2QM0A

Crystal structure of bes protein from bacillus cereus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
261
Chain Sequence
b'NTTVEKQQIITSNTEQWKMYSKLEGKEYQIHISKPKQPAPDSGYPVIYVLDGNAFFQTFHEAVKIQSVRAEKTGVSPAIIVGVGYPIEGAFSGEERCYDFTPSVISKPWPKTGGAHNFFTFIEEELKPQIEKNFEIDKGKQTLFGHLGGLFALHILFTNLNAFQNYFISSPSIWWNNKSVLEKEENLIIELNNAKFETGVFLTVGSLEREHMVVGANELSERLLQVNHDKLKFKFYEAEGENHASVVPTSLSKGLRFISYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BES
molecule tags Structural genomics, unknown function
source organism Bacillus cereus atcc 14579
publication title Crystal Structure of BES from Bacillus cereus.
rcsb
total genus 84
structure length 261
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qm0A01
1EK2A 3M83A 5CXXA 1LPNA 1HQDA 1YB6A 3VISA 4Q1VA 5JYCA 2PVSA 1ZI9A 3QH4A 2O7VA 5EGNA 3WL6A 3R40A 3FYTA 1JT2A 4JYPA 1XRMA 4H35A 3AJAA 1L7RA 5LZ8A 3CN7A 2FJPA 2HHAA 3QPAA 1XQVA 1QLWA 2PL5A 1XZDA 4H18A 4BTVA 2WLSA 4PO3X 3UUFA 3L1JA 2QRUA 5ALHA 2ROQA 5YASA 5AOCA 2RGUA 2V98A 2WIGA 1JU4A 1JJIA 4MEBA 4KR0A 3AINA 2WILA 2C5GA 2H1IA 3OPMA 1QGED 4X94A 2BAGA 3C8HA 4Y2XA 2XUKA 1DT5A 5H3HA 4XX1A 1YR2A 1U8EA 1E5TA 3ESBA 4C87A 3H1BA 5DWDA 4N8SA 2DR0A 2HA6A 3WWCA 3N2ZB 2DSNA 3WZLA 3ESCA 2OQIA 4FBLA 1VKHA 5KWIA 1SCQA 4YASA 1QFMA 1CUFA 2XE4A 2WHPA 2Z3WA 3W2TA 1DQZA 3LIPA 5AOAA 4DM7A 5BOVA 1E3QA 4A23A 1TCBA 3O4IA 2GBIA 2XMZA 5CH3A 1UOPA 4AZ3A 2X5XA 4X00A 2GZSA 3WA6A 4BVLA 2DQYA 4EY6A 4DMKA 2EDCA 5AK5A 1XFDA 4ITVA 4FNMA 4GXNA 2YH2A 1Z68A 4ETWA 2ZVDA 2I3DA 4CG3A 4BCBA 4HXGA 4UFPA 1HDEA 2R11A 2P8SA 3H2KA 5AKJA 3DKRA 4H7HA 2HL6A 3BIXA 5AKEA 4V2IA 2ACEA 2WFLA 1FSSA 1DU4A 1XKLA 3IDAA 3D2CA 3FWHA 1MX9A 1F0PA 5FPQA 4IH9A 1WB5A 1XZAA 3AUKA 5ESRA 1EB8A 4NS4A 1UK6A 2PBLA 1IVYA 2XUIA 3EQ8A 4QLOA 3EQ7A 3LIIA 3R3YA 3BDIA 1J06A 1HPLA 3OTQA 4K6GA 1F8UA 1P0IA 5DYYA 3IIIA 3E1GA 1XZJA 1CUZA 2O2IA 2J3DA 3LCRA 4G9GA 5KWJA 5SYMA 4OYYA 2ZYSA 1A8SA 1CUYA 4GBGA 2AJLI 3O4GA 4UBIA 3VJLA 5CT5A 1MPXA 1C7JA 2XI4A 3FVTA 5HCUA 4ZRDA 3A6ZA 3M82A 2HA3A 4A5SA 5LYYA 1CUEA 4OU5A 3GZJA 1N8SA 2VA9A 4W1QA 3AIKA 2PSEA 3I1IA 2Y6VA 4HVTA 4BDTA 5ALRA 3STXA 3WK9A 1UOOA 4FHZA 1MNQA 2CBGA 4WFIA 5E4TA 5CH5A 1XRNA 2C0QA 1BN6A 1AKNA 3AIOA 1XZLA 3QZUA 1FFAA 5AP9A 2PX6A 3V1MA 3EQ9A 5CBKA 3C6XA 2QS9A 1PJAA 4TVKA 3I2KA 3BF7A 3ANSA 5FKJA 5JIBA 3QMVA 2VJBA 2JGIA 1CUBA 2XMQA 3DJYA 1CV2A 4B81A 4X93A 2OQVA 1XQXA 1EINA 4EY5A 5C81A 4UBJA 4YX9A 1D07A 4W1SA 4Y2QA 2XMSA 4G9EA 4HAIA 4Q05A 3A70A 3O9MA 4EBBA 2HDWA 2DHDA 3W9UA 4FBMA 4BCCA 3ESDA 4DMCA 4U2BA 1CUVA 2BJHA 4C4YA 4ZXFA 2C7BA 4OD0A 1XZFA 4WDRA 1WOMA 4DNFA 4JNCA 4FKBA 1DWPA 2EDAA 5C7YA 3WIBA 3G7NA 3OC0A 4KE7A 1I6WA 3D4LA 2AJCA 2QUAA 1NU6A 3SC2A 4EY8A 5AKYA 5K3FB 1ZGCA 4OSEA 2Z8XA 3FAKA 1N5RA 5D3ZA 1K4YA 4BRSA 4MWTA 1WPRA 3DKKA 2HRRA 1MAAA 4KE9A 2HU5A 2G5TA 4TGLA 2WFLB 1TRHA 4BVKA 4J0DA 1EDDA 4DSZA 1YA8A 2VATA 2RIPA 4JH0A 1C7IA 3W9BA 3FLAA 2X76A 1SC9A 2J4CA 2BUAA 5HF9A 4H7JA 2H7YA 4MEAA 2XT0A 2FUKA 4DMHA 4JEIA 5ALEA 3QMMA 1ODTC 2JGJA 4FMPA 1AMNA 4ZV9A 4F5ZA 2QTBA 3BL8A 3FYUA 4DTCA 2QKYA 5C8VA 5ALUA 2XDWA 4AO6A 5ALMA 2V96A 2QOEA 5ALZA 2RAUA 4W1PA 3P2MA 4S0XA 3KWJA 4Q3KA 2XLCA 4G8BA 3B12A 4HRYA 1XZMA 2XLBA 5AHXA 3D3NA 3L1HA 3I6ZA 4C4ZA 3KSRA 5LP1A 3R3XA 4CIBA 4U2CA 3H04A 2ZSIA 5LZ4A 4KACA 3H2IA 1ORWA 3DL7A 4BTLA 4XIIA 3UUEA 2NW6A 5LZ7A 4AN0A 4KAFA 5ALXA 3WA7A 3BWXA 3IURA 1DINA 1XKTA 5ALWA 4BP8A 2AJDA 3G0BA 2AXEA 2YYSA 2XQFA 3ILSA 4H7KA 3WKEA 1AZWA 4BAZA 2QR5A 5AI5A 2PSDA 1DTEA 2H7XA 3DCNA 4B0PA 4P92A 2WIDA 3FCYA 2JF0A 3H2GA 1XZKA 2XUGA 4BDSA 3G8YA 5JADA 2PPLA 5FOQA 5ALPA 3I6YA 1EVQA 5EHNA 3GUUA 4AXBA 1XZGA 3K2IA 1JMKC 2VJDA 1CQWA 3IUMA 5K3DA 4M0FA 5CT8A 2CKMA 1N1MA 4KAJA 1EX9A 2C5FA 5DTJA 4MYSA 5IVDA 5ALNA 4DMFA 4Y2UA 3ANTA 3DLTA 3G9XA 1QIIA 4Y2PA 5A7HA 4TPKA 1AX9A 3HABA 3DYIA 4FLMA 2PKYX 1IUOA 3PF8A 3W05A 1SCKA 4LKOA 1EVEA 4WDQA 5ALVA 1UK9A 3L1IA 2WFZA 4Y2JA 1LPOA 4OCZA 4B84A 5D3KA 3PUHA 3FBWA 2CB9A 1CVLA 4J03A 4BC0A 4INZA 3W04A 4W63A 3C6ZA 4E46A 3IULA 2G5PA 3K6KA 2G4LA 3RM3A 2WKWA 2QMQA 2CJPA 2IIVA 2I78A 3KDAA 5CT6A 4N5HX 5ALLA 1MT3A 3YASA 3F97A 5I9IA 5LKRA 1ZJ5A 1ORVA 2QJWA 4EUSA 2VAVA 4UFNA 3WK7A 1CUHA 3WMRA 1HLGA 4DNOA 5LZ2A 5LZ5A 1GXSA 3EF3A 1EI9A 3I6MA 4J0IA 1U4NA 1BCSA 3BF8A 4DLNA 3WK5A 2CMFA 4LXGA 3I2JA 3H0CA 1W6RA 1GGVA 1Q83A 1JJFA 5LZ9A 1R9MA 1E66A 2OCKA 2XMDA 4HS9A 1MU0A 1B6GA 2ZYIA 4BRZA 4X95A 1AUOA 2HA7A 5JZBA 3WZMA 4UPDA 4QLAA 2WJ6A 2LIPA 1NU8A 5JANA 1QJ4A 3ED1A 5HF5A 5DYWA 3C70A 3VXKA 5K5EA 1GPLA 4AX4A 3N0TA 2RI6A 3IB3A 4CG2A 3I2GA 2IITA 3WWPA 4BBZA 7YASA 4E15A 1ZICA 2AJ8A 1BCRA 3WK4A 1VA5A 1GPKA 4U2EA 4QWMA 2GYWA 4N8EA 3EIOA 4G4JA 1TQHA 5ALQA 3D5EA 3I2IA 5ALIA 2PSHA 2HU8A 4LYEA 1T4MA 4H77A 4WY8A 1QIDA 4IH4A 1W52X 3PI6A 2V97A 3BDVA 2ZJ6A 3BJRA 4BVJA 3GA7A 1F0NA 3FSGD 2C0PA 4DGQA 1ODSA 2V9ZA 1WHTA 4UBKA 3C5WP 5AOBA 1QONA 4M0MA 3AFIA 4X91A 1YAJA 1Y37A 4UHBA 2HIHA 2H7CA 4UBNA 5KREA 3RKSA 4F60A 4WCVA 4IHAA 4EY7A 4G4IA 1UXOA 4Y2RA 3QM1A 4G4GA 3T52A 4Y2TA 4ROTA 4CFSA 4AO8A 2OCLA 4G1FA 4DIUA 3QBJA 3WIOA 4B7ZA 4L72A 1FFBA 2BUCA 3KOOA 5F4ZA 2WIKA 4LYDA 1VOTA 2FJ0A 2WIJA 1A88A 1CLEA 4BZZA 5AI8A 4C01A 4AO7A 1PV1A 5IVIA 3JW8A 1FFCA 2CZQA 3CXUA 1XLUA 1DWOA 1QE3A 3DS8A 3IUNA 1TK3A 1VA4A 4PNZA 1SOMA 2XMBA 4IQ4A 3C6YA 3CN9A 4AB1A 2ECFA 3K9BA 2RONA 1P0PA 3STTA 4CCWA 1AQLA 1MX5A 5AK4A 1XQYA 1LZLA 3R3UA 3DQZA 1QFSA 2B61A 3JWEA 1DX6A 2WQZA 4UHCA 4NZZA 5EHXA 3TGLA 2XUHA 5BV7A 4XVCA 2OCIA 5ALFA 3V9AA 2Y6UA 2WTMA 3HLKA 2HA5A 5ALDA 4X6XA 5IVHA 3FLEA 4Z49A 4CIAA 2VT6A 5IVKA 1U65A 4B83A 1MN6A 1R9NA 4FLFA 2XQJA 4P93A 4B85A 2VEOA 2XUPA 4J0KA 1H22A 5FP0A 1DX4A 3STVA 2JGMA 1KU6A 3E0XA 4I3FA 2O2GA 5AM1A 3ZWQA 1UWCA 1XZEA 1HBJA 1P0QA 4HXFB 3H18A 2PU5A 3DEAA 2OPHA 1QOZA 2O7RA 4K2AA 3G02A 5AKZA 2J4FA 3WKAA 2Z8ZA 1Q0ZA 5ALSA 5K3CA 4G8DA 1XZBA 3Q8WA 5AICA 1FJ2A 3PICA 1IZ7A 2WHRA 2HA4A 4GLBA 1XRRA 5AI0A 2WU4A 5AKXA 5HF8A 2ACKA 1IUPA 2VT7A 4K6KA 1EDEA 3B3QA 4QDUA 1FFDA 4NVRA 5IKXA 1J1IA 4AMYA 3F9CA 1IZ8A 5FDFA 5A7FA 5A62A 2I03A 1O6GA 3HI4A 3WK6A 3DYVA 5AKIA 4UBLA 3IUQA 2ES4A 4H7EA 5JARA 5JAOA 4N8DA 5T4HA 3A2MA 5JASA 4RGYA 4KRYA 3AIMA 3WL8A 3IUJA 4Y9SA 2XUDA 4QDZA 2XUQA 1YAHA 2JEZA 2RHWA 1WB4A 4UFOA 1UKBA 3D0KA 2OGSA 4X7BA 3H1AA 3Q0TA 1WHSA 1MJ5A 6YASA 4BB0A 4OB8A 5CW2A 2XMCA 5JAPA 3VVLA 3H2JA 4QDTA 3MUOA 1CUCA 2XQGA 3VKFA 2PU7A 4P9NA 4KE6A 2VJCA 4RNCA 4X6UA 2Z3ZA 4RPCA 1CUAA 3DDUA 1K5PA 1GPNA 4QZVA 2AJBA 5EIHA 4IO0A 1IUNA 3WKCA 3WL7A 3STUA 2OAGA 4UHHA 4W9RA 3G0IA 1CUJA 4LXIA 2OXEA 2HA2A 1M33A 2XQKA 2VF2A 3WJ1A 2BUBA 3G0CA 4FFVA 5AM5A 3ZLTA 4B6GA 3GROA 1QIMA 4RE5A 3PFBA 3TJMA 2DHEA 2HM7A 1RP1A 3NUZA 1LPPA 4QWWA 1LPAB 1JU3A 3HEAA 3RK4A 1Q84A 1GQSA 1CUWA 2WTNA 4H0CA 1UKAA 2WUEA 5JZSA 2BFNA 4U2FA 5LLSA 1J07A 1ZGBA 3SK0A 1JI3A 1XZCA 3U0VA 2WUFA 1XZHA 5LKAA 2EEPA 3WKDA 3QVMA 3O9VA 1R4ZA 3WWEA 3GELA 2BCEA 4J0JA 2Y1KA 4X92A 3STWA 2Q0XA 2GYVA 4Y2VA 2XUFA 1TAHA 4BYMA 1ZI6A 3DL4A 5JD5A 3TRDA 1P0MA 1MNAA 4WJLA 1SCIA 5ISMA 5FLKA 3DOHA 5HQ3B 5T4EA 1GT6A 5AKHA 4X90A 4BZWA 4XWGA 4MJ3A 1THTA 2BGRA 4YK7A 3WLAA 1YA4A 2GZRA 3QPDA 4XJVA 4ZWNA 4HRXA 3A2LA 3IBTA 2DHCA 1ETHA 3D2AA 1WB6A 1Y7IA 4MWSA 1VLQA 5K3BA 4BAGA 3F67A 3EBLA 1CUXA 1EB9A 5JZ9A 3ZV7A 4UBOA 1R3DA 3VJMA 5DNVA 2DCMA 2YASA 3F8SA 4FOLA 2CEKA 1QTIA 5K3AA 1BRTA 3AZQA 5AKKA 1QO7A 1YS2X 2ZYHA 3IVMA 2ZJFA 1WM1A 3NWOA 4B80A 3A2NA 4QDXA 5AIAA 3H19A 2GBCA 1QTRA 3D7RA 2GBFA 1RYYA 1BN7A 1ZOIA 3WQHA 2VQ6A 4FWBA 3X3HA 2QXTA 3B5EA 1ISPA 4G5XA 3VJKA 4MYDA 5EI5A 4LIPD 5ALGA 5DLPA 5DNUA 1XLVA 2YXPX 3U1TA 4E11A 1UFOA 3AZPA 4J3JA 4I4CA 4DNPA 3KWFA 1BS9A 5JAHA 5C8XA 2IX9A 1BEZA 2XUJA 3QITA 1L7QA 1GQRA 1XQWA 1EHYA 3S8YA 4Y7DA 5FUMA 2VJAA 1H2ZA 2WU3A 1VJ5A 2JEYA 1ZI8A 4I19A 4UUQA 4PSDA 3E4DA 1UK7A 2JGEA 5DJ5A 3QMWA 4HTAA 4U2DA 3ZLVA 2JGFA 4OYLA 3I2HA 2W6CX 3QYJA 5HZGA 5K3FA 4GDMA 4BCDA 2C4HA 3G9ZA 3RARA 2QUBA 2CUTA 2XUAA 1BROA 1F6WA 3BXPA 2JGLA 3WJ2A 4W1RA 3RLIA 4FNGA 5ALJA 4HXEB 3ICWA 3G9TA 5AKLA 5EHQA 3FOBA 3C6BA 1ACJA 4ARBA 4B9EA 2WJ4A 4PQEA 2ONCA 2Y2UA 1ZD3A 4WFKA 2XQIA 1R1DA 2O2HA 1AC5A 2WG0A 3DD5A 2HU7A 5A71A 4GI1A 1ZIYA 4L9AA 1G42A 2JBWA 3F98A 3UMJA 2PSJA 3DNMA 2JGKA 4GW3A 3C43A 3WYDA 4AMZA 4C88A 3HXKA 5A2GA 3VDXA 3SWWA 3WYNA 4CI9A 5AIBA 5AM4A 3GBSA 3E3AA 1L7AA 1PFQA 2OG1A 1EK1A 2HFJA 3M81A 3FNBA 2QT9A 4BC1A 3O4HA 5DNWA 3F96A 4J0HA 4UHFA 3R41A 3M3DA 3WWDA 4DSAA 5I8PA 3V1LA 5AM3A 2WSLA 3OOSA 1T2NA 2H9YA 3T4UA 4EHBA 1UKCA 5JATA 1E8DA 3WL5A 2E3JA 2XUOA 5HK8A 3WWOA 2VTVA 4C4XA 5JD4A 3CCCA 3ESAA 5D7BA 4KEAA 5E4YA 4Q82A 2WUDA 4O08A 5CT4A 4HZGA 4J7AA 4D9JA 3AZOA 1YB7A 5ALOA 1CUGA 3H2HA 5FV4A 1JJBA 5JALA 4FDMA 4L0CA 1DQYA 1S8OA 1CUSA 2ZYRA 1GKKA 5A7GA 3W06A 1TCAA 2ZJ7A 3JYHA 2C58A 4F21A 5E4JA 3HACA 4N5IX 1KU0A 2WHPB 5J3JA 1MTZA 1ZD2P 3SX4A 1ZD4A 4EZIA 5CRIA 4AZ0A 1FFEA 5AI6A 4CCYB 4JUIA 2Z5GA 3IA2A 1IMJA 2XMGA 2QVBA 1LBSA 2ORYA 5BWCA 3CCBA 1W76A 1BEEA 5IH7A 5EIAA 5CXUA 4Q3LA 4KYVA 2OAEA 3LP5A 4CG1A 5EHZA 4A16A 2D0DA 5CTAA 4OU4A 1CQZA 2PUHA 4QE3A 1H2XA 2X8BA 1CUIA 3OG9A 1J2EA 1QO9A 4CCYA 1A8QA 3LS2A 5AI9A 5DTIA 4QNNA 2HRQA 5AO9A 4PW0A 1QZ3A 4WY5A 4MXDA 5BWBA 2OCGA 3FYUB 1WPXA 1OILA 3V48A 1JMYA 1ZD5A 5HFNA 4PSCA 2WG1A 5EFZA 2B9VA 3D2BA 4GEGA 4Q3OA 3D59A 1AURA 5HFAA 1XZIA 3MUNA 2WFMA 1W1IA 4C89A 1DWQA 4EA6A 1JKMA 4ARAA 5HQ3A 4UHDA 1CIJA 3ICVA 5T4BA 1TIBA 2WHQA 3NOXA 5HKBA 4MQLA 4X3CA 3PFCA 3C5VA 5FPPA 3I28A 1EH5A 4GHWA 1R50A 4PSUA 4PV7A 2JIDA 4X71A 4X6YA 1AGYA 3C8DA 3OM8A 2VAXA 1N5MA 3V1KA 1XLWA 3R3WA 3H17A 1VE7A 4B9AA 5HF6A 2QZPA 1TKRA 3WI7A 1E8MA 5D6OA 4UHEA 3WK8A 5HK9A 4G8CA 4H7FA 1HL7A 1QIHA 2GYUA 4BE9A 1W75A 1H2YA 1THGA 4X97A 5AI4A 4YPVA 5ALYA 1EDBA 5C8ZA 3AILA 1CPYA 2HA0A 1A7UA 3S2ZA 3V1NA 4K5QA 2DFPA 2HFKA 5AM2A 1W4LA 2BKLA 1LPSA 3GFFA 4BATA 3HYSA 1CEXA 5LIPA 4ZREA 1YCDA 3C45A 1B41A 3STYA 1U2EA 5JD6A 5AKGA 2WG2A 3HRHA 1VZ3A 4K6HA 5E2IA 2GBGA 4OUKX 1LGYA 1LPMA 2G63A 4EY4A 5ALKA 1X2EA 4IH1A 4ZV7A 1USWA 1YSCA 2UZ0A 1UOQA 1CUUA 2R8BA 3PE6A 4LXHA 3VVMA 1QIFA 2OGZA 1QIEA 3O0DA 4Q34A 4F0JA 3WKBA 5HKAA 3FYUC 3HC7A 4KJXA 1QIJA 4LHEA 2B20A 3R3VA 4OB6A 5A6VA 4ZGBA 1K63A 5CMLA 1MX1A 5AM0A 1MO2A 1OCEA 3DOIA 1G5FA 1CR6A 2OGTA 1QIGA 2FX5A 3C87A 1EA5A 1OXMA 3BE8A 5K3EA 1UK8A 1LNSA 1Y7HA 2QM0A 2QJRA 1DT3A 4FFWA 2PM8A 2W22A 1H2WA 1LPBB 1UZAA 4RE6A 1E8NA 4U2GA 1KEZA 3ZPXA 1VZ2A 4UBMA 3HZOA 1QIKA 3MVEA 5ALTA 1MAHA 1RWQA 3FCXA 5AK3A 4E14A 5CH8A 1X70A 5FRDA 4DNQA 1JFRA 2B4KA 2I3ZA 3FLBA 5AJHA 3G0GA 5JAUA 3PUIA 4J0GA 1VXOA 1XROA 4ZI5A 1BU8A 1XRPA 2D5LA 3BIWA 5AH0A 4C6HA 2K2QB 1ZJ4A 2QXUA 3ZLUA 3TEJA 1GZ7A 5FXMA 1CUDA 1R88A 4H7IA 3ZI7A 3HJUA 4M0EA 4FTWA 1YS1X 3LLCA 3PDCA 1EXWA 4OB7A 5AK6A 3I2FA 2HADA 1TCCA 4BE4A 1XRLA 3O95A 1C4XA 3KXPA 3G0DA 1ACLA 4KAAA 4MQMA 3I1YA 2WIFA 1YASA 4PF1A 4KE8A 4BAUA 3R0VA 1XRQA 1E89A 2ZSHA 1O6FA 4H7DA 1GKLA 1LZKA 2PUJA 1BE0A 3HSSA 1ODCA 1X2BA 5I7UA 2XMRA 3R3ZA 4QDOA 3MGAA 3FVRA 5SYNA 4QEKA 5EIEA 1A8UA 2WUGA 5KBYA 1ZIXA 1SFRA 4X85A 1VE6A 4P08A 4BP9A 3OURA 5T4FA 2RHTA 4QA9A 5CT9A 4GWLA 1UT6A 5CURA 3PF9A 1Q0RA 3O4JA 2DQZA 4FLEA 1HKHA 2J3QA 4DYHA 4GECA 2VSQA 1K6EA 3KD2A 4AN1A 4Y2SA 1H23A 3QPCA 4J0CA 3FSGA 1CFJA 1WCYA 1LBTA 4Y2YA 3NGMA 4B82A 4B0OA 4NMWA 1LLFA 1K8QA 4WFJA 1VXRA 4JYMA 1CRLA 2WM2A 2XB6A 4L3WA 4KRXA 5DYTA 2Y2VA 1G4HA 2PSFA 3G9UA 4EB0A 4AQDA 1G66A 3BJMA 2WJ3A 4OPMA 2OLEA 1NX9A 2BGNA
chains in the Genus database with same CATH superfamily
1IQPA 1CR2A 3PIRA 3U26A 4EELA 3I0ZA 2NUTB 1J7JA 4JGGA 5EUQB 3PFNA 3TUIC 4EATA 2BKVA 3MINA 4F3NA 3WLOA 2JS7A 4U7FA 1DIRA 3SN6A 3M83A 5CXXA 3AEQA 1TE2A 3UA4A 2NU9A 1HQDA 1YB6A 1CYEA 3B5JA 3L7CA 1AGXA 1OBVA 4B2YA 1RRFA 1LXCA 1V5EA 2C1XA 3NC4A 5JYCA 4TV9F 5EGNA 1R9JA 2DHRA 2A5GA 1GP2A 2A3NA 3TLGA 3EIFA 2HYIC 3TIFA 3OQJA 5FUVA 1I14A 1MHPA 2RAFA 1XRMA 4OBBA 3TOSA 4D3YA 4H35A 1WSDA 3BFKA 3U16A 1RKXA 4F8EA 3CGGA 3E84A 1Q21A 3TECE 5BW4A 1J42A 4CPDA 5IT9A 2XWQA 1D2CA 2P2NA 1BGXT 1O4WA 1YJ8A 3LGXA 1QLWA 4GSLA 5LMNB 1XZDA 3DMYA 4GMXA 1T6NA 2LVBA 2WLSA 4QYIA 1VMIA 2XIQA 3AHJA 1XA4A 2RK6A 3NBUA 1J21A 4US1R 3WQRA 1O1YA 5IG2A 2FSHA 1DHTA 4UAJA 4JQCA 1XCMA 2ZG6A 3ONEA 3SLGA 4L50A 2WT8A 1NSFA 4AY5A 4IO1A 3NASA 1Z0ZA 1NI3A 1SBQA 4HDNA 5H3LA 4V0QA 3B1VA 1NJ6A 2V98A 3UM9A 1ZH4A 3QBDA 3AWIA 3TTWA 1U02A 2DF8A 3B8EA 3LU1A 3OO0A 4MEBA 4BLRA 1L3BA 4RCYA 4BNIA 5BUQA 1N1DA 3AINA 4NYJR 2E18A 1HFKA 2FP4B 4XLLA 1S4MA 1KORA 2QL6A 4D3DA 3LDFA 2NO0A 1Z4IA 1AK1A 2FPOA 2H1IA 1N0VC 3E4CA 4X94A 3C8HA 2G71A 4H1VA 1U2QA 3DAGA 3FR8A 3CYFA 1LJ8A 3BB3A 1Z33A 4PVDA 4BLQA 3AKEA 4DLTA 1U3GA 4KXXA 2O2JA 1NYQA 4E94A 1NX6A 1U5AA 3NDJA 4PZEA 3KFLA 3ADPA 4TS9A 5H3HA 1OY1A 4F06A 1HWYA 4Q4JB 4XX1A 4CM3A 3DZDA 1AH2A 2W2VA 1U2DC 1S2OA 1L4NA 1W49A 3C3PA 3L02A 2ZTUA 4C87A 4TL7A 4CTJA 5AHWA 4GZ3A 4EPVA 3U5TA 2E2WA 3OCZA 5AW0A 1EDOA 4B45A 10MHA 3T9DA 1DDGA 3RG8A 1PKXA 2OFWA 2HA6A 3THRA 1M1NA 5CP8A 3WWCA 2LW7A 2H57A 5NULA 3IOBA 1CZHA 4DWWA 3PNKA 3CWZA 3MSXA 3Q9SA 5B1IA 1C30A 4EYQA 3H13A 1JIQA 3D8SA 3MTDA 3HZZA 1KYIA 1MMFB 3C7AA 3VVBA 1DRWA 2W4MA 2HK7A 4UMDA 2YN0A 4XTCS 1JN0A 2OQIA 5GP1A 1ESZA 3LQ2A 1VHTA 2BZ0A 3PITA 1VKHA 5KWIA 1X1QA 4YAGA 2GCIA 4LG1A 4PY2A 1DTSA 4NJOA 4DR4B 3WHIA 4B3MB 2XITA 3BD7A 2O52A 4X1KA 3A9RA 5AOVA 3HCNA 4Q19A 4F3CA 1IK6A 1OI7A 3SXPA 1MC1A 2J09A 1EKXA 2GAJA 5BVGA 2P75A 1ISFA 3KPUA 4HDKB 4DZRA 3T1OA 1TEVA 1U3CA 4UM8B 4XQ9A 2CWWA 4NE7A 1TTQB 2LP4Y 2P2SA 1V4NA 4BN0A 2GBIA 4GRDA 2HIAA 4QU8A 4WN9B 5F9HA 1B4DA 2RGCA 5BW6B 1LBQA 2XTMA 1RABA 5DNAA 1RIIA 4MCJA 1JHVA 2ONKA 3OEWA 4CKBB 9GPBA 3IO3A 3NAQA 4IICA 3RT7A 1PO7A 2JAPA 4D6YA 1V3TA 4GO1A 1F2UB 3EZYA 3BZBA 2DQYA 1XHLA 2Q0QA 4XCVA 4XRRA 3K94A 3GA0A 2EDCA 5AK5A 4HAYA 4NCJA 1BFUA 5FORA 2O3QA 4A73A 3WLJA 1DFIA 1WBJB 2EFJA 3TLKA 4MW9A 5BN4B 1TVKA 4KDFA 2I5PO 4RD1A 2Q3JA 4Q93A 2G6BA 2BHRA 4CG3A 1AF7A 1QYVA 4KTVE 4BP1A 3FZQA 3F49S 3H2KA 1EFDN 2X40A 2XWSA 2R79A 3DKRA 2WWVD 1KP3A 4G5HA 1QCYA 4M46A 2HL6A 3ZDAA 1MP0A 2A9FA 1LFAA 4XOIA 2VH1A 4DCGA 4QYSA 3TMYA 2J4DA 4FGJA 5IHXA 1C41A 2JJ2A 3SF8B 4RXUA 1DU4A 4GBJA 1WDWB 2ZRLA 4O4LB 1T1RA 4MTCA 4HUTA 3K20A 1XX6A 1Z16A 1ZIOA 2Q99A 5EZ5A 3N2YA 3E9MA 4BFUA 2CL5A 3Q4GA 4RZIA 4CL3A 3FWHA 1G7SA 3A3NA 1ZBQA 3C2QA 3FPKA 3NEJA 3VZPA 5FPHA 2ZULA 1UMDA 5CCDA 3T4EA 3PRHA 2IV3A 3B5IA 3AUKA 4IMIB 3W5IA 3WLMA 2AEMA 2GJAA 1PJCA 1EB8A 4C7KA 4NS4A 4G0XA 1UK6A 3K1ZA 2SKEA 1IVYA 2HJSA 1O0CA 2IXEA 2XUIA 2HMUA 2Y0EA 3PE4A 4OXIA 4PLWA 2DEUA 1XPOA 3WLNA 3Q1LA 5D8DA 1RJ9B 4E5UA 4QOGA 3WRVA 1KRXA 3OMXA 2FWBA 4OJYA 3SM9A 3AESA 1TUGA 1CJTC 2C2XA 1JQEA 1ZM7A 2Z8YM 3QUCA 2V1XA 3B1JA 1BXGA 5TQVA 1H5QA 1U3VA 3RREA 3OZEA 4LDPA 3WB9A 4JA0A 3VNBA 1ATIA 4INJA 2R7AA 3BRQA 2YTZA 4M1MA 3SHQA 4DQLA 1YULA 5JV5A 3CZ4A 2X4DA 2FN4A 3MXTA 1FP2A 3IIIA 3OHSX 4MKIA 5DLDA 2ZBGA 1J8FA 5EZ6B 5F35A 1RC8A 4TV8A 2WWFA 4LDZA 2DQ4A 4NICA 1NUAA 3LXXA 5CM2Z 4M1OA 3M6AA 4C22A 1CUZA 4RK0A 2VH2A 3A27A 3IBSA 5HQJA 3NZEA 1QP4A 1A0OA 3UT0A 2CLFB 2VCHA 2O2IA 1WCXA 5DB4A 5B58C 1M8JA 1TMOA 4Y30A 3RYIB 5K03A 5EKSA 2EWMA 1ST2A 4UU8A 3BYZA 2C59A 1D2RA 1UC5B 2FRXA 2ZBPA 3AKYA 2CNWA 4KXFB 1NYTA 3OFND 3BGWA 4N6OA 5A9TA 2J9GA 3L8YA 3K1JA 1IN8A 1AUVA 1ZM3A 2FP4A 2XECA 3H0EA 3U4IA 4R81A 3HM9A 3ZS9A 1HM5A 1P2DA 2XB9A 4FDUA 1A8SA 4JBIA 1VTKA 3JYPA 3DWGA 5JOQA 3O4GA 4UBIA 3VJLA 3LUDA 1O96A 4KQKA 4B6QA 1C7JA 2WYWA 4XW2A 4CODB 4LI3X 2XI4A 3HBAA 3FVTA 3G0HA 3CZQA 1KJ8A 1XA3A 1S0UA 3ZGVA 3MJCA 2C4NA 1U9ZA 3A6ZA 3L18A 4ZRDA 4GQAA 2FFBA 2C94A 5FV7A 3JQGB 1U3DA 5BN1A 1B8NA 1C7FA 1AF4A 3M5CA 2QVGA 4QT4A 3KE8A 2LWIA 1ECJA 3RFTA 2P4UA 1PQUA 4C9BA 1VYHA 3A9VA 3NTUA 2WAMA 3MC1A 4FZRA 3PXUA 4MPTA 4TTQA 5IW8A 1ECFA 2OXIA 3RT1A 3GZJA 2OCAA 2ZRHA 2VA9A 3C15C 4LMAA 4L9WA 1J25A 2WDPA 2D4HA 4G0MA 5DTQA 4YAIA 4ZRMA 4JYAB 1KMHA 4Z51A 1YDFA 5C37A 1I7DA 3AR4A 3LOUA 2WSBA 4HVTA 1SVOA 5DSZA 3EPHA 3BGIA 3LC2O 5ALRA 2BFFB 3WK9A 1RIFA 2QYHA 4FHZA 1D03A 2FE4A 4TTAA 2NO1A 4KMSA 4NOKA 2CNDA 3ABIA 5BOSA 1MIHA 5BXQC 1CEQA 1MW9X 3TW0A 2QE7A 4JR0A 4NU8X 4K6OA 3A6GA 3DCJA 1MKYA 2NU9B 3QELB 5EJ5A 4CLEA 3FUWA 3GLHB 2WZQA 2DLCX 1E9FA 3RCBA 1L5QA 4NATA 3EUWA 4QVIA 2RARA 1YDEA 5K3SA 4LHXA 3CVWA 2PX6A 1HLDA 2QENA 4NHEA 5BQXA 3GY0A 4IJVA 4PHHA 1NKTA 3OX1A 1V8DA 3V1MA 4FFMA 3RVOA 2XA9A 4FDTA 3H9JA 1KMNA 1U0RA 4R31A 2QMUA 2H4YA 1GAEO 2J45A 3E9EA 2K2WA 1WL8A 1KYQA 1R4NA 2W70A 3N8DA 3MS4A 4YR7A 1DPGA 4AX8A 3OX4A 4ZJPA 4OAQA 3GEEA 2P2YA 4WAUA 4CFZA 4HP8A 8ATCA 4MQ4A 4AAYA 1Y33E 3I2KA 4M22A 1SXPA 2CXHA 2YJGA 3RRFA 1Z13A 2J9XB 3MILA 3ANSA 3CS3A 4PLCA 1M1NB 2W5UA 1BKDR 1ZWKA 4OFBA 1SEVA 1A7KA 1Q1BA 1Z8HA 2UYOA 2JGIA 2VJBA 3QUQA 1P2FA 3B52X 3G1UA 3OIUA 5K1ZA 3ZBPA 1YTUA 2XEDA 2BFFA 4GXTA 3SIXA 3TNJA 4HZIA 3E03A 2QDXA 1H5UA 3A1NA 3T3DA 1QF9A 4X7RA 4ARCA 5DDIP 1CV2A 1OLXA 1U0JA 1UEIA 1T4CB 4EF4A 1DRKA 2R86A 1TF7A 4WEOA 4Z2YA 1LBEA 1C4WA 3H9EO 4WHMA 3TNDA 4ZVOA 4L76A 3KT3A 4LZWA 1XQXA 1WCV1 1JWAB 3S55A 2GO7A 1AKTA 2FWIA 1V8FA 4W1SA 2YIVX 1U8YA 4FMBB 3VO1A 4Y2QA 2W2XA 1JEJA 4G5OA 1KOLA 4HLCA 2XMSA 4TXLA 4G9EA 1EUDA 2INGX 4V2UA 3Q2OA 4LK2A 4V02A 4DLKA 3UAOA 3BWMA 4PYLA 1I0LA 1DO0A 2ZIZA 2M98A 3FUXA 1OXUA 3O9MA 4K6CA 5IT4A 5FO1A 1C9YA 2NTEA 4R01A 3GUHA 1F7VA 1A95A 1KI1A 4O0MA 1RE1A 2QZ4A 3DR3A 3QV1A 1O3YA 4UUMA 1K6IA 4EITA 2EW8A 1GUDA 2YZMA 4KWTA 3QVJA 5LP6F 4KGZA 1P8JA 3DDZX 4Z2AA 3CV3A 2CDRA 4AL4A 4U2BA 1QE5A 4FR2A 5CDFE 3ORHA 3M0EA 1TQ8A 1C7ZA 3F9IA 3RS2A 4DG9A 3TMAA 2BJHA 3EMDA 5LA6F 2O0MA 3UJ3X 4EKNB 2EFEB 2GN6A 3LY7A 2C7BA 2DGDA 2CCKA 2IFTA 1Y98A 1H9AA 1JHAA 2R6CA 1I2CA 1NE7A 3HNPA 5KTRA 2WSSD 3C39A 4IDGA 1R0CA 3U4CA 4D74A 1DIBA 1D04A 4LHYA 1DWPA 3I64A 2VHCA 1OFTA 1TEZA 1XEFA 2Q6VA 2MOKA 4CQJA 4GOJA 1GV1A 1RRMA 4WA7A 3WTCA 1H8HD 3I72A 4S2UA 5CYPA 1FRVA 2E49A 1YB2A 1KSHA 1Z4MA 5U4QA 1V9LA 4OSOA 1XP8A 3KR1A 3L5KA 3AY7A 4R16A 5AJVB 1RI5A 2AJCA 2NUTA 5DPMA 4DDHA 5IT0A 4GNRA 4J0QA 2E5LB 1C1XA 4IR7A 1Y6FA 1IY8A 1XTJA 3LRTA 5JCXA 4IAOA 1M0WA 1GA6A 4MVJI 1N5RA 1ZC3A 1EVYA 2FPPB 3PNPA 4TRRA 4GS5A 4HNRA 1F2UA 1E59A 1P7ZA 3N59A 3V00A 1E2GA 1PNQA 2IYTA 4LJSA 1U0OC 4MWTA 5CU7A 1Z6AA 2PQ2A 4IZIA 3D8TA 4FINA 4YPOA 1BXRB 4R69A 1B8PA 1F0KA 1N2EA 1ARZA 2L18A 3H97A 4CDNA 3U62A 4P2GA 4H3VA 4EVQA 4IOJA 5HPYB 1EDZA 2HU5A 2YMPA 4UOEA 5BNFA 3S70A 3CUVA 2VHXA 3AVUA 2AEFA 1T10A 1TRHA 1V1MA 4DCMA 5TQ2A 2ILTA 3TRJA 3RI3A 1H9CA 1HE5A 4BTEA 3PX3A 4U02A 3MAJA 1T25A 1YA8A 1SHKA 2PS0A 3NTLA 4FZVA 2H2DA 3GDHA 2VATA 4CG0A 1QHNA 2F8SA 1Y1TA 4HDSB 2HKIA 3GRKA 4E09A 2X76A 1CRQA 4RS4A 1SG0A 4RH3A 3LL7A 3RTBA 4FSDA 4PR3A 5FUQA 4D8UA 4V24A 3TDKA 4GYKA 2H7YA 3T0IA 4WWHA 5DM4A 3WMEA 3I9MA 4HOYA 2P1RA 1QHIA 2V9PA 1VCOA 2FUKA 2FN3A 2IYZA 3LA6A 4JN6B 2AZ4A 1IAQA 4KLNA 5ALEA 3BULA 4HGYA 2LRHA 4WV3A 5K6RA 4ZTZB 1ODTC 1OIXA 1G6Q1 1ZH0A 2CNNA 1WBBA 4GVXA 3K5IA 4MYTA 5JZVA 2JHCA 5E0KB 3TLEA 3GMTA 1X92A 3EC7A 3LX5A 4F5ZA 3HA3A 2FCAA 3VPDA 1E98A 1IEQA 4OGFA 4OKNA 1ZK4A 5BW5A 3CMCO 3KR0A 2P9CA 4RPLA 2O2EA 3BH7A 4CQMD 1F4LA 4HB0A 3D3JA 3KCQA 4NYMQ 3URMA 3VSBA 5INTA 4GBED 1PWZA 5C8VA 1YE5A 5KYGA 3F8TA 4QGHA 2V96A 5ALMA 4BFXA 4ZHQF 3RADC 1MGPA 2ZBRA 1CY6A 1HDIA 1JYFA 2Q49A 3BRCA 3E5MA 3FBGA 2FZ5A 3JQ8B 3SBOA 3BBPA 2XHZA 2TS1A 5IARA 3L1UA 3PJFA 3G2KA 4OLHA 4ESEA 1N75A 2ID8A 2VP0A 2Z83A 5C7OO 4K9DA 2VCEA 5AHXA 1XYYA 2IL1A 4ZOAA 3TQTA 1Q16A 3RSLA 3ZQKA 4YONB 4MIKA 1T26A 2PWPA 2P6RA 4KW7A 4YRLA 4Y7CA 4CIBA 4PYRA 3NJ4A 3WQBA 3DAYA 1FU8A 3L07A 3ACCA 3PPVA 2N42A 4G1CA 4F6LA 1RYEA 4KACA 4UNSA 1UJBA 4E5SA 1WCWA 2R62A 2WMNB 1JKIA 4KKVA 2O14A 2BGUA 3GGOA 1OB5A 5IUKC 2J0EA 3LCJA 2CUKA 1N9GB 4ZVVA 3RFVA 3UENA 4YRZA 5JYEA 1Z2PX 1ICIA 1ODFA 2FPXA 2GZMA 2Q9AA 1Y8RB 1MXHA 1YZQA 3CY6A 4TKZA 3NHMA 1FX0A 4ARSA 1O0BA 3QY0A 2XBLA 4KAFA 3UOGA 3U4MA 1GL9B 1LW7A 4HQKA 2PEZA 3BJZA 1ZMXA 1L7EA 4RZHA 2P2LA 3WA7A 3CURA 4AF7A 5JAQA 3U49A 1E6WA 5JVDB 4ETNA 3RYCA 4ARVA 3UUGA 4AZ0B 1TGYA 2Y99A 2BR3A 3KOZA 4BP8A 1GXSB 4RQTA 4YJGB 2AXEA 5K0ZA 1SXJA 1G19A 1M2OA 1NVEA 1Z7GA 1CD5A 3FI9A 1JU9A 1YZYA 2A8YA 2BDTA 3WKEA 2YWXA 4I9NA 2YFHA 1DTEA 3GAMA 4E5PA 1ZK1A 1UPBA 2KQUA 3FYDA 3HEBA 4GLLA 1OB2A 3GV0A 5FWNA 2OPBA 2WIDA 1CJBA 4G0PA 2V8OA 2H4FA 2WV9A 3ASZA 3EGCA 2JF0A 3MUEA 3KJIA 5KYKA 4RD4A 1DLIA 1EBBA 4ZAWA 4EW1A 1YVEI 1Z9BA 4WNIA 2FMHA 2LTAA 1GEGA 2XUGA 2GA9A 1ZFNA 4PYNA 5DASA 2JGDB 5EIWA 4Q02A 5JADA 3ZHSA 2B21A 2R6FA 3FDJA 1MO5A 3AUUA 4GT1A 5ALPA 3RU7A 1GZHB 2QTAA 1Z0KA 4M87A 3ZK8A 2E1PA 4KPUA 2QN1A 1NFQA 1EVQA 3WNBA 4EW6A 3ZOKA 5EHNA 4ML3A 4NQZA 5G53C 5REQB 4AXBA 3K2IA 1CQWA 1GITA 2ZE8A 3IBCA 3GMSA 5K3DA 1ENPA 5HSGA 1KR5A 1JALA 2OO7A 3D4IA 2CKMA 3CKKA 4HLUC 3LW8A 4NK4A 5CHEA 4RL6A 4JWTA 1DELA 5ESDA 5ILGA 5DTJA 4KIUA 1HE3A 1FTWA 2QU8A 4MYSA 3EQ2A 1YGYA 3BFJA 3BMQB 3IBYA 1E96A 4FYKA 4N7MA 4FGWA 3FY4A 2HPZA 3IHLA 3M1YA 5ALNA 3ZXXA 3ZZNA 1Q7BA 3HYCA 5C1IA 3WMGA 1I7SB 3CGWA 2BH2A 2ZATA 3PL1A 4CKWB 4ZYLA 2ADFA 3KYCB 3SKVA 1O95A 1O94A 1IK4A 1GO2A 2BR5A 4TPKA 5DF1A 4ZVUA 5TLSA 2IKQA 2R68A 5B1YA 4B7AA 2X15A 4YH1A 4KHZA 4B7XA 3ZX4A 3K0KA 4YO7A 2AA3A 3DYIA 1V9CA 1EAYA 1OZHA 4FLMA 1W581 2BEJA 2PKYX 2GN1A 3B6EA 4AJHA 1AGPA 4Z4IA 1GHTA 2GB4A 3W05A 2IVZA 4LKOA 3ZG6A 3B48A 1TJYA 4FYHA 3ZWNA 4LDQA 1EWKA 1UK9A 3A1UA 2Z4TA 2G9QA 5I8WA 1PX0A 1TM3E 2WFZA 1RMQA 1B6TA 2HQRA 1VCNA 3QE0A 4XYBA 2CLKB 1E6EA 1ZMTA 4JUFA 5E6UA 5F5XA 5D3KA 1SVKA 3PUHA 5FJJA 1QB8A 1JT9A 1RBYA 4FJ2A 1VSBA 1TVEA 1V16A 1UPFA 3KOMA 2Q6OA 1W9MA 4WNAA 5A0FA 4FHCA 4PZLA 3NCTA 1FLVA 2OTCA 3BMOA 3C6ZA 1J2YA 1R00A 3EG9A 3TAUA 7ABPA 1LWNA 4YRGA 1Y8AA 1JEQB 4FYPA 4PS0A 5BN5A 3ZWBA 4K86A 5I8PA 2H59A 5ULLA 1WXEA 2YUIA 2VK8A 5B4VA 3O5AA 1WLYA 4O4HA 1Z5OA 4L5BA 2ZXEA 4LYJA 4NAVA 2CD7A 3PXDA 2IIVA 3KWLA 4LYYA 4CKXA 1KMIY 2VDWB 3KDAA 1A1VA 1G5TA 4N5HX 5LQNA 1MT3A 3LLUA 4AZ3B 1R8QA 3RJZA 3Q3IA 3NRCA 3SQWA 2L82A 2OP0A 4XYEA 3ZJVA 4DIFA 1ZJ5A 1TJ5A 4RPGA 1BS2A 1NONA 3OZVA 3U09A 1OTHA 5JSZB 2QJWA 3G49A 3AKCA 3S4YA 4UFNA 2CNWD 2FYTA 4M76B 1ZEJA 3M6FA 4PTYA 1GQYA 1QQ6A 1XB2A 3I4LA 5SY9A 2XNCA 2X0DA 1X7HA 5IDWA 1AZTA 2W48A 4DNOA 1PT5A 5FUBA 1E4EB 5LZ2A 3WMXA 3LHIA 2GJ4A 3AF5A 3DUFA 1OASA 1COWA 1Q91A 5JNSA 1OAOA 5SV2A 2WFAA 2BFPA 3LP8A 3GRRA 3GOHA 5LQUA 4JI2B 4LZPA 3AW9A 4NG4A 1RRGA 3TM4A 4EG0A 1U11A 4I50F 5FOSA 4B3CA 1VIAA 5FBHA 4DLNA 1EQAA 1LWOA 1V8OA 2Q07A 1MQ9A 2VPXA 1RD4A 1UFVA 4LXGA 4WFQA 3ZGZA 5JSKA 3PFWO 1KQNA 4M36A 3BL5A 5ADHA 2AJTA 1MH1A 4P3OA 1M66A 1ADFA 3CLHA 4ILEA 1GGVA 2A5LA 4S04A 3RVKA 4IWNA 2A57A 3PPIA 4JOSA 1JJFA 1K75A 1U28C 2D7JA 4J7UA 2ADMA 1I6LA 2A4MA 2XMDA 1D2HA 1OBHA 5DIFA 3HB4X 1S6YA 2H9IA 2QLNA 2ZTHA 1JFTA 5AJTA 2X6TA 4XGIA 1A97A 1FVOA 3ZE6A 1SXGA 1NNUA 5KX5F 1G18A 3P9QA 2PKQP 4E7OA 2C88A 4BZQA 1M2GA 2YVKA 3E9RA 3WRXA 3ZGLA 1M2JA 3OTOB 3R9IA 3HI6A 1Y80A 2HCTA 4MB0A 2JIRA 2LIPA 1T15A 4HEJA 1L1FA 1XDWA 4B8WA 1NU8A 3FGNA 3MMNA 3O8DA 2A5JA 3DMGA 1FVHA 4XI9A 1COZA 1M7BA 1BMFA 2CL0X 2R84A 2RGEA 2ZAIA 3VXKA 3RYCB 1BA2A 1ID8A 2ZUWA 4WESB 3CISA 2B4QA 3DZIA 3DOJA 3W1WA 3FF4A 1P1FA 2VF7A 3T94A 1Y7LA 1L1QA 4GSYA 3H5OA 3SI7A 2J6BA 4AURA 1PP4A 1EVJA 4AX4A 2ZW9A 3L2OB 1C2YA 2I34A 2XGGA 2EOAA 2QRJA 3K8OE 1DCFA 3KJHA 4K9PA 5EYPA 3O8CA 5DYNA 3O90A 4XSVA 4ASUA 1C9MA 4ACBA 3TTYA 3OIGA 4BJ1A 5BR1A 5KCMA 1OTYA 5EZYF 3TCKA 4KN6A 4E32A 1ZICA 4AJNA 1X8JA 1O9HA 1RRVA 4YRRA 1NAIA 3P4UA 4ZYVA 4YIHA 3R3HA 1UKZA 5BSRA 5T3UA 1LB1B 5EJGA 1RYFA 1UFQA 2ODAA 5EINA 3U40A 2GERA 2GYWA 4IV8A 3H4MA 5MF6A 2GDZA 3CFYA 3EIOA 2BWJA 5K8TA 1CE8A 1TQHA 4N7RA 4I55A 3D5EA 4S0ZA 4NLLA 3I2IA 2VDKB 1L4BA 1KMHB 1I4WA 3IVCA 2AI3A 1A7JA 5DCYA 2AZMA 3WJ2A 1E18A 1QQ7A 1XN4A 5LMUB 2GZ2A 2WMOB 3G8CA 4H77A 4CF4A 5CFOA 2ADOA 4ND8A 2P6MA 5BPHA 1R8YA 1W52X 1ZBDA 5D86A 3VNRA 3HO1A 1KJQA 2A2ZA 2ZJ6A 3DTNA 4JLOA 3INYA 2ZYGA 2XNKA 2OC9A 3MHPA 4ZQIA 4LQCA 1PFUA 2ZS7A 3FSGD 3AWDA 3VC1A 2MHCA 1WHTA 1YHZA 2BEUB 2Y27A 3C5WP 3EBOA 1I1NA 4YHBA 1LSJA 1QONA 3AFIA 3DYBA 1E3LA 1YAJA 1D09A 5H9WA 2HWWA 3GJTA 4WESA 4BGVA 3UWKA 2IGTA 2PH5A 3ECAA 2HIHA 1V41E 2H7CA 2P68A 2MU1A 1NWCA 4IHAA 4PEVA 4G4IA 1QKIA 1HDYA 1L1RA 1DG9A 4Y2RA 3GJQA 3KOXA 3MSCA 4BL5A 4KGXA 2ZP1A 4QJ5A 3JQEA 2PZFA 4OHZA 2V3VA 2JJMA 2OSVA 1NVVQ 2IUEA 2YXEA 4G1FA 3LC7O 3QBJA 3NHUA 2J07A 1JVBA 3BCSA 3WIOA 5LQJA 1FFBA 2BUCA 3KOOA 3LKDA 5C46F 4DBZA 5U9CA 3ROGA 1I5RA 2WIKA 4B6OA 1SOVA 2DPHA 2GJKA 5DYGA 2HGSA 3VO8A 3KZMA 4HLNA 1VKZA 2WIJA 1E2QA 3U3JA 1JDUA 4PAOA 4A8PA 2PJDA 4B35A 1MO6A 5KKAA 1K7FB 3EASA 3MJTA 5HEKA 3TQQA 3UG6A 2X5OA 4DJTA 4DLWA 4MQEA 1G21E 1Y34E 3PDUA 4BZZA 3OU6A 4MCHA 2BRUC 1SUWA 2G88A 4X7PA 3R20A 5AXBA 4C01A 3CLSD 4E1VA 4HNQA 2Q0HA 2XHEA 4NRDA 2ORWA 2YWDA 1FA9A 1KI4A 2H4ZA 3JW8A 2LNDA 1U1CA 1V11B 3M6VA 3DXZA 4C08A 4QG3A 4NU5A 3ROMA 2A5YB 3ZDCA 5A3JA 4YROA 4D45A 1XTPA 2WOOA 2ZI7A 4D43A 5JNTA 5KTPA 7MHTA 1TK3A 4LWZA 3WDLA 3R74A 4G01B 3BSWA 4HAWA 1HYEA 1SOWA 4PQFA 1MB9A 1SOMA 1M1YB 3WZ2A 4HH3C 2XMBA 4IQ4A 1K06A 3FETA 1T6XA 3QG5A 5CB8A 3M1LA 3UXMA 5LR6A 2VOEA 3H9BA 3QYPA 1CG6A 4AB1A 4EYGA 3PPYA 1P2VA 2PMBA 3T5AA 2D13A 2GHTA 1RT9A 4KWIA 3MWFA 1MX5A 5AK4A 5HTKA 1LZLA 3ASUA 4HJXA 3RS4A 2VBFA 5EMKA 3DQZA 4JBWA 1UAYA 4EEXA 4QECA 4U1RA 1B73A 1U7DA 2HQBA 1M2HA 1ST3A 2FCRA 1T1SA 3R5HA 1TK2A 5IAJA 2MIIA 3VR5A 4RIEA 1TQDA 4RXMA 3DEFA 2DTEA 4UHCA 3H7AA 3TGLA 1V6AA 3QLVA 9LDTA 4DUGA 2VDPB 2EW2A 1GPUA 1SCNE 3DLCA 3ZWMA 4HS4A 3R8CA 1VL2A 2NVBA 5IC6A 4D46A 4EGJA 2I3BA 4MQFB 4GWGA 3OPYB 4PCVA 2HQ1A 4YCDA 5ALDA 4Q1BA 3W5SA 2NTVA 4BX0A 2CVZA 1LTQA 3ZDRA 1G16A 3N5KA 1MABB 2NZUG 3EXHB 4AIIA 2WK1A 1RQ7A 4F6RA 4RVSA 3AL2A 3DWIA 4FGUA 3WNQA 4B46A 4MAMA 4D3SA 4BX2A 2J5RA 1QO0A 2YY7A 4WZBB 4UQLA 3HWX1 3CKLA 2A33A 3NU1A 1LNQA 2DG2A 2HMYB 3PWSA 3ERCA 3HE3A 4B85A 4FFOA 1NXVA 4QPNA 3DXXA 5CHYA 4URXR 4N54A 3OOEA 3STVA 3TZEA 4C4AA 4JENA 3D6HA 3MJDA 4CU5A 2JG3A 4ALJA 1NF9A 1KU6A 1UQTA 3E0XA 3GXOA 4ZYXA 2Y9MB 1VI6A 2OILA 3HP4A 2C4KA 1G8PA 1D4FA 3F6SA 3E61A 3ZWQA 5EIOA 2F90A 1UKVY 3I23A 4YRQA 2ZSEA 3ZHYA 1EUCB 4L02A 4I99A 4OQQA 1FRZA 1VJTA 2PFSA 3PXXA 2Q3FA 2RHHA 5H16A 1CBUA 2Y8EA 3RT9A 3IJEB 1E2HA 2WQ7A 1SGWA 1G98A 3L8HA 1ADGA 3H18A 4R1LA 3DEAA 3E48A 1KHHA 5B1SA 1ZIPA 4ZKEA 1SCAA 5C32A 1SKMA 2O7RA 3HKDB 1QP7A 1S2IA 2Z2KA 1Q1QA 3MPOA 4PNHA 1ZO8A 4EG3A 4QUIA 2RH4A 1XNQB 1DEHA 4I1VA 3W9SA 2AMJA 5K4HA 2O20A 1Q1AA 5ALSA 1OH8A 5JEDA 2RHGB 3X1DA 4RK4A 5K3CA 2VYND 3ROXA 3EA4A 3Q8WA 4OGWA 3O73A 1F48A 1UZUA 2VHZA 4KI0A 2FPKA 2IEGA 2ZWIA 3PICA 1PD0A 4NARA 5JYDA 3ZJ5A 4YJ2F 2VRNA 3Q87B 2VHJA 3UK1A 3DO8A 3DV2A 2XDQB 1XRRA 1D7AA 1I9GA 2P9YA 4HZUB 1U8CB 3RTCA 5TSDA 2P90A 5IXYA 1IUPA 4KIGA 1N9KA 1IOWA 2BYTA 1YKSA 2VT7A 2ZANA 4INOA 2BCGY 3U3ZA 3AI3A 3AIIA 3C5CA 1Z08A 2E87A 2FSPA 2ISQA 4IHJF 4NVRA 5GV7A 3BQNB 1WZNA 1XAHA 2Q6TA 4R9NA 4BMDA 1EWVA 1S2NA 2N1MA 3M7IA 2COEA 5FDFA 5JNVA 4Y6GB 4KN8A 2D2FA 1KK3A 3HJAA 1KKMA 1UDRA 1X3SA 2ODBA 1QRAA 1C8LA 1JHRA 1O6GA 3PQ3A 4EFLA 4BNMA 4JEMA 1JJ7A 1LCIA 1VKNA 4INAA 1S2GA 2D0IA 3NUQA 4S1OA 2Z3VA 4WVFA 4YJHB 1XU7A 5AKIA 3M34A 2YJTD 3RUDA 1XVVA 1N92A 2OHHA 4ZAGA 4H7EA 3GWGA 3SYKA 5DK6A 1P72A 1RJDA 3AC0A 4FX2A 3T38A 2OV2A 2VDNB 1A69A 3JVUA 1D4OA 2ZAOA 4N8DA 4YLGA 5F1OA 5HUHA 3QEBZ 1E3MA 1H0HA 3LI2A 4HGRA 5EWJA 2BFAA 2A5FA 2PRSA 2QPAA 1RBMA 3KQMA 3Q88A 3IPAA 5C4MA 5IZ4A 1Z8NA 4O4IF 3JZDA 4DB4A 4J0FA 1Y63A 5IAOA 1G55A 1OX6A 2NVOA 3AIMA 2DU8A 4M8IA 2OBMA 2IU3A 4L5IA 1X1BA 4XM1A 5E8JA 1GZDA 1ETUA 1NLUA 2FQ1A 3AUXA 3KRTA 2R7NA 3QXXA 5LXTB 4D8VA 2ZAYA 4KSBA 4TMZA 1E4OA 2OFOA 1K9VF 3MINB 4FGLA 2HTFA 4Y6QA 3WS7A 5LCXA 3VHXA 4MGKR 5CITA 1PW7A 3LH5A 3NIDB 3TD9A 1ORTA 4GGPA 4KNYA 5KO2A 5ER6A 2HAEA 4AS2A 1K8RA 4LZLA 5J23A 2BT4A 2DULA 3DE1X 1MQSA 3E18A 3K0HA 5ANRB 5TB5A 1PTJA 1CF4A 4BXOA 1W9HA 3DV9A 3ZK9A 3FE2A 1FSPA 2OGSA 2AG1A 4X7BA 3UG7A 4ND3A 1T8PA 1KQGA 2CUNA 1JI0A 3RRNA 1SUAA 2PH3A 4J1QA 2NZXA 2O8CA 1WHSA 5J2UA 3V46A 3F6RA 1N5KA 1RLTA 1YONA 2IJGX 2JZOA 3EMBA 4GKBA 5DEOA 4BB0A 1D9ZA 3HEMA 4NNPA 4PHCA 3W3AH 1N2HA 2IS6A 1QG4A 4JI0B 3KIPA 5CDGA 1EGHA 1XHFA 4IQ0A 2PYDA 1CUCA 2NUBA 2PFGA 2IA5A 3BFPA 2I4IA 2PUTA 4RPIA 1SZDA 4V39A 2JCXA 1IMOA 3L0OA 5EAIA 1TOAA 3PHHA 1UWKA 3G5UA 2JLZA 2H5IA 1E77A 2R1TA 4IF6A 1KIFA 3OLCX 4RPCA 3VGJA 2ZJ2A 1DARA 1TKAA 3FYSA 3QMPA 4Q9IA 4B6PA 2WJWA 4BN4A 4YRMA 3ODPA 4EB6A 1IUNA 3SJUA 3H05A 2HW8A 3STUA 4NS1A 1G2QA 3PHCA 4TL9A 2SCUA 1B23P 1XZQA 2V4ZA 3MT9A 4J4TA 4KIWA 4MW7A 5JNUA 3H5RA 1CUJA 1L4YA 1T5LA 2GK6A 3C98A 1I4OA 3T99A 4F3RA 3PHIA 5JLJA 1YFLA 1HC7A 2OXEA 4EO9A 2KBFA 1AGNA 2PFKA 4WA8A 4XEUA 5F51A 1BDHA 3RGWS 3DC7A 1YTLA 5FWDA 2PR7A 1PDOA 2KWIA 1M33A 4PGHA 1ILEA 3TLZA 3U7QB 3H5WA 1USIA 3G0CA 1UPAA 4LJYA 2ZE5A 1M7GA 3LYLA 3OM0A 5DBHX 5KNCA 1SK9A 1FMLA 2GVNA 1NVBA 4MRRA 3O0TA 4RY8A 1QIMA 3E9CA 3KL2A 3S2EA 1V5GA 3TJMA 3THYB 1JS1X 1KDRA 3AF6A 5M7EA 2G06A 1XEWY 2XNDD 2C2BA 1LI5A 1TEXA 3S27A 3U2QA 1J99A 2HM7A 4BBAA 4HGNA 1WY5A 3NUZA 5DM2A 1WXGA 1E9CA 4QWWA 4R8KA 1S3SA 4P2BA 4R2LA 4YJ3B 1MA0A 1CFZA 1B1CA 4N82A 4RTMA 1Q84A 5EMJA 2XADA 2ZUSA 3BWDD 3H8WA 2DVMA 1CUWA 2WTNA 1C29B 1FUYB 1PR6A 1RI4A 4IDBA 7AT1A 1JDBB 4WPGA 1G3UA 4MLPA 2BC9A 3PCRB 3WYFA 4MZXA 1O8BA 3C3DA 2W6QA 4UEJA 4CF6A 5I3ZA 5F2KA 2J7KA 3FOAA 3L7DA 5EIBC 5LLSA 3KYDA 3TSOA 4ZJZA 1XZCA 1HYGA 3PRJA 3K70B 5ENDA 3LQ4A 4MQ5A 3ENQA 5F98A 4A0RA 3KO8A 3ZDYB 1PGPA 3QVMA 4RYLA 1R4ZA 2ZUTA 4JXZA 3U0BA 3QVOA 3NYQA 2C5EA 2Y1KA 3PUWA 4R41A 4X92A 1FJGB 2IZ7A 1UPTA 2B5WA 1Q0PA 1UBKS 2XUFA 4RHYA 4M0KA 4WLFA 4UPEA 3JR7A 1CW2B 1YOVB 2X9LA 1C0PA 1U7HA 3NO4A 5IAKA 2XCOA 3UKDA 4ZIRA 2I4OA 3OQ1A 1VSUA 3DE6X 3RYFB 1E3DA 3ZHCA 3IQWA 4DCSA 4EDHA 2VDUE 1YRAA 3DOHA 2FQWA 3R4VA 4AI6A 2RIRA 4MQFA 5AKHA 2LZ0A 1TMKA 3CIFA 3RF7A 3OQIB 4IQ8A 3HO8A 3AR5A 1GZ3A 1THTA 2QY9A 4WECA 4BLUA 2FA9A 1OLSA 4RQUA 5KQGA 1E7WA 2HI0A 3CF4A 1GLVA 2B5OA 1QTNA 3QPDA 4J9UE 4XDZA 1O9BA 1X1AA 4XJVA 5GGYA 4JXJA 2L17A 1I10A 1JR3D 5CM8B 1JV2B 3A2LA 4U9IS 3L0ZA 1NPTO 1ZX1A 1OGYA 4O59O 3N0XA 1LTHR 5KYXB 4YY3B 2IY9A 1IBRA 2X4GA 1C0KA 1YZHA 1N3LA 2ZFUA 3ABSB 5JXGA 1QV6A 1ZVKA 3MD9A 4CKEA 4DWVA 1G8SA 4ZVSA 2ETVA 4DG5A 3HK2A 3NCHA 1YQ9A 2BFBA 1T8RA 5ELLA 3BJIC 2FPUA 1RKBA 4EX6A 2VP4A 3PHLA 5BVHA 3PC7A 2QTRA 1ZUHA 2D7CA 5J2TB 2R1UA 3F8SA 1QTIA 1XTVA 2JJQA 4TTVA 3TQIA 1BRTA 2G5CA 3TIXB 2FPGA 2OUIA 1RADA 4LISA 4WKBA 1YRQA 4REQA 4MKHA 3X1MA 3EQ6A 2J59A 1UL1X 1QYIA 1O0SA 1UOEA 2XOKA 2B4YA 3ROEA 2O3TA 3NVMB 2QYOA 2ZYHA 3IVMA 1NMYA 4GZ5A 4EPWA 4NMXB 3FMIA 2P65A 3GAFA 3A2NA 2IPLA 4RZUA 1P2BA 1YQUA 4QDXA 5AIAA 1DAEA 5HBGA 1Y5NA 2X22A 4YMGA 2Y77A 3O7WA 3EXFB 1EK0A 1Q7GA 3LAWA 1RYYA 2XE7A 3LWBA 1V7CA 4RSHA 4ZCSA 4TWAA 1K4KA 1E6LA 3AFMA 4U39A 3EFOA 5GV8A 3WQHA 5C2JB 5IU6A 3P96A 4ZDWA 1FDIA 4IQGA 3GCDA 2EJBA 1GTRA 1W96A 4IIBA 1ISPA 1ZN2A 4S12A 4MUGA 3W0LB 1S2LA 5EI5A 3I9KA 1ADBA 1GTMA 1NOIA 4RIHA 4RD3A 4UVHA 2HH9A 3GC6A 4CF3A 2R5NA 2C4UA 3HKCB 3HMKA 3MGBA 1KEPA 3O93A 4IIEA 2ZPAA 1FL9A 2ZRDA 5DLPA 4C20A 2HLPA 2VNAA 5IP5A 2DMRA 1VE9A 1WPGA 2GVDC 4OFWA 5PGMA 2PUFA 2W98A 4NE9A 1U6JA 5KNLA 4C0JA 3N0RA 3E82A 5G40A 1CZUA 3Q85A 4MS1B 4N12A 2AS0A 3EXHC 1SUEA 2ZUBA 2A84A 3EEYA 3LO8A 1BKSB 2QTHA 4OBWA 4QUJA 1XMOB 2RC5A 3G8BA 1YKFA 4PYMA 1D6MA 2VPYA 3QU4A 4K9QA 1ZJWA 3ILHA 4V38A 5THQA 2RK3A 2A9KA 1GQRA 3LFTA 3LNTA 2G8LA 3WGKA 4L3OA 1SUSA 1XQWA 1EHYA 2OXRA 2OV1A 1VMEA 1VGQA 3TXYA 1J33A 1P60A 2Q1XA 4Y7DA 4LDRA 4DMLA 2Y0CA 2VJAA 1OXTA 1H2ZA 1P9WA 4NR0A 2H0AA 1ZNXA 1RDFA 4L75A 5AJZA 1RQXA 1RXIA 1VJ5A 2Y68A 2AQIA 1UBFA 3LKZA 3MELA 1T5DX 4CUZA 1C8VB 2GTPA 1E2DA 1UK7A 4KVZA 1KDYA 4E6PA 3Q98A 3X1WA 4DAOA 4YT4A 2JGEA 1KPGA 1QP8A 2HWYA 2ZCUA 4N0MA 1ZW6A 2JCYA 3B6KA 3CZAA 5LXTF 4ENTA 5LLDA 3IPRA 3K72B 4HTAA 2Y93A 3MBOA 4U2DA 3VYTB 1T0BA 3AGQA 1Z62A 4BV3A 3HRKA 4GKKB 5F23A 4OTZA 4TYYA 3RDPA 3PR1A 4UCXA 4LZNA 1TZCA 2H1CA 4P32A 4WQMA 2GX6A 4GDMA 3QWIA 1DHRA 3RRBA 3U7HB 2V7QA 4DAEA 1XDUA 3E7FA 3OLWA 1N5IA 5CIQA 3VKGA 2C1ZA 3FKQA 2R8YA 1K5GA 2OYCA 1UWLA 1Z37A 5EL0A 5K09A 1IPEA 2G5GX 4IFTA 1X1SA 4MWGA 1Z17A 2XW6A 4AKIA 3GCXA 1PEKE 3OE1A 4NDNE 2CDCA 1SZCA 4EQ6A 821PA 3KBOA 3VR6D 3O47A 4RMNA 1ESDA 1OKKA 4TZTA 1YZNA 3PD7A 4M1SA 4UZFA 2Q4RA 3MWDA 1UBNA 4R1TA 1AA9A 1R2QA 2CJWA 3BRWD 2A9QA 5KVAA 2ZT7A 2I8LA 2I6XA 1PTJC 5K4AA 1SUBA 4IHJB 1IU9A 1ZP6A 2G82A 4V0SA 2YHUA 3JXEA 4DJEC 5L7TA 1ACJA 3F6BX 4B9EA 3CE9A 1G21A 4OHOA 4MS3B 2OECA 4B6EA 1RXWA 1HV8A 4XYLA 1R5JA 5K0TA 2BEVB 1CQIA 2WJVA 5IC5A 3MW8A 1R1DA 2HXSA 3PQ8A 4FDLA 3MD0A 3S6JA 3RNOA 4UM9B 2FPMA 4IF4A 4L8LA 1R0WA 1XK7A 4V1CA 3IVRA 1UDCA 4D8YA 5CAEA 1RFGE 3IPCA 3NIBA 4YJ2B 5DW0A 1JGTA 1XNJA 4DFDA 4JC8A 2ZXFA 4GI1A 4HTFA 2F67A 2WWGA 1WWKA 2Q21A 4L08A 2F43B 1S3FA 3NHZA 4H0FA 5G0WA 3FPEA 3UK0A 5ITZB 3GAAA 3SOPA 1BA3A 2H85A 3C43A 3WYDA 4ZHSA 1GD1O 2O06A 1MF7A 3G5MA 2AQ8A 1E5DA 3OVMA 1E3WA 2G7ZA 5E6RA 3HKEB 1O03A 4QIHA 2G9RA 5DLEA 4P34A 3CVJA 4KXLA 4ZPJA 4LWPA 2I55A 2WTEA 2X3FA 4I1YA 4FILA 3ICOA 4OOFA 1RJGA 2Z8YA 4CI9A 3HCBA 3E3AA 3MJ4A 3NALA 5AM4A 2OZLA 4GL2A 1L7AA 1F5NA 3GNSA 3KU4A 1G41A 3L7JA 3SYLA 1JEYB 2ZE7A 4R8LA 1GVHA 1T5IA 2AF3C 1FXWA 4Q24A 3FNBA 4P80A 5EWLB 4F4DA 1W48A 4K87A 4J8PA 1D3AA 5DK4A 3FUCA 1UJCA 5DNWA 4IOKA 2O59A 3Q41A 2C1EA 3HSYA 2KX7A 1TZKA 4HMOA 3VZBA 2FP3A 3ER8A 4Z7OB 3R41A 4PQGA 2MYTA 1JG7A 4MJXA 3ZXSA 4OI0A 1JKJA 1TAQA 4RGBA 2HYDA 2FGJA 2C9DA 1YVUA 2ZYTX 3OOSA 1T2NA 1OXBB 3TBKA 1OSNA 1UKCA 1R27A 1U0EA 1V2HE 1I80A 2E85A 2E3JA 1Y8ZA 3K9WA 1AS3A 2XUOA 5P21A 2VTVA 6CHYA 4P4SA 1XDSA 4WASA 1W4ZA 5D2CA 2R8ZA 3R9WA 2WJAA 1U0GA 4NJMA 1HFEL 1T8WA 4QJIA 2G36A 4TL8A 4Z9FA 4TKVA 3OQNA 4KWEA 1TTHA 3S1AA 4BMSA 5CVUA 2AKEA 3K0EA 2AMLA 4JJFA 4MARA 3QJYA 3PCXA 4HZGA 1L6IA 1E4VA 3B2QA 2VI5A 2IW3A 4M55A 3VR6A 4P58A 3OCVA 1Z0JA 2MMGA 4FU0A 4PZ9A 4CL8A 4D82A 5HRUA 2GFQA 2CNBA 3H2HA 1PJZA 1RZVA 1PQPA 4KB5A 1SC1A 1NMSA 2D2VA 3D6MA 4XJSA 1TUBA 3QFCA 3DTYA 1I01A 1P1JA 3OZBA 1ZH8A 1YBHA 4I55F 4O3FA 3SEAA 3T7EA 1FMTA 3PLRA 3ZIDA 4MS4A 1DQYA 1KVQA 4RLFA 2EIHA 5BMVB 5C0OE 1OI4A 5BYAA 5DHSA 3HKBB 2QVLA 2R8PA 2ZYRA 4TV8F 3SYMA 4PO8A 3TVDA 2IPNA 1XD2A 4MUMA 1AKVA 3PB3A 2HEIA 4N9QA 5JRJA 4V1CB 1QK4A 3QYFA 1E9DA 1JIUA 2VLBA 2C58A 3C3KA 3JYHA 3KYJB 3KEQA 2FN8A 4IJWA 4QUEA 3WDSA 4E4TA 5CFLA 2AN5A 5TARA 5JCJD 4A6DA 2GUWA 1IEWA 1VI5A 4N5IX 3RRJA 1KU0A 5BSHA 3OZSA 5KTKA 2VPPA 5L3QB 2NZ8A 3IR7A 1MTZA 4HD8A 3WISA 1OF1A 1AKUA 1M2OB 4UJ5A 4JLWA 2TSYB 4YJGA 3TSZA 4LGCA 3KAKA 4DV0B 2Q28A 4KWHA 1FS5A 1SK8A 2I8CA 3OUTA 3C4JA 1BVRA 4JYZA 2HJWA 4RU1A 5AI6A 1Y6RA 4ZOLB 5C34B 3W1EA 2BHNA 3NT5A 3B6JA 2EZTA 2ODWA 3DFKA 3OP1A 4JSYA 1EQ2A 4MS1A 3V34A 1Q2XA 2XRYA 1YDHA 3CPHA 2P6PA 2BSAA 4D0NA 3K15A 4EJ6A 2ZIXB 5FTKA 4EJSA 1KARA 2EXXA 3KS9A 5KOHA 4MAAA 1JFLA 4YP1A 1WIWA 2VJNA 4IQFA 4KFCA 3FNIA 1E5QA 1JDBC 2VXOA 1T9ZA 4BMCA 1JPJA 1F5SA 2EHJA 3FNFA 3AVXA 2WYOA 2WWYA 4AYTA 3B70A 5DOZA 2YJ3A 4DHEA 1GKUB 2G09A 5LOVB 4RTKA 1CZKA 2XJ9A 4F2DA 3IBGA 4R9RA 3VTFA 2COUA 5CXUA 2WR8A 3Q7TA 3AT1A 1X9IA 2VTBA 4HAZA 4BXOB 3FPLA 2CL7X 4XZ3A 3RHZA 4CG1A 4P84A 4D9MA 5AVWA 1XG5A 4TLBA 1CQZA 5IASA 1FOEB 2RGNA 2NTNA 4MJ7A 1SC3A 5LQMA 3MTJA 4I2VA 3K6SB 1CUIA 4KP7A 3OG9A 3RVBA 4DRXB 4F85A 2B9EA 3LT2A 1A8QA 4ZT3A 1C50A 2QIPA 4QYMA 2AC2A 4QOIA 3LS2A 5AI9A 4E3WA 2HRQA 1T9GS 1N0IA 3PQ6A 1WNFA 4JCCA 1QH8B 5I7OA 4RD6A 3MGGA 4PW0A 2Q5HA 5LP6A 2FG5A 4C6RA 5DHUA 3EWIA 4PVCA 4AJEA 4NXNB 1WULS 4CV1A 1OLUB 4G1BA 1NFFA 4QUHA 1M6WA 3EXIA 4L5CA 1OILA 1PRYA 3V48A 1LK5A 5B2EA 2Z08A 5HCIA 2FVYA 4FFNA 3JATA 4MI6A 3RJ5A 1C3VA 1F2DA 1XTRA 1V45E 4M60A 3AR3A 4MUNA 1KJZA 4AWAA 2IH5A 2B9VA 3QKSB 4NBLA 1VPTA 1IDOA 2I2XB 1EIWA 2PXAA 1XC7A 2FKNA 3D59A 1AURA 3KLNA 1TT7A 1U0SY 1W1UA 2WM9B 3HY3A 4D0GA 2VOJA 5KOHB 3HTXA 3MUNA 1RTTA 4JNKA 3ZWYA 2I65A 1FYDA 4DBVO 1U9IC 3RVMA 3ZY2A 3U7GA 2FWJA 2EKZA 1K0UA 1DBVO 2ET6A 5JAIA 1GRCA 4EUNA 5TPZA 3BK2A 3RE1A 2YQ5A 4FEYA 4ZN6A 1E5VA 2B8WA 3N8IA 5K05A 5FX2A 2UVQA 4H15A 4UHDA 2PA3A 2W2MA 1XVLA 5AUOB 1DZ3A 1BAPA 1JB9A 1ML4A 1P3Y1 1H2RS 2N75A 4P33A 4QQKA 2NQ2C 1LVUA 1TO2E 4MQLA 4X3CA 2ATXA 3PFCA 5J40A 1G6HA 1OFUX 4M8LA 3AF0A 2VSYA 3GFBA 3MA0A 2X42A 2Y4OA 5HZHA 5THKA 3UWSA 3MIZA 2GRAA 3C5VA 4ZYTA 3I28A 3U6BA 4AJLA 1EIZA 3D4OA 4RPKA 1NVWQ 5HMMA 4X24A 1EH5A 1KFEB 3DEJA 4GHWA 3LMKA 5T67A 1E6UA 1R50A 1IBCA 1NR5A 4RK1A 1AV7A 3RSQA 5A4JA 3UQZA 5CXQA 3DVLA 1SVIA 3L7AA 1R0RE 4RBNA 2BI4A 4F4UA 1ZKMA 5CBPA 2GEJA 2H18A 2C2YA 3C6QA 3M6LA 3IUEA 4JI7B 3V7NA 4CEJB 3I37X 2QXYA 4HQLA 3OEEA 4XPZA 4F3KA 1NBMA 3CF4G 3SNHA 1PNRA 1JTFA 3FIJA 1NW8A 1XLWA 4JV5B 1W5FA 3R3WA 1M6HA 1FBTA 4QHSA 3RIHA 4ZVNA 1C14A 1U6IA 1VE7A 3BIOA 4B9AA 1UINA 5HF6A 5LL6P 3GVCA 2JFNA 1SKQA 1S8AA 1SXJE 1TKRA 2D59A 2BFCB 3AM1A 3WI7A 1M8PA 5DCUA 3H3XA 1ZU5A 2Q1YA 1KKUA 3LT1A 1H2BA 1OPXA 3ON5A 4HH0A 1N2OA 2WF7A 4GX2A 1IPFA 5D6OA 3TJZA 5IVPA 3ELYA 1M0EA 4RAQA 2JD2A 4IGAA 5DLQC 5FNVF 4AMGA 2B82A 3ZVRA 3QV2A 5K45A 3GIWA 8ABPA 4XD7A 1WMFA 4HYTA 1QIHA 1FJHA 3JRXA 3JQ7B 2P78A 4TYMA 3ZWAA 5DM60 2P2ZA 2O8DB 2NZWA 1HZJA 1GTVA 2Z5FA 3LPCA 5IUNC 5TQ0A 1RLJA 1IM8A 3T1TA 2IS4A 4PFJA 1GN9A 1G5IA 2R00C 2DKFA 2Z95A 1EDBA 5FHQA 5CLQA 2QMOA 1U1DA 3EOBI 1CPYA 1UMKA 3NTOA 2F48A 5IKMA 3QX3A 3K1TA 1E92A 1F4PA 1UADA 1ZA2A 2FRVA 4GVLA 1C5KA 1PNOA 3EAGA 4JUBA 4HDQB 2OBFA 4H27A 1DG3A 2YHIA 1HX7A 2FEKA 1H0RA 3C4VA 1L7XA 4K5QA 4YCSA 2AYYA 3OD1A 2ZBFA 1YL7A 3H16A 2Y1WA 4EFMA 1DC5A 4YMVA 2GH1A 1CF9A 4K2HA 5JZMA 3UGQA 1KR2A 1XL1A 2I76A 1PUJA 3R7SA 1VJRA 4KOEC 2K4MA 3FMFA 2NUPB 1HE1C 4E1AA 1BWQA 2W6OA 4BATA 1IOZA 1EG2A 4H3SA 3DMNA 4LPKA 1VJ0A 3SHWA 1S8NA 4ND5A 3M49A 2WHEA 3WJ7A 3I52A 4FMDF 4JAVC 1CEXA 4KXUA 4L2IA 4NL4H 3STYA 1M2VA 5JD6A 3MCAA 2XTZA 3B1FA 3A58B 5JWOA 1NVKA 1LI7A 2WA2A 3JYQA 2GPNA 3AKZA 4DLUA 5F2EA 1W73A 1VZ3A 1YI0A 2X1LA 4IUYA 1VPVA 2WWRA 4GX5A 3HDYA 2GBGA 1AUPA 1K89A 4MUHA 1DQPA 1C0IA 2EYUA 4RX1A 4TUYF 5JPDA 1YHYA 1F51E 2MYUA 2FEPA 2P11A 3K30A 1D1QA 5I7WA 5ALKA 3GQBA 3KJFA 4DA8A 1KAOA 2ATEA 2V6GA 3M5DA 3FOCA 3ADBA 1USWA 2A9JA 1BOFA 5JYBA 3D8NA 3X0DA 5EWMB 2UZ0A 1UOQA 4C29A 1CUUA 2R8BA 2VUSA 1DIGA 2QZSA 3PE6A 4FN4A 4FHDA 5AHRA 3TQSA 2WM3A 4ZZ3A 3RKUA 1QIFA 5DGDA 3KM0A 2WKPA 2ZS8A 4YRAA 5M29A 1QQBA 3L4KA 3T3MB 1YR9A 2BOVA 2R6DA 2GM5A 3VR5D 1Q11A 1WF6A 2NN3C 1U3TA 4TRNA 4UXIA 3ZI4A 4C04A 5HKAA 3JD1A 4KJXA 1EFPA 5HILA 4DJAA 2YR0A 1JIIA 4MNTA 3DMHA 2QRVB 2W6PA 2UUPA 1P4AA 4G24A 4Z1OA 2B20A 2OQRA 3B9QA 1KWKA 2A3RA 4ZGBA 5A6VA 1CP3A 3AHIA 1CLUA 1K7SN 3CKYA 1A50B 4ZMBA 1H4SA 5CMLA 3MOGA 3TQRA 3ZGNA 1ZNQO 2Q50A 2VP3A 5TQJA 3BPSA 1RYMA 4RS3A 2RGWA 2OOKA 1IN7A 1MO2A 5AM0A 1H6DA 2KB0A 1YBAA 1NF3A 1G5FA 1CR6A 4WLVA 1V3UA 1QIGA 2WIAA 3QFHA 4C0BA 1PG2A 1Z8DA 4XB6B 4MICA 1ZXLA 1OXMA 4LYGA 1R5NA 1OH7A 1C9EA 3N53A 4S1NA 1LNSA 2QJTA 2OB2A 3WC4A 4XVHA 2JFOA 3DBIA 3TD2A 1NMXA 4GSKA 5BNWA 3DFFA 4I0WB 2W22A 4LNUB 4CR6A 3K0SA 3THYA 1LPBB 5LUBA 2CT8A 1OFHA 1VIMA 3DLBA 4RM3A 3ZJYA 4IIYA 4P53A 4KR3A 3EH1A 4U2GA 1U5CA 3IILA 4FNOA 3IEKA 3LXMA 4H16A 4U4AA 4RZQA 4FVTA 1T0IA 3UT5A 1W0KA 4AG5A 3ZD6A 5EEHA 3TR0A 1NXOA 5D51S 3HZOA 1QIKA 1FPMA 1N7JA 3JQAB 3L6EA 2IHYA 5IBPA 4IDFA 3RHTA 4C2AA 1RWQA 4KQJA 1IBLB 2CY0A 3MCVA 4LSMA 3VU9B 5F9FA 4QO7A 3FCXA 3L0SA 5AK3A 5GVRA 2GSWA 1ZINA 1JHMA 5BUCA 3MYRA 5JQWA 3RYHB 3RVSA 5TNXA 1GGEA 4FFRA 3UH1A 4WNCA 2AFHA 3A4VA 4KHPB 2B4KA 1YT5A 2PWZA 2QR3A 3G5TA 4HF7A 4G8JA 3ND6A 3I32A 4GMDA 1E5LA 4JB0A 4AQYB 1K98A 1WUTA 1DJQA 1ZD9A 1O87A 2DT8A 3DE4X 1SRRA 3KQWA 4H59A 4R3NA 3SFTA 4DYVA 3IE0A 2ZWOA 4F72A 3F7TA 3I62A 1G3RA 4I1UA 3UXEA 3O82A 4ZI5A 2YS6A 2OAP1 1F8GA 4FHGA 4QFCA 3ZWDA 3COYA 2K2QB 5C52B 4R7TA 2OKGA 5DMHA 1ZJ4A 5KTOA 1RMTA 5B64A 2C98A 1GZ7A 4JC4A 5WRFA 3GJYA 1UC4B 5KYWB 3QE9Y 2CUZA 1M1YE 4HLUA 1GPDG 1KGSA 4M0LA 1MRZA 4RVOA 5AFSA 1PIWA 2A78A 1SAYA 2G17A 4FTWA 4R40A 5EQTA 1EXDA 1XEXA 3HO6A 3QVGA 2NV0A 2H1VA 2C2ZA 4KLRA 2NO6A 3PDCA 1NJFA 1T4BA 2B2CA 2BTQB 5ERGB 4BWYA 2V1UA 2FV8A 2EEZA 4OB7A 3O1HB 5LLTA 5KOYA 1E94E 4EW3A 3I2FA 4M21A 4TYNA 1OIVA 4W99A 2C20A 1FZQA 3EUAA 1KI9A 3EVCA 1N8NA 4DR2B 4DSTA 3GU3A 1C4XA 1FRNA 5CK5A 1XNHA 1JLRA 2BM9A 4YNBA 4YN3A 3VX4A 1IBSA 1CZNA 1FTQA 1KEVA 3I1YA 3RSGA 1TL7C 1GU1A 1LC0A 1MPTA 1W29A 2CFOA 2NAPA 1FMJA 1ZRNA 3EVGA 4RHEA 4H17A 2WIFA 5KTYA 5EE3A 1YASA 4PC3A 1RYHA 3HNRA 3W7AA 1QH1B 2JBAA 1N34B 4DIOA 5JI2E 4M4SA 2PUCA 1BHQ1 1KGDA 1Z0DA 3OICA 4V03A 5JBNA 2TMKA 4HN4B 3EHDA 1XRQA 1E89A 2BZSA 1JAIA 2ZSHA 1JBQA 4FW9A 2NGRA 4W8GA 1CC1S 4EZEA 1MUUA 2IEAA 1IY2A 3W8RA 1SXJC 2UUAB 1MJNA 1VBMA 4QRHA 5FPSA 2IYQA 2P6UA 4CLRB 4H7DA 3QY9A 1ZH2A 3S29A 2JI8A 3H5AA 4B47A 2YY5A 1II8B 1LZKA 3LDGA 4ZCQA 1BE0A 2GESA 2PX8A 4ZEOA 1H8ED 1EGMB 4EMBA 2QIOA 2X1VA 4C4TA 2QLFA 2A7XA 1KY4A 3OLXA 4EHDA 1UBOS 3J81k 3R3ZA 1PT6A 3CNHA 4M53A 4QDOA 1JEOA 4EI2A 4Z9XA 1RVDA 1WSWA 2QWXA 3BWVA 1N6IA 4I14A 3FVRA 1TAGA 4OHVA 1TQ4A 4QEKA 5LMCA 4WRRA 5GONF 4JP5A 2ZVJA 1HQYE 3E53A 1Z22A 5CX4A 5F7XA 4MQEB 4WOKA 3ENWA 4Q9HA 2JJ2D 3D8RA 3TLXA 2WAXA 1R10A 3V4VB 2B92A 5D3MA 4TMYA 3MJEA 3K6JA 2HUNA 4H08A 2BDEA 3ZNQA 4PGAA 3MLBA 4PX2A 2PGIA 1VE6A 5AHOA 4KR7A 1LSOA 3LOQA 4HVCA 4F1WA 4BP9A 2R8EA 3KG2A 1PZNA 1XAJA 2AEJA 1EESA 1JTVA 1JFSA 2J6HA 5LSAA 3WRYC 5LD2C 3OTIA 2AKAB 3AG6A 5CBPB 5ICSA 1FZTA 2BISA 4LPSA 4XM2A 1ZQ1A 1SQ6A 1X3LA 2QBYB 2BHSA 5CURA 3PF9A 5ERXA 5LQRA 3LGAA 3FPBA 4LRYA 4RSGA 4O4HF 4XQGA 3T3EA 3O3MB 3VYRB 2FGKA 2GEDA 5EXXA 1C9DB 1B6RA 3MG9A 3RU9A 4BQQA 4EO4A 4I4TB 3QF7A 1DAOA 4Q01A 1T5HX 2A9OA 1R4NB 1DCKA 1NVAA 1XJ5A 3TZCA 4YQEA 1WVGA 3UEOA 4B3BA 1USKA 1USUA 2P69A 5HGJA 3OZGA 1ZVVA 4YXWA 1T2EA 3O75A 2VSQA 3SIPA 4QATA 3O1LA 5E0OA