4GMDA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
203
Chain Sequence
TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/inhibitor
total genus 77
structure length 203
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmdA00
1KK0A 1SXJE 4LI0A 4YXWD 4FIDA 3EC1A 3O47A 4NHOA 4YXWA 5JS8A 5KUTA 2RAPA 2RGEA 4IOKA 1OYYA 4KITB 1R0WA 4M9ZA 1VHLA 2WMOB 4G5GA 1CULC 3DVLA 3I8SA 2AK3A 2JATA 4IDOA 1N0UA 3LV8A 1LV7A 1BS1A 1UKVY 4HATA 2OXRA 2QM8A 2ZITA 2RGCA 2REBA 1JEEA 2PX0A 1NJGA 3AVQA 3X1XA 4UNPA 4DDWA 4FINA 3AKEA 3SN6A 2CCKA 5FOVA 5HCIA 2Z0MA 4OI0A 1XMJA 2QORA 1E4VA 2LCFA 1CTQA 3GFOA 2RGBA 1GG2A 2IUSA 3WXMA 3U4QB 2AWNA 3KKMA 4AD8A 3KL4A 1CIPA 5JBQA 3T35A 4EFMA 3SJBA 2OG2A 1UFQA 1UKZA 4TMXA 3SDZA 1YR8A 1D5CA 2QTVB 1OW3B 1HEIA 2I3BA 2QBYB 2Q3MA 2IYUA 2P65A 2HJVA 1E69A 2JJ8A 2P6RA 1SXJC 1YHNA 5EP4A 3QKTA 4Q1BA 2JJ1D 2PL3A 2QI9C 1VYVA 2JJ1A 5KPJA 3MSXA 1HE8B 5EUQB 3SOPA 1AQUA 2WIAA 3GMTA 4X8HA 2Z83A 2JLSA 3LX5A 4HDQB 4PSVA 3RYTC 3BH6A 4DCUA 1W7AA 1VTKA 2ATVA 3IQWA 3SYNA 2Y8EA 1B23P 4BFVA 2VP0A 2ZREA 2NIPA 3A37A 3QPWA 3F0TA 1W0JD 1Z0KA 2VSXA 1S0UA 4G5SA 1G21E 1N0VC 1JXOA 1W0JA 5B30A 3CRVA 5C1BA 1W47A 4IOJA 3VMFA 3GLHB 2NO6A 1Q1BA 2FA9A 4GPTA 2BCGY 4JVMA 1E79D 4HAYA 1ZBDA 1JBKA 1E79A 3LVQE 3WNBA 3BOSA 1US8B 621PA 3KKNA 3RHFA 5DI9A 4D6PA 2W83A 4QM7A 1FUUA 4MKGA 1Z22A 3ADCA 1CBUA 2ZYUX 2V1UA 4C2TA 5DNYB 1TL7C 2YOHA 4XSHA 2BMEA 4PXAA 3WMGA 4XVRA 2QP9X 1UBGA 1TPZA 3GFTA 3L8ZA 4II7A 3K0FA 3K9HA 1M7HA 2ZR0A 3KB1A 3TK1A 3C7KA 3ICQB 3KB2A 1IONA 3CX6A 5DN6D 3W6OA 1KSJA 4BASA 5DN6A 1L7VC 5J4HA 3BFXA 3QKSB 4O2RA 1SVIA 4UQOA 1N25A 1TQ4A 1XFAA 3HR8A 3VU9B 1KGDA 2GCOB 3SJAA 3TQFA 3BAFA 2IYLD 4IEIA 5JJIA 2FZ4A 1YE8A 4B74A 5M04A 1P60A 2OT3B 1KJWA 1MT0A 1OFTA 3AKCA 2IBMA 4ON9A 3U7HB 1DE0A 5EE5B 1NG1A 4XSGA 4YMVA 3U7FB 4GP6A 1ZJ6A 4IOMA 4R9UC 5H1YA 1VG8A 2ZI9A 3DO6A 3EW9A 3FKQA 2KBFA 3MWYW 2QPAA 2BWJA 2WM9B 4V03A 4OI2A 4QHSA 1VIAA 1NN5A 2GJ9A 2BKEA 1XNJA 4PO8A 2G1KA 4G01B 1TUEA 4H9GA 2BM1A 1VPLA 2QGNA 4D82A 2IS4A 1OSNA 4HAXA 4LDJA 4LYJA 3IILA 3VKGA 4OI1A 1P2SA 3G82C 3TMKA 4TQUS 5TY0A 2OHFA 2D74A 5SZHB 2IS6A 2HJGA 4XVUA 3GP8A 3HYRA 5TV2A 1W36B 2A7QA 4V0KA 3SR0A 2WWYA 2YZ2A 4QJ3A 4CZ2A 3THWA 3LDAA 3M1IA 3KKOA 1SHZA 4NCKA 3B1VA 1GKUB 3RRYA 2O5VA 4B48A 1ZP6A 1XD9A 5TARA 3TH5A 3K9GA 2QM7A 3PR1A 5KU1A 1AQYA 4IRUB 3CF6R 4L5BA 2FPMA 3U3JA 2FGJA 1UKEA 2A5YB 2D06A 2XNSA 2YOFA 3THOA 4A15A 2YV5A 5JECA 4LPSA 3EZ9A 2VL7A 2NMVA 2B7CA 2VF7A 3TR0A 3BC1A 3ADBA 4F92B 4DLSA 3D31A 4R2HA 2EFDB 1SVSA 1W49A 1E2JA 3A1TA 2GAOA 1ESNA 3GLHE 4BE7B 3LLMA 4A0GA 1OHHD 4JYBA 3DOFA 4QKQA 1DAFA 1OHHA 3GEEA 1HYQA 4YDHB 3QY0A 3NBFA 1UAAA 2ZROA 2EYQA 3HU3A 1J99A 3NVAA 4Y0VA 1JJVA 3CWZA 3KDSE 4L4UA 3P4YA 3RABA 4MGYR 1NVWQ 2YJTD 3L8YA 4BLSA 4CT4B 1ZM7A 4NYIQ 2WJGA 4DLYA 3B1YA 2CE7A 1YR7A 2GF0A 4WAUA 3LO5A 5JMTA 4DT1B 3MJRA 4H1UA 2CHVA 3QUSA 2PJZA 2PH1A 1NVVQ 5SZKB 2NO9A 3WHLA 1NG9A 3BK7A 1GNPA 3EZFA 1L8QA 2NZJA 1VECA 4QG7A 5C4GB 3WBJA 2OFOA 2V54A 2ZRAA 3TIFA 2G88A 2PT5A 1DO2A 4OQXA 1SVWA 2WJHA 1W1WA 2C99A 2Q9AA 3WBKA 4CGZA 4R98A 3K53A 4DEYA 3CNNA 4EKDA 2ZI7A 2A5FA 1RRPA 2F9LA 1G3UA 3AP1A 3SEAA 4PPGA 4D0NA 3U60B 2C9YA 1QHHA 4D25A 3VR2A 3THYA 3HP1A 2A5DA 4YMTA 5LBIA 3LBHA 4FW9A 4LHYA 4RY2A 4CEIB 4AY2A 2JCSA 2ZTSA 1R6BX 2CHQA 1QHXA 1ZRHA 3DM9B 5LD2C 4ZIRB 3QKRA 2G0TA 1ZCAA 4GZLA 4JJZA 2R65A 1XF9A 3PUYA 2QSZA 5L3VA 4M21A 4TTPA 1GVNB 5E95A 3OIWA 1ZD8A 2V4ZA 2A9KA 4DVGA 4LX0A 3RRNA 1Z0JA 3MLEA 4HB0A 3AKYA 2IS2A 1JQLB 2I4IA 1OXXK 1UBEA 1OIXA 1X86B 4NH0A 2WKPA 1NL3A 3I8XA 4M2LA 2J41A 4I1SA 1V43A 4M9QA 5IT5A 3AF4A 3C41J 4BGDA 1P2VA 3CO5A 1P4SA 2P5SA 2AX4A 2VP9A 3I73A 1KZGB 1UEJA 1Z07A 1XXHB 1M2OB 4JL8A 1DADA 2ANCA 4B2IA 4B44A 4CEHA 4MYTA 1KSGA 4TL7A 1KI8A 5CLLA 1Q22A 4NKRA 3DL0A 4G0NA 3LNCA 1IY0A 1P9WA 3G5UA 4PSAA 3VHLB 1KI9A 2PCJA 3NBZC 1UDXA 2VF8A 4KYUA 2MMCA 2F43A 2J1LA 2NOAA 4DCVA 1TX4B 5FBQB 1NY5A 4YMWA 4Z54A 5JJKA 4NCNA 4JLDA 1FL9A 4P3YA 3IDQA 2CL0X 1PLLA 3PXGA 5AUNB 3NH6A 2MSDB 4RD2A 1HQCA 5FOWA 3A1WA 2OO7A 3H84A 2F55A 3Q8XB 4TWZA 3W8RA 4LHZA 2ZJYA 3RC8A 1A2KC 2WMNB 2XZPA 5KNBA 2DWPA 4LY6A 4N0EA 1MO4A 1RE0A 4ESHA 4GFDA 3EZ6A 1HA3A 1ZNYA 2CJWB 2FN4A 4HLDA 5AJVB 2IXGA 3U44B 2VHJA 3AKDA 4C7OA 2OLKA 5CLQA 5J47A 1CU1A 2BBOA 2ODEA 4V0MA 3AF0A 4HB4A 5EZ6B 4IJMA 5H70A 1O3YA 4KODA 3WNDA 3V4RA 1XPOA 2J46A 3SBEA 1FNMA 1G3RA 4IDHA 4BFWA 4U7DA 1KDRA 2A3RA 3I62A 4MA4A 3RS2A 5CM8B 4U02A 4NU0A 2FJUA 3WNCA 3TUZC 4OHVA 4CF7A 4EFLA 2GHIA 1R0YA 1EXMA 3BGWA 1L2TA 3FVQA 5JSZB 1IN7A 1VCIA 1Z6AA 1SVOA 1RW4A 3CBQA 2J3EA 1YZNA 5DYGA 1K8RA 2B6HA 3WRXC 4B73A 1RKBA 3R7WB 4ZO4A 4IEEA 3NC0C 3QF4A 1FZQA 4OQNA 5JLJA 1QVRA 5C46F 2CCJA 2J0VA 2ODNA 4FWIB 3X1YA 4IHQA 4P33A 4A8JB 4PQFA 3THXB 1TUIA 2V6IA 3P20A 2REXB 1NRJB 4OHXA 1G64A 1ZM4A 5AJXA 3CPEA 1FTSA 1Q12A 4I4LA 5L3SB 1E2FA 2GK7A 4HZUB 4QGHA 1HE1C 1F2TB 3K0AA 1N5LA 4A0FA 1C4OA 1AS2A 1E98A 3FHOA 3QOFA 2Q3HA 2RGGA 2W0MA 3TUIC 1NN0A 1QRAA 2VO1A 2O8BB 1HUQA 3A1SA 1TF2A 3B82A 4RD0A 5JWOA 1KK1A 2QMOA 4LK2A 3K0EA 3DKPA 1D2NA 4RZUA 4Z1MD 2IYWA 2HUPA 3H0KA 4GT1A 4RJLA 1L4UA 4Z1MA 4ACBA 4WW0A 5KNDA 1BKDR 3H86A 4QJ4A 1E2GA 2Z5FA 3VTKA 4DDUA 2C9CA 4RSGA 1JEDA 1KMHA 1Z08A 2WVJA 4LC0A 4Q9IA 4K81B 4A4DA 3IUYA 3GLFB 4O0MA 2ZSBA 4FMDF 3SHWA 1GKYA 1HURA 1NP6A 2V9PA 4UNSA 2TMKA 4C30A 4DRZA 1OIVA 1QHIA 5GJVC 2EWWA 2X2EA 3ZZUA 3RS4A 1HH4A 1N6IA 1CF4A 2BEKA 4DIDA 3B13B 2VHUA 1M8PA 3QVVA 2P2LA 1HQYE 3UMFA 3CH5A 3JVUA 5HKKD 3DPUA 1GNRA 3SJCA 5G41A 5HKKA 1E1RD 4HSEA 5CJPA 1EGAA 2GNOA 1E1RA 4JYCA 4MUBA 3MWJA 2VIIA 1A4RA 4GOKA 4M9XA 1S9HA 5A0FA 3QXHA 2ZYWX 3K70C 3IGFA 4B43A 1WF3A 1NIJA 3GJ3A 4TQ9A 4RD1A 1JNYA 2UKDA 2GRJA 2FFHA 1IXSB 2CMKA 4JT2A 2Z4SA 1C9KA 5E7JA 5JRJA 3PFIA 4HDOB 4L9WA 3HPRA 3WYGA 3FKSD 4Q4HB 2DWQA 1Z8FA 3FKSA 2J45A 1W2GA 4FCVA 1DO0A 4DB2A 2CL7X 1LB1B 1MH1A 4LJ4A 3ZS9A 1OT3A 5KPDA 4A2WA 2ZE6A 2GJKA 4DCTA 3I5YA 1GL9B 4QOSA 4O3MA 3LRPA 5EE9A 3IEUA 2IEYA 3QXXA 4ZKEA 1QVAA 2B21A 4JL5A 5IHPA 1OV4A 1WMSA 1II8B 4XOIA 2XNDD 3B6EA 3FOZA 4PQYA 1KSHA 2XNDA 1FMLA 1E2IA 4MUAA 4PC2A 2IXEA 5FL3A 4CYMA 2OFWA 1AN0A 4P4UA 1J2JA 5DH9A 1GP2A 2HXYA 3PVSA 4GZMA 4B33A 1H8HD 4PSKA 2QROA 1H8HA 2ZR7A 5JWRA 1GAJA 4QJ5A 3KXKA 1U0JA 1AS0A 1JPNA 1TEVA 1NKSA 5FBWB 1J8MF 2ZUDA 4LGMA 2EFCB 5GJCA 4UJ3A 2C78A 3P1JA 1NVXQ 3WYFA 4OK3A 4X8OA 3S1AA 2RGDA 3VX4A 1T9HA 421PA 4AG5A 1CR0A 1VG1A 1WRBA 3LH5A 1G7CA 3NG1A 4GI7A 3VQTA 5L3QA 3L0PA 2JGNA 1KIMA 1N6PA 3AF2A 2JDID 2FFBA 4QL3A 1WCV1 3RNLA 1ZNZA 4D0LB 1A82A 2JDIA 1NN1A 4AKIA 1HY3A 2Z43A 3NXSA 3RS7A 3TKLA 2FSFA 3V00A 4JJKA 5CB8A 1VYUA 3K70D 1RRCA 1AS3A 2Q21A 3EA5A 4MKHA 4I81A 5TXGA 2F3TA 4AKEA 2VYFA 2BIFA 2XB2A 4LPKA 4QBFA 3KTAA 4DXAA 4MGIR 1GSIA 3E5HA 3W8NA 5FUVA 3AVVA 2VBCA 4DLUA 1GRQA 2ZRGA 4TYPA 3VX3A 3GLGB 3O8CA 1G6OA 2IYZA 4B47A 2O8DA 3CNOA 4JSYA 2EU8A 3PUXA 2DCUA 3M0EA 1GTVA 2B92A 3UG6A 4D80A 5GADl 4ZDWA 1DAGA 3B5JA 3CRRA 1DG1G 2ZU0C 3GLFE 2CE2X 2EFGA 4LRWA 5DI3A 4A8JC 1II9A 3TE6A 2ZRLA 2QRZA 2SHKA 4GOXA 3CLVA 3HJNA 3PIRA 4X8LA 5JWHA 3EASA 1IQPA 4Q4AB 4NMMA 4NTZA 1E99A 1ZUNB 2ZJ8A 1NBME 1LS1A 1XCGB 2FX3A 1Q57A 3SNHA 3BERA 5JCPA 4DKXA 3B85A 4CEJB 5C2JB 3EX7C 2ZVQX 1YZKA 4EPTA 2HV8A 2JJ2D 2QGZA 3W9YA 1Q21A 4QHYA 1BYUA 1JJ7A 1G291 5DGXA 1M7BA 2JJ2A 1AZTA 3Q5EA 5HZHA 4QBHA 1ANKA 3GJ0A 2PZEA 4PC7A 2QE7A 1IXRC 4DWJA 2NPIA 4LYFA 4Q9LA 2F7SA 2ZRDA 2XZOA 2H8KA 2IYYA 2A5GA 1ZIPA 2WV9A 4EIWA 2IX3A 1JAHA 4FMCF 2O52A 5KTYA 4K46A 3DM5A 4NYMQ 4BLRA 1XBTA 2ATXA 4GNKA 2WWXA 4TLBA 1OB2A 1ZM9A 2BMJA 4Q7KA 3QE0A 4DSTA 4PC3A 1J8YF 2AK2A 1R0ZA 1XEWY 1Q1QA 3B9QA 1IN4A 4PAQA 1N6LA 4Q48A 3N5CA 4A1FA 2ZI4A 3BD9A 1I4DD 1G8GA 1LW7A 3A8TA 4C0LA 1NLYA 2G83A 2KB0A 3K09A 3Q85A 2ZJBA 3EG5A 2OBMA 4HLCA 4LBYA 3U6KA 2C9OA 4KBFA 2CVFA 2FSHA 1OH5A 3EARA 2J0QA 1X8JA 1QDEA 1XJCA 2QTFA 5FUYA 1E32A 2GXAA 1CR2A 1S3SA 2FFQA 1GKIA 3B1XA 4M1OA 4F93B 2MSEB 2GAAA 2DFLA 3TQCA 2VHCA 1XD2A 1LVGA 2X77A 5D3QA 1XTSA 1U0LA 5JEDA 4L8GA 3DOEA 4TZ6A 3QPUA 1F2UB 4Q66C 1J70A 1E0SA 2X19A 1Z29A 1SHKA 1VDZA 2VP2A 4MYUA 2QY9A 1U2RA 2O0KA 1X8LA 2NGRA 3ETLA 5ELXA 1K5DA 1AA9A 2IC5A 4WXRA 4CVNA 2Q6TA 3R9WA 3B8HA 5HPYB 1KYIA 3DMDA 2W2TA 4RKEA 5C18A 2IYRA 2C77A 2FE4A 4EPXA 1IN8A 1TADA 3CX7A 3KQLA 1DG3A 3EZ2A 4ZI2A 4EJSB 2ZAOA 4RD4A 3ZYCA 2BBWA 3NBXX 3DMNA 2VRWA 3MCAA 3GJ7A 1T5IA 3KX2A 4D2IA 3FTQA 1E9DA 4JLJA 1Z47A 2GXQA 1TF5A 2ZIAA 1P72A 2JLZA 4V0NA 3QKRB 4PC1A 5K8LA 3A1UA 1E0KA 1COWD 4KV9A 5E7MA 5E7IA 2IYVA 1COWA 4URUR 4G5RA 1AJEA 2FNAA 1BYIA 4OK6A 4TN1A 2JLXA 4B34A 1P61B 4EDHA 4DB4A 2VH5R 3UIEA 4NPHA 5FPYA 3TJZA 2RH5A 1NBMD 1LY1A 4Q18A 1NBMA 2KWIA 5FTNA 4F4IA 2PT7A 3VNUA 3ZQJA 3KFVA 3PITA 2PEYA 3GCGA 1R7RA 2RKOA 2QAGC 5DHAA 1SQ5A 2QG6A 1M34E 2ZUCA 5CDFE 1SVMA 2O8CB 3ZH9B 1W44A 2AD5A 4JKIA 3R9IA 4CEHB 2OBLA 2ZE8A 1ZUIA 4UJ5A 2GZAA 4DEXA 4BRWA 3C15C 5L3RA 3FMPB 3GPLA 1XTIA 4TMZA 2PJRA 2ZYVX 4Q00A 2BMFA 4BFSA 3OHMA 1YZGA 4ZCIA 3I72A 2XSZD 1Z06A 3A4NA 3RDPA 3U3RA 1S1MA 2XSZA 4OKSA 4FMDB 1MO5A 3GJ6A 1RRGA 3DEFA 4NZYA 4TLDA 3ZZ0A 4Q5IA 1T8TA 3ZIAD 4AK9A 2WOOA 3ZIAA 1T3LA 1VYTA 1PUJA 4TQAA 3W34A 4OHYA 4Z8YA 1P3JA 2ZSAA 3DKVA 1OXTA 3MRSA 2QT1A 4S2EA 3C14C 3U5ZB 4ZCLA 4ARZA 5BN4A 4JBXA 3BJIC 2D3WA 4GMXA 3RSOA 4JLKA 1SXJD 3D3QA 3GJ4A 4IDNA 1SXJA 1ZAKA 3RRZA 4R7ZA 2GVZC 3D8BA 5FBVB 3T1TA 5B2ZA 2HT1A 1N6OA 2JAQA 5KHOC 4V02A 3O8DA 5B57C 2YKGA 1ELOA 2CCGA 3RWMB 2MSCB 5KSYA 3BB1A 1YR9A 4DUGD 3LQQA 1QHYA 4DLVA 4W7SA 2ORIA 4DUGA 1ZW6A 2ZXUA 1W4RA 4IDPA 5LB2A 2Q0HA 2JLVA 2IW3A 4Q01A 4Y0AA 4O2LA 1TQ6A 4TMKA 2QAGA 3QG1A 1GZSA 1EFUA 1KMQA 3F3YA 3T1VA 5KO2A 2KE5A 3TLXA 4TMWA 3NH9A 2ZM5A 4AI6A 1G16A 2UZIR 5DLQC 2F3RA 1EFHA 1YKSA 4M1SA 4DSNA 3A4LA 4RZ3A 3FDIA 4OBEA 1MOZA 3EPHA 2N42A 4BWYA 2NPFA 1Q20A 5HTKA 5BQ5A 4MDEA 1P9RA 1SKYB 1V5WA 1RRFA 3AB3A 3B9PA 3KKPA 3VKHA 1FX0A 1S1CA 4PTLA 4XIGS 3SFZA 4M1YA 3DDCA 5DISB 1DARA 5FUWA 5FOSA 2WJVA 1ZCBA 4NCIA 3ONWA 5AJYA 3RS3A 3UK6A 3SQWA 2D7DA 4B6EA 4BFXA 3IBYA 1D9ZA 2E9SA 3CKLA 2D7CA 1IN5A 4IOLA 4WVFA 5JRZA 3B78A 2FSIA 4TYWA 1KI3A 2B7BA 2R8RA 4JLOA 4A6PA 1MABB 4Q1DA 4XD7D 2PZFA 2O8FB 4XD7A 1R0XA 3GJ8A 2DPXA 2QP3A 1AKYA 2IF0A 4P4SB 4ERNA 1WB9A 2PBRA 5CDFA 1QG2A 1WQ1R 5FH9A 2H92A 3FMFA 4OJQA 3H4MA 1KI6A 4EJSC 5P21A 4C3ZA 1DTSA 5D3MB 4MDFA 1VG9B 2FZLA 2ZPTX 4B2LA 1MR3F 1Q0UA 2BMDA 1RYHA 4LJ8A 2O0JA 4LJ7A 4HUQA 1Z6GA 2YHSA 1TU4A 2JLUA 1YZUA 1D2MA 1TAGA 3CWQA 1DPFA 1PLJA 3UMSA 3VNVA 1RVDA 1T3SA 3H2YA 3CR7A 3K9NA 1WE2A 4ZDJA 1R4AA 1X6VA 4TZ0A 1F48A 4QNRA 3GLIB 1GOTA 2ZRCA 4D81A 4GL2A 1UM8A 2WSMA 5BWMA 2C8VA 3X1DA 2G6BA 1TQ2A 4HLQB 1I2DA 4RZXA 2PEZA 3VR3A 4YC7A 3TUJC 2CXXA 4WZ6A 4RFSA 4BZQA 4EPRA 1Z2CA 2IYXA 3MFYA 4HAWA 3SZRA 3IEVA 2Q3FA 5EXSA 4NYIR 3LW8A 2RMKA 5EP1A 2BV3A 4EQ6B 1CJKC 4HZIA 1FMJA 4TTRA 2IL1A 1XMVA 4GDFA 4I1UA 5CYOA 1NVVR 3C5HA 2IUUA 2ZJ5A 3OIVA 4AG6A 5KYKA 3U7GA 4TLEA 4ZDKA 4HLUC 4FMCB 1IXZA 1Q3HA 3NBYC 4Q1EA 3RSLA 2P67A 4WIAA 1XCMA 2CBZA 3AV0B 1DEKA 3AH8A 3OEHD 3EPJA 1P7CA 3KUDA 4Q02A 3U3MA 3OEHA 5FOXA 1ZUHA 1LF0A 2BEJA 4QBIA 3VHXA 4O25A 2QMHA 2ZRJA 1G7RA 2VPPA 1CJTC 3ZZTA 8OHMA 2C04A 3KXLA 4YLGA 4BZPA 3U4QA 4OHZA 2AD1A 3U6BA 2IA5A 2QU8A 3QBTA 1TEXA 4RFVA 5AK0A 4TL9A 4HAUA 2J87A 4TSFD 4B3CA 2QBYA 4TSFA 1VCNA 2AFHE 5JI2E 4UKDA 2YC4C 4PZZA 1YZTA 3QEJA 2VP6A 1T91A 1XEXA 2H7VA 3AEZA 5FR2A 5FPSA 3W5JA 3HWSA 5UKDA 1P5ZB 3SQXA 1AK2A 1L4YA 1VIYA 4KLNA 2VSFA 3WHKA 3T61A 3KUCA 1W46A 1G20E 5TVKA 4AC9A 5LPNA 1YJ5A 2AKAB 4Q9HA 4ESVA 2GWHA 3LBIA 4MH0R 4LV5B 1XD8A 721PA 3EC2A 1N2CE 2FV8A 3LWNA 4A92A 2GBLC 3NEJA 3R20A 3U3KA 2AR7A 4PPQA 3EA0A 4LHWA 3REFA 1GL6A 1JR3E 3GLHA 2G3YA 5JI3E 2ZRNA 4UNRA 4BEBA 1KDTA 4F38A 3Q7QA 1US8A 1RJ9B 4NDZA 4JKYA 1W36C 1N0WA 3W3AA 2ZVPX 3FPAA 4DLZA 3TSOA 4XTRA 4XWAA 3A6PC 4DLRA 2ZR9A 2GJAA 2ZRBA 3UWOA 3VR5A 1Z63A 2K5UA 4J0QA 2FPKA 3BB4A 1EX6A 5KSZA 5A4JA 1GM5A 5AUOB 2CNWD 1P73A 1R5OA 2ZQ5A 2CNWA 3P26A 5G3YA 3SYLA 2IS1A 1Z0AA 5KDOA 1NLZA 2ZE7A 5F3WB 4LV8B 1E94E 3LY5A 3T06B 5FI0B 4KFSA 1ZU4A 4V0LA 1FNNA 3QKSA 1KO7A 3OIYA 5F98A 3FMIA 4JLBA 1SZPA 2GESA 4M9SA 1PV4A 3PCRB 1H8ED 2ZU6A 4HI0E 4NONA 2GJ8A 4AURA 1W2HA 1E2KA 1H8EA 3VU9A 4B76A 1XZPA 3L82B 2GCOA 4LYHA 4AYXA 3LQRA 5C4MA 4KAXA 5EXXA 1AGRA 5JJLA 2YWGA 1CRQA 3V9PA 2ZJOA 4XWKA 2YVUA 4C4PA 3HPQA 3ND9A 1QG4A 3FE2A 1GNQA 1XU4A 1AGPA 1IJFA 1WA5A 1Z5ZA 4XVQA 2FEOA 4P32A 1SULA 1N6KA 2OCAA 3CW2A 1BOFA 1DOAA 2WWFA 3RAPR 1KO8A 2QA5A 2XXAB 4LC1A 2BM0A 1CS4C 2QENA 2QZ4A 3CUEF 5FOUA 3P4XA 2CL6X 2GXSA 2QNRA 1WDTA 2ZE5A 3LXXA 3H1TA 5FUXA 3WRYC 3WMFA 1ZVQA 2AL7A 4KFUA 5CB6A 2ZJ2A 3N2IA 4M22A 2GBLA 2YINC 4K8OA 1E9EA 3B1ZA 1G3IA 1XJQA 5A5GA 1FP7A 3DZDA 1XPRA 2XTMA 1G3QA 1ZIOA 4Q1FA 3UMRA 3CF2A 1P9NA 3CB4A 3RS0A 2YWHA 2HXSA 1W4BA 2C5LA 3OIUA 2ZRHA 1U99A 1W4AA 2C98A 3CRQA 3FFAA 2JEOA 1E2NA 1NIPA 2ZANA 3WY9A 1XD2B 3QSYA 1RIFA 1DAHA 1OE0A 3PJRA 3HR7A 1GIAA 2E1RA 3BXZA 4KSBA 1G8HA 2DFTA 4MGZR 1WP9A 1T0HB 4OJKA 4B2PA 4QM6A 2XAUA 3A1VA 2VP4A 3CPHA 1XXHE 4DHEA 2RCNA 4Z8XA 3ASZA 2IYTA 3PEYA 5FOTA 1A7JA 3IBGA 3Q3JB 4BLQA 1KI2A 1U90A 1JQJC 1C1YA 4KJZA 2H18A 3KFXA 4LCBA 4BFTA 3U61B 2NO7A 4AIIA 1E0JA 1XTJA 2BOVA 4NE2A 4RD3A 4BRUA 3CPJB 1EFTA 2Z4RA 1OB5A 2XB4A 1J90A 3I32A 4G5QA 4YDSA 1VMAA 1D6JA 2VSOA 3CH4B 4B35A 5FBRB 3O8RA 1XWIA 2OCBA 4JLNA 4LV6A 1XTRA 1U98A 1KOFA 3LXRA 4LJAA 3TSWA 1ZM3A 4LJ6A 4TMVA 1WBDA 1F3OA 4IFBA 2V7QD 3W3ZB 2OUKA 2V7QA 3I92A 4EPWA 1RYFA 4XTCS 5G53C 2OBNA 4DSUA 4R2IA 1KK2A 1XMSA 4JLMA 1QZXA 1XTQA 3PUZA 2JLRA 4AYTA 2OAQ1 1HT1E 1RZ3A 3SE0A 1VG0B 4DT1A 2GKSA 3ZD7A 1IM2A 1JB1A 2A2ZA 4C0KA 4Q19A 4L15A 3PENA 1FW6A 2CLDX 5GJWC 3RWOA 3MGCA 3KQNA 4QBGB 1KAOA 1Z6XA 3RANA 2C95A 3PUWA 3QKUA 5JEEA 2AFIE 2R6GA 2GK6A 1VCMA 3AVOA 5EXTA 1KDOA 1XX6A 1TQDA 1ZD9A 1KKMA 3PUVA 2IWRA 4CIDA 3T1OA 1P75A 3NEYA 3MAAC 3SHFA 3MWKA 2CLCX 1YRBA 1N6NA 4TL6A 5F9HA 1Q3TA 2XZLA 4US1R 3K0SA 5SZJA 4W5HA 4HUTA 3Q5DA 4B3DA 1DELA 4TTQA 4CEIA 3K0FB 3LW7A 3EXAA 5KOYA 3G0HA 1D9XA 4G5OA 4HDCA 5CIQA 2FGKA 1ZNWA 1SVKA 2W6ID 2Z6VA 4ZIRA 3OESA 2W6IA 4D0GA 1E2PA 2R2AA 1DBSA 4MRSA 3I1FA 2OESA 2QT0A 2BKUA 5AJZA 1T5LA 1VKJA 2Q9BA 3CX8A 2VA8A 4U5XA 4PZYA 1MV5A 2RGNC 2G1JA 1XDBA 2HYIC 1QBKC 4QGGA 2ONJA 4CW7A 2AXNA 1OXVA 2FEMA 3D6TB 3TW4A 1W5TA 2RHMA 2GDJA 4PC6A 2UVQA 3C5CA 2GTPA 3AVPA 5GJBA 3RC3A 4E07A 1G4AE 3C8UA 4KFRA 4IFEA 4MRRA 3ASYA 4AKHA 1PZNA 2IHBA 4HB3A 2AXPA 4WBSA 2QQ0A 2ZRKA 4C0SA 4DSOA 4JLVA 2VHQA 2DHRA 1CP2A 3E70C 3QI2A 4NBSA 4M0LA 3CR8A 4IVQA 2GXUA 1Y63A 2DB3A 1MRNA 1TMKA 2FU5C 4UXJA 2X1VA 1EWRA 3EAQA 4NYJQ 4XJXA 3SU8A 2OE2A 3VAAA 3OAAD 2ZSEA 2W0SA 3AM1A 3OAAA 3ZQ6A 2V8OA 2I1VB 2NG1A 2WAYA 2ZSDA 3CM0A 5FR1A 5CK5A 2QN6A 5CITA 2F1JA 4NCHA 1KZ7B 2X2FA 1FUKA 4PHTA 3VKWA 1W4CA 2DFNA 3THWB 2WWGA 4WOPA 4A82A 3FHCB 2PX3A 2WTUA 1R10A 3IIJA 5AJWA 2CLSA 1Z6TA 1KI4A 5LB4A 4TYYA 1OH8A 2QTHA 2ZS8A 5CM9C 1OH7A 1EWQA 4JS0A 3CRMA 4B6FA 2ONKA 4FD2A 4MGKR 4A2QA 5DSZA 5KDDA 3JZAA 4EAQA 4YQFA 2CJWA 3U44A 4PR0A 4MYCA 2XGJA 1LS6A 1YZQA 3EWAA 5G40A 3BIFA 3QPVA 1OXUA 2GEDA 1E9FA 3AVUA 3I61A 1UPTA 3A4MA 3UATA 2JIZD 3RS5A 4YMUA 4DC9A 3BB3A 2JIZA 2J0SA 2RGNA 1R2QA 2HCBA 2QPOA 1FQJA 1IBRA 4B3FX 4KYIB 1KO1A 4DJTA 3AVTA 2ZSFA 2WPDD 1G4UR 3PG5A 4CRWB 4FWTA 2OAP1 2WPDA 2HCJB 3C16C 4MRPA 2HF9A 5JSZA 4FCTA 3R7WA 5CYPA 1HTWA 821PA 2D4HA 4DCNA 3BORA 2PMDA 2QMEA 4GP7A 1T4GA 1ZINA 2YWEA 4WZAE 1A1VA 1N5KA 2N1BA 4JMPA 4A8JA 4NYMR 1XJ0A 2W2XA 4NP6A 5IF9A 5K8IA 3THXA 2ZRFA 3QIAA 4TYQA 1NMXA 3SI7A 2XTNA 4I1VA 2IHYA 4PAMA 1TTTA 3AVYA 2WZQA 1GDDA 5L3SA 2OLJA 4HZUA 5TMPA 2DR3A 2GZDA 1FTNA 2PLRA 1RFLA 3CONA 1CJMA 1F2TA 1U8YA 2REOA 4H1VA 2F1HA 1YRAA 4A0RA 1ONBA 5DIFA 5IDVA 2H5EA 3CZQA 2O8BA 1QHHB 1KSFX 3THYB 1X1RA 1N6HA 4PZLA 1LNZA 2KSQA 1T0JB 3U7EB 3GLGE 2N46A 3TR5A 5FTJA 1E6CA 1QHNA 4RCYA 2R9VA 5H8WA 1TU3A 2R6CA 2ZS7A 3IO5A 1U0HC 2BDTA 3GLFA 1CJUC 5L8VA 2P5TB 2WICA 1P6XA 4NCJA 3B60A 3EWSA 3OFND 2BBSA 4MRNA 1G19A 3VR1A 3OFNA 3ZD6A 3B2EA 4KXFB 1R8QA 1Z6YA 1ETUA 4JLPA 3I4LA 4OYHA 4YONB 4RZ2A 4B71A 5AUPB 2VLIA 3MD0A 3ZJYA 2G9NA 3KKQA 1P62B 2FSGA 3LD9A 2J7PD 1J7KA 2J7PA 4A6XA 5HE9A 2V6JA 1IY1A 3E1SA 4KVAA 4UNNA 5F2EA 3LLUA 1XEXB 2A78A 1KO4A 3CIOA 1YU9A 2Q9CA 3PEWA 5CIWA 4RKFA 5TDHA 1GUAA 3AGQA 5DE3A 4Q4HA 4POAA 3T5DA 5JCZA 4JVSB 2KJQA 3ZVLA 3GEIA 3A58B 1IN6A 4BFYA 1LFDB 5FI1B 2W58A 3IHLA 5J40A 2FFAA 3L0SA 1NMZA 1UKYA 5EP2A 4WA7A 3ZDQA 2F43B 1MO6A 4I1OA 5JFGA 4IW3B 1II8A 2ZI6A 121PA 1AZSC 3P27A 3BRWD 1E9BA 4M1MA 2AWOA 1U8AA 1HV8A 3P32A 4KCGA 1II0A 2O8EA 4TL8A 4Q47A 1E1QD 4M4SA 4C9BA 4KBGA 1E1QA 4M1WA 4BUJA 3IIKA 4N3NA 4L9SA 1CR4A 3FHTA 4PHGA 4PAOA 3WYAA 3HYTA 5DYIA 2IYSA 4RVCA 4EPYA 4F91B 3ADDA 5BXQC 5LD2B 1WXQA 2CVHA 5FPKA 4FCWA 1ZNXA 2ZEJA 4JBWA 4C7OB 4KU4A 4PANA 4ITRC 1KY2A 2H1LA 3AP3A 3NKVA 1G1MA 1G8FA 1UADA 2FG5A 3SBDA 3T34A 2EVWX 5EP3A 1AIPA 1T3HA 2IXFA 2WBLC 4LHVA 4W9MC 5E3HA 1UDWA 1IJEA 4IXMA 3K0CC 5HCNA 5FTLA 1CEEA 1GWNA 4IDQA 4QC2A 3OE7D 3AGPA 2EYUA 1E4YA 3OE7A 4PHFA 4KLZA 2QP4A 1JPJA 2ASEA 4AWXA 1ESMA 5DHFA 5B58C 3NIBA 2VP5A 1ODFA 5EXPA 5KSPA 3MJHA 5BYJA 1ZMXA 2V55B 2ANBA 3KJGA 1XEWX 1RC8A 2OV2A 1JECA 4EUNA 3NHBA 3NHAA 3QF4B 3R9XA 3GLGA 5F9FA 3QQ5A 2OZEA 3AF1A 1W0KD 3R8FA 5JHGB 1E2HA 2GZHA 2VTKA 1W0KA 2J0UA 2LKDA 2ZYTX 5G3ZA 4CT5A 4PO9A 1S9DA 3Q7PA 2WOJA 3NTUA 5CJ2A 4ACAA 2FH5B 4DDTA 2D2FA 5IRCD 4ZI3A 3QG5A 3TAHA 3T5GA 4N0DA 5H68A 2WIBA 1B0UA 3QXCA 1BMFD 1G17A 2BVNA 4FXPA 1XCPA 1BMFA 4YMSA 3PV0A 1BO6A 3T12A 4L16A 2EW1A 4GMDA 4B3XA 1N5IA 1Z83A 4X8MA 4BEJA 3QF7A 4P0TA 3ZLJA 4Q4AA 2WKRA 3K0AB 3MG9A 3T15A 2JA1A 3N2EA 4IKEA 3A36A 1YQTA 2HF8A 4F7WA 4UXIA 5AUQA 3FWYA 4KSCA 1E9RA 3SYKA 4C0HA 4F4CA 3K8YA 4P4TA 2RGAA 3UKDA 4C0QC 1MRSA 1E3MA 2ZETA 2A30A 3FYHA 3K1JA 1D2EA 3GJ5A 4CEJA 1E0AA 1XMIA 2IWHA 4OQLA 3L0IB 4E22A 4DDVA 3TAUA 4TMTA 2FOLA 3I5XA 3NWJA 4M8NE 2WWHA 1CKEA 3OEED 2OXCA 5J4LA 1KMHB 3OEEA 1OXSC 5IK2D 1KKLA 1P2TA 5IK2A 1CLUA 3K0CA 1CR1A 4LJ5A 3TGPA 2YYZA 1E2LA 2GF9A 4Q7MB 2B8WA 4E03A 1AM4D 221PA 5CK4A 2HT6A 5BYKA 4A0HA 4UXHA 1E2EA 4DCSA 3HDTA 2QQEA 4KO8A 2IT1A 4DIEA 2EQBA 1ZYUA 2QSYA 1G3MA 2L0XA 1KHTA 2J9RA 2QL6A 3LX8A 3PQCA 4OL0A 3BS4A 3QBVA 2NO1A 5KSOA 1IOZA 3PEVA 4Q4JA 4Q4LA 1UBFA 2BJWA 2GILA 1DVRA 1E9CA 2YOGA 4IVRA 4PHHA 1GRNA 1O87A 5JHHB 1KK3A 2YC2C 2O0HA 4PPFA 1NMYA 4Q9KA 1YVDA 4MQBA 5DO9A 3KQKA 1EX7A 1R5BA 1U9IC 1XP8A 4UNQA 2XJ4A 2ERYA 4JSTA 3IO3A 4BPBA 2J59A 2HDNB 4V0ME 1F2UA 4HAZA 4PFSA 3TNFA 1Z0DA 3KXIA 1PUIA 4ASUD 3VR6A 4ZKDA 3LFUA 3VR4A 4ASUA 4B3GA 2J5XA 2PMKA 4Q9JA 2JLYA 1T8UA 4HYYA 4Z51A 1EFRD 1E2QA 2KI5A 2R6FA 3EIEA 3AVWA 3UWKA 1OIWA 1EFRA 4D4JA 2XJ9A 3FFBA 5GVRA 2R62A 1R5NA 2G0NA 1G5RA 2V3CC 3KJIA 2ZS9A 3NC1C 5BW8A 1TF7A 3EIHA 4LSGA 2WJJA 1EK0A 3WP1B 1IHUA 4Q7JB 3W90A 4EJSA 5HR5A 2BCJQ 3GJXC 2VHTA 1KJYA 4AYWA 3AUYA 1Q44A 4LBZA 1OFUX 4BLOA 4KI0A 1SKYE 3TW8B 2LWIA 3FMOB 1W48A 2UZ3A 4URVR 3S1AB 2F6RA 4FI3C 3MWLA 2QUZA 1OYWA 2ZRMA 1SGWA 4BFZA 2WJYA 5L3QB 3IPXA 1NY6A 4QHTA 4WZBE 2VEDA 1Z0FA 4EPVA 5EJEA 2GVDC 4OHWA 3DHWC 1G18A 3K70B 1Q1EA 2ERXA 4B32A 1KY3A 1NJFA 2GETA 3KTAB 4JBYA 4CDGA 2D62A 3U3OA 1WBBA 2NZ8A 3JZMA 1SVLA 2O8CA 4NL4H 4DLWA 4BFUA 2O8DB 1GRRA 4BZXA 3LVRE 2RHDA 1Q1ZA 1U9IA 4ZV4A 1YZLA 3F8TA 3N70A 2H17A 2X8AA 4R71A 5DI3B 2H16A 3E2IA 3BE4A 1XRJA 1G7SA 3QXSA 2ZRPA 4HLUA 3IQXA 4PPNA 3ECCA 3TRFA 4BQSA 2WWWA 3BH7A 1E2MA 4OK5A 4U00A 1G5PA 4Q7LA 5EQTA 3KZ1E 1LTQA 1N3BA 3L43A 2W6JD 1KNXA 3QXJA 4OQMA 1KO5A 4DLTA 1OF1A 1S96A 2W6JA 1UJ2A 3X1WA 2PCLA 1VHTA 4KHZA 4Q21A 3GLIE 3EPKA 4HEJA 2NO0A 4QRHA 5E4FA 1MO3A 3M6AA 2QAJA 1KJZA 2J7KA 4JZKA 4RCZA 2FWRA 5J4KA 1BH2A 5J4YA 4M1KA 2WWIA 3ND8A 2WHXA 3BFKA 3TVTA 3WP0A 3QJYA 1GILA 1BIFA 1KAGA 3QNUA 4E09A 1R8SA 1PVOA 2W00A 2YWFA 1K5GA 1X1SA 4M1TA 4AKGA 3Q72A 3W6PA 1K6MA 4W5WA 2FDCA 4JVLA 3ICEA 5FBLB 1Z2AA 4WXPA 4URWR 3NDBB 2H57A 4G3XA 2HLDD 1KTVA 4M53A 2ZAMA 2HLDA 4BLTA 2P3SA 5EUMA 4QXAA 3HU2A 3EZ7A 1Z28A 1X3SA 1NSFA 3AP2A 3JVVA 2V1XA 2WJIA 2OEPA 4KVGA 1W36D 1GITA 4DLXA 2B8TA 2DYKA 2C2HA 2PZGA 2IF2A 5LDDC 4C0JA 2ZRIA 2ODWA 3ZVNA 1DAIA 4ZCMA 4RD6A 2XTZA 2P6NA 3LA6A 2CEAA 2ORVA 2QPTA 2IK8A 521PA 4ABYA 3KQUA 1NF3A 1NSTA 1M6NA 3UPUA 1ZD1A 4QGAA 2AN9A 2LKCA 1UEIA 3IHWA 1EFCA 5TB5A 4Q1CA 3X1ZA 2WSSD 2QRNA 1KNQA 1N5JA 2WSSA 3AF3A 4TLAA 2XOKD 2ODBA 2DY1A 2XOKA 5J5CA 3I3SR 2ZI3A 1MABA 5JS7A 2RB4A 3BWDD 2O8FA 3IKJA 2P6UA 6Q21A 1JR3D 3HU1A 4G1UC 5J4VA 1F6BA 1JR3A 4P4SA 4ZPXA 1OFHA 3ADKA 1FP6A 3M4YA 4JLAA 1P2UA 3GQBA 3SFVA 4US2R 4C2UA 3KJHA 5ANRB 1NVUQ 3KJEA 3IIMA 1G5TA 2I1QA 5SZIA 3SC3A 1H65A 1UBCA 5D3MA 4C0BA 1G7TA 1OPXA 5K8UA 1A5TA 4MITA 3CZPA 1M1YE 4GOJA 2GEUA 1DAKA 2RGXA 4PQRA 2A5JA 3ZS8A 2D2EA 2IUTA 4LWZA 1E96A 2CK3D 1F60A 1IAQA 3GFPA 4LHXA 2CK3A 3U2QA 4TLCA 1GL7A 3KQHA 1XPUA 2OILA 3DZ8A 1PJRA 3CNLA 1X8KA 3K9LA 4GSYA 5GVSA 4Q03A 4URXR 3X2SA 3GLIA 1G6HA 1D8TA 1OH6A 1I2MA 4URZR 2HEIA 5JZVA 3O8BA 2MMGA 1JR6A 2BBTA 1EG7A 1E9SA 3D7MA 1Z3IX 1XZQA 4LJYA 1UF9A 3WMEA 1NKTA 4QGFA 2BJVA 2C03A 2R6DA 4A36A 3LAWA 4JT4A 2FF7A 3AUXA 4EFNA 4TYNA 4LJ9A 4EQ6A 2OFXA 4FMBB 4BECA 3L0OA 2QMUA 1NLFA 2P0EA 2PLFA 1CRPA 2OSBA 2XX3A 1FOEB 1I4LD 3UG7A 3ZVMA 1NN3A 2IYQA 2EWVA 3QVUA 1G8YA 1IY2A 1FFHA 2GJSA 4TT3D 4A9AA 4B3BA 3RRMA 4TT3A 2EFHB 1JAIA 1QF9A 2O8EB 2AKYA 4HAVA 4MRVA 1QHGA 4FN5A 3TSZA 2QEQA 1DAEA 2R44A 4LUCA 3W5IA 2GEVA 3T1QA 2JLWA 2XEXA 1Z0IA 2BHRA 1U94A 2E87A 5HE8A 3MMPA 3QENA 4ARZB 3F5FA 1NI3A 5KDLA 2ECKA 3TVDA 1T6NA 4W5JA 2ZUBA 1KI7A 1JI0A 1SXJB 1ZC4A 2IEZA 3MUFA 1KI1A 4XWOA 1U8ZA 4LZZA 4N1AA 4V0OA 4IXNA 4QFMA 3NDPA 1XXHA 1DAMA 1YR6A 3SJZA 2F1RA 2WAXA 4JL6A 4OI4A 1XEFA 4DBLC 5AR1A 1GFIA 2R6AA 2W2VA 5BN3A 2ZJZA 3L2OB 1ZU5A 4P31A 5HZKA 3CF0A 1RPZA 4LOAA 3QEOA 2QAGB 3V4FA 1S4QA 2HYDA 4BLPA 1I4TD 4JVNA 4MYHA 3R8CA 3REGA 5FTMA 3BH0A 1S2MA 5EE1A 5B64A 3K09C 2C96A 3IPYA 5KNCA 1EESA 3VFDA 3GD7A 1RJ9A 2J0UB 3SS8A 5EE3A 2OM2A 5EZ5A 4Q1AA 3BBPA 4B75A 4C0AC 1LF5A 1FX0B 1M7GA 2JLQA 1MKYA 2XITA 1W5SA 1A2BA 1OKKD 3Q9LA 1G8PA 1OKKA 4URYR 1PLKA 2NTYC 2VQSA 2ZI5A 3AQ4A 4KFTA 3FGNA 4QNMA 1JALA 4F4JA 1KDPA 1S3GA 1ZC3A 3RVBA 2G77B 1VCOA 3C4JA 4IVPA 4LYAA 4NYJR 4GBMA 5AWFC 1AKEA 2CDNA 4GRAA 2GCPA 1E9AA 2GCNA 1OLOA 2OCPA 1F5NA 1G9XA 2KBEA 4LBVA 5FTKA 3FB4A 4D4LA 2FMXA 2DWOA 1ZM2A 2DFKB 1XTKA 3PEUA 4MKIA 2AHOA 3B1WA 5FL7D 1KI6B 5FL7A 3W6NA 2QE7D 1NNEA 4ZDIA 2WKQA 3UXMA 1OFIA 5BN5A 2BC9A 3GEHA 4HUQB 1CXZA 1U81A 3UANA 1G41A 5FFMA 2F1IA 4S35A 4MKFA 1TNDA 2XXAA 3B7GA 1M74A 3EPLA 4ILEA 5K8TA 1E2DA 4JIMA 3OF5A 1FQKA 1OJLA 2EFEB 1N6RA 2YNMA 1SKQA 5EE0A 1HT2E 4PX9A 3TBKA 4D4KA 4D4MA 4HB2A 1FPMA 2CHGA 2NQ2C 3RLFA 3LBNA 2JASA 2FPLA 2OCYC 1QHSA 3AVXA 1Y3AA 1DS6A 1CJVC 3CRW1 5FPHA 3EIQA 4Q4JB 4XH9B 4E5UA 4I99A 4RFSB 2GA8A 4PO1A 2ZJAA 3BFVA 4OQFA 5FPTA 4D26A 2DBYA 4US0R 3J81k 2F9MA 1XB2A 1JXMA 4DZZA 3OZXA 4LBWA 2ORWA 3ZGXA 1S8FA 3ZVRA 4A2PA
chains in the Genus database with same CATH superfamily
1SXJE 3ETNA 1FBTA 3O47A 4NHOA 2AYZA 3DCNA 1MJGM 3C7TA 5BNTA 1ML4A 1HTTA 4N5MA 2Y1FA 4G5GA 1CULC 4PLPA 3I8SA 1X92A 4HQRA 1VZ2A 3KU4A 3ZV7A 1N0UA 3LV8A 1IATA 2MYPA 2HPHA 2ZITA 4PZ0A 3A7EA 1FZTA 3LUAA 2ET6A 1JEEA 2PX0A 4CKBA 1H2ZA 1NJGA 2BEVB 3PT5A 4YO8A 4UNPA 1FE8A 3SSNA 3X1XA 1Q0TA 4KQIA 2FMUA 3GRZA 3SN6A 1OU4A 4OI0A 2QORA 1E4VA 2LCFA 2BTQB 4ZQGA 4C03A 5K4GA 1PDVA 5A7FA 3GFOA 1GG2A 2IUSA 3MXOA 4PYRA 4Q1VA 2F4VB 1MG0A 2AWNA 3KKMA 2CB9A 4AJHA 2ACKA 3U9LA 4YMLA 1ORHA 1OI7A 4N6OA 3T4UA 2GAIA 3H75A 4ARAA 4ZCTA 4BXOA 1RP7A 2I1WA 2J6HA 4Y7DA 3DZCA 5KQMA 3FRJA 1U1EA 1YR8A 3BE8A 5JYEA 3ZR4B 2QTVB 4ENQA 1J97A 1RQPA 3EZXA 2DKOA 3CNBA 3M2TA 2QQFA 1KMMA 2P65A 3AY7A 4O4JF 2HJVA 2JJ8A 1N7GA 4CKWA 5KINB 3C3EA 1DJLA 1SXJC 1T6BY 1YHNA 4OMCA 4Q1BA 5EP4A 5B4TA 2P9EA 4IIEA 1VYVA 2JJ1A 5FLEX 3EVTA 3L49A 4EECA 1ZSVA 3JALA 3JVIA 4MXDA 5EUQB 3MJCA 2Y0BA 2YXEA 1Z4KA 3SOPA 2VG8A 4RHUA 2VYQA 5I3CA 4JEMA 4HDQB 3CE9A 4DADA 1KAEA 1V1RB 3I01A 3HCWA 2Y8EA 3A37A 1V7QA 3AB7A 3AR6A 4ZO6A 1XNHA 1W0JD 1ZR4A 1T2CA 1S0UA 2BN4A 4M49A 3ITKA 4F5DA 1JXOA 5A5VA 1I1QB 1V3TA 3L02A 1A8PA 2FN7A 3H7IA 4R7TA 3T5TA 3VMFA 2FEAA 3CLTC 2WNIA 2DP4E 3M1LA 4HAYA 1RBYA 3R75A 2PZMA 5EIBC 2LXNA 3TQOA 2OZVA 3BOSA 2FEXA 621PA 2VXCA 3DV0B 5BUQA 4HNTA 2O7SA 5HM8A 5J23A 3FGPA 1RC1A 1JLRA 2I7TA 4GR9A 1U4SA 5AKYA 1FUUA 2QTMA 2YBDA 4RA9A 1HDZA 1QIMA 4MCHA 3WO1A 2L42A 4R1LA 3OY2A 2ZYUX 4ROTA 2YZKA 4ZAZA 1BFKA 4I4NA 2FR0A 1EVJA 1TL7C 1V11A 2HHCA 2JIDA 2BMEA 2SKEA 1NMQA 2B1RA 3L9WA 5KAMA 4RAOA 1L5RA 1WO8A 4Z86A 4GQAA 1UBGA 1ZL2A 2NSDA 3RHSA 4YAGA 4GG1A 4MWTA 1K0FA 1VLLA 1Z2PX 2R68A 3L8ZA 4EL0A 1HYGA 3TM5A 1IQRA 1JEAA 2R1UA 3K9HA 4KYTA 3UHFA 3L84A 3NV7A 3TNJA 3ZWCA 3C48A 3KWFA 3LT2A 5DN6D 1CZRA 1A7AA 2IPNA 1IZ9A 3LY7A 2I2XB 1THGA 3BFXA 3QKSB 2WD9A 5G0SA 1GJRA 1TYEB 4UQOA 4TMFA 1J21A 5TVGA 4DM7A 4O3FA 5FNZA 1G4HA 4CKZA 4ARIA 1CQJA 2EGUA 2R00A 2FPUA 3HR8A 3VU9B 3SJAA 3TLBA 2X1HA 4EX7A 3HGQA 1JQ3A 3WL3A 4B2YA 4IEIA 2D4AA 1M3SA 1YE8A 4KP7A 3A6LA 3GFQA 2EAUA 3DV9A 1RJEA 4WKPA 3UTDA 2OT3B 1X15A 5M04A 3GPDG 1JHMA 1MT0A 1JDNA 3AKCA 3E7XA 4GLOA 2IBMA 1N8SA 4DG5A 2BGKA 3IOBA 3JQCA 5I7EA 2VQDA 4LJSA 3NDRA 4UM8B 1OPRA 1MXHA 1ODLA 2PKYX 4PLZA 4V0QA 4XSGA 4Y2VA 5C1IA 3U7FB 3SIXA 1F1BA 1J0AA 3DO6A 5B1EA 4GQBA 4UZEA 1UFRA 2KBFA 2VQ6A 3MWYW 1UOQA 1X0VA 4JELA 1RHQA 1HFKA 4CMBA 3MBKA 2A6PA 2AXQA 3JD4A 3TKYA 5LDHA 5TGZA 1ST2A 3C3KA 1PV2A 4B3RB 4BQEA 1UT6A 3C3WA 2GJ9A 4RK4A 4YCAA 1KY4A 1TUEA 1XAHA 1VPLA 1ECGA 1R0BA 2PQMA 3E23A 4FYWA 3E15A 2IS4A 3CLTD 1PFGA 3P0JA 4LYJA 4R8KA 1C7ZA 2I7DA 1AXGA 3RBAA 4D9GA 1J9GA 3G82C 5EIBD 5KSWB 1JHPA 3HN7A 4MARA 2OHFA 5SZHB 2AVDA 5I3ZA 2HJGA 4G0UA 1C3JA 2BKVA 4V0KA 4G0WA 3G5AA 3R0QA 3UYLA 4I4TF 1NVEA 4X54A 1EK6A 4CZ2A 5AVSA 4RTPA 1B8PA 3QU2A 4YFYA 2B1GA 1VOTA 5CT9A 4ZO8A 1NBIA 2ID9A 5AI6A 1PTJA 2JJQA 3K1YA 1JPVA 1SC3A 2O5VA 1G6KA 3FRIA 4M87A 3LXMA 2QTAA 4NOLA 4NSNA 5AOBA 4YRAA 1AF4A 4KDRA 3TH5A 2H1FA 3IESA 3OY7A 1OVMA 4QQKA 3TTYA 4IRUB 2QRJA 2H29A 4F46A 3WLMA 6YASA 1UKEA 2D06A 4JQSA 3TL2A 2YOFA 2ENUA 4L08A 5FUBA 4ZEWA 4A15A 5FTKA 3KT0A 3L1KA 2YV5A 5JECA 1NFQA 3QPBA 1G5QA 1N2CB 4R40A 2IGBA 3KR1A 2F9FA 4L27A 5F21A 3IUBA 3N7UA 4HX2A 4YWJA 3TR0A 4BMXA 4DEVA 1L8LA 2YFQA 5EKTA 3D31A 1VI2A 3PPWA 4FDVA 2EFDB 4FTWA 3IMFA 4R2HA 5G4KA 5HDBB 4DY4A 1B76A 2O14A 1VLQA 2X4GA 2XUZA 3HUUA 3TLGB 4CMIA 4MEJA 1OHHD 1GRVA 3DWEX 4QKQA 3FOWA 1V2GA 1F9AA 2HGSA 4OGWA 2BRUA 3FRHA 3QY0A 2RONA 3RVQA 4AJLA 4D79A 1GTL1 4QSMA 4N40A 4KWIA 3T3EA 3NVAA 1GHTA 2QJFA 2W6OA 1JJVA 1OAOC 2G08A 3CWZA 3ECAA 3MMZA 4JB3A 1O7JA 1ODTC 2LRHA 3FUXA 3L8YA 4JLSA 4BLSA 2ZIXA 3BWCA 3FDXA 3O73A 4NYIQ 3QUCA 4G8CA 5ENDA 3SEQA 5H5JA 4BNGA 1X9GA 1H3EA 3WGZA 1HRKA 4WDQA 3ZU5A 4ZJZA 3HXTA 5AXBA 1YQWA 3ED1A 3HO1A 3QUSA 4FXOA 3OU7A 2OD2A 1NVVQ 1NG9A 2NO9A 2JLCA 2R47A 1ZESA 4RGYA 4YRJA 4HTAA 3JRNA 5K05A 2PV7A 3EZFA 4UHEA 1UMBB 1VECA 5AM2A 3OQOA 4X7PA 2OFOA 3HCDA 3D3KA 1MQ8B 4RETA 3KQTA 2V54A 3Q11A 2ZRAA 4IYRA 2G88A 4G24A 5KEIA 3QY9A 1O9BA 4FD3A 1TE2A 4FNOA 4WFQA 4LWQA 2Q9AA 1B26A 2QHXA 4H7IA 2R1TA 4OUKX 1GGKA 4TSKA 1I10A 2VVTA 3L8HA 3BWEA 1A5BB 1X1BA 1YZFA 3MT7A 3AEQB 1A88A 1WU8A 2YHUA 2OWDA 4M8KA 1QXSA 4PPGA 1QHHA 2CFSA 1C9EA 1WPQA 3KQVA 4AL4A 4KQWA 3JQAA 3VR2A 3THYA 2XDQA 3IBCA 3V3TA 1OBFO 4C2BA 3DC7A 3LOUA 3BWMA 5CW2A 4F5YA 1RC0A 3BFPA 4ER5A 2CJPA 2GQ0A 1V5GA 3QZUA 2JVJA 4D3SA 1R6BX 4Q3NA 3JARB 2D0PB 4U7GA 1QHXA 2OXEA 1ZRHA 2PIDA 3DM9B 3RU2A 4Q3LA 1Q7TA 3B9RA 4K0RA 4GZLA 3ODPA 1XAJA 1DOHA 2BFMA 1WZ2A 4M21A 5E95A 2DWUA 2V4ZA 2A9KA 2XADA 2ALJA 4LX0A 5B3LA 1KZHA 3DDUA 3RTDA 2DXIA 2PWPA 2IS2A 4YRDA 1BCSB 4YRFA 1OXXK 4NBVA 3HACA 1GUYA 1UBEA 4OH7A 1RZRD 3WWEA 1TVEA 3F6BX 3KDAA 4KKXB 4NH0A 3V7YA 1ZIDA 5CLHA 5CD9A 3PA6A 2QRVB 4I1SA 4M2LA 3I2HA 4LG1A 1VKOA 3FETA 3PR2B 4LZAA 5DBHX 3BD8A 1T6ZA 3KPUA 4MR8A 3EFEA 4FOLA 2ZUFA 3LRTA 3OC0A 4J7UA 2HDHA 1SKAA 2ANCA 1PW5A 4DMRA 2PL1A 4V1CI 2EP5A 4C7MA 3P8ZA 3WRWA 3FAKA 3JWPA 1KP9A 3A6EA 1VGQA 3U0BA 1Q22A 4TGLA 1XXLA 3I64A 3LG2A 3W4KA 4CCAA 5EG5A 3EIXA 1P9WA 3FZGA 4QTTB 4C5AA 3NBZC 2JG3A 3P9SA 2VF8A 3ENVA 1WHSA 3OJOA 2NOAA 4MHTA 1PJ8A 3EXHB 4YJDA 3UOGA 4ENRA 3GIDA 1RRMA 5JLAA 4NCNA 1FL9A 3MMSA 4P3YA 3U9SA 3AZPA 1KGSA 4AIRA 5AUNB 2JS7A 2G71A 3GMDA 5JS2A 4NMXB 2MSDB 4KR0A 1PT7A 2VYNA 3VZQA 3A1WA 2CXUA 4G1VA 3OCUA 4BGVA 1LPPA 4TWZA 1E60A 2Z5GA 3E61A 3K35A 2ZJYA 1ZIYA 1A2KC 2GZMA 2NZXA 1KJQA 1C9YA 5LOVA 1LPMA 1VI6A 1VKNA 3MD9A 4W4TA 3ZLTA 2DWPA 1T8RA 4O4JB 4UC0A 4BTVA 1RE0A 3SC4A 5HF8A 1SU7A 2FN4A 1HC7A 2RGUA 4HLDA 5DTQA 3TBFA 3WIUA 3JTMA 1KOGA 3JZFA 4G5YA 2VHEA 5CLQA 5J47A 3R6DA 1CU1A 2J48A 2OV8A 4PV7A 2ODEA 3ROGA 4YCLA 4UDOA 3NHUA 4EG8A 4V2UA 4V0MA 2C0PA 4HB4A 5BO5A 2VDMB 1BX0A 2AFIB 3PQEA 4IJMA 4UAJA 1IZ7A 4KODA 3V4RA 3OD5A 2GBPA 3ZU2A 3VYUB 3ZU3A 2P30A 3SBEA 4BFWA 5I9BA 2P9HA 4LWOA 3DLPX 4EKEA 3PGKA 4ZMSA 5A0TA 2GSDA 1FVXA 4MA4A 3AJDA 4CM9A 2GBFA 2G67A 3LHDA 3WNCA 1RE1A 1TO2E 3D7NA 1O8CA 1R0YA 3ZD9A 3DE7X 3CHYA 4CMAA 3OJCA 4ZQCB 4PYMA 5JSZB 2CNNA 1VCIA 3V4ZA 5ARBA 4A73A 1K8RA 1P2DA 2B6HA 1M1ZA 2JHPA 3DZHA 1RKBA 3GEMA 3R7WB 3WLEA 1NPTO 1I3NA 1PD0A 5FORA 1YVPA 3QF4A 5DRYA 4OQNA 1A50B 1QVRA 5KC8A 4JXXA 2YN2A 2Z30A 3ACBA 2Z3ZA 4JP8A 4PYNA 4UD6A 5A9SB 1B7GO 2QRHA 1BS2A 3IAFA 2LD4A 3OETA 5A3VA 4CN8A 4IHQA 4DGQA 4PQFA 4R2JA 4ZQFA 5U1PA 2XQVA 2HBYA 2V6IA 3P20A 3DC2A 4RJTA 2E4UA 3CSDA 3OO1A 3AUUA 1ZM4A 1ISMA 5CCDA 3BE5A 1J0BA 2PH5A 3IQZA 3SZLA 4I4LA 3UM9A 2ZM5A 4HZUB 2FE1A 1M6EX 3HP4A 5IX8A 1YL5A 2XUFA 1Y4AE 2VAVA 4YPFA 5JUWA 1C3LA 5JCJD 4Z9FA 4NZNA 3QOFA 3EEIA 2HMTA 2W0MA 3S7TA 1W5AA 4A03A 2NADA 4YRPA 4DG8A 1FTYA 3OSUA 4HQKA 3TZKA 2MWMA 4ZT3A 4MUMA 4YAOA 4DV2B 1MOQA 4UBMA 1XMOB 1IVSA 1KK1A 3KM0A 1EMDA 5CNIA 1D2NA 3W5DA 4JOSA 5KNDD 3KUKA 1C1HA 4MINA 4ACBA 2W37A 4IJWA 4YUWA 1IG3A 5SYNA 1E2GA 1QH1A 2J6BA 2Z5FA 4LRSB 3VTKA 1QZZA 1JEDA 3ML1A 1CZLA 3AFMA 2Q4TA 2WVJA 1YS4A 5BV1A 4XQ9A 1ZAYA 3WQRA 4WBNA 3GLFB 3V8BA 4QULA 4BJ1A 3HA5A 1CK4A 1HURA 1JP7A 1UK7A 2JCGA 3DTNA 4WI1A 4W6ZA 5EI5A 4BX2A 3EVNA 5JADA 4ZMRA 2BEKA 2IOQA 4ZN6A 4BGIA 1CDOA 2ID8A 2BZ1A 5JRDS 1SXGA 1J2UA 1UK6A 1Y80A 2P2LA 3KZOA 5KU1A 1HQYE 1B1AA 4ND4A 1O0CA 3CH5A 4IDFA 2QQ5A 3IVAA 4D4HA 2YJ3A 3SJCA 4ML3A 2NZUG 3I6ZA 3MJEA 4HSEA 5CJPA 3AONB 1ZOLA 3GBVA 4BN4A 1E1RA 3USES 2DH5A 3KFLA 1A4RA 4GOKA 4F8JA 1S9HA 2G4CA 2R97A 2ZYWX 4R5MA 3TRIA 4Z4EA 4I4TB 2PYIA 4EJFA 1C8LA 1VGVA 4IQ0A 4K9QA 1JNYA 4IIFA 4FGWA 1UBUS 4JT2A 3H42B 2Y0EA 4D9FA 4B85A 5JRJA 4L9WA 4WTOA 3HPRA 3HCAA 3VZPA 3VUFA 4UMEA 2DWQA 1KAHA 3FKSA 4Q24A 3F6CA 3CGWA 1W2GA 2ETVA 2OORA 3BIJA 1LJUA 2O3QA 2CL7X 3JR3A 3LPNA 1MH1A 4FCVA 4XYLA 3ZS9A 1EB8A 3JQDA 2GJKA 2AJTA 4XB6B 4AJOA 4DCTA 1FVFA 2BFNA 3IEUA 1GQOA 4ANFA 3G2IA 2B21A 4JL5A 4I66A 5E6SB 2OB2A 4ZKEA 3UC9A 1I13A 4LMRA 1II8B 2NVOA 2XNDD 4XOIA 3CEAA 2XMDA 5GMOA 4BO9A 2HSDA 1VSVA 3U7QA 2XNHA 1ZRNA 3FWZA 2H52A 4F04A 1E3EA 4OHMA 3C43A 1X74A 4QEDA 5ECWA 5L51A 3K2IA 1OI3A 3TQFA 3A9UA 4P4UA 1CJBA 1J2JA 1GP2A 4PZ9A 4DFDA 2RC5A 3GJSA 1DV2A 3UJ6A 3KE8A 1CEXA 5JAMA 4D74A 1QIJA 3ZE9A 2PS1A 1FRZA 2PSHA 3KXKA 4LI3X 1AS0A 3JQGA 3U1BA 5FBWB 1J0CA 3L1UA 2JVKA 2HJWA 1QTRA 2HC9A 5KJ6A 4D9CA 1E1MA 1FTQA 3HUEA 4KPEC 4JJEA 3NWPA 4TRMA 4EG6A 1EK2A 2O57A 3SKYA 4DA0A 3L06A 2EQ5A 5TPWB 3FCSB 2OYCA 4EKNB 2C2KA 4QRDA 2P62A 4ZC8A 3DDOA 4GI7A 3PKJA 1GGFA 1KIMA 1LPSA 1ZNZA 3CWCA 4DYHA 5ISMA 1QQ7A 1NN1A 1EB9A 1GCUA 2EZTA 1D0IA 2QZ9A 2Z43A 3GEGA 3QA9A 4MS1A 5CHYA 3RS7A 4RTOA 2VT6A 5GM2A 4N5LA 2X7XA 3G1TA 2Q21A 4FLFA 4I81A 3PDWA 2Y76A 4O8CA 4BNWA 1YDMA 1V5IA 3KTAA 2ZQZA 4DXAA 2RHLA 1JIKA 1R6DA 2NQ8A 5G1PA 4BWFB 1ZMBA 4DLUA 1OOEA 1RWNA 1Y7PA 2EBWA 2ZRGA 3MS4A 4TYPA 1G59A 4PTZA 1GARA 2AOTB 10MHA 3O8CA 5HF6A 3AINA 2R25B 3ANNA 1CUBA 3CNOA 1DI0A 2QM3A 2DCUA 2FG7C 1P1CA 3GVCA 4Y9DA 2O8VA 2COKA 3PHIA 2HOQA 5A6SB 5GADl 1I4OA 5BQOA 2B83A 2F48A 2GBIA 3CRRA 1UMDA 1O6CA 1UMCB 1Q0PA 1DIAA 1PR6A 1V3UA 5DI3A 5DHTA 1O94C 3HJAA 1PN3A 3H9CA 4GOXA 1SCAA 9ATCA 3OZWA 3GP3A 3RFUA 2DULA 4CF4A 3LWZA 4Q4AB 1EUYA 1DKPA 3A2MA 2FWJA 3H3FA 4R7GA 1SC6A 4NTZA 4CF6A 1ZUNB 1RLMA 1VKZA 3DZIA 2O8DA 1LS1A 2DERA 3A31A 1XCGB 1H0HA 2FX3A 3V6MA 3IAHA 3NCTA 4DV6B 4K6KA 4TN5A 2C7VA 5WRFA 4GSLA 4CEJB 5C2JB 3EX7C 3V1LA 2ZVQX 2H7XA 1FFXA 2GZRA 4GD3Q 2HMUA 2HV8A 2BGMA 4MV7A 5HA5A 5J58A 1EK1A 2HSWA 2JJ2A 1FU8A 2NUAA 3Q5EA 5HZHA 1QP4A 3UK7A 3FYTA 5JIBA 1R0KA 3ZQ4A 4QDXA 4PLHA 2Q1UA 4YPVA 3GGCA 4XPIB 4LYFA 4XIFA 4Q9LA 2MSKA 3FUCA 2ZRDA 2A5GA 1LA2A 4FMCF 3PDHA 2XYQA 4LJRA 1N2SA 4NAHA 1Z33A 4PNEA 1XBTA 3NB0A 3OZEA 1SZJG 4GNKA 4Y98A 3SZUA 1ZN7A 4BE4A 2CXRA 1YVEI 1ZM9A 2BFFA 3OPYI 4Q7KA 1XU7A 3UAWA 3COPA 4XLZA 1XA4A 2AK2A 1UQUA 2QL9A 1IBMB 3A1NA 1XEWY 4YCJA 1N6LA 2VDWA 3EB9A 3N5CA 2ZI4A 3TI7A 4RA6A 4CF3A 2COEA 2LTAA 4WCFC 3WLOA 3KAJA 3NU1A 5CVDA 2FLWA 2W9XA 4AXXA 4C0LA 3K09A 2ZJBA 4ZO9A 3U6KA 2CVFA 4QPNA 1J33A 2GCEA 2QTFA 1DKLA 3DVSX 5FUYA 1E32A 4ZHQA 1L4NA 1L6IA 3DAFA 1VL0A 1QFXA 2FFQA 4EY6A 4F93B 2QVZX 3WLQA 3QWFA 1G8AA 3MVEA 4KH0A 4TTTS 4X3CA 1W25A 4RAQA 1LVGA 2QLFA 2IYPA 4F45A 1O94D 3ZOKA 4YNBA 1GCOA 1P1HA 5J2UA 4XQGA 3QTBA 3U3XA 1TA0A 1F2UB 4PNPA 3PF9A 2SNIE 1E0SA 1VLJA 3L07A 4U9UA 4RPGA 3W7BA 1WXIA 3HP7A 2VP2A 4MYUA 4RQUA 3U0VA 3RIGA 3UQZA 3ZIDA 5B1HA 3NAQA 3F67A 1YFKA 1NUTA 3KHUA 5IC4A 4RDIA 1R4MB 5B36A 2W6MA 4HS4A 1U7PA 3BHMA 4K6GA 1XKLA 4JASB 5BVHA 5AH0A 4N3BA 4KRFA 3W9BA 1KYIA 4E1BA 1GGHA 5AHOA 5KYUA 2IYRA 3T7EA 2QTGA 5ADWA 5KTNA 2GCGA 2W71A 4OH1A 1TADA 2MINA 3QP9A 3ZJVA 4EJSB 2ZAOA 2QN9A 1N0IA 4RD4A 3ZKAA 3DMNA 2VRWA 2VDOB 1Q6YA 2R86A 4CTJA 1T5IA 2JD1A 3AFHA 1M2VA 3AOEC 3DLCA 3ZI0A 4AJJA 1Z47A 2GXQA 3ZW8A 1QANA 1ND6A 1TF5A 1JVBA 1P72A 1EQUA 3A27A 4V0NA 1B6SA 1DTWA 4Q3OA 3DMFA 4KDCA 5E7MA 2AW3A 3DDZX 3LBYA 2IYVA 3O1LA 1R66A 4HUJA 5AVTA 2ZSHA 2AEEA 2HSGA 3H5TA 1O96B 1Q7EA 4JN6B 4TN1A 2VBIA 3COSA 4MGEA 1L5KA 2XMGA 2VH5R 1OMOA 3TDMA 2BEWA 4DUZB 4YRGA 3D54D 4BV8A 2YN4A 1QE0A 4MPDA 4XM2A 4C7KA 4M54A 1WPRA 2UZAA 2Q27A 4IH1A 1NBMA 2Y1GA 2KWIA 3L05A 2PANA 5KOJA 1QMGA 1CR6A 2IVFA 1J5PA 1P4RA 2TRSB 2X5XA 2BDEA 4HRVA 2Y68A 3CKYA 3H16A 2QAGC 3RU9A 4EX6A 2P91A 4FS8A 3O0TA 4CFZA 1LSUA 3TQRA 2ZUCA 2DCMA 3FZNA 2HQSA 4C4RA 5L3ZA 2QL7A 3ENZA 4CEHB 1BJKA 4RPJA 1SKUA 3AWIA 2I62A 3IEXA 5HEKA 1IY9A 3OICA 2C54A 2GYVA 2MHCA 3MRVA 4BRWA 5A5EA 1DBIA 2ZJ0A 4CCWA 3FMPB 4D43A 4LNAA 2M6LA 3TCNA 5LQDA 4TMZA 3GPLA 3TXXA 2HV9A 3NHPA 3G0BA 4IQGA 4JLUA 4WXHA 3K5PA 4BFSA 4F6RA 5JNWA 2UXBB 2YZNA 3LKBA 3HCEA 4RXTA 4GEGA 5I9NA 4ZCIA 4J0IA 1CS0B 4RYLA 2RI6A 1IEWA 1C0PA 4OKSA 1PYOA 1XLWA 3GJ6A 2O8NA 5D6OA 1MDBA 1RRGA 4QE3A 4TV9A 4D44A 3VAYA 4PGHA 5JY1A 3ZIAD 2VSNA 2YVKA 3ZHVA 5FKJA 5EIXA 1UKAA 3JQBA 2EGGA 1K6EA 1T3LA 4TQAA 4YAKA 3EOZA 4Y7CA 3A6ZA 1OGJA 3RKUA 2QT1A 4Z49A 3L8FA 4BFCA 2HSJA 2VNKA 4U63A 5ALOA 5JYDA 2V0GA 4GO1A 1DC3A 2PTHA 1GFZA 5YASA 3EVGA 3NTRA 1LI7A 4MA5A 4I6GA 2WTNA 3WGGA 3EEQA 2Y1CA 3RSOA 1L7XA 3NBMA 4IDNA 3E5RA 3IRUA 1JV2B 1SXJA 1YHYA 3QEMA 2QW8A 3IAS6 4R7ZA 3D8BA 2WNSA 1VFNA 5IUNC 1K7YA 1I0IA 5B2ZA 3VKVA 2JAQA 5KHOC 1J22A 4OTZA 1U7ZA 1Z62A 1PBTA 2V0CA 4BB6A 4AO8A 4ZFNA 2Q3DA 3GRYA 4RFLA 4WZZA 1BJRE 2ORIA 2I4RA 2H8GA 2WHQA 3FIJA 2DKNA 4PINA 5EESA 3DGFC 3RG2A 2ZXUA 1AU9A 3L93A 4WESA 5H7XA 4QVIA 1B74A 4Y0AA 1AH2A 1CE8B 3DNPA 3UT5A 1Z7WA 4HWKA 1H3FA 1Q95A 3WIVA 3T3IA 3T1VA 3F3YA 3QLVC 4M6WB 1KXJA 3NH9A 4MCJA 3DJYA 1G16A 2UZIR 5ICFA 1EFHA 1B0ZA 1KMNA 1YKSA 3A4LA 3LGAA 4R41A 1T8YA 2R1VA 1H2YA 1P4AA 4HRAA 3M89A 4GOND 2JB9A 3FH0A 4KQ2A 5HTKA 5BQ5A 3TSCA 1L4MA 1IJBA 2CKMA 2QVYX 5CXSA 4DSAA 1BMQA 3OLVA 1TVMA 3HM9A 4XIGS 2AEJA 2G1UA 4RU1A 2FKAA 4CMKA 2ONZA 2VCEA 3I1IA 3KZVA 3OP1A 4NK5A 3UXHA 3NHFA 4HDRA 4MULA 3L7DA 3RS3A 1MU0A 5DNAA 5F3DA 4B6EA 1V48A 2QVBA 3IBYA 4DQXA 1CJCA 3ROKA 3D4NA 4WZBB 4XWTA 4ETIA 2SECE 3F4KA 3VYSB 1XZFA 2PZKA 4L6CA 3TZQA 5E6RB 4IDEA 1B0AA 1P33A 1NNSA 4NBRA 3N0XA 2Q8PA 4YV1A 3PC2A 5IDWA 4EVSA 4JLOA 1IHOA 1I2ZA 2H63A 2L19A 3SDBA 2PU5A 1U9JA 3FFWA 3CEHA 4JC5A 4LF9B 1HTBA 4OB6A 2IF0A 1RLUA 3CH6A 4JK3A 3DXXA 4G6ZA 4ZQBA 3SAJA 2ZUSA 5BSKA 3CG4A 1ZK3A 3MA0A 1WEKA 1ZGCA 2H3EA 3X1JA 3O31A 2H92A 1UJ6A 5B5SA 2FUG1 3FMFA 1V1MA 2H0QA 1SUDA 3MCWA 4L51A 4OJQA 5IXSA 3NAGA 4DV5B 5EZQA 3VHRA 4C3ZA 16PKA 4MDFA 2FZLA 4KACA 2EJWA 2RG1A 4IILA 4OAQA 3ROEA 5T41A 3K15A 2O0JA 3WICA 2EKPA 2QYSA 5JFTA 5A0VA 4IM7A 4F3TA 1YZUA 1JHAA 2PRIA 4TM8A 5ALMA 3VBEA 1TAGA 4AJ9A 3M70A 2ORED 2V3WA 3O8OA 3VNVA 3GJRA 1RVDA 5J5AA 4RABA 1YIDA 4MDYA 4XWYA 2O2IA 4IO1A 3M9WA 4FBMA 4RPKA 1GR0A 3EMDA 4ZDJA 1R4AA 1V26A 4TZ0A 3WHPA 1U3CA 3WKEA 4KZPA 4TT8A 3BMOA 4QNRA 2PUVA 4C7JA 1GOTA 3E18A 4D4GA 3SR4A 4GL2A 1QFJA 3V55A 3L7JA 3M49A 4UU8A 3RAGA 5K7SA 3BKWA 3ST7A 3TUJC 3K1TA 4WZ6A 1A9TA 5IAAA 1ZZEA 4R8RA 4RFSA 5BSMA 4EPRA 3SC2B 2CXNA 3D0KA 4C5BA 1XZHA 4ARCA 3TLKA 2WC1A 3VGJA 3VC7A 2VDLB 5I7FA 4YRQA 1ZA2A 1VJDA 3NHYA 4NYIR 4IFIA 4X24A 3B38A 5EP1A 2BV3A 3GK3A 4LYGA 4BVAA 1Z0ZA 4BO5A 2B7LA 5IP5A 2IL1A 4KPYA 4G97A 4GDFA 1YRQA 1TDJA 1NVVR 3C5HA 5B2FA 3OIVA 2JHAA 4AG6A 4DRXB 5KYKA 4KIFA 3DLBA 1EVIA 4X61A 3M2PA 3PFBA 2IOHA 3H1PA 1AKMA 3CKMA 2OK7A 1NJSA 1Q3HA 3NBYC 4FMCB 4NBWA 2E37A 1REQA 3C6MA 4YGYA 2VAPA 4CTKA 5HRCA 2GM9A 1EVZA 3UJ8A 1TLFA 3HJUA 1E4OA 1I0ZA 5DF1A 3EPJA 1P7CA 4WJZA 3U3MA 3VNRA 3OEHA 1F6DA 1EUCA 3PLNA 1DQZA 3DEZA 1O54A 4QBIA 4OLFA 4TWAA 5K99A 2Q5OA 3GGJA 2IHZA 2IPAB 2V7PA 4INOA 4BZPA 1V4BA 3RASA 4NZZA 5EERA 1J5XA 3LDHA 3K9CA 3DDSA 2QU8A 4GYJA 1TEXA 1LSJA 1XKXA 1ULZA 4RFVA 5AK0A 1LNSA 2J87A 4B3CA 2R87A 4TSFA 4WNAA 5EMMA 1XDSA 2AFHE 2P7HA 4ND1A 4UKDA 4XM0A 1KP2A 2JH8A 2OTCA 2ZTLA 4PZZA 2H7VA 2X3YA 2ZDQA 5FR2A 3HWSA 2IYEA 5UKDA 1Q74A 1A98A 1MEOA 3TLZA 4DZTA 3SQXA 1WZEA 1L4YA 3O4FA 5A05A 4KH1A 1NOKA 4A7PA 2VTBA 1G20E 3PL1A 5TVKA 4AC9A 1YJ5A 2I3AA 3ZHRA 3LBIA 4D42A 2I7CA 4LV5B 7GPBA 3ZW7A 2P41A 1X70A 3FY4A 1LUAA 3P9KA 1G9SA 1U9CA 1ZD5A 1PZEA 1UWVA 2WW8A 1VPTA 2GBLC 3ABRB 3NEJA 3PI7A 4YDRA 2AR7A 4FFWA 1JTFA 1P80A 3HN2A 3REFA 1GL6A 1JR3E 2CNLA 4AU1A 3D5TA 2G3YA 1DGQA 2OOSA 4BEBA 3LFTA 2AVNA 1DWPA 1G0NA 2XNJA 1XPJA 3HLKA 3Q7QA 4WADA 3NTQA 1WPXA 3QELA 5H81A 2ZAIA 5KVQA 4EATA 1I6MA 2IP1A 1W36C 1STOA 3W3AA 4MW9A 1NBOA 3TSOA 3RVMA 2HIHA 1XTTA 2IIVA 4XWAA 3LC2O 1FTGA 3ZTWA 4JHXA 3UWOA 5ALWA 1QB7A 2Y1EA 3PPVA 4DHWA 2AC2A 4I4CA 5ALRA 4MYDA 4XPZA 5A4JA 1XMXA 2VJOA 2PRKA 3HCRA 3OLWA 3BSYA 4CN9A 1FYXA 2YX1A 4N47A 4QPZA 1ISJA 1K7SN 1XDGA 1ZN9A 4RH0A 3NIFB 1OLUB 3N2LA 4R9VA 5G3YA 2PUCA 2IS1A 4D9BA 4ZCSA 1T2UA 3AIKA 1E94E 1ZH4A 2BFOA 3T06B 3NVKI 4FFPA 1VLVA 4DF3A 2SCUA 5F98A 2P4QA 3F47A 3OZGA 3RFCA 4JLBA 4YT8A 2GESA 1PV4A 1WDMA 3PCRB 3HO6A 1Q92A 4NONA 3R5XA 5THXA 4AURA 1W2HA 4C6RA 4OOEA 4B76A 5BR7A 3VXKA 2GCOA 5C4MA 1EGQA 1CIJA 1RACA 5EXXA 1AGRA 1N2OA 2PVPA 2YWGA 4DRYA 1CRQA 1TK3A 3CB2A 5CHEA 3V9PA 3IPLA 4ZJYA 1LCIA 4XWKA 5AVWA 3EODA 2YVUA 1W4LA 4RW0A 3UAGA 1RPAA 2R5NA 4BO1A 2FPOA 2WK1A 1QG4A 2A5LA 3PSAA 5JC8A 1GNQA 1WA5A 4TTJA 2Q6KA 2QYTA 5CNKA 1ULAA 2XCSB 3QFCA 2Y1OA 4MW5A 1SULA 3C24A 3L41A 4OHKA 4CM3A 3DR5A 3HV0A 5A3RA 3IA2A 2RKBA 5DT2A 3RAPR 2QA5A 1Q2XA 3RI3A 2LUOA 4LC1A 2ZUEA 3CUEF 4HBZA 4FHEA 3AR7A 4JUCA 1RP1A 2ZOSA 4KPUB 4OOFA 2CL6X 3A4VA 2QNRA 3BGVA 1NOIA 3ENKA 2VCHA 3H1TA 1YCHA 1XRSB 2JFBA 2AL7A 3L4BA 3LXXA 2GEBA 1RIIA 3GUZA 5B37A 2B4AA 2PLWA 2H1WA 4K8OA 3C85A 1FFBA 1LK7A 3E8XA 2OO5A 1IMJA 1K3UB 3DZDA 1PW7A 2ZIEA 3IUMA 3SHVA 1GPMA 4ENVA 5JH7B 2Q3BA 1HLDA 2GUGA 4Q1FA 3UMRA 1QO9A 2JI4A 5E9JA 3ROPA 3VYWA 3SXUA 1V8PA 4P84A 1UWKA 1OD6A 1U99A 4MUHA 3FFAA 3F8SA 5TQVA 1B2RA 1L5OA 4KV7A 4C22A 4OP2A 4RBNA 2ZANA 3A05A 4JXZA 2UXDB 4Z0HO 5JJCA 1L5WA 1C9MA 5BN3B 1CQIA 1DAHA 3ZU6A 4NE7A 1DG9A 3BXZA 1J8DA 1PU2A 4KSBA 7MHTA 3FA2A 1G8HA 1WP9A 2Q29A 1T0HB 4OJKA 3RLIA 5AM1A 1ODKA 2FWPA 1R9GA 5AOVA 1YDWA 1KYWA 2FW1A 2WUVA 1M2NA 1M1NA 4DW8A 2IYTA 4HXYA 1Q7RA 4UQLA 1C29B 1E1CA 1KFKB 3KQWA 1JXAA 3IBGA 4QFDA 3KLNA 5T64A 4CKBB 5BUZA 3YASA 4YJGA 1I01A 4GZ6A 4UFOA 3N8HA 3UJ9A 5C35A 1KKUA 2M2IA 3KFXA 3RVPA 1VE5A 3VYRB 4BFTA 1PHPA 4GOLD 3L0DA 1L7PA 4AIIA 3ILXA 4AUNA 1SUPA 3DXFA 3TPZA 4BRUA 1VJTA 3WK4A 3OT1A 2RK4A 3BN3A 1VMAA 1NKVA 2I3ZA 3IVMA 4DARA 1D6JA 2FCRA 3GBPA 1IU9A 2VSOA 5K4HA 2V74B 4W1QA 4F86A 3O8RA 2BHLA 4QUIA 4BXOB 1IDOA 5FPQA 2VWPA 1L1RA 3Q41A 3IP3A 2HA0A 4DLLA 3NFRA 5G1NA 1DBVO 3LQFA 4BEVA 1ZGHA 4JYZA 3Q88A 4HG2A 3PNLA 4LJ6A 2H4YA 4TMVA 1F3OA 5F52A 3RC7A 2N3ZA 4CKWB 4WLOA 4LTMA 5KVVA 4CFYA 4DMGA 3TL3A 2FCAA 4EPWA 3I9V1 1TCVA 1ZS9A 4P5DA 1E2UA 1XAGA 5AO9A 3LTNC 1JLLB 2DR0A 5K4AA 1EI9A 1PGOA 1RYZA 3HGMA 4JLMA 2VDRB 3JALB 4AYTA 2AN1A 5BRJA 2OAQ1 3HVRA 3EHDA 2DUNA 2P75A 1Y3IA 3B8EA 1A5AB 3ZUPA 5JNSA 1EVKA 1UOEA 4TS3A 2D0IA 4Q7EA 2YIJA 3T4PA 1WY7A 3NONA 4F2DA 1T2DA 3RWOA 1FW6A 4OFWA 4EHAA 1Z6XA 1ZCFA 2C95A 3CA8A 3CQ9A 3PUWA 1Z4MA 4RHEA 1QC5A 1Y9EA 3AHIA 3WLIA 4HDAA 3W2HA 1VE3A 4YASA 4MVJE 4ABTA 1XX6A 4NCBA 4D9EA 2RC6A 1YB6A 4CLRA 2IU0A 1ZHFA 1FFGA 1Z4OA 4B0OA 3DLHA 3AHHA 4RA9B 1SPXA 1FW8A 1QQ6A 3BTOA 1QAOA 3LP6A 1KH3A