1WVGA

Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
356
structure length
352
Chain Sequence
SIDKNFWQGKRVFVTGHTGFKGSWLSLWLTEMGAIVKGYALDAPTVPSLFEIVRLNDLMESHIGDIRDFEKLRSSIAEFKPEIVFHMAAQPLVRLSYEQPIKTYSTNVMGTVHLLETVKQVGNIKAVVNITSDKCYDNREWVWGYRENEPMGGYDPYSNSKGCAELVASAFRNSFFNPANYEQHGVGLASVRAGNVIGGGDWAKDRLIPDILRSFENNQQVIIRNPYSIRPWQHVLEPLSGYIVVAQRLYTEGAKFSEGWNFGPRDEDAKTVEFIVDKMVTLWGDDASWLLDPHEAHYLKLDCSKANMQLGWHPRWGLTETLSRIVKWHKAWIRGEDMLICSKREISDYMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CDP-D-glucose 4,6-dehydratase from Salmonella typhi complexed with CDP-D-xylose.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
molecule keywords CDP-glucose 4,6-dehydratase
total genus 135
structure length 352
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.1.45: CDP-glucose 4,6-dehydratase.
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wvgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1wvgA02
2VNAA 1KEUA 1UP6A 3GPDG 4E31A 2GNAA 1FK8A 2A4KA 3ZWPA 3GF4A 2YHIA 3MJCA 2AXQA 4E5YA 2D59A 1E7MA 1NPDA 3GVXA 4RPLA 1R4NB 4R5HA 4UEKA 4RF2A 4B4VA 1B8VA 1D1TA 4GGOA 4AJPA 1R66A 4MP3A 1QYWA 5KIAA 4KQXA 4PZDA 3HFSA 5A04A 1NM5A 8LDHA 1H6CA 3ICCA 3UAGA 2EW8A 2NQTA 1GUFA 1HT0A 1E3IA 3P19A 2WTBA 4E33A 3IJRA 4EI2A 1NBOA 4Z0PA 3HN2A 2D2IA 1U7HA 3UHAA 1QLJA 2AW5A 1RYEA 1ARZA 2O23A 3OQ1A 4BKUA 4CQMA 4KUHA 4CMEC 4UUMA 5U4QA 1BTOA 4U5QA 1E3JA 2AE2A 4FR5A 3RASA 4ZVVA 5DBGA 3DZGA 4BUCA 3DTTA 5DBIA 2WEKA 1UR5A 3ZWXA 1PJQA 3VPHA 4BNHA 2VYVD 3KXDA 3PDUA 3LSYA 4LVCA 2PGJA 3HNPA 4CM8A 1Y8RB 2GDZA 3GT0A 5BSHA 3DONA 1GADO 1EFLA 5JO9A 3DAFA 4IIVA 3DMYA 3E9MA 5DOVA 2DUUA 1H2HA 4YB8A 4YAEA 4R9SA 2J5KA 4O0LA 3VVCA 4Z6KA 5JAIA 4J6FA 4KUGA 1EFKA 3K73O 1CYDA 3D3WA 3RD5A 1LA2A 1P33A 3H4VA 3U4DA 1ENOA 4YJDA 5BNFA 3EC7A 1H6DA 5CDSA 1U2GA 1MLDA 1IPFA 1ZUD1 4XB2A 3S1LA 1S6YA 3ITKA 1PGPA 2DU8A 1K6XA 3JQBC 1OBFO 3ONEA 4MPDA 4PG4A 2D8AA 4O6VA 4QEDA 2O3SA 2JCYA 3NT5A 1LI4A 5TJHA 3RROA 5B4VA 4HFJA 3PP8A 4HNHA 3AUUA 1XIVA 1LX6A 2FN7A 2O7SA 3IQDB 4GKBA 2GRAA 4BNTA 4DVJA 2NACA 2NVBA 1C0IA 1DC3A 2RH4A 2ZTLA 3F47A 4CQMB 2ZJ1A 4R01A 4J1SA 5GY7A 5EIOA 4XKJA 1B16A 4EUFA 2HK7A 1A27A 3WGHA 4CM9D 2CZCA 4Y8VA 1Y8QA 2FSVA 4ILKA 3WB9A 4BNZA 2CDCA 2VWPA 4MIYA 4IZHA 3D4NA 1GPDG 4J4TA 1ZSNA 4OKNA 3LLSA 1K6JA 3DBHB 2D5AA 3KHUA 2QYTA 3NV9A 4HFNA 5G4KB 4DUPA 4MDHA 5KJFA 2OHXA 2GLXA 4W9NA 1Z6ZA 1ZXBA 4LW8A 5AXDA 4BNLA 5KKCA 3SLKA 4ND2A 5G0WA 3TZ6A 3GRKA 4BGVA 3HN7A 5JPIA 3IJPA 3DZKA 3OEYA 2C2YA 1PL6A 3E9NA 2IRWA 2PGLA 3Q0EA 5HWSA 3WTBA 4E2ZA 3A28A 4PLPA 2GYYA 4P4GA 3DZBA 1Q0LA 3VKUA 4GX2A 5DF1A 3PHLA 5IDXA 2PH5A 3QWBA 3VPSA 4AJEA 3D5TA 3FI9A 1LLQA 1BMDA 5KKAA 4FFMA 3VPXA 1UAYA 4IJWA 2NTNA 3DOJA 4QTZA 1WDMA 2HQ1A 4TMFA 1YL6A 4NDNE 4YWJA 2YFHA 3W4IA 1N9GB 1WP4A 4CJXA 2D5CA 3SLGA 4YPOA 3F1KA 1B26A 1V8BA 3WLEA 5CP8A 1HYGA 3BTUA 3JQAA 5JY1A 1HWYA 4AG3A 3DAGA 2IZZA 1GZ3A 1F8FA 1L7DA 2IE0A 3AUSA 4Q9NA 1B8PA 3MJVA 3JD1A 4QSMA 1I3KA 2WWRA 4PLCA 4W82A 2VHXA 3OQ6A 4A5OA 4PVCA 2YHUA 5GMOA 2B69A 2BLLA 1E7RA 4P4LA 4TROA 1E6EA 3UICA 5KVCA 4M55A 4CM8B 3OETA 1DAPA 4IJKA 1IULA 4MP8A 4CLEA 3FTPA 4Z0HO 3BYZA 4R1UA 3O38A 1QG6A 3AUAA 2E4AA 1O8CA 2LDBA 3AW9A 4OHUA 4CM6A 3F5QA 1MP0A 1A72A 2GPTA 1NQAO 2UYYA 4E5MA 4ZQHA 3KSUA 1YQXA 1A7KA 1NASA 1D8AA 1I5RA 1C14A 5ILGA 1XEAA 1YS4A 1XGKA 4LGVA 3JQFA 3UCEA 4OGWA 1TT5A 2HAEA 4XGKA 4YJFB 1UZMA 4JGBA 3U49A 1BHSA 1BXGA 1LDNA 1HDZA 3GGGA 3NGLA 4NU5A 3JQEA 4Y6RA 7MDHA 4DMLA 1HE4A 1PIWA 1KVUA 4R3NA 1VRWA 1I3NA 2X22A 3ETEA 5IG2A 4NFSA 3WGQA 2BMAA 1PS9A 2AQ8A 2BFPA 3L4SO 1HL3A 4Q3BA 3IC5A 3TJRA 1JTVA 2O3QA 4IQ8A 3W4KA 3GUCA 4IXWA 3ONDA 4F45A 4JROA 3O8QA 1M6HA 1ZEJA 3PHGA 1XDWA 3N7UA 4J3FA 4UVIA 1FDWA 3FHLA 1YDEA 1K5HA 4WEOA 1M75A 5IZCA 1XHLA 3V1UA 2IZ1A 2RBEA 4G2NA 5HS6A 3FPLA 4AJ2A 2BFMA 1CETA 2YDXA 3OICA 1NP3A 4IMPA 3GAFA 3WX0A 4J9UE 1DFGA 1TVEA 4DPMA 3Q9UA 4A03A 4J2OA 4CMIA 1GL3A 2UUOA 3JD4A 2QRJA 2R6JA 3PXXA 2G76A 1W4ZA 2GGSA 3HWRA 4OJNA 4WUVA 4G65A 3HG7A 2EP5A 5DCUA 2O3TA 2DVMA 5ENVA 2PKRA 1E6WA 1U3TA 3ENKA 1Y7TA 1PQUA 3ZHXA 3C7DB 1IZ0A 3DHYA 3DMTC 3EAGA 1IPEA 2BF7A 4YT4A 4BO8A 4EW6A 1HLPA 4E4YA 1HYHA 1H2BA 2AE1A 3H9EO 4ONEA 1E7SA 1BW9B 2P5UA 1EK5A 4YBZA 2NADA 1Y81A 5IN4A 3AJRA 3GNTA 1ULUA 4N18A 3MJ4A 4CL8A 1I2CA 2W98A 1PZFA 3ABIA 4E12A 2VTEA 3JV7A 1QV7A 1YJQA 4U0KA 4CMBA 4FFPA 1TLTA 3AK4A 5CPBA 5K0ZA 3GEDA 4DL9A 4GWGA 1ENYA 3K8ZA 2DM6A 3H8VA 1D4FA 2VOJA 4GLOA 3G17A 4WNIA 2O3JA 3OIDA 3PZRA 1GAEO 1P44A 4BMVA 2O4CA 3UN1A 2VYVA 3QVSA 5AYVA 1UZNA 8ADHA 5L9AA 4GMGA 5CEFA 1PWXA 1DBVO 4EJ0A 5G0TA 1VL8A 2C7VA 3AI3A 1F0YA 4AJ4A 4R16A 4CLRB 4XX0A 3JQ6A 4UUOA 3ANMA 2GUGA 2FRDA 3ROKA 4BNJA 2Q1SA 4YJGB 4IJVA 1O5IA 4AL4A 1X1EA 4YAIA 3GDGA 1E3SA 4XD2A 1V3TA 4RO0A 4XA8A 1IZ9A 2I99A 4K6CA 2X7HA 4J91A 4FJ0A 2BFOA 2C20A 3LZ6A 1D7OA 2OORA 4CR6A 1LLUA 1BGVA 4OAQA 1Q7GA 3QWIA 1LC0A 1OFGA 1E1KA 4YJHA 1I3LA 5HS4A 2OXIA 3DBLA 3I9KA 3I9JA 1I0ZA 2YUTA 3ZWYA 1JWBB 1SC6A 4EDFA 3IS3A 4INAA 4DIOA 4KWHA 4E13A 3MJTA 5JMPA 1P1IA 4TKLA 1SO8A 2HMVA 4MP6A 3ZGYA 1X14A 2V6GA 1U4SA 1UP7A 3ZU3A 3WQQA 4M54A 3WLFA 3JD0A 4BMSA 2Y66A 4KDFA 5GZ6A 2RH8A 4LCJA 2TMGA 4ND3A 1NHWA 3WYBA 1R6DA 3PIDA 1TI7A 1C1DB 4DQVA 1KETA 4BNNA 1GEEA 3TL2A 1DPGA 4RLSA 3AWDA 3VZRA 1A9YA 2AG5A 3LU1A 1A4UA 2IEDA 1VE9A 1TXGA 2WE8A 4WCFB 4ALLA 5COQA 1BRMA 1WWKA 4A7PA 2X9NA 5TT0A 4YQYA 1NXQA 2I5PO 2FOIA 3D5QA 5A05A 2EJWA 1I2BA 3DOOA 2VT2A 4LCEA 2W8ZA 4JBGA 4CV0A 1M2WA 2Z5LA 4FSHA 3ASUA 4HFMA 3G1UA 4DWVA 4YRBA 1PL8A 4UEJA 4IIUA 1M6WA 4GLLA 3WGZA 4GI2A 2C2XA 3S2IA 3IUSA 3UH1A 1ZO8A 3PLRA 4YACA 1IOLA 1ZJYA 4ZQFA 4E32A 3R3JA 1Z82A 1E1MA 4MO2A 4ALIA 3JQFC 3RI3A 3CINA 1D1SA 4LISA 4EYEA 1YJ8A 3RJ5A 2C5AA 3M6IA 3JQGB 5A9SA 4R5MA 1V0JA 4DQXA 2EXXA 3NAQA 3BMNB 4DPKA 1KVQA 3A1NA 3OJLA 4EITA 1B2LA 2P9EA 1MV8A 3ZHZA 5JLAA 3QSGA 3E6AA 2Q49A 2B36A 1HE3A 4J4HA 3TN7A 2XXJA 5CDTA 3QWFA 5EN4A 4WLVA 1P0FA 1HSOA 1JW9B 5T6BA 1EQUA 4ZGWA 3L4BC 2OBNA 2VNSA 1SBYA 3NEPX 5F1KA 3QA9A 1MXFA 2B37A 5FF9A 4D3FA 2W90A 3OHSX 3EMKA 3OJ0A 1MXHA 2HJSA 1GCOA 1ZMTA 2IXBA 3C3XA 3DBHA 4ZHSA 2WMDA 2G5CA 4BO4A 1N8KA 2XF8A 4XZ3A 1DRVA 3GFGA 2SCUA 1WPQA 4I5GA 5KJEA 1K6IA 1P0CA 1CRWG 3UUWA 4B3JA 2ET6A 1ZXLA 3U3XA 3ZNNA 3TZHA 5GZ3A 3PGJA 1HDOA 2DPGA 1LSUA 2J3KA 3GHHA 3KM0A 4DLBA 5BSGA 4FIZA 3G79A 2GZ2A 2YV3A 1FDUA 2Q2QA 4FJ2A 3TWOA 5IXSA 3JQ8B 1FMCA 2ZYAA 3RUFA 2ZYDA 3WOHA 5A06A 3H5NA 5TJ9A 1SAYA 4D0RA 1I30A 4WLEA 3ANNA 3B6ZA 1CIVA 1O6ZA 3ZWVA 2PKQP 4RVHA 1X0VA 1LDBA 3WQSB 4TZKA 3I9OA 4BV9A 3MTJA 3QY9A 4NHEA 4Y98A 1FDSA 3H9GA 3LC2O 5C5IA 4E5NA 1TEHA 2R00C 3DBRB 2EJVA 1PWZA 3KYDA 3ZWCA 4FCCA 1SOVA 3C8MA 3GZ4A 3K5PA 4DC1A 1BDMA 1Z7EA 3ZNPA 4S3MA 5F5LA 5JC8A 2OO5A 4NIMA 4R54A 1QYVA 5EQFA 4D79A 1J4AA 1LRLA 3STHA 4I5DA 1T2CA 4JX8A 4UEOA 4FB5A 2CY0A 1EE2A 3AY6A 1Y6JA 4WOKA 2EWMA 3PIIA 2AQHA 3BHMA 4J7CA 4LSMA 4OXKA 2NVWA 3BTVA 3ETDA 2PV7A 4YVFA 4PRKA 2IODA 1GU7A 3VKVA 3Q6IA 4NBUA 1PJTA 5HTOA 1NNUA 1P31A 1R0LA 3CKYA 3M2PA 1DJNA 3NT2A 4IINA 4LSWA 4Z0TA 3WMWA 2B4RO 1VPDA 2YZ7A 4CQMD 5C3MA 1DOHA 5I7EA 3EVNA 3C7CB 2NU8A 4B4UA 4BNWA 3G1TA 1DDOA 1PGOA 2AG8A 4II3A 4CMKA 1B15A 3GPIA 3DMTA 1XSEA 1UXGA 3OECA 1C0KA 5JW6A 4HY3A 4O63O 4NFHA 2Q99A 1IY8A 4UUPA 3NGXA 1EVJA 4NI5A 2EP7A 1J6UA 3G3EA 4RZHA 4RPJA 4TRJA 2PWZA 3H5AA 4BOYA 1P74A 4GX1A 4WCFA 1NFFA 4EZBA 2HRBA 2NWQA 4WK6A 2O2SA 1DHRA 2Q46A 1DB3A 1PX0A 1LQUA 2DT5A 3DZIA 3ONFA 4MVJM 4TQGA 5MDHA 2VQ3A 3GRPA 4RLHA 1DC4A 3MZ0A 3PYMA 3S8MA 1DFIA 3GZNB 4RV9A 2GN9A 3H9QA 2PZJA 4CMAA 4BS9A 2VZ0A 3A9WA 2WDZA 2VHZA 4HX5A 4AICA 1GDHA 4PZEA 4AJNA 2Q2WA 4D42A 1LDGA 3I4CA 1E77A 2VHVA 4OQZA 4RDHA 4BNIA 2VYNA 3S2GA 4HFRA 3AFMA 2AA3A 4L73A 1NFQA 3ZCXA 4C4OA 5IAAA 1L1FA 1NVGA 4GMFA 4F6CA 3LT4A 1GD1O 1N92A 3ROMA 4GVLA 1LRKA 2QIOA 1KEWA 2YFQA 3PQDA 4URFA 2YV2A 4RF5A 1MA0A 3TDKA 3Q11A 5A9TA 4B79A 3AFNA 3H2ZA 2B83A 3FWZA 3PZBA 3AUTA 1M66A 1E3WB 4F6LA 4DYDA 1BXZA 4PLYA 3D64A 2OFPA 1DAOA 1K89A 2FPGA 4HV4A 2EKPA 5G0UA 2VTDA 4ID9A 1ISIA 3DBRA 5TC4A 1GQ2A 3BMQA 3DZHA 4ITUA 4MVJD 3GG2A 4BNVA 3HUDA 3UFXA 2QHXA 1E3WA 1ML3A 3QJ5A 1YWGO 4LRSB 5JCJA 3SC4A 1GZ4A 3FNEA 3RAJA 4LK3A 2VOEA 2VZ8A 3UCFA 5L7TA 1XELA 4CMHA 1EVIA 5I7FA 2GZ1A 2CF5A 2Z95A 4NBWA 4II2A 5EQDA 4L74A 4OQYA 4Y67A 4TKMA 2BELA 2H5LA 4J90A 4OXNA 1VJTA 2Y68A 1UZLA 4XIJA 3SX2A 4BO9A 4E2YA 1NVTA 1QRRA 1LDEA 2Z1NA 4WECA 4WKGA 5T5QA 2UV8A 3L6OO 5A5EA 1X15A 2D1YA 3E03A 1X7HA 3OIGA 1ZMOA 2NLOA 1CQIA 1I8TA 2Y0CA 3ZI0A 4AJJA 4ESOA 4HNGA 4PRLA 5TS3A 2ZB3A 5U9CA 2EERA 3MTGA 3K31A 1QORA 3PWSA 1A9ZA 4ZD6A 1YH3A 3GAZA 3D1LA 4MIOA 2C59A 4B4OA 2OMEA 3OJOA 3ADOA 3BIOA 4YRAA 2PTGA 1JLLA 1W0CA 3FSRA 3HE3A 5AOVA 2Q4EA 3QE3A 4PG8A 2C82A 2X9GA 1M67A 2LDXA 5DP2A 2PR2A 4OM8A 4IDDA 2VWGA 3PPIA 1EK6A 4FFLA 4JXKA 4PG6A 3PQFA 4A26A 1FDVA 1HETA 3MOGA 1XYGA 5IZCC 1SZJG 4IM7A 2WD7B 5B37A 3L6DA 4GX5A 5ILOA 3O03A 2H1SA 3GVIA 5IDWA 2BKAA 4BQRA 5A3JA 2C07A 4JJIA 3B20A 3INTA 3JQAD 2A92A 3FWNA 2X0NA 3B1JA 4ND1A 4K9DA 5T8KC 3OMLA 4GL4A 4CMGA 1XQ1A 4YJFA 3AY3A 6LDHA 3H65A 3VZQA 4IQGA 3RFVA 4NMHA 2Q1UA 3ZWOA 3VVBA 1OZAA 1WW8A 2YDYA 3BAZA 4FOSA 3WGIA 4R68A 4CR8A 4MIEA 4PLWA 1OMOA 4E5KA 4N7RA 1JA9A 1N1EA 2ZB4A 5ER6A 3PJFA 1WMBA 3QW2A 4E21A 2JFGA 2J3HA 3DXFA 1UP4A 3I6IA 2AQKA 4A10A 4B4WA 1PZGA 1B0AA 1NPTO 4QFCA 4CLDA 3HDYA 4HKTA 3SVTA 3OH8A 3PLNA 3K30A 3KTDA 1NR7A 3E5MA 1FXSA 3TOZA 4CM7A 1ZK4A 5BQFA 3I3OA 2XOXA 4NPCA 1V35A 2FY8A 3AOGA 2POQX 4DYVA 1UXJA 3TQHA 5I8WA 4O5OA 4NBTA 4YEDA 4RVDA 4CUJA 2ZCUA 5HA5A 1AE1A 1MG5A 1ZW1A 3DZJA 3AY7A 2DPHA 2FSSA 2AEFA 4LRTB 1N1GA 2CVQA 2JFFA 3WBBA 5AQ1A 3I9LA 4FS3A 4BO3A 1U9JA 3ITDA 1NPYA 3JYOA 4DIFA 2OL4A 4O59O 1V3UA 4NNJA 4BNKA 1VL6A 5CG2A 4CUZA 2Q3EA 1ZK0A 4RORA 1OC4A 2HO5A 2X86A 3PEFA 4YR9A 5L40A 5TGDA 3I1JA 2NU7A 1PJCA 3PVZA 4B3HA 3GDOA 3VTZA 1JVSA 1N9GA 4DIBA 4YJHB 4YRDA 4Q3AA 3GVPA 1JAXA 4L8VA 2I3GA 3RUIA 3DR3A 2PD6A 3GOHA 2X5OA 4I08A 2EEZA 4C7KA 1JWAB 5L51A 1H94A 3VDRA 4RZIA 3ZV5A 4FFOA 3ZHYA 3MOIA 3H9JA 2JAHA 3CTMA 5ITWA 3X2FA 1NQOA 4IDGA 1IHXA 2B5VA 2C54A 3WIEA 4D41A 3KZVA 4MVJF 1YL5A 3S2FA 3IDSA 2H6EA 2ZB7A 5I9MA 4DREA 4YCAA 3WJ7A 2P5YA 2VWQA 1GQYA 2PK3A 1K2WA 3NRCA 3NUGA 4MKRA 1WVGA 4WJZA 5TF4A 5JC1A 2Y1CA 1JQBA 1X1TA 1CQJA 3RC9A 2DLDA 1ZVMA 2UUPA 5CEJA 3MJSA 4FW8A 3LF2A 1NVMB 1ZZEA 4PLVA 3RIHA 1MX3A 3ADPA 2D3TA 5CDUA 1UDAA 1EBFA 4MVJG 5L95A 4YT8A 1AHIA 4HP8A 1ZBQA 1TT5B 4CM1A 3ENNA 1LU9A 5DOZA 4WGGA 4RVUA 3GC6A 3WFIA 1BVUA 3JQBA 4N5NA 2HMUA 3RKUA 1NQ5A 2I6TA 2Q1WA 5J23A 1T2AA 3IMFA 5LCXA 3AOEA 2EF1A 4OO3A 3B1KA 4BNFA 1ISFA 3O4RA 1LNQA 4GKVA 4BGUA 2NSDA 1C1DA 2VT3A 4S1VA 1F06A 1E7WA 5COBA 4CM5A 3ZV4A 4U6SA 1W73A 2E82A 4NK4A 3GY0A 3JTMA 1CERA 1KC3A 1PJ3A 1QYXA 4NR0A 2VRCD 2V6MA 1WNTA 3KVOA 2EW2A 3WSVA 1V6AA 3QHAA 2PD3A 5G0VA 4ND5A 4TWRA 4CMCA 1BDBA 3CMCO 1E5LA 2QRLA 2QYSA 3QP9A 3NJ4A 4H7PA 6ADHA 1HDXA 4E2WA 3VZPA 1LUAA 4I5FA 2BI8A 4B8ZA 1BWSA 1IL0A 2CFCA 4XJTA 1ZJZA 3F9IA 3OQBA 5JSFA 1K0UA 5KNLA 3I23A 1XKQA 2O3RA 4BV8A 5C37A 4JJFA 4JN6B 1YQGA 1G6KA 1ORRA 4CMEA 3BHIA 3CEAA 3CH6A 4FPXA 5IZ4A 3TFOA 2AEJA 2JCXA 2W2LD 3O8QB 4MJLA 1DEHA 1YXMA 3NTOA 3G0OA 4AFNA 2O3UA 3FNHA 1XU9A 4I1IA 3QWAA 3DOCA 1GUZA 1ISMA 4R1TA 4MVJP 1DLJA 4OMUA 4NG5A 1T2FA 4KP7A 5DCYA 1VKNA 2DC1A 4A0SA 4R9RA 3F5SA 2B35A 3PTZA 1B14A 1XA0A 1H93A 3M2TA 4CUKA 4GGPA 5ICMA 2P9GA 5JDCA 4QUKA 3PQEA 4XDZA 3JD3A 1NQTA 1H6BA 5L45A 4E0BA 3PDJA 3FBTA 1LBEA 1UUFA 1DHTA 4NFYA 5B1YA 4D45A 1FJHA 3IKVA 3KSDO 3V5NA 2YJZA 4WNCA 1U8FO 2TMDA 4WLFA 1C1XB 4PVDA 3VAZA 4WCDA 2O7QA 1WZEA 2BH9A 4UREA 2HK8A 2DAPA 2R00A 3IKTA 2Q1TA 3F6YA 5EERA 3CZMA 3D3EA 5K6AC 5EESA 3QRWA 3WTCA 1EDOA 4Q3CA 3OA2A 1EBUA 2OP0A 4F3YA 1RKXA 1PL7A 4BKPA 2FR0A 3B1FA 2QZZA 2YV1A 1DIRA 4GSKA 3PHJA 5CPFA 2WE7A 1N5DA 4RVSA 1Q0QA 4YT5A 3RBZA 4MVJH 5A02A 3ZWMA 2JD1A 1IE3A 3ETGA 3LF1A 4NQZA 4ZJUA 3WG9A 4E30A 3WGGA 1F8GA 2BI7A 1SEPA 5F5NA 4N5MA 5FI3A 2XPCA 4AJOA 4L9RA 4XR4A 1HEUA 4CLHA 5T8KA 2GN8A 1YB5A 3H6KA 5G4KA 3V2GA 1VJ1A 1H9AA 3OP4A 4CLOA 1PJLA 2EG9A 5FYDA 2PD4A 5TRTA 1T24A 2X6TA 1I33A 3BTOA 1KEPA 1ISGA 3UKOA 4Q3DA 3E1KA 3I52A 3CIFA 1P1FA 4KQWA 4XYGA 5ENDA 5G2OA 1MB4A 5H81A 1MUUA 3AOEC 4JCOA 1XQ6A 5L3ZA 4DC0A 4B3IA 4EBFA 2W4QA 3W1VA 4GX0A 2JHGA 4KDEA 4QFDA 2X9VA 1RM4A 4U0JA 4XYLA 3BMNA 4WCFC 4OIMA 5HM8A 3D0OA 4KTTE 1VLLA 4KMSA 3E18A 3LLVA 3A06A 5EMHA 1P9LA 4ZRMA 3K2EA 2EV9A 1PQPA 2AEMA 1T1RA 4GWKA 5JO0A 1CDOA 1DIAA 3KYCB 3KYDB 3LK7A 2Y0EA 2IXAA 1X7GA 3KUXA 1EZ4A 3R3SA 4RQTA 5DCWA 3TF5A 1OAAA 2EIHA 4ZQBA 4J49A 3UF0A 3FN4A 4DQUA 2ZJ0A 1X13A 3WICA 3VOSA 3PGXA 3EK2A 4O1MA 1HRDA 4BKQA 3ASVA 3F46A 2AHRA 1HTBA 1R37A 3KETA 4Y6PA 3DWFA 4W99A 1PJ4A 1GYRA 1I3MA 2HU2A 3CXRA 3FPCA 1U5AA 4D43A 3L9WA 4L0QA 1Z73A 2IDZA 1Q0HA 3N74A 2AMFA 1KERA 4R4JA 3HHPA 1DJQA 2X0IA 1J5PA 2EKLA 5JXWA 1AGNA 4XQGA 3W8EA 2ZB8A 3HFGA 3X2EA 2P2SA 1KVSA 2HSDA 2I67A 4OKIA 3SEFA 1JVBA 5B4UA 5ADHA 1SOWA 2ZATA 4PN3A 3OFSA 4RVFA 2P91A 2YHIB 1Z7BA 1QKIA 4LMRA 4W7HA 3HZZA 3BHJA 5K9ZA 3DEYX 3A4VA 1Q7CA 1J49A 1G1AA 2NVUA 3OSUA 4IGEA 1T2DA 5HRUA 2PA3A 3AI2A 1BW9A 1KY5A 1RJWA 1RM3A 2FZEA 4TZTA 4ALMA 3RSHA 3VPGA 4M87A 5JYEA 4PIVA 5C7IO 4FQ8A 1HKUA 2VHYA 3MEQA 3QVXA 4CLOB 4CV2A 1R4MA 1ZK1A 2D4AA 2HRZA 3JQ9A 2WYUA 5BSFA 1B3RA 2OZPA 1DRUA 2W2KB 5DNAA 3JQCA 3K6JA 1I24A 1Y9AA 5H83A 3E82A 2Z1MA 1R15A 2E49A 2Y0DA 4PLFA 4BGIA 3Q1LA 4DA9A 4IMRA 2DBZA 4CQLB 1SB9A 1T25A 3E8XA 1NAIA 3EYWA 4ZU3A 5TLSA 3U5TA 3PI7A 2EKQA 2VN8A 1AXEA 3PFFA 3WMXA 3P2YA 2Y99A 3IIEA 3ROQA 1H5QA 3U9LA 5FEUA 2GF2A 5BT9A 1RM0A 2FR1A 3L9XA 4BO5A 4P4NA 2VCYA 1GYQA 1SB8A 1U8XX 5TT1A 4BNXA 2DBVO 3K92A 1SPXA 3OBBA 4NBRA 3GGOA 1SNYA 4NK5A 2Q50A 1NR1A 1E3EA 1XCBA 2YQ4A 1CEQA 4CMJA 3KOUA 4UVDA 5JS6A 2X58A 4R1SA 4CMIB 3DL2A 5JBIA 3WS7A 3FNGA 4FFRA 2NU9A 4ZQEA 3I9MA 1HZZA 4RJTA 4A73A 1WLYA 3RQSA 5KJ6A 4P38A 3BTSA 2CD9A 4CM9A 1GV1A 4YA6A 3KYBA 4BNYA 1WDKA 3PYXA 3R6DA 4IBOA 3ZZNA 5FI5A 1DO8A 1NX6A 1R0KA 2JD2A 3GLQA 4I8XA 4AJ1A 3GEMA 2O2YA 4PLZA 1PEDA 5KVSA 3C1OA 1E92A 1N2SA 1GQQA 2HKIA 4XYEA 1CWUA 4GBJA 4J1NA 4XGIA 3EDMA 4ZQGA 4DBVO 1UXKA 4K6FA 4Y6SA 1UH5A 2P4HX 2ZQZA 2VUUA 4D3DA 4L4SA 1YE3A 4PLHA 1E6UA 3WXBA 1EUZA 3OEWA 4P22A 4UUNA 1ONNA 2JCVA 3JYQA 1E1LA 4WOJA 1DRWA 3I83A 4JP3A 5JAMA 5LDGA 1Z74A 3OIFA 1DC6A 2PLAA 4MVJI 1LRJA 3INGA 1QXSA 1EUDA 3DZFA 1U3WA 1PS8A 1GUYA 1YO6A 3DQPA 3KO8A 3H2SA 4XRRA 3VH3A 4CM4B 1PGJA 4L75A 4DLLA 5JFOA 2IYPA 5COAA 5KWEA 4Q3EA 3VZSA 4EUHA 3GHYA 2NV6A 1Q2XA 1ADBA 2GCGA 5A9SB 3RC7A 2P9CA 3U4IA 4DMMA 3EY4A 4RGBA 5I8ZA 3DTYA 2Q4BA 4KZPA 1GTMA 2AQIA 1A71A 4KTVE 1B7GO 1R16A 4FOOA 4E6PA 4I9HA 4ROSA 4J1TA 2ILTA 3W6ZA 1HLDA 1W6UA 4J1QA 4IS2A 4A2CA 1QYCA 5A4DA 5TIIA 3V2UA 4ZN6A 4CV1A 2A94A 3WBFA 2NNLD 5THKA 1LDMA 3NDIA 5F21A 1U1IA 4L76A 1KBZA 2HDHA 4RPGA 3AI1A 2JAPA 3A14A 3CPSA 2HMWA 1E5QA 4MVJE 5A1TA 1DSSG 5CAEA 3K96A 2F00A 5EL0A 2ZCVA 4HWKA 5L53A 2GERA 4W4TA 2FWMX 1GCUA 1ZSVA 1YKFA 1T4BA 4PCVA 2Y1EA 3WYEA 4D3SA 4PG7A 1FDTA 1ID1A 1T4DA 1NAHA 3OF2A 3PHIA 2NTVA 1MC5A 1ZH8A 3HDJA 4ND4A 3ZW9A 4CL3A 4IDAA 1HDYA 5B12A 1Z75A 4FC7A 1H6AA 2Y1OA 3FTNA 4IDFA 2Q45A 4BNGA 2QW8A 4BVAA 1I36A 4TRNA 2XXBA 1WDLA 1ZNQO 1QMGA 5DN9A 4I5EA 2OGUA 4NJOA 2FPIA 1Y5RA 2CSUA 4XYMA 4QO8A 3R0IA 2B5WA 4HBGA 2CMDA 2I3AA 3JYNA 4IQ0A 2Y93A 2GN4A 1JU9A 1JN0A 3ULKA 5IF3A 3RBVA 1RPNA 4PLTA 1MFPA 3WGYA 3F4BA 2FMUA 2BRUA 2WYVA 3NDRA 1ISJA 4BNUA 2DFVA 3BZUA 4IXTA 2VZ9A 5TX7A 1PJ2A 3V8BA 3WJAA 1NWCA 2DKNA 3UVEA 3IP1A 1ZSYA 3E48A 3V2HA 2ZK7A 3L07A 3ZU4A 1GEGA 1R12A 2WD8A 3RCBA 3KBOA 1ZK3A 4TSKA 3RJ9A 3UCXA 4DBZA 4BO7A 4RPHA 3HDQA 2JHFA 5BR7A 5THQA 5I9NA 5DP1A 4JNKA 2JL1A 4R69A 1D3AA 5CHEA 3KSZO 5BSEA 4ZICA 1Q1NA 2F1KA 3JQ7A 4YXFA 3ROPA 3FRJA 1VC2A 1VL0A 1ZK2A 4XQCA 3FR7A 3FBGA 5EJ2A 2ZIZA 3HADA 4WPGA 3RFXA 1HSZA 5A5FA 4RDIA 3TPCA 1BXGB 2JFHA 2V65A 1U5CA 2GD1O 1DLIA 1O95A 3KB6A 1Y8QB 2RHRA 1KVTA 2CNBA 5DDIP 2NU6A 1U3VA 4QO7A 1RWBA 4RL6A 4YAKA 5GZ1A 3RUEA 1GPJA 4K1LA 3RBXA 1SEVA 4NBVA 4IGFA 2DTDA 3UW3A 1LJ8A 3KEQA 3SXPA 1EQ2A 4I9UA 3QQPA 1T1SA 4OOFA 3GH3A 4BKRA 2QX7A 3I4FA 5JDIC 2JJYA 4Z9YA 2NUAA 5DZSA 1Z45A 2X4GA 4Q3NA 2DBRA 2ZTUA 2Y67A 1EVZA 4CV3A 5I9LA 2ZQYA 5JMWA 1PJSA 3C7AA 1BXKA 5KTKA 4EEXA 3BMOB 5F1PA 3RWBA 2UDPA 5KCZA 3EHEA 5ITVA 3QLJA 1EVYA 4XB1A 1ONPA 2CF6A 4Z3DA 5AXCA 5BNTA 2G17A 1EMDA 3D4PA 4D7AA 3GMDA 5I7SA 2GR9A 3PYLA 2JKVA 3ZV6A 1ISHA 2HMTA 4KOAA 2Y05A 4BL5A 2H63A 5JCJD 2X1HA 3H5RA 3JQ7B 1O94A 1LQTA 5IJZA 2WD7A 3ZWAA 1ULSA 4E2XA 4M86A 1P1RA 2B0JA 1IYZA 3TL3A 1K3TA 1P3DA 3P2OA 3WIDA 4MINA 1A4IA 5BNIA 3LT2A 1MG0A 3JQAB 5H82A 4MKXA 4YTEA 1B8UA 1T26A 3GMSA 3BMCB 4YYZA 1IB6A 2J6IA 3D4OA 4IDBA 4Q39A 5IDQA 4BKOA 3E9QA 5CEEA 1A7AA 1VSUA 3C1TA 4IY1A 1O89A 4E3ZA 3I9NA 1UAGA 1EUCA 2O50A 4UAGA 3HQ4O 1Y1PA 4IUYA 1YVEI 3H7AA 4FJ1A 1G0OA 4U6QA 2E6UX 2J8ZA 5L7WA 4XWYA 4NJMA 4EGFA 4XRGA 4XCVA 2O48X 1P45A 2X0RA 1YB1A 3DC2A 1QR6A 3BMQB 4W6ZA 1I2ZA 3CMMA 1I01A 2B4QA 4J0EA 3D7LA 3JQ8A 4MOWA 4PG5A 3MWEB 1L7EA 4HUJA 3VPFA 3GN1A 4M1QA 3GVCA 5CDYA 2QG4A 4OH1A 2PY6A 1PS0A 3AM3A 4FGWA 4N5LA 3T4XA 1SCUA 1PGNA 3TFQA 5T67A 4CQLA 5ICSA 2J3JA 2CVZA 3CZRA 4W7IA 1LLDA 3QVTA 4OSPA 4KWIA 1N7HA 3PK0A 3RUHA 3RUDA 3DFZA 3DHEA 3KV3O 1PZEA 3WGTA 3NDJA 1BSVA 3DHNA 4NU6A 4LN1A 4J4BA 1JAYA 1LSJA 4J0FA 3LDHA 1XLTA 3QWHA 3VC7A 2QZ9A 2HLPA 3CE6A 5C7OO 4OL9A 2NQ8A 1YB4A 2GSDA 2IYOA 1H0KA 4RF3A 1ZKMA 3GNSA 4B7CA 1YQDA 3JQ9C 4H3VA 4G5HA 1AUPA 1C0PA 2HJRA 4BB5A 1V3VA 2RHCA 1OI7A 4X54A 3GNQA 3TZQA 1WAMA 2I9PA 3K2BA 1DXYA 1HDRA 2GO1A 1U4OA 3OM9A 2J5RA 4YAJA 3PWZA 1HYEA 1LSSA 3VH2A 4L4XA 1F17A 4EEZA 1B3BA 3RU9A 4M89A 2PZMA 1WZIA 5TSDA 3FD8A 4JJGA 1AXGA 1KEVA 4IZIA 3D3WB 1PTJA 1YGYA 3OJFA 3VTFA 3WFJA 4TVBA 2ZYGA 2PKQO 4JIGA 3LT1A 4GH5A 1QV6A 3H3FA 1ZIDA 3FNFA 1ZEMA 4QT0A 4GPD1 4R3WA 1GY8A 2G1UA 4GQAA 3W4JA 1BG6A 3MCVA 1KYQA 3ZH2A 2YYYA 4TRMA 5AXBA 3WNVA 1CF2O 1E7YA 3PFWO 3BMOA 4ALJA 4BO2A 1JKJA 4DGSA 2FP4A 4U8GA 5IDYA 1H9BA 1WMAA 1YOVA 4DLAA 4PZCA 5DBFA 2PNFA 3ZDFA 4C7JA 1LSOA 4AJHA 3VH1A 4ALNA 3EGOA 1X0XA 3BA1A 4YJGA 3HDHA 1EE9A 1P77A 1PJBA 3WDSA 4P8RA 3FR8A 5AVOA 5CFZA 2EGGA 2IEBA 1DFHA 4M8SA 5EINA 4CLRA 1MC4A 5G4LA 3ORFA 3GA0A 5IN5A 3QIVA 5C7LO 5MGBA 3GR6A 3C1AA 2P68A 4HXYA 2C0CA 3SJ7A 2NM0A 4YDRA 3F1LA 2X8LA 2J3IA 4Z3KA 1VSVA 2PFGA 2CUKA 4FN4A 5F1OA 3TOXA 3ST7A 3DBLB 3KRTA 1E0DA 1HE2A 2Y1GA 4FDAA 4NJMB 4FC6A 2D0IA 3UXYA 4GVXA 4I9NA 1F14A 1FF9A 3B70A 5JAQA 5TQVA 2BD0A 3WSWA 3WNQA 1YBVA 1N7GA 2HUNA 4DPLA 3HSKA 4PFJA 4L4RA 3C24A 5T57A 5JAZA 2YQ5A 3DB2A 5LC1A 5ES3A 4RVGA 3GUYA 3TSCA 4DRYA 3AU9A 2VYND 2VRBA 1LTHR 3GGPA 5L7YA 5KVQA 2EHDA 3L0DA 2PGDA 3U09A 1ZFNA 2IZ0A 1EDZA 3HJAA 4XQ9A 1GYPA 2CDBA 2R2GA 4U7WA 5JDIA 4Z9XA 4BO6A 4RQUA 1NYTA 3EW7A 2EGHA 1E1NA 1AN9A 2X5JO 1GFSA 3NTRA 3NX4A 9LDBA 3W6UA 1U7TA 4E5PA 1QYDA 1ZCJA 2WM3A 2HMSA 4AJIA 1YDWA 5ER9A 1QSGA 1RYDA 9LDTA 4KUEA 4BO0A 1PSDA 1Y5MA 2DTXA 1GZ6A 2OUIA 5A03A 1NTOA 4NH4A 4WASA 2NVUB 1XG5A 2GASA 2W2LA 2OBYA 4FD3A 4IDCA 2FPPA 1TA4A 3ZV3A 4GSLA 3GVHA 1MFZA 3H9UA 4EJ6A 4B7XA 1DIHA 3EVTA 4W9NC 2X5KO 1HXHA 5HBRA 5A9RA 5CG1A 4UVEA 1JDJA 5IXYA 3ZU5A 5IFLA 2E37A 3M1AA 1T2EA 3T4EA 1C3VA 1JKFA 3ZW8A 3ZHBA 1YOVB 1S7CA 3ZWWA 1YONA 4XDYA 1ENPA 1P1JA 2ZTMA 3IAHA 4WLUA 3JQGA 4BIIA 1KY4A 3ZU2A 1KS9A 1A5ZA 2XAAA 4AJKA 3DDNA 1LEHA 4J9VA 4QXMA 3GDFA 1GR0A 3ANLA 4JLWA 4JBIA 1YRLA 4YT2A 4EJMA 1ADGA 3NJ8A 3JSAA 2NTJA 1KVRA 3JCZA 4XQEA 3KEOA 4OOEA 1V9LA 5FFFA 2Y1FA 5L4SA 3VH4A 3F3SA 3P7MA 1XWFA 3NTQA 4XJSA 4CM4A 4M49A 3BMCA 4WLOA 3TNLA 4G81A 1HZJA 1HDGO 2I66A 5U1PA 3ZWBA 3R1IA 3P5SA 2ZKLA 4OXYA 5DT9A 3W8FA 1TB4A 3HB5X 1VM6A 3U0BA 4DXHA 2DUWA 3NT4A 4B7UA 1NFRA 3W8DA 1EEHA 3IUPA 1PGQA 3IP3A 4YQZA 3NKLA 3ZNQA 2WSBA 2BGKA 2PZKA 2DFDA 5B4TA 1P1KA 2FR8A 3DAPA 2C5EA 4CPDA 4ALKA 1MGOA 4EUEA 1DIBA 4IDEA 4LVUA 4JBHA 1XR3A 1U2DA 3IOYA 1R4NA 3RU7A 4CR7A 7ADHA 5KVVA 2QRKA 4UULA 1W8DA 3O9ZA 4QX6A 1JKIA 4R1NA 4JK3A 2YY7A 2DTEA 4Z9FA 4A27A 3JD2A 3PRJA 2OP1A 3SC6A 2ZTVA 1NHGA 2RAFA 4J7UA 4RPKA 5F3RA 3T7EA 2GN6A 4YAGA 1PU2A 4J16A 5EPOA 4IPTA 3ZNOA 3EUWA 4ZA2A 3HB4X 4XR9A 3PJDA 3LVFO 5G0SA 5JE8A 3VHRA 3FF4A 4J43A 2WYWA 1PZHA 4H15A 2WJPA 1ONOA 3LC1O 2G82A 3V1TC 2FZWA 1J0XO 3WWYA 1UXHA 5T64A 1LC3A 1X7DA 2V6BA 1U28A 4F46A 4BGEA 2O4UX 2BFAA 1UDBA 3K9QO 3AM4A 3CUKA 3INRA 2UAGA 5KJ1A 4XEHA 1CJCA 3H3JA 4R41A 4AJLA 2J5QA 5AXAA 1YL7A 4RF4A 2PH3A 4ZRNA 2G0TA 1U3UA 1C0LA 3F4LA 4WEQA 5JNLA 2FHSA 4H16A 3L77A 3RVDA 2OOSA 5KJCA 3PHHA 2CDAA 3PWKA 5CDGA 2QQ5A 3C85A 3RC2A 4D0SA 2E48A 3GN2A 3SBOA 3MJEA 3JYLA 2X0JA 3QV1A 3RUAA 3Q9NA 5L4NA 1M76A 5I7VA 4B8WA 4OYRA 3WGOA 1XU7A 1VKOA 4BQPA 4BMNA 4D46A 3IL2A 5JYDA 3NYWA 4UVHA 3WQRA 4RCVA 3ZN2A 3GK3A 1G0NA 3DBVO 4FBGA 4DTIA 3ZWNA 3L4BA 3G49A 1Q7BA 3CSDA 2C29D 3SJUA 3GZNA 3PJGA 3EZLA 5TNXA 4QECA 3LYLA 1F12A 1ADCA 2RIRA 1WXDA 3O26A 5FWNA 3LQFA 4XIYA 1OC2A 1O9BA 4AVYA 3Q3CA 3RKRA 1HF3A 3M1LA 5LDHA 1TT7A 2B4TO 3TZKA 3RFTA 1BVRA 2A9FA 2DBQA 1UJMA 2H9IA 3I5MA 4N54A 3WWZA 2HK9A 1PR9A 3BXXA 3GFBA 4JP2A 4XYBA 2HCTA 3MWDB 1UDCA 3COSA 1IHYA 4IS3A 1AHHA 2V6FA 4K28A 4IJUA 3WR5A 2JD0A 3T7CA 3OJEA 4LMPA 1I10A 3JQDA 3OA0A 3TZCA 5JDCC 3RC1A 4BHTA 3JYPA 1LDYA 3S2EA 4XGNA 5JY6A 2VUSA 4UVGA 4CM3A 2P4QA 4QQRA 4MKZA 3ICPA 3L6EA 1RM5A 1OOEA 1E3LA 1LLCA 1LXCA 1QP8A 4WLNA 2CVOA 4J7XA 2GZ3A 1DIGA 3KLPX 3VDQA 3ON5A 3DFUA 1VJ0A 3GEGA 3V1YA 2A35A 2X23A 3Q2KA 4BB6A 2BGMA 1VI2A 4CLXA 1O0SA 5JCXA 5A3VA 2VRCA 4HADA 1YBMA 1DC5A 4CODB 1QLHA 3KYCA 4OSOA 3UGKA 3S55A 1Y8RA 4D44A 1ADFA 3KLMX 4MVJA 1ENZA 1NWHA 3QVWA 4BNMA 4JQCA 1C1XA 4WE3A 3QVOA 4FGSA 2I76A 3WYCA 2VUTA 1GV0A 1P1HA 4BO1A 3GQVA 1KIFA 3RUCA 3U62A 3UOGA 2UVDA 5KOIA 4K26A 4PLGA 1HDCA 1UXIA 2PZLA 3EZYA 3FCOA 4Y9DA 5DULA 3GG9A 1HE5A 4R51A 4FFNA 4TRRA 1PQWA 1R0SA 1PR3A 1YBAA 2BGLA 3U4CA 3U4HA 5L4LA 4NZ9A 1I32A 1E7QA 3LC7O 3LT0A 4TVOA 2RCYA 2VWHA 2BHLA 2W2KA 3Q2IA 1KOLA 3DO5A 1IUKA 1Y9EA 2Q2VA 3AU8A 4J2HA 4PGFA 1R4MB 2C7GA 3TRIA 3E5RA 1SMKA 3N58A 3PJEA 4GAEA 1KC1A 5K6AA 3AM5A 3I6QA 2DQ4A 2Y1DA 2V7PA 2I65A 2YW9A 2VHWA
chains in the Genus database with same CATH superfamily
3U1TA 2FKAA 4WOPA 2WINI 1QDUA 3RRMA 4KFRA 4Y6OA 2P1DA 2XWBF 2YHIA 5K0BA 3MWYW 3EZGA 1G8GA 2AXQA 1SRQA 2D59A 4E5YA 1MQAA 2C7RA 3MTAA 3E3OA 3UHPA 3GW8A 3ND5A 1DTWB 1RQNA 2ZPTX 2W0SA 2HCJB 1TFRA 3LDFA 2OGTA 2GCNA 4RESA 2QX4A 3VOAA 4KMMA 4MWBA 4AZ3A 1A9XB 4BHHB 2JLRA 2YYAA 3OJCA 1Y1KE 1M6YA 1NM5A 3DT8A 3E4CA 4UXHA 3ICCA 4YONB 2JFNA 4KREA 2EW8A 1GUFA 2D3WA 2Q3FA 1RAGA 1RI1A 5EKTA 4K40A 4EBBA 1UBGA 4LX8A 2AFHA 3P19A 5CW1A 1KI8A 3HZOA 4WXHA 4G0ZA 1P62B 2IQ5A 2OCDA 3MRSA 1B2RA 3EF3A 5FFNA 3WDKA 4QXAA 4HYYA 1YULA 2IYYA 2XJ4A 3G8CA 3VHXA 3FXAA 1J7JA 1OH7A 3FKSD 1I4OA 1P4RA 1Z4OA 4A2WA 2ZPAA 1VLQA 4WERA 2C9YA 4TVKA 4E4TA 2WT9A 1RWPA 1TK2A 2ID4A 5G1OA 1BTOA 4U5QA 3WLHA 3K70D 3LY5A 2NU8B 2RGBA 2MU1A 4FR5A 1JEOA 2NXCA 1P3Y1 2OPBA 5DBGA 4ZVVA 4CIBA 2LKCA 3O1HB 3THSA 1INLA 4BUCA 2I2CA 4K6OA 1T5SA 1ECBA 4I1YA 2WG0A 2WEKA 1EWRA 4KVZA 3TKAA 5JZMA 1BHQ1 1YAJA 3QOXA 2CYCA 2PT6A 1CJMA 1KL7A 4JJ6A 2V4ZA 4UZEA 1H5UA 4BX2A 4ERNA 5LOVF 3BSYA 3T41A 5K8TA 5KYWB 1N2EA 5MGNA 1MJ5A 3H2IA 1YJ5A 5K2OA 3QY0A 4JI5B 2WM2A 1QR2A 2IUTA 4YRCA 5FADA 3GT0A 1VLJA 2FG5A 3DONA 5EXEA 2ZUTA 1LB1B 5FYQA 1E58A 1QCCA 3FIUA 4JV5B 4J29A 1VRCA 3CSSA 1R1DA 3DAFA 3QPCA 2IYQA 1JECA 1OW3B 3VVCA 1CQPA 1N6KA 4K88A 1JQAA 4J6FA 5FR2A 4CCWA 4IKPA 1RABA 2II6A 5EIAA 3O8RA 2CZGA 2JF0A 2YXEA 4OQQA 1UJ5A 4R0VA 4KR7A 1PHRA 1ENOA 1UKEA 4YJDA 2CEKA 2MT9A 5BNFA 2PAAA 3EC7A 3KNZA 4KYIB 5JIBA 5CDSA 1IHDA 1IPFA 4XB2A 3UATA 2C7OA 3QXXA 2CCKA 4HHEA 2BTQB 3ITKA 1EVEA 4LQCA 5D6NA 4DWJA 2WNSA 3KD2A 4FZVA 3JQBC 4PC2A 2XNJA 1M7HA 3IE1A 3KR0A 4ZAGA 4O6VA 2YWFA 2WP8J 1P4GA 2JCYA 2ODWA 3HXKA 3NT5A 1E8MA 5ICFA 1RKBA 4OGKA 3ZY3A 4B6JA 4NCXA 1IH8A 3A9VA 4AY2A 2O6LA 4HNHA 4OQ4A 3MMPA 2XBUA 2HPZA 3ZVMA 3BJIC 3BZWA 5T4FA 5F98A 4UDYX 4DVJA 1GUAA 3KZKA 3QPBA 2OHGA 2NACA 2R7LA 2RH4A 2ZTLA 2EDAA 2R4TA 1JHXA 2W2OA 1CUAA 3A1TA 3LX8A 4J1SA 5EIOA 3EQ7A 1KMQA 3EVEA 4OI4A 1PG5A 3TQTA 1JP7A 1QFMA 3WGHA 4M8NE 4QM7A 2CZCA 3WB9A 1Y8QA 2FSVA 4HSEA 4EQZA 1TEZA 2CDCA 3ZOKA 1DUVG 1WUHS 2Q41A 4WFKA 4GI7A 5MFPA 3V55A 3DBHB 5G4KB 4DUPA 1IM5A 2QYTA 5JDIA 2JLXA 3PEWA 3I92A 4NCBA 2OHXA 4YV2A 2G36A 1Z6ZA 1VKRA 2C7BA 3U61B 1HMPA 5KKCA 1B4DA 3ZE9A 5ELLA 4IG9A 5J47A 4DV7B 3SLKA 3JWPA 3LJKA 4ND2A 1HA3A 2CFRA 1CR6A 1WV0A 2N0SA 2Z43A 3BREA 4YMTA 5JPIA 3IPCA 3VOTA 4E03A 5K8LA 3UXMA 3FPFA 1FUUA 1QHYA 3STYA 4LYYA 2PGLA 4GFDA 4QGFA 1XTZA 3CX3A 1AKYA 1Z4IA 3WTBA 4EKYA 1G41A 2XCSB 5JJLA 1RWVA 1EJ0A 2D2FA 3DFKA 1SA0B 1ZNYA 4P4GA 4LHVA 1QJ4A 2ECPA 1Q0LA 2OD7A 2PMKA 2I34A 3E9RA 5FAKA 3J7AC 2XWPA 3NWBA 2D06A 3PHLA 3QYJA 2PH5A 2OCAA 4IOLA 2AEEA 4RSGA 1ZCAA 5E1OA 4JNCA 4AJEA 3D5TA 2ZT8A 1XTPA 3EG5A 1XAHA 5BSKA 4DR5B 2IGTA 1QIJA 2JEOA 3FYTA 4C22A 3O7WA 3QEMB 4ND7A 3BPSA 3OI7A 2V7QD 2P9ZA 4IJWA 3WL3A 1XNRB 2IHJA 4EPWA 3DOJA 1E2EA 4FEGA 5EE0A 3LCVB 4W1SA 5ALNA 2V0NA 4YWJA 4AY5A 3H4TA 3W4IA 1PRYA 3I0NA 2E4VA 5IBPA 1WP4A 3H8JA 2O1XA 5AT1A 4BFXA 5JARA 4YPOA 3C7TA 3ICOA 1B26A 3I34X 4NNPA 4B7ZA 4R84A 5CP8A 3JQAA 1TUEA 4WY5A 5T41A 3SS7X 3TLBA 1MW8X 5TMEA 3LPAA 1F8FA 5AKHA 4UQPA 4IVRA 1B8PA 4EPRA 3JD1A 4M38A 3R9XB 4QSMA 4PLCA 2B6NA 3TVDA 1Z4NA 2VHXA 4GEKA 3C6KA 3DMPA 2V7UA 4GGMX 1KYYA 2QA5A 5DHPA 5LYJB 3UB4A 3OOYA 1GPMA 4II7A 4CIXA 4CM8B 3OETA 1S0UA 2OHVA 3MELA 3UANA 1IULA 4DSUA 5CA1A 4V0NA 4OSEA 4PQFA 4PYIA 4U3JA 3L92A 4U63A 4DSNA 3FFAA 1LBQA 3PL5A 3UV6A 3FB4A 3GRVA 4C0BA 1O1YA 1UL1X 2E4AA 2QWXA 1OE0A 1ZGZA 2BAGA 1BH2A 3KJQA 4FUTA 1QK3A 1MP0A 4JGIA 1A72A 1D2AA 2FUNB 3T9CA 4E5MA 5M34A 3GPLA 3HWWA 1YQXA 2V96A 3SQOA 3WWDA 3RSQA 1A7KA 2QK4A 3PC2A 4LYHA 3V00A 3ZHVA 4BASA 1NATA 4B6FA 2WJJA 5JMOA 1D8AA 1DUSA 4L3VA 3TX6A 1YQTA 1XGKA 4S05A 1A9RA 5HE8A 4OGWA 2VRNA 1JR4A 2ESRA 4YJFB 1UZMA 3A3NA 1IJBA 1BWQA 4JR0A 2QVZX 1BHSA 1BXGA 5DW0A 1QP0A 3D2BA 4Q4LA 1PIWA 1VPVA 1VRWA 1RP1A 3ESAA 2BMAA 5FA5A 4E3WA 5LD2C 4WA7A 2BGWA 4Q3BA 3R3WA 1DG1G 1JTVA 3OPMA 3TXYA 2D1RA 4D8YA 3ONDA 4C2UA 2H7CA 5DLDA 3AKCA 4QJBA 1LTQA 1M6HA 1S3SA 1ZEJA 1FP6A 5TVGA 4Y2PA 3VR5D 3NHPA 5DNUA 4CKCB 4MV4A 4WEOA 1M75A 1X7XB 2NIPA 1XHLA 1MC1A 1NXVA 3Q3JB 4ISBA 3UYLA 4C2BA 2IZ1A 4MCAA 2ZWAA 2P5SA 2BFMA 2B78A 3KUCA 3OICA 1NP3A 2OK8A 2OGSA 3OESA 2XZOA 4F6RB 3SDBA 4JUAA 1RZ3A 4PQEA 3I39X 4M0KA 1R0CA 1G19A 1YBHA 4B81A 4D9MA 1MQ8B 4RTMA 1T4MA 2AI1A 3KTAB 3SF0A 4YMHA 1E9CA 1RXEA 4XUEA 1NBIA 1G8FA 1P72A 4OMDA 4URYR 4MZXA 1W4ZA 3JX9A 4DA0A 1R0RE 2IBMA 1EFRD 2GM9A 1R9MA 2LIVA 1PR4A 2IY9A 2ZJFA 3JVDA 1NULA 4G65A 3VYTB 2PKRA 3ENKA 4NFLA 1OPRA 1Y4UA 1THZA 2BKEA 1NVWQ 1C7IA 4DNOA 1P91A 4QPPA 3EAGA 1IPEA 1KNXA 1YCHA 2BF7A 1L8OA 2WBLC 5EFOA 3BF8A 4E4YA 4EW6A 1RQXA 4Q12A 1T8WA 1H2BA 3I2HA 4GE3A 2R8BA 2NG1A 1RXSA 3T3MB 1BW9B 4S0ZA 2R48A 5EEGA 4YBZA 4KH0A 2Q5CA 4DKXA 1Y81A 5FAXA 2YRWA 3AJRA 5IN4A 3A1VA 5K20A 3PG5A 3MJ4A 3ZCQA 5T3UA 1FQWA 1IATA 1J5XA 2NNWB 2C04A 2XUFA 1Q44A 3ABIA 4QATA 2VTEA 3O82A 3FDZA 3NATA 3W1WA 1UOEA 1W9MA 2VATA 2X13A 3B36A 3MTIA 1NBMA 1YS6A 1MEOA 4ASUD 3TSYA 5L3VA 3BERA 1P9NA 1JRLA 1ENYA 3OOEA 4GWGA 1LVGA 3K8ZA 2ACVA 3QPVA 1D4FA 4NONA 2VOJA 5DNWA 1U8YA 1ZU4A 1R8SA 3PUKA 4LDRA 3COJA 2TYSB 3SKXA 5KYXB 1QGDA 2QUBA 1U7ZA 2AFHB 2GJ9A 4WBSA 1DGQA 2P0EA 4XGQA 1MV5A 4BMVA 5KSZA 5KYYA 1Y48E 2JHAA 3LKDA 3UN1A 1BIFA 1ORHA 2A9OA 3HJCA 4MWEA 5L9AA 4M9XA 4HN4B 1G3MA 4Q48A 4YCJA 4E08A 5CB6A 5JALA 4M9QA 2GD6A 3H6GA 5DK4A 1E64A 1RTTA 3EJWA 2C9BA 1XVUA 4AM8A 2O8FB 2H59A 3DZDA 4KRXA 2C7VA 2YVLA 4H17A 3ZVLA 4AJ4A 4AS2A 2YXNA 3NM6B 4BLUA 3KHTA 2MSNA 2VUIB 2FRDA 1JXOA 1O5OA 3ANMA 4KQKA 1UXOA 1CLUA 1OA1A 1Z33A 2AIRA 2WT4A 4IJVA 4UBKA 1O95D 5LQSA 1SVKA 4AL4A 3T7AA 3DVAB 4C6RA 4PGMA 2IS4A 1D04A 2BR5A 2M2IA 4K6CA 2V74B 2FTKE 3BFXA 4B87A 4NZNA 3LZ6A 3IVAA 5E6SB 4Q1DA 3ESYA 4QOEA 3VV2A 4ZOCA 1V9CA 1XZ8A 1BGVA 2ZBFA 5K45A 2VP0A 3RSZA 3G23A 4G89A 1KWKA 1DO0A 1LC0A 2ZETA 3M6FA 1WDWB 3JR7A 3L8YA 1L5ZA 4KLZA 1I3LA 1PJZA 1J8VA 2XUHA 2QQGA 4HRAA 2OXTA 1Y6GA 2CLLB 3G9UA 3I9KA 3QU7A 1EGVB 1PBTA 1XROA 1MB0A 3W7BA 3WLSA 2YUTA 2W4MA 3B7PA 3V33A 4BYMA 4H27A 1NOKA 3W5AA 4F9GA 1XDGA 2FGJA 2HH9A 3HFJA 4NCNA 3MJTA 1L5HA 4TKLA 1YA6A 3NHJA 5LNK6 3VKWA 2WKPA 1I7DA 4F85A 1UP7A 1VIAA 1KSHA 1MMFB 2JA1A 4TLAA 2UXBB 2LWIA 2O07A 4B6QA 1EIZA 2C5LA 1U5BA 2R8YA 3MW8A 1F4LA 4TX1A 1TTPB 4NX2A 3TUIC 3W5VA 3WHKA 1YR8A 1X77A 1U81A 3KHSA 3R23A 3UJPA 1VKJA 3H5TA 3PIDA 1YR6A 4BTVA 2C9MA 3AJEA 5AR1A 5TQ2A 1C1DB 1CY2A 1KETA 4O4JA 2DPYA 1J25A 1BE6A 1XZHA 1NMXA 4LQDA 4LYJA 4RLSA 3TL2A 3AEKB 2I3ZA 4MUBA 2R79A 3QENA 5CLLA 4QDJA 2IV2X 1U5BB 3WIOA 1TKRA 1C41A 3G9ZA 4AK9A 2P77A 5BPHA 2OAGA 2QVLA 2C4UA 3HKDA 5DIZA 2E87A 1WWKA 4X44A 1JT9A 4IR7A 3HO6A 1N36B 2QRVB 2O8BA 1NXQA 1YSCA 2UXCB 2FOIA 4HL6A 5A05A 2VT2A 2OV1A 4CV0A 5A4AA 1G64A 3ASUA 4X45A 4XUCA 3VC3A 4UEJA 1UMDB 1UFKA 1M6WA 4YRBA 2D2EA 4GLLA 4F2GA 5JWOA 5KKNB 1W8IA 4J0KA 4BNLA 2ZE5A 2GD0A 1DQSA 2M1XA 4NCKA 5CXSA 2R66A 3DLAA 3VPCA 3ZD6A 3UH1A 4GG1A 1WCWA 1P8JA 4DSTA 3GFRA 3GNLA 1KI6A 3ZD7A 1IOLA 5IYZA 2DEUA 4JQOA 4ZQFA 3RWOA 2IPNA 2LTAA 4PFSA 4ALIA 4YV1A 5KUTA 3DKKA 2A7QA 4PN7A 3JQFC 3DOHA 4J0HA 1MOPA 4ZYUA 3TLYA 2QT1A 3JQGB 1RLIA 1TTHA 2HSEA 2QTVA 3HJTA 1GLNA 3K9WA 1CP3A 2CKMA 3IQGX 3MLBA 3O4GA 4PU0A 1OXMA 4DPKA 1NF3A 5K7SA 1JJFA 3OJLA 4EITA 1B2LA 2Z98A 4N8SA 3W77A 3ZHZA 2J9RA 3WLIA 2A0UA 4CT0A 2OB1A 1L7NA 3K4HA 4B6PA 3RJTA 4J4HA 3TN7A 1JR3D 1X2EA 3ZIAD 4FDUA 4WLVA 2WJ4A 3DEAA 3TNJA 1JW9B 2QTLA 3TLZA 1I1NA 4EK9A 1CVIA 1YB6A 1T4CB 2OBNA 2VNSA 4OB8A 5AI0A 5FWYB 3SXUA 5CFOA 1CY1A 2O8CB 1MAAA 3QA9A 4LRXA 4YPFA 1NLFA 4UMFA 2BGNA 3OY2A 4D81A 4ND6A 2HXGA 2P9BA 1HLFA 1ZMTA 3C3XA 4WXMA 2WMDA 4BO4A 4F8JA 4YXWA 4LG1A 3JVUA 3VR6D 3GFGA 3E3LA 3TW8A 1BDIA 3EIQA 5C31A 1P0CA 4FUQA 4KK4A 4RXTA 3HBJA 3HXQA 3ZX5A 5JASA 1ZXLA 3U60B 1PBNA 5DHFA 3HLKA 3O8OA 4JOCA 3JAMA 4KXVA 5HUQA 4IO0A 3ZE1B 4TXHA 4YRGA 5JZSA 5CNMA 4MSUA 3GBPA 1HDOA 4HR7A 2D1TA 2J3KA 3KM0A 4OJMX 3H13A 4F4FA 4ISCA 2QAGC 2VJYA 1KJ8A 1Y33E 1W2WB 1RLJA 3TKLA 2B8WA 2YV3A 4XUDA 1MENA 1XMSA 3Q7TA 5JNUA 2H4JA 3AJDA 1FMCA 4MRAA 3F97A 2RE8A 4AYXA 4JS0A 2ZRLA 5BQPA 2VXBA 3LXUX 3RUFA 5BYAA 3ADDA 2AMYA 3WOHA 3OZEA 3GJ5A 1SCNE 3H2HA 2GK3A 4G86A 5AH0A 5FBKA 4CEHA 3CLUC 3ANNA 1V7ZA 1CIVA 3B6ZA 2QRNA 1VHTA 1TDJA 1YHYA 2X0FA 1FVXA 3RC3A 4JJAA 3GRZA 2I8CA 2LP4Y 4D97A 1WOYA 5C80A 3P9IA 1P75A 4RD3A 2PO5A 3G0BA 4M9UA 5FOXA 3WQSB 2BMFA 3LNTA 4TZKA 4BFLA 1OH5A 2OCGA 4QFBA 1FQKA 1EFAA 1M1YB 1R7RA 4HUTA 2CXRA 3SEAA 4PYKA 1FDSA 3ZXYA 5IUJC 5MN5A 1F7VA 1SXGA 3AVQA 2EJVA 1PWZA 1HKHA 2IIQA 2IOFA 1LZKA 3SYLA 1SOVA 3C8MA 4C9BA 3GZ4A 1EFVB 2R7AA 1ECGA 5KU7A 4I6JA 2QTNA 4WW0A 1JJ7A 2OO5A 2ZZMA 2YC2C 1AKQA 1QYVA 2ZLBA 4UDNA 3OOWA 4ZV4A 2IITA 1J4AA 2QJTA 5BOSB 4I5DA 1T2CA 2QRVA 4UEOA 2PYZA 3FUWA 5T4HA 2O8BB 1MB2A 1Y6JA 3G85A 4QRIA 1ISSA 1VE6A 2F1JA 2IYSA 3IAFA 5HJ2A 5ILOA 1SJ9A 4RK6A 1C8BA 4J7CA 4D96A 1TQ2A 1E5DA 1ABFA 1JMKC 3ETDA 3G7NA 5CLJA 1AHNA 1W76A 4YIKA 2QJFA 2RGNC 3IVGA 3Q6IA 4L5YA 4NBUA 5KYKA 5HTOA 3M2PA 4LSWA 3DULA 3NT2A 3WMWA 2WSMA 1W4RA 2C1XA 1VPDA 2NT3A 2WU4A 1JSXA 1Q1BA 2YZ7A 4P4SB 3WDMA 5DLQC 3R7DA 5C3MA 5I7EA 4Z53A 1E9FA 3K0FA 4MLZA 1NXOA 2CLOB 2W00A 2QVCA 3C7CB 4AXBA 4BLSA 2R65A 3G1TA 1DDOA 1PGOA 3A6ZA 1M10A 3T94A 1KORA 2YY5A 3HJHA 3OECA 2ZR7A 3IOCA 1SQ5A 2NXJA 2CFTA 4MUMA 2WWTA 1WEHA 3TRHA 1JDSA 4HY3A 2YN0A 3PD7A 5JQGB 3PCRB 5EXSA 4F71A 4NFHA 2F8SA 3S29A 3LVQE 1IY8A 2FSVC 2IW3A 5LMZA 3QKWA 1RC8A 3SJCA 3L8MA 1EVJA 1J6UA 1VL1A 3G3EA 4PZAA 1BEEA 2JIPA 4RZHA 3SC2A 3O92A 5C8YB 1UODA 1FYEA 3E81A 4YROA 5KNBD 2HU7A 2O2SA 3D0QA 4AZ0A 3W8NA 1XNQB 2AN9A 1DB3A 3DZIA 1P4AA 3FSJX 2V7TA 3IMKA 5IJ0B 2VQ3A 1E2PA 3UHJA 4M0CA 1H9CA 1PVDA 1IJFA 1DFIA 2I22A 3GZNB 4HDNB 5JAMA 3ZI7A 5BW8A 3T1VA 4YMUA 3CONA 3KEMA 1BEZA 2OYSA 2PZJA 3MD9A 4JEHA 3K8QA 1RJFA 1IEQA 4AICA 1X80A 3E0QA 3HUFA 1HFWA 4QYSA 2D5LA 3MBOA 1LDGA 2A59A 5G1PA 4AJNA 4WV3A 1QTIA 3I4CA 2X6QA 2PJZA 3P0FA 4ICIA 1CQIB 3E3MA 3L8HA 4RDHA 3LKZA 4BNIA 2E85A 2VHUA 3S2GA 4DV5B 4L73A 1UPUA 4E2FA 4J8PA 3QF7A 4RL4A 2YS7A 3ESCA 3ZY6A 3MWKA 3C3EA 5A4MS 1BXRB 2J45A 4UE2A 2A0KA 2D1QA 2IHYA 2QN8A 3HFRA 3JQRA 3LT4A 4JX9A 4RZSA 4LTMA 1ZGAA 1KEWA 1XI2A 2I71A 3FKQA 4J75A 3EFOB 2YV2A 1EFHA 1STOA 2NO7A 3TDKA 1L4GA 5ALRA 4BFTA 3W5CA 4KAJA 4EA6A 2Z2JA 1VE7A 4BXOA 4QOSA 4PPNA 3BN3A 3DDSA 3H2ZA 2B83A 3FWZA 4WWHA 3ROGA 3SSNA 3TTUA 4TYNA 1RBQA 3WA7A 4W9RA 4TS9A 2ZXFA 1UCFA 1TX4B 2GCOB 1TW2A 2CHEA 4PAGA 4B5LA 1E63A 1BXZA 3D64A 2AMJA 3HUUA 2P5TB 3PFGA 1S4QA 1FJXA 1QGUA 2Y1LA 4HNUA 3ND8A 2ZREA 1ISIA 4ID9A 4DNPA 3BMQA 4ITUA 4JJZA 3D7SA 3NI2A 3HCBA 5LP6F 3DC7A 3WO0A 3ZDYB 1E3TA 1ML3A 2AW3A 4J1GA 3G6KA 2DCUA 4EFDA 3B1WA 2D62A 5J1TB 2Q3DA 4M1SA 5EXDA 1WETA 1XC7A 1T9GS 2VOEA 3OE4A 3V3TA 3USCS 5I4BA 2O8CA 3L04A 2CF5A 5JJBA 2Z95A 5EQDA 3SZ3A 4TKMA 2BELA 2HHLA 3G7SA 4OQXA 1JQEA 1YZHA 2P8JA 4V38A 4PHGA 1U0HC 1S96A 1Y3HA 3KL4A 3ETCA 3K16A 3OP1A 1UZLA 4J90A 4XIJA 3WA6A 4DAOA 1QZTA 1NVTA 1QRRA 1XYYA 3DT6A 4N3BA 4MW6A 5IF9A 1WXQA 1O97C 3FI0A 2NLOA 1ZHHA 5IAOA 1W1IA 1I8TA 2YZGA 5KSWB 2UUCB 3DMFA 1DKNA 2WKQA 3OO0A 4PRLA 4V0SA 5TS3A 2RGRA 5ALUA 1OSNA 2FMHA 3AB8A 5BXYA 4QWMA 1N4AA 3N2GA 2WVHA 4MIOA 1RP7A 2BLNA 4BMCA 2PZBA 2E1PA 3ADOA 3UK6A 4YRAA 2PTGA 3M6XA 3T3EA 1EVKA 4C6HA 5AOVA 1A8QA 4PG8A 3HO8A 4LIPD 1NUAA 1ECJA 1LI5A 2YQZA 1FDIA 3TSAA 3I04A 2ZIGA 4FFLA 1FDVA 1J8QA 1K06A 1WB6A 1CEYA 4KBFA 1KMMA 4PBTA 1BQEA 4ARCA 3ZUPA 2WTNA 3BWDD 3NRBA 3UNXA 3VKGA 1H22A 2IXFA 2ZBGA 1SKYB 1J07A 1W9HA 4LY3A 2ST1A 3O03A 5DHUA 4AQDA 4R81A 1T4CA 5AKKA 1KDRA 4G1EB 3MT0A 4PSAA 2C07A 2Q6OA 1NIJA 4MV5A 4EKDA 1UM8A 2X0NA 5AJHA 1OILA 3QBDA 3PF9A 1TM2A 3ZGXA 4D9BA 4YJFA 2YL2A 1TZKA 2IL1A 3AY3A 5DRYA 2OWEA 4TXNA 6LDHA 2JJQA 5BR1A 4YC7A 3S2YA 4WH0A 1IVYA 3I0ZA 3DG9A 3VVBA 2C61A 2W6CX 3EZ2A 4MYCA 1OZAA 1AKTA 1M83A 2PWPA 5F4ZA 1M1NA 2QVGA 4P7GA 3QUQA 4JSTA 3T7KA 3B9QA 3DVRX 4R68A 4MIEA 4RFSA 4PPGA 1OMOA 3OY7A 4OHRA 3UAVA 1YU9A 2Q8QA 4W5OA 1SXJB 4PYOA 1N1EA 1YRBA 1JV2B 2EBWA 5ER6A 4US0R 3PJFA 1W0KA 1WMBA 3QW2A 4ZDIA 4IDQA 2JFGA 4U7JA 4QUJA 4V3BA 1UP4A 4G4SP 5B7GA 1QJCA 4B4WA 4POOA 2QU7A 1B0AA 4F72A 2AZ4A 4OH7A 3Q3VA 3B9PA 5J2TB 1QGYA 1ZIXA 3CZ4A 3NCTA 4NSNA 5FL3A 3E5MA 4TV9B 1Y3IA 2VTKA 4I4TB 4Z1OA 4M6WA 4QDTA 3WK5A 1F2VA 4U2BA 3VJLA 1ZK4A 2DQYA 5AM3A 3ACCA 5DLPA 2ECKA 2VJPA 4NPCA 3UK0A 3PXEA 3CNOA 1PLKA 3AOGA 4A82A 2POQX 3B5JA 2QDKA 1UT5A 4IWNA 2ZDQA 2GZMA 4JCCA 3DD5A 5I8WA 2VDVE 5ADUS 2J7KA 2Q3JA 2Z3ZA 5E4YA 4RVDA 4CUJA 1FVHA 1AE1A 5HA5A 3DTVB 4URXR 3DZJA 3QFCA 4S2UA 5CVCA 2DPHA 2IOFK 2PJDA 3MXOA 4MR7A 4EYOA 1V6CA 3D7RA 4HAOA 4JEIA 3RTBA 1EKXA 1QO9A 2P6NA 4Q9IA 3WBBA 3WYFA 2W6OA 4OBBA 1MABB 1A69A 2A5JA 1QQ6A 4X8HA 3Q5DA 5CLHA 1U9JA 4HB3A 3OLZA 5FJJA 1NPYA 4BO3A 5SY9A 5JZBA 3JYOA 3R9WA 1HFEL 1VYVA 1ZUNA 2QROA 2NN3C 3LC0A 4DIFA 1N78A 1SHLA 1II8A 2OL4A 5B1IA 4LWOA 4R71A 3AUJB 2R6ZA 1DAGA 4BNKA 3GJ8A 1E2KA 4CUZA 1ZGJA 2FV8A 2X4DA 2ID9A 1KFJB 2HDOA 1OC4A 1J2YA 2R5NA 4HEQA 1QWOA 4ZQCB 3C45A 4IZ6A 2XVMA 3GDOA 4BJ3A 2ZS7A 5HOEA 2PUHA 4PONA 4YJHB 4POAA 4Q3AA 1KO4A 3BBPA 2YWJA 1JAXA 2JJ1A 1G63A 1L9KA 2NV2B 2YY6A 3EFEA 2D7DA 4AAYA 3G1WA 2OCKA 2DHEA 1IUPA 1W44A 2JJMA 2PT5A 5FWAA 4AW9A 2MDTA 3ECAA 2PD6A 1E2MA 3RSLA 4D6XA 1PI3A 3ZQUA 3CVWA 3FTFA 2X5OA 6YASA 4EG8A 4JOQA 3ZV5A 5LXTB 2WMOB 3UTCA 3LD9A 2H9YA 2JAHA 3CTMA 4LOHA 2J7PD 2NTYC 2INGX 2NUBA 2HIGA 4IDGA 5EI5A 5HKLA 3X2FA 1JR6A 2HIAA 1U0BB 1TF7A 1TO6A 5LLSA 1YZQA 2YOHA 1YK0A 3ZLBA 3KUKA 5HTKA 1D07A 4EZIA 4F1KA 4PRYA 1AF4A 2PPVA 1YL5A 5HQ3A 3IDSA 5I9MA 4DMHA 5EJIA 3WJ7A 4CG0A 4PHTA 1XVTA 2PN1A 5CD9A 2PK3A 1K2WA 3NRCA 3NUGA 5KDLA 1WVGA 1Q1GA 2R6CA 3ZK8A 3WRWA 1JQBA 1FFDA 2HBYA 3RO7A 4A15A 3FNBA 4P1ZA 4CVNA 1LFDB 1PR1A 1TK9A 4EA8A 4I3FA 4JLAA 4CDRA 3OPYB 3RIHA 4OLFA 3OTWA 2QZJA 3CGWA 2DX7A 5L95A 4YT8A 4QPDA 4CM1A 1TT5B 1PFVA 3F8TA 4M21A 4P3XA 3OQHA 2AN5A 1EGAA 3KOMA 4EQ6B 4RZ2A 2RFLA 3PNOA 1Q14A 1IK4A 1NQ5A 1Q12A 3UW1A 3IUYA 1PZMA 4G01B 3WL8A 2ONZA 1T2AA 3IMFA 4HMQA 5DM2A 3RARA 4NV0A 5LCXA 4B3MB 2VVTA 4OI2A 2O2CA 1FTQA 3B1KA 4KXLA 4OO3A 4KGXA 2W2TA 3BIJA 4H60A 4QIHA 3ANXA 2XWQA 3O4RA 4Y2UA 1FE8A 2NSDA 3EEBA 5EOVA 1C1DA 4BWYA 4S1VA 4PXYA 3IUBA 5COBA 3UB2A 4ENWA 1L7VC 4U6SA 3STVA 2ZJ4A 2E82A 2OCBA 5BRNA 3GY0A 1CERA 1PKEA 1RYHA 2IXTA 1QYXA 4NYIR 3P45A 4MTCA 1CJKC 1ULTA 2VRCD 3FGNA 3MCZA 4ZI5A 2CVHA 3KVOA 3TIIA 3FZQA 1MO4A 1O95C 4C5BA 3UQYS 1V6AA 2J9FA 3LTEA 4QEZA 4O3MA 3IDQA 4U9UA 1K68A 4ZVPA 1ZISA 2EC5A 4C04A 4TWRA 1BDBA 4RPIA 4CMEC 1CY8A 3NJ4A 4H7PA 3EPRA 3NVMB 3Q8MA 4UAUA 2CFIA 1UC8A 3LBFA 2BMJA 3OZRA 1PJ8A 1QHFA 2H8KA 4MS4B 3T3HA 1N5OX 4JVMA 2O3RA 3U7HB 1P0QA 2GRUA 1G6KA 2GKGA 4N47A 3HH8A 2O2XA 4CMEA 2QRMA 3BHIA 3DWEX 1PYGA 4FPXA 5DE3A 5ALIA 5EUQB 4Z7QB 2JCXA 4HGRA 3K20A 4MJLA 4GOXA 3NTOA 2IIBA 4AFNA 5DNYB 2F43A 3FNHA 2BEWB 2JATA 4I1IA 4RHXA 1KY3A 1AXRA 1DLJA 1UBSB 2RK3A 2X6RA 3G8YA 3LE8A 3R6WA 1MIOA 5AM5A 5EMLA 3MLAA 4NCAA 3FWKA 3JWEA 3MAJA 3QXGA 1R18A 3ETHA 4R9RA 3R7WB 1AM4D 4A0SA 2B35A 3AVXA 1K6MA 2JJ2A 2NGRA 2OILA 3KK0A 3LQQA 3Q15C 4MUHA 2ZDHA 4R2JA 5DTQA 3S1AB 5ICMA 2P9GA 4FFSA 3RSGA 5E3HA 1NXWA 4JIMA 4XOUA 5JDCA 2PJUA 1B0ZA 3EHDA 1ULAA 4MUJA 1H6BA 5EA2A 1ULZA 1WB4A 3K53A 2PX2A 3K8YA 3KLBA 3EWSA 3PC8A 3PDJA 3QXCA 4RIIA 5B1YA 2HF9A 3GQBA 1FVFA 1GAJA 1SFRA 2A86A 2TMDA 3D8TA 4C7OB 4REQA 1SCBA 2FW0A 5K3FB 3VAZA 4WCDA 2O7QA 3P0JA 3RS5A 1WZEA 1RYMA 4XCXA 3NORA 1ULHA 4KCGA 4EPXA 2XDWA 2F17A 2NZUG 4F3NA 1VMKA 3GFFA 5IYZB 2QM7A 3AR4A 4BJ6A 1BHO1 2HFKA 5EESA 3ZBUA 1EDOA 4LFBB 2I1VB 3OZ7A 1NZDA 2QIPA 1EBUA 4P7FA 5HUJA 1JZQA 5LYJA 1S4MA 2ODEA 3FHCB 3HXMA 3KB2A 3KKEA 3BWMA 2ERCA 4JLVA 1JDTA 1VKHA 3PFHA 4L0CA 2FR0A 5EIHA 1VMAA 1DIRA 4PM4A 4V2IA 5DO9A 3PU6A 2R7NA 4RVSA 3TBKA 2VAMA 2LV8A 2PG3A 4MVJH 5A02A 2A9JA 2DFKB 2JD1A 4RM3A 4IUDS 2ANBA 1SBNE 2ZU0C 3ETGA 1KK1A 4P81A 3LF1A 2B2XA 4REOA 4I81A 1DJMA 4JODA 3EFOA 4RMHA 5I7HA 3GBVA 4E30A 4DLTA 5JJIA 2OUKA 2ZRQA 1W0KD 4HAYA 2CHVA 2MWMA 2BGTA 3N2IA 5AJZA 3SS9X 4CLHA 2XKJE 2ZYRA 2VK2A 2X8AA 1K7XB 3ESBA 2IDJA 4UHHA 5CNJA 2WILA 3WJ2A 1VJ1A 1H9AA 3OP4A 1OVGA 1U0GA 1DPFA 1K6EA 3GRYA 5FPPA 5FYDA 4FNOA 1OI3A 4LY6A 3TLEA 2CXOA 13PKA 5TRTA 1T24A 3VVLA 3T3NA 1QONA 4KFTA 4LV5B 4P35A 3W5UA 1MNQA 2LUOA 2WF9A 3A58B 1DDIA 3D6AA 4MUIA 3PQ3A 1YMUA 2X8WA 4Y1FA 2AT1A 1PR5A 3HXLA 1FTWA 2QX8A 5DYWA 2FGKA 3S1AA 5ENDA 4RJKA 4C14A 4B3TB 4IEEA 3RREA 1A76A 1MB4A 1YOBA 4RBNA 4AIRA 1BNCA 4MEJA 4C0HA 2FA9A 2IHUA 1FMLA 2WAOA 4O2AF 4YALA 5KTRA 2W4QA 4GX0A 2JEYA 3DMHA 1WSBA 1Z5GA 3H9CA 3PFIA 3I2JA 5LBUA 1J56A 2B7BA 1FW8A 1HY3A 1GKLA 3LDUA 3QVMA 4IFBA 1M2VA 5IC5A 5HM8A 3D0OA 4RHTA 1L0BA 3ZL9A 4KTTE 1D9XA 4KMSA 1NG9A 3E18A 3LLVA 4EX7A 3KJHA 1SXJA 2OBLA 2EFCB 2CUTA 3GLHB 4RA9B 5EMHA 4ZRMA 1JLLB 2DCMA 4LE0A 4TTRA 2AEMA 4WVFA 2C0PA 1KZGB 3TNDA 1Z35A 4LWQA 3LK7A 1Q0TA 1N0HA 2JG3A 1DX6A 3WBKA 1K5GA 1S1CA 2Y0EA 1X7GA 3KUXA 2O8VA 4P7KA 4CU5A 2XA9A 1CT9A 1M1YA 2CLCX 1OAAA 1U0SY 2EIHA 4OQDA 4ZQBA 3LM8A 2PZEA 3DBIA 3FZGA 3WICA 4KW7A 2RG1A 1AKNA 3EK2A 4O1MA 4GKKB 1HRDA 3NYRA 3R9IA 4BKQA 4UNQA 1TEXA 2IZ6A 3MYYA 3PA6A 1U0RA 3E4DA 2WKWA 4P3KA 1FRZA 4X3PA 1VB5A 4Q7MB 3W6NA 1JJAA 2ZDGA 2GLUA 3AEXA 3GV0A 4IKEA 4JT2A 3TK1A 5B7QA 4M9RA 4PGGA 3UJDA 4AZ0B 1Z73A 2IDZA 1P6UA 2WSYB 4GPIB 4OXIA 2X19A 4LJKA 3X1YA 1Q0HA 3N74A 2AMFA 1RKVA 3GXOA 4REMA 4B34A 1PTKA 2X0IA 4C6TB 3DAOA 4ENTA 4LXGA 4QYXA 1J5PA 2EKLA 1YC5A 2OXRA 4CCYB 1I80A 3HFGA 4ZGGA 4OFXA 4JGGA 1R6XA 3SEFA 2HSDA 5B4UA 1EP2B 4ND8A 5ADHA 3M9XA 3S8EA 2CV2A 1KRXA 4V0KA 4NZMA 4RVFA 2YHIB 3H2KA 3SOZA 4N7JA 1FFHA 5IAGA 1L4FA 5K9ZA 1Q91A 1TZMA 3DEYX 3DDCA 1Q20A 3QH4A 2G25A 4QPJC 4KU4A 1T2DA 1UK6A 1XF1A 4KITB 1BW9A 1KOFA 1N32B 1KMHA 3NHBA 4BEVA 4YGXB 1RJWA 1WB5A 2FZEA 3VTAA 4ALMA 1PLJA 4PO8A 2AR9A 4HOYA 2ZP1A 1Q57A 4EHKA 5E9JA 1R5NA 2VHYA 4YJ2B 2GA8A 3QVXA 3RKSA 4F8YA 3ZKWB 3FCUB 2D4AA 1RTKA 2QAGA 3FVQA 3KQQA 1GTL1 1K4MA 1FY2A 2MSEB 3CIOA 5BSFA 5AVQA 4TMZA 5AW7A 1RKUA 4YRNA 1V7CA 4TN5A 4LF4B 3CRNA 4K3VA 1GNVA 5BVGA 5F2OA 2H1LA 4Z8YA 3OJWA 3M0EA 4CF7A 2Q27A 4PO9A 4P86A 2Z1MA 2C4HA 4QHYA 3LOQA 4FSDA 2Y0DA 1D2RA 2ATXA 4JKYA 5I7WA 4KDCA 5K6TA 4IMRA 2Q62A 1YRAA 2HBRA 1UQUA 3CEPB 4BB9A 4ER3A 1XRLA 1AKEA 2HMYB 1T25A 2C8VA 5JVDA 4UE3S 3FTCA 1CZKA 5FKJA 4IX9A 1S01A 5G40A 3E7PA 3ZJ4A 1AXEA 1DQPA 2Q6IA 3S8YA 3WQBA 1RHJA 1GQSA 1K9VF 1SZDA 4G97A 3P2YA 4M22A 5JECA 3W79A 5B3LA 4GQBA 4YWHA 4YAUA 2WIFA 5FEUA 2GF2A 4A0QA 4ON9A 4BO5A 1GGEA 3B3JA 1XTKA 4F3TA 2F1OA 2ZI9A 5HGJA 2XYQA 3G9TA 1JHAA 3LW7A 5TT1A 2G9UA 1XL0A 2B92A 3OIVA 1DELA 1SOUA 4C0QC 2ICAA 3FH0A 5J2UB 4CDGA 2WJIA 1XCBA 3H87A 1CEQA 3KOUA 5JS6A 3BE6A 3ZS9A 5BWOA 5JBIA 3O2SB 2JIRA 3CRRA 5F52A 5H3LA 2QTGA 4DXDA 2O1SA 3H7IA 1W0JA 4A73A 1JYEA 2BY4A 3RQSA 4BUZA 2VBGA 1Q83A 4CM9A 4DR6B 3L6RA 3FVWA 2COEA 3F7TA 4YA6A 2BEWA 3SJBA 2JAOA 2F62A 3EIUA 3SK0A 4UTNA 2PE5A 1DO8A 2JD2A 3GLQA 2V1UA 4I8XA 2DE0X 1QQAA 3X1DA 5DTMA 2Y92A 3C1OA 3ZW7A 1A2KC 1XNHA 2AOTB 1WV1A 2BR4A 2JK1A 3EDMA 3LQKA 4J3JA 4AO6A 2RK4A 3FF1A 4CE6A 3EMDA 1QP7A 2ZUBA 4G25A 1Y42X 3EDOA 2P4HX 3AETA 3BRQA 3JS5A 4KGZA 1L1RA 1Y7LA 2AXPA 4L4SA 2ZSJA 1EUZA 4D3DA 4F0JA 2RB4A 2OHIA 1O2DA 2VDWB 1NLMA 3JYQA 3PTLA 3RSFA 1JHMA 3I83A 4L5AA 5TEVA 2RHMA 5I45A 3G68A 1H3FA 4G1CA 4AECA 1BKDR 3PVCA 1DXOA 2GZSA 3QU4A 4HAVA 1JG3A 2XWSA 1KEKA 1WUIS 3OE5A 5JW6A 5D5QA 1QXSA 4PC6A 3DZFA 3QKUA 1GUYA 1YO6A 2VAXA 3EC1A 3PDIA 1OXBB 3Q7SA 4L75A 5I3ZA 4RZUA 3E7FA 5AI4A 2J07A 3TIVA 1VHJA 3DA8A 3VZSA 2YNMC 3OFVA 5F3WB 2NV6A 1Q2XA 1SC3<