 2VBCA 2YWGA 421PA 4PSAA 4BLPA 2RCNA 3K0FA 2G0NA 4JVNA 1E2DA 2ZRKA 4ZIRB 1Z0IA 5KNCA 1II8B 2OFXA 4MYCA 4O2LA 3FOZA 2ZI9A 3KXIA 4Y0VA 1KK1A 3CIOA 5DN6A 3VMFA 3T1TA 2XXAB 3NIBA 1NBME 3FHCB 3KB2A 3EPKA 3QKRA 3RLFA 3CZPA 4TSFD 2OBMA 5JHHB 4CRWB 3SN6A 2MSCB 3Q85A 4MKGA 3X1DA 2PMKA 3TMKA 4B6EA 1L4UA 2PMDA 4NPHA 1EESA 3LVRE 3EWAA 1U9IA 3WMGA 1K5DA 3WYGA 1FNMA 1Q44A 1KY3A 2D2EA 1BYIA 5JCPA 1AS0A 1Z8FA 4AKHA 1II9A 2EU8A 5CK4A 4NH0A 1NN5A 2HLDA 4FINA 1Z0JA 2D7DA 4EUNA 1A82A 1KAGA 3W3AA 4B71A 1SXJA 3C7KA 2Q3HA 4EFMA 1JR3E 2GK6A 3JVUA 2ZITA 1JALA 3CKLA 1MRSA 3MJRA 4A2WA 4B32A 4A15A 2J59A 1BIFA 2ANCA 3NEJA 4JLMA 1CEEA 3FB4A 3T15A 1KMHA 2V7QA 3RSOA 5KUTA 3PR1A 4C0SA 1UDWA 4TLBA 4QXAA 2D2FA 4P32A 2XNDA 4P33A 4TQ9A 2F3RA 2O5VA 1S3SA 4HZIA 4PHFA 4GDFA 4C4PA 2IC5A 4DLUA 3AEZA 2PEZA 3LQQA 4P0TA 5G3ZA 3K70B 4NYMR 1OIWA 2IYSA 2ODEA 1XEXA 4OQLA 2OXRA 2RB4A 1HT1E 4CYMA 1NNEA 5JJLA 1X8KA 4Q4JB 4BASA 1NF3A 3ICEA 1E79D 1X8JA 2V1UA 3RRYA 1R4AA 1XNJA 3DL0A 4Q4HA 2WBLC 1QVAA 2XNSA 5IRCD 3CPHA 3FKQA 1R10A 1E9EA 4LJ7A 2TMKA 4NMMA 5JJIA 2ZAOA 4LV8B 3UWOA 1HA3A 4QL3A 1QHIA 4M9ZA 4EJSB 3LD9A 2HYIC 2EQBA 2GNOA 4QBGB 2PH1A 5JWHA 2A5GA 2ZI6A 3TW8B 1CR0A 1II8A 4GSYA 3CWQA 4EPRA 1VYUA 4LWZA 3GJ8A 2ZRJA 4B35A 4IVRA 1Q1QA 3SYNA 2F1HA 4IKEA 4HZUB 2HCJB 3DPUA 4PPNA 2CL6X 5E3HA 4KJZA 4RJLA 4KBGA 1G5RA 3CW2A 1W46A 4JMPA 4UXHA 3ADCA 1U0JA 1TU3A 4M1MA 5SZJA 2JLSA 3SHFA 3ADDA 2ZU0C 1IN6A 3BIFA 1FUUA 2J1LA 3L82B 4S35A 3CRVA 2C95A 2XZPA 3IHWA 1Z28A 3L0OA 1X3SA 3U4QA 2BDTA 3U6KA 2IYRA 3AF2A 1E2EA 4UKDA 3T1OA 4D4JA 4EPWA 5B57C 2ORWA 2QQ0A 5CLQA 4CEJB 3D31A 4FI3C 1XU4A 2LKDA 2V9PA 3CRW1 3QOFA 4I1VA 5IDVA 3CBQA 4ESHA 2DWQA 2DFLA 2CJWA 5AUNB 3EG5A 5CIWA 1HEIA 3LXRA 4L4UA 4KVGA 4BE7B 1DG3A 1NKSA 2A30A 4MYTA 2KBFA 4KITB 2JLUA 3I92A 2QMOA 4Q1EA 5SZKB 4B76A 2WAXA 4PC2A 1NI3A 2LKCA 4Q1CA 2V8OA 2ZJ5A 3LLMA 2IHYA 3N70A 3D8BA 2EFHB 3A37A 2ZSBA 3P1JA 3WRYC 4FXPA 3QKSA 4IXMA 3RWOA 3L8YA 3ECCA 5FPKA 1UJ2A 1TUEA 1OXUA 4QNMA 1AQYA 1Z06A 721PA 3FMOB 3OIVA 1I2MA 1Q1ZA 3A8TA 3R8FA 2J41A 4AG5A 3CF6R 3K8YA 1LS1A 2BEJA 4MRNA 1OXTA 3THWA 3GJXC 2F6RA 2ZRDA 3W34A 2H5EA 1IXSB 5D3QA 4MRRA 3ZIAA 4HDQB 4TTPA 4TT3A 1Q12A 1TU4A 3RVBA 3MJHA 3AP2A 3I1FA 3WXMA 4W7SA 5GVRA 2DFNA 2JEOA 2JASA 1GRRA 4UJ3A 2OAP1 1XCPA 3S1AA 1E0SA 1RFLA 4DLTA 1IOZA 2QAGA 4GI7A 5TDHA 2VRWA 4MDEA 1F48A 1P2SA 1ZRHA 5JFGA 4AYWA 2J9RA 2BOVA 5B30A 1SVSA 4IDNA 2G1KA 5CB8A 1G41A 4A8JC 1WE2A 5CM9C 1NG1A 3VFDA 2YOHA 1UEIA 1TQDA 1W44A 4IRUB 5J4LA 2NO9A 3LW7A 3NC0C 5HZHA 3QXXA 4PANA 2QPAA 2H92A 1D6JA 4RY2A 1ZMXA 1P3JA 3BE4A 4M22A 4ZCMA 2V3CC 1FQJA 1VYTA 3ZQ6A 1U94A 4U02A 1D2NA 4HAVA 4PQYA 1BS1A 1R5OA 2QU8A 3PUVA 4L9SA 4Q1FA 5K8LA 2QTHA 1MO6A 1NMYA 2FA9A 2CLDX 3W6NA 4HB2A 3NDBB 1AS2A 5ELXA 2ZS7A 1NLZA 4JYBA 3EZ6A 4QG7A 3RS7A 1ZD9A 2HCBA 1XTIA 3UG6A 2IYZA 5L3QA 4PAMA 1SZPA 2QQEA 1YR9A 1Z22A 5M04A 1GFIA 3IIMA 4CW7A 821PA 2NO0A 3NEYA 1A7JA 3ZYCA 3SBDA 1Q3TA 4POAA 1RVDA 4DB2A 4KU4A 4W5HA 3ADBA 1RIFA 3A1WA 2HT1A 1ESMA 2G9NA 4M1YA 3A4LA 1PLJA 3L8ZA 3U7HB 1Q1EA 3BWDD 1AJEA 2QMEA 2FJUA 1KNXA 3KQLA 2OBNA 2F9LA 2N1BA 2OUKA 2QMUA 2GXSA 3AKYA 3BXZA 3ZJYA 1XD9A 1W36D 2XEXA 2QG6A 3OEHA 5FBRB 4RD6A 4H9GA 1W36B 1RRPA 1E2PA 1F5NA 4B3FX 2QPTA 4NCIA
chains in the Genus database with same CATH superfamily
1M5TA 2VP4A 4MINA 4BNHA 4QVKA 1ESZA 2BFEB 2DBVO 4CEHA 1O97D 5AVJA 1IY1A 2G04A 4LGCA 3F4LA 4UNRA 1P0PA 3MTIA 3O8LA 1KH3A 5KSPA 1W25A 1ZHFA 4WRRA 2WWVD 3UJAA 1C3OA 5ED0A 4ZQEA 5DISB 4KFSA 3GAFA 1NQVA 1Z88A 1PR9A 2OCLA 2PQ0A 2VDNB 4MVJM 5KOJB 2Z04A 1NXVA 2J08A 1NWHA 5BPFA 5KWEA 1J20A 2C9YA 4MHOA 2PBZA 1P9NA 1SBHA 4CQMB 2A8YA 1XXHB 3SX2A 2VHQA 3FTPA 4YAGA 3NUGA 3LA6A 4I1SA 4IHQA 5G1NA 2GLUA 1QCCA 5FBVB 1U3CA 1UDXA 1Y4UA 3L7YA 4ZRDA 5GQSA 1XV5A 3KC2A 4JL5A 3SIRA 4WNAA 3RG2A 2BONA 2AYXA 1YI1A 4LDQA 3AEYA 4OGFA 2CW5A 2WT4A 3A3YA 2WY2D 4OB7A 2QTCA 1JDVA 2HPAA 3IV7A 2O52A 1U9JA 1SAYA 5IZ4A 1Q14A 2BGLA 4KODA 1ENYA 3PLAE 2NYRA 4DHWA 4I55F 3ZWNA 3WWEA 1M1YA 1V3QE 4X3OA 4EMBA 3KKEA 2JL1A 1I1HA 1DLIA 2LDXA 5L3ZA 3DAFA 3WLOA 4EHIA 5KNLA 4HAIA 4EBFA 3LKZA 2SBTA 1W73A 4RU1A 3UWDA 4YMGA 1LLFA 1GPYA 2AI2A 5NULA 2J30A 1ZUHA 1R1DA 2WKSA 3T12A 5BSKA 2EFEB 2ZRNA 5EUBA 4HDRA 1V39A 3HA5A 3NWJA 4MH0R 2Z3WA 3CX8A 2QA5A 3AU9A 4UHBA 3UMSA 1YL5A 2CT8A 3WHPA 2J32A 3FUTA 3SR3A 2IHVA 2OSVA 4PQFA 3M1IA 4R2JA 3RVLA 1WD7A 1U3GA 4HTFB 4CT5A 4I50A 3E23A 1WW2A 3IIKA 3TTYA 4A4DA 4CGZA 2Y2VA 4DJ5X 1WB5A 2JBWA 5C46F 3QELA 3A2MA 2OGUA 3CNLA 4L85A 4AWAA 4LBZA 3O0DA 2R25B 3TZEA 3Q1LA 2QX8A 1X2BA 2ZAIA 3I2YX 4IJ5A 4LXXA 5EINA 5E7IA 2A7QA 4EW6A 1VA4A 4PN7A 2W2OA 3TCKA 1D5WA 3HHPA 3GN1A 4DCTA 8ATCA 1JMVA 3K72B 3S7ZA 1UZUA 1BMDA 3BTSA 4EO9A 1UBRS 1ZU4A 3C2QA 3O7WA 3GRUA 3F1LA 4FEYA 1P7WA 2O4UX 2Z98A 2LWIA 3H86A 1HG1A 1BD4A 3RHZA 3UAXA 3SM3A 4HS4A 1Y4SA 4MULA 5KSWB 1P4RA 3G6WA 3GRKA 1NA5A 4IR7A 5LMNB 4MRMA 4QDXA 2PKQP 3V1UA 4MRPA 2OWEA 1BJRE 1G8AA 3PICA 5F1YA 5CK5A 4S0ZA 3RC2A 4KWHA 5LD2B 4E2FA 1RYEA 5KWJA 1Q83A 2DWUA 2XCRB 4RLQA 2A0UA 3H9QA 2FUCA 3Q7SA 4JJ8A 4U9HS 2QQGA 1M34A 3P45A 1R9GA 3P4XA 4YXFA 2XZOA 3K53A 1R8SA 3F97A 3JQ7A 3IP7A 1PJAA 2JK0A 2IXEA 1U04A 1PL7A 3H1GA 2OT3B 3KWJA 4NU8X 3PKZA 3AVXA 1QC5A 5DTEA 3RVPA 2W2QA 3O7MA 1E9SA 2GESA 2IGBA 4KPGA 1AF7A 1P6UA 5CNIA 1V95A 3VVMA 3WYBA 3DEKA 5EJ2A 2OKGA 3IBTA 1UT8A 2JNWA 3O8NA 3VYUB 1BFDA 3WRWA 1RZRD 2XVAA 1BX1A 2HEGA 5AH0A 1BHQ1 4PLZA 1NC3A 3RYIA 3S6JA 5KOHA 2Q9BA 3G1TA 4MAFA 5TQ2B 5LCXA 4Y6PA 2ST1A 4JLSA 3RRZA 1LK0A 4B8YA 5A9SA 2Y8EA 3AVWA 4WX2B 1MC4A 1WCXA 3E1KA 4OGGA 3RWMB 1JJAA 5ECDA 4QUGA 4U2FA 1HE2A 1CB0A 1S3GA 5EOVA 5JATA 1T5LA 2FRDA 3ESQA 3QOWA 3VJLA 2FFHA 2FF5A 2AXEA 3JD4A 2OXTA 2X0FA 1Q21A 3CCFA 3QPUA 5GMOA 5H9VA 2DFVA 4FX2A 2Y4NA 5T4BA 3W06A 4N5HX 4US2R 4CCYA 3M6VA 2AG6A 2JH9A 5LKAA 3TZCA 3IVRA 3UF0A 5JLJA 4GQAA 1T34A 3U6BA 2O0JA 1X9GA 3B9PA 1NOKA 2AE1A 4O4IF 1PX2A 3QHPA 5DHPA 3TUJC 3U48A 1XLTC 2XLCA 4XVQA 4C6HA 1E32A 1NLMA 1TNDA 1XWIA 4H7EA 4NK5A 3AM4A 5JSUA 5JS1A 2VDJA 2DETA 2ISCA 3PEWA 4BXOB 2A9PA 4ZV7A 1VRWA 3HR8A 3VPSA 2GN2A 4D99A 4ZHQB 5JNSA 2Q6LA 5CFRA 2PE5A 3A58B 1XTBA 3AINA 4GZLA 1V2GA 4KCGA 2OV6A 5JZOA 2BHSA 4DCSA 3JAWB 4IDPA 4O5OA 5DYIA 1JHUA 5CYOA 4YY3B 1Y82A 4CMEC 4IHJF 3AHDA 4U00A 4H15A 3EOAI 2EZTA 3CO0S 4WZZA 2VFAA 2YNMC 5GOZA 4TSRA 5AJXA 5IT5A 5KYWB 4XIYA 5AVOA 4Q4HB 2H57A 3W05A 4PFSA 5ESXA 4EABA 4AY2A 1VI2A 3E81A 4YRDA 3E5HA 1GRQA 3KYCA 5JVDF 1X9HA 3EQ7A 4HG2A 5F1KA 4X1IB 1BKYA 1GYQA 1DX6A 1JR3A 2F43B 2F9FA 2VLIA 3MAAC 3RV4A 3I9JA 2IW3A 2HU7A 1FRQA 3HXPA 4JKIA 5K3DA 2QVYX 3MCTA 1CUIA 4TQGA 2W48A 4YRAA 2Q27A 1ISGA 4V0OA 1L7DA 1C1YA 1YFZA 2B30A 2H7YA 1JNYA 2WZBA 3E4CA 2X7HA 4OBEA 5A5GA 1JR6A 2CVPA 2G28A 4IUYA 5KU1A 2L18A 1VBNA 1HRDA 3I9V1 4W6ZA 2LCFA 3WA7A 4FYMA 3OQOA 2XBUA 3U9TA 3PX7A 1NSYA 3ZKAA 2IYNA 1GL7A 2VTBB 2JANA 4M89A 5D3MB 3T06B 2YBDA 4C29A 4KPFC 4PHCA 3S0JA 1VPVA 4KXYA 1C1XA 1NE7A 3GUCA 4QBIA 1E2QA 5AKHA 2G09A 5EIOA 3QH4A 4IIJA 1LZKA 1L8OA 1WD5A 3ELUA 4J7XA 4JU8A 4RVFA 3SU8A 7REQB 5EKUA 5AVVA 3NRCA 1GAQA 4IGFA 4ARVA 5CB0A 4AD8A 4EUSA 2PD6A 2VBGA 3B9BA 1PZEA 1DCFA 4DWOA 4DXDA 3ICOA 4QPCA 2DFDA 1OQAA 3T4EA 2W2KA 4I6EA 3N0TA 2Y9PB 3G2OA 4N0MA 1DKOA 5KCMA 1WPGA 2O1EA 3KOWA 2IE8A 4CPDA 4RSMA 4LJ4A 3HNOA 1B42A 5DP1A 3VR5A 4J7UA 4WPGA 3R9KA 1N5LA 3O94A 2J07A 4UDOA 5DMHA 1KO1A 1N8KA 3OQHA 4WSOA 1II0A 1P6QA 3DDUA 3N2GB 4AY4A 4XGKA 5LWHA 1GYRA 4PAQA 3VNAA 1CF2O 4US1R 5IEBA 4PHGA 4X41A 1M8KA 2Y71A 3CKKA 2BD0A 4HAXA 3HFGA 1QHNA 1Z6YA 2B1GA 2Y27A 4PQGA 2H08A 5BSHA 5JCJD 3BRQA 1F3LA 3PIRA 5FNVF 5SYAA 1QRRA 5F52A 1H3FA 1ONBA 3TRKA 3JQAB 1GOTA 2P5TB 4D25A 1P77A 3DEIA 4OREX 5TC4A 1FOEB 1OILA 2XD9A 1LI4A 3SNKA 2J5RA 2QTRA 3U44B 3GCWA 3D8NA 4OLHA 4LX8A 3A27A 5INTA 1X39A 2H9IA 1P62B 2XMZA 2ACKA 1ORTA 5CXXA 3D6UA 3KJIA 3PCXA 4Z0TA 2ZUTA 3R74A 4Q4DA 1VRVA 5HBRA 3FCOA 5LQNA 5B4VA 2XHZA 3H2HA 4C7JA 5K8CA 1YD7A 3B78A 1QIGA 2QE7D 1K4YA 1SO8A 3DJFA 1XTRA 1XEWY 2D0PB 3EIQA 1HC7A 5FBKA 3HEMA 2C4TA 4RSHA 1X7XB 1XMXA 4G4SO 5AOAA 1WXXA 3LFHA 4CL8A 1J49A 3QIVA 3ZOKA 4EB8A 5LMCA 2YWCA 1LK5A 2P7IA 2DUJA 3OIYA 3PTLA 5F7OA 1E2IA 2I99A 4GD3Q 3GJYA 4W6QA 1MQ9A 3U17A 4L8LA 3OD5A 3UFBA 3AFMA 1CUSA 2FPOA 3HMKA 2W5UA 2CJYA 1JJFA 1GNQA 1PAUA 2GYYA 3D0RA 3ETDA 4FCWA 4GQBA 4HGNA 4RULA 1V4BA 1WL8A 5I5EA 1JLRA 2ZRMA 3AVPA 2NPFA 4C1NA 4FEEA 3IP1A 3EXG2 4QYMA 1JYSA 4TV9B 4EL5A 3VH2A 5FTMA 2QZ9A 2ZSHA 2WVAA 2XTAA 5HS6A 1FS6A 4N0DA 1R6VA 3GRPA 1ZCBA 5DBIA 3EW7A 4U9IS 1QCYA 5ALGA 3PCTA 4DR3B 1XQWA 1OAOC 3TGLA 1V41E 2WF5A 1SK9A 2I3BA 1SXQA 5MFZA 5TIIA 1JIXA 2JI8A 4TN5A 2GASA 2WSMA 1QH0A 4OUDB 4YFYA 2ID9A 1UXHA 3BCSA 4UZSA 3T7DA 4MVJE 4EUEA 3RYCA 5BWBA 1L1QA 1E99A 4V2IA 1SJ9A 2I3AA 3W1EA 3OMLA 3ASVA 3F5SA 3WP0A 1R7RA 1U0LA 2D00A 3HCEA 1XRJA 3QW2A 4OHMA 1D1SA 2IDMA 2YJGA 2H2DA 5C8VA 3QUSA 5DH9A 4ARIA 5K3EA 1CHNA 3D3NA 4A10A 1QFJA 2BI7A 3DO5A 1YC2A 2Y05A 4AUNA 4EGFA 2ZYIA 1KR2A 1E6KA 3QPBA 1CU1A 3CJQA 5IJ9A 1A7KA 4IJ6A 1K1EA 4JIMA 5DBHX 2QQ5A 2OC4A 5MF6A 2EW2A 4WY8A 4DZZA 2PKXA 1Z38A 4FDTA 1WIWA 4PGAA 2YYAA 1XRQA 2FOXA 1KE1A 1DMSA 1SIWA 4DUGD 4FILA 4NJOA 1M2JA 3BGWA 3C3XA 3IAAA 1HLGA 6PFKA 3UXMA 4P4UA 4QT0A 3U81A 5H1YA 2QN8A 7GPBA 1XK7A 1ZJ5A 3PHCA 3TQOA 2J45A 3I83A 3PNSA 1IZ8A 2FPIB 2DJIA 3RC3A 3H42B 2NO7A 1PZGA 5KOIA 1PFWA 1CNMA 2Q49A 1TPZA 2ZYAA 3BXXA 2G8LA 3OZ7A 5JC8A 2WPDA 9GPBA 1YVPA 1QIDA 3HYLA 4M49A 4WQMA 3EZ9A 3ZVNA 3AF1A 2OZEA 2C4MA 4HQLA 2B8TA 1D6NA 5BOSA 2O8NA 1FS4A 2W2VA 1JHRA 2CMGA 1D5CA 1PK8A 4RADA 5IK2A 5DBOA 4YRSA 3IQHX 4WZBB 5BV7A 3IOEA 3EXFB 2W2LD 3WDKA 1WSWA 4TMWA 5TF4A 2C78A 4TMVA 4G0XA 5E9QA 3TRIA 4QGHA 3M0EA 2C3UA 2EV9A 3KFVA 2DXIA 3OAAD 1EX7A 1N0UA 1E5DA 1U8AA 3Q6IA 5BO5A 3ZVRA 3IJRA 3JWEA 4AG3A 5I8WA 2AEJA 5CCDA 4MJ7A 3FWYA 3GLUA 2VHTA 4R1UA 4IIGA 4UASA 1CUEA 3FROA 1Z36A 4AX8A 2WICA 4WY5A 2ZE8A 3QU5A 2EWVA 5DKFA 5JC1A 2VDUE 1GAXA 1GEGA 2KBEA 4O1MA 3A14A 3EGIA 2P0AA 3ON5A 2PT9A 3I0MA 4MUGA 1VP9A 4U5XA 1O94D 2WF7A 3FUVA 1I1QB 1MQ8B 1NJSA 2F62A 3DDHA 4FNAA 3GRYA 4NU6A 2AC2A 4M1ZA 4Q93A 4JVOA 4R7TA 3WL6A 4B6JA 5AHKA 5LQAA 4INJA 5JVDA 1X13A 4MS3A 3L8HA 1Y7LA 4P4LA 3G2PA 5BURA 1CEXA 4O08A 4TUYB 1P7ZA 2B8JA 3E3AA 1IATA 1E9BA 4HP8A 1QIEA 3TD9A 3LY9A 1Z7EA 4QOGA 1KI9A 2GZ1A 2ZIXB 4DLNA 3L3BA 2QE6A 1JMYA 1WXHA 4XVUA 3GGOA 1JFFA 1ZESA 4JENA 4OHFA 3ED1A 4UPEA 4HYQA 4DADA 4BX8A 4HAUA 4PYIA 2R4UA 5DYWA 3W78A 5AQEA 3W2IA 3TTVA 1N5DA 1HKHA 4ZOLF 4HX9A 2DHEA 3RSQA 1H69A 4BATA 4L8WB 4EX7A 2ZYGA 5F9FA 4C0JA 1CZOA 4WFKA 4ZC1A 5JNRA 3MD0A 1T8UA 4XWAA 3WKBA 1YDMA 4G0QA 4RJTA 1BYUA 2BHLA 2Q5FA 3HBMA 3HCNA 4RCYA 3TAUA 2LNDA 2RIRA 4QNRA 3VHLB 5EZYA 3W5DA 4N3AA 1FBNA 2C9CA 3AEQB 4M87A 4NJMB 5G4KB 3UXEA 4ZO6A 4DZRA 4ZV4A 1KI3A 3NMUF 2IYQA 2C61A 2VP5A 3R1IA 5AM0A 3AU8A 1A9ZA 4L73A 2CGEA 5KX5B 5EJ5A 3QSGA 3HJBA 3G8CA 4PS0A 1U2GC 2ZRBA 4ZC8A 1E1QA 2BV3A 4IFBA 5ADUS 5CJJA 3RRFA 2FQWA 4HNVA 5D5QA 2NM0A 4YAFA 4I3HA 2X8JA 3PLRA 4LHWA 4Z1OA 3GPIA 1DRUA 2XYRA 3HDVA 1O4VA 3MGGA 5ESDA 4N9QA 2H1FA 3PFGA 2IH2A 2H7VA 4CV2A 1JS1X 1QIFA 2XQVA 4UARA 1XVTA 3F90A 2M1ZA 3PENA 3VGJA 2PU5A 3AESB 4EUHA 3A1SA 4XUDA 4ZAYA 2XITA 5K0GA 1KY4A 4LHYA 1P2GA 5AK5A 2AK3A 1S3FA 1PGJA 2O2ZA 3TTWA 1EP9A 1H2ZA 3HA7A 2QRHA 4LRQA 1W94A 4R69A 1EUCB 2E4VA 4B43A 2QBYB 4NFHA 4H0CA 3GXOA 4BNDA 4B5LA 3DUFA 1ML3A 1T8WA 5EWJB 1K7EB 5C8YB 1AH2A 3PFWO 1GQYA 2FKAA 4L15A 1A4IA 2OXCA 1FVXA 3FIUA 4JI8B 1E6LA 1HE1C 1X6VA 3NGLA 1L5ZA 4LE0A 1JJVA 4LF4B 1YQQA 4Y1RA 1ZL0A 3TW0A 3TG8A 5DM2A 4KXWA 4OXIA 5FFNA 1JDTA 1CUCA 5DHRA 1R00A 3TCNA 1UADA 1KOGA 1TMGE 5J2UF 2FMTA 2N75A 3BICA 5E2AA 4J0KA 4B7XA 3F73A 1OV4A 1MPTA 2D62A 2JLQA 4BDSA 4YJ3A 4LEIA 3EIEA 2VWPA 2QENA 4LV6A 3M6UA 1KOLA 4B3CA 5ILGA 5KSZA 3WNQA 3W8DA 5TY0A 2YHIA 1GY8A 4FUTA 4LC1A 2DPLA 2X1MA 3KYDB 1JAHA 2O3RA 2IEAA 5JTTA 5A6SB 2FPGB 1MA3A 3NGXA 1NY6A 1DFHA 3DFKA 4MQUA 1U0FA 5IXYA 5DSTA 1J4AA 4C0XA 2QI9C 4TTRA 1T5DX 3EAFA 1MABA 4X65B 3Q2OA 4MVXA 4YXWA 1G7CA 2XUKA 3LSYA 2QXUA 3F2IA 4R1LA 3K0EA 4CF7A 2O14A 2ONCA 3AQ4A 1GTMA 1T6YA 1U90A 2J0UB 2J3HA 2PBFA 2V7GA 3IB6A 3MB8A 4HLUA 5TQ0A 1TZCA 1HE8B 4J29A 4JEUA 3V1KA 4P84A 1QPZA 3LQ2A 1KFBB 1PWYE 3PXUA 2P6MA 3E2PA 1I7PA 3YASA 1V71A 4OFZA 1G8GA 2V7XA 4ZRMA 5FJIA 4A5OA 2DX7A 1EE1A 4IZHA 1JQBA 3AEUB 5KKCA 5CB4B 2I34A 3LCVB 2HXGA 1H1LA 1SD1A 3ILXA 4IJKA 3HXOA 2WTMA 3C24A 3LH5A 3V7UA 2IXFA 1JJ7A 1TFRA 2ZVPX 3QE0A 1MRZA 1Z25A 3GBVA 1CIPA 2G4VA 4EMTA 1P33A 4HSEA 3CM0A 4NX2A 4GXNA 3VH3A 1MU0A 1SUEA 2PLRA 5E6RA 2CNOA 3WLEA 4A8JB 2QXYA 4QPDA 4U1RA 5DNCA 3PUXA 3H1AA 3UCFA 2O8CB 1NVAA 1GR1A 3OX2A 2OILA 2BUBA 3AL3A 2P91A 3HG7A 2BZSA 4LFBB 3INNA 1W30A 4KVZA 3TW4A 1IOVA 4V0MA 4OHYA 4WK6A 1E9RA 1B8VA 1GKYA 4U8HA 4D98A 4ZI3A 3MWEA 1J8MF 1PWHA 2IYXA 4UHDA 3SS7X 4ICIA 5F7ZA 2NU8A 2YXLA 1MH1A 4V3BA 1D6SA 4TRNA 4B1FA 1VSQA 6REQB 1MVLA 1YR2A 3RUFA 1KBOA 2AFHB 3LDAA 1RC8A 1SHJA 2PZMA 4MYHA 3H19A 2EGHA 5I4CA 4KRXA 3ZWKA 1TZ2A 1XQ1A 4IRXA 1NYRA 3A6KA 1YAJA 3N53A 2HTEA 1F4VA 4NZZA 4RACA 5IH7A 2W11A 1J0AA 4OBWA 3OVMA 3K6KA 4S1VA 1MORA 2Q1YA 3BVPA 2A3RA 4GMGA 3MGCA 1U3UA 2AB0A 1UM8A 4HEJA 1CVRA 1Z4IA 3I64A 3FCYA 1XJ0A 1YIOA 1WBDA 3FDJA 4MTCA 1J9ZA 3V1MA 3ZJ4A 3LBIA 4AULA 1I94B 4P93A 4R1PA 3PHLA 5IHPA 2R8ZA 2REBA 4RKFA 4RGQA 4NE2A 4RIIA 1ECBA 4S2EA 4QDUA 4ZREA 4BZWA 4ER6A 2TMYA 4Z4GA 1KMMA 3WZLA 2V58A 4MVJH 3G2IA 1ZRNA 3ND7A 4H59A 1GZ5A 5EY5B 1KVSA 1RDFA 3QVGA 3ASUA 3KQVA 3W1VA 1RD4A 1M6HA 4XB2A 5HMLA 2VPWA 1IN7A 3ZU4A 2W8BA 1DRKA 2E4AA 1P19A 2X8LA 3BH0A 1ZA2A 3NEAA 1ZMRA 3NRJA 3Q2KA 4FMCB 3HJUA 4IZOA 4ZEVA 3M4JA 3K1ZA 3TZQA 4HQNA 1EFTA 2XYVA 2ISQA 4Y9SA 2IV7A 4F9GA 4M54A 2GEDA 2OV4A 3GRZA 5LNK6 1UK7A 2H4JA 1MNQA 1E1CB 1K5HA 3MQ2A 3CVVA 2ZVJA 1RSZA 2IH4A 4BKRA 1W36C 5C32A 4LCJA 1NHWA 3TPFA 3PYLA 1EXMA 4BV2A 1CIJA 2G83A 3ZGOA 4MDFA 1G7RA 4P4NA 2JAOA 4EG8A 3TZBA 1VHJA 4HWOA 5EJGA 4EO4A 2ODPA 5EWMB 4XWWA 1I1OA 1KTVA 1YK1A 3CLVA 3K70C 1L4LA 3H8SA 4XW2A 2VC2B 3G2MA 1BFKA 2Y1LA 4LPSA 3B7GA 2RGAA 4I9NA 3EDOA 2OV1A 4XM1A 4UPDA 3TL6A 2CSXA 1YASA 2PRSA 1T6ZA 1IH8A 1CZLA 5JZ9A 1KPGA 1M54A 3ZDXB 4KX5A 4D57A 2QP3A 3G2NA 2IHZA 4RTKA 4XKJA 1WA5A 3PR2B 1N9ZA 1KGSA 2NXJA 3RBXA 4N8DA 5BQOA 4CQLB 2IYVA 2JAUA 5ALFA 2JFBA 3OPXA 3UANA 3TJMA 1PU2A 3DMGA 2H7CA 2RB5A 1NSFA 5C1BA 2DFPA 1ZJ4A 1QGOA 2XODA 2JLZA 2G1PA 1X1TA 3UKOA 3ZWDA 2R60A 1G60A 1BRTA 1O08A 4B3RB 3FYHA 1OPRA 2J9ZB 4WFIA 5KJ1A 2NQ8A 4EY8A 2P2ZA 1YRQA 4WZAA 2B82A 3MXTA 4N54A 1P0MA 1JSXA 4JX9A 1S2LA 4P38A 2PIAA 3EH2A 1PJLA 4HPJB 3U0VA 3EUEA 4LPKA 4DRXA 4XB1A 4FWTA 3KXLA 4V0RA 1NBAA 2QROA 3BX1A 3CVJA 4RLHA 5G40A 3ZBQA 5E6UA 5LYJA 4Q47A 5LM3A 4DLTA 2PL9A 3IMEA 4K9MA 4X44A 1A69A 3AG6A 3B13B 4ZKDA 1OI7A 1N2IA 4LYFA 3L1HA 5KSYA 2YUIA 1XEAA 3FWPA 1SIUA 1LLDA 1T0IA 4NJEA 5SYNA 1Z82A 2O2CA 1CUXA 4IQFA 1F4PA 2WKQA 1NG9A 1NUPA 2Z2XA 1TEZA 1YZNA 3WWCA 1L5SA 1P9LA 4U6QA 4Y0NA 5KNCH 1GPAA 5B3LA 1JX6A 3BMOA 3I5AA 1GTG1 2W8BB 3H5OA 4UE6A 3TW8A 5EIEA 3ZOZA 1C2YA 4L74A 2PLNA 4CIBA 2JH8A 2GPSA 5HQTA 4O02B 2ZM6B 9LDTA 2WJ3A 3DEJA 4OQYA 4AN1A 3N74A 5K05A 4CTNA 2CHGA 2PGIA 1FMLA 1X92A 3CRQA 2O8BB 5IMBA 4X5OA 3M6XA 5CBKA 2ZUBA 5LP6A 2VTDA 2W6ID 1ZSYA 3IEUA 3MC1A 4HJRA 2ZYTX 4NYJQ 3TD6A 5ALMA 4DSTA 2RH4A 4ND5A 2QVGA 4AZ3A 2VYVD 1A5TA 3KZNA 2DQ4A 4OSEA 1J0EA 3DYIA 5D6OA 5DLDA 4F9FA 4URVR 3B7PA 2YY5A 5HKKD 1WXQA 3RRMA 1TL7C 2R79A 2V54A 1EI9A 3B1KA 1FVHA 3PPIA 1QH1A 3LRPA 4DA7A 3IDFA 3V8PA 1WCYA 3HV0A 1GL3A 1F0YA 1MDFA 4ZJYA 2QU7A 1KZ7B 1M6YA 4IIJB 4ZCLA 5AK3A 2GN9A 6ABPA 3WJAA 1E9DA 4OGKA 2I62A 1F6BA 3C43A 1FDIA 2QNRA 4BRWA 4I8XA 3B6KA 1MFPA 5TMEA 3PXBA 4EY4A 2R5FA 3E8MA 3C16C 3EC7A 5JMOA 4WUTA 4O63O 3W5CA 1Y8RB 2X14A 2CSUA 4QPPA 1LFDB 2H2AA 2HSJA 1B3RA 4HUJA 4PAOA 5HZMA 4EA9A 1TJNA 3G68A 5EERA 1ULHA 3RYTC 1IM8A 1A9PA 5BN1A 3SC2A 2YMLA 5BSRA 1AKUA 2QTGA 2H1SA 2P65A 1U0EA 3O4GA 4HUQB 4CKXA 1UKZA 1E61A 6GPBA 4MQEA 5FBQB 4BBJA 1NN3A 1IY8A 5GONB 3BD9A 2ZWOA 5KCZA 1EH5A 3JQEA 4DA4A 5ERXA 1KZHA 1AK2A 3MBIA 3HR4A 3IDQA 3AP1A 4PTZA 3GFFA 4BPBA 3J7AC 4J0DA 1G16A 1QONA 3I8SA 4KVFA 2V03A 1H8EA 3SHVA 3LOQA 1G1AA 3DVAB 1FXWF 1Y1LA 4HLNA 5BUZA 2O8DB 2NV0A 1G3IA 3CRNA 1TEHA 4B6OA 5LLTA 2YIJA 1NVFA 3ZWCA 3ROKA 3L8CA 3W7BA 1RI4A 2C04A 3DDNA 4UHEA 3S7TA 4XYBA 4A0SA 3MUEA 3OT4A 4OL0A 4I5IA 3BB3A 1IWOA 1E7MA 3MFQA 5KTYA 3WGMA 2P9QA 1I30A 2XTMA 1IPHA 3AP3A 2OLKA 4XWYA 4ND6A 4JC0A 5JNWA 1JXMA 3G0OA 2QTWB 3KVOA 3NDRA 3ZHBA 1V16A 1NRXA 2V6FA 1H5QA 2UZ4A 3DBOB 2C99A 5LXTA 2V0NA 2OC9A 1XF1A 4Q1AA 1D4AA 2QF7A 5FHRA 2GZAA 4KUEA 4QGFA 4C76A 4MYDA 4Q1BA 1P6XA 4NOLA 1DHTA 3EIWA 2A57A 1HE4A 4MUBA 4OBXA 4XTRA 2AOWA 1GLVA 1YDEA 4YCDA 3ND6A 4J4TA 3K96A 4MGHA 1COWD 2NACA 2QTAA 2ZUUA 3GFTA 3OQVA 3PSHA 4FHCA 1GV0A 2RGUA 1DJOA 2VG8A 5HX7A 4AVYA 3OQIA 2YCLA 1KJ9A 2H85A 2YHAA 4IX1A 3LI2A 1L1EA 2GJ4A 3HCWA 1JDBB 4HVAA 3CZAA 3N5CA 1A2QA 2HU8A 1AMOA 3GZTB 5L95A 2WHPA 2JC3A 4MQBA 3WGQA 4X8LA 1E60A 4Y98A 1N4AA 1U2DC 2ZSAA 3GJ7A 1ZD3A 4GRAA 2RIPA 1KI8A 2H1IA 2VK2A 3PUZA 4NP6A 4IY1A 3U3ZA 5LKRA 4XD7A 1WKBA 4IWYA 5CDFA 4PFQA 5LU8A 1MX9A 4G0WA 5FFFA 2ONJA 5K8VA 1MX3A 1XDGA 2P9BA 1SQ6A 4B6QA 1PV2A 1ZNZA 2BCGY 2EFDB 3JQDA 2DQKA 3O9MA 1YDGA 2X0DA 4ZN6A 4GZ6A 1BVRA 1E2HA 1OC4A 1L5VA 5AK0A 5FOWA 1JTEA 1XBTA 1PFVA 2IT1A 4Q9LA 1TD1A 1TJPB 2IPLA 3P9NA 2JJ8A 2JFQA 2O20A 4AAYA 3P8ZA 3FDZB 4HL6A 4UATA 1W2GA 1TMYA 2FAXA 2ZTSA 3GDFA 5EJ6A 1GILA 3KZXA 4FGJA 4M9SA 2EX0A 5JJKA 3KEGA 1YKSA 4K5QA 2EFCB 3EQ6A 3HM9A 5EWMA 1H9BA 1CNEA 3V9AA 1XNQB 3C3DA 4DR2B 1KAMA 3FMIA 2Q5HA 4ZO8A 3ZU6A 4YP9A 4E1AA 5EHZA 3LUDA 2BVNA 3QK7A 1UM9B 2PZFA 3TR5A 3L0YA 4I55A 2AOUA 5CD1A 1AG9A 2ZXFA 4GECA 4K9RA 1IUPA 3H9GA 4NWIA 1VJ5A 4OJKA 3W2FA 4MR8A 2OHJA 1JDJA 1JIKA 2H6EA 5C31A 1RZVA 1X1EA 3ZK7A 1UKEA 1W4CA 2XUAA 3IBCA 3PXDA 1Y5IA 3U4HA 3BZUA 2JH3A 4PQEA 3I4CA 1GUZA 2IXGA 4DMRA 2WSBA 4RK5A 1VJCA 4ZU6X 5HZKA 3IPCA 4H4CA 3KWMA 5F76A 1GUAA 2R86A 4X66B 3AR2A 4LY9A 1L4MA 2APJA 4BVJA 4OXRA 2MTBA 2VO1A 1HE5A 2VN8A 2PVCA 3ADKA 3KLBA 4RV9A 4HFMA 4B48A 3DUWA 1W85A 5TT0A 1TA4A 4C4OA 3EXFA 3PLNA 3TQCA 1Z2CA 2QZSA 2V74B 2FW1A 2QD3A 3FPFA 1R0CA 4DT1B 4HUTA 2O2EA 3CPSA 1OU4A 1HETA 2AN3A 2GN0A 2OSBA 4UNSA 1DXQA 1KFJB 4V03A 2IV3A 1JR4A 3E9MA 1CUJA 1SB8A 2ZB3A 3GLHB 3H9EO 3PP8A 5EGSA 4C2AA 2AJTA 3BWCA 3S2EA 4J43A 4BLOA 2I1QA 1UBUS 1RTKA 2IXBA 4B3HA 4FMPA 2GM4A 2BLNA 2I4LA 1QF7A 2IZOA 5CU7A 3VGPA 5IG2A 1GGNA 3LGSA 3OJXA 4BLRA 5IULC 4HFNA 5KSOA 4FU0A 4Z4EA 1K6XA 1R8YA 3UT0A 5KNDH 3Q3IA 1OV6A 4F91B 1CQWA 4WCFB 3D8UA 4DRXB 4EJSC 4QEKA 1SKQA 1CJBA 4J90A 5TGTA 5L3SA 3AVUA 4FW9A 4R2IA 4UMDA 2CLHB 3RUIA 5CAEA 3DQPA 2WSSA 3NLLA 3IPXA 3R3XA 2W70A 4IOKA 3MWKA 3BQNB 4FFPA 2LCIA 4Q9KA 1ML4A 3WNBA 3IMKA 5IJZA 5LP6B 1O9GA 3QXCA 4QQRA 1HKUA 1VKNA 3DZBA 4JI0B 1G63A 4ENVA 5LQJA 4X54A 2PLFA 1XZKA 5CIQA 4LJ6A 4LN1A 1DSSG 4BB6A 2PS9A 1JTFA 5I6DA 1XMIA 2AA3A 3Q2IA 4N1AA 1M9NA 1ZVQA 1CR2A 1WKVA 1XD2A 3IP3A 1LI5A 4O2BA 1JAIA 1PV4A 1JR3D 2NZJA 3HXMA 4MP6A 3DXYA 3F74A 1MTZA 1CY4A 4K3UA 1K8ZB 5DNDA 4YB8A 1ZN2A 1ZW6A 3KTAA 5HKBA 2IYLD 4NEQA 4YC7A 4GL2A 1JAZA 1SUFA 1TTQB 2CK3D 2E48A 1I1NA 2WVJA 4PF1A 2C77A 1KKMA 3TRDA 1CRQA 4IOJA 1NNSA 2G0AA 3KKOA 4O4JB 2C58A 2CNWA 4XQGA 3B2EA 4M55A 5AKLA 1M74A 3FNBA 4DB4A 2WINI 4NG5A 3J81k 5DGTA 1LNZA 4OI1A 3VX4A 1HNWB 3L06A 1E9AA 4RTNA 4BFSA 1TDJA 4ND7A 2X5JO 3QU9A 5FBZA 3WJ7A 3IO5A 3ZQJA 4ZHQF 4B2LA 1ZEMA 3WLPA 4DYDA 3T3PB 1K63A 4G5SA 4NZMA 3ZCRA 1DIHA 5ISMA 2E37A 5FTLA 5AW0A 3B85A 4ILEA 4EHKA 5HJEA 1CULC 2FFQA 3V2GA 1ZLXA 4BGIA 1E2FA 3AONB 3NKLA 3SQWA 5ITZA 3O03A 1IY2A 1XXHA 2XGSA 1T2CA 3DBHB 4QLBA 4I2VA 3A1DA 3IAM1 3KRTA 3IGFA 3EF1A 4J8PA 2MSWA 2OOSA 4QO7A 1Z62A 3FHTA 2I6FA 3P2JA 2FDCA 3OKPA 2VHUA 1T8SA 5HBGA 5L4NA 4PPGA 1NBOA 1U2ZA 2F4NA 2QUBA 3GZ4A 4P86A 4AP5A 4XRRA 1WQ3A 1LQUA 1N6IA 2XUGA 3FBWA 3NBAA 4OUDA 3UK2A 4ES6A 3LC7O 2OL4A 1UQTA 4GOMD 5D84A 4EOGA 1KYWA 2FW8A 2W6JD 1NNLA 3OEEA 3GFSA 1A9SA 3LXMA 2DOKA 2HREA 4BO3A 5BMVF 4GG1A 3I32A 1EX9A 5DBFA 4OU5A 3GCZA 2ZI4A 2ZRFA 4YUAA 3COZA 1USKA 2VPXA 3K2QA 2EG9A 2A5JA 1NFRA 3V1NA 4LYYA 1LDBA 5CT8A 2KLBA 3OCWA 4W7HA 4D9GA 3CU5A 2WHPB 3HCCA 2CMDA 3PHIA 3FPHA 4CMIB 4C7OA 3CEJA 3EGEA 4JDPA 2R1TB 4YWHA 4D42A 3L1JA 4L4SA 2HJVA 3GFPA 4DSNA 2J3JA 2BH2A 1P72A 4XIIA 3UK6A 5CDYA 1PNTA 3Q9UA 1HDGO 2F1IA 1O8BA 1SUAA 1N0VC 2W2NA 3AL2A 1RP7A 3SIPA 3RSFA 3TVTA 1XP8A 1IM2A 1KNQA 1YUMA 2IEBA 5HOEA 3QELB 2ZIWB 2VHYA 5B58C 4A3SA 4UREA 2ASEA 1W6UA 1TUGA 1FTGA 1EFVB 1NOIA 2RG1A 3EWSA 3QLTA 5M2QA 2G72A 7YASA 2VHCA 3DBRB 1GSOA 1Z8NA 2JFYA 4DIFA 5KNCD 1X8XA 1V16B 2Q8PA 4TL8A 4WXHA 4EIWA 2D3TA 3D7RA 3KQOA 1UANA 1JT2A 2H48A 1KDTA 1SCBA 2QTMA 3FLAA 4RTLA 5KYKA 1WSAA 5IC6A 4LYJA 1SHKA 3QXJA 4DJTA 5I7EA 3H1EA 1ZGZA 3ZWQA 2VJMB 1JLKA 3QVMA 4BQSA 1M33A 4MI1A 1U1IA 1JE0A 3OM8A 2IA5A 5CPBA 5DM60 4BC0A 4L5YA 5C5IA 3FSGA 4Y2UA 3ZW8A 4DMKA 3DBIA 4RV5A 2XWBF 1L7RA 3LDHA 3NATA 3ZE0B 4DQXA 3PEYA 4MUXA 3WZMA 2YNMA 3HY3A 4RMHA 3CNOA 3VX3A 1WDMA 2B4KA 1WDKA 4TMZA 3QEOA 4DLVA 3R6GA 4HOYA 3LRTA 4UBJA 4BUJA 4LYDA 2RHDA 1WF3A 2EVWX 4RIGA 3PC8A 1BHSA 3PGVA 1GNRA 3AEQA 1VSBA 3I53A 3ZJUA 1KP2A 2VJQA 8OHMA 1NURA 2LIPA 2XCLA 2XDYA 3OTIA 2CMHA 1COZA 4HN9A 3SFTA 3OFKA 4GE0A 4CL2A 1U2SA 3KR9A 5EVJA 1ZKMA 2XDAA 1AXRA 1N0HA 2WTBA 2AUNA 2ZR9A 4F11A 3KD2A 5JAUA 5JXIA 2W6ZA 5SY9A 4WCDA 3TXYA 2C7BA 2HV8A 3R0XA 3ZXYA