1WVGA

Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
356
structure length
352
Chain Sequence
SIDKNFWQGKRVFVTGHTGFKGSWLSLWLTEMGAIVKGYALDAPTVPSLFEIVRLNDLMESHIGDIRDFEKLRSSIAEFKPEIVFHMAAQPLVRLSYEQPIKTYSTNVMGTVHLLETVKQVGNIKAVVNITSDKCYDNREWVWGYRENEPMGGYDPYSNSKGCAELVASAFRNSFFNPANYEQHGVGLASVRAGNVIGGGDWAKDRLIPDILRSFENNQQVIIRNPYSIRPWQHVLEPLSGYIVVAQRLYTEGAKFSEGWNFGPRDEDAKTVEFIVDKMVTLWGDDASWLLDPHEAHYLKLDCSKANMQLGWHPRWGLTETLSRIVKWHKAWIRGEDMLICSKREISDYMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CDP-glucose 4,6-dehydratase
publication title Structure of CDP-D-glucose 4,6-dehydratase from Salmonella typhi complexed with CDP-D-xylose.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 135
structure length 352
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.1.45: CDP-glucose 4,6-dehydratase.
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wvgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1wvgA02
4IIVA 2AE1A 3DC2A 1R6DA 1N8KA 4B4UA 4PRKA 5EL0A 1HL3A 1KC1A 3HNPA 2PY6A 4XIYA 2Y1EA 3HWRA 5KVQA 4A10A 3F6YA 4ZRNA 1YJQA 1Z74A 2JD2A 3E03A 2LDBA 4TRRA 1LA2A 2BD0A 1WP4A 4YT5A 4D3DA 1DRWA 2EW8A 2VHYA 2C54A 4A03A 1DFGA 2C07A 3JQAD 2NUAA 4WECA 4IDEA 4TKLA 1ZW1A 2ZB7A 4UEJA 4OGWA 5DBIA 2DUWA 1HE3A 4AVYA 3KYCB 3QVTA 1E7WA 1VJ1A 2C82A 3DL2A 3WBFA 4DC1A 4YPOA 1PJCA 4GKVA 3NT4A 4JIGA 5JNLA 4Z0HO 1DAOA 2OMEA 3AU9A 1Y8QA 4D46A 3IAHA 3Q9UA 4UULA 3OJEA 4N54A 4A73A 4BNZA 1NNUA 3DMTC 3GPIA 4FIZA 4CM3A 1EBFA 4IJUA 4ZJUA 1MX3A 1GTMA 1LU9A 1C0LA 4IM7A 1LQUA 2YZ7A 2DVMA 3H9EO 4WOKA 4NBWA 3DBLB 1OC4A 4BVAA 2PZJA 3GQVA 4JXKA 3TSCA 1GQQA 3UOGA 2D0IA 2JKVA 3KRTA 3RUHA 1ZZEA 4J1TA 3PJGA 4YTEA 2OO5A 4J3FA 2X1HA 3WJAA 3JYPA 1ZEJA 4OH1A 2HCTA 1YVEI 4L76A 2VCYA 3EZYA 1GEEA 3VPFA 3H3JA 4NNJA 4QT0A 4N5MA 1DHRA 2EWMA 2PH3A 2PWZA 4OOEA 1ZIDA 4WK6A 3RIHA 4FJ1A 1UXJA 2QG4A 1E6UA 1ENZA 4ZQHA 4B8WA 4RPLA 1ZMOA 4PIVA 4YJGB 2C7VA 4E33A 2DUUA 4W7HA 3B1KA 4CV2A 4ZN6A 2B69A 3GY0A 3I23A 4MP6A 4PG5A 3CZRA 4DMLA 4MOWA 2NACA 2GR9A 4BNJA 4UUNA 4BGIA 3DB2A 2ZTMA 1T2FA 1DFIA 2WE7A 1UR5A 4FJ0A 1HSOA 3JQGB 4P4LA 4YAGA 2NVUB 3CIFA 4L9RA 4R54A 2RIRA 2H6EA 3RC2A 3AY6A 2P5UA 4IJWA 3V1YA 3A28A 1NFFA 4XYBA 4YRDA 1NWCA 2VOJA 5TT1A 5IZCC 3WFJA 2NVBA 3RC7A 1C3VA 1SNYA 3F1KA 3MJ4A 2NNLD 2HK8A 4DUPA 3DMTA 4ND1A 2NTVA 2Q1UA 4ITUA 1EDOA 1MFZA 3HN7A 3I4CA 4D42A 1HT0A 3ANLA 3FN4A 3RU9A 2WYWA 1HDRA 4E6PA 4BIIA 5TF4A 1XIVA 4NBUA 4MINA 4D43A 5EJ2A 3AFNA 3OEWA 3PYXA 4R4JA 5TC4A 3DZIA 3R3JA 1KY4A 3U62A 4IBOA 3PYMA 2R00C 5KIAA 1P0CA 2EG9A 1SOWA 1D4FA 1H5QA 1Z45A 1ULUA 4Q9NA 5AXAA 8ADHA 2HJRA 3GVCA 3KHUA 4TSKA 4PZDA 1LSOA 3MTJA 3TZKA 4M87A 5DULA 1ONOA 1BDMA 2PKQO 1WAMA 1IUKA 3NAQA 1KBZA 2O2SA 2TMDA 2V6BA 3GEGA 2J5KA 1IPEA 3ULKA 4DLLA 2RHRA 3I9OA 3MTGA 3AI2A 4Z9FA 2CF5A 3SEFA 3FNFA 1E7MA 3QIVA 2JHFA 5A9SA 1QSGA 2AG5A 2B35A 3E5MA 4LRTB 1NQTA 5ES3A 5JLAA 4MVJP 1T4BA 5HRUA 4GAEA 1LSUA 4TVBA 1VL0A 2OL4A 2OFPA 3EAGA 3RQSA 3U4CA 1O95A 2FWMX 3LC7O 4NG5A 1ZK4A 4EEZA 3WWZA 3BMNB 2AA3A 4CMGA 3A9WA 5JC8A 3OQBA 3JQAA 1I5RA 1ADFA 2Q46A 3HB5X 4CQMA 5BSHA 1ZJZA 4W99A 4PLZA 5F1KA 4WNIA 1GYRA 1A27A 3H65A 3L0DA 1NQAO 4ND4A 2HMUA 4IUYA 4AJHA 3M1AA 1P1FA 4DIBA 3R6DA 4WCFC 1Q0LA 4HNHA 4MVJM 3GFGA 4U7WA 5IZCA 1BWSA 2D3TA 1HE4A 4YAEA 1UP6A 3OA2A 5CEJA 1EZ4A 1KVTA 4XYGA 1IULA 1XU9A 3C8MA 4BQPA 1T1RA 2I76A 4J4HA 3U3XA 1ZK2A 4NFYA 2NQTA 1F14A 1MUUA 4PN3A 1Y9EA 2W2KA 5DBFA 3S2GA 4UUMA 4ND5A 3SJUA 2D4AA 1YKFA 2HRBA 2O7SA 3JQFC 4I9UA 1XQ6A 1DC5A 1NQOA 2GN6A 2W98A 4BNMA 2C59A 4JBGA 4ND2A 4MVJH 1JW9B 3IMFA 4PLFA 3ZNQA 4CPDA 1SCUA 2AW5A 3G1TA 4OXKA 4IZIA 2F1KA 4E12A 2POQX 2RAFA 1Q0HA 2IE0A 4J4BA 3L9WA 4ESOA 5C37A 4EJ0A 4X54A 4CUZA 9LDTA 1ENYA 4XA8A 3FBTA 5CAEA 2WM3A 1T26A 3INTA 5CPFA 4BO0A 1ZSNA 2W2LD 2ZQZA 1PL8A 1LC3A 2WEKA 2I5PO 2O7QA 1NM5A 4DLBA 1DJQA 2CFCA 4XQ9A 5EPOA 5MDHA 1BVUA 1E3IA 3FCOA 1BXKA 2P9GA 3PHHA 3ENNA 3O9ZA 4JN6B 4B3HA 4E5KA 2DPGA 3PZBA 2EJVA 2GN8A 1ZK0A 1T2DA 4CLRA 1EVIA 4RDIA 1E3WB 5KKAA 3RWBA 1HEUA 3E8XA 3C24A 3RCBA 1B14A 2PD6A 3VZRA 4DRYA 4KWIA 4E30A 3PZRA 3CMMA 3RKUA 2NVWA 4C7KA 3IJPA 3KEQA 1DO8A 2EF1A 4QX6A 3GC6A 3OEYA 4S1VA 4AL4A 3ANNA 2NTNA 1ZK3A 3TWOA 1P1RA 3BMQA 4WCFA 1YB5A 4M55A 4FC7A 4QECA 3UW3A 1K3TA 4PLPA 1QYCA 4CMEA 3PFFA 4PLYA 3GZ4A 1G0OA 4J1QA 3D64A 2CDBA 1ONPA 4Z6KA 1HETA 3IJRA 3MCVA 4URFA 5HS6A 4B7CA 3PHLA 1MXHA 3LT1A 5CDYA 3WMXA 3QWBA 4Y6SA 3QWIA 4YACA 5A05A 4KTVE 1OFGA 3H5AA 4RVDA 3S2EA 1P1JA 3LK7A 2RHCA 5DCWA 3U09A 4IY1A 3ASUA 3QQPA 5LDHA 3OQ6A 5TT0A 2BGMA 3ZWYA 3D5QA 4IXTA 3WGOA 3KVOA 1PSDA 4LMPA 5HA5A 5TJ9A 2HMSA 4LN1A 3KYDB 4AJKA 3KETA 4E31A 1LLCA 1EVYA 1ZO8A 3PRJA 3OJLA 1LJ8A 5CEEA 4MDHA 4LW8A 2WYVA 1ADGA 2D1YA 2GGSA 3IOYA 4Y9DA 5G4KA 3AOEC 3QWAA 4J0EA 1ISIA 1DBVO 5F1PA 4ZD6A 4E5PA 1BVRA 4MKRA 5LDGA 3AUUA 5JAMA 1R16A 4EITA 2J3IA 5JCJD 4EBFA 3D4OA 3VZSA 3CINA 1UP7A 2ILTA 2PZKA 1LLUA 3W4IA 1HDGO 4K26A 1CJCA 2E48A 3IDSA 3NEPX 1JWBB 1P0FA 2FOIA 2W4QA 1V0JA 4LISA 2AQKA 2ZTLA 3B70A 2XXBA 3F4BA 1NWHA 3TOZA 2QHXA 1N1EA 2CF6A 5DF1A 4ALIA 3TFOA 4NZ9A 1I3MA 2F00A 4PG6A 4JQCA 4PLCA 2D5AA 4RZHA 4GVXA 2HSDA 3AUTA 4FDAA 3CEAA 3OH8A 5C3MA 4HFJA 6LDHA 4XJSA 3PIIA 1P1KA 3W4KA 4F3YA 1XR3A 1EUDA 3EYWA 4RVFA 4TKMA 4IDFA 1FJHA 5TLSA 4OSPA 1F8FA 3NDRA 1DOHA 1Y8RA 2HDHA 4ZHSA 5IDYA 4Z0PA 3DWFA 4CM9D 3SLGA 3Q3CA 4XIJA 4GSKA 3CUKA 4FFMA 1EE9A 5I9MA 1TI7A 3GDGA 1F12A 3KM0A 2NU7A 2OBNA 4MKZA 2Y68A 1A5ZA 3GPDG 3S8MA 4J9VA 4FFRA 3TZHA 1CQIA 1TVEA 1WDKA 2O2YA 4HUJA 5G0WA 3PFWO 3H3FA 4DA9A 4Q39A 3CZMA 5TNXA 2EKLA 2PKRA 5IF3A 2QRLA 1QG6A 1LBEA 4IGFA 4IQ0A 4TQGA 2QYSA 3FTNA 3AOEA 4XQEA 1GZ3A 3ASVA 2CD9A 2AQIA 2ZTUA 4OXNA 3NJ4A 2H1SA 2OBYA 2UAGA 3DQPA 4OJNA 2DBRA 1A72A 1SEVA 1W6UA 4BB6A 3GGOA 5L7TA 1RM3A 4DBZA 1HZJA 3GNTA 2B36A 1CQJA 1CEQA 2EKQA 3BMCB 4E0BA 2Q49A 4FFLA 2R2GA 4LGVA 1X1TA 4IDDA 5CP8A 5JSFA 1R4NB 4D41A 4MVJG 3IUPA 2IDZA 1CETA 1ID1A 5A5EA 1E1LA 4BNWA 5AXDA 1M67A 3GK3A 3ZW9A 4JJFA 2HAEA 3ON5A 4E5MA 2VN8A 5CDSA 2X86A 2JAPA 3DBHB 3FWNA 1PS0A 3NGLA 1M6WA 4JP2A 3KSUA 4WLNA 3V2HA 2QYTA 3ZDFA 4A2CA 2AE2A 4JCOA 1S7CA 3I6QA 4RORA 1QLJA 3QWHA 4CQLB 3O26A 2PK3A 2J8ZA 1XLTA 4IS3A 4ZVVA 1UZMA 1O5IA 3JYNA 3RUDA 5H82A 1JAYA 2DTXA 2FY8A 4TRMA 4BNLA 4PG4A 1EFLA 3WGGA 1C0IA 3KYCA 1NVGA 4IXWA 1DFHA 4RL6A 1OAAA 1SMKA 4FD3A 6ADHA 3PLNA 5DCUA 4BNIA 4DPLA 2GZ1A 1H6CA 4RZIA 1H6DA 3L4BC 4GPD1 2AEFA 4L75A 3KUXA 1ZXLA 1PIWA 1R0LA 1MC4A 2OOSA 1ZSYA 2EEZA 5L7YA 2AHRA 4QEDA 4D45A 3V5NA 3D5TA 3DBLA 2Y0DA 1MB4A 3SBOA 3WQQA 1RM5A 3WTCA 5JMPA 4P38A 1WXDA 4RF2A 4F6CA 4RF3A 4M1QA 1UH5A 5KNLA 1O94A 2Y99A 3F5QA 1PZHA 3RD5A 1O8CA 5KTKA 5TX7A 4W82A 2RH8A 4OL9A 4N18A 5TQVA 2JFHA 1EQ2A 3WR5A 2QZ9A 1KVSA 4JJIA 3H9QA 1K2WA 1YBVA 4E21A 4UEKA 1J6UA 2HJSA 5T8KA 3F1LA 3QJ5A 3MJCA 4H16A 5EQFA 3RJ5A 4O63O 3ZHBA 1IPFA 1G6KA 3O8QB 4XB2A 2Y1DA 1VSVA 3E1KA 4RPJA 1C1XB 3FWZA 4FJ2A 3NJ8A 3STHA 3UVEA 3V1UA 4YJGA 1C1DB 1YXMA 1LXCA 2DLDA 3FPLA 1ULSA 2EP5A 3CPSA 2Z95A 2D2IA 4OQYA 4BKOA 3WS7A 3PWSA 4R1UA 2W8ZA 4ZQFA 4XJTA 1PEDA 2WWRA 3QSGA 4HV4A 1E3JA 4D0SA 1MG5A 1ZFNA 3JQGA 2NVUA 3FHLA 2P68A 1PGOA 3OICA 4RLHA 4CM4B 4ZRMA 4CODB 1KIFA 1Z7EA 5DT9A 4DWVA 5C5IA 1P45A 4O1MA 3UFXA 1SOVA 3L4BA 4E32A 1UAYA 2Y05A 3KOUA 2UVDA 2DAPA 3ZNOA 4I08A 1KVQA 1J5PA 1NX6A 3NDIA 4RO0A 5I7VA 4W9NA 3WLFA 3VPXA 2FPGA 2R6JA 3CE6A 5I7FA 2Z5LA 4PG7A 4YDRA 1UDBA 3VDQA 5T67A 3H9JA 2Q1SA 3PQFA 1ENPA 1BTOA 2Q50A 2UUOA 4BQRA 1YS4A 3E9MA 1GQ2A 1VKNA 1ZEMA 1TA4A 3K73O 3K9QO 3WQSB 3QVOA 1BGVA 2O4UX 1B16A 1E1NA 1F17A 2X7HA 5ER9A 1QLHA 4BMNA 4NFSA 1E6EA 5ILGA 4DL9A 2DM6A 3BXXA 3VZQA 1O6ZA 1U2GA 1KS9A 4J2OA 3ZV6A 3FNGA 2DFVA 4DPMA 4BO5A 2IYPA 5A1TA 3UCXA 1U3TA 1K6XA 3BHIA 5JS6A 1MXFA 2HRZA 2DBVO 4EDFA 1M75A 3OSUA 1GCUA 5EIOA 3T7CA 1VPDA 3KYBA 4BKRA 3GR6A 4HY3A 5KJEA 5FYDA 3OIFA 2FSVA 2I3AA 5CHEA 3VDRA 1KC3A 1EDZA 3GEDA 4BNHA 2C0CA 3X2FA 5BSGA 4G81A 3VHRA 2I3GA 3BMNA 1BDBA 3AU8A 3WGYA 2PA3A 2PLAA 4Z0TA 4MIYA 4WCDA 3ZI0A 2YV3A 4L8VA 3H6KA 4D3SA 3LZ6A 3RBXA 2D5CA 1U8XX 1TXGA 2G0TA 2W90A 1CF2O 4N7RA 3ICPA 4FW8A 3AJRA 3JV7A 3WGHA 5T5QA 3ROQA 4KDEA 2O48X 1VLLA 4OM8A 4RF4A 5CPBA 1B8VA 4L73A 4R16A 4KUHA 1GUZA 3MOIA 5C7LO 3RUAA 3DAPA 2FHSA 3MJSA 5T6BA 2X0NA 4WLVA 3UN1A 4J1SA 3ZU5A 2VWQA 4F6LA 1ISJA 3G79A 3KLPX 3M6IA 1HYEA 1LDYA 2FR8A 5ER6A 3VVBA 2GASA 3DFZA 5THKA 4MIEA 3K31A 1NR7A 5JE8A 3FTPA 1GD1O 3GGPA 1NAHA 3AOGA 4ROSA 3AM3A 2I99A 5TSDA 4B3JA 2FN7A 2VZ8A 1ADBA 5KVSA 1MFPA 1ZH8A 4BMVA 5KWEA 2EHDA 4FS3A 2DC1A 1JAXA 5I8ZA 1C0PA 3I9JA 5CEFA 5A02A 2AXQA 4B4VA 2SCUA 2HK7A 4MVJA 2HUNA 3AFMA 4JNKA 3PQDA 4XR4A 3NTOA 4AJ2A 2CSUA 5ENVA 4YWJA 4L4XA 2WYUA 4RLSA 4DIOA 2ZJ0A 2GN9A 5U1PA 2V65A 2Y0EA 4BNYA 5MGBA 4R68A 3W4JA 3PHJA 1PU2A 1GL3A 2ZYDA 2NU9A 3JYLA 5H81A 3OP4A 3IL2A 1V35A 4LMRA 2GN4A 1KEPA 1E3WA 1YB4A 4WOJA 3T7EA 1DIGA 3TN7A 5IN4A 1Y6JA 2V6MA 4XQCA 5CDGA 3SVTA 4QQRA 4BV8A 3OF2A 4NK5A 1M6HA 5IDWA 3SC4A 4NFHA 4IDBA 1N1GA 1MC5A 2C29D 3WWYA 4AJ4A 3VKVA 1ORRA 1U8FO 3ZH2A 4AJEA 4UVEA 2VNAA 4CR8A 2DTDA 1N7HA 4XB1A 1HLPA 1A71A 1X1EA 3I9NA 4U0JA 3GRPA 1X7DA 4AJIA 3U5TA 4TZKA 4CMJA 4NBVA 4QO7A 3KV3O 4DC0A 1KVUA 4NU5A 3EW7A 4K6CA 1L1FA 4CL3A 1D1SA 2EP7A 3ZHYA 1EQUA 3HDHA 4IGEA 4EJ6A 2GPTA 3UCFA 4AG3A 3DOJA 1Z82A 1B26A 1A7KA 1U4SA 3RKRA 1LSSA 3BMOB 3AY7A 3G49A 1Y81A 3P2YA 3GDOA 3DZFA 1DAPA 2Y67A 3TDKA 1GV0A 4MO2A 1LX6A 1I10A 3WYCA 5L40A 3WMWA 3KYDA 2JFFA 4WJZA 3GNSA 5JYEA 1KY5A 4BKUA 3KBOA 5A3VA 5IXYA 1LNQA 4QSMA 1CERA 4WLEA 2NSDA 1XHLA 3HE3A 2Y93A 3TL2A 1EFKA 1QYWA 4WASA 3CXRA 3DHNA 3RUIA 2JJYA 2DKNA 3CKYA 2X58A 3GT0A 5F5LA 3WSWA 4BV9A 1B15A 4D7AA 4BB5A 3OIGA 2X9VA 3DDNA 4BS9A 2X23A 5L9AA 3JTMA 4UVGA 3GVIA 4RF5A 5KOIA 2CDAA 4UUPA 3RUFA 4B7XA 1IE3A 3DBRB 1ZK1A 4IIUA 4XWYA 3ADOA 4CM5A 4NJOA 3C7AA 3QHAA 3BTVA 3LLVA 2WE8A 4CM7A 3HG7A 1NP3A 2QRKA 2OUIA 2HKIA 4FGWA 4CMEC 3GAFA 4F46A 3PGJA 4EUEA 3B20A 3ITKA 4I5GA 2H5LA 3OETA 5AXBA 3KEOA 2VHVA 1XYGA 3ADPA 1XEAA 4IDGA 3JQ8B 4UVIA 2NADA 5FI5A 3ZGYA 3KLMX 2O4CA 3PHIA 3OBBA 3ONDA 4FCCA 4I9HA 3X2EA 2A9FA 2WMDA 5TS3A 3I9LA 4GLOA 4RDHA 3BTSA 4KWHA 4XGKA 3BIOA 3KO8A 2IZ1A 3JCZA 2YDYA 3NKLA 4Q3CA 4NQZA 1U28A 1ZNQO 4XCVA 3ONFA 3E9NA 1NPYA 4RVHA 2B4QA 1H6AA 4IDCA 5H83A 2ZCUA 3QP9A 1GYPA 2PGDA 4CUJA 3A1NA 3KZVA 4JK3A 4AFNA 3HN2A 4AJOA 1KYQA 2BFOA 3FRJA 4Z9YA 3C1AA 3GZNB 3QVWA 1E3LA 3AUAA 1ZKMA 5CFZA 2GYYA 3NRCA 3RBVA 3H5RA 1KETA 2GSDA 3UXYA 1PGQA 4FB5A 3PXXA 3INGA 3ZWAA 5JCXA 4K1LA 4R69A 4KUEA 4YR9A 2I6TA 4MJLA 5JMWA 3LU1A 2OXIA 4L74A 2NQ8A 4LCEA 1EEHA 1W4ZA 1IZ0A 2YJZA 4A27A 3TZCA 5BR7A 1E7RA 1TB4A 1OZAA 1ZBQA 5KVVA 3VH3A 1SAYA 5BNTA 4ZGWA 2Y1CA 4NK4A 3K5PA 2H9IA 2Q2WA 4UVHA 1G0NA 3BMCA 2AQHA 1E6WA 2Q1TA 1PL6A 5HS4A 4J1NA 1N5DA 3I83A 4IZHA 2YV2A 3I6IA 2EKPA 2JL1A 3ABIA 2X5JO 4BNUA 1R4NA 5AYVA 3I9MA 1SC6A 1QYVA 4C7JA 1QXSA 2GDZA 1ISMA 3K30A 1TT5B 3MJVA 3PJEA 1I2BA 1DIHA 3PVZA 3P7MA 4B3IA 3ICCA 5FF9A 4MP8A 3PDJA 3QWFA 4QUKA 3RC9A 3DBHA 3DOCA 2HU2A 3VVCA 2IYOA 3D4PA 1PGNA 3N58A 2FMUA 3Q2IA 2YFHA 4R01A 3ROMA 3DZKA 3F5SA 4P22A 3RFVA 3PTZA 2NM0A 3WXBA 4O0LA 4GX2A 1E3SA 1U7HA 3I1JA 4EZBA 1HRDA 4GGPA 2JCXA 2ZYAA 1DC6A 4CQLA 3E82A 4RVUA 2Q4EA 4Z9XA 3KSZO 3H4VA 2O3JA 1VL8A 2IODA 2YV1A 4K6FA 5L51A 4Z3DA 1IHXA 1PWXA 2HMTA 3DR3A 4CMHA 1U3VA 3O4RA 4JGBA 4EYEA 5ITVA 1S6YA 1Y9AA 2WDZA 3O38A 4BO9A 1X13A 3FF4A 2AMFA 2NU6A 1UXKA 1QYXA 1EBUA 2DPHA 1OOEA 3ZW8A 1R66A 4DBVO 4Y6PA 2PKQP 2PTGA 1KERA 1WVGA 1BXGB 4YJHB 3FNHA 1UAGA 4N5NA 1DC4A 4YT2A 1YRLA 4E5NA 1RPNA 4R1TA 2P2SA 1F06A 4OO3A 2C5EA 4RGBA 3VPHA 3UAGA 3H5NA 1XWFA 4LRSB 5DNAA 3WNQA 4CL8A 1M76A 4CV0A 3ZWCA 3N7UA 3NYWA 5B12A 2VRCD 3GMSA 4IDAA 5DN9A 1JLLA 1LLDA 1WDLA 2Q2VA 3RU7A 2J3JA 1K5HA 2QQ5A 5A04A 5EESA 5K0ZA 1NFQA 1UP4A 1YOVB 4E5YA 1E3EA 4XZ3A 4FQ8A 3TL3A 3OM9A 4Q3BA 3DAFA 3GAZA 1ZUD1 1LDBA 5A3JA 3TOXA 1OBFO 1PQUA 1NVMB 4RPHA 3ZWPA 2VWHA 3U9LA 4MVJF 4DXHA 2E49A 1IHYA 4O5OA 3B1FA 3DFUA 3JQ6A 4PZEA 4QO8A 2IXBA 3B6ZA 1P3DA 4I9NA 3E48A 2IXAA 3M1LA 4J91A 1ADCA 1DLIA 4DIFA 3WOHA 5A03A 5ICSA 4D3FA 1HWYA 2DU8A 2B37A 1LI4A 3O8QA 1MLDA 5IFLA 3JQ7B 4ZU3A 1C1XA 4LSWA 1QRRA 3RASA 2O3SA 4AJPA 1HKUA 1C1DA 3C7DB 1UZLA 3K96A 4Q3NA 1FK8A 4BNFA 3PJFA 3CSDA 1Z6ZA 3HZZA 1ZVMA 3AI1A 4NBRA 4CM6A 2FR1A 3RUEA 3DO5A 3LQFA 1N7GA 1GU7A 1ML3A 5IG2A 3QA9A 2DT5A 1PZGA 1EK6A 1WNTA 1YDWA 4J2HA 1UZNA 4B4WA 2FPPA 3WX0A 1ISHA 1D8AA 3PWZA 4CMAA 4EUFA 1YB1A 3JD1A 4LVCA 5JAIA 1YQGA 4CM4A 1B8UA 1UDCA 1B7GO 1PQPA 3OJFA 4AICA 2W2LA 1P9LA 5JDIA 3JQ9C 4RQTA 2X22A 4FGSA 2Y1GA 2GD1O 3WDSA 4G5HA 3E5RA 5JW6A 2A94A 4JBHA 5JO0A 2QIOA 3WTBA 1MA0A 1IZ9A 4NHEA 2X5KO 1A4IA 3W8EA 4XQGA 3EZLA 3D4NA 1PJ3A 1KVRA 3H9UA 3WGIA 1DC3A 2A92A 1TT7A 2GF2A 3I4FA 3EVNA 1XSEA 3ZV5A 2GLXA 1T24A 2FZWA 3PK0A 1QV6A 3ETEA 1ZSVA 3ZWVA 5GMOA 1P77A 2B0JA 2E37A 2ZYGA 4H7PA 2PH5A 1N92A 3IC5A 3DTTA 3INRA 3TQHA 3V2GA 1NQ5A 2Q1WA 2QX7A 3ROKA 1H93A 4KP7A 4M89A 3S2IA 4DMMA 1LDMA 1F0YA 1WLYA 3KTDA 5G2OA 3F4LA 2WD8A 1DB3A 3MJTA 4GSLA 4OAQA 3U0BA 5T8KC 4BGUA 4RJTA 5BQFA 3ANMA 5K9ZA 4WPGA 4BKPA 4J7UA 3V2UA 2CDCA 2HLPA 5CDUA 2P4QA 1X7HA 4J49A 3U4HA 3VPGA 4Q3EA 1PGJA 2G5CA 4CV3A 4CLOB 4YVFA 4XRRA 4IJKA 3D0OA 3ENKA 1LQTA 2PNFA 3AI3A 1YGYA 2FZEA 3GN1A 4AJLA 7ADHA 3V8BA 1LRLA 4OQZA 4QFCA 1HF3A 4NR0A 1I0ZA 2C7GA 3E18A 4ID9A 1R15A 3LT4A 5L7WA 2BELA 1T4DA 5FFFA 2FRDA 4PLHA 4R5HA 5G0SA 1A7AA 1X7GA 3GA0A 5COAA 4WNCA 1DIRA 1NR1A 3OJOA 1SZJG 1FXSA 2FR0A 5ENDA 3WG9A 8LDHA 1XGKA 4FN4A 1U3UA 3F46A 3KXDA 4OKIA 4II2A 2VWGA 4PG8A 1UDAA 5A9TA 3VTZA 5JC1A 2J5QA 4L0QA 2VUSA 3JQ9A 4W9NC 1GFSA 2BF7A 1C14A 2NTJA 4Y8VA 1Q7BA 2UYYA 5JCJA 4B4OA 1YL6A 4CR6A 4E4YA 3D3WB 1KEVA 3L77A 4BO2A 5BSEA 2CY0A 1I3NA 2P9EA 3DHYA 1R12A 3Q2KA 2J3KA 4BNXA 2GO1A 1AGNA 2B5VA 2VRCA 3K6JA 1NASA 3ZCXA 4NIMA 4R9RA 1JN0A 4K9DA 3PHGA 2VWPA 4E13A 1R4MB 4HKTA 3TRIA 1VKOA 4ZA2A 1GPDG 1P1HA 4KOAA 5F1OA 1Q0QA 4XX0A 1MP0A 2PZLA 3UH1A 3NX4A 1MV8A 1V3VA 1P1IA 3PEFA 3JYOA 1I30A 3PQEA 2YHUA 4FOOA 1CYDA 2Z1NA 3RSHA 2XF8A 3PJDA 4J16A 3HDJA 2GZ2A 4J7XA 5L45A 3FI9A 2BRUA 4GL4A 3ZWOA 3VH4A 1H94A 1EE2A 3LT0A 5CDTA 3ZU2A 1NPTO 3QLJA 1HLDA 2NU8A 1RM0A 4CM9A 5A9RA 4H3VA 4EJMA 3S2FA 3CTMA 1AHHA 4MPDA 4YJDA 5DCYA 2HMVA 3W8FA 3JSAA 3D7LA 4DVJA 3WFIA 3O03A 3ITDA 2VZ9A 1E7SA 4NJMB 4YRAA 2DBQA 4XYMA 1HYHA 1IY8A 2C2XA 1A9ZA 3HFSA 4XYEA 4EGFA 3M2TA 3AM5A 3L6OO 4KZPA 4IQ8A 5JY1A 3BYZA 2BHLA 1P31A 4HWKA 2ZIZA 1UXIA 1UXHA 5BSFA 1Z73A 1H6BA 4YA6A 1G1AA 1PS9A 4TRJA 4R51A 3LF1A 4YJFB 4UREA 1DHTA 1Y1PA 3JQDA 2EJWA 3QVXA 4YAKA 4EEXA 2ZK7A 4A7PA 4EUHA 3MEQA 3IQDB 1JWAB 3BHJA 1JKFA 2P91A 2IRWA 3HQ4O 3HUDA 2BFPA 4N5LA 1DRUA 3BMOA 1QP8A 4NMHA 4B8ZA 5C7IO 2X0JA 5JFOA 4E3ZA 1N9GB 1JA9A 3PIDA 3T4EA 3JQBA 4M86A 2B5WA 1MGOA 4NU6A 5EQDA 2IZ0A 2O3RA 2VT3A 1PJ2A 2VYND 1LC0A 2XOXA 2NV6A 5C7OO 2PD4A 2IEBA 2Q3EA 4UUOA 3H2ZA 3WGTA 1LRJA 3DOOA 3WIDA 3CMCO 1RKXA 1FMCA 1VI2A 1JU9A 2Q45A 2HQ1A 4TROA 1BXZA 1JKIA 4C4OA 3L6EA 2PGLA 5AVOA 4EW6A 4G65A 2VNSA 3FBGA 2OORA 1WZIA 4WEQA 2OP0A 3DHEA 3OFSA 1PZEA 2A4KA 5ITWA 4HX5A 1Z7BA 3GEMA 3UKOA 5B1YA 5ILOA 3DONA 3Q1LA 1YDEA 4YCAA 4JP3A 4XDYA 3ETGA 3DBRA 1JVSA 3GLQA 4CQMD 5L95A 4OSOA 2OZPA 3BAZA 2AQ8A 2G76A 1HDCA 1PJSA 1P74A 3QVSA 3ZWMA 1EVJA 4LK3A 3K8ZA 3HADA 1YO6A 2YHIB 1K89A 4PLGA 2JCYA 1LRKA 3EY4A 4RPGA 4BGVA 3AK4A 4CMIB 1J49A 3L4SO 4DQUA 1NAIA 3JQ8A 4WLFA 3T4XA 2X4GA 4GMFA 5JAQA 2I65A 4OXYA 1DLJA 3A4VA 4YEDA 4NI5A 2ET6A 3R0IA 1E1KA 2D59A 1RJWA 3VC7A 4BO8A 2Y0CA 3P19A 2OHXA 3HSKA 3OA0A 1J4AA 4BL5A 5KCZA 1ZJYA 5L4NA 4GWKA 1PR3A 5A5FA 4HADA 3VH1A 4XGIA 5JAZA 5IJZA 2JD1A 2X0IA 3HJAA 4U6QA 4A0SA 1T2AA 1HTBA 1XA0A 1GADO 1PS8A 5K6AC 2OGUA 3LT2A 1E7YA 3GZNA 4EI2A 3BA1A 1NTOA 4GLLA 5HWSA 1GUFA 1YJ8A 4HFRA 3R3SA 1N2SA 4ALJA 4CJXA 1FF9A 1PQWA 4ND3A 3GVHA 4HFMA 1UJMA 1H2HA 2CVZA 1AXGA 4MKXA 4RVGA 3ORFA 4XKJA 1B2LA 4ZQEA 5U4QA 4AJNA 4CV1A 3OQ1A 1RM4A 5IZ4A 1I32A 1VL6A 5HBRA 4ALNA 2VHWA 4CMKA 3OHSX 1NXQA 3N74A 4BO6A 1HDZA 3OIDA 4CUKA 3GFBA 1KEUA 3TNLA 1U1IA 4YAIA 1HDOA 3PLRA 1Y5MA 4CM8B 4Y98A 5AXCA 2XXJA 1Z75A 2DQ4A 1GEGA 1QMGA 1SPXA 1BW9B 1PJLA 3ZU3A 1XG5A 4BMSA 3GN2A 2WD7B 3LYLA 3ZNNA 3VPSA 5IDXA 3K92A 3Q11A 1NHWA 3G0OA 3WICA 3SC6A 3NTRA 4RVSA 1HSZA 1ISFA 1KEWA 4TZTA 1HYGA 1TT5A 1LDGA 1XDWA 4L4RA 2A35A 2NLOA 1Q7CA 5G0TA 2BFMA 3RROA 1PX0A 1H2BA 2J3HA 2QW8A 5L53A 4ONEA 4J6FA 3GVXA 2ZTVA 2G17A 3DTYA 3GNQA 3TFQA 1E77A 4PLTA 5L4LA 3Q6IA 3HHPA 2YQ5A 1LDNA 2EERA 2B83A 4CLHA 5B4VA 5TIIA 1CDOA 4WLOA 5DOVA 4BNTA 1I2ZA 4R5MA 4GH5A 2TMGA 5DOZA 3QW2A 3P2OA 1YL5A 4GGOA 1ARZA 3EGOA 3G3EA 3TZQA 1CWUA 3EDMA 2Y1OA 4A26A 3V1TC 1RYEA 1I3LA 3LVFO 3CH6A 4HFNA 4JBIA 4S3MA 7MDHA 5K6AA 1EK5A 4YT8A 2ZCVA 2ZKLA 5EMHA 5THQA 3DBVO 3OECA 4CLXA 2VYNA 4YRBA 5DZSA 3MJEA 4YJHA 1BXGA 3VOSA 1L7EA 5KJ1A 3H7AA 5GZ1A 4UEOA 1R0KA 1PJTA 5F3RA 4ZQGA 4CR7A 1DIBA 2P4HX 4BO3A 2I67A 4DLAA 5KVCA 4GQAA 1AE1A 3S1LA 1B3RA 4B79A 4PLVA 5HM8A 2GERA 3C1TA 1GYQA 4HNGA 4U6SA 2O3TA 1AUPA 5B4UA 1CIVA 1X0XA 3Q9NA 1D3AA 1YOVA 4YYZA 4UVDA 2BMAA 2B4RO 2CNBA 3MOGA 1B0AA 3BTOA 1B3BA 3H9GA 1DRVA 2VQ3A 2YUTA 2XAAA 2LDXA 1UXGA 1PTJA 4NH4A 3ONEA 1U4OA 3F9IA 4XR9A 1Y8QB 2IZZA 1GZ6A 4ZICA 3ZWXA 2O3QA 2UDPA 4I5DA 3JD2A 4FR5A 3JD3A 2C2YA 4WE3A 5IDQA 3DZHA 2PZMA 4DQVA 5KKCA 1T2CA 3IKTA 2Q4BA 2G82A 2J5RA 1H9BA 1YWGO 2D8AA 3UCEA 1PL7A 5JDCC 1NHGA 1QR6A 4KDFA 3ST7A 3A14A 4FFNA 3Q0EA 4OIMA 4Y6RA 4CM1A 2QZZA 3GG9A 1DXYA 3JQ7A 4LCJA 4WUVA 2QRJA 2P9CA 2JD0A 3PI7A 1K6IA 4PRLA 2X0RA 4FPXA 5CG1A 2DBZA 2FP4A 1WW8A 1SBYA 4H15A 3RFTA 2VTEA 3MWDB 4LVUA 4IJVA 1FDSA 2PFGA 4HP8A 2R00A 3U4IA 4FSHA 1K0UA 3WGZA 3LSYA 3JQEA 4U8GA 5EN4A 3WSVA 2GUGA 2YYYA 4YQZA 9LDBA 1Q7GA 5U9CA 1YBMA 3QV1A 1I8TA 1JKJA 3NT2A 4BHTA 2HO5A 3W6ZA 2O3UA 5G4LA 1DEHA 4GBJA 1H9AA 1QV7A 4GKBA 5DP1A 3ZN2A 1XKQA 4J9UE 1W0CA 3BTUA 2RBEA 4YB8A 4E2XA 5DP2A 3COSA 4U0KA 1WMBA 4NBTA 2GCGA 3VH2A 1AHIA 3ROPA 4FOSA 5AOVA 2I66A 3NDJA 3QE3A 4XD2A 4INAA 5EINA 2O23A 4P8RA 5JXWA 2X9NA 4RCVA 1TEHA 1QORA 2YY7A 5LCXA 4PLWA 5BNIA 3I52A 4RV9A 1HXHA 2JFGA 4QFDA 3WBBA 2VUTA 4IS2A 3M2PA 1M2WA 2BI7A 5HTOA 4PVCA 1Q1NA 3F3SA 5I9LA 1LEHA 3GUYA 1X0VA 3RFXA 2BGLA 2ZATA 4R1NA 2HMWA 5A4DA 1ZMTA 3LLSA 1ZXBA 5L4SA 1ZCJA 4R41A 2JAHA 4XGNA 1IOLA 4CLOA 3AM4A 4TVOA 3OMLA 5KJ6A 1GDHA 4L4SA 5JDCA 4LSMA 3UICA 4Q3DA 3WJ7A 1RWBA 1SEPA 5DDIP 5FEUA 3TF5A 4ZQBA 1PR9A 3AUSA 1H0KA 1NBOA 5ICMA 3GGGA 4E2ZA 1DPGA 5T57A 3BZUA 1AN9A 4QXMA 1OI7A 3L9XA 1YE3A 4Q3AA 1NVTA 3G1UA 4HBGA 2VYVD 2B4TO 3I9KA 3JQFA 4I8XA 5JYDA 5IN5A 5KJCA 3A06A 4O6VA 2V6GA 3HDQA 2WJPA 5B37A 3C85A 2X8LA 2PV7A 3G17A 5JDIC 1OMOA 1SB9A 1TLTA 4ALMA 2CVQA 5TGDA 3IKVA 5TJHA 3ZZNA 4CLEA 1EVZA 3IUSA 1V3TA 1YH3A 1PGPA 4BNNA 4DPKA 4F45A 1XCBA 3E9QA 1ISGA 3QY9A 3P5SA 4J7CA 5A9SB 3KB6A 2YFQA 1YL7A 1A9YA 3NTQA 4J43A 3D3WA 3ZV3A 4PVDA 4R1SA 2BH9A 2OP1A 1R37A 4GVLA 1I3KA 4WGGA 5JBIA 3ZV4A 5JPIA 1DSSG 3AY3A 3DZGA 1I33A 3SJ7A 3UUWA 5A06A 2HK9A 4TMFA 4ALLA 2AG8A 4J90A 1KOLA 3JQAB 4IQGA 1R4MA 4BNKA 1WDMA 4CQMB 4XRGA 1BHSA 2YDXA 1D1TA 1T25A 2EGHA 3I5MA 2EV9A 5LC1A 3IS3A 1WWKA 4IINA 2ZB3A 5ADHA 2Y66A 3H2SA 1U5CA 3DAGA 2V6FA 1GR0A 4TRNA 3WYBA 2E6UX 4Y67A 4GX0A 3UF0A 4I5EA 2BLLA 2ZB4A 1FDUA 4DGSA 1GUYA 1I36A 1V9LA 1O0SA 1M66A 1P33A 1A4UA 2FPIA 3ETDA 3DXFA 3RAJA 3GRKA 1VE9A 4AJJA 5I7SA 3JQCA 1T1SA 3OJ0A 1BG6A 2W2KB 2CUKA 3WYEA 5T64A 4ALKA 1VC2A 5BT9A 4FFOA 3VAZA 2WTBA 4P4GA 3GDFA 2VTDA 3K2BA 3ZU4A 1GQYA 4DTIA 4DREA 3QRWA 2PGJA 4BO7A 1EUZA 1GAEO 2G1UA 3GHHA 1GY8A 1QKIA 4NJMA 3RJ9A 2GZ3A 3NUGA 1NYTA 3IP1A 4HXYA 3WGQA 4KUGA 4II3A 5IAAA 3WIEA 3U49A 4WLUA 3ZWNA 1YONA 3ZHXA 3ZWWA 3R1IA 3H8VA 1E5LA 3DEYX 1W73A 3HFGA 3SX2A 4UAGA 5F5NA 1YBAA 3GMDA 2IEDA 3ZNPA 3U4DA 3ZHZA 1JVBA 4CMBA 2I9PA 4BOYA 2EXXA 4BUCA 2ZQYA 4DYVA 3EMKA 1EUCA 3PGXA 3AWDA 4MIOA 4YJFA 3RC1A 3PWKA 4ILKA 2Z1MA 2Y1FA 4GX1A 3SXPA 5COBA 1HDXA 1MG0A 2X5OA 3PPIA 3JYQA 5KJFA 2DTEA 3D3EA 5J23A 1GCOA 4YBZA 2UV8A 4JLWA 3ZWBA 4OYRA 3FR8A 2Q2QA 4CLRB 2Q99A 5FWNA 4PZCA 3TJRA 3AW9A 4BNVA 4IMRA 3W6UA 1WPQA 3LC1O 4Z3KA 4XYLA 1FDTA 1N9GA 1V8BA 4DQXA 2RCYA 4KQXA 1GV1A 1Y7TA 2C5AA 3EHEA 1IB6A 1O9BA 3C7CB 2BFAA 4E2YA 4NDNE 3PP8A 4D79A 2ZB8A 3BMQB 4IPTA 4WCFB 1HE5A 1IL0A 1E7QA 3VKUA 1R0SA 1K6JA 3KSDO 2E4AA 2JCVA 2VUUA 4YAJA 1X14A 3W8DA 4TWRA 1B8PA 5G0VA 1JTVA 4KQWA 3EUWA 3DZBA 1E1MA 1V6AA 1NPDA 4KMSA 2VZ0A 3RI3A 1UUFA 5I9NA 4B7UA 1T2EA 4YT4A 4R9SA 4GX5A 3FNEA 2VYVA 5F21A 1VSUA 2VRBA 1PJQA 2PR2A 1I2CA 1F8GA 4NPCA 3SLKA 4W4TA 3JD0A 1U3WA 4JROA 5COQA 3PDUA 3RBZA 4FC6A 5FI3A 3BHMA 2NWQA 5L3ZA 3IIEA 3FR7A 2YHIA 4XDZA 3RUCA 4OHUA 5G4KB 2CVOA 1AXEA 3WQRA 5G0UA 5EERA 1SB8A 4CMIA 2WSBA 3WB9A 1E5QA 2GNAA 5DBGA 3RVDA 1VM6A 3NGXA 4DYDA 2DFDA 4CLDA 3TPCA 5TRTA 1U2DA 2BI8A 1Q2XA 2EGGA 2JHGA 3GVPA 2P5YA 1P44A 1DIAA 1L7DA 1HDYA 2V7PA 4M49A 3JQBC 3L07A 2EW2A 4JX8A 3GOHA 4I1IA 4RQUA 5GZ6A 5BNFA 3W1VA 3F47A 2O50A 4BO4A 4WKGA 1YQXA 3C1OA 4J4TA 3LDHA 3C3XA 2BGKA 4WEOA 5IXSA 1FDVA 3GH3A 3B1JA 4O59O 1Y5RA 2CMDA 2X9GA 4D0RA 5B4TA 2AEJA 1NFRA 4YQYA 1GZ4A 3FSRA 3MZ0A 2VHZA 5JY6A 1BMDA 1OC2A 1U9JA 3EVTA 1HE2A 4PGFA 3I3OA 1E0DA 4MVJD 1LSJA 1Y8RB 1BRMA 3IP3A 3WNVA 2E82A 3LC2O 1GPJA 3FD8A 4W6ZA 2GRAA 4MVJI 1LLQA 3E6AA 2YW9A 2VHXA 2EIHA 2FSSA 2X6TA 2C20A 3GF4A 1PJ4A 1RYDA 2AEMA 4XEHA 2VT2A 5GY7A 5CG2A 4CM8A 4QTZA 3S55A 3NT5A 2XPCA 4K28A 3NV9A 5JO9A 1J0XO 3DZJA 3MWEB 4PFJA 1V3UA 4G2NA 4KTTE 4OKNA 1BW9A 1QYDA 3GUCA 3L6DA 4M54A 4RPKA 4J0FA 1IYZA 3K2EA 1VJ0A 2WD7A 1HZZA 4JJGA 3UGKA 3PYLA 1VRWA 1YQDA 1PJBA 2PD3A 3LF2A 4R3WA 3VTFA 4CMCA 1PWZA 4MVJE 4U5QA 3VZPA 4AJ1A 4FFPA 3HDYA 2CZCA 5AQ1A 1X15A 4FBGA 1E92A 1W8DA 3FPCA 4W7IA 2BKAA 4E2WA 3JD4A 1PZFA 2J6IA 1I01A 1ENOA 1U5AA 2YQ4A 4OMUA 1XQ1A 4BKQA 4GWGA 1U7TA 1XELA 4IMPA 3HB4X 1JDJA 3TZ6A 1LUAA 4BGEA 3EC7A 1LTHR 4BO1A 1D7OA 1CRWG 1C0KA 1I24A 1JQBA 1WZEA 3EK2A 4MP3A 4R3NA 3UHAA 1WMAA 4GI2A 4D44A 1DDOA 5I8WA 4P4NA 3WLEA 4M8SA 1SO8A 1O89A 2RH4A 1EMDA 4A5OA 4YXFA 3DMYA 5I7EA 4OOFA 3GG2A 4GMGA 1BSVA 1FDWA 1DJNA 2H63A 4I5FA 5GZ3A 1VJTA 2UUPA 3GHYA 4PCVA 1ONNA 4BNGA 2VOEA 3D1LA 1LDEA 2ZJ1A 1XU7A
chains in the Genus database with same CATH superfamily
3S7TA 1PW5A 2OM2A 3N6XA 2IXEA 1R6DA 2PGNA 2HIGA 1YRWA 3I04A 2XDQB 4PRKA 4R84A 5EL0A 2FMKA 2OENG 1HL3A 3K9GA 5EKDA 5FD8A 3MJHA 2HIMA 2GXUA 5JANA 2WJIA 3BZWA 1O95D 1XZFA 4FWIB 4NZZA 4ZRNA 1MJGM 1YJQA 4PSDA 5EJ8A 1V95A 4J07A 2E4WA 2LDBA 5LA6F 1LA2A 1AGRA 2BD0A 2QN6A 4YT5A 2BGWA 1DRWA 1T36B 2EW8A 1JDPA 1JJFA 4L9AA 2C54A 1TW2A 2JW5A 2VHYA 5LXTB 3HCCA 3PPVA 4U9IS 4F92B 1M10A 3BJEA 4WECA 4IDEA 4NCIA 2ZB7A 4C3ZA 1NP7A 4HN9A 2DSTA 5CT8A 3LOUA 4AVYA 3EPKA 4KR3A 2SKEA 4NMMA 1Y89A 4PU0A 1OKKD 2YCBA 4ZDWA 2E1RA 3GJSA 1V39A 4DC1A 1PJCA 4GKVA 3FYUB 4HWTA 2CXQA 5HCIA 4BBPA 3LGAA 2ZJ3A 4J7AA 5JNLA 1U9IA 2OMEA 4K8RB 3RGWS 2C58A 2VI5A 3GJ4A 3OQVA 4YRZA 2Q9BA 2XSZA 4Q4HB 3DKRA 4JI7B 2A0UA 1M2JA 4UULA 4BNZA 4A73A 2XEXA 5LU8A 3LUCA 1P6QA 3H1TA 3SS7X 2X77A 2VJPA 3GPIA 4FIZA 4CM3A 2ZIAA 4WJKB 2OEPA 4BBZA 4Y1RB 1P4SA 4IJUA 5P8WA 3W6NA 1SUEA 3DV9A 1BX3A 5JEDA 2RH5A 3F96A 4X84A 2DVMA 4YS6A 2J41A 4WOKA 3BWDD 1OC4A 2NT4A 2X8JA 3TSCA 4PXYA 1ESNA 4PYLA 2BCJQ 2QM7A 4XIFA 1ZZEA 3MWDA 2ZANA 3PJGA 1M7HA 2VF2A 3W2FA 4CIBA 4UFOA 2OO5A 2ZJYA 4J3FA 4B6PA 2X1HA 3IP5A 4DQLA 4ZQCB 5WRFA 3FZQA 2E5FA 2PPVA 4KE6A 1YVEI 1VIMA 4RJLA 2PX5A 2CV0A 1KHTA 1GEEA 2FLWA 5AHRA 1VIYA 5EXXA 1ZC4A 2NQ2C 1DHRA 1ODFA 4GM0A 4Z2YA 2PH3A 2ZIUB 1PG2A 1M2OA 2J3QA 2PWZA 5GJVC 4BQOA 4TVSA 4WK6A 3HVHA 2XRZA 1N2EA 1A1SA 5HQJA 4D8UA 3M1IA 4YMVA 5CNJA 1E6UA 1ENZA 1TZMA 4JJ4A 2ZI5A 4RK4A 2CLMB 2H4HA 4ZQHA 4RPLA 1F5NA 4W63A 5P21A 3ZHUA 3HYRA 1LH0A 1S9DA 5DWQA 1W36D 3E3AA 2I6XA 2UVPA 4V0QA 4CV2A 2RAVA 2BFCA 2IVFA 2W2XA 2B69A 4QGGA 1H66A 3GY0A 4C06A 2W6ID 4D81A 4MP6A 4PG5A 4NBNA 2NACA 4BNJA 3QKSB 1J97A 4TPKA 4D0GA 3HBFA 5CCDA 2Q5QA 1EHIA 1X80A 2ZTMA 1GNPA 1DFIA 4EYSA 4EKEA 7YASA 5FT9A 1K6EA 4K87A 4B2IA 4C5BA 3SXUA 5CLIA 3GOQA 3I04M 3AY6A 2ZJ4A 1WRBA 5EUQB 3V1YA 3ZCXA 1NFFA 4QTTB 1NWCA 4HNAA 3UFXB 2OGTA 4KQIA 5IZCC 3QE4A 1N3YA 1EWTA 1F8XA 1FP7A 1AKWA 4UAUA 1SNYA 4KE8A 5A2GA 3DMTA 4ND1A 1IY9A 4DUZB 2NTVA 2Q1UA 3IEUA 4ITUA 3HN7A 1OA1A 4YGYA 4D42A 1HT0A 4X62B 2WYWA 1HDRA 2BDUA 2GA9A 3KJNA 2C2MA 2O06A 3N05A 3S70A 4D4MA 4NBUA 4WK0B 3RK1A 2PMBA 3AFNA 3OEWA 2I2WA 4R4JA 5IM4F 3U7HB 1RADA 2WG1A 4X91A 1U8UA 3GD7A 4QZVA 4IBOA 5I7HA 4YAFA 1ID8A 3I34X 1E8NA 1CQXA 1P0CA 8ADHA 1Q12A 4D96A 4DHWA 2HJRA 3PC8A 4TSKA 1K06A 3PTLA 2J9ZB 5E9WA 2JB9A 1U90A 3CKKA 3Q88A 4TZ0A 1BDMA 1XV5A 4K6MA 5KC9A 1KBZA 5KYWB 1GUBA 2YXNA 2Q29A 3I9OA 1KYXA 3AI2A 4LY6A 1KA9H 4B6FA 3ZIDA 1AF4A 3KSRA 3N59A 4RIFA 8AT1A 3SEFA 1E5DA 1KGSA 2F43A 2JHFA 1G19A 4PO1A 5ES3A 3NNNA 2DETA 3M3HA 2WSSA 1Y4SA 2HF9A 2LNDA 2QJFA 3FNIA 1T4BA 1FP4B 2C0QA 4G5SA 4IAOA 5J5VA 2YWDA 1DKLA 3FNQA 4MEAA 1HG0A 2OL4A 5JV5A 1N75A 1QP4A 3KTFA 2HRDA 5LQCA 2PYDA 4HLQB 5C53B 4XVHA 4DDWA 4PTLA 3LXRA 2ZP1A 3OQJA 5BP7A 2VPQA 1LK7A 1QFYA 1CJUC 4MUIA 3WWZA 4LCBA 4EEZA 5HIJA 1DKRA 4ZCTA 2H17A 3CNBA 3ZDXB 5JC8A 2GM4A 4P7KA 3SKXA 1YMVA 2ZITA 3JQAA 1I5RA 2Q46A 2AUNA 3GDWA 1VZ2A 3WZMA 3D8NA 5F1KA 4CQMA 4WNIA 4B32A 4ME6A 4K9MA 2Q6OA 3H65A 3JAKB 3UUEA 5EQJB 4IUYA 4AJHA 1WHTA 4KRXA 2J9XB 4REMA 4O1HA 1JTFA 5BN3A 1EJ2A 3ZDCA 3GLGE 4G8BA 3GBPA 4WCFC 1NJFA 1NRWA 3HO1A 4CL0A 1UP6A 5CEJA 3CF6R 1IN5A 1J39A 3OCYA 1BKYA 1KVTA 3DO8A 1IULA 3C8MA 4XYGA 1XQXA 3G5TA 5G40A 2P2GA 4BQPA 5I45A 4LV8B 3H3XA 4TT8A 2I76A 1RZRA 4MQ6A 2ZI4A 3ICEA 1ZK2A 3GZJA 4LHXA 1RD4A 4H4EA 3TD9A 3HVRA 1M8JA 2ECFA 4DY4A 3I2IA 4HQRA 2FZLA 5CVEA 3SJUA 3HUEA 5ECWA 1Y4ZA 4MLZA 3JQFC 4I9UA 1XQ6A 3OG9A 1DC5A 1T5BA 3WL8A 5CITA 4OM7A 1ILEA 3R7WA 4MVJH 2JVIA 2GEBA 3IMFA 5EMLA 3TUJC 4IKPA 2IYQA 1E9EA 2J9FB 3QVJA 1E6MA 2AW5A 3G1TA 1Z4OA 3QM1A 4IZIA 2FFJA 4ZDIA 5EMNA 2ASVA 3RC3A 5HSGA 2PSDA 4G1EB 5AT1A 1ZPDA 4EY7A 4KPGA 2DUMA 3CURA 3I0ZA 4P81A 4ZO7A 1TYBE 3CXUA 2FW8A 4LPKA 4EJ0A 4ENSA 4JYBA 4B3TB 1ZIYA 3G9ZA 3LOQA 1KP3A 2CDRA 1CZOA 2P6NA 3EHDA 3QENA 1QS0B 3ENQA 5CPFA 4XWWA 4B2YA 1M2HA 1OXKB 4BLOA 4GXRA 1LC3A 2QTLA 2PRKA 2WEKA 4LZJA 4ECAA 1NM5A 4EG8A 1Q2UA 1PAUA 1DJQA 2C31A 2ZAGA 3CLTC 1BU5A 4XQ9A 5EPOA 1J06A 1BVUA 1OTYA 2P1DA 3BK7A 3K16A 4E15A 5MDHA 2NP7A 2O8BB 1CXZA 1XEWX 2J9GA 3DOFA 1BXKA 1X86B 3FFWA 3PHHA 4GPIB 2H4XA 1SXGA 2HT6A 3O9ZA 4JN6B 1DAFA 3QFRA 3W5UA 3FDIA 1RFLA 4ZYZA 4P2GA 1Q20A 1BMFA 3HA5A 4HNSA 4F0JA 1DQPA 3LP5A 3JWJA 3BCHA 4CF5A 2HU7A 4FZRA 2H08A 4CLRA 1EVIA 1H8EA 2C83A 2Q6LA 5I47A 2WIJA 1UL1X 1HEUA 1NOKA 3E8XA 1YZFA 4MYDA 1XVVA 1ZW6A 4N6OA 5LQDA 2HEIA 1SVLA 1A7JA 1Y3BE 4S1PA 1T1JA 3ZG6A 5F33A 4EA7A 4YJ2A 5HILA 4C7KA 2MMCA 2EJTA 2YMMA 1SR8A 3IJPA 1NMQA 2PMFA 4O5AA 1JDVA 3NHLA 3L7BA 1XAGA 4S1TA 1P1RA 4ZOLA 2G8LA 1A3CA 1K3TA 2ZRQA 4LJ8A 3SZUA 2FZ4A 2NO5A 1N8TA 2JGAA 2P9ZA 3L0YA 4KO2S 4Y3UA 1KMCA 5C8XA 1XPJA 1Z17A 1HETA 2ZSBA 3GX1A 3K3PA 4LY9A 4R2JA 4BLQA 1HQKA 3DTVA 1WUHS 2ERYA 3T9AA 1JJVA 3TW4A 1QZTA 2PS3A 4G23A 4KC0A 1SCIA 4KHPB 1OU4A 3R20A 4DLYA 1EHCA 4L2IA 4QT4A 3N8DA 3OY2A 4G07A 1U7PA 2RC5A 3QOFA 3QWIA 4KQHA 3TTTA 2ZM6B 3ADDA 3QLVC 9MHTA 1V9SA 2ZB2A 4RVDA 1IAVA 3H5AA 5D8DA 4W1RA 1XEXB 1P1JA 3SR4A 1XP8A 1OX6A 2RHCA 5DCWA 2X2EA 4ZFNA 3U09A 3EJ6A 4QVIA 3ASUA 3PE4A 5D3ZA 3EG9B 2B4YA 2R1TA 3QQPA 4NFLA 4A2WA 3V3TA 3ZWYA 1CT9A 4W5RA 5JZ9A 2ZUSA 4KXFB 1G2IA 5HA5A 3F8WA 3Q85A 1XTZA 3R4CA 1RT9A 3G8CA 3KYDB 4AJKA 1M8PA 1LLCA 3OIVA 1ZO8A 2Q6TA 5HZMA 1LJ8A 5CH3A 3A3OA 4G8DA 1D2HA 1RQ7A 3IPRA 4MDHA 5AM5A 2WYVA 5E6UB 1SBCA 1IBRA 2HLDA 3RRNA 4X6YA 4A6DA 3BDIA 3QWAA 4DIKA 2J6BA 3BGVA 2QNRA 4J0EA 3H0CA 3GLGA 3IR5A 4L5CA 4C4YA 3QXJA 4MW6A 5JAMA 2VP6A 1CUFA 3CS3A 5BO5A 4EBFA 2IL1A 1VPTA 4I4TB 2ILTA 4HB2A 5H3CA 1X39A 1QH8A 2ZWPA 2BISA 3FRHA 1CJCA 2X0KA 2VQEB 1OLSA 2E48A 1X3LA 3MMZA 3OWOA 1UBOS 4NZPA 1NU6A 4L27A 4YMUA 3FAKA 1MQAA 3AZQA 4W7SA 4D4KA 3W0LB 4G0UA 4QBGB 3RT1A 1M6YA 3TOZA 1RZVA 2EEPA 2J0UB 4JQOA 1N1EA 1Z0AA 2CF6A 1WXHA 3VPCA 4C7OB 1X1SA 1UKZA 3MSXA 1Q91A 1ZU5A 1D2NA 3REFA 1TIKA 1WABA 2XVAA 3EBOA 5JPDA 5K8UA 1A8IA 4GVXA 2HSDA 2E85A 3K8OE 4FDAA 3WIUA 1PNQA 4CQNA 3OKAA 1NW3A 3EN0A 4KCGA 3REOA 1Z5ZA 5HIMA 3PIIA 3FWPA 4UHJA 2IV2X 4KRFA 2ORIA 2Q9CA 3BBPA 4Y2UA 1Q74A 2C9DA 1ZG3A 1RAIA 4N47A 1XR3A 3OPMA 4TKMA 3WK8A 4P31A 4RVFA 2GD2A 3HWSA 4ZJZA 1T1EA 4OSPA 2HLHA 2HDHA 4NECA 1PHPA 4OUDB 2K5UA 3IMKA 5LLDA 4X71A 5HOEA 3NPAA 3NVMB 1YFKA 4BECA 3LNCA 2EP8A 4ZCQA 5SV2A 4ZK2A 1FMFA 4H6XA 1JBKA 4FFMA 3USZA 1QHXA 4JX9A 1GTG1 1TI7A 1K2VN 2M2IA 3ANTA 3CBQA 1CKEA 3GDGA 3UXEA 1F12A 4GC9A 1BHQ1 5A5GA 3GJQA 4MQUA 2PUBA 5K3FB 4F9TA 5JD5A 1KEEB 2B7CA 5E38A 4QM6A 4MKZA 1MO5A 1P73A 3T61A 3GPDG 4N0PA 1KJ9A 2FP4B 4J9VA 5DWVA 2QTBA 4FFRA 3TZHA 1TVEA 2F90A 3NHAA 5G0WA 3CRQA 3CUEF 3V00A 5HIAA 3CZMA 5ENZA 3MJFA 1ZJ6A 1GGKA 3VYTB 3RF6A 2QRLA 1AV6A 3SOZA 3LBFA 4TQGA 2PZEA 1NVXQ 1XMOB 1HI9A 2QYSA 2B8JA 1GQFA 1M1YB 3ZCSA 5A5VA 2PT6A 2QZJA 1O08A 4BLUA 3WWOA 3BSFA 3GIWA 2YFKA 4DIMA 1MAUA 4REQB 1EZZA 4MW2A 5EJEA 1BCSB 4MUGA 3LVBA 2DBRA 2GCOA 4GUDA 5L7TA 3M3DA 4DBZA 3V6LA 4M8KA 2RB4A 1O54A 3NHFA 4X1IA 4PYRA 1CEQA 2VAPA 2FPRA 4E0BA 1XKTA 2Q49A 3DOHA 1F0KA 2QOEA 5GM2A 2OG2A 3NMUF 2Y92A 1R6UA 2OV2A 4LJ4A 1NP6A 1AU9A 1QIHA 4LGVA 3UB2A 3HDVA 3HZRA 5JXHA 5JSFA 1O94C 1AGYA 1X8LA 2OAGA 4FNMA 5EEGA 3MMSA 1CETA 2QD2A 2NPFA 3FM9A 2IYLD 4R71A 1E1LA 1BEUB 2IH5A 4C76A 1I94B 2PUVA 5KI6A 3KJEA 4RZSA 4BCDA 3BRWA 3GK3A 1Z5WA 5F9MA 1N4DA 2XXAB 1F4LA 1RWKA 4CIYA 3PNLA 4RTMA 2WR8A 4JJFA 2GESA 3ON5A 1XDGA 2XDQA 1DNPA 4O4JB 3CEPB 3QUSA 1MAAA 3DBHB 5AW3A 5IS2A 1PS0A 3NGLA 4HTFB 4NG4A 1X38A 5FL3A 5JFTA 1KI3A 1LFDB 3ZQ6A 2QYTA 4M1ZA 3GNLA 1OFUX 4LXXA 4QYSA 4DFDA 1U0RA 1S7CA 4WBXC 2GXAA 3I6QA 5DMHA 1QF7A 5I7RA 3OF5A 1O5TA 3QWHA 1T36A 2PK3A 1M6VB 4IJ5A 3VISA 2R7AA 4QODA 1FJ2A 2R3SA 5LMUB 1UZMA 5K4AA 1O5IA 1WCIB 1GWNA 4L15A 3RUDA 3J80A 5BWNA 5JVDF 5JTTA 2PYIA 3L82B 3BH6A 3EDYA 3MGKA 4JS0A 3HXMA 1SXJB 3MCAA 3FYUA 4DJFC 4BRSA 1V7CA 3QXCA 4JMLA 2I78A 3K6RA 3TMYA 2ZT8A 3RKSA 1JDZA 4DPLA 4Z1MD 4Q4HA 1BAPA 2B34A 2ZE5A 2L69A 3HKDB 3O8DA 3D6FA 2XZDA 1QB8A 3GFRA 1CUUA 1Y63A 2AJLI 4FXPA 3MWFA 1HM5A 2M6KA 4FYKA 2AKEA 4ERNA 1VSQA 1PIWA 1N2BA 3I6BA 4OJTA 1U0GA 1R0LA 2CJWB 3OO1A 4TKUB 4Y1RA 2NP6A 4AMGA 1NSTA 2G0NA 4HUTA 1WEHA 2A0WA 4HSEA 4BJ6A 3LBNA 3ZLAA 13PKA 1J9GA 2YZGA 3HL0A 3LQ2A 4H18A 3F6BX 1KFBB 5AW4A 3GLTA 3MTBA 1MB4A 1UPBA 1VLHA 5E4TA 3O9MA 4WCVA 1WQ4A 4EX7A 1RM5A 4GR5A 3WTCA 1W5FA 5JMPA 1T35A 4D4JA 1N4AA 1XMQB 2IOHA 3TD2A 2QJOA 4IILA 4CFZA 1I7SB 5JJLA 1WXDA 4YR7A 2ODWA 4GLFA 5B7PA 1A9PA 1K8RA 3WLLA 2WM9B 4BMDA 2BMWA 5KNLA 3D3QA 4J1JA 1W5EA 3F5QA 3FF1A 3MTDA 3Q5EA 3DBOB 3QKRB 5DXAA 1O8CA 1XRLA 4JLSA 3VV3A 3SLRA 1I5EA 5A4AA 3NH6A 2JIDA 3KHKA 3WMGA 3B5JA 5TQVA 2ZE8A 3KVNA 3T3NA 1O7JA 2VK8A 4M2LA 4MYCA 4I8IA 1PO7A 1QIIA 3UMCA 1V8DA 3MJCA 3LQRA 3RJ5A 2Z6UA 2JGEA 3KZKA 4DCUA 1IPFA 4LJAA 3OQHA 2A9JA 4DF3A 5BW6B 2OA0A 5J2UA 1VSVA 1XTBA 7REQB 3E1SA 4YCDA 3FWZA 2Q6KA 3UVEA 3LBAA 3NJ8A 1TJYA 4HTAA 1C1DB 4ZVLA 3S27A 4ARUA 3AYZB 2O5EA 2PKCA 1G8JA 1ODCA 3E8SA 3EH1A 4ER0A 1PR1A 4X61A 3L79A 3ADCA 3K70D 2OD2A 1ULSA 4HEA1 4JZYA 5ES4B 4XCXA 2GPYA 4UCFA 2Y77A 3OCWA 1SRQA 1NLYA 3A2LA 3JVEA 4JODA 3QKSA 3Q8LA 3AUXA 2W8ZA 5JJIA 4XJTA 4ABYA 4K6KA 1T3TA 2QX8A 4UBLA 4KFSA 3QSGA 2XYRA 4HV4A 4PHHA 4D0SA 4UUQA 3H5VA 3LUKA 5JNWA 1I9GA 2P68A 3N39C 4ZVSA 3R6LA 4CIVA 2KWIA 4DWVA 1TC1A 2WTMA 3NBFA 4WQMA 3TEJA 3H8SA 1RZUA 1FIUA 3UFXA 4EENA 1J00A 3JRXA 4TXLA 2FCRA 3NVDA 3O0DA 4GECA 3KOXA 1F20A 3BGWA 3KOUA 9ATCA 1CUVA 3BIWA 4XUGB 3VR4D 4ZTUB 1DCTA 2HQBA 2FFHA 2YIJA 2QUIA 3DT9A 3FPHA 3QFFA 1GUAA 1KIMA 1JHPA 5AUPB 3A7DA 5JZVA 2JAQA 4W9NA 3A10A 1L8OA 3N28A 5FB3A 3WLFA 1ABBA 2G9NA 2R6JA 3N8KA 4JHXA 2CJXA 1Z08A 2J3DA 3UJ9A 1FSZA 3O2JA 4BTLA 1UDBA 3VDQA 4ZOBA 1KO4A 5GJCA 5LL6P 3H9JA 5KTSA 4TQ9A 1XZCA 3C41J 4AYWA 4IFEA 3D31A 2Q50A 2UUOA 2X8BA 3UMSA 1T34A 5JSQA 1ZEMA 3K9QO 1JF8A 3QVOA 3BE4A 5NLLA 3D6VA 3LOPA 4FKZA 4KKVA 2OQVA 3SICE 5HUJA 5J47A 1E1NA 3LUJA 4BBAA 3ADKA 1E6EA 5ILGA 1WF3A 4DL9A 2IELA 2B1RA 5KYWA 4BU1A 2GK6A 2VLBA 3KJGA 4L5JA 5EMJA 1RPAA 4DPMA 2IYPA 4MUXA 3UCXA 4GZMA 1K6XA 2CJPA 4HAVA 5JS6A 4AQ7A 5CA0F 2PVPA 5F76A 3V8QA 3W5HA 4EDFA 1EWRA 4BDTA 1D2MA 1HRKA 2QX4A 4OL0A 5B2FA 3T7CA 1XMSA 1FP4A 4BKRA 2FE1A 1OPRA 1FNMA 1RBYA 1VPVA 3AJ8A 5FYDA 3JZIA 5JWOA 3LRXA 1PTKA 1YF3A 1GT91 4JR2A 3GEDA 2LIPA 1JQ5A 3IAM6 5F78A 4BNHA 4PSCA 4K46A 3WRYC 3VPDA 3AU8A 3CBGA 4DR3B 2LBPA 1T13A 4HLUA 4MTCA 4D99A 1L5WA 4WCDA 1IQ0A 3TW8B 5DM70 2ZI7A 3O9VA 2D7DA 4IDUB 2J3LA 3KVVA 3RBXA 5CNKA 2I2BA 1CF2O 3JAKA 4MRRA 5K3EA 3R76A 2B7BA 3JV7A 4YN3A 2YNMD 3V7UA 3WGHA 3RRYA 4KDEA 3E3OA 4OJQA 1IVYA 1VLLA 3Q5GA 4RF4A 5EIBD 2NGRA 4GEGA 1TF7A 5CPBA 5KQGA 2XBMA 4L73A 4B34A 5BUSA 1GUZA 3CX7A 3ELYA 5GINE 3DAPA 4L7QA 2Z2XA 5TEWA 2A33A 2QV0A 3RWOA 4WFQA 4BTVA 2DG2A 4J1SA 3UN1A 2YC2C 1VLJA 2A57A 4PNZA 5SZHB 4BVLA 3DDWA 3OEHA 5K03A 4YRSA 2E2WA 2NXEA 3NVAA 2FR8A 2L18A 2QROA 3VKHA 4HNUA 5EI5A 2GASA 3DFZA 4MYSA 3WGLA 1QLWA 2Z5GA 4LOKA 5JE8A 1NXOA 1GD1O 1SQ6A 2EW1A 3HXPA 3ZHTA 1HGXA 4O4IF 2WQZA 5K8IA 3AOGA 4G8CA 3PA8A 4ROSA 3AM3A 1T6NA 2VDWB 1QK5A 4X5OA 4BZXA 4NCKA 2ILVA 3A1UA 3HZOA 4DCCA 1UANA 5TSDA 2FN7A 4XX0B 2J9FA 5AVJA 2A5YB 4PM4A 5G02A 2B1GA 2XNDA 1IMJA 1MFPA 2FWBA 4UFNA 1KDYA 3NTVA 4C5AA 3EF1A 1PLKA 4YI3A 2DWPA 1NY5A 3IOCA 2D7CA 3I9JA 1JE0A 1XDBA 5A02A 1S01A 2CUTA 1YMUA 5FOXA 4QELA 2TRSB 4KIJA 1K5PA 4MVJA 2ALJA 3AFMA 4JB3A 1KBQA 1KKLA 1QS0A 4JNKA 2ZRIA 5LWHA 4B2PA 5JATA 4NOJA 4XR4A 3QKUA 3OF3A 2CSUA 2W6QA 4LQDA 2XYHA 4OJYA 4RLSA 3IAM1 3NATA 5EOVA 2ZJ0A 4ZWNA 3OZ7A 1RHUA 2E5LB 2GN9A 2JCBA 2BGIA 2V7VA 3OCCA 4LKRA 4KXMA 1POWA 4MR7B 4NHOA 2Y0EA 4A23A 4AMVA 5AVVA 1ULZA 4CBVA 5K0EA 1CNFA 3VJMA 1M5RA 2ONJA 2ZBPA 3CT6A 3SVLA 1PU2A 2R5NA 1GL3A 1RIIA 4TYMA 1B42A 3T7RA 4UU8A 5JSHA 5CCBA 3OP4A 3EXFB 5CM9C 4W1SA 4HBZA 1JR3A 2JGNA 3DEZA 3D2LA 3RAGA 3NTXA 3TN7A 3IQIX 1JHAA 2O2GA 3O8BA 4O8CA 4QWMA 2V6MA 4XQCA 3CJQA 5CDGA 3SEAA 3FMGA 3OOYA 3TUIC 2VP0A 4Z5XA 1MX1A 2XQGA 3T1TA 1AN0A 2R96A 1F38A 1M1YE 2GVNA 3TZBA 3IP8A 3UT0A 3IT2A 1N1GA 2R8BA 3N0RA 1BS9A 1LKZA 4I99A 2GZRA 4CDNA 1ORRA 1U8FO 4NBSA 1IVNA 4CR8A 2HBRA 3TQCA 2QLLA 1HLPA 3I9NA 5LMNB 2QGFA 3COVA 2A9KA 5AP9A 1RLOA 4CMJA 4N5HX 3C0KA 3B78A 2P8SA 1KSFX 4EZIA 2XOEA 4QC2A 1QFXA 3HVUA 4B3FX 5BMOA 2QE6A 2QM8A 1RJFA 3O8LA 5HW0A 3RV3A 2EP7A 4QRIA 2QD4A 4JY7A 4YNBA 4AG3A 1TGYA 2W2TA 3M3PA 4EPRA 2QAIA 3GQBB 4QU5A 1KZ1A 4TYPA 3AY7A 3G49A 1MRZA 4JB8A 3P2YA 1XEXA 4OEHA 1SVOA 3DZFA 3FVVA 2P7HA 3NOOA 2ZT5A 3COYA 3EG9A 3HP1A 3TDKA 3FDXA 4HL6A 4UHDA 4PZ0A 4MO2A 3KP1A 5BR4A 1P8AA 2FSPA 5HUQA 4V0OA 3U19A 4HN4B 1EA5A 2DULA 4KN6A 4BZPA 3KYDA 3OBIA 3RSQA 2IYSA 1CR6A 1ETUA 4IOLA 4PZPA 4RGVA 5E6UA 5FBVB 5C4GB 3I8SA 2R85A 1PEKE 5EQTA 2NSDA 3UJHA 4NZOA 4PZZA 3DG9A 1G8GA 2FSUA 2OZEA 6NULA 1GZUA 3DHNA 4KV9A 1TFUA 2NO1A 3GT0A 5F5LA 4OHOA 1YA4A 1RKQA 4ZYLA 4BV9A 4XM1A 1B15A 2R1ZA 3ML1A 4I4TA 3HU3A 5JLAA 2XUDA 4D7AA 1Z06A 1CRLA 2H52A 2IOYA 3T1YB 2P6PA 3HJNA 1DEOA 2JFXA 2QD3A 4XD7D 3LWDA 1DUSA 4IFBA 4FDUA 2X2OA 3GVIA 4U63A 5DNUA 4MV7A 1VIVA 2DT8A 1SXJE 3CKMA 5CLLA 3I5UA 4FCWA 2RHGB 3AR7A 3FSJX 2YWEA 3RUFA 4CF3A 4JLAA 3DBRB 3R41A 4XWYA 2J0UA 1QNFA 4GNKA 4AMUA 3GXBA 2QP3A 3BTVA 3P2EA 2H2FA 1HC7A 4KYVA 1BA2A 1XAIA 3LLVA 4O2BF 2YWJA 5CVUA 4NQRA 4TL8A 3BF8A 1X94A 4V39A 2WE8A 1QZ3A 4N40A 3P9KA 4X60A 2BE7A 1EK1A 2OUIA 4CKBB 1ZVJA 4CMEC 4F46A 1CHDA 3FTQA 3ITKA 3B1VA 4A91A 5HBGA 4DCPA 2IYXA 4ZZIA 3LHSA 4QUGA 1KJYA 4IDGA 4UVIA 5K1ZA 2NADA 3KLMX 1FJXA 3DUFA 4IWXA 2XEDA 3PHIA 5I6DA 3MUNA 3O83A 4PTZA 2A9FA 5AVKA 4KWHA 4KGVA 4OUDA 1P7CA 3IAFA 1V1JA 5FLKA 1X1BA 2MTBA 3M4XA 2EL9A 1DX6A 1VLMA 3JCZA 3QH4A 2XUIA 2YDYA 5DV9A 3RYFB 3ETJA 3U2QA 1GL6A 1D7AA 2AK3A 4LDNA 1RRGA 1J09A 3G85A 1RU3A 3ESAA 2IPAB 3MAJA 4K0RA 3PKZA 4B83A 1IDOA 3CWZA 1GU0A 5K3FA 3ONFA 4UAVA 3WLTA 4EZEA 1KEEA 4FZ3A 1JIJA 1YFLA 1WB4A 4IDCA 5H83A 5JJCA 4EATA 3KZVA 3HN2A 2IOFA 1GKUB 5FUVA 3SJZA 3UKDA 5A7GA 1QHYA 1E4EB 4AJOA 2JLYA 2A9RA 3R5XA 2PUCA 4DR1B 3AX6A 5LB4A 1ZKMA 5A2QA 3SJCA 5E8RA 2I3ZA 2D2EA 3IUJA 4AY2A 2JFPA 3H5RA 2GSDA 3HUUA 4PSAA 1UKCA 2JFQA 3INGA 3ZWAA 1E98A 3EFOB 1WP9A 2P6MA 4QDOA 1UMKA 1M1YA 1VGVA 4N9QA 2ZU6A 4EMSA 1GA4A 4C4RA 5B1HA 1ZX1A 3FLAA 4MKHA 1T5IA 5JMWA 4REQA 1W2WB 5IW8A 4X7RA 1W9HA 4P9NA 3G23A 2PUHA 3I1FA 4C2UA 1BCSA 4LCEA 4D56A 3K70B 1IZ0A 1G8AA 2YJZA 4O29A 3G6KA 3UMRA 1TB4A 1GTVA 1OZAA 2OQIA 1P72A 1SGWA 4DLNA 5KVVA 3QBTA 4U7DA 4DYHA 3LG2A 1ZM3A 3VR4H 2C95A 1L1QA 4OQEA 3SZRA 5JS7A 2NG1A 2BEJA 3ZLVA 5IF9A 1E6WA 3NJRA 4WZZA 1E69A 1PL6A 5IBQA 5HS4A 2UZAA 4J1NA 1UJ2A 1CLUA 2YV2A 3LWZA 1ZVVA 3R3WA 4II7A 4PIPA 2X5JO 1XROA 2MMGA 3IQFA 3U37A 3I6MA 5EE1A 1G38A 5AYVA 4QPPA 1NOIA 1QYVA 1NQXA 1CQZA 4B5LA 3EJWA 4KL8S 1QXSA 4A1OA 2YOFA 4D9NA 3A31A 4PFKA 1ISMA 1OWNA 3PVZA 2YXLA 4MUYA 5CFQA 3DMHA 4LXIA 1T8RA 5AHOA 2XXAA 1FRFS 3QX9A 3KQPA 3ZD9A 4RAQA 4O4JA 1TYDE 3PDJA 4L0CA 4MP8A 4QUKA 1U94A 2EKBA 4MROA 1YE8A 3DBHA 4IRMA 5HFNA 5TPZD 2XGGA 4HTFA 3TLAA 4K9NA 3Q2IA 2OWEA 4R01A 1JL3A 1ECLA 1LZLA 3PNBA 4P22A 5EZQA 2PE5A 1FXWF 1GPH1 1JSCA 4Z4HA 5HKKA 1QMPA 1RHKA 2OV3A 3DAHA 1WD5A 4O0LA 5E0OA 3WHLA 4EZBA 4P7FA 2ZYAA 2BJHA 1WEKA 1M6VA 2I8LA 1JGTA 1JLRA 4W5OA 3AV0B 4Z9XA 3KSZO 4ZKDA 3U7GA 1QP7A 3ESCA 1WCIA 5A7HA 4ZCSA 4R05A 2YV1A 2BY4A 2H7CA 2XVZA 2Y0BA 4FNOA 5DHAA 3UOAB 5A4DA 1PWXA 3BD9A 4X90A 4RTNA 1U3VA 5ITVA 2HT1A 4DG9A 1SXJA 1R6VA 1MO4A 3V8VA 1X13A 4BO9A 2FVXA 1QYXA 1EBUA 3T3IA 4AP5A 5E2AA 4Y6PA 2PKQP 2PTGA 1KERA 1WVGA 2OCIA 1ZM4A 5CX4A 3HKDA 4RANA 2VPTA 4N5NA 1FS4A 2HSJA 3F2IA 4E5NA 3ANYB 1RPNA 2P2SA 4MI1A 2GLUA 3UAGA 3H5NA 3WNQA 2GWRA 3KKNA 4B6SA 1M76A 2YIMA 3KQHA 3KSBC 1CJSA 2CJWA 3N7UA 4TKUA 5B12A 1URPA 2F62A 5DN9A 4DIUA 3RU7A 1FFWA 4B6EA 5AIBA 2JI6A 2FSHA 2FEAA 3D7SA 3LC0A 1NFQA 3IUYA 1UP4A 3DUWA 3PS9A 2GK7A 4HB4A 2VL7A 3DGEC 2IWHA 4E5YA 3O92A 1OT5A 3V4OA 5A1JA 2UZ3A 1KNXA 1VIAA 1ZRHA 5H4GA 1F9EA 1K4KA 1NVMB 3ZWPA 1WF6A 5I5EA 3JU3A 1KFEB 4HDKB 2E49A 2EWWA 4L7VA 5FPHA 3WNZA 3PC2A 1P5ZB 3AVXA 4M38A 3QKRA 2IYAA 2PAFA 1MOSA 1KMMA 1SQ5A 1YNSA 4QO8A 1E6CA 2OG1A 3P0IA 4LF5B 2QDXA 5F77A 3UBMA 1HORA 2GARA 1FYDA 3AR3A 3B6ZA 1L7AA 3EDOA 4I9NA 3OUTA 3L0ZA 4J91A 5FR2A 1ADCA 4G5RA 3IMCA 4DIFA 2AYXA 5HF6A 3WOHA 4CFYA 4D3FA 5A03A 2DUNA 5ICSA 2DU8A 1FX0B 2B1IA 1VA4A 2AGVA 3LPAA 1E0KA 3F0TA 1LCIA 1XLTC 2QGZA 1XZMA 3GBVA 4MV6A 1X77A 1K8QA 4LSWA 3AHCA 3T38A 3U3RA 2HBQA 2O3SA 4AJPA 4RLQA 1C1DA 2PA0A 2R4QA 1BC5A 4F2PA 1XOIA 1CTQA 3DEHA 2GBFA 2IYYA 4DR4B 1XZIA 4B40A 1KFJB 1HOXA 1YQWA 1ZVMA 2QNIA 4P0TA 3IEXA 4XUDA 3GA5A 4YECA 4DCSA 1VTKA 5B3LA 4RW0A 4CM6A 2FR1A 4DMHA 3LQFA 1GU7A 1ML3A 2Q2NA 1Z2EA 3FDZB 1RQGA 3Q7SA 4QD3A 4BMOB 1XK6A 1SCAA 3QK7A 1A9TA 1EXNA 4Z7QB 3DVRX 4EUFA 4FI3F 5CYOA 1C2TA 2C2KA 3JD1A 4LVCA 5JAIA 3VR0A 3SM9A 1ORIA 3OO0A 2IS4A 2DPMA 3OJFA 3FNBA 4AICA 1LPPA 4FFBB 3AO0B 2A7QA 2AN1A 2GBPA 3TAUA 2AJBA 3PD0A 2BVNA 1ZR2A 2F7SA 4LE0A 2HD4A 2GD1O 3HCNA 1LF5A 3TLGB 1WSBA 1QZXA 4L8WB 5JZOA 3TSAA 2PCJA 3ZY2A 1ZIPA 3IQHX 2RGEA 3L1JA 4D3XA 5BW4A 1IZ9A 2X5KO 2YWRA 1KZ7B 3W8EA 3EZLA 3EQ7A 2WWTA 3D4NA 3R6GA 4FLMA 1KVRA 1CJVC 3H9UA 3IJEB 4NYJQ 3X1KA 3WGIA 1IZZA 1DC3A 1XUOA 3QJGA 1DARA 4KXLA 4LRWA 5JZSA 1KJWA 3EVNA 1A5SB 4KWEA 4AU1A 1C8LA 2CV2A 3HO8A 3E61A 4LF7B 4P1ZA 4P3YA 1CLEA 1NBIA 3J7TA 2B0JA 2E37A 5GMOA 3ZWVA 4OLAA 1WDWB 1OREA 3GGDA 2AWNA 5EXDA 4ZT4A 1VRVA 4OI2A 2QAGC 3EF0A 3INRA 2B3TA 1EIZA 2I03A 1ZQ9A 2Q1WA 4JKYA 3MB8A 4KP7A 4L28A 1KZHA 3DDHA 4DMMA 1WLYA 3ZOZA 3KTDA 3HJBA 5G2OA 3ZE6A 1Z7YA 2WD8A 3F4LA 1N3BA 1KAHA 1OTXA 3MJTA 3T5TA 1US8B 3PE3A 3DMRA 4N9WA 1XRQA 1W0JD 4PBRA 4PYIA 4TS3A 2ZROA 4J16C 3GCWA 4QBHA 1OBHA 3F5MA 1BU8A 2R2AA 3QTLA 4WPGA 4WXHA 3BX1A 1XTQA 2HLPA 2P4QA 3QPBA 3VPGA 4BFYA 1ZHOA 4CV3A 4B3SB 2AMYA 2IYUA 1I1OA 1T6BY 3KZMA 3R0VA 4YVFA 5C5CA 3WA7A 4RHXA 1GPLA 4IJKA 4L02A 3D0OA 2Q0QA 2WIFA 3VKWA 4C9BA 1C29B 3GN1A 2C4MA 4AJLA 7ADHA 2BP7B 2OC9A 3EXHC 2VLIA 3HBNA 4ILEA 1HR0B 4OQZA 4XUCA 4ERXA 1CQWA 1JFLA 1NBME 2FVYA 5CLQA 1RI5A 2JCGA 3M4JA 1K8XB 3LT4A 3OT4A 4IHJF 1XJCA 1XZGA 2DQKA 2H65A 2IZOA 2MYTA 2YH2A 3FPSA 4LYFA 4TWAA 4ZO8A 1U8AA 5CLHA 4UTNA 4C43A 1GSOA 4Q12A 5FFFA 2E3JA 1PX2A 3U1TA 4MB6A 4QL3A 3QLTA 2VS1A 1FFGA 3ETHA 3TW8A 4QXQA 4D9KA 3CLKA 5CH5A 1XPRA 1IQPA 1NR1A 4IDUA 1SZJG 3TOCA 5BPHA 2Q3FA 5JH7F 1NLUA 1V5WA 3OE4A 5EJIA 1I9CA 4ZK6A 4JI4B 2HWYA 2XB9A 3D6NB 4BE9A 4E11A 4MKFA 4PGGA 5KZMB 4G5QA 3ET5A 5JC1A 5AI6A 2BGJA 2GO7A 1CPYA 2BF7A 4Y8VA 3ICQB 1XALA 2E18A 5ALLA 1G7CA 2X3UA 1OXUA 3I2GA 3TBFA 4CR6A 5IBCA 2H5EA 1OXBB 2XQJA 4M22A 1UBMS 2N42A 2FZKA 4L57A 4FOTA 5BSEA 4MV3A 1I3NA 2AR9A 1YS9A 2J3KA 4AO7A 4AQDA 5ANRB 1CV2A 5EE5B 5FI0B 2VRCA 4Q24A 1NASA 1F8YA 3L7NA 1E3DA 1HLFA 1PYGA 3LW8A 4K9DA 4R9RA 4X00A 4MMYB 4BP1A 4YUAA 1R4MB 3QVUA 4HKTA 4JVSB 5DKFA 1GO2A 3A27A 2VDWA 3TRIA 1NRIA 4Q00A 4KBYA 1GPDG 2VRWA 2PS9A 4ZA2A 3TEFA 4BVGA 4BZQA 3FCAA 3AF0A 2WOJA 4XX0A 4DOMA 4DLTA 2GMWA 3A1WA 3WLMA 1G7TA 3NIFB 1GLNA 2WPDA 4QRDA 3PEFA 4CG2A 4FOOA 3C3YA 2RKBA 3FKSD 1CYDA 4NCXA 1H3NA 4QTXA 5DU2A 3RSHA 3SJAA 2FOXA 2QU8A 5DTQA 1QB7A 1XZKA 3PR2B 5JSZB 2Q5EA 2FKAA 5L45A 3FI9A 3P45A 4GL4A 5ABPA 2PXHA 4DJTA 1EE2A 3NPMA 1B2RA 5A71A 3M49A 4HYQA 4Y0NA 5CDTA 3P0RA 1NPTO 3ZJUA 2FPIB 3TB4A 5F9FA 1P2FA 2G83A 2G7ZA 1J20A 4HGPA 3MD0A 3S2FA 2FOLA 3CTMA 5A9RA 2C4HA 1L3BA 5FOQA 1KRWA 4MR7A 1JLMA 4CU5A 2ZRJA 2HA6A 5JNUA 5DBHX 5DCYA 3SEQA 4HUQB 4DVJA 5LXTF 2QL9A 1E4OA 4RD0A 3EXFA 2PAAA 4BX0A 1I4DD 3WGVA 4FVTA 3WDLA 5K3DA 1KF0A 3C98A 1IZ8A 1UBLS 3AM5A 1ZUHA 4HRVA 4N8EA 1RKVA 4IQ8A 3BYZA