2QM0A

Crystal structure of bes protein from bacillus cereus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
261
Chain Sequence
NTTVEKQQIITSNTEQWKMYSKLEGKEYQIHISKPKQPAPDSGYPVIYVLDGNAFFQTFHEAVKIQSVRAEKTGVSPAIIVGVGYPIEGAFSGEERCYDFTPSVISKPWPKTGGAHNFFTFIEEELKPQIEKNFEIDKGKQTLFGHLGGLFALHILFTNLNAFQNYFISSPSIWWNNKSVLEKEENLIIELNNAKFETGVFLTVGSLEREHMVVGANELSERLLQVNHDKLKFKFYEAEGENHASVVPTSLSKGLRFISYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BES
publication title Crystal Structure of BES from Bacillus cereus.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 84
structure length 261
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qm0A01
5CW2A 2WG0A 3D4LA 4Y2YA 2XMBA 4PO3X 2XUIA 1DT3A 4WCVA 7YASA 4GDMA 1F0NA 5JATA 1QIKA 2PU7A 4AB1A 5ALWA 1XZBA 4CG2A 2WKWA 3BWXA 1UKBA 3CCBA 1B41A 4B0OA 4YPVA 3CN7A 5DYWA 3BJRA 2NW6A 1P0PA 1J1IA 3W9BA 3I2HA 1DTEA 2XUJA 3GROA 2ACEA 2VT6A 3O9MA 1CUFA 1LPSA 5LYYA 3WZMA 5FP0A 4DTCA 3S8YA 2ZSIA 4GECA 1CR6A 1LPAB 3TRDA 1X70A 2AJ8A 5T4EA 3E0XA 2PSEA 1EHYA 1UK7A 2X8BA 2BAGA 2VTVA 4BCBA 5ALXA 4J0HA 1EVQA 1MU0A 4OU4A 3IUQA 1JU3A 4H7DA 1HKHA 1YR2A 4U2DA 3VJMA 1TKRA 3V9AA 1OCEA 4UBNA 2C0QA 4J0CA 3ED1A 4Q3LA 2B61A 2XLBA 4UBKA 4B84A 1ACLA 3IB3A 4JH0A 4A5SA 4A16A 3ZPXA 1N5MA 4HVTA 5ALLA 5JALA 1ZJ5A 3BDVA 5K3BA 1F6WA 1H22A 2QMQA 1R88A 2FX5A 2ECFA 5LKRA 4ZI5A 3FYTA 1GPNA 3IURA 4MQMA 4UFOA 4NVRA 1ODSA 5AI0A 3H18A 5ISMA 2ZYRA 1CUJA 1QIDA 5AKYA 2WILA 4U2EA 3KDAA 5ALMA 4FDMA 4BDSA 1QLWA 1CVLA 2O2HA 1DINA 1Y7IA 2WIGA 3SK0A 4X85A 1CIJA 5DWDA 1CUHA 1E8DA 3FCYA 4A23A 3WL6A 4Q3OA 1CPYA 2JGEA 1GPLA 5HK9A 5ALKA 1AUOA 2OQIA 5I8PA 3M81A 2DHEA 3FSGD 5KBYA 2GBIA 1J07A 1BU8A 3FYUC 2OAGA 4K6HA 4AMYA 2OLEA 5AKJA 4BVLA 3FWHA 4G8BA 4X91A 4OCZA 1UOOA 4F21A 4J7AA 4HXEB 4G4GA 3D2BA 4MJ3A 2RHWA 2PPLA 3C8HA 4FBLA 3C8DA 1K63A 2GZRA 4G4IA 4RE6A 3G0BA 1JJFA 4JYPA 3I6ZA 1MX9A 2HFJA 5D3ZA 1KU6A 1EK1A 2PL5A 3D3NA 2QTBA 1Y37A 2PM8A 4K2AA 5KREA 2QVBA 4WDRA 1IUNA 4E15A 4GW3A 5JD6A 5ALNA 4WDQA 1A8QA 4P9NA 2E3JA 1JJIA 3QPAA 4WFKA 2Y6VA 5HF8A 3DS8A 3QMVA 3DJYA 3V1LA 5K3DA 1DWOA 1DQYA 5JASA 5ALSA 3R3XA 1E66A 4BB0A 5AI4A 3WKAA 2BKLA 4JYMA 2WFZA 4ZXFA 3FLBA 4FLEA 4OPMA 3DKKA 4N5IX 1GQRA 1ZI6A 1C4XA 3WIBA 4LXHA 3EQ8A 4G4JA 1U8EA 4Q1VA 1YS2X 2H7YA 2OGZA 1FFCA 2XI4A 1AMNA 2R11A 3DL4A 3D2AA 1G42A 3PE6A 3EF3A 2QUAA 4ITVA 3O4JA 5CURA 5AK4A 1W76A 2XQFA 3OG9A 2OCGA 2QZPA 3C45A 4S0XA 3WL5A 1GPKA 1ZI8A 1JI3A 1XZIA 1J06A 2G63A 1ORVA 1OXMA 3R3VA 3PFBA 1S8OA 4K6GA 3F9CA 3H0CA 5AOBA 1DX4A 4C6HA 1N5RA 2DCMA 3QITA 5ALIA 1X2BA 4BTLA 4OB7A 1JKMA 1C7IA 1FFAA 5AKEA 4L72A 4KRYA 4MEAA 4XVCA 2CJPA 2WFLB 1GKKA 4CIAA 1XZMA 4B85A 4EY5A 4P08A 5LZ4A 3WK5A 3ESAA 1AQLA 2Y6UA 2HU7A 4BBZA 1ZICA 4DSZA 1EH5A 4FOLA 1RYYA 1QTRA 1R4ZA 5BWCA 2VAVA 3G0IA 2XQKA 5C7YA 1XKLA 4ZWNA 1YAHA 5C81A 1UKAA 4H7FA 1IUPA 1T4MA 3RK4A 4UPDA 3SC2A 5HF5A 1PFQA 4NMWA 2UZ0A 4KE6A 4BDTA 1DQZA 1QJ4A 2OCIA 2Y1KA 1QONA 5KWIA 5AI6A 2ZYIA 1F0PA 5CH3A 1GKLA 1SOMA 1H23A 2HADA 5DNVA 1VKHA 4PQEA 5EFZA 2C0PA 3DDUA 1LPBB 1P0IA 1VLQA 3RKSA 4I4CA 3I2FA 3HJUA 1DWPA 1QFMA 2WFLA 2V9ZA 5K5EA 4NZZA 4BCCA 1XZAA 1JJBA 3WLAA 1A8SA 1TIBA 1KU0A 1VA4A 3STTA 5JD4A 3QYJA 4H77A 4C01A 3I2KA 1Z68A 5EIAA 2OPHA 2JGIA 2ROQA 3DLTA 1TQHA 5DTJA 4HRYA 4OYYA 3A2NA 5YASA 5HKAA 1M33A 3WKBA 1Q83A 2IX9A 1QTIA 2VJBA 4GHWA 4UFNA 4KE9A 1CUBA 1MNQA 4INZA 5EHQA 4B81A 1LPPA 4G1FA 3WKCA 4FMPA 2ZSHA 1YA4A 1WM1A 1XQXA 5CXUA 4TVKA 5FUMA 2FJPA 3O95A 2BGRA 5DNWA 5SYMA 1XRRA 2I78A 1A7UA 2ZJFA 4JNCA 4J0DA 1EDDA 1K5PA 5IVDA 4EHBA 1O6GA 4DSAA 1LGYA 4AQDA 3I6MA 5IH7A 3ZLUA 4HXGA 3LP5A 1ZD3A 4LHEA 1ODTC 1XRPA 2C5FA 1R9MA 3DEAA 4QDXA 1MTZA 4CCYA 2PU5A 4QA9A 1ZGCA 2VJDA 2CUTA 1YA8A 1NX9A 5A7GA 4X3CA 4J0JA 3UUFA 2JIDA 3GELA 4J0GA 5EI5A 2B20A 4BRZA 3D5EA 3ICVA 2WHQA 1XROA 1XZFA 3RLIA 4H7IA 3WKDA 5BV7A 1QE3A 5FKJA 4PNZA 4J0IA 4PF1A 1ZIXA 5ALUA 1UT6A 4EY8A 1IZ7A 1YB7A 3FLEA 5CT5A 4IH4A 1JFRA 2WIKA 4X00A 3Q0TA 1IVYA 3BDIA 1CUAA 5JIBA 3KD2A 3C6BA 1MAAA 1R9NA 4DYHA 2PSHA 2C5GA 3SX4A 4BAUA 3FYUB 1T2NA 4U2CA 2VAXA 1EA5A 2XMGA 2WSLA 1TCAA 1PV1A 5A2GA 1CQWA 4D9JA 1AURA 4BZZA 1QGED 4CG1A 4FHZA 1JT2A 1AKNA 4BTVA 3CXUA 4Y2TA 3N2ZB 3WI7A 1BCRA 4N8SA 1CFJA 1ZOIA 2WLSA 2OGTA 5ALHA 3K9BA 1R3DA 4AN1A 3W05A 2XB6A 1ACJA 4X93A 4FBMA 3O4GA 3LIPA 5AI8A 4DMCA 1XFDA 3OC0A 1QO9A 3KWJA 1LZLA 4MYDA 4QE3A 1WCYA 5E4TA 1HQDA 5EIEA 4KRXA 4MXDA 3C5VA 1JMYA 3FVTA 2QUBA 1O6FA 4ZRDA 5T4HA 5AOAA 1XRNA 5ALGA 2PSFA 3FYUA 4X7BA 3DNMA 1EK2A 2Z3ZA 5HFNA 3W9UA 4QDZA 3ZV7A 4B83A 3OTQA 3H04A 1E8MA 3D2CA 2DQYA 3D59A 4DNQA 1YCDA 2JGKA 4EA6A 3QPCA 5HCUA 1N8SA 3WK7A 2EDAA 2WUEA 5LZ9A 3D7RA 3FNBA 1C7JA 1WPXA 1IZ8A 3A6ZA 5DTIA 3KSRA 1MAHA 4DGQA 2CBGA 3KXPA 3FCXA 2JBWA 2JEYA 4AZ3A 5E4YA 3BE8A 1HLGA 2ZYSA 3WWPA 4FKBA 5LZ5A 3VVLA 1CUWA 1G4HA 4HTAA 1UK6A 5T4FA 1Y7HA 3LLCA 3AINA 2JEZA 4UBOA 1P0QA 2PX6A 5JZBA 2J4CA 2IITA 2ACKA 2GBGA 1CV2A 3EIOA 3F98A 4KJXA 6YASA 5CT9A 4DMHA 4EBBA 4XX1A 4EB0A 2BUCA 4I3FA 1R1DA 4Q05A 4ROTA 4WFIA 5LLSA 3BL8A 4KE7A 1HL7A 5I9IA 4QZVA 5F4ZA 5JAPA 2AXEA 5LZ8A 3HACA 1UOPA 5AKXA 5HK8A 3V1NA 1XLWA 3F8SA 5AKKA 2D0DA 2QR5A 4Y2VA 3R0VA 1D07A 5ALOA 1G5FA 5FPQA 2HA2A 2ZYHA 2XUQA 4G5XA 1K8QA 1UFOA 4Y2PA 3G0GA 2BFNA 1VE6A 4WY8A 4QDOA 1QIHA 1QIGA 4B9EA 5AO9A 3C5WP 3WK9A 2V98A 4KYVA 1Q0ZA 2B9VA 5LZ2A 4LYDA 2XMRA 2WHPB 4ZREA 2WU4A 3EQ7A 5AKGA 3STXA 3GBSA 3GA7A 5JZSA 3E3AA 5AM4A 1ZJ4A 1K6EA 4X92A 1W4LA 2VATA 2G5TA 2J4FA 5K3AA 4W1RA 3HLKA 1WB6A 2RAUA 2QKYA 2HA4A 5H3HA 5K3CA 1UXOA 2PSDA 5JZ9A 2HDWA 2DHCA 5EHNA 4BVJA 2OCLA 4Y2QA 1A88A 2JGFA 1XZDA 2QS9A 1UKCA 3OM8A 1XZGA 4H0CA 1YASA 4X71A 3QMMA 2AJLI 3F97A 1QZ3A 3DOHA 4N8DA 4BP8A 5BOVA 3H2HA 5CMLA 3ICWA 2WHPA 4GI1A 5IVIA 1GGVA 2HFKA 3MVEA 2XT0A 4Y7DA 4F0JA 2CZQA 1TK3A 3I1IA 1L7QA 3DYVA 4H7JA 1CUGA 3WWOA 3R3UA 1QIMA 5CRIA 3STVA 3WWEA 1MNAA 4H7EA 2O2IA 2BGNA 3O0DA 1CUUA 4G9GA 4QWMA 3PF9A 2Z8XA 4F60A 3MGAA 1MN6A 3HI4A 1E5TA 4O08A 2HRQA 5DYTA 3PUHA 4DMKA 2YH2A 1XQWA 3G0DA 3D0KA 3TJMA 5ALJA 2GZSA 5JAOA 2GBCA 4Z49A 2DR0A 2HA7A 3LS2A 2W6CX 3WYDA 3QVMA 3WL8A 2C4HA 1VA5A 2YYSA 1XRQA 3JYHA 1N1MA 2WHRA 2PVSA 4CCWA 4YX9A 4K6KA 3AIMA 1CUEA 4X95A 4BATA 4EUSA 4EY4A 4GXNA 3CCCA 5AKIA 3FAKA 3QZUA 4QLAA 3G9TA 1VZ3A 4IH9A 1CUVA 4TGLA 3T4UA 1H2XA 3I6YA 3PICA 3BIXA 5LIPA 1YAJA 2RGUA 4XIIA 5JYCA 1CQZA 1YSCA 1Q84A 1ZGBA 3RARA 4OD0A 5A62A 2AJCA 1JU4A 4J0KA 5ALDA 2HM7A 4Q34A 3LIIA 3IULA 4ARBA 3AFIA 2VA9A 4PW0A 3WL7A 4BAZA 4UFPA 4EY6A 2CMFA 2XUDA 4C4ZA 2XUGA 3C6XA 3BXPA 2J3DA 3H1AA 1CUCA 1Q0RA 5AHXA 4WY5A 4KAAA 4L0CA 4AZ0A 5IVHA 2C7BA 2XMCA 2QOEA 1BE0A 3A2LA 3QPDA 4Y9SA 4X6UA 2LIPA 2XQIA 2JF0A 1FFBA 5JANA 1XKTA 4LKOA 2WTMA 4IH1A 1W1IA 3GFFA 2QXUA 4DM7A 3H2GA 3VJLA 1XZHA 4PSCA 2JGLA 4GEGA 3H2IA 5AK6A 5ALYA 4FNMA 2IIVA 2OQVA 1AGYA 2BCEA 5AKLA 5A7HA 1EI9A 2WIDA 5ALFA 4DNOA 4BYMA 3EQ9A 5AM2A 3STUA 3GZJA 2WJ3A 3IUNA 1VXOA 2HA3A 1U4NA 1TCBA 1EB9A 3FSGA 3ZWQA 1ODCA 3WJ2A 2QRUA 2Y2VA 5ALQA 2VQ6A 1H2ZA 4C89A 3KOOA 1FFEA 3VXKA 1TRHA 4G8DA 2QJRA 2WUGA 4WJLA 1UK9A 4HS9A 4QWWA 4C4XA 5CXXA 5ALZA 4FFVA 3W2TA 1HDEA 2X5XA 1EDEA 1EDBA 1U65A 4QLOA 4W1QA 3UUEA 4KACA 3STYA 3KWFA 2XUHA 2GYWA 3V48A 5CBKA 1LPOA 2GYUA 3M3DA 1B6GA 3OOSA 3DD5A 2XUFA 3K6KA 5HQ3B 3GUUA 1LBSA 1SFRA 1HBJA 4E14A 1SC9A 3CN9A 2I3ZA 5CT6A 1QIIA 2W22A 5AK3A 5AICA 2JGJA 3ESBA 3AZPA 4LXGA 4RNCA 3WYNA 5HFAA 4X6XA 3PF8A 4FWBA 2XUKA 1E89A 5AKHA 1XQVA 3DOIA 5D7BA 2OXEA 3MUNA 4M0MA 3AZOA 3JW8A 3O9VA 1EB8A 1THTA 2XLCA 4UHFA 5FPPA 4UHBA 2RIPA 3FOBA 3V1KA 2HA6A 3E1GA 5ESRA 2ZJ6A 3H1BA 2BUBA 3WMRA 3ANTA 1ZD5A 1F8UA 4XJVA 4J03A 4G8CA 1CEXA 4UHEA 5J3JA 5CT8A 3HRHA 3VJKA 5HQ3A 3HYSA 4BCDA 5AM3A 2AJBA 3AUKA 4UBJA 3B5EA 5AOCA 3I2IA 1QFSA 4L3WA 1K4YA 3OPMA 1U2EA 5EHXA 1PJAA 3HXKA 4JEIA 1L7RA 1IMJA 3WK4A 2XUPA 1XZKA 2WIFA 2VSQA 5JADA 2WUFA 4PSUA 4Q82A 5FDFA 4E46A 3WA6A 1YB6A 4OB8A 3O4IA 4OU5A 5EHZA 1GZ7A 3UMJA 4N5HX 3A2MA 2H9YA 4YASA 4WFJA 4OSEA 4HRXA 4BP9A 4UUQA 1VOTA 1HPLA 3HEAA 3C87A 3G02A 4W1SA 2QT9A 4MEBA 2ONCA 5AK5A 2QM0A 3PUIA 2HRRA 4QEKA 2GYVA 5A6VA 2HIHA 2YASA 3G9XA 3PI6A 5AM0A 4UHCA 4H7HA 4PV7A 5DJ5A 1VZ2A 4HZGA 1XZJA 1H2YA 3QBJA 5AM1A 4J3JA 1QOZA 1P0MA 5HF6A 4AN0A 3I28A 5ALPA 1ZIYA 1BCSA 4YK7A 5CH5A 4FTWA 2PSJA 3ZLTA 2OGSA 4NS4A 5DNUA 1BROA 1VXRA 2PBLA 1CRLA 1I6WA 3H17A 2WQZA 3H19A 1WB4A 5FV4A 4I19A 3FLAA 5AI9A 3DKRA 3IUJA 1CUXA 4Y2RA 4C88A 2H7CA 3S2ZA 1TAHA 5IVKA 3L1IA 5IKXA 2I3DA 2DSNA 4RE5A 3C70A 5JAUA 3HSSA 4AO8A 3WKEA 4B0PA 2VF2A 4RPCA 3G7NA 2DFPA 3WWDA 4TPKA 1QIJA 3IIIA 4DLNA 2FJ0A 4K5QA 4HXFB 4BC1A 4GWLA 4QDTA 5LKAA 1BS9A 4UBMA 2VJAA 5AJHA 1SCQA 1UZAA 4EY7A 4AO6A 5AP9A 4BE9A 3WJ1A 4FNGA 2VT7A 3QH4A 3G8YA 4B82A 4AO7A 1G66A 3DCNA 5ALVA 3AILA 4U2GA 3STWA 3WK6A 2HA0A 2WUDA 1DWQA 2OG1A 4M0EA 3ILSA 5DYYA 5AM5A 1XLVA 3E4DA 2D5LA 2R8BA 4UBLA 3WK8A 3BJMA 1W75A 1CUSA 4OUKX 1XLUA 1NU8A 5K3EA 3AJAA 5ALTA 1KEZA 3Q8WA 3AZQA 3QMWA 1H2WA 2O2GA 1LLFA 1RP1A 3L1HA 5DLPA 2Q0XA 5K3FB 2WJ6A 3I2GA 4L9AA 5I7UA 4P92A 2EDCA 1XZLA 2VEOA 2XDWA 1AC5A 1XZCA 3JWEA 1FJ2A 5C8XA 5JAHA 1WOMA 2XE4A 2O7RA 1QO7A 2WIJA 1CUYA 2V96A 2Z5GA 1MJ5A 4MYSA 5E4JA 2XMZA 1ISPA 3I2JA 4FFWA 1CLEA 2X76A 5KWJA 3FBWA 2WG2A 3NUZA 5AH0A 2ZVDA 4X90A 3M82A 1EXWA 5AKZA 4C87A 4Y2XA 4MQLA 4G9EA 1ETHA 4X97A 5FXMA 2YXPX 3X3HA 2EEPA 3R3WA 3WIOA 5K3FA 4W1PA 1A8UA 4W9RA 1DT5A 5T4BA 1L7AA 3L1JA 5JARA 3WWCA 4KAFA 5A7FA 5AIAA 3T52A 3G9ZA 4ZV9A 4B6GA 2K2QB 5FRDA 1XRMA 1LNSA 5LZ7A 2P8SA 4KAJA 5AIBA 3TEJA 2CKMA 2QXTA 1SCIA 2XUOA 4LXIA 2RONA 3B12A 1WHSA 3ESCA 3NWOA 3H2KA 2RI6A 2ORYA 3B3QA 2I03A 2Z3WA 4BRSA 1JMKC 4GBGA 3QM1A 3NOXA 3IDAA 3M83A 1YS1X 5FLKA 4ZV7A 4U2BA 4H35A 1RWQA 1BEEA 1BEZA 5CH8A 2C58A 1MO2A 1AX9A 2Z8ZA 4HAIA 1EINA 3AIOA 4BC0A 4F5ZA 1DX6A 3C6ZA 1WPRA 2DHDA 3ESDA 5D6OA 4IHAA 4MWTA 4P93A 3AIKA 1SCKA 1NU6A 1VJ5A 5CT4A 3G0CA 2WM2A 2XUAA 4UBIA 2XMQA 3PDCA 1MX1A 1GQSA 2OAEA 1GXSA 4ARAA 4FLFA 2OCKA 4OYLA 5JD5A 3IA2A 5HF9A 3VKFA 4B9AA 5ALEA 2XMSA 4X6YA 3LCRA 4C4YA 1BN7A 2BJHA 3O4HA 4OB6A 2FUKA 4AX4A 5ALRA 1QIEA 1OILA 4MWSA 4ZGBA 3DL7A 2CB9A 2GBFA 2XQGA 3SWWA 3U0VA 5E2IA 1E8NA 1CUZA 1FSSA 4BE4A 3H2JA 2PKYX 5LP1A 3K2IA 2B4KA 3W06A 1FFDA 1XQYA 3ZLVA 4Y2SA 4UHDA 5D3KA 1MX5A 1XRLA 1EX9A 4BAGA 1WHTA 2RHTA 4DNFA 3V1MA 3WA7A 1VE7A 4N8EA 3VDXA 4CFSA 4EZIA 2V97A 5BWBA 3IUMA 3EBLA 5CTAA 2WJ4A 2WG1A 3U1TA 1CUIA 4IQ4A 4W63A 1MT3A 1CUDA 2PUJA 1WB5A 1DU4A 1ZD4A 1BN6A 4H18A 4QNNA 3OURA 3YASA 1TCCA 4LIPD 4UHHA 4B7ZA 2G4LA 5C8ZA 4BVKA 4CCYB 2HL6A 2HHAA 3MUOA 3HABA 2HA5A 3WZLA 4FLMA 1UOQA 5SYNA 4BZWA 4Q3KA 5AI5A 5C8VA 1R50A 3DYIA 2ES4A 4E11A 4PSDA 4CIBA 1UK8A 4V2IA 2PUHA 1ZD2P 1AZWA 3VVMA 3DQZA 2JGMA 2HU5A 4H7KA 2VJCA 2H1IA 2AJDA 3I1YA 1USWA 1W6RA 3ANSA 3F96A 2WTNA 3F67A 1GT6A 4X94A 3HC7A 3WQHA 2G5PA 2H7XA 4Y2JA 2WU3A 4Y2UA 4CI9A 3R3YA 3R3ZA 3C43A 1J2EA 1X2EA 2XMDA 3TGLA 1LBTA 2CEKA 4AMZA 3C6YA 3NGMA 1E3QA 4M0FA 1EVEA 1LZKA 2HU8A 5HKBA 5A71A 4RGYA 4AXBA 4KR0A 3PFCA 1UWCA 4DIUA 1BRTA 4DNPA 5HZGA 4KE8A 1IUOA 1MPXA 1XZEA 5EGNA 1ZI9A 2WFMA 3HZOA 5EIHA 4DMFA 4LYEA 3RM3A 3ZI7A 4B80A 2O7VA 1LPMA 2BUAA 1ORWA 3W04A 1QIFA 4KEAA 3VISA 4XWGA 3P2MA 4JUIA 3BF7A 3IBTA 3BF8A 3N0TA 3R41A 3G9UA 3R40A 2DQZA 4IO0A 4U2FA 3IVMA 4ETWA 3A70A 4GLBA 1W52X 2J3QA 4QDUA 2Y2UA 2XQJA 1THGA 3FVRA 1LPNA 5FOQA 2ZJ7A 4CG3A 2QJWA 3BIWA
chains in the Genus database with same CATH superfamily
5CW2A 3M9LA 4HDRA 1J21A 2FZKA 4U02A 3R6LA 4YJ2A 1IHDA 4WEOA 2J46A 2IS6A 1DT3A 3D6JA 1PQPA 1AUXA 2EL7A 2IQ5A 3AFOA 1U0GA 4L16A 5J2TA 1NVVQ 3QLJA 4PWZA 3IUBA 1RI3A 3F1LA 3LOPA 1QSGA 4KMOA 1B76A 1KA9H 2ZUSA 3FIUA 3N3BC 4FINA 4ZQEA 5I9BA 4GZMA 5ULLA 5MFPA 3S27A 4CG2A 2HJGA 4D9BA 3LUCA 4JT4A 2X7HA 3CR8A 3ZCQA 3TINA 4FDUA 3N74A 4YPVA 1F7VA 3BJRA 3H2YA 4P7JA 1E6WA 1RYFA 1ADBA 2H0RA 1OH7A 1T0UA 2QQGA 4LZOA 1P0PA 1TJ5A 2RHOA 4C3ZA 4EG1A 1EUZA 1J1IA 3EIQA 3HS3A 4HMQA 3AW9A 4MITA 5EIWA 2HWYA 5F7XA 2XUJA 4ABYA 4DA9A 2IRWA 2V6MA 3MWEA 3PSHA 3D1LA 3GROA 1L5GB 5A4MS 3L4SO 3O9MA 5BNWA 3Q8KA 2AN9A 3L0OA 1A2OA 3ELUA 3E5HA 1TTTA 3T5TA 1JIVA 1MA3A 1C3OB 3EUEA 2A78A 4RCYA 3L0DA 1YS9A 4A0GA 1LPAB 3TRDA 2HXGA 4AJ4A 1X70A 1M2WA 2AJ8A 3S70A 3SFVA 4DDTA 1UK7A 4N3BA 1J0AA 1ZD8A 1IN5A 3THYB 2GF9A 3DBVO 3FUWA 1TC2A 3TZQA 4BCBA 4DUGA 4MB0A 5JTTA 3C98A 4Q4AA 4G1BA 3IDZA 3AYXB 2YMPA 4J0HA 3DXFA 2UU9B 3C7AA 3R9XA 3W5HA 5IWAB 4YRBA 5CNIA 3AFHA 3T7CA 3LO5A 2WT9A 3GMTA 2M9MA 1EBUA 2BSQA 1DAEA 1TKRA 5KHAA 4L2IA 1OCEA 3MINA 4MV6A 5JBIA 4TV8F 1HMPA 2PT9A 3LM8A 2XLBA 3OQIA 1V8DA 1XD2B 1WF3A 4B84A 3ONFA 3UVEA 5K2OA 3IB3A 3IL2A 2FHSA 2OZKA 4RD0A 5LUAA 4NYJQ 4RY8A 4A5SA 1U0BB 3CH4B 3D6AA 4OMCA 1VL5A 3EZ9A 1N5MA 3LT4A 4NRDA 2GGSA 2EQBA 5ALLA 3ZPXA 1ZJ5A 4UVEA 1JFVA 3BDVA 3OT1B 5E1DA 2HPHA 4ZT5A 2O19A 2AF3C 4HS4A 2ILVA 3HLYA 4LOJA 4PLHA 4S0ZA 1AM4D 5IDVA 2H1HA 2FX5A 1ZW6A 2OYSA 5LKRA 3N2KB 2M98A 5FFMA 2LR0A 5H1YA 1YACA 1L7BA 1ZSNA 4ZOAA 4ZI5A 3UH1A 3M4YA 4MQMA 4RPHA 1GIAA 2B7LA 1JR3D 4LZWA 1BOFA 3VNSA 5KKAA 4JIGA 5AI0A 3H18A 1T6NA 4EVSA 5KQLA 2NPFA 1NRIA 3GJ0A 1JEOA 2R5WA 2PRJA 3PNQA 3K72B 4XD2A 2HLPA 3UJPA 1CUJA 1RMQA 5AUNB 2ZS8A 1EFRA 3BFVA 2UYHA 3NOVA 2HHCA 2PX2A 4C3OB 2C4WA 2G36A 3KDAA 5LN1A 1ZN7A 4BDSA 3QEKA 5FF9A 2WJPA 1ENPA 5JDCA 2SICE 3Q10A 5CLFA 2O2HA 4H0FA 2HDHA 5KYWA 2WIGA 3ZK8A 2QV0A 3MELA 1QHEA 4RXUA 5M29A 2IHTA 3RADC 3M6WA 4IIHA 4Q6BA 5FBLB 4C14A 1W47A 1VKRA 2FZWA 1E8DA 3SDZA 2D3WA 1ORHA 2ZULA 4LGMA 3WIVA 4I50A 1FUKA 1DE0A 3IAAA 3PHBE 4R41A 5BPFA 1D2MA 4UEJA 1DAIA 1CNFA 1P4SA 1ZCJA 2E89A 4PLVA 5L45A 5HK9A 4PHTA 2BGMA 4DM3A 5ALKA 1XN1A 1CS0A 2DFKB 1AUOA 1YVEI 1ZG3A 1NP3A 2VPXA 5EJ9A 2H59A 1Q1ZA 3CF4G 3NAGA 3KJQA 3VPBA 2Z6VA 2C8JA 1BMQA 4HAUA 4JKOA 3CRVA 4N82A 2W43A 3GNQA 3LWZA 4NOLA 4JQSA 1Z7EA 5DHUA 4G0YA 1SVLA 4JP8A 3NHWA 3RFCA 2O0MA 2E4XA 3O93A 3PFGA 1BO6A 1DHRA 2NUPB 4R9UC 2WTUA 4RW0A 3FYUC 4A7PA 2VDUE 3A6EA 4QGFA 4D8WA 4H17A 5LIRA 5DV9A 4YJ2F 4R16A 2F67A 3QVJA 5EJMA 2XPCA 3PQCA 4MQUA 5GV7A 4MV0A 1VMAA 3QY9A 1BEUB 4FPXA 3FWHA 1Q6ZA 3KVOA 4LHWA 5AYVA 4X91A 5JT1A 5K99A 3UAYA 3M1YA 1C4KA 3VOAA 4RLFA 3BGDA 2ZSKA 4YIKA 1JSXA 2C9BA 1IXKA 5J2TF 3C3AA 1V3UA 3EH2A 4EP1A 3CUWA 2R5FA 2QAGA 3RVBA 5DLDA 2WE8A 4J7AA 2OEPA 1QAQA 3AVYA 3BCRA 3UT5A 2QZ4A 1DRUA 4R2XA 4D9KA 1IZYA 1JWBB 1NF9A 3D2BA 4J1TA 4YUVA 4D9GA 5A5FA 3NOQA 4FBLA 5BYKA 2WAXA 3GJ3A 1FP4A 3TSWA 2GZAA 1AIPA 1XLTC 3AR8A 3USCS 1QF6A 2PFKA 4EQ6B 4XQGA 2R86A 1DAHA 1VKJA 3EOBI 3ZZ1A 4ZIRB 2I1WA 1E2FA 1E60A 4EB6B 4DSOA 1FXSA 1YQQA 3I6ZA 4G37A 3EXIB 3I9NA 1VFNA 4BGDA 5JY6A 3R5FA 3THSA 3CLRD 4R83A 5ADWA 3QLVC 2H1VA 3EF0A 1T6ZA 5D3ZA 5E2BA 3T61A 4K46A 4AFNA 4YV2A 5EJGA 1VI5A 5H7XA 4YMTA 4CGZA 4RADA 5I9TA 3DO5A 4WKNA 1E3MA 3GK3A 4CM5A 3E9NA 1FMTA 4PLGA 1KVQA 5IUNC 4I08A 4UAUA 1LC3A 3A27A 3AERB 4MKXA 1E3JA 4BX9A 3GLFB 2BMAA 2ZJ2A 2XD9A 2C8KA 4WDRA 2OL4A 2VWQA 3LC2O 3N2IA 1II8B 1A77A 1RYDA 2C1ZA 5I47A 2QN6A 3K70C 4KN9S 2UXBB 4GW3A 4DRXB 5JD6A 3PCRB 1A8QA 2GAIA 4P9NA 1L5QA 2E3JA 1JJIA 4MMYB 2RGDA 4RD6A 4WOJA 4AU1A 2W6ID 4QBIA 5D86A 1N7JA 4GWGA 5EG5A 3RVKA 4C4OA 5LMCA 4BKRA 3HGQA 4RFLA 4ENQA 2V6BA 4B32A 4NESA 2J30A 2HJWA 4B3DA 5K0TA 4P4SA 4JI3B 3T7SA 4DV2B 3I34X 1ODIA 4DCUA 1ZAYA 2OV6A 4CM6A 2O54A 4K0RA 1MEJA 2JGDA 3TG2A 2EF0A 3P9CA 4DKJA 4YDRA 2FWPA 1B2LA 5ANRB 2WKSA 4RVUA 3NC0C 4YLYA 1M6NA 1DQYA 1NJ8A 4HB3A 4GOOD 1PN3A 3RABA 4BEVA 8ADHA 5KNBA 3R3XA 2O3QA 1E66A 4ZQCB 1V8OA 1J97A 3MTDA 3C7TA 3PUXA 4JEUA 3LK7A 2LKCA 3LOQA 4GQBA 1OWLA 5SZJA 2VXYA 3EUAA 3LZDA 3UT6A 2YCBA 4EJ2A 1NI3A 4ML3A 2E18A 4MLZA 4B3MB 3SYKA 2AGVA 4XJTA 4BMVA 4F4HA 2E4WA 4N01A 1NUAA 2VTKA 3LFUA 3FPCA 1VLZA 3QFSA 2OKCA 4OPMA 2OXTA 2ZXUA 3NORA 3NALA 3DKKA 3RWMB 4B6OA 2IS4A 3U6KA 4EKIA 4FZVA 1N2HA 1CZHA 1C3EA 2IYRA 2C2KA 2WABA 1P2SA 2Q4DA 3CUKA 3CWCA 1X19A 1RKVA 4ZQHA 3QW4B 4OMFG 2IZ0A 2X2OA 4HH0A 4ALKA 3BD7A 4JJ7A 1I1HA 4GU5A 1GP2A 1KIFA 3MMPA 1QLHA 4RKWA 4UEWA 2OGWA 1LBQA 4P4TA 4ED9A 2H7YA 4YWJA 1VE1A 3L77A 2PV0A 2G4CA 4AMGA 5BMVA 1UP4A 1SHJA 1VKNA 5CX1B 4YJHB 4Q3EA 4B2LA 3GCWA 2F48A 2A5LA 4EJMA 2XKBA 5K0BA 2J85A 2P2GA 2QVXX 3RFFA 1I13A 1L6IA 2CZGA 4I50F 5SZIA 2J41A 2ZITA 3CLTD 3DB1A 3DL4A 5JR3A 1AMNA 3JQFC 4XAQA 1U1CA 5KTRA 3E58A 1NI5A 4RVOA 2NT4A 2XE6A 1WW8A 2JCGA 1TI7A 4KQFA 2QUAA 1EDOA 4RAQA 3GB9A 5DMHA 3R76A 2QTAA 4ITVA 4DA8A 4E13A 1NNI1 1CJBA 1GGMA 4XM2A 4D8XA 2VBIA 4HI0E 4JR0A 2Q5HA 2JKZA 3O4JA 3EGEA 5CURA 5JSZB 2XGJA 1LSJA 2R2AA 2EATA 4G63A 1IL0A 1LDGA 1H2FA 4LG1A 2CYCA 4M60A 2E48A 2OCGA 2WWIA 4E5DA 4TKZA 3COSA 1PL8A 4MV9A 3HADA 1SBZA 4HYQA 2H5JA 1ZI8A 3ROKA 1UWVA 3IAFA 4EKEA 2UUBB 1RLOA 1U6JA 3NT2A 1T1GA 2NZJA 2BH9A 5TQ0B 1J06A 3S55A 3TSYA 3R7LA 3U48A 1DVRA 4J76A 2KLHA 4O0LA 1CQXA 1YFJA 1II0A 3NW9A 3EPRA 4AMUA 5LNK1 2ZZKA 2BL4A 2OFOA 1OPRA 1S8OA 4KGZA 4RK1A 3TL3A 1C1YA 1W2WB 1EEHA 2OCDA 1FF9A 2X5OA 3AU8A 4HTFB 3RYIA 3SC3A 5BN5A 3H65A 3ILYA 4S24A 3WMXA 3LPAA 1Q0LA 1PS8A 2H2HA 2ZXFA 4FU0A 1Y6QA 1K3UB 3QITA 1PWZA 4Y2HA 3DC2A 5ALIA 1NNEA 4KYUA 4Q7KA 3GT4A 1I3LA 4R68A 4BMCA 4BTLA 4BPBA 4R0MA 1V9SA 5HWSA 4DADA 4B4WA 1TEZA 2BGIA 4H1TA 1HQCA 1EUCA 3NASA 4C2TA 3W8DA 1VKOA 3P9YA 2JRLA 2DKNA 1PZGA 1NIPA 2R8EA 4QELA 1K7SN 4EZEA 3H6KA 1NMYA 5FWXA 2X42A 2CLEB 3LCJA 4CGYA 3EA5A 1RQNA 2WM8A 2Z8YA 1DELA 3V2UA 4IJQA 4X7RA 4XIFA 2KYRA 4CM4B 5FHRA 3A26A 4CIAA 3Q8MA 1XZMA 1QYRA 3K5IA 3S7TA 1I9GA 1RKXA 4JP3A 3UMYA 1AMOA 5H59A 5D85A 2HREA 1X7YB 3SDBA 1CG6A 3JQ7A 1EHCA 1WOYA 3PU6A 1BQ3A 2D1QA 3EMDA 1I24A 3LBYA 1G3MA 3A6FA 1WE2A 3FGPA 4CTMA 3B8EA 5ECDA 2BDEA 1COZA 3HJNA 2VKTA 4J1QA 3ST7A 4DMMA 1B6TA 2G6BA 3AV3A 4PYOA 1WMDA 1R0CA 1RIIA 5CA1B 1XZQA 2FR8A 3NC1C 4L7QA 4R2HA 2H7VA 4MGKR 4PVDA 1B8PA 3G0IA 4E1VA 4B09A 3Q9SA 2HMTA 3X1YA 4AAYA 4ZJPA 2NU7A 1XKLA 3ZY5A 4E5SA 1ZO8A 4C08A 3OT4A 3UANA 3R09A 5DBHX 1BGWA 2D62A 4ZWNA 3ZUGA 4FJ0A 1G20A 4IIUA 4LE1A 2OXCA 4QVGA 5BW6B 5BNTA 1Z4LA 1IUPA 1DXOA 3KQHA 2J67A 3MCWA 3HUFA 5EIBC 4GMHA 1J90A 3MJ4A 1KO8A 3HKDA 3V33A 1JFFB 4OFXA 4BDTA 3ICQB 4MUGA 1QJ4A 3CT6A 3AEXA 4NE7A 4OQNA 1YZFA 4BYGA 3SZGA 1UFKA 1N9KA 1V5GA 2FWIA 2OFPA 2ZYIA 3WJAA 3BMCB 4BOYA 4QXQA 5CH3A 1Q1EA 4L85A 5JJIA 4RWZA 4EK9A 1HNXB 4RF5A 3QKRA 4G0PA 1PSDA 1KEPA 2C8LA 4PR0A 3SJBA 2GWRA 4LXQA 2X9GA 1QB7A 1P0IA 3KUKA 5CAEA 1A8IA 1VJRA 4LJAA 3KEFA 1NNUA 3RKSA 1IZ9A 4QIHA 5A05A 3C16C 2Y1EA 5DU2A 2EAUA 3SX2A 1U2GA 2WVGA 3HN2A 3JQ8A 5F76A 2HGZA 3EYAA 3HJUA 1FDVA 5FADA 3HWSA 1TO6A 1QFMA 2WFLA 3PC3A 2AR9A 3KFLA 4J4HA 1HV8A 4NZZA 2HHJA 5LA6F 1Y1KE 2BRUC 2PS9A 4Q01A 4BHTA 4INOA 1XZAA 3AV0B 3AR6A 1JJBA 3FDXA 3GLHA 4ZVSA 5KCZA 3PJRA 4MKFA 5DYIA 3U4AA 2DULA 3H99A 1VPTA 3U7JA 1DMSA 3C15C 4BNTA 1U7UA 4U00A 3LWNA 3EVEA 4I3HA 4Y6QA 2X40A 3VI4B 5HQTA 1GL3A 4H3HB 5FTLA 3UB2A 5JD4A 3BEDA 1Z68A 2GN6A 4IWYA 4MQ4A 5EIAA 4C0HA 1YRBA 2Z08A 2ZRAA 4GQIA 3TPFA 5K20A 1LLQA 3MK31 4HGOA 1MENA 4LV5B 5BV1A 2IW1A 3DLTA 5EEHA 1TQHA 4MJXA 5FBHA 4HRYA 2EZ4A 2ZAMA 2OUIA 5E4FA 1XAHA 3LPNA 5E3HA 4F3YA 3ET5A 2W9XA 3TB6A 2ZJAA 1GZUA 4ERXA 1Z0DA 1XC7A 4CEIA 3CG0A 4JL6A 4OHBA 1QHXA 2WDPA 5YASA 1ZHFA 2H4ZA 4GC9A 4GP6A 3VJRA 2BJWA 2VHEA 4NDNE 3WKBA 3HZRA 3MLAA 2VDWA 4J6FA 1V9CA 1BQEA 2PUGA 1FNBA 3HY6A 4GHWA 2DPMA 5ITZA 2F9LA 4Y7CA 4KE9A 2AX3A 2I67A 3FNEA 1HC7A 3D4PA 1TYDE 3RBVA 3PQEA 3HNOA 1NP6A 1L2TA 3MMZA 2I6QA 4B81A 4M9CA 4BN5A 5CLLA 1F48A 2VHYA 4NV0A 4ZJZA 3WKCA 3QSYA 4FMPA 1UEIA 2RAVA 1TPYA 1DEXA 1TUIA 2ZSHA 5DX0A 1E1QA 1WBDA 5TSDA 1WM1A 4WXEA 4KO4S 1XQXA 1GYRA 4AKTA 1AHIA 3DZ8A 1ULSA 2FJPA 5L3ZA 5MGBA 3L5OA 1C29B 2IY8A 2YOGA 3O95A 3HXMA 5DGDA 4TMZA 1GTVA 1XRRA 2GK3A 3NTQA 4CQLB 5JCPA 1TJ4A 1YE3A 2MOKA 3LC1O 4RDCA 3X1WA 3ODPA 5IAAA 4XR4A 4C1NA 3DKPA 5M04A 1EWTA 1Q3TA 1N7HA 2ZR0A 3AR3A 3UPTA 1DAFA 3TQCA 1O6GA 2QLTA 3DUFA 3NUGA 3OMLA 4GZ6A 5IN5A 4YIHA 1CIVA 1SQ5A 4AQDA 3WBBA 4CMIB 5B36A 2GM5A 3I6MA 3O5AA 3FDZB 3T3OA 1JG7A 4RFVA 5DLQC 3ZLUA 1SQFA 1KJWA 3PKIA 4ZA2A 2FSSA 1RSZA 1P4RA 3V7WA 3KVRA 3HDHA 2C7QA 2R00C 4D44A 2GPNA 4HJRA 5IHPA 3TVYA 4TSRA 2DSTA 1VLHA 4L4SA 1FNCA 4MZDA 4Q00A 4EAAA 5F9HA 2YXNA 1R9MA 1PL7A 3DEAA 3JALA 3LVRE 2VQDA 4G6ZA 1IHYA 4QDXA 1M2KA 3MBKA 4QXAA 3TO5A 3OEWA 3ILXA 3W8NA 1MXHA 2ZRCA 4ZDKA 2V7XA 4AX8A 5CDUA 3OOEA 3VDRA 1FUIA 1A9OA 4N40A 4QFBA 2POQX 1KSFX 5CHYA 3ZZNA 4C6TB 4UTRA 4C0BA 2GK7A 2YFKA 3K9FC 1KFBB 5D1NA 5C8DA 4BMXA 1NN5A 2YIMA 1DC4A 3D8TA 1AV7A 4PC2A 5GONA 3E05A 2VF8A 4OP1A 1YI8A 3DOJA 4YC7A 1V45E 1QYDA 1V1RA 3L49A 4N3NA 4RENA 3UUFA 3CNQS 2JB9A 1GDTA 3QU5A 7REQB 1FCJA 3KDSE 3GELA 3DCJA 4MSUA 5TNXA 5EI5A 1T24A 3RHFA 2VDMB 5KPDA 4BNFA 4LTMA 2WB4A 1NNLA 3BBLA 3BXGA 4JLKA 4BRZA 5A3JA 1Z0SA 3EGOA 4RGVA 5CDSA 2WHQA 5ICMA 1GSOA 3DVQX 5BV7A 3VNRA 4RTNA 2C5EA 4YPOA 4RCVA 4R1NA 2G4VA 2J5XA 3KU1A 4PLPA 2FUNB 5B30A 5E1OA 4L0DA 2PAFA 3BTVA 2ZSAA 621PA 3EXAA 3HUDA 4GLFA 4IIXA 2ZI9A 4UAJA 3DBHA 1TJPB 2VR1A 3TJRA 1XMSA 4U7DA 5KTTA 1TA9A 4NEQA 5EPOA 1CD5A 2I8CA 4ZT2A 1NT4A 2DJ5A 3CRMA 3V4OA 5JMTA 4EY8A 3VA7A 2F8SA 3CLVA 4P5PA 3DO8A 1DGQA 3V3TA 2RGBA 2ZKIA 2G25A 5BSTA 4IH4A 2OO5A 1JQBA 1JFRA 1DDGA 1QORA 2YUIA 3R0QA 2SECE 4EHJA 2BFWA 3A1VA 3Q0TA 2D2IA 4DCPA 1OXVA 2K7FA 3KKPA 3NO4A 3ER9A 4HLDA 3DBIA 3FYCA 2AOUB 2B98A 1TTPB 3C6BA 2RH8A 1MAAA 1R9NA 4OQXA 3CZPA 1GNVA 1HNZB 3MTQA 2Q4OA 1M2HA 3QVGB 1J0XO 2QMOA 2ISCA 1PV1A 3PKJA 5TY0A 3OZIA 4S1NA 1G6OA 1NPTO 1OHHD 2O06A 2BEVB 1ZEMA 3NXSA 3HNPA 5CVUA 3Q8LA 4RZ2A 4NFYA 2QL5A 2VNHA 1JU9A 4OBBA 4EPRA 4CG1A 3O0TA 4MQEB 3DDSA 4BQSA 1UBOS 5LB2A 4RHUA 4ZK2A 4ARVA 3AKZA 5T7BA 3SE0A 2H4JA 3O74A 4E08A 2JRCA 4B34A 3SS7X 3KTOA 4QPDA 5JXJA 3ZVNA 3WI7A 4KQIA 4MRMA 5LP6C 3E53A 3SZRA 5GM1A 5JXHA 1OAAA 1RCUA 2XCUA 1CFJA 3NQ41 5EPUA 1VIVA 2GSDA 4X1YB 4ARUA 2CFSA 3BGIA 1ZOIA 2HK6A 1KE1A 1R3DA 2I4MA 3D3WB 1YD7A 4DABA 1J1ZA 2A1IA 4LC9A 3QEMA 1D1TA 2B8NA 1JHXA 2QTZA 4CTNA 3NPAA 4YP7A 2IV3A 3RSSA 3O2JA 1MMFB 4LKRA 4MPPA 1BCSB 3TE6A 2ZOSA 3TGPA 1PLKA 1U7XA 3NATA 1TM1E 2O1WA 2HXYA 4IX9A 4M21A 4WCFB 4FFDA 4U3JA 3VYRB 2ZIXA 6GPBA 2A9JA 4NBRA 1HYHA 4LF4B 1JAHA 1HE5A 2PS0A 4RJLA 3SOZA 1JTVA 3LX8A 4KRXA 3BMOA 5JNTA 2Z43A 4RH1A 3VR5H 1O7JA 1PBTA 1J09A 1TU4A 2C0CA 1TUGA 2CUZA 3E2MA 4HWPA 4ZRDA 2HLDD 3NYRA 4RV9A 6Q21A 1XCBA 4F4UA 4NU8X 2YY5A 4II2A 3Q2KA 1XRNA 5ALGA 3SC6A 2EJWA 3IAM1 4HGNA 5K4AA 2PSFA 3FYUA 5BV2P 4WTOA 4X7BA 4KMSA 1QH8A 4V02A 1AOXA 1M10A 2VYQA 2Z3ZA 4GT1A 2Z95A 1U9ZA 4FYIA 5CVJA 5EKUA 2JVJA 2XJ9A 4KGXA 4DR5B 4OHRA 1C1HA 1XPJA 3WR5A 2JD1A 1KS2A 4FJ2A 4UZSA 1PZXA 2ZIGA 2MINB 3OPNA 3D59A 1WUHS 3BX1A 4E1BA 2I62A 4KW7A 1C1XA 2IKSA 4RK0A 3JYPA 4GYKA 2JGKA 2D0IA 2V7EA 3OLVA 3P5SA 3UEOA 4BJ6A 1IBLB 2CXOA 2P9ZA 2QYTA 4MP6A 3WK7A 4RC9A 1CQIB 1RWNA 1QTQA 3KHKA 5B7QA 2JCSA 1RHUA 4JFAA 3FNBA 3KB2A 2VP2A 1C7JA 5F1OA 4LF9B 1HSZA 2CXNA 4QYXA 1XLTA 2PD3A 4OA8A 5C8YA 5DTIA 5C7LO 4OM7A 2POCA 3QUTA 3TQTA 4DGQA 5GONF 1O4VA 3HP4A 4HWOA 4OQPA 4BPRA 2R62A 4HWSA 5BSRA 2JLQA 5DO9A 3WRXC 2QPLA 3T5BA 4KPYA 5AVRA 4M8SA 2FEOA 3R8FA 2QD5A 3QKSA 3WWPA 1JSRA 4BZQA 4IRUB 1F17A 2I6XA 2XZTA 1M2GA 1ECGA 4YWHA 2YXBA 4DDKA 1J9ZA 2V1XA 2XYGA 2ZKLA 1EU1A 1FNMA 3TB4A 3N05A 1UDBA 1XN4A 2QTCA 4GNRA 3GLIA 5T4FA 1Y7HA 2A9OA 3CXRA 3GBVA 1OBFO 4MA0A 4YLGA 4BNZA 1SOWA 4B7CA 3OX3A 1R00A 1OC4A 5E9AA 4EW2A 2W2LD 1T2UA 4EYKA 4XWOA 2BGTA 2JEZA 1FPQA 2VUHB 2IOFK 2P5TB 3INRA 3KX2A 4IF6A 4PR3A 2PX6A 3OFND 4TL7A 5JZBA 4TTAA 4YLEA 3BOSA 4ALMA 1E0DA 4EH1A 1I94B 3JARA 1W6UA 2QTMA 4ZOBA 1GO2A 1G8KA 3ZZMA 5JZMA 3P9QA 5ESWA 5FYQA 4D81A 2PXHA 1JZQA 4S1VA 2C9ZA 2O3JA 3AK4A 3K0HA 3QBDA 4BNKA 1Z8HA 3O8QB 4Q1DA 5CT9A 3W2IA 1KP9A 5C5EA 3R0XA 2HEGA 3FHOA 4BZPA 5KX5F 1TQ2A 1Z8FA 1MB0A 2XOXA 2QHXA 4PQGA 1SRRA 4R3WA 4ZOQI 4WESA 4EB0A 1OB5A 5AW6A 3PTAA 2VNSA 2GZHA 4X1IA 4Q05A 1IJEA 1N3BA 2OCAA 4WFIA 1G41A 1FDOA 4BQRA 3BL8A 3WRVA 4YJ3A 1P2VA 2I8LA 1K89A 1NR5A 1YJAA 2BJVA 2I2CA 1F2UB 4YP0A 3CBGA 1F4LA 3L7OA 2P75A 1QCZA 4Q24A 5HIJA 5I9IA 4BQPA 3KOWA 3ECCA 1B26A 3OQ1A 1L5MA 3O8BA 4LY9A 1GR1A 4WKGA 3SSNA 4H1UA 3FCCA 3I76A 2VHQA 5HHTA 2ZJBA 2Q3FA 3HACA 5BV0A 1ABBA 4P38A 2F59A 3IB6A 5CB4A 2C1EA 2NSDA 1Z5PA 1YA6A 4UD2A 2RBGA 1JGTA 1ZK4A 2SHKA 4KUHA 4FIDA 2J3KA 4FC7A 4HO1X 2PG3A 3M5CA 3UAOA 4QXMA 2P69A 3F8SA 4AY2A 2A0UA 3RHSA 2D0DA 4M1SA 1YXMA 3KU4A 3RSOA 4WVFA 1L6RA 3O1HB 3QYPA 4Y2VA 4F93B 3V8EA 2JG3A 5I45A 4ZN6A 2SCUB 3IE2A 5H8WA 1G55A 4XFJA 3RVPA 3HBLA 5IXSA 2G83A 1A95A 2ZRLA 1AB5A 1E3TA 1PDOA 1U0NA 2EG5A 3AY6A 2WLTA 3M5DA 1M7BA 2GILA 1XBTA 1Z4MA 2NZ8A 2WJVA 4CXMA 2IOQA 4DA0A 4XX0B 1J2UA 2XKAA 1MQAA 1DRVA 3Q5GA 5FPQA 3B89A 3CT4A 1W88A 4WPGA 2ZM6B 4RIHA 1GADO 1NLYA 1D1PA 3JWPA 2C3PA 2WNSA 4PQYA 4Y2PA 4LTNA 1ZHOA 3I09A 3VYTB 1FDWA 1I8TA 4WY8A 1YT5A 1SY7A 4G4SP 2IVFA 2BM8A 3HGTA 3HVIA 1ABEA 3C7KA 1GA4A 4MW7A 4QDOA 1WQ3A 4B9EA 2OTCA 1TMYA 1ZNQO 2UZ3A 2W4QA 4LE2A 3KSZO 4PZUA 4RFSA 3FPGA 5FPYA 3C48A 1Q0ZA 1HDGO 4BV2A 1SC6A 2FMHA 3RLFA 3AGQA 1BMFA 2Q0HA 4LRTB 1CJVC 2QLLA 2J3IA 1W30A 5DHFA 3SYRA 5SV2A 1LW6E 3MAAC 4EVIA 2K87A 3LW7A 2WM3A 3OKFA 2OO3A 3DHNA 3CRW1 2R1UA 3HDVA 3IEVA 3MN1A 2CWWA 1BHJA 5AKGA 4D3YA 4MI3A 1OX4A 2GARA 2D7DA 3VR4D 2FXIA 2WC1A 3LQQA 3R75A 2DLNA 2ZQZA 3LF1A 1SB9A 5ICSA 5BPHA 1Y3FE 3C8MA 4PC1A 1TECE 4EM6A 1K6EA 4P84A 2DWCA 4GKAA 3CIFA 1YONA 3H6GA 3AI3A 2OBBA 2X41A 1XKXA 2MU1A 2H18A 2G5TA 1TPZA 3MXTA 4TTQA 1KGSA 2RAPA 3HYLA 3JVDA 3LUDA 4WI1A 1MB2A 5G0UA 3GYGA 4A27A 5LQDA 3VAYA 3DW3X 4W1RA 1ZUIA 5C8YF 3RGWS 2YR0A 3T06B 1R0LA 3JASA 2ZPTX 3DQPA 4TLMB 2QKYA 1F8YA 2VTDA 3CWZA 3C3WA 3MSCA 5P8WA 1N57A 3I1JA 4COOA 5A3VA 3F9IA 4K9LA 5K1ZA 4OAOA 3I92A 4D79A 3R7WB 2PSDA 3R3HA 2BOVA 2B4QA 4AT1A 4W6ZA 4ARZA 1HE3A 5FYDA 4J8PA 1JIUA 1C3VA 3OETA 3OH8A 4BVJA 1J9GA 4Z9BA 5IDWA 1RLIA 3GARA 4BIIA 2AT1A 4UMVA 4PGHA 5LYJA 1BG6A 1P17A 2BBTA 1T5HX 2GTHA 1XZGA 2G8NA 1IHOA 2H31A 4K9KA 4OJQA 4H0CA 4DJTA 1M6VB 2AJLI 2UDPA 3F97A 3QMMA 4X71A 2XKJE 3RF6A 3RHZA 3KPJA 3SAJA 3WQSB 1G7CA 4J3FA 4LWOA 2GLXA 2LUOA 3GF4A 2G08A 2GA8A 3SD7A 4LDZA 2YVLA 4B75A 3A9RA 4Z7OB 3DUWA 2IPXA 1P60A 1FXWF 1TK9A 2XNCA 4E5YA 5IT4A 4DF3A 3NHAA 3ZE9A 2CZQA 2ZUFA 4QRDA 3OZTA 3AEKB 4LVNA 2XYQA 1QPBA 3GAMA 4HX9A 3CF2A 5PGMA 3FJOA 4H7JA 3Q40A 1CZUA 5AMXA 2OP0A 5BYAA 1X1AA 4R2KA 3RSLA 3HDTA 2IIPA 2IPNA 2ZWAA 3WWEA 4DJEC 3KZNA 3DOFA 3WIUA 3GIWA 2PUAA 4J94A 1LV8A 1SBNE 5AW5A 4YAIA 3X1KA 3A6PC 3M3PA 4NV3A 4H7EA 4D98A 1S0UA 1B93A 1U7DA 1PGQA 2BGNA 3G89A 4HDOB 3GL9A 1SH7A 4GGMX 4CLEA 4E6PA 1P80A 3AUFA 1UDWA 4LYAA 1T3SA 4FS8A 1QZUA 3G2PA 5EP1A 4XPIA 1J25A 5CB4F 3RU9A 4HBZA 2O5EA 4HQNA 4LUCA 5KU1A 4HN9A 1XCMA 5HNKA 2YX1A 1DEOA 4O08A 4YR7A 1ZR2A 4TUYF 2QUHA 4C7XA 4CFZA 5ADUS 3L7CA 3KHSA 2B82A 4HG2A 3ZU6A 2WQ7A 1Y9EA 3C1AA 3H3FA 3ND5A 1GRQA 1T3ZA 2AHRA 2PLNA 2WINI 3NUQA 4I1OA 1XQWA 1V2HE 4K05A 4PO1A 2BRUA 3D0KA 5DBGA 3VC1A 2K7ZA 1ZNZA 2RJNA 2QROA 4UHJA 4S05A 1YTUA 3AUAA 4NXNB 4TMVA 2FEXA 1K8XB 4GX2A 1DOAA 1DG9A 2XOEA 1G5TA 3D4NA 2HHLA 4ND6A 1RAFA 4W4TA 4YRDA 5FD8A 5LLDA 2ET6A 1IHUA 4F1JA 2J9XB 1RBYA 5HE9A 4N76A 3SLRA 3CIOA 3F5SA 3O1LA 5IULC 1OBCA 2C4HA 3PYMA 4ZTBA 1QFZA 3CW8X 4M8KA 4FOOA 5LJIA 2YYSA 3AX6A 4C5BA 2XOKA 3R5HA 4EDHA 3WYFA 1KVUA 3UMCA 1NFFA 3MNFA 4MR9B 3NHJA 1BE1A 1GDHA 1N9GB 4C22A 5AHRA 1PSZA 3E2PA 3OWHA 4BN0A 1QJCA 3F5DA 1I1NA 4K6KA 4DUPA 3AIMA 3TD6A 1Y8QB 2VI5A 5BWMA 4AP5A 2ZIFA 4GXNA 3SHQA 4AURA 4MVJF 4R5MA 1ZJZA 3DNPA 2OHJA 3FDFA 4CNQA 1Y8AA 3EC1A 4QLAA 3K8QA 4Q3AA 1OAOC 4MULA 1QNLA 3SP1A 2EW8A 1VZ3A 2NACA 2RHJA 1CY2A 3PHHA 4NG4A 3THWB 2P11A 2PBZA 1YKGA 3UAVA 4AY5A 4BS9A 1K7FB 5FJJA 1H2XA 1QP0A 3I6YA 4GGPA 1YR7A 3FB4A 3PICA 5K0JA 4IZ6A 5LIPA 3D6MA 2Q3JA 1CU1A 3CVYA 4WOBA 5KYUA 5BSGA 3JAMA 3DR5A 1KQPA 4L0QA 4TZ0A 5DSTA 4I1RA 1F0YA 1K0FA 1BXRA 1QP8A 2B4AA 1CQZA 4U6QA 4Y2GA 4D8TA 4YXFA 1YQDA 3PDIA 3MRTA 5AW9A 1GAWA 1IBCA 3MPUA 1XCJA 3PX2A 2JBAA 2P0YA 3A6JA 1WBBA 2EWMA 1KR2A 2GBLC 4CKWB 4BO3A 1UBNA 4JITA 3DD1A 3F5MA 2ZSBA 4YAUA 1VYHA 3DE5X 1G0NA 4L4ZA 4OJMX 4FOPA 5HIMA 2XNDA 3DTVD 3HRIA 4LVOA 3F5FA 4RXMA 2AJCA 4HDAA 5KYVA 1NF8A 1JEAA 2P78A 1JDUA 3GEBA 4JWTA 4YJ2B 1JPUA 2QNIA 5ALDA 4EOGA 1CERA 1T0HB 1W4AA 1Q3KA 2RH5A 2GUWA 3OKCA 5CPFA 2BFCA 5IMBA 2DC1A 4PG6A 3VHQA 3DCIA 3AFIA 4P5DA 1RJFA 1UC4B 2B78A 1RXCA 2P2NA 2W7TA 1PV2A 2MTBA 3K0AB 4MYTA 3UWPA 1EP1B 3W3AD 2C9DA 4YBZA 2CMFA 3W5CA 4LECA 2ECKA 3FFTA 1UP6A 3OC6A 1PZEA 2XUGA 1OBOA 3DPIA 3C6XA 4LC0A 5BYBA 5CLQA 3K70D 4LI3X 1CUCA 1YJXA 1BIFA 1MQ8B 3OCWA 3Q4GA 4RKFA 4TXHA 4AZ0A 4BWVA 4FB5A 3K32A 1Y5NA 4NJEA 2IBMA 5KJFA 1MRNA 2C7BA 4D26A 1PKEA 2XMCA 2QOEA 1X7ZA 1MLDA 1KXZA 4JIMA 4LSZA 1M6HA 2NUAA 3A2LA 3GLHE 4N5DA 5AXBA 1NMSA 1XVVA 4KV7A 1NBOA 3EQ6A 2F1JA 2X14A 3PTZA 5ARCA 3FTFA 1MH1A 5DCLA 1LDNA 3AF5A 4RETA 2X2PA 4LKOA 2DPXA 1GYQA 5I4IA 4IMIB 5EMNA 5B57C 5JQGA 1DRWA 4PG8A 1W1IA 1VHTA 3GFFA 1ZRHA 3A1FA 2P3QA 3COYA 2Z6AA 4D3FA 3ABOB 3Q3JB 5KDLA 3HZZA 3ZCRA 3WSTA 2WU0A 3HCEA 4KPFC 1JXQA 2IIVA 3VGPA 5JSHA 1C7FA 2EKLA 2BCEA 2DBYA 4YTEA 1ML3A 1Q92A 2YICA 5LQNA 5ALFA 4TSFD 1MP0A 4HQKA 4B46A 1U98A 2EHJA 4BYMA 5AM2A 1FDSA 2RH9B 3D8UA 1LTKA 3V4VB 4F4DA 4HKTA 4UE2A 2HV8A 1CY4A 2PN1A 3OE7A 4OP3A 4GKVA 1ZWKA 5F3DA 3U13A 3VZBA 1LUAA 4HN4B 3SCZA 4G1EB 5EKDA 4ZYVA 1ZJYA 2QRUA 3CSDA 5JH7F 3NM4A 5JS7A 1H2ZA 1T34A 3QU7A 3QLEA 4C89A 2PAAA 4E3WA 1DO2A 1TE2A 1FFEA 4LQCA 2Q4RA 3ADBA 2W2XA 1V7PC 4QG7A 1ZZEA 3HL4A 1J8QA 1W581 4KWCA 1EVYA 2P6OA 4JY7A 4UATA 4CETA 4LHXA 2A0FA 4HNUA 1DBQA 4YDQA 4QUHA 3FSJX 2EBWA 5SY6A 4OLFA 5TJ9A 1M2VA 1P5JA 3EZFA 1XVAA 4G89A 3ZDEA 4HFJA 1WJGA 1DQNA 1AKTA 1C9MA 2C83A 5FBWB 1QX3A 2XE8A 5CXXA 3ZJVA 4FFVA 4JN6B 1FNDA 1L9KA 3UJDA 1HDEA 1KYXA 2X5XA 3U1VA 2A5GA 3OTOB 2PGXA 4KI0A 1A7JA 1DKLA 3RVMA 5TQVA 1US8B 1JHDA 4PLZA 4RA6B 4O0MA 2A6PA 5CTJA 1KS9A 3UUEA 1O9GA 4BO4A 4GZ3A 3CURA 3FTPA 4FYVA 2XUHA 4ESVA 1F3OA 3TLAA 1R4MA 3JQGB 1RE0A 4JU8A 2DJIA 4CZ2A 3GNLA 5AVUA 2JFNA 3M3DA 3O92A 1B6GA 1M0SA 2Z04A 4Z4FA 3CG4A 4FCCA 3OOSA 3ED5A 1AK2A 3ABSB 3KTAA 3X1MA 1KVSA 4MS3A 3GLQA 3IAEA 3KO8A 5CR9A 4D99A 1RM4A 1RQPA 4K2AA 3T7RA 4CIYA 2X0RA 2PANA 2YL2A 5AW8A 2EW1A 1X39A 3TAHA 1W85A 4OVKA 1TKCA 2ZI5A 5CITA 2C4TA 1E6UA 5CVVA 2Q9CA 2FPXA 5EIOA 1V7CA 4DXHA 4XYLA 3WICA 4Q6WA 1ZNXA 4ND2A 4DIBA 5CM8B 4L73A 4FYXA 4LDJA 4JI8B 4FP9A 1NW6A 1V9LA 3ISVA 3K0CC 4KL8S 5BO5A 4OYRA 4KR6A 3O1IC 1Y8RA 1U7WA 2HF8A 4IUBS 3WC4A 2C7GA 5I8ZA 4NBNA 1Q0SA 3Q6NA 4QVKA 4AS3A 5H82A 1DSSG 2JGJA 3AR2A 4MEJA 4HZUB 5J4HA 5CFMA 1SCJA 3D4BA 2C97A 1ZMXA 5LQCA 2IHJA 4F46A 2Y99A 3W77A 1R6DA 3NGXA 4AY6A 1MZPA 3SG0A 4O3MA 3E3NA 5L3SA 1RXUA 1UH5A 4LXTA 2QD2A 2RMKA 2AR7A 3G17A 4U7HA 5AKHA 1XQVA 2OLJA 3DOIA 1H69A 5E6RB 5D7BA 1XYGA 1PR5A 2DERA 2OWEA 3L04A 1SXJB 2P67A 3U3XA 4DN6A 3AZOA 2KBEA 1V7QA 3BILA 4LOHA 1FLDA 3JWJA 1GUFA 1KK2A 3EDOA 4RPGA 1TVCA 3TM5A 2XLCA 5DGXA 3A3YA 3P9KA 1PRYA 1GZSA 2G7MC 4X1KA 5FPPA 5KPJA 5DGCA 1HY3A 3MSXA 3WNZA 5IT0A 1TEVA 2QD4A 2HPZA 2VFAA 3FOBA 3PENA 3VZCA 3V1KA 4HFRA 3QY0A 3E1GA 2BHLA 2FFJA 3LLSA 1S01A 3F6SA 2M1XA 3OAAA 2B8WA 4XJVA 4G8CA 1CEXA 3CPSA 4RH3A 1MG5A 1IAVA 4UHEA 3ZWOA 5MN5A 1XKQA 2VQ3A 5FWAA 4F1KA 4ZJYA 2ZGVA 3VJKA 1VRCA 5HQ3A 1WX1A 1LD3A 2PMBA 3JVEA 3N7UA 4AZWA 3R74A 3RYTC 2YZNA 3SIPA 1ZS9A 1F2VA 5AVTA 3LUPA 4LRXA 1FJHA 2J7PD 3I6IA 4R8VA 4FKZA 4FEEA 5JQGF 1YRAA 3N59A 3IC5A 4JELA 5AM3A 1BXZA 2AJBA 2C9CA 2C57A 3L43A 4UBJA 2W98A 5IFLA 1H65A 1ZUHA 3DZJA 5AJWA 1X8LA 3KZKA 3UO8B 2VIIA 1QFSA 5JRZA 1AQYA 1K4YA 2P8JA 3OPMA 3HG7A 4E33A 2ISQA 4RD1A 1OASA 2PRIA 3MWEB 2JHPA 4Y98A 2FPMA 3HXKA 1D6SA 3GLTA 3V8QA 3WDLA 3AEUB 4JEIA 1DAGA 2XNKA 3H4VA 1IMJA 3C7DB 3WGHA 2XUPA 4C0WA 2W71A 4YAKA 4JX9A 2G7ZA 1CR0A 2FF5A 4UM8B 4EKGA 1HT3A 4PXAA 2ZAOA 1QCCA 3QMPA 2RGRA 3R77A 1G6KA 4G07A 4YUWA 5B58T 3AG6A 3GAFA 5CDTA 2BR3A 3IP5A 4Q4AB 1JDVA 5IZCC 3E23A 1MC5A 2O0HA 2X5JO 3M3HA 5KVVA 4HGQA 3DOEA 2Y77A 1YB6A 4H6VA 5D5QA 2BELA 3RFUA 1AJEA 2D13A 1L4FA 1YBAA 4URWR 4G1UC 4BNHA 5FOSA 4OU5A 1V41E 2IYFA 3WOHA 4M99A 3EAGA 5F7OA 4HNTA 2I54A 3QXJA 3ZWYA 3JRWA 4DVGA 1XDBA 3LMKA 1DV1A 2NXJA 2GB4A 1RRCA 1NY6A 3N7AA 3GEEA 4N5HX 4O5OA 2EX4A 4YASA 1J0DA 5LU8A 5ILQA 1D7OA 1A9RA 2R47A 5LLTA 4YJFA 4X8MA 5U1PA 4P3YA 3VI3B 4DR6B 4OSEA 1O3YA 1BDJA 1EAYA 5DT9A 1UM9A 1KAMA 1P7CA 1P1JA 3PUZA 1ENOA 4FOSA 1Y9ZA 3D8BA 3OZWA 1E2KA 4JI7B 1MJNA 1R4NB 2Y67A 4RSMA 1YVRA 3N5KA 4W8GA 1QR6A 3C87A 3G02A 1J0CA 1WIWA 3GNSA 4EY3A 3E7XA 2QT9A 2ONCA 1V3VA 5K0FA 2WICA 2AEEA 2C2HA 2FV8A 2V8BA 3E6AA 1JEYB 4JLPA 3JVVA 3ZY4A 2QSJA 2FY8A 4MYCA 1AQIA 3O3OB 2NOAA 2X4GA 3FBGA 3FUUA 4MVWA 4RUKA 4L50A 1CZRA 4UXIA 4R69A 4TXMA 2OBNA 3JXEA 4OV6B 5A6VA 4KITB 1EGVB 2HIHA 3QENA 3G9XA 3SQXA 1SB8A 3GD5A 5ED0A 3NANA 2IP1A 4ZO8A 1M74A 1UMCB 4H7HA 1MAWA 4IGIA 3S6JA 4IDNA 2J33A 1O03A 1YVUA 3LKVA 3I4LA 1UJBA 2Q28A 4QPPA 1IY1A 1K92A 1E61A 2J3JA 3QK7A 1HE2A 4EECA 1PG2A 3GLKA 1OBHA 2A57A 1VZ2A 3AOGA 2ZANA 3IQZA 1SU4A 2BN4A 3E9ZA 2QSZA 4MWGA 4AWAA 1H2YA 3NIWA 4NENB 1C1DB 1DJOA 1I0LA 2G5CA 2SKEA 3K8ZA 1JIJA 3QBJA 3K31A 4WXHA 3FYSA 4OK3A 3UK1A 4ALJA 3EDRA 3QUSA 2IOHA 3I28A 5ALPA 1FU4A 4NHEA 2Q0QA 4XB2A 3EG9B 3O47A 5IBRA 4B4DA 4UHKA 2E5LB 2GK4A 3AHEA 4LSWA 4QOFA 4L27A 3NX4A 3MQ2A 2QRMA 1G59A 2CXHA 1L5RA 1YDHA 1Y1TA 2FX2A 2GO1A 4Z7QB 3RS0A 1S02A 3DAYA 3O84A 1PK9A 1ZKMA 4FE7A 5CDFA 1CRLA 3M8KA 6PFKA 1W0JD 5GGYA 3ZHYA 2WW8A 1MIOB 3PPYA 1G6HA 4XLLA 3WFIA 3B1JA 2HBYA 3OBIA 4B47A 5IU6A 3H19A 2O23A 1WKCA 3T7TA 2ODBA 3VAZA 1WB4A 4KIWA 2WHYA 2H06A 1JG6A 4L22A 4OKNA 4I19A 2OQ2A 2CBXA 3FLAA 2F7SA 3OJ0A 4ISCA 4LMAA 5AI9A 4PANA 5LDDC 1PJZA 4KKVA 4WNAA 3GRAA 5AVQA 1NUUA 5T6BA 1CRQA 2H5IA 1DTWB 4I14A 1CUXA 1QK3A 1ZOSA 4HBGA 4WZ6A 4XQEA 5AXDA 1W36B 1ZKDA 1H5UA 2BGKA 2J6CA 4KLAA 2AKYA 3S2ZA 3VZDA 3LT2A 3A6KA 1TAHA 1FFSA 3PWZA 4WBNA 4RJJA 1UPFA 4KG7A 5GTDA 1KOJA 1IU9A 2FUG1 3VR4H 8LDHA 2XTMA 1DCTA 4C43A 2QAGB 3L05A 4L74A 1WPQA 2DSNA 4Y6OA 1DDIA 1UBMS 4ESHA 4OXKA 5I7EA 4DWOA 4R1LA 1ZY2A 1HI9A 4HH3C 3HSSA 4AO8A 3O7WA 4IWXA 1LCIA 2LKDA 2QLMA 2HU2A 4NMHA 1B0AA 3ZV6A 1DUIA 5K2MA 3LC0A 4NBLA 3K9NA 1LJLA 4TPKA 1N1EA 4UTZA 3VOTA 4LOLA 2CHQA 1I32A 2FSUA 3K2BA 4C07A 2DFTA 7MHTA 3LKDA 2BMJA 2VVTA 3RASA 3NVDA 2EJBA 2FJ0A 3SSMA 5C5IA 2FFAA 4LYFA 4FFBB 5EXTA 4C0SA 4JJEA 2AOVA 3JQAA 1S89A 1FDUA 4RY0A 5FAKA 1BX0A 1E79D 3LL4A 1PWXA 3OTHA 3A28A 4QQ8A 4UBMA 5JSUA 1RJGA 2YWBA 1AO3A 3ONWA 5AJHA 1GPBA 4P54A 3TI7A 3BRQA 3TIGA 1IQ0A 2W0SA 3KD3A 2BFDA 1GLNA 1NPDA 4UOQA 5DW0A 2A0WA 1JQKA 1L8LA 2ZVJA 1COWD 1RCTE 2HIMA 4K7JA 1YZUA 2YZKA 3CMCO 5AP9A 1MW9X 1Q91A 1U94A 3DEKA 3HA7A 4FB4A 1RAIA 1KJJA 3GN2A 3SMVA 2CV1A 4JLUA 2WVHA 4BO0A 1E7YA 5IAOA 3GJ5A 3L7KA 3EOZA 5E6SA 4BLWA 1EFPA 4IQGA 3OF2A 2R0QC 4BVGA 2B7CA 5ICFA 1PL6A 2W70A 3DCNA 1XYVA 2PPVA 3F6RA 3BMNB 4JSTA 2XT9A 2HYDA 2P0EA 2I7VA 3N8HA 1R0ZA 1JFSA 3ZK7A 4XUGB 3GR6A 4CL0A 1IWBB 1Y4UA 3WK6A 2ZRHA 4NK5A 5K0ZA 4HFNA 2DR3A 2YXEA 4ZAVA 2OG1A 4MVJE 4QFMA 5ALQA 5C34B 3TNLA 2VBCA 4M0EA 4KQ2A 1U2RA 4X7MA 4F85A 1PBNA 1MGOA 1T8TA 5I9MA 4DV1B 1OFTA 3WK8A 3BJMA 2AN1A 3GJQA 4F7DA 4BUCA 1G8AA 1M0TA 1QE0A 4P7FA 4H3VA 4OQQA 5AW0A 4O2AA 3IGFA 3HVKA 2OENG 3QJ5A 5CLGA 2H1FA 5LQRA 1YC5A 4OUKX 4HVAA 3PXUA 3G82C 1XCOA 5K3EA 1P73A 3AJAA 3Q3EA 2HD4A 4OP2A 2II6A 4B73A 1NW8A 2TS1A 2X6QA 2QP9X 3FPHA 3SJAA 4IJWA 4BO6A 2Q2NA 4QOSA 3URMA 4TTIA 4E7PA 4EJ6A 3AZQA 3HV0A 3E81A 3VDMA 2O2GA 2YUTA 2Q6IA 4K40A 4JOSA 4NBKA 1V16A 4GF5A 1TD1A 1NL3A 1K2WA 3H5TA 1TGVA 1SG6A 1F38A 5GGXA 3I2GA 1U2SA 4B6FA 4JXJA 4L9AA 4R3UC 3X1JA 3W2EA 5CFPA 2PMKA 4FNOA 1L7DA 3WBFA 1JA1A 2WIBA 4TMTA 1P4HA 5BMVB 2L82A 1GM5A 1H5QA 3E35A 2LDBA 2VEOA 1SQ6A 4RMHA 2WOOA 3V6LA 1CF9A 1OJ7A 3HK2A 4TXNA 1FQJA 2D59A 5DNEA 3VPFA 3QX9A 2JFQA 4W5JA 1NWHA 4L75A 4ZI7B 4LQLA 2YNMD 3T1YB 3SX0A 5J1TB 5JAHA 2DY1A 3H2BA 2UYQA 4W7SA 1QO7A 4XGQA 1IM8A 2IA5A 4U7GA 4E2YA 3AVVA 1ECPA 2V96A 2XB4A 4GLOA 2GZMA 4FOTA 1ZGHA 2P1DA 4MYSA 2IXBA 2YWXA 4C21A 3RAFC 1LU9A 3U5TA 1TF2A 4ZK6A 4MUNA 3RNLA 2YHBA 3A0RB 1H6DA 4LVCA 4ILEA 3ZWKA 2WPDA 5DXFA 4JOBA 1KK0A 1UCFA 1QZZA 1WHSB 2QW8A 3IQHX 4Q3CA 3Q6MA 3FTDA 4P53A 1G8GA 5F77A 5F5LA 2P9YA 1DBWA 4RMNA 1V5FA 2V59A 5JO0A 4WBNF 3PP8A 3Q7TA 5C46F 1ZIDA 2G1PA 1YR6A 3OAAD 1VGRA 3PXAA 4Q9HA 5A4IS 2FEWB 3M82A 3QNUA 3TMAA 1E3EA 4C87A 2I2AA 2NNWB 2XITA 4DT1B 1HFJA 2BFAA 3M2TA 2R4UA 3ZNNA 3GFGA 2XZOA 1RC1A 1HTBA 1T4CB 2ZM5A 5GJWC 4HLUC 2EEPA 4GUDA 1SCUA 4UDYX 5CVEA 3TLXA 1GA6A 1D2CA 2HNAA 3GIDA 4QOEA 1SURA 1ZWLA 1H8EA 3MTBA 3TW4A 5EKTA 1GA1A 2IOYA 3HM2A 3ABQB 4CM1A 1PT7A 2GPAA 3TOSA 2HC9A 3ESZA 5A04A 2ZBUA 2AFHB 3NCTA 3L1JA 4X45A 5JARA 3QP9A 4F4JA 4OHVA 2RGXA 3TEFA 3DTYA 4DLYA 4QNMA 3T52A 2JLAA 3DVLA 3VSEA 3NWBA 1OVMA 3IIMA 4RGBA 4B6GA 2AFIE 1GXSB 3N2LA 1C4OA 1QBGA 3A25A 1Z47A 2HSJA 3LX6A 4RJKA 4XEHA 2A35A 5DKFA 3C85A 3DOUA 1CY8A 5CD1A 2JLVA 3ADKA 4EEXA 3TNJA 3PYXA 3W3AH 4F4IA 5KWEA 5EWMB 1TVEA 4LNHA 4H0NA 3UKJA 4X20A 1W44A 4BEBA 4CMJA 3H5LA 2IHKA 3C8ZA 3EGXA 2ZI6A 4RTPA 3EDQA 2PQ0A 3TFQA 4JLDA 3KSUA 2FCRA 1J22A 3CQ9A 1JTEA 1PR1A 4F06A 4YRGA 1EK6A 5FTNA 3WIEA 2R8OA 4EHKA 3RSGA 2BT4A 3D8RA 5HCNA 2IL1A 2Z3WA 4NZNA 2JJ8A 3I8XA 2MYPA 4NEGA 3KYDB 1DHTA 3LI2A 3UGQA 3DDWA 2EKPA 1R6UA 2BI8A 4UUPA 1NDUA 5FTMA 5FFNA 4DQDA 2IELA 4RF3A 5BR7A 4MGEA 1Z0AA 2BKVA 2MMGA 3M83A 3RJTA 1YS1X 3O31A 1Z17A 1UMDA 1ES9A 3HKDB 3MCZA 4H35A 5K05A 3UJAA 4B74A 1A9QA 1T1SA 2MYNA 3C1TA 1TW2A 1XEAA 4F6LA 5KIAA 1DCFA 4M1EA 2RCNA 2F4VB 3N58A 4KDCA 1RWQA 2QSYA 2H51A 2Q7OE 1LY1A 1IN7A 1FY2A 1MO2A 2C3UA 2GCPA 2P30A 2PZKA 3AIOA 3CVOA 1T4GA 2ZRJA 3G2KA 4OHKA 4G1MB 4PNPA 3U31A 5CCBA 4O2AF 3KZ1E 2OFFA 1GRNA 5HA5A 1HFWA 4CIDA 3QKRB 3AIKA 3DV9A 3HU3A 3OZCA 1ZYUA 3CLKA 2CVHA 1NU6A 1OLUA 4KMRA 3ODGA 5BSFA 3U3ZA 1WHTB 2OSVA 4NJOA 4RYDA 5CT4A 2WM2A 5JJBA 1GNPA 4OLJA 1UBUS 2LV8A 3FWZA 4KFTA 1JPNA 4TL6A 1Z33A 1E32A 2F43B 2CHVA 2HRDA 5DRYA 1ECCA 1MX1A 2OILA 3M6FA 3P71T 2H2WA 1F5NA 3BAZA 4WZAE 3RVDA 2G3YA 2VLIA 1ZIOA 4ARAA 4GICA 1C9DB 2KX7A 2OCKA 4OYLA 3DR3A 3IA2A 1I9CA 1RKQA 1K7CA 4DG5A 5H02A 3VKFA 4B9AA 4BQOA 5HIKA 1ESZA 1FBTA 1B6RA 3UHOA 3FHTA 4KNWA 3H05A 4X6YA 1RJ9B 3QEOA 4QBKA 1GU0A 4N65A 4HDSA 4V24A 1BAPA 2ZQYA 3T7AA 3UQZA 4ITUA 1SVOA 1R8QA 2OHVA 2HCFA 3NDPA 4BX0A 3ZU5A 4B3CA 4KTVE 5B7NA 5DIFA 1V48A 1OF1A 1N6NA 2W90A 1DCMA 3DL7A 1VJCA 2CB9A 3IR7A 5EJEA 2ISSD 1NQTA 4BNGA 2JFOA 2D0OB 5AD1A 1V3TA 5CCEA 1U99A 3V80A 1FSSA 2QUZA 1U1EA 3JWHA 4DXDA 3KP1A 4A0RA 5DHQA 3T0FA 3OTWA 4OXIA 4XVQA 4YCDA 3W9SA 2VDWB 4N9WA 3RSHA 4MMZB 1TADA 1VDZA 2GF0A 3K0CA 1KAQA 4KXLA 3W06A 1HQKA 3TOVA 1HLDA 1JLSA 1XQ1A 3BFXA 3PKZA 3L0CA 1XQYA 2VPYA 1IE3A 1UBJS 1M1YE 1MOPA 4HNHA 5E9JA 3TLKA 4D5EA 4DV7B 2ZZMA 1UJCA 5D3KA 3RKUA 2WV7A 3BWYA 6ADHA 4I1PA 1CY7A 2LCIA 4TT8A 5DX8A 2VXOA 4YT2A 2OZPA 2X1MA 1J39A 1ZAKA 2RHTA 3OHPA 4JC5A 5REQA 4I4LA 1DTSA 2WMOB 3GMIA 1Q95A 4CFSA 3RWOA 2V0CA 3AI1A 1NA5A 2FMUA 5KAPA 2WG1A 1Z8NA 2WFAA 4BY9E 5EUCA 4I1VA 3DP7A 3UJ7A 3VRHA 1J5PA 3RYHB 1JECA 5BN4B 1JQEA 2Z1MA 2YC2C 3L18A 4L0MA 2AMLA 5IG2A 1JALA 2FPUA 3DUFB 4IQ4A 1RZUA 3KFXA 2FUEA 1MT3A 1P5HA 3FVWA 3TQRA 1XAJA 2OY0A 5A03A 2D2XA 5EIFA 4XIYA 3FTEA 3BKXA 1DU4A 1ZD4A 3NIBA 3HYCA 1IG3A 3BERA 5K09A 2BGJA 4IZHA 2AVDA 2QXYA 1N6HA 4QNNA 4ESEA 1GWNA 3YASA 3UJCA 1KJ8A 1SBIA 3AU9A 4FGZA 4AF8A 4O3FA 5T64A 1ISRA 2NTYC 4B7ZA 3KQQA 2ANBA 2G4LA 5KYKA 1QGYA 5TEWA 1H9BA 3T3GA 3H87A 1G291 4QQKA 4BUZA 4URZR 3DZFA 4ZCSA 2GVDC 1FNSA 1LSOA 2GTPA 3L5KA 3QX8A 3U7IA 1PUXA 1Y63A 4IIYA 4IJUA 2CD9A 3WZLA 3MRVA 1SKYE 3KAPA 4DV6B 4NCAA 3X1DA 2Q5CA 3G79A 1GV0A 1OIVA 2ZI3A 3RNOA 1E1CB 2CFOA 1KYVA 2VTBA 1RM3A 1JI0A 2AG1A 2H2FA 2RGYA 3ONEA 4YV0A 4BZWA 4C03A 4HUTA 5LJLA 5AI5A 5KVQA 5TVGA 1R50A 5CNMA 2G0TA 5FIUA 3BB3A 4IFTA 4PSDA 2QLNA 3AETA 1T2FA 4TWAA 3BSFA 3MT7A 1NQVA 2XSZD 2QX4A 4ER7A 2GKOA 1WXWA 1PEDA 5IASA 4GVLA 3RSQA 4D57A 4EGCB 5B7PA 1LFAA 2JZNA 2VYVD 2YQ5A 3U3DA 1KKUA 4R71A 1ZD2P 3U7RA 5IWCA 1AZWA 3CZCA 3KJEA 4J2OA 4EG7A 3DQZA 3O8NA 3MTIA 1GPYA 2NTJA 4EGJA 1Y6ZA 1V43A 4IS2A 3UWKA 2GVNA 1T6YA 2CXSA 2VJCA 2H1IA 4WLUA 1WRBA 3EC7A 3K6RA 3SMQA 2VQEB 3VH3A 4BNUA 3IUYA 3I1YA 3PL5A 1W6RA 1WW3A 1BC5A 4CYMA 2VRNA 3T1HB 4EFLA 3VNVA 2OA0A 2NUTA 2FWRA 3T9EA 1KH2A 1QWOA 1ICEA 4UDNA 2O0LA 2CZCA 2IY9A 2YHUA 4W5WA 1O57A 1O87A 1NXWA 3GV0A 4EGQA 3EXEB 4X94A 2GXAA 1FPMA 4II3A 4YJGA 1OA1A 3ONVA 3OJEA 4Y2JA 2WU3A 3U4DA 2GCEA 2YV3A 3VC3A 1VL1A 1PT8A 1ENZA 2FW1A 5TPZA 2HRBA 3VDQA 1W93A 3ZJYA 1H9CA 3B1XA 1JDNA 2FHPA 5KKNB 4Y9RA 2A30A 4M1WA 3EIEA 4AJKA 1CEQA 4EMTA 5DTMA 1X2EA 2QN3A 3AF2A 3AQ4A 3D8HA 1I0IA 5KNCA 1IY8A 3GVXA 3NM5A 4UMFA 4Z3DA 1T6BY 2ZBDA 4I6EA 4AMZA 4Q7QA 1XA4A 4AG6A 1EVEA 1T9GS 1M0WA 2HU8A 3TLJA 4TYPA 4HVCA 3DZKA 3ZOKA 1USVA 1LK0A 2AS0A 2AWNA 4GLJA 4HSGA 2QX8A 4IQ8A 4AXBA 1GAJA 4FM9A 4ZYYA 5L7YA 5IJ0B 1UEJA 3S68A 3RRZA 4URUR 1JWLA 3Q0IA 1ZJJA 3WQBA 2GLUA 3CZAA 3PFCA 1BRTA 3L0YA 4MRMB 2IZOA 1I7LA 3NJ8A 3T54A 2B36A 5HZGA 3E5NA 2RARA 5DN9A 1V2GA 3ZHSA 2IBSA 3N70A 2DBRA 1X1BA 2AXNA 2NV2B 4XCXA 3U16A 1FK8A 3FOWA 3TK1A 4HAWA 5J2UF 2QRVA 3EZNA 2VDQB 4FI3F 2EVWX 3RM3A 1Z7YA 2I76A 4B80A 3KQOA 3I58A 4ETNA 3FMOB 3I8SA 1V6SA 1LPMA 4CN8A 1ORWA 5K45A 4OM8A 4PIPA 4J7UA 4Q9LA 3RIHA 2BWJA 4FHDA 4RZQA 1QAOA 3ANLA 1YBVA 2E21A 4M49A 3VISA 4D9HA 5K7SA 1M2OA 1XMPA 1NMEA 2BZ1A 2ZDQA 3IVAA 3N87A 3P2MA 1G2QA 4QHTA 4XSVA 3RO7A 3T5DA 4E31A 5JWRA 1Z4NA 1LRLA 3UMGA 2DKOA 5LOVA 2OMEA 3QVTA 5E6UA 3OICA 3IQIX 2W6QA 4P86A 4BB6A 2PS1A 3ZU3A 5EESA 2PLWA 2QM3A 2QR2A 3BXFA 4M8LA 1KEVA 1Y34E 1QQ7A 3ANYB 1OXUA 2QEQA 3KAKA 4RZ3A 2NVUA 2Q6LA 4D3ZA