2QM0A

Crystal structure of bes protein from bacillus cereus
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
271
structure length
261
Chain Sequence
NTTVEKQQIITSNTEQWKMYSKLEGKEYQIHISKPKQPAPDSGYPVIYVLDGNAFFQTFHEAVKIQSVRAEKTGVSPAIIVGVGYPIEGAFSGEERCYDFTPSVISKPWPKTGGAHNFFTFIEEELKPQIEKNFEIDKGKQTLFGHLGGLFALHILFTNLNAFQNYFISSPSIWWNNKSVLEKEENLIIELNNAKFETGVFLTVGSLEREHMVVGANELSERLLQVNHDKLKFKFYEAEGENHASVVPTSLSKGLRFISYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BES
publication title Crystal Structure of BES from Bacillus cereus.
rcsb
source organism Bacillus cereus atcc 14579
total genus 84
structure length 261
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qm0A01
4BB0A 4G1FA 3WIOA 3SX4A 5LZ8A 3UUEA 4QDUA 4Y2QA 4EY6A 4LXHA 4MEBA 4L3WA 2WUFA 3V1KA 2AXEA 4C4ZA 5JATA 5I8PA 3PUHA 4UHBA 4XVCA 5DYYA 1L7AA 4ROTA 3I2GA 1CUEA 5ALRA 2WSLA 4PO3X 4RPCA 4KAFA 3RK4A 3WK5A 3CCCA 4KE9A 2WILA 2WU4A 3I2KA 3G0BA 1LNSA 1AKNA 2XB6A 3H0CA 2OGSA 3SK0A 1O6GA 4DSAA 1JJBA 4J0HA 1OCEA 1QIGA 1XRLA 3I2IA 2XUHA 2WJ6A 4G8DA 5AKIA 4XIIA 1E89A 4FBLA 4N5IX 3IB3A 4G9GA 3WWOA 1FFAA 2WUDA 1DTEA 1Q83A 1JU3A 2PSJA 1NU8A 1J07A 5AI5A 2VATA 1UK7A 4JEIA 1EVQA 3IUMA 2PUHA 2VJAA 5BWCA 4UHEA 4QA9A 5CT8A 5LKAA 4CIBA 3W2TA 1FFEA 1ZJ5A 3WWCA 3I6MA 3ILSA 2HM7A 1GKLA 4S0XA 2XI4A 4LXIA 5A71A 4MEAA 5AH0A 3VVLA 2QVBA 1D07A 3FYUB 2Y2UA 4B83A 4KRXA 2HA7A 1VE6A 3C70A 1EINA 5EIHA 2XMRA 3FLBA 4KRYA 3O9MA 3T52A 3DQZA 5LIPA 3ESCA 5JASA 2B61A 4NZZA 3RM3A 3I6YA 2K2QB 3BJRA 1XRMA 1YB6A 4UBOA 1PFQA 3LIPA 4B7ZA 3VISA 1E3QA 3QZUA 1X2BA 5AKZA 1HBJA 1BCSA 1EB9A 5DWDA 4AO6A 4BYMA 5HQ3A 2XQGA 4KYVA 3K9BA 4I19A 5JZSA 1J06A 3FSGA 1UK6A 3EQ7A 4J0CA 4BC1A 1EDEA 2JGFA 4AN0A 2XMBA 1SOMA 1CUXA 2OGZA 5T4HA 1JJIA 3G8YA 2HL6A 1CUIA 3MVEA 3WL5A 3G0CA 2YASA 1HLGA 1AGYA 4J3JA 5JADA 3PICA 5EHNA 5DTJA 1CIJA 4Q82A 4Y7DA 3D59A 2ONCA 1Q0RA 4JYMA 3EBLA 4UHDA 2HU5A 2H9YA 2WFMA 5D6OA 2XLCA 5CRIA 3V1LA 4FBMA 4OU5A 3AJAA 4AO7A 1K5PA 2OQIA 2XUDA 3FLEA 5LZ4A 3VJLA 1JT2A 5HF9A 3VJMA 4ZREA 3HSSA 5ALMA 4WFKA 4H7DA 1DX6A 3WWEA 4P93A 4QDXA 4HXEB 3E4DA 1QIMA 3QM1A 2AJDA 3WL6A 4Y9SA 4MXDA 4BVKA 1CUSA 1DT5A 2HHAA 1QIIA 1E66A 1CUDA 1WM1A 3WJ2A 3D2CA 3X3HA 3FSGD 4IHAA 3E1GA 3H2IA 1XZBA 3O9VA 4H7HA 5HQ3B 5ISMA 3QPDA 2GYVA 3TGLA 3ICWA 4J0DA 4M0FA 2XMGA 5AKYA 5BWBA 1CUWA 4HXFB 4BAUA 1F0PA 4CCYA 3FLAA 4P08A 4MYSA 4F5ZA 1IUOA 2ACKA 4M0EA 5FPQA 4AB1A 5ALYA 4AMZA 1RYYA 4YASA 2QXTA 4ZGBA 1CUYA 5A62A 2XE4A 3WQHA 3U1TA 1E8DA 3OC0A 1UOOA 4OPMA 1XZAA 1I6WA 3BIWA 4BE9A 5H3HA 5FOQA 5LZ5A 1TCAA 5DJ5A 5DTIA 2CMFA 3FWHA 3DJYA 4B80A 1EDDA 3I6ZA 3UMJA 4H7FA 4PSCA 4CIAA 1JI3A 5ALEA 5K3BA 1THTA 4X6UA 1LPOA 2ORYA 3NUZA 2XMDA 4Q1VA 1C7JA 2O7VA 3MGAA 5ALKA 2AJCA 1O6FA 3PFBA 4GEGA 1VE7A 3H2GA 1UKCA 2IITA 3OM8A 5K5EA 3WKAA 1CUAA 4G9EA 1LBSA 2JGLA 3LCRA 3JW8A 4E15A 3DDUA 4DYHA 2GYUA 1J2EA 3MUNA 5DYWA 2R11A 5SYMA 2BKLA 3WYNA 1MX5A 2Z3ZA 4G8BA 4NMWA 1LPPA 1QONA 4IQ4A 3L1HA 5JAUA 1QE3A 5ALFA 4DM7A 3HZOA 5AK5A 1R4ZA 1CV2A 2PPLA 3HI4A 3GUUA 5ALTA 4EB0A 3BE8A 3I28A 4FHZA 5LZ7A 1ODTC 4X90A 3VDXA 1F0NA 4FOLA 4H18A 3GELA 5HK8A 1XZCA 4WDRA 4CCYB 1U65A 3HEAA 1AQLA 4U2FA 3IDAA 1VLQA 1THGA 3M3DA 2ZJFA 2PVSA 1HKHA 4HAIA 2JIDA 4K6HA 4DNOA 4BTLA 4PV7A 4ZRDA 4MWSA 1BEEA 5AM5A 4CFSA 1QJ4A 1MJ5A 4TVKA 3R3VA 5A2GA 1FSSA 2V96A 3D4LA 4BZWA 3G9TA 4I3FA 5ALHA 1UWCA 2QJWA 2PBLA 2QZPA 2Y6VA 2J3QA 5AM4A 4B0OA 1CRLA 5BV7A 4WFIA 1EDBA 1UOPA 3W9UA 1B6GA 4FTWA 4GECA 1ZD5A 3LIIA 3DOIA 3I1IA 2OG1A 1AURA 1DQYA 2QOEA 5A6VA 2P8SA 1UK8A 1QFMA 2XMCA 2WIFA 1CPYA 4BDTA 4N8SA 1ORVA 4EY5A 1LPNA 3FYTA 1W1IA 4WFJA 3O95A 2IX9A 4G8CA 1A88A 5JYCA 3E0XA 4HXGA 2DCMA 3ZPXA 2PSHA 1N1MA 4BCBA 4C4YA 1AMNA 1ZD2P 3KDAA 1MNAA 3CCBA 3HACA 5JD4A 2VJDA 2ROQA 4F21A 5AM1A 1QTIA 3OPMA 3DEAA 2QXUA 3AZQA 1CQZA 4U2EA 1C7IA 2J4FA 4QZVA 4OCZA 3ZWQA 5K3EA 1K4YA 1RWQA 1ZIXA 2AJBA 4GW3A 4C01A 2VTVA 5HKAA 4X6YA 4X85A 2WU3A 4UBMA 5K3FA 2UZ0A 4EY8A 2DQYA 2FUKA 3FYUA 2FJ0A 5EI5A 2OXEA 4C6HA 4DMHA 5EHXA 2WKWA 4N8EA 4ZI5A 1N5MA 2DFPA 3D0KA 1UKAA 3OG9A 4X91A 1ETHA 1K8QA 2WFLA 1PJAA 2HDWA 2XQKA 1VOTA 5K3AA 3R41A 3H2HA 1DT3A 2CZQA 3QH4A 3DOHA 2VSQA 4QLAA 3WZMA 5JANA 2C7BA 5AI6A 2QJRA 2FX5A 4YPVA 3PDCA 5FV4A 1XZIA 4K5QA 2Z3WA 1FFBA 3R3ZA 3FAKA 3QYJA 3F9CA 1BCRA 4BP8A 3SWWA 2RIPA 1TCCA 5LLSA 2XT0A 4CG1A 4YX9A 1A8UA 1LBTA 5ALJA 4Y2TA 3R3YA 2VJBA 3Q8WA 2OLEA 5AJHA 3IVMA 4E11A 4UPDA 3HRHA 3EQ8A 3L1JA 2LIPA 2HIHA 2BUCA 4GWLA 4WY8A 5D3KA 3FVTA 3BIXA 3P2MA 5AM2A 1XZFA 2RAUA 4BP9A 4KJXA 4EHBA 5JD6A 4O08A 4X71A 5FKJA 2I3DA 2VAVA 1LPMA 5J3JA 3H1AA 3V1NA 3IIIA 4OD0A 3KSRA 2HA3A 3UUFA 1ZJ4A 2WHQA 2WTMA 2XMQA 3EQ9A 1EVEA 2XMSA 5ALUA 4BATA 1TCBA 4OSEA 1GZ7A 2D5LA 2CEKA 3AFIA 4AZ0A 1GGVA 4UUQA 2AJLI 1BRTA 2FJPA 3QITA 5ALWA 3O4GA 3QMMA 4L9AA 5K3FB 4B84A 1XROA 5IVHA 4AQDA 1A8SA 3NOXA 1XQYA 2WUGA 2XUOA 4K2AA 3AZOA 2EDAA 1HL7A 5AKKA 1ZI6A 1VXOA 3C43A 3A6ZA 4UHFA 3C6ZA 2PX6A 2WFLB 1HPLA 1MNQA 2WIJA 1WCYA 2OQVA 1Q84A 1DQZA 3IUNA 1N8SA 4BVLA 3PF9A 4HTAA 2WLSA 5CXUA 2OGTA 3HABA 2XQFA 2C4HA 2C0QA 5CBKA 2XUFA 2ECFA 3GROA 2HA6A 1QZ3A 2BAGA 4XX1A 4QWWA 3M82A 4ARBA 3ED1A 1ODSA 5D7BA 3S8YA 3KD2A 5DLPA 1H2WA 4UFPA 4BVJA 4FKBA 4C89A 1XZHA 1XRNA 1CR6A 1CEXA 4WJLA 4PF1A 1E8NA 4B9AA 1XLVA 1BN6A 3STWA 3ZV7A 3HJUA 3G0GA 3BJMA 1EA5A 2JGKA 3KWFA 2BJHA 1GPKA 1HQDA 1GT6A 2QT9A 3BF7A 1Q0ZA 1DWOA 1Y7HA 5LZ2A 1ZGCA 5EIAA 5EFZA 3QPAA 4PNZA 2CBGA 2WHPB 4B9EA 4ZWNA 4FFVA 3AIOA 5HF6A 4Y2RA 1DWQA 4EZIA 5FDFA 2O2HA 5HK9A 4RE6A 3G9UA 3SC2A 3D3NA 4W9RA 2WHRA 1XZJA 3WK7A 5HCUA 4E14A 1XQVA 2HADA 2GZSA 1AX9A 4J0KA 3WMRA 3HYSA 3WKBA 4H77A 1X70A 3WYDA 5JARA 2DHCA 1ZICA 4DLNA 1YA4A 2ZJ7A 5KWJA 1MAHA 4ARAA 3HLKA 3D2AA 3FVRA 3WZLA 5ALVA 4IH9A 4U2CA 3RKSA 4DNFA 1XQXA 4CG2A 1CVLA 3WK8A 3AINA 4U2GA 3DKRA 2C5GA 3IURA 2WTNA 2BGRA 2JGIA 3FCXA 1LPBB 4UBIA 3ESAA 3WIBA 1QO9A 3OOSA 4W1QA 1PV1A 1CUZA 1R88A 1UZAA 4P9NA 5AI4A 2BFNA 4UBNA 5AOBA 1XLWA 2HA5A 2HRQA 4W1RA 2B20A 3DD5A 3AIMA 3TJMA 1E8MA 5ALXA 2RI6A 3QPCA 1FFDA 4H35A 2WIGA 1SCIA 3H1BA 1YASA 3FCYA 2WG2A 1P0IA 4UFNA 1YAJA 4UBKA 3QVMA 1XLUA 1EXWA 2C58A 2PSFA 4Q05A 1XZKA 5CT4A 2PL5A 4DGQA 1N5RA 5CW2A 3AZPA 5ALDA 3WK4A 4B85A 3ZLTA 2XQJA 4EY4A 2HU7A 3DYVA 1QIEA 1JJFA 2WM2A 1CUVA 5AKHA 4LXGA 5IVKA 3ICVA 2DR0A 1DU4A 1SCKA 4E46A 3YASA 1QTRA 5AK6A 1T4MA 1P0MA 2YYSA 2VEOA 1YS2X 4H7KA 3C8HA 1KEZA 4V2IA 3OURA 1H2YA 4X95A 1ACJA 4JUIA 4BZZA 1LZKA 4HRYA 3DKKA 4OU4A 1QIJA 1TKRA 5A7FA 1BE0A 1H22A 1LZLA 1MO2A 1U8EA 1LPAB 1C4XA 5FUMA 1CUGA 4PQEA 4KR0A 2Z8ZA 5T4BA 5T4EA 2EDCA 3KXPA 3DLTA 4PW0A 1WOMA 4QLOA 5HF5A 1BS9A 1W75A 1JMYA 4J0IA 4FNGA 2BUBA 2HRRA 3C5WP 1JMKC 2WQZA 1VZ3A 1ISPA 2W6CX 2GBIA 3QMVA 3AIKA 3R3UA 1MN6A 3R3WA 3WKCA 2CUTA 3GZJA 1XRPA 2WG1A 1GKKA 5K3DA 5C8XA 5ALNA 4BBZA 1YAHA 1XRRA 1AZWA 1ZI9A 4G5XA 2X76A 2OAGA 2HA2A 4QE3A 1W4LA 2X5XA 3ANSA 3E3AA 4YK7A 2OCIA 3ZLVA 1WHSA 5KBYA 1MX1A 2Y6UA 2WJ3A 1ACLA 1QOZA 1MTZA 1NX9A 4KE7A 2XUPA 3I2FA 3DCNA 1JU4A 2XUQA 5AI8A 4EY7A 3W06A 4P92A 4D9JA 1KU0A 1HDEA 4MYDA 2VJCA 1U4NA 4Z49A 2ZYRA 4I4CA 5CH8A 4ZXFA 3GBSA 4QNNA 1A7UA 1OILA 3C6YA 4FLFA 5HZGA 5JAHA 1YCDA 3W9BA 3O4JA 5ALZA 2Z5GA 4Y2SA 4Q34A 4NVRA 1CUJA 5CT9A 2I78A 3A70A 3Q0TA 1MU0A 2XUAA 3BDVA 1RP1A 3F8SA 1CUHA 4B6GA 5EHQA 5AHXA 5IVDA 1XRQA 4CG3A 1IMJA 4FLEA 2VA9A 1XZLA 4KAJA 2PM8A 1QIFA 1UOQA 1KU6A 3VKFA 1FFCA 4DMCA 2X8BA 2JEZA 2RHTA 3PF8A 1MT3A 3RARA 2JGMA 2GZRA 5ALGA 4HVTA 3F67A 4AXBA 2C0PA 1UXOA 4LYEA 1YSCA 4C4XA 1M33A 1TQHA 1YR2A 2HA0A 1YB7A 2XMZA 5AI9A 1FJ2A 4GDMA 3R40A 3GA7A 2V97A 1ZIYA 5ESRA 3FYUC 4H7JA 4MJ3A 1MPXA 3EF3A 4Y2JA 4Y2VA 5FXMA 5DNVA 4J03A 5AKGA 2VQ6A 4A5SA 3TRDA 3JWEA 2HFKA 3WK6A 1CUBA 4JH0A 4UBJA 4JYPA 1L7QA 4BDSA 3K6KA 4U2BA 2B9VA 5HF8A 4BCCA 4BAZA 2Y2VA 4ITVA 2HFJA 3WWDA 2C5FA 3PI6A 2WIKA 5JALA 1VZ2A 2OCLA 5K3CA 3STXA 1WB5A 2BCEA 5AIBA 4IO0A 1WB6A 2GBFA 4HZGA 3DYIA 2Y1KA 4OB6A 5AKJA 2BUAA 1QGED 5AKLA 5C81A 1IVYA 4Q3KA 5AM0A 4XJVA 4Y2YA 4OYLA 3STUA 4FDMA 1XZDA 2O2IA 5E2IA 4X97A 5CH5A 2DHEA 5AI0A 4TGLA 2G5TA 2YXPX 4A16A 5F4ZA 1H2XA 2G63A 1CFJA 1BROA 1WPXA 2CB9A 4KACA 3TEJA 2JF0A 5JIBA 5SYNA 5AOAA 4H7IA 1EX9A 5I7UA 4F60A 5AP9A 4DMFA 1XKLA 3EIOA 2WHPA 3V48A 1LLFA 3WA7A 1DWPA 5AM3A 4LHEA 1BN7A 4X7BA 4B0PA 2JEYA 4MQMA 4UHCA 1USWA 3QMWA 1JKMA 2NW6A 5CMLA 1IUNA 1AUOA 5AOCA 5AK3A 3KOOA 4EUSA 1EH5A 1K6EA 2QTBA 1ZGBA 3B3QA 1SCQA 3BXPA 1QO7A 5EIEA 4PSDA 3L1IA 4AMYA 4OYYA 4NS4A 2O2GA 3G9ZA 5AICA 4KE8A 5AK4A 4XWGA 1QIHA 1CUCA 1R9MA 2QUBA 4QWMA 1WPRA 5JAPA 4FMPA 3DL7A 5ALLA 3FNBA 1B41A 1J1IA 3FOBA 4N8DA 1XKTA 4IH4A 3CN9A 4ZV7A 1CUFA 3C8DA 4RGYA 2QMQA 4DMKA 5CT5A 3HXKA 5ALQA 5LZ9A 1EK2A 2G4LA 2PU7A 2AJ8A 3NGMA 1L7RA 2H1IA 3C6BA 4FFWA 4W1PA 1Y37A 1QFSA 4QDZA 3O4HA 3C6XA 1EB8A 2R8BA 4X93A 1G66A 4KEAA 3C45A 2QRUA 3WL8A 2WG0A 3ZLUA 4M0MA 5D3ZA 5EHZA 1G42A 4KE6A 3A2LA 1XZMA 3VJKA 3H17A 1VA5A 1F8UA 4GLBA 2ACEA 4OUKX 1U2EA 1WB4A 2I03A 3WA6A 3QBJA 4ZV9A 3H2JA 2O7RA 5T4FA 5CT6A 1ZI8A 2WFZA 2H7CA 2GBGA 1CUUA 2H7XA 3C87A 4FNMA 1YA8A 1G5FA 4QDOA 5HFNA 1W6RA 3HC7A 3IBTA 3W04A 1ODCA 3IUQA 1GQRA 3AUKA 4U2DA 2VAXA 5C8VA 2HA4A 1UKBA 2V9ZA 1UT6A 1P0QA 2I3ZA 4B81A 4FLMA 1IUPA 2XUGA 4DNPA 1CQWA 5AO9A 3VVMA 1WHTA 2Z8XA 5IKXA 3V9AA 2ES4A 4F0JA 2VT6A 1QIKA 3V1MA 1S8OA 5FRDA 1UFOA 3WJ1A 3K2IA 7YASA 3AILA 3G0DA 4A23A 4Y2UA 3IUJA 3B12A 6YASA 4UHHA 2DHDA 1F6WA 1R3DA 2QR5A 2RHWA 4WCVA 4L72A 4UFOA 1MAAA 3MUOA 4GHWA 4AN1A 3CXUA 2QUAA 4Y2XA 1LGYA 5A7HA 3F98A 3OTQA 4RE5A 5BOVA 1G4HA 4EBBA 2ZYHA 5EGNA 5DNWA 1DINA 3DL4A 3WL7A 3M81A 3N0TA 4AX4A 5CURA 1GPNA 3ESBA 4EA6A 1EHYA 1R50A 4HRXA 4PSUA 3NWOA 3U0VA 2CJPA 3H2KA 1OXMA 1TRHA 3WLAA 4DNQA 5ALIA 2PSEA 2XUJA 4N5HX 1GQSA 5IH7A 1LPSA 1QLWA 4J0GA 1VKHA 2B4KA 5FP0A 3DNMA 4ETWA 2W22A 4GBGA 1W52X 3WKDA 1K63A 2ZYIA 3B5EA 5I9IA 3G0IA 4WDQA 5A7GA 1E5TA 1A8QA 2EEPA 1NU6A 4K6KA 3STTA 1VJ5A 2WJ4A 4BCDA 4G4JA 3BL8A 3O4IA 3F97A 2HU8A 5FPPA 3R3XA 2H7YA 4LIPD 4B82A 4HS9A 2ZVDA 4JNCA 3CN7A 4DIUA 5YASA 1MX9A 3M83A 5E4YA 4QDTA 5JAOA 3IA2A 3STVA 3O0DA 1QIDA 3KWJA 4CI9A 2QS9A 1H2ZA 2RGUA 3S2ZA 3G02A 4LYDA 5ALSA 3WI7A 4AZ3A 4W1SA 3ESDA 2DSNA 4Y2PA 4BAGA 3IULA 2XDWA 2Q0XA 3GFFA 1ZD3A 5E4TA 5IVIA 1XQWA 5LYYA 1TK3A 2PU5A 4WY5A 4AO8A 1X2EA 2G5PA 2GBCA 1Z68A 2J4CA 4BTVA 5JZBA 5LKRA 3VXKA 2E3JA 3R0VA 2XLBA 2PUJA 5FLKA 3LLCA 3I1YA 1T2NA 4LKOA 2ZJ6A 1R9NA 5JD5A 3T4UA 4C88A 4IH1A 2VT7A 2RONA 1IZ8A 5ALOA 5CTAA 2OAEA 1CLEA 4OB8A 4KAAA 4UBLA 1XZGA 4BE4A 3PE6A 5DNUA 3ANTA 4RNCA 2VF2A 4BC0A 3BWXA 2QKYA 1GXSA 2XQIA 1UK9A 3H04A 3WKEA 1ORWA 1ZD4A 2OPHA 2JGJA 5C8ZA 3I2HA 5HFAA 3G7NA 4J0JA 2J3DA 4K6GA 2GYWA 5AIAA 1VA4A 1ZOIA 1EK1A 4X00A 1AC5A 2PSDA 3RLIA 2ZSHA 3DS8A 4X92A 3W05A 1TIBA 3WK9A 5C7YA 2BGNA 2XUIA 5AKXA 1IZ7A 3C5VA 1W76A 4C87A 4MQLA 5LP1A 3BF8A 5E4JA 3F96A 2V98A 3H18A 2XUKA 4BRZA 3A2NA 2DQZA 4H0CA 4G4IA 4X3CA 5KREA 1VXRA 3D2BA 1XZEA 2ZYSA 1SFRA 1BU8A 4J7AA 5CH3A 1XFDA 3ZI7A 3JYHA 4H7EA 3LS2A 4FWBA 1R1DA 2JBWA 3D7RA 1H23A 3H19A 5DYTA 5JZ9A 4CCWA 2D0DA 3FBWA 4DSZA 3N2ZB 1TAHA 4QEKA 5HKBA 4X94A 4BRSA 2WIDA 5CXXA 1YS1X 4OB7A 2OCKA 4X6XA 4L0CA 2OCGA 3D5EA 2CKMA 1JFRA 5KWIA 3STYA 4GXNA 2ZSIA 4TPKA 3WWPA 3I2JA 1SC9A 3A2MA 4DTCA 2PKYX 5AKEA 3LP5A 1EI9A 4Q3LA 1GPLA 1P0PA 5ALPA 2WUEA 1BEZA 4G4GA 1Y7IA 3PFCA 2JGEA 3BDIA 1DX4A 4GI1A 2IIVA 2YH2A 4W63A 3PUIA 4MWTA 2QM0A 4INZA 3G9XA 4Q3OA
chains in the Genus database with same CATH superfamily
1Z88A 4G1FA 4C3UA 4POOA 4BJ3A 5KYWA 1FMJA 3T1TA 1POWA 2FOIA 3K0AA 5BT8A 3NEJA 2R8PA 1RBYA 3UUEA 1PZEA 1X7ZA 2D4AA 1OLOA 2GR9A 8ADHA 4DR3B 4Z3DA 2G5CA 4C0AC 1V11A 1FDWA 3JALA 4ZVNA 1Z4LA 3AUJB 3FWKA 4MEBA 4AY2A 2WUFA 3VHXA 3BFVA 3UMFA 1VL0A 3R7BA 4TVSA 5I8PA 2IF0A 5DYYA 4QPCA 5GM2A 1L7AA 5LNK6 1P3Y1 4ROTA 4DBLE 2KMLA 4EUNA 1RHUA 3WV4A 5ALRA 5JS2A 8ABPA 3OCZA 1V95A 3VR2D 2AOVA 3RK4A 1HC7A 3WNDA 1SOAA 1M6EX 3AETA 3GVCA 5HM6A 1UXGA 4RZ3A 4G07A 5CB0A 4OATA 3BXOA 4KPEC 1T29A 4MZDA 2OV4A 3C8MA 1XMSA 4OKSA 5IPFA 2ZSAA 4DAOA 2WYHA 5K0GA 1AKNA 2RGDA 1BQEA 2ZU0C 4XIJA 5AOBA 2OCXA 3LUFA 3PQDA 4A4DA 3I73A 2OGSA 1HK7A 3UGQA 4UTOA 4WZAA 2R86A 4CR7A 1XAGA 4DSAA 1ODJA 3R20A 2PUDA 1VL5A 3MT0A 5L3SB 3BG5A 1X8XA 1XRLA 2A9RA 3KSUA 2XUHA 1SG6A 5DNDA 1YC2A 1WXGA 5JAQA 3ZWCA 3HPQA 5IJ0A 3OQOA 1ZN9A 3OY7A 3PSHA 5EP3A 1E89A 4OA8A 1HX7A 3RFCA 4UARA 3QW2A 3KEOA 3TBKA 4G67A 4ES6A 4LI0A 4FDLA 1JWBB 3JVIA 4DS3A 3KIPA 4YY3B 4EO9A 5BUCA 2PGJA 3IPYA 4X65B 2VSFA 3QPVA 4QRDA 5DCLA 3PD0A 1A9TA 2FK8A 1FFAA 2H2WA 2WMYA 2WMDA 3A14A 1FBTA 1RYMA 1KFKB 2EQ5A 3A6GA 1Q83A 4ML3A 5HTKA 4IG4A 2W6JD 1RAHA 1WMEA 2O48X 4DVGA 2YCLA 3E35A 5JFGA 3P0IA 3AUSA 4MTLA 2DERA 3IO3A 4AKEA 2XYRA 4CM7A 1TQDA 2QVLA 3P0JA 4DDKA 3DLAA 3A9CA 1P17A 3H5OA 3QU4A 4YJDA 3ZDRA 2C7QA 2O7NA 4X7RA 1ISHA 1H8EA 3M70A 4MLDA 1KE1A 3VA7A 3TVDA 4BVBA 4U9UA 3ENNA 3HQ4O 2PUHA 3L43A 5J4LA 4BGVA 1Y80A 4GFDA 3R9XB 1YJBA 4Q0MA 1Q6YA 1N3YA 2Y67A 5C2JB 4EMUA 1P7VA 1GZ4A 2NTVA 1UBCA 1EX7A 3H9JA 4RFVA 2B21A 4ZT2A 4F5YA 2ZQ5A 3MNFA 4DSUA 1DTWA 2G0NA 4WOKA 2IHJA 2QN7A 2XI4A 4DLSA 5IM4F 2ZI4A 5F51A 4HQOA 1H9CA 1XTBA 1CRQA 1EE2A 3GJZA 3NIBA 4BQIA 1VPWA 4O1MA 3MBIA 1E5DA 2DH6A 5L3VA 4UPEA 2XECA 1VFPA 3EBOA 3FYUB 1QDLB 1N9ZA 3MWJA 3Q8XB 5JCJD 1E3JA 2LPMA 5DFAA 3C70A 3N0RA 4UNSA 4FSHA 5HHTA 1EINA 4AJIA 3LSYA 2Q7XA 3IPAA 3PHHA 3FLBA 2DVMA 5E8JA 4GVXA 2UZ1A 4N9QA 2ZGVA 1LQUA 4DA9A 3D02A 5LPNA 1S2GA 2AMYA 1W9HA 3BZWA 1G20A 3HI6A 5KDLA 4E2XA 4XX0A 5DBGA 3WDSA 3RVPA 2IP2A 5JR3A 4JLKA 4LI3X 1N6PA 3HGMA 3KSMA 2VTEA 2MYNA 3AVYA 1EWQA 3ESCA 1T5LA 2C2WA 1T6XA 3DAHA 3ZIAD 3BIFA 3BD8A 4GM4A 1KPGA 4GQIA 4LYHA 3DHVA 4UZEA 3ZDBA 2EW8A 1IN6A 5FWDA 3ONWA 1O0CA 1ULAA 3AW8A 1LSSA 2K2QB 4OYHA 4X45A 2BYTA 3IV6A 2PCJA 3GUHA 3HUUA 4MJXA 1YB6A 3RUIA 3ZG6A 4C14A 4DDHA 4DIDA 5FH9A 2ZIFA 1GHTA 2GARA 2FMXA 2ZRHA 4KBYA 3QZUA 3V4SA 4RYLA 2LRHA 1J2RA 4KFTA 1DS6A 3RFXA 2X2FA 1HBJA 3OJLA 5KOHB 4WLNA 1PLKA 3ZBTA 4AP9A 2E4WA 2HHCA 2QTGA 1KO7A 2YV5A 3EUFA 4G5OA 5FULA 3GJ8A 3ASUA 2RGYA 5FA6A 2OY0A 2XQGA 4DN6A 4HEJA 4F56A 4M8KA 3W3AA 1L5LA 3DZDA 1YVDA 1J06A 4GM0A 1GEEA 5JZOA 5AJVB 5K9ZA 2ZRQA 2F64A 1GFWA 1WWKA 3FNFA 4I3HA 1IHYA 4J43A 4ZCQA 3A9UA 3LX5A 3HR8A 4DKXA 4BC1A 2O52A 1EDEA 4EELA 2O23A 1CSEE 1K06A 5D87A 1BQ4A 2JGFA 4AN0A 1AKUA 1CC1S 3NALA 4RZHA 2OBBA 5CNMA 5B55A 5LA6B 4OXYA 4WLOA 1SOMA 2YZMA 3GLRA 5T4HA 1JV2B 4Z51A 5IT5A 1C8LA 1BU5A 1JJIA 3GLIB 1WX1A 4IOLA 1FE8A 3DAYA 4IJWA 2ECQA 3OFVA 1J8MF 1F2DA 1UPBA 4HQLA 3VHLB 1ZUNB 3DL0A 5HE8A 4AL4A 1DIBA 3C3CA 1T9KA 3X43A 3KAPA 2DUUA 5A05A 4CETA 1X7DA 3B6IA 2DQ4A 4C6SA 2PIAA 2IUSA 1MA3A 2KYRA 3PEFA 3C48A 3TX6A 4GRIA 3BAZA 4UCFA 4IKEA 2ZE5A 2YASA 4XUGB 5CX1B 3HH8A 1HLGA 4F9GA 1AGYA 1G5QA 1U6KA 3Q88A 3IL2A 3U7GA 1BMFA 4ILEA 4AS1A 2QZJA 2IBSA 2VDKB 4HDMB 3CEHA 5DNCA 3PWZA 4RA6B 4BFTA 4EVIA 2ALJA 4N3AA 4CVNA 4DQ0A 4JJZA 4Q82A 4ZOLF 4CDRA 2OP1A 3Q12A 3JRNA 5FTWA 3D59A 4Y2HA 4AKSA 4KR7A 1WDMA 2ONCA 3F0TA 4M9CA 3P7MA 3B1FA 4JYMA 1NDQA 2BM8A 1C4OA 3EZGA 1EGHA 2HU5A 4RD1A 4JHXA 4Q37A 1KKLA 3HBLA 3WQBA 1OSNA 3ODGA 4N0MA 2WLTA 5CRIA 4ZVVA 3V1LA 1JSXA 5BSMA 3RTGA 1BS1A 3DPIA 3KOXA 1RYDA 4MWCA 5M04A 2R84A 1XQ1A 4KQ2A 1AHNA 1IVNA 2B7BA 3AJAA 3KOMA 4RELA 3S70A 2ZULA 4A7PA 1X8KA 2JAOA 1K5PA 3FKSA 3I37X 4M9SA 1JSLA 2QP3A 3H1GA 4F86A 4AZ3B 5JO0A 1Y1TA 2CYBA 2HF2A 1E7QA 3WB1A 4X62B 3RD5A 1UBHS 3I9NA 3SJCA 5AVYA 2O54A 3IKTA 2Z95A 3W9SA 4MVCA 4ZDIA 4KWCA 5GMOA 3U7RA 3LM8A 3WWEA 4OXXA 2ZP1A 4TZ6A 3GDHA 4XOIA 3IAEA 2KBEA 4P93A 3F3KA 3H86A 1UKEA 2IDZA 3E4DA 4HXEB 5EP4A 4BMVA 4OBEA 2Q3CA 2AD5A 1K7XB 3NONA 3PUYA 1EJ6A 2AJDA 4GIBA 5IH3A 1FW8A 1NW9B 2W71A 1FTQA 1YUBA 1LDMA 2C9BA 2R7MA 2YICA 1Y9AA 1C7ZA 1ORHA 1NJ5A 1Q91A 2JHFA 2P11A 3F5DA 4Y9SA 1NX6A 1VCNA 2QYSA 4LWZA 4CUKA 5L95A 4GZ6A 1X39A 1GVNB 1I6LA 4EHIA 4I6EA 5KKCA 4JBXA 2B35A 3V8RA 1DT5A 1QVVA 2XTMA 4M7WA 3AKZA 3ZD7A 3QIVA 2I4LA 4CUZA 2SCUB 4G3XA 3ZU4A 1CUDA 1ZCBA 3W5JA 4NMLA 1W73A 5J9FA 4LF5B 1B0UA 5I9SA 3HVKA 4IDBA 1SCJA 5FX2A 1N2EA 1ENOA 1RI5A 3H2IA 1BCSB 1S2NA 5ICEA 5DW0A 2ODTX 3NIWA 2AF4C 3B51X 3P0EA 3QLVA 5HJ5A 4HDKB 3FWPA 3UBTA 3EA0A 3K8ZA 1KKUA 2WU8A 1N2XA 1J2JA 4OMCA 5IKOA 1GUBA 1R4NA 1V96A 5FI3A 4B74A 2B34A 3S81A 3H6KA 2JI6A 3DLPX 4S1TA 4PLCA 1H4VB 4E5KA 4LNUB 3FHOA 4ZT4A 4BFWA 4BP1A 3TGLA 4ZYUA 5CFPA 1DGQA 5DGHA 3G89A 3W5SA 5AKYA 4PYMA 2OYSA 1K3UB 1G21B 4MWEA 4D0RA 1CUWA 1U6IA 4DJTA 1GKIA 2PIDA 2AG0A 4N7RA 5DMHA 3VC3A 2AEMA 3OPYI 2QY9A 4IZHA 4CCYA 4KNVA 2IUYA 1V9LA 3X2EA 1UBJS 4YACA 1WO8A 3W9YA 3HYRA 3TBHA 1JHYA 2J9XB 3GLUA 1TJ4A 1QFZA 1BH2A 1VYUA 3G2OA 3R6DA 3ROPA 4AMZA 2IF2A 4QRIA 3THXA 4URYR 1BWQA 1EX1A 4YRGA 4UEKA 4RPIA 1H9AA 4CCSA 3B53X 1C0LA 3Q15C 1K7FB 3WQHA 4RULA 2HHLA 1PGJA 3LQKA 3OWXA 1GR1A 2VNKA 4MIKA 1Q1EA 1Y98A 1UOOA 1U1GA 1LVHA 3HK2A 1I6WA 2H51A 3MMNA 4BE9A 1B93A 2I2AA 4P7GA 2RIRA 1JEDA 2GBPA 3FCEA 4QUBA 4IGIA 1M2JA 2CMFA 4EG5A 2QVXX 3CF0A 1ZCFA 3L6EA 3WLEA 3JQ7A 1RJFA 2V0NA 3AUAA 3O8OA 4B6RA 2VXCA 2VXBA 1PEYA 3QMPA 3CISA 3SZ3A 4F2PA 3VU3A 3CZPA 1E4EB 2ONZA 3CWQA 1PNRA 3N70A 1PS8A 1DKMA 4GX1A 1MIOB 1P4JA 4I9HA 4PSCA 3B9BA 4R1MA 3PQEA 1UXIA 2FZCA 2Q3EA 5DV9A 1THTA 1U0HC 1U3DA 2GKSA 2ORYA 4NYJR 3FH0A 5DGXA 1Y81A 1ZXXA 3FNIA 1SCUB 1F2TB 3H3JA 2MOKA 3SY8A 1ORRA 4Z4HA 2Y1DA 1R2QA 3H4TA 4F12A 2GDZA 1XVLA 1MABA 2IC5A 1C81A 1DAIA 1PP4A 2V5AA 1EKXA 1C7JA 3IVXA 4U6SA 2P67A 4KP7A 1YDHA 5A3QA 3MGAA 4PRLA 1FP4A 1V5FA 3KYBA 4KQ6A 3O9ZA 3PEWA 5KU7A 2JJ8A 4XTCS 4WVFA 5KYUA 4J1TC 4IQ0A 4MQEB 2VXYA 5HJ2A 2H4ZA 1KP3A 3O7MA 3QF4B 4GEGA 4QSHA 5DM2A 4EHHA 5A4KA 4HB4A 1VE7A 2ZIWB 3H2GA 2JZCA 3UWDA 3WVNA 2P2YA 4JSRA 4RWEA 1EK5A 1QHNA 2OA0A 5DM70 5HKLA 2IU0A 4WZ6A 5IUNC 2R79A 3ZHUA 4XLLA 2O5CA 3U61B 5K5EA 1XTIA 3Q3HA 4YDQA 2OXCA 4LYAA 1FXWA 4IDOA 3D6VA 3WDMA 3UJPA 1TD1A 3P4YA 3CZ9A 2QGFA 3OP4A 1CF4A 3LRXA 2AOUB 3D0RA 4IDPA 4NE2A 3DF7A 2GM5A 5E6UB 3F90A 2P9TA 3K5HA 4IXMA 4NZ9A 3UGKA 2JGLA 4TLDA 4GMKA 3E03A 3T5DA 4EKNB 1GG2A 3A0RB 1NHWA 1X3LA 4D4MA 5KTNA 1TYAE 4KW7A 3TW0A 1NJ6A 2XKBA 3E27A 3EMVA 3A9VA 5P8WA 5AD1A 2P9YA 3Q1LA 4W4TA 3MUNA 1MO6A 2FPPA 5D84A 2GLXA 1D04A 4PBRA 1PWZA 2I8AA 3EGWA 4V0OA 3HWSA 1O3YA 2DTDA 1KSHA 4KNYA 3VNBA 3AR8A 4V3BA 3LXRA 2Z3ZA 1BSVA 5BW8A 4NMWA 2IYNA 1ADYA 1QONA 2BFBA 3V6LA 2ZBUA 1PUIA 3JXEA 3TLEA 3PQ2A 1ISGA 2AJTA 2FN9A 3QFCA 3DDZX 3GWZA 2NP6A 3R9XA 5K0SA 3ETGA 2PYZA 1VL6A 4IWYA 5AK5A 3U7QA 4B76A 4ATNA 1U9IA 1XD2B 3DVAA 1R4ZA 1JFVA 5IC5A 2PPLA 3FDJA 3HI4A 4HDRB 3RYIB 1R8QA 5ALTA 4AK9A 5DW3A 4UREA 4HYEA 3BDAA 4XWOA 1CWUA 1QHGA 3VM6A 1UQUA 2IHVA 1Y6GA 4AJNA 2VCYA 4FHZA 5LZ7A 1YA6A 3IIKA 3AM1A 3GVIA 4RS4A 2X9NA 5LCXA 4DLKA 1AQNA 4DUGA 4ND7A 2ZBGA 4U39A 2NM0A 4AJEA 1DI0A 4Z1OA 5KTMA 3C16C 3GELA 4BVHA 1Z6PA 1FTYA 3LKBA 4K1LA 4J0EA 1SQFA 2YNMC 1M9NA 1KS9A 4B48A 5M2QA 3M3DA 3CR7A 1KJ9A 5H8WA 3AHJA 1R0KA 2PVSA 1XDUA 3A6DA 3OE7D 3GRVA 1HKHA 1IG3A 2JIDA 2A9VA 3NBKA 1ZH4A 4K6HA 4M1WA 3WYCA 1SU6A 2ODAA 2V3WA 2G76A 2O5RA 2ZJ4A 1G6HA 2BDUA 4F4JA 1UJ2A 4C7OA 3GNTA 3GQBB 2IU3A 4QGBA 2JLWA 3PYMA 4YQZA 2V9PA 4C0SA 3O7WA 3RWOA 4EPYA 2CNBA 2F1IA 1K3FA 2QT1A 4LZOA 4W8HA 2VAMA 4S1NA 1C3EA 2OFWA 1WMDA 4CFSA 1P0FA 1YVUA 1ZISA 1U31A 1XTZA 1R5OA 5JQGA 3WGTA 2MSEB 4HWPA 1J97A 4WESA 4NOJA 1OZGA 3OQIB 4KLZA 3SCZA 4FM9A 2ETXA 4TVKA 1FA9A 2EEZA 2ZYDA 2FPGB 2QAGC 2JJ1D 1KQFA 3JZAA 3PFKA 4BASA 2ZE6A 3W79A 1GRQA 1T2DA 4EGFA 1IH8A 3NBFA 1YJ5A 3L18A 3EAQA 3QLJA 5KNBD 5ALHA 3PCRB 1XQ6A 3AERB 3KVRA 3AVXA 3B78A 5ELLA 2P3OA 2VLIA 1RDFA 4WACA 4J2TA 4PZ9A 4YWJA 3QE4A 4F5EA 4K81B 3IE1A 1N6OA 2QZPA 2Y6VA 4A6EA 1IWBB 2D13A 4G63A 2J6IA 4Q03A 3GG9A 3GLGA 4MDHA 4H4CA 5DT9A 4B0OA 1DKUA 3NTLA 5BV7A 3KKLA 5FWYA 4WFIA 1FSGA 1TTQB 1VJGA 3DHEA 1XZ8A 3OMXA 3HHPA 3ISVA 1CJTC 4K9SA 1QRDA 1BMQA 1P1RA 3GJ4A 4GECA 2HK7A 3QVJA 2QUIA 1FLDA 2RI1A 2VZ9A 2AZXA 3BPSA 3CHYA 3S2FA 4ZZ0A 1IEVA 2X6QA 3SC3A 1FXUA 4PLTA 2B8JA 5I3ZA 1WSAA 1ZM4A 2R65A 5KB3A 4QU0A 2F59A 1L5MA 2VK8A 1D8AA 4PHGA 5A6VA 2CHFA 5BN4B 5H1YA 3JYLA 2CZGA 1P1IA 2N47A 1QFMA 2LXNA 1GY8A 2WIFA 5CK5A 1FTSA 5A9TA 2YXBA 3L8EA 5K6AC 3IOCA 3D6UA 1CZOA 1MLDA 1HV8A 2FEKA 5CHYA 4TLEA 4Z7JA 5J4HA 2ZR8A 4ZHQA 3O91A 1KOLA 4U6NA 3SYKA 1Q3KA 3EPJA 4H4EA 2QVCA 2AQIA 1JB9A 1O8CA 2OC4A 4M9RA 1UXJA 2FDXA 1A2KC 3D3JA 4QOJA 5FFNA 1I0IA 1PCXA 3ANXA 3IDQA 3ZTWA 1IVSA 3HZZA 1X1TA 4AI6A 3QOYA 4AUNA 3BJEA 1PJ4A 2J3JA 3NOQA 3HWRA 1P62B 1GZVA 3ND7A 1B7GO 4UM8B 5EWJB 3ZW8A 2YZKA 1CQXA 2PSHA 2OL4A 3EWNA 4MUHA 4RJKA 4W8OA 3A32A 1P9RA 3U62A 1CZRA 1GLNA 1NUQA 4ESOA 1ZGJA 5C7LO 1SD2A 3NATA 5MHTA 3TIVA 3V33A 2HUPA 3B1WA 4O4IB 5C1PA 1Y5IA 3C7AA 5CIYA 4JS0A 4NNJA 4DCVA 3GYBA 1Y8QB 1NBEA 3HACA 3DG9A 2PJZA 1YI0A 2VJDA 1IBKB 2XIQA 1QTIA 1PJQA 1GU7A 2QMZA 2DPGA 2TMDA 3OPMA 2UYGA 4FDVA 4HN4B 1NMSA 3IBGA 3U9LA 2QXUA 1X74A 3OT5A 1XGKA 3E81A 4U2EA 1C7IA 1NLZA 1M5UA 1SU4A 2OBXA 3QWBA 1PJ3A 3PC8A 5EIBC 4BLTA 5KIAA 1H4TA 3QWHA 3ZUPA 4HDAA 4NH4A 1GTRA 3MCVA 3OHMA 1FP7A 3P2OA 4JXJA 2GD1O 3JQDA 4WY2A 4HATA 5DM1A 1V8BA 2VJKA 2NU6A 5GWXA 3USCS 3HWWA 1N2OA 1NTOA 1ZIXA 4TS9A 2V6GA 1K4KA 3RVLA 3VX3A 4QLBA 2IS2A 2VHQA 3DMGA 4CV1A 1WEHA 3WL3A 2VTVA 4ZAFA 5LFAA 1YDGA 4BBJA 1FNSA 1Q22A 4LSGA 2IJGX 3V34A 3PENA 1D4ZA 5B6IA 3PXEA 2YVUA 2SBTA 3W78A 2J9FA 3RODA 3W1WA 4MWGA 2FZ5A 4A2PA 4EENA 2FUKA 4BEVA 1UKVY 1JZTA 1C9MA 4AZWA 4L4YA 4HWSA 2WWWA 2IW1A 3UATA 5EIWA 4DMHA 4N6OA 1YE8A 2R44A 1TOAA 1X7YB 2GEDA 2CFOA 1F0KA 2GFHA 3A58B 4CGYA 2PJUA 3W77A 2GEVA 3M5PA 3D0KA 3WB2A 1Q57A 1UKAA 1JQAA 2VJNA 2J0EA 2NZJA 2RJOA 5F9MA 1KYTA 4O2BF 2Q3BA 1C3LA 2QJOA 4YYEA 4AM8A 4GOKA 1XVVA 4WKGA 1Z0SA 3PDIB 3MUEA 3TSYA 5JSHA 2P2SA 1CDOA 1K8QA 1ZK2A 4G9BA 4DXAA 3IVAA 3U2QA 1VOTA 3GCDA 1CD5A 4R3NA 2GMWA 3HSYA 4BRWA 2QVGA 3O2JA 3O8LA 1J0CA 1TI7A 3LFHA 3H2HA 3R41A 4R51A 5J59A 1OBVA 4ER0A 1A9YA 2D5CA 1B1CA 4PG5A 4F8YA 1ENPA 1E7MA 3GBVA 3TEFA 1B8OA 4JI4B 5AI6A 4JJ8A 4II7A 3DXYA 5KNDD 4ADSG 1QR6A 3OTGA 1P8JA 1KWKA 1HSOA 4D80A 2L42A 1QHHB 1WCWA 3PDCA 4P0QB 2W4MA 4ZQHA 3NHWA 1KZYC 2Z3WA 1L6RA 4PZ0A 1LTKA 1NJ8A 1ZM2A 2YIMA 4PYKA 4QLAA 5G0SA 3H5NA 1HKUA 1KS2A 4UAGA 1U8CB 2JAUA 4BEJA 1LK5A 2GI4A 5FTKA 2A9JA 3X1YA 3ZDEA 2XT0A 1RWWA 1QWSA 3P94A 3TZQA 3O8QA 3V4PB 1OPXA 5K6RA 4W9MC 3E1KA 4BMSA 3KJXA 1A8UA 4FT4A 1GFIA 1G17A 3C3PA 4XR4A 4KPFC 3ZXYA 3OSUA 1URPA 5FQNA 2Q5OA 3T7AA 3FN4A 2BRUA 3SLKA 2X4LA 1LVUA 3CUTA 3VYSB 1NNLA 1W581 3AJRA 2D2IA 1MEOA 4Y2TA 5CB8A 4P4SA 3AWDA 3K8YA 2COEA 3R6LA 2HXSA 4E11A 4ETMA 2QQ5A 1G59A 1W30A 1D2NA 2MDTA 3ECAA 5TNXA 3R9KA 1RKQA 3HRHA 4RMNA 3ZBUA 1OWLA 1RCFA 3C2QA 2CWDA 4H9GA 5LNK1 2LIPA 4W82A 2CLSA 4FMDB 2GCGA 3WY9A 1V47A 1L2TA 2HIHA 1IUKA 4PR0A 3U3JA 4EMBA 1YHNA 2QD5A 3DF9A 3GL9A 1BXGA 4WQMA 1RKXA 1Y9DA 3D54D 3PNPA 4WY8A 5DCUA 3K09A 2I54A 2GJSA 1KK0A 3P2MA 1T8YA 2O6LA 2QDKA 4KQ9A 4UXIA 1AK1A 5AM2A 5KOJB 3HLYA 1KJJA 4I9NA 2RAUA 4AYWA 2NUAA 4ZOQI 2HQBA 1GTG1 4KJXA 4EHBA 5JD6A 3CRVA 4QOGA 1JW9B 4R0VA 4JB8A 5FOVA 4BV9A 4QBHA 3WRYA 3VZPA 4NQRA 5FKJA 2KX7A 3CURA 3E7FA 1PBNA 4S2EA 3GDWA 2I3DA 3HGTA 2ANBA 2JLSA 4MW6A 2OXTA 4NMXB 4RCVA 1OKKA 2A5LA 1PU2A 4KFRA 5TSDA 4UQLA 1VMKA 3KQHA 4IHKA 3AL3A 4M1EA 4QRHA 3TW8A 1AK9A 3Q87B 2JI4A 2GRAA 3EXIA 1WXQA 4G09A 1Z6XA 4MS3B 3IIMA 5JSYA 5KWSA 4MUAA 4TMTA 1ZJ4A 4LC1A 4XLZA 2WHQA 2WTMA 3IP9A 5D3MB 4EUEA 3WTBA 1PUJA 6ABPA 1BEUB 2CK3A 1XI2A 1RT9A 2JFHA 3ECSA 4PXSA 4C1NA 3DPSA 4REMA 4CM4A 2WKRA 2XMSA 2C5HA 4E4RA 1ZYUA 4UATA 2WJZB 3C3EA 4ZAYA 4BATA 1TCBA 3N0WA 2FZ4A 4FS3A 1JU9A 3QUCA 1GG8A 2ID7A 4HNHA 4OSEA 2IZOA 3QEJA 1JG6A 2H0RA 4NX2A 4PNHA 1L6IA 3AB3A 3R6WA 1CETA 4B4UA 2GEJA 4AZ0A 1HL3A 1GGVA 1E9CA 3PHJA 5KJ6A 3GJ6A 1XL0A 3OIFA 4H17A 2ZAYA 3LLSA 3QMMA 5K3FB 3M3HA 4JUFA 5JLJA 4ETNA 1NJ1A 4WIAA 3KSDO 4J9VA 4LF7B 5IKEA 4ZVRA 4JI5B 5TLSA 1GNPA 2GPAA 2WF6A 3AUFA 3BKXA 4O29A 2RH4A 2XUOA 3OTIA 5C5DA 2LDBA 2Q99A 3AZOA 1WU8A 1VBFA 2H07A 3B2NA 4MI3A 3E1SA 1TAQA 4HUJA 2EDAA 4FEAA 4ZO6A 1JE0A 1ZI6A 2FWNA 4Y2GA 4C5AA 4EDHA 4ESEA 3DAFA 4OJYA 3KHTA 2P4UA 4D79A 4ZARA 5L4LA 1JBQA 2YUIA 1BS2A 3HDQA 3HRKA 1I7NA 3GGPA 2AXQA 3GRZA 1ZMTA 2WIJA 1MNQA 3ORHA 4LXUA 4MO9A 5H83A 2OQVA 1Q84A 1NM5A 1F48A 3EPKA 4YT8A 1OV6A 3TRKA 1ZC4A 4JOSA 1N9GA 4X1KA 1PJLA 2XWBF 4Q19A 3ENVA 4DFDA 1A4XA 2WNSA 4LK3A 1TRKA 2Y05A 4ZPJA 4BVLA 3CU5A 5HGJA 2P0AA 3EHEA 4CLHA 3ULKA 4HTAA 5TT0A 4CEIA 1WDWB 1H5QA 1E1DA 1OA1A 3WAGA 3A6EA 3ZNNA 4FJ1A 1Z4NA 3L46A 4UDOA 2C4HA 3TD9A 3UJ3X 1ICEA 2XUFA 2ECFA 4MR9A 1LI4A 2Q1SA 3CZ5A 4U7FA 5IYZF 2XSZA 2ZFUA 2PRSA 1D6NA 1SOVA 2IKQA 3A1VA 4XX1A 3SZOA 1GZSA 3K2QA 3ZY4A 1JPVA 2OHHA 4MPJA 4WBSA 3E8MA 4ARBA 1LFDB 4NEGA 3H1FA 2PX3A 1YR9A 5D7BA 2DUWA 3QU9A 5DLPA 4U02A 1GFSA 3E58A 3CVXA 4Z54A 4HL6A 2G8LA 4DCOA 1M1YB 4EECA 1UJNA 2BPOA 2BONA 2O1XA 4FKBA 5C7OO 4OXIA 1JF8A 4IIYA 1U04A 5DCYA 5JWRA 4FE3A 4XW2A 1Q1QA 3DBVO 1XRNA 1V3UA 2C97A 4MGYR 1CR6A 4LQCA 2IHKA 1LEHA 4HYQA 5ITZB 2H54A 1O58A 3L7BA 1V2HE 1S1MA 4JLJA 3RK1A 4Q9KA 1J8DA 3RC2A 5JHHB 1E8NA 2ECPA 2XNCA 1H9BA 1OB5A 5G3ZA 3OQ6A 3ZV7A 5IULC 2J0UB 2YHUA 3T38A 5J5CA 4FYMA 2QE7D 3OJXA 2IYQA 2JKYA 2QRMA 3D6FA 3EZ9A 4QUIA 1F4PA 4XSHA 5E1MA 5A4MS 5EMJA 3HJUA 4EA8A 4PVCA 4HAYA 1FPMA 1BHSA 2Q3FA 2OFFA 1PL8A 2BMJA 1NRWA 2GXSA 2V6FA 2X9QA 3ZE9A 1VJTA 4MKZA 2GVNA 4OG2A 1C1HA 2HBQA 3UK1A 2DB3A 3Q8KA 2R6JA 2MR6A 2QT9A 2ZSBA 3UA3A 1VE1A 3H75A 3I6QA 4ZI3A 4LC0A 1ZN8A 1X80B 2CNNA 2WHEA 4RHXA 2REQB 1DWOA 1R4MA 3UCFA 1XMJA 3CVUA 3TB4A 1JVNA 3WLFA 3QVTA 3UMBA 3A6JA 3BJIC 1ZMRA 2GK6A 2J48A 3PC4A 1TF2A 5EFZA 5H3CA 5TS3A 2GAFA 1V16A 4Y1EA 2R96A 4PNZA 4RK4A 3QU7A 3RVJA 1CNFA 1OYVA 3U31A 1NMYA 1YS6A 2R25B 4YJFB 2YVQA 4B9EA 3VNUA 4KXUA 2CLOB 3AIOA 3CF6R 4J07A 3RFTA 4AMVA 1KEWA 3EOBI 1FQOA 3TG2A 2WY2D 4URHA 3VTZA 5KNLA 1LY1A 1DWQA 3A27A 1V6AA 5FDFA 2O2HA 2JLZA 1FFSA 4YJHB 2IGBA 3K9NA 3LO8A 1B3BA 5I5EA 4RENA 2WEKA 4YA6A 4W9RA 1KAOA 3T1HB 1T3SA 3DWEX 2E5WA 3EHDA 4WK0B 5MGNA 2J41A 1HE4A 1L4UA 3BRWD 4F6RA 5A0VA 2OKCA 1XZJA 2R7LA 3GUCA 3OM9A 4ERNA 2BH9A 4UOZA 3MC1A 4RVDA 4DV7B 1XQVA 2D0PB 3ZHXA 4DZTA 3II6X 1MC1A 4J0KA 3WSVA 3ZWWA 4REQB 4H77A 2AMJA 3ZWOA 2EZ9A 2F8TA 3CNQS 4GI5A 1N7IA 1SEVA 1RRPA 2G9NA 1XHLA 4I81A 5JYDA 1WE2A 1WUKS 1YA4A 1P29A 2HWKA 3R7SA 4Q7JB 2QNBA 3JAMA 3W5DA 4NJMA 2ZJ7A 2W2TA 5DGTA 4U1RA 1KR5A 1LBEA 3GMSA 4PLWA 1RJGA 2GEKA 1IBSA 1BYIA 1RPNA 2DT5A 1QGOA 2A2ZA 2FWJA 2P9FA 1MQAA 2YJ4A 2ZB3A 3QWFA 4TXJA 3WK8A 4EO7A 1CBUA 3K53A 1IPEA 1KMNA 2A1UB 2IZ6A 3AINA 2A57A 4WKOA 4U2GA 2FSVC 5KSOA 1QB7A 1OH5A 1W88B 2A5YB 2C5GA 3IOYA 1VLJA 3PNMA 4PQGA 3FCXA 3F6RA 3VPFA 2W83A 3HXTA 1AO0A 3ZZ1A 4E08A 4LGYA 2QM8A 2YYZA 5BW5A 1P0CA 3WICA 3PQ6A 4E2FA 1P6UA 3WIBA 1OIWA 1VJDA 4RYDA 3TUIC 4OP3A 4YWHA 5ERYA 4A03A 5JNWA 3RC3A 2IYZA 3KJEA 1FVFA 2AI1A 4CQMA 2ZE8A 1E1CB 1UZAA 4YT5A 2BDEA 3QOXA 1Z33A 3FPGA 4HVLA 5E6RA 2HRQA 5FTNA 1P9OA 3OH8A 3REGA 3OICA 3QKRA 2FRDA 3IIJA 1QF6A 1DCFA 2AK2A 2GPYA 1P1KA 5ALXA 3TJMA 3HO1A 3MS4A 1WULS 3QPCA 4ZYTA 1QP4A 2WIGA 1B43A 4FGKA 4I6GA 2GB4A 1O1YA 1S2LA 4PNPA 3MJ4A 4Y1GA 2R1TB 2ZB2A 3I9KA 3FRIA 3NHAA 1HYQA 1YIDA 4FDAA 3A4IA 4JWKA 5D5QA 1JIVA 4A73A 5J47A 1SELA 1J8QA 4J9UE 1J1UA 1NURA 3QVMA 4RTJA 4BNVA 1E6CA 4LZJA 4EHAA 2PUWA 4ARSA 1U8TA 4ZVQA 4EHNA 2RKOA 3OEWA 3DDNA 1GGHA 3CSSA 4PZZA 1Y0BA 1NF9A 2C58A 3ANNA 2PSFA 5D85A 5EQDA 4DQLA 5BOSA 3GLFE 3HTXA 3I0NA 1XD8A 3IJEB 3C5EA 1HH4A 2C98A 2QK4A 4RW0A 3RAJA 4D9MA 5ALVA 4NICA 2PE5A 4FHDA 1DIGA 4Z99A 3KHUA 4MYUA 1M6YA 3ZLTA 3ZUGA 3TVYA 4GKVA 1KVTA 3DYVA 5JNTA 1P7YA 1U0OC 5FF9A 4IOMA 4KXWA 4O8ZA 3Q7PA 1E2MA 1CP2A 1IZYA 1THMA 1KE2A 5PGMA 1SCKA 1CY4A 4K9LA 4G1EB 3KLNA 1HLFA 2QORA 5DHTA 4ZKEA 3RW9A 4KDFA 1I3KA 3YASA 4DUYB 1T6ZA 3BWMA 1G6OA 4QYMA 5C9ZA 3BXEA 3V8BA 1ACMA 3NHJA 4TKVB 5AK6A 2HT6A 4YRMA 2RGNA 1PT8A 2BEWB 2VPYA 3MIIA 5A0FA 4ZI7B 4PG7A 1HE5A 4KCGA 3T9EA 9LDBA 2R0QC 1AQJA 5BSEA 2AN3A 2H2FA 1HMYA 4CKYA 1X9HA 3RV3A 2KB0A 3THWA 2X6RA 5MN6A 3T7SA 4K26A 3UNXA 4GLOA 2FX2A 2JC3A 3O4VA 3OCUA 1TVCA 3SYRA 1OIVA 1BG6A 2VZ8A 3P0FA 3DZIA 4JDPA 3DEFA 1H5UA 1QUFA 3SC2B 4ARAA 4E88A 4PONA 3MTDA 2PV0A 4OU4A 5AJUA 4ZK2A 2B69A 4PS0A 1QIJA 4LFCB 1TKRA 4DJEC 3JQ8A 5CCDA 2C8VA 1ODLA 2YZNA 5FEUA 4RHFA 5EOVA 3LMKA 4ZGGA 3RSHA 3G0OA 2DMRA 3K1YA 4RLFA 1LPAB 5I9TA 4FYXA 1IDOA 1CQIB 4GPD1 5FUMA 2QBYB 3L41A 4NDAA 4KR0A 2TMYA 3LF2A 2HV8A 1GUDA 1WRBA 1YI8A 1E3WA 2DUNA 2Z8ZA 3P96A 5HKKD 1ONNA 3ELDA 1HFWA 3ZU6A 3O74A 3M9WA 3MN1A 3PC2A 4IAOA 3ISJA 3VGPA 4F11A 4KOAA 2O1WA 3ROGA 1AZSC 2P7HA 3IPRA 3TKAA 1D7OA 3ZE8A 5HF5A 5AJWA 2GN6A 5EMHA 3SYMA 4JI0B 1QGUA 1XCGB 2FMIA 2P77A 3PZBA 3CTMA 3BMNA 4CIWA 2V1XA 2WAXA 1TGVA 5EEGA 4K6FA 1DO8A 4TV9B 1RLTA 1W2HA 5IJZA 3MTIA 1RM0A 1E1KA 3KPJA 4GKBA 1XU4A 2GBIA 1UC9A 3J81A 1M6VB 3S2UA 1NI3A 3R3UA 3INNA 4RD0A 5EJ6A 1WB9A 3CJRA 3R7NA 3ZE0B 1RZUA 1OZ0A 1U0FA 2OD7A 1D1QA 1S2DA 1TZ2A 1LS1A 3GZJA 4L74A 3IBYA 4UNPA 3ENWA 1GNQA 2VNJA 4G1MB 3E84A 1V8FA 1OH6A 5EUMA 2QNIA 1QVWA 1IWPB 3S1SA 2PTGA 3ASZA 1YO6A 2FPKA 5ABPA 3NNSA 3DSRA 4EHLA 4EUFA 3OCJA 4RF5A 4QE3A 1ZNXA 2XRYA 5FBHA 4TWBA 1SULA 3E3AA 3C15C 2MJLA 3WBJA 2CMKA 2GFIA 2OCIA 3ZLVA 1JXMA 3KV3O 4GP6A 4GLLA 3DEKA 4AJHA 2BGLA 3UUWA 3ZX5A 3KP1A 3NO4A 4IDCA 3IDOA 1REQB 3BMQA 4BV3A 4OMDA 2NYUA 4J2OA 1Y7LA 1Z2AA 3FWZA 2LCQA 4BFYA 4QJIA 5A6SA 3VOBA 1N2IA 1ACLA 2IXTA 2ORED 1MTZA 1VYTA 2PXXA 4FYYA 4AUKA 4EG3A 4M7PA 4TT8A 5EKDA 4Y6SA 2NXWA 3LF1A 2OG2A 4OHOA 1U7PA 1DDIA 2GN0A 2JCVA 1J2YA 2ZWOA 3B1YA 2PO5A 5IJ9B 5KYTA 4CNBA 5FNVB 4FK8A 4EY7A 4AZTA 4F91B 4PYOA 4LVOA 3W06A 3HXQA 1AZTA 3TIIA 2O8EB 5LUBA 3W2IA 4AS2A 1HDEA 4MYDA 5JCPA 4FONA 4NONA 3BMXA 2DECA 4GUAA 4TMFA 3RYHB 4CKBA 2FMHA 3NV9A 4V3CA 1C1YA 1JHVA 2NXNA 5E7IA 4I4CA 1LJLA 3AOGA 3UYLA 421PA 5K8TA 3FZQA 2E0IA 5CH8A 3CUWA 1MCZA 1OWMA 3BREA 4RDXA 2JFUA 1OILA 1NYTA 2FFQA 4X61A 1G2IA 3CS3A 3NHLA 2JLVA 3ND6A 1KKMA 2H18A 3O4JA 3L0ZA 4U3JB 4MP8A 4S35A 5ALZA 2HJWA 3DE7X 1Z9BA 1FB5A 2CWWA 3RREA 4BZXA 2W4IA 1EAYA 3N87A 2CXQA 3JPWA 4FKZA 4HDOB 3RVKA 4NVRA 1CUJA 1N0HA 1GILA 2VH2A 3SSOA 1K6IA 3PX2A 2DG2A 4D3DA 5I4BA 3M6FA 2JVKA 1Z0DA 2ZJ8A 2ZUBA 1JHZA 1EGAA 2CHUA 4C4SA 1NR7A 2FPRA 4KR3A 3AEUA 3DZKA 2OZVA 3GLHA 3MTAA 4XDYA 5J43A 1A8HA 3BDVA 3NKLA 3TR5A 4BNDA 2OHIA 1RP1A 1MGOA 3DVRX 3BCSA 3SQDA 3FDXA 2JGAA 4TN5A 4DJ5X 1PKEA 3G82C 3MINB 4IJ6A 4NYJQ 4WOPA 4LPKA 4ZOLA 4UASA 3C24A 5EHQA 5IP5A 3V8PA 5A03A 5IVDA 4NU6A 1XRQA 3AG6A 4CG3A 5B30A 1QH0A 3EZNA 2DLDA 4HNTA 2R4UA 2CBZA 3ZKWB 1IMJA 3UPUA 3AGQA 2CN1A 1TYDE 1R9JA 1TA4A 1TU3A 2WKSA 1KVUA 1QVAA 1BGVA 1QIFA 3L02A 5AVXA 4FW9A 2Q27A 3GIWA 4FYJA 4JL5A 4A91A 3NHUA 1KU6A 3VKFA 1AKWA 4FIZA 3U4CA 2QG4A 4H2DA 3VOTA 3RARA 2CHQA 3I2YX 3K0FA 2WSYB 2VDRB 2ZBDA 3L93A 1BJRE 2B1IA 2JGMA 3QVLA 1E9EA 1SEPA 3O82A 5D00A 4C6TB 2GTPA 1JVSA 2RHGB 1W4CA 4ENPA 1U2ZA 3CX4A 3K9FC 3LC1O 4MR8A 1ZITA 2ODPA 1RIFA 1TKBA 3BQNB 2OO7A 2WE7A 3KL4A 3L7CA 4XYGA 3WFIA 2A14A 4CM8A 2UYQA 1LF0A 1NBME 1RQNA 4Q12A 4AXBA 1P81A 4R8KA 3RS8A 2C0PA 4LYEA 1PZMA 3A4VA 1E3DA 2Z6AA 1IHOA 5ESDA 5FAXA 3L5OA 2WTEA 1N1DA 1QQ7A 2H29A 1B8PA 1NT2A 1TQHA 3K9WA 4I0WB 2RHOA 1Y3HA 5JSZA 3DMDA 1ZD8A 4IJQA 2YYAA 3R5SA 4IMPA 2ZVJA 3V4FA 2HHHB 3CH5A 4K2HA 2Q6OA 1Q7BA 1YB7A 4R8RA 3DUFB 3H13A 4YV0A 2JJ2D 4GDMA 2WF7A 3GA7A 5CVCA 5EJ4A 3B36A 1X19A 4XOUA 4CGZA 2H1FA 4J8PA 2YWRA 1JR6A 2QTRA 2EKQA 2H00A 5DX1A 4C0LA 3FYUC 4JFAA 4LXTA 4ZK6A 3ZWYA 1B8VA 1U3FA 1GGFA 2VHEA 3RG8A 3RBXA 4HCJA 3RBAA 4BZQA 2XNSA 4EYGA 1EXVA 4MV4A 1SKMA 1ZH6A 3EF3A 3I4CA 4Y2JA 3AHGA 1UZLA 2VYND 3W7AA 1JDZA 3D81A 3TYXA 1MO4A 3KU1A 2ON6A 5CLIA 1USKA 4K9MA 3LCUA 5AKGA 3FYDA 1F60A 4ZA2A 3ZGNA 2VQ6A 3FPJA 4NBKA 1R5BA 1L0BA 1OZAA 3LXUX 4NQZA 3L8MA 4POAA 4FMCB 4EYOA 1RRVA 2HFKA 3A3OA 4QASA 1IAQA 4FDUA 4NSNA 3VAZA 1QRRA 4XIGS 2PA3A 4E70A 4CMAA 4OX9B 2R2GA 4JN6B 3SZMA 2P4QA 5CFLA 5CDFE 4EQ6B 1G19A 1DADA 3ELUA 4CQLA 5EG5A 2FF5A 4OIFA 3KALA 2BMEA 4MUEA 3OKAA 4IGFA 5BXQC 1JEYA 4MO2A 2XJ9A 2JFVA 2GN2A 5TB5A 1EUZA 4A0RA 1FQKA 4DV1B 4UC0A 4MQFB 1IN8A 2VP0A 2XCUA 4CV2A 4HNGA 1D0VA 5BNFA 2I3GA 2P27A 4G41A 3PC3A 3TTUA 2XWQA 2OBLA 3A31A 4LDPA 1N6RA 2A9FA 2O1EA 2Y2VA 4ITVA 3WWDA 3IBSA 2NO7A 4E7OA 1F8GA 1RHQA 1Z26A 2C5FA 5JRJA 1G0OA 1PT5A 3C4JA 1NPTO 1Q6ZA 4GE3A 4KDEA 3E3MA 4LOAA 3UT6A 3IAS1 2UKDA 1FMLA 3CB2A 1OLSA 3OQJA 1Y9EA 2WSMA 2G04A 1D4OA 4K6OA 5K3CA 3LWNA 5HXAA 3ZVNA 3TIXB 1C2TA 3ANLA 3LY8A 2ZDHA 4YR9A 2PUEA 1ZU5A 2BCEA 3GAMA 1XNGA 4HH3C 1E9DA 4C30A 2PHZA 1L7EA 5AIBA 1C50A 1GWNA 2P2CA 1OASA 3JTEA 1U2DA 2W8BA 5BQPA 1PVVA 2EZ8A 4LZAA 4FUTA 3TIFA 1G64A 1WVMA 4MUBA 2QVYX 2MYPA 2AG6A 1PN3A 4FXPA 3U3KA 1QHSA 2J5RA 4RD6A 3SE7A 2CGEA 4Z7QB 3OPVA 2QLLA 1YMUA 2VUHB 5C8YB 2NVBA 4LOHA 3UV3A 3GPLA 2VUIB 4MQ5A 3LSTA 1PLJA 1EWYA 3IUBA 4UEQA 5FO1A 1SUCA 1NXWA 1Z0ZA 3B70A 2UUBB 3HYCA 3KETA 1QPBA 4NV1A 5AM0A 1MH1A 2QHXA 4Y2YA 4ZYVA 1AN0A 2C59A 1CXZA 2NXEA 3RE1A 1E2UA 4TXLA 1Z6QA 3A4MA 3MG9A 4BHTA 2ZG6A 4FDMA 5E2IA 4D4LA 1E7YA 3AOEC 5CH5A 4JYZA 3CJQA 2DHEA 4J4TA 4MUXA 4P7KA 4Q4HB 5AI0A 1YQUA 3RSZA 3CLKA 1US8A 1FRQA 1V8OA 2REOA 3AR2A 3H5IA 1E9FA 1VE3A 1ECCA 2I8LA 3HA3A 2Q41A 4YRJA 4CMHA 1VSUA 1IHXA 4A16A 4QJ3A 4OHYA 1SMKA 3ROKA 5F4ZA 1RLIA 1R66A 1Z16A 1GAJA 3VUFA 1XZPA 2G63A 2X8LA 4B7UA 5CB6A 1CFJA 1BROA 4LWPA 5JH7B 5JD3A 1M2KA 2CB9A 5AVOA 3MIZA 2JANA 2JF0A 4ND3A 5CDHA 5JIBA 5JJKA 1K7CA 2G1JA 4IDNA 5BSUA 3T7DA 1KTIA 4PRKA 4CKEB 4A8JC 4MS1A 3CZCA 2MINA 4IIJB 4QTZA 5FIUA 1N2GA 1PAUA 1XHFA 2P2GA 3BXGA 4MCAA 4MPRA 1YCHA 2YY5A 2PKEA 3DFFA 4O2RA 1KEKA 5K2OA 2CDAA 2CUNA 4RDHA 3N7UA 2HMTA 2WHPA 5JMTA 3C3KA 3ZOZA 2GN1A 2BV3A 3WA7A 2O0KA 4WLUA 3K9GA 4H27A 4LHEA 3VZBA 3SC4A 2BFFB 5DRYA 2VXOA 2ZRPA 5CA1B 2LV8A 2VSXA 1M8FA 1X0VA 1B73A 1O0BA 4RBNA 1PGNA 4GZ5A 3QY0A 3RGGA 5JXGA 3RYCB 1Q0UA 1GRCA 1SZCA 1DX9A 4FYPA 3TI9A 3AYXB 3AF1A 1P1JA 4TWAA 1NLYA 3K31A 1KXZA 1ZC3A 1L5ZA 1JWAB 3ELWA 3N2NA 4EYSA 1QH1A 3ST7A 1GPUA 4Q1CA 4LE1A 4AF6A 2QENA 3P9NA 3V2UA 1U3WA 4XSGA 4WT7A 2ZJZA 1P60A 1YFZA 2J31A 3OT1A 3H97A 1NQ5A 4N5NA 4QHYA 2J3MA 2LVBA 2BF4A 3MWEA 2J6HA 4AMYA 3QSGA 3B1XA 1SBYA 3ZWKA 3AY7A 4NS4A 4D42A 4OHZA 2CJYA 2PH5A 2IV7A 5AICA 1DUIA 4KE8A 1ONPA 3GA0A 1YBVA 1QIHA 4XWGA 1R9MA 1JQ5A 3CR8A 4OAPA 1M2VA 2BVNA 2L19A 2PR7A 4QWMA 1HDIA 5JEEA 2O7QA 4IIBA 5DN6A 1Q14A 5JAPA 1DXHA 3GARA 4QXMA 1FUIA 4UOEA 2VDLB 4RCYA 4KXNA 4JL6A 3PR2B 5EJGA 5TEWA 2HBZA 2WTUA 2PZGA 2VPXA 1MTOA 4JLSA 2Q3DA 4CLRB 3PFFA 3FOBA 4B8YA 1FYFA 1PJCA 1FQJA 3O3MB 4C5CA 3S40A 2QTWB 3RTDA 3PVSA 3EXG1 1XKTA 1GA4A 4BMPB 1Z4QA 5ECWA 2L69A 3VMMA 1B2LA 1V71A 3NCTA 4ZV7A 3DD1A 3KKEA 4GGMX 3C8DA 4RGYA 3K0KA 2Z1MA 1XNQB 4RDCA 1AKQA 4FD3A 1O95C 1S7CA 1W0JD 1XRSB 2AFIA 4F2GA 2X5NA 1GN9A 2GK7A 5LZ9A 1GA6A 3DZHA 4P36A 2PU7A 2HX1A 5BRJA 1K27A 4GR9A 3U17A 4AG3A 5BURA 3NGMA 4RK1A 1NXTA 3BVPA 2OZLA 2EV9A 3I01M 2PZKA 2UVPB 4RMJA 3T5MA 1TPYA 4B6PA 1Y37A 1X1AA 1XMPA 4ENWA 3C6XA 2GUWA 4QG7A 4X93A 4KEAA 5JD5A 3C45A 2QRUA 5EXSA 2Z9CA 2ZRGA 4HDCA 1QU2A 2LR0A 5DMXA 5D3ZA 3ZXXA 3MJTA 2MSDB 1G42A 2ECOA 3MD9A 4M76B 4NAVA 4DIEA 5KVVA 3GZNA 3WGLA 2OE2A 1MQSA 4L7QA 3ZWMA 3FM9A 4WWHA 5JC1A 3KK0A 3OHSX 1PWHA 5EE3A 5JCOA 1B8NA 1RPJA 3HB5X 3LOUA 1C3OB 1WU7A 2ACEA 1TM4E 3EGEA 1U8UA 1U2EA 3E9MA 3OOYA 4D81A 4M9XA 3WJ7A 4EA7A 2E9SA 3NFYA 2DFVA 2WD9A 3OPQA 2F62A 2HPVA 1H1DA 5KKNB 1D7AA 5CLQA 3C7KA 3BE4A 4OQPA 2JFNA 4R8SA 1WQ1R 2IXGA 3IGFA 4ZT3A 4ZV9A 5T3UA 3ZZNA 2HTEA 4FIDA 1JUDA 3L7YA 3NMUF 5CT6A 1LX6A 3KZ1E 1W0KD 2VJQA 2H7CA 2GBGA 5J4VA 2F3QA 2JFWA 4FNMA 5K8UA 2XWJI 3PT9A 5HFNA 4AKIA 5K0TA 2C29D 4Q3BA 3UYKA 3UMSA 2WV9A 1ODCA 1GTMA 3GX1A 3RO7A 3NKVA 1ZVKA 3AUKA 4QEDA 3HXMA 3M6IA 2KI5A 5SV2A 3PFIA 1Q0QA 4JLWA 2I9PA 4YQYA 2IBMA 1JDNA 1W5BA 1I24A 2FKAA 2FETA 3FDZB 1UKBA 1H2RS 2ZTSA 2V9ZA 3QKSB 4QODA 1UT6A 3RRJA 2HSDA 4B43A 4E5YA 4NCNA 4EUHA 1P0QA 5A4JA 3QVXA 2E4YA 2R4QA 3FCSB 2XYPA 1ND6A 2CVHA 4C2AA 1ZHFA 2NV0A 4G37A 4MW2A 3U6KA 3IMKA 3ZK7A 1H0RA 3VSEA 1PJRA 3S8MA 5LMZA 4Y6GB 5FCDA 1MENA 1DBWA 5TF4A 3L1UA 3VVBA 3VVMA 1XDGA 3FMIA 3IHWA 2W2LA 2PBZA 3C3AA 1L3BA 4LY3A 2PS9A 3V9AA 3VKWA 4PZYA 4WZAE 3E8XA 2W7TA 3BD7A 3WYGA 4KK3A 3R7AA 1E9SA 6LDHA 1GQ2A 1S8OA 2BISA 1FFWA 1R74A 4AY4A 4LYYA 2VP2A 4M8SA 1CEYA 3K2IA 2KM1A 5AMXA 4AS3A 5DXFA 6REQB 4A23A 3E18A 5BNIA 4Y2UA 2OPBA 1KR2A 4FGLA 3IKVA 4AURA 4MKIA 4UHHA 1LD3A 2DHDA 2RH5A 2EC5A 1Z4JA 1PKXA 5CK4A 1IOVA 1YTUA 1KK3A 2X7JA 3HL0A 3N5CA 1A97A 4OTZA 1E0KA 2QR5A 3FHJA 4U63A 4X0EA 4YDSA 4UFOA 5IUKC 4OFZA 3TTVA 4QM7A 3MUOA 3F73A 1N8TA 4O2BA 1Q7EA 2JPDA 1E3LA 3E9YA 3BWYA 4RY8A 5KWEA 2UUOA 3AHEA 3F4LA 1SVUA 3CXUA 1DXQA 5JWOA 3COJA 2BCGY 2AYYA 3F98A 4GX5A 3GP8A 4TQAA 2WA1A 5DNWA 1R0LA 1E99A 4AP5A 3CVWA 2NVWA 1JHXA 3HLTA 4TQ9A 3TZHA 5HQTA 2EU8A 3AESB 3N0TA 4JEMA 1M1ZA 3ESBA 2Z6UA 3LXXA 2YZ2A 1W2WB 2IYWA 2X3FA 1UJ4A 3EEOA 2GCEA 1FK8A 3E15A 3O83A 4A8HA 3U44A 3U0VA 3RHZA 5B36A 1O6ZA 2NU8B 3NXKA 5BQ5A 1N2HA 3DOOA 4MYRA 1TVKA 4F3RA 1R18A 3BFKA 3L8GA 1LU9A 1GUYA 1J00A 1ZVJA 2DULA 3ZCXA 4JNKA 2X0JA 3OPNA 1IK4A 3HCCA 2XUJA 3KLBA 1I10A 4XUCA 3D7LA 1YOVB 1ZQ9A 4EAAA 1LPSA 1TF5A 5AXCA 3FVWA 1QLWA 2NTEA 2CHVA 1FX1A 3KJGA 4G0XA 3UIEA 1V7QA 4Z4EA 5LP6C 2HPHA 3ENKA 4FR0A 3KJFA 3TL3A 3R0IA 5FP0A 5I51A 3DKPA 3DTVA 2FH5B 2V55B 3LV8A 5D5PA 1Y8RA 2AZMA 2APJA 3FTCA 3Q41A 4DHWA 3QI7A 3RT9A 2OK8A 1L5HA 3WKDA 4E21A 1K63A 1ZBQA 2D5AA 2ZR7A 3QV2A 2ZYIA 2WAMA 4KSYA 1KC3A 2B5OA 2GPWA 3D9QX 3DHYA 3B5EA 1G20E 4ZYXA 2QSYA 2QYTA 4J6EA 2SKCA 2B36A 5IX8A 4YJ3F 1AQ6A 4CEJA 1H2FA 1E7SA 4YP7A 1IQRA 4UZSA 3HXPA 5EWLB 3O4RA 3AQ4A 2X9LA 4JJKA 4RM2A 4TMYA 1TVEA 2Q6KA 4ZJUA 3ZEIA 4I2NA 1X14A 3IPCA 1K08A 1V8DA 3HY3A 5ARDA 2ZK7A 4LS3A 3C41J 1A8QA 2GS9A 3K0HA 4L7VA 4HZIA 4M6WA 2WKQA 4P33A 4R16A 3H8WA 2W37A 3I5AA 2WJ4A 4MCIA 4OUDB 1PS0A 1H2HA 1PSZA 4YUWA 1T5TA 1RXVA 3OC6A 2V7WA 1FL9A 3ILHA 2H1HA 3R3XA 2FGJA 2PMCA 4HS9A 5A4IS 4JNCA 3P9IA 4LZPA 4QFDA 4A8PA 1JQEA 4DIUA 4XGNA 5YASA 4NY1A 4RVHA 3WLPA 1M1UA 5E4YA 1T4DA 3MXTA 4M0LA 4QDTA 3S0JA 4MW5A 4C76A 1CE8A 3SVZA 3FUUA 1DAFA 2RHDA 2E18A 4PHCA 2R5WA 5A1TA 3U09A 3HUFA 1O96A 3GFTA 1CCWA 2C5LA 4PLVA 4KR9A 3IT0A 1QAQA 5ICGA 3FTPA 3CW9A 2XY4A 3Q72A 2IIQA 1U3TA 2VYCA 1F17A 2YHAA 4GPBA 3ZVRA 3NIDB 4B71A 5AVUA 3P2KA 3WLHA 4F9TA 5JU6A 2NSLA 1EFUA 3G02A 2OO5C 1Z38A 4JLVA 4LYDA 2X0IA 1FYXA 3IIEA 3LY7A 2GTHA 4MAFA 4OSOA 1Z6ZA 4KXXA 3SNKA 4HLDA 5HBGA 4R2JA 4U8HA 2K5UA 2N9UA 3HR7A 2IYEA 4LHXA 4Q3NA 4W1SA 3ESDA 4QO8A 4MX8A 5U4XA 1LK0A 3F47A 4MUIA 3IALA 5FPTA 2OOSA 1E5VA 4AG6A 4KQJA 5FWXB 2CDRA 5E4TA 5IVIA 1KMQA 1PFGA 4O1HA 3W6PA 2B8NA 1TAUA 1FXSA 4OKNA 1FDOA 1XQWA 2WPDD 5LYYA 4AICA 1VDMA 2IOFA 2VRCA 1DBPA 1FNDA 4JMLA 3QK7A 4RKRA 2C99A 2G67A 3O8NA 3TQRA 3MZ0A 4AO8A 5J1SB 2A5JA 3BB3A 5BVHB 5EA2A 2Y92A 3AHFA 3BJZA 2OBFA 2G9RA 3EY9A 3P8ZA 2GBCA 1DL5A 4UUNA 3TOVA 1RRMA 3NWJA 3NAMA 3PNOA 4BX3A 2AFHA 2PD4A 5DLDA 3S1AB 4BTVA 1E2IA 2AZTA 1XE3A 1NVXQ 2IL1A 3B9PA 4MVJG 4X5OA 4CUJA 7MDHA 1GKYA 3VXKA 3K0CC 3ROZA 4H1TA 5KOYA 1K2VN 2NTYC 4ZMRA 3W2EA 4U9HS 1KQOA 1B6TA 3OZBA 4K46A 4UU8A 1A50B 2Y9MB 3BWCA 3SXUA 2H1WA 1MVOA 4EFLA 1MOPA 4B7AA 5CG1A 5FR2A 3R5JA 4URUR 3W5BA 5ICMA 5CVDA 2V4MA 1CIPA 2DWOA 3LLCA 5EYPB 2RBKA 4LOIA 3GXOA 3L7KA 5IYZA 2ZJ6A 1P6XA 1ZY2A 1R9NA 1SBIA 3PQ7A 4OA5A 2G7ZA 3LPMA 4IIFA 2IU6A 4YFVA 1K8ZB 2PX2A 4EB6B 2V3VA 2BFDA 4L4XA 1FW6A 3VH4A 4DV5B 4IH1A 1JG2A 3R09A 3TPCA 4H7PA 4QXRA 2VT7A 1NOKA 1HDRA 1NW4A 4LMAA 4KXVA 3RRNA 5CTAA 4G89A 1AUQA 1IY9A 4HG2A 4N39A 5KVSA 1W85A 2X58A 1G9XA 2QRVA 1EHIA 2AMFA 4RSGA 1E79A 2C1EA 3VR6D 1NBMD 2G0AA 4MGKR 4V1CI 2JLYA 1WDKA 1IQUA 3SKYA 4UBLA 4KOEC 3C8UA 5EJIA 1UR5A 4QUGA 1PR2A 2PVCA 3N2KA 4CL3A 1PEDA 1UBOS 4HLUC 4W5JA 2H9AA 2BCJQ 5H4GA 4EJ6A 1FUUA 4FINA 2GZHA 3NEAA 4MVJM 2PXHA 1FYDA 1XQ9A 2CLKB 3GDOA 3WLMA 1VMDA 4G2NA 3WO1A 1YULA 4EW2A 1SVOA 1GXSA 4DZRA 2XQIA 3LHSA 4KZKA 4LRUA 4XRGA 5B3KA 1NXPA 1XLTA 3EXAA 1T36A 2EBFX 2YNMA 5BNTA 1RLMA 1STOA 3AF6A 2FP4B 4OQZA 4OQLA 4CN9A 4F2HA 1ZINA 2B1JA 2E2WA 2RJ3A 2B0CA 3MTGA 3QIAA 4US0R 1HETA 2I4OA 5ADVA 2NUPA 1YZFA 1RAFA 3NU1A 4HGZA 4YECA 2PTHA 1OFIA 3AVTA 1BNCA 4CF3A 2Z5LA 2JGJA 2VSYA 2R751 3CRRA 3ZXIA 3U7EB 1CT9A 4D5EA 1QYCA 1G60A 2AK3A 1CJBA 1Q2XA 2D3WA 2PYDA 3FFTA 3G7NA 3QELB 4OEHA 4KXFB 4R1LA 3C6MA 3ABIA 4WBXC 1RSZA 1EM6A 4D4IA 4YP1A 2N75A 3L0SA 3KUXA 5FYQA 3C4VA 4G0PA 2RGAA 1AC5A 1XOIA 3GK3A 4MS4B 4WEQA 2ADFA 4X00A 4XD7A 4IDFA 4K03A 4YAUA 1P7WA 2AB0A 1FP1D 2DM6A 3MS2A 4BKRA 3CIFA 2QAGA 2Z58A 3D4BA 4Q1EA 4ED9A 3OAAA 3LH5A 3DS8A 3KQQA 3D7KA 3I5UA 3C7TA 3OD5A 1MAUA 3RG2A 3W05A 4BNIA 3N6XA 5FBKA 1SUPA 5DKFA 3M1AA 4HGOA 3WK9A 2Q4BA 4KQXA 5DTEA 2WV7A 3BGIA 1XA4A 3C5VA 4EARA 4FX5A 4H08A 5IBQA 3A1UA 4NCXA 1F8YA 3NI2A 3QUTA 2PSSA 1NBOA 3NYWA 4L9SA 5HEKA 1DAHA 4J75A 3F96A 3GRAA 3PIRA 2V98A 1CZNA 5E4JA 3UAWA 2Y3IA 3ZHTA 1C30A 2ONYA 5K8IA 3OEYA 5IWAB 1COZA 5KC8A 5BUSA 3U7JA 4RK6A 1AVTA 3FZNA 1QDUA 2QR2A 2WHXA 2C3YA 3IXQA 1YR3A 3EIQA 1V1MA 2IUTA 1A7AA 5IXJA 2M6RA 3E3NA 4L28A 4F92B 4D3YA 1JXQA 3V5NA 3TMYA 3VMFA 1XZEA 2ID8A 2A58A 4ZVMA 3PDUA 4ZJYA 2IHBA 3GNQA 4BFCA 1BU8A 5CH3A 1B2RA 3KJIA 4HDNB 4LDJA 3W5VA 3I8OA 1GOTA 3NWPA 3QXHA 4QPZA 1VLHA 3J7AC 4O5OA 1WW2A 3ZI7A 2PRYA 4RZXA 4JBHA 10MHA 3LS2A 4ICIA 2NQ8A 2Q5HA 3AQIA 3EXG2 2HMAA 4FWBA 2JBWA 2NTNA 4B79A 4YLEA 3JAWB 4LYFA 3RS5A 2CXPA 2XYGA 4BZPA 4QQRA 4YI5A 5BN5B 1YQGA 8AT1A 2VSNA 5E0OA 2GCIA 3N2ZB 3NTXA 2X7HA 1OWNA 2WUWE 3HCFA 5FORA 3KVVA 4L8YA 3SF0A 5KX5B 2WIDA 2G1UA 5IC4A 4R01A 4FHFA 2GD2A 4NECA 1YS1X 5TGTA 1E94E 1JFLA 1T0JB 4ZC8A 3N28A 3TBFA 2BTOA 2OCKA