1WVGA

Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
356
structure length
352
Chain Sequence
b'SIDKNFWQGKRVFVTGHTGFKGSWLSLWLTEMGAIVKGYALDAPTVPSLFEIVRLNDLMESHIGDIRDFEKLRSSIAEFKPEIVFHMAAQPLVRLSYEQPIKTYSTNVMGTVHLLETVKQVGNIKAVVNITSDKCYDNREWVWGYRENEPMGGYDPYSNSKGCAELVASAFRNSFFNPANYEQHGVGLASVRAGNVIGGGDWAKDRLIPDILRSFENNQQVIIRNPYSIRPWQHVLEPLSGYIVVAQRLYTEGAKFSEGWNFGPRDEDAKTVEFIVDKMVTLWGDDASWLLDPHEAHYLKLDCSKANMQLGWHPRWGLTETLSRIVKWHKAWIRGEDMLICSKREISDYMSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDP-glucose 4,6-dehydratase
publication title Structure of CDP-D-glucose 4,6-dehydratase from Salmonella typhi complexed with CDP-D-xylose.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 135
structure length 352
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.1.45: CDP-glucose 4,6-dehydratase.
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wvgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1wvgA02
3IP1A 3Q1LA 1KVSA 4FFNA 2C2XA 1H2BA 3OJOA 1GR0A 3R1IA 2VOEA 1UUFA 2IYPA 5JMWA 3Q3CA 4BNFA 4AJEA 1M6HA 1HXHA 3H6KA 1DAOA 3VZPA 2DFDA 2I3GA 3WYEA 3DOJA 4YAGA 3R0IA 3CZMA 1UXKA 2NVUB 2CDBA 4HUJA 1YONA 4Q9NA 1UXGA 3H2SA 5T67A 5LC1A 3ZHXA 1E1MA 3TWOA 4PZCA 5T5QA 4GBJA 1EVIA 4M1QA 4G2NA 2H5LA 1LDNA 1ONPA 4NJOA 2HK9A 2OP0A 5AXBA 4ALJA 4BO4A 4D44A 4ND1A 4ALIA 2O3TA 2HK8A 4IZIA 1QYVA 3JYOA 1G6KA 3ZI0A 4WCFA 3FN4A 4B4UA 3T7EA 5CG2A 5B37A 4MVJA 2GZ2A 2V6BA 4Y9DA 1DIBA 3TF5A 3SXPA 4HADA 5CEJA 1NFRA 3B1FA 3PJDA 4QFCA 4B79A 1LSUA 1DIAA 1NQOA 2ILTA 1Q1NA 1ML3A 4FGWA 4MVJI 4BKRA 2ZYAA 3HHPA 3AW9A 2AQ8A 4W7IA 4XA8A 1VLLA 4FFPA 3RBVA 4LMRA 4FOOA 3BZUA 2DFVA 1NNUA 1DSSG 2WYUA 3AFNA 3OQBA 4DPMA 5COAA 3QWBA 4N7RA 1T4BA 2A4KA 4NBVA 3VVCA 5A9RA 1I3NA 4OOFA 4BB6A 4DRYA 5DNAA 3E6AA 4MVJP 1LEHA 1MX3A 1R0KA 5KVVA 1T1SA 3GMSA 3AFMA 3Q2IA 1VJTA 2YW9A 3L4SO 1IB6A 3C8MA 4FFOA 3TZCA 2Y05A 1E6WA 3GVCA 5JDCA 4J2HA 4C4OA 3HFGA 4AJ2A 2BGLA 4LN1A 4ZU3A 4J9VA 2B0JA 1LRKA 5KKAA 5COBA 3ZWMA 4IMRA 4IGEA 1GZ4A 1DC6A 4K9DA 4N54A 4G81A 4NBUA 2P5YA 5DP1A 1IE3A 2X6TA 3FNEA 1XA0A 4MPDA 4WASA 4CQMB 5A05A 4IXWA 1GYRA 2VWQA 2ZCVA 3QQPA 4TKMA 1XSEA 4RF4A 2B4RO 1RJWA 3JQGA 4R16A 4XGIA 1QG6A 3QJ5A 5LDGA 3AOGA 1K2WA 5IXSA 5F1PA 4E13A 4JP2A 3TN7A 4XRRA 4ZN6A 4A73A 3W6UA 4E2XA 4YT5A 5TGDA 3WBFA 1EFKA 3ZU3A 3AU9A 1EQ2A 3UF0A 3S8MA 4DMLA 1AN9A 1X1EA 1ZK2A 3ROPA 2POQX 4XRGA 4E33A 2XXBA 3EC7A 5ITVA 3U4DA 4A27A 1YQGA 3O26A 1DHTA 4U6SA 5H82A 2FSVA 3P2YA 5DCWA 3JQBA 2OP1A 3ZWOA 4RORA 2PZJA 4KOAA 4HKTA 3CUKA 4UUMA 1SO8A 1BXGB 3B6ZA 2HMTA 1YL6A 5HA5A 2CMDA 1JKIA 3KSDO 1C0LA 1MA0A 1M76A 1NPDA 2HQ1A 2VUTA 3PJGA 4BNLA 1LDBA 3PP8A 3PTZA 4NFHA 4C7KA 4CODB 4XQ9A 4YA6A 2ZJ1A 3WGQA 4NR0A 1PQPA 3GVPA 1DAPA 1KERA 4FJ0A 4RQTA 4FIZA 1IYZA 2YHIA 4PG5A 2WSBA 4GX5A 3W4KA 4I5FA 4Z6KA 1MXFA 1WAMA 5CDTA 1MGOA 1LBEA 3NDJA 4U0JA 5DOVA 3JYQA 2AG5A 3JQ7B 1DRUA 2QIOA 2RBEA 4RPHA 4EJMA 2H9IA 3L6OO 3WFJA 1T24A 3NX4A 4BUCA 4FQ8A 1EK5A 1YB1A 1C1DB 3WIEA 1JW9B 3CMMA 3U62A 2AHRA 1PQWA 1XDWA 3EMKA 3GNQA 4UAGA 1XIVA 2NU7A 3AUAA 2O4CA 1B3BA 1GPJA 4EJ0A 2FRDA 2QX7A 4QT0A 4DGSA 1U28A 2VT2A 2NTJA 4AJOA 4CLHA 3ZWVA 5I9LA 2XAAA 5BSGA 1H9BA 2AEFA 5AXAA 1B8UA 3C1AA 3C7DB 3WWZA 1DLIA 4GVXA 4DREA 1P1RA 4CLEA 4HXYA 3ONFA 4BNHA 3DZKA 1P3DA 3WFIA 4CM8A 4GI2A 4E5YA 1JVBA 1ZO8A 4YAKA 5JC8A 2FR8A 3QW2A 3BMNB 3DZGA 4B7XA 3Q6IA 1H5QA 2Q46A 1SPXA 3UGKA 1KY5A 2HCTA 4DQXA 4YQZA 2J5RA 2ZTMA 3JQ9C 3WGIA 1UZLA 4L9RA 1UXJA 1U8FO 4JBIA 1NWHA 3ZCXA 4OKIA 3MTGA 5ENVA 1G0OA 2O3RA 4M89A 1CRWG 4CLXA 4KTTE 4J1TA 3K6JA 3RC1A 2Y67A 1Y5MA 3WG9A 3E9QA 2E49A 5AYVA 1HF3A 3E5MA 4OSPA 5G4LA 1HYGA 1OC4A 4JJGA 5KVCA 3M6IA 3CE6A 2IE0A 1HDGO 4CQLA 2Z5LA 5THQA 4KQXA 1SBYA 2V6MA 3MOGA 3ETDA 4FFMA 4R9RA 3OJEA 3AOEC 3JD3A 1LSSA 3UH1A 2UDPA 5G0TA 3NTQA 5KVQA 2JAPA 4B7UA 4YYZA 3D4PA 3TOZA 4JQCA 2P4QA 3DTTA 2NQTA 1A4UA 1PJBA 4WOKA 1O8CA 4TRJA 1ZXBA 4ND5A 3KUXA 1PGJA 1Y8QA 3FHLA 4CMAA 5GY7A 3GAFA 2BELA 4OQYA 3H5RA 1P1HA 4LRSB 1LLUA 1F8GA 2HLPA 2VRCD 3KM0A 4BO3A 3DMTC 1P44A 3K5PA 4BIIA 1DBVO 3AUSA 1BSVA 4FBGA 3K9QO 3RBZA 1A27A 1P0CA 2BFOA 3ZHZA 4DC1A 2ZK7A 1BVRA 3ETEA 3GK3A 3GG2A 3ZWBA 4W9NA 2ZB4A 4IXTA 3X2EA 2JJYA 2VRBA 4ND2A 2NV6A 4DTIA 1I24A 3T7CA 3QRWA 4OL9A 4ZRMA 1NVGA 2DAPA 5F1KA 3ZU4A 1Q0QA 1ADCA 1AXEA 1UDCA 3QSGA 4CLRB 4CR8A 2J6IA 2JAHA 1WDKA 2GZ1A 1QP8A 1HSZA 5F5NA 4DMMA 3AY3A 3ZU2A 1F8FA 5JO0A 4D0SA 1GCUA 2DBQA 2OXIA 3ITDA 5CDSA 4CMIB 2JD0A 5THKA 6LDHA 4R5MA 4YRDA 2C5AA 4I9HA 3KV3O 4W4TA 4WE3A 4XGNA 1PZGA 1PZEA 4XYGA 1U7TA 3UICA 3ZWCA 4J7XA 3GT0A 3LDHA 4UUNA 4X54A 5U4QA 4CUJA 1OFGA 5T64A 2O48X 2GPTA 4YJHA 4WLOA 3OMLA 1JAYA 4TQGA 4URFA 3ZWAA 4CMHA 5L7TA 3W8DA 4YJGA 4YJFB 1GUFA 1LSJA 3U4CA 3IKVA 4XYLA 1DJQA 4FN4A 3KYDA 1BHSA 5A5FA 1GV1A 5GZ3A 1LLDA 3DMYA 1BDBA 1EVJA 1E3SA 2WMDA 1EDZA 3H9QA 4PLVA 1GCOA 2X1HA 1R37A 3WNQA 2C59A 4D0RA 1WNTA 3U49A 1W4ZA 3JV7A 2OMEA 3QE3A 4L75A 4RVDA 3W8EA 2AA3A 4LK3A 4Y98A 5MDHA 4WEOA 1ZBQA 2NLOA 1BVUA 4DLAA 3DWFA 1IL0A 1ENYA 3DZJA 3TQHA 4BO8A 1R66A 4J1SA 2IXAA 2Z95A 5KOIA 3FPCA 4KP7A 1LJ8A 1EUCA 2P91A 4U6QA 1YQXA 4MDHA 3G0OA 4U7WA 3LC7O 3AI3A 4YCAA 1E3LA 3W8FA 2WD7B 1A5ZA 2G1UA 5J23A 1OAAA 1PZHA 1VM6A 2IODA 3U3XA 2NACA 3PEFA 3FF4A 4XJSA 4XB1A 3VPFA 3ZV3A 2JFFA 4AJPA 3HB4X 5F3RA 5TC4A 2EJWA 1GQYA 3KYDB 2O3QA 3IIEA 3U4HA 1WPQA 3D3WB 5G0SA 5JY1A 4A26A 4M55A 5C7OO 2CDCA 3GUCA 2UUOA 4A2CA 3DFZA 4D3FA 1HYEA 1D4FA 3OA0A 3PGXA 1X15A 4ZQBA 1X0VA 4O59O 2YQ5A 1DIGA 1XCBA 4AVYA 5I7SA 1TLTA 2ZTLA 1DPGA 4EUEA 4GLLA 1MG5A 5JXWA 4I9UA 4BOYA 5F1OA 4NK5A 1R12A 3QWHA 3OQ6A 4RQUA 3LT2A 1WZEA 4BO6A 1TVEA 1D1SA 2HMVA 3JD1A 4P4LA 1B26A 4S1VA 4FFRA 1E1NA 4R1TA 5I8ZA 4OOEA 2BD0A 3GOHA 1YB5A 5I7EA 3DHEA 1TI7A 2ZQZA 5CEEA 3LC1O 1H93A 4DL9A 1GQ2A 2H1SA 2FY8A 4AJHA 4R01A 3KVOA 4ALNA 4EUFA 3L07A 3VVBA 2JL1A 1U3UA 1U4SA 1GYQA 3E18A 1ADFA 1T2EA 1CIVA 1N1GA 4BKQA 1HE4A 2GR9A 2QYSA 1HZZA 1CJCA 1JWAB 2QYTA 3A14A 3ADOA 3GEGA 3INRA 1ZW1A 3F1LA 4J3FA 4AJJA 4JJIA 1S6YA 4PLHA 1V3UA 5CPBA 1HWYA 3Q9UA 4O5OA 3GHHA 3QP9A 4Y6PA 4YAEA 4GSLA 3VTZA 3OP4A 4D79A 5A5EA 3RC2A 3PI7A 1HEUA 1U3TA 4CL8A 4KMSA 3MJCA 3P5SA 3GA0A 2PGDA 5T8KA 1X13A 1YS4A 4NJMB 1YOVA 3OSUA 3DBRA 5IN4A 3VPHA 2IDZA 4YT8A 5IJZA 1UP6A 1DIRA 3EZLA 1KBZA 3M2PA 1C0IA 4AJIA 5B1YA 4CM1A 1EEHA 3WTBA 2OOSA 2VUUA 3KO8A 5BQFA 3MJTA 2PLAA 4GGPA 1UP7A 3L9WA 4FJ2A 4FSHA 2X86A 4MVJD 4FCCA 1U1IA 3I9MA 4L4SA 2GN9A 3ZNPA 4LVCA 4Q3CA 1PJ4A 2IZ0A 1E77A 2NNLD 3E9NA 1H94A 1B16A 1KOLA 4MVJF 1EVZA 2C7GA 1ZKMA 4E21A 4EDFA 3VTFA 4FDAA 4XDYA 3RUFA 3RROA 5JPIA 4QECA 3WX0A 1Y9AA 4CLOA 3GF4A 3Q9NA 5C7IO 4Z0PA 1HDZA 3DOOA 3E82A 4BNYA 4D41A 2PH3A 1SNYA 1LDYA 3JSAA 2B4QA 2I3AA 4NDNE 4CMBA 1SEVA 3KRTA 4XGKA 3WQQA 3IMFA 3PFWO 2PFGA 1XG5A 3WB9A 1ZH8A 3DHNA 3BMCB 3VKVA 4IJKA 4BHTA 2NSDA 3NT2A 3O8QB 5T6BA 3L4BC 3LT1A 4F45A 2CSUA 3W6ZA 3HNPA 4Z0TA 3RUHA 3TFOA 3AI1A 5T57A 4EZBA 4BO1A 3RU7A 1RKXA 2VWHA 3IKTA 4CMKA 2E6UX 1J6UA 4RLSA 5A9SA 4NG5A 4C7JA 1N7HA 3EVNA 3PLRA 5TIIA 1UZNA 3IJPA 4OXKA 2PZKA 4M49A 3EW7A 1XHLA 3PYLA 3I3OA 3IUSA 1ID1A 1PJTA 4B8WA 4D42A 2C7VA 3WLFA 2EIHA 3RKRA 4J2OA 3SC6A 2C0CA 2FP4A 2FSSA 1FMCA 1M2WA 3GDOA 2GO1A 4LSMA 2EGHA 2E4AA 3EAGA 3RUIA 2NU9A 1BXKA 4K1LA 4DLLA 2V6GA 1ISHA 1Z7EA 3RC9A 2I6TA 4B8ZA 4UVHA 5JAZA 3CEAA 1W0CA 2R2GA 2PH5A 3JQEA 4MKRA 4D3SA 3BXXA 4PG7A 1UDAA 1MXHA 4K28A 4MP6A 1C1XB 4CPDA 1U8XX 3UOGA 3N7UA 3C3XA 8LDHA 2W2KA 1BTOA 3TFQA 3DTYA 3KB6A 4K6CA 4P4NA 4Z3DA 4P8RA 1MB4A 3S55A 1JTVA 3ZV5A 1SEPA 2FR0A 2H6EA 1K3TA 3WICA 2Y1OA 3C85A 5L40A 1ZXLA 3H9EO 3RFVA 4GVLA 2DM6A 2EP7A 2Y99A 4BNGA 2G0TA 4JX8A 4R41A 2ZIZA 1NASA 1PQUA 1TB4A 1QV7A 4JN6B 5KIAA 1CDOA 2AW5A 4Z9YA 4DUPA 2Y66A 4XJTA 3RIHA 5AXCA 2QZ9A 2ZQYA 3HDYA 2DTDA 4J16A 1LTHR 2BMAA 3VZQA 1PU2A 4CJXA 1WDLA 3RJ9A 4JNKA 2BI7A 5JMPA 3BAZA 4E2YA 1XU7A 4TRRA 2JHGA 1GTMA 1PJLA 4A0SA 2ZTUA 5ILOA 3L4BA 4BMNA 5K6AC 1G1AA 3KSZO 3H9GA 3AM3A 4DIFA 4B7CA 1Q2XA 4BNJA 4WCDA 2HRBA 1PJ3A 1WZIA 3AUUA 4AFNA 1VE9A 2PD6A 3G1TA 4E5NA 3DQPA 2I99A 4RCVA 5DP2A 3V5NA 4BGEA 3K2EA 3WGTA 1O0SA 4DPLA 2O2SA 4XD2A 5KCZA 1EBFA 3GC6A 2BKAA 3TOXA 4WLUA 2EWMA 3OEWA 3ETGA 1I8TA 1E3WB 1ZEJA 3QWAA 5CHEA 4FS3A 2OZPA 3QWIA 4WGGA 2WM3A 5JLAA 1NAIA 5L51A 2HO5A 1GZ3A 5ADHA 3C7CB 4ROSA 3WLEA 4H15A 2E37A 2VYVA 3OJFA 4JJFA 4DYDA 1SB8A 3OIGA 1ONNA 4IINA 4NMHA 3BTUA 5JSFA 1ZEMA 3JQAA 4N18A 3HJAA 5MGBA 3KYCB 3FR7A 5EQDA 4LGVA 4GWGA 4M87A 2R00A 3D4OA 5EMHA 3GGOA 1Z45A 4IDFA 4ZVVA 2CZCA 3VHRA 2Y1GA 1H6DA 1WXDA 4JCOA 5C5IA 4GPD1 4I5GA 3BMQA 3ZV6A 2C54A 2HKIA 3DBLA 4L0QA 5H81A 4XEHA 5L53A 1VKNA 2J3IA 5IFLA 5TJ9A 5ILGA 4XYEA 4E6PA 2O2YA 1F0YA 3GVIA 3MJEA 3GPIA 2R6JA 3LF2A 2LDBA 1QYXA 4J43A 2D4AA 1OC2A 4WCFB 3D4NA 4D7AA 4NIMA 4XR4A 2Y0EA 4RO0A 4RLHA 5G2OA 3GVXA 4IQ8A 4HFJA 3A1NA 4WJZA 1YB4A 2E48A 1XQ1A 3OECA 3IL2A 4GX1A 1SMKA 5G4KA 3D5QA 3HDHA 4A7PA 3HADA 1U4OA 1HDCA 3ADPA 3G17A 4MVJE 1VRWA 4PG4A 1CWUA 2GRAA 1A9ZA 4AJKA 1ULSA 4DBVO 3AM4A 4II2A 3C7AA 1P1KA 2CNBA 1TT7A 2EKLA 3H7AA 2CFCA 4BGVA 3CIFA 5K6AA 5FI5A 3DAFA 2W2LA 1EE9A 2DBZA 3ONDA 3PGJA 5KJEA 3K30A 2B83A 5L4SA 4JIGA 1VL6A 4Q3NA 3ZN2A 2Q2VA 3CINA 3H5NA 1BMDA 1PL8A 4HFMA 4OSOA 3GNTA 2PGLA 4CV2A 2GDZA 4YACA 5GZ6A 5DT9A 3WDSA 3IC5A 3PK0A 4YAJA 2PWZA 4DYVA 4HV4A 4AG3A 1PL6A 5JAQA 1V3TA 4UVDA 1FK8A 4YRAA 1NVTA 1Q7CA 1O95A 1H0KA 3D0OA 4YPOA 1I33A 5AXDA 4L4RA 5A06A 1X7HA 3X2FA 3NAQA 1ISJA 1V35A 2VNAA 3OIFA 3F1KA 3HSKA 5JW6A 1NR1A 4DC0A 2Q4BA 3NV9A 4Q3EA 3VPXA 4JLWA 1ZFNA 4KQWA 3LC2O 1I2BA 3JQGB 4OH1A 2NVWA 4AJ4A 1Y8RA 4XQGA 2GN4A 3RUCA 2A92A 3WGZA 1Z73A 1E3IA 1UXIA 3H9UA 5GZ1A 1BGVA 1NFQA 2DC1A 3PJEA 4YWJA 4GX0A 1E7MA 4DPKA 1Y9EA 5A02A 2OL4A 5HRUA 1DLJA 2O3SA 1T25A 3G1UA 3FSRA 4M86A 4U0KA 1N5DA 1HDRA 1PS9A 1YXMA 3EDMA 2YY7A 2FPIA 4IDDA 3E1KA 3NRCA 3QA9A 5HWSA 3GRPA 4RDHA 1ENZA 4DWVA 5DF1A 1BG6A 2JKVA 3CSDA 1LLQA 4GX2A 4Y6SA 4BKUA 2WWRA 4WLNA 1KEWA 1ZJYA 1R0LA 2IZ1A 3DR3A 2NUAA 1GUZA 4ALMA 3B70A 4KUGA 5A4DA 4MOWA 4PIVA 1UH5A 5B4UA 1ISMA 2PKQP 1D3AA 3TL3A 4R68A 2YHIB 1R16A 5IZCC 1KIFA 2ZYGA 4R51A 5L95A 3RBXA 2P68A 2VTEA 5EPOA 3I5MA 4EI2A 5HS4A 4IIVA 4IPTA 4Z3KA 4TMFA 3ITKA 5F21A 2P9GA 2X22A 3ZNQA 1NX6A 4YEDA 3WSWA 3W1VA 2ZYDA 4BMSA 2G17A 2H63A 3FNFA 1GEEA 3ICPA 4U8GA 4DA9A 1ORRA 4D46A 1UJMA 1PS8A 3AM5A 3K96A 1HE2A 3PJFA 3HB5X 1XWFA 2IRWA 2Y68A 3I9KA 4R5HA 1F12A 1VC2A 3VDRA 1OOEA 3JYPA 7ADHA 1E7SA 4ZQHA 3RASA 2VTDA 2W8ZA 1RM0A 1DFIA 1VKOA 4FB5A 2F1KA 1E7WA 3FCOA 3U5TA 5KVSA 1EQUA 1HZJA 4CM8B 1JN0A 4LSWA 3GR6A 5LCXA 3ORFA 3GZNA 3LF1A 3SLKA 3DFUA 2BRUA 4NH4A 2O7QA 3G3EA 4PZDA 4N5MA 1HDXA 4D3DA 3IUPA 5DCYA 3FR8A 1E7QA 3BMOA 2JD1A 4W6ZA 4J7UA 1I32A 5DBFA 5AOVA 1N7GA 1X14A 3T4XA 3V1TC 1FDTA 1K6JA 4UVIA 3LYLA 1UAGA 1GY8A 4S3MA 3ROMA 1G0NA 5L7YA 3LQFA 4IDGA 1T2AA 3H3JA 1TT5A 3PHJA 4YR9A 2P5UA 2W4QA 4ID9A 5EINA 1ULUA 3WS7A 1GZ6A 2Q3EA 1X7DA 2Y0DA 1I10A 4N5LA 2G5CA 3V2HA 3ANNA 3GPDG 3NGLA 2WDZA 5KKCA 1BRMA 1CQJA 3ZNOA 1JQBA 4FGSA 4WUVA 1DFHA 2D5CA 1B7GO 5EN4A 5JYEA 1R4NA 2D0IA 3PFFA 3QVSA 4QSMA 5U1PA 2UV8A 1PL7A 2EEZA 4WK6A 1GQQA 3HG7A 4CQLB 4TZKA 4IGFA 1P74A 1R15A 2PY6A 2Q1WA 1PJSA 2OHXA 4FOSA 4QXMA 2GN6A 4Y67A 3WXBA 3CKYA 1NP3A 1QLHA 2VHXA 4MIYA 1ISGA 3I9JA 1SCUA 4CM4A 4GH5A 5L4LA 1J49A 1SOVA 2A9FA 3I52A 4LISA 3JQ9A 5IZCA 1PWZA 1F14A 4E2WA 3FI9A 1O89A 3EUWA 2CD9A 4UVEA 2DTXA 1Y8QB 3FTPA 2UUPA 3MJVA 4UEOA 2Y0CA 3S2IA 1EK6A 2C2YA 4PLGA 1NWCA 1T2DA 4R54A 1UP4A 3U0BA 1YBAA 2V6FA 1I2ZA 3D5TA 3BTVA 4KZPA 5IF3A 3R3JA 4W82A 2GF2A 1B8PA 3A4VA 4BS9A 5IDQA 5JO9A 4B3HA 3C24A 3DBHA 1VSUA 3GN1A 4XR9A 3F47A 4TKLA 5K0ZA 3SJ7A 3ZW8A 3IJRA 3V1YA 4NBRA 3AOEA 4BQRA 3PLNA 3BHJA 1UZMA 5BSFA 4J90A 2O7SA 3V8BA 1UAYA 4PZEA 1I5RA 1GADO 4YT2A 4BO2A 2QRLA 2PNFA 4I8XA 5LDHA 3JD4A 5BNIA 2FPPA 5IG2A 4OXNA 3PZRA 2CF6A 2D59A 3EVTA 3QVWA 1Z7BA 5IXYA 1FDUA 1GUYA 3FD8A 3DMTA 4YJHB 4ZQEA 4KUHA 1HRDA 1XGKA 4YJGB 4BB5A 1N92A 4BO7A 1KEUA 1M66A 3MOIA 2ZTVA 3VPSA 3WOHA 1VJ1A 1ZZEA 4J49A 3GEMA 3ZWYA 1WP4A 4GAEA 2OUIA 1HDYA 2YDXA 3SBOA 2X0RA 1XR3A 2P9CA 4TVOA 4D45A 3NJ4A 5JE8A 4MJLA 5EIOA 3BTOA 1MFPA 1N9GA 1A7KA 3ZGYA 5CDGA 4XCVA 2B4TO 3PHGA 1TA4A 3NDIA 2IEBA 5F5LA 5I9MA 4PCVA 3A06A 4UVGA 1JWBB 4A10A 2Z1NA 5ER9A 5TF4A 3MZ0A 3LVFO 2X5KO 3PDJA 4CMJA 2NM0A 3VAZA 5H83A 1YGYA 4CMEC 1YL7A 1V8BA 4E4YA 3UUWA 2C29D 4DQUA 3TZKA 2YQ4A 3S2GA 4L76A 4JP3A 4TVBA 3NTRA 4JBHA 4PRKA 3DZHA 1PS0A 4HFNA 4OM8A 4WEQA 1J5PA 1H6CA 4FPXA 4RF2A 1DFGA 3S1LA 2X23A 3I6IA 4R9SA 2Q1SA 4QTZA 4J1QA 4BNNA 4E5MA 4QO8A 2FPGA 3JQ8A 2I9PA 2QW8A 3AWDA 2CY0A 1YBMA 2ZB3A 1NQAO 1DRVA 2JCVA 2WJPA 3L9XA 3NJ8A 4BKPA 5G0VA 1PR3A 3JD0A 1NXQA 3NGXA 2I65A 4WECA 3RSHA 3UCXA 2EGGA 2B35A 3KTDA 1MP0A 1UXHA 1Y5RA 3PIIA 2NADA 5A03A 3UKOA 3ANLA 4Y6RA 6ADHA 1NQ5A 2G82A 4BMVA 4Z0HO 5EESA 4BGUA 2AEJA 1NQTA 3RU9A 4OKNA 3VH2A 3CPSA 1WMAA 4H16A 5EERA 2Q2QA 5I8WA 2VNSA 3I4FA 4W7HA 2HDHA 1EVYA 2XF8A 1OI7A 9LDBA 2ZCUA 1DC4A 4GSKA 5EQFA 3Q0EA 2X0IA 4R4JA 5KTKA 1E1KA 1JDJA 3N58A 4CR7A 4MP8A 3U4IA 2DPHA 3LK7A 1T2CA 2DKNA 3O03A 5ES3A 1NPTO 3KOUA 4NPCA 2VWPA 4G65A 3GGPA 4B3IA 2ZATA 4ZGWA 3ICCA 1AE1A 5DCUA 4LW8A 1KS9A 1A9YA 1F17A 3OETA 3QHAA 4XQCA 1E1LA 3PQFA 1XLTA 1EZ4A 4FW8A 5ICMA 2RHRA 1RM4A 3WWYA 2DPGA 2RAFA 4XKJA 1BW9A 4QEDA 3ON5A 3ABIA 3G49A 4KWIA 3VZRA 2Y1CA 2X0JA 3GG9A 4RZIA 3TZ6A 3JQAD 1E7RA 3F4BA 4MIEA 1E6EA 4U5QA 2GLXA 3JQFC 4QUKA 4XWYA 2IYOA 3DHYA 1QLJA 3UXYA 3PHIA 3GH3A 3WJ7A 4J1NA 4PFJA 4ZQFA 3VOSA 4IDAA 3RI3A 5IZ4A 1LQTA 1VSVA 5ICSA 3DAGA 4BO9A 1DHRA 4J91A 1LDEA 1QORA 1X1TA 2FOIA 4RF5A 4AICA 1I0ZA 3H9JA 1U2DA 3ZDFA 1PGQA 4OHUA 1GEGA 3PWKA 4J4TA 1YKFA 5BT9A 4EJ6A 5CEFA 4TRNA 4MINA 1IY8A 5EL0A 3L6EA 1YOVB 1J4AA 2EV9A 3DBRB 3MWEB 1P45A 1E5QA 4IZHA 2AQKA 2VZ8A 4IDBA 4A5OA 4O0LA 2HJRA 3ZU5A 1DXYA 1VI2A 4LCEA 4CV3A 2Y1FA 2EKPA 1P31A 3TZQA 5BNTA 2EJVA 3RQSA 5JYDA 4IMPA 4CLDA 2GD1O 4XX0A 4IY1A 5DZSA 1QV6A 1BW9B 1R4MA 1P1FA 5I7VA 2DUWA 1FDWA 4CLOB 4FC6A 1DDOA 2W90A 3NT5A 3KXDA 1A7AA 4UEJA 2BH9A 4TSKA 2O23A 2DTEA 1PGPA 3E9MA 2EF1A 2HU2A 2AE1A 2W2LD 5C7LO 3PVZA 3L6DA 3MCVA 3SX2A 1QMGA 1MFZA 3VDQA 3D1LA 2YJZA 3T4EA 7MDHA 1YL5A 5AQ1A 3JTMA 2F00A 3ZV4A 3I83A 1ZSVA 2J3HA 3A9WA 3GMDA 1O6ZA 5CP8A 2AEMA 4J0EA 3LLVA 2PKQO 3FPLA 1GPDG 2PD4A 4K26A 3OEYA 4CMGA 4RJTA 5ER6A 2YUTA 1ONOA 1QSGA 2NVUA 4WPGA 4RDIA 3B1KA 4E3ZA 2JHFA 1Y1PA 1PGNA 1NHGA 2C5EA 2VCYA 3S2EA 5A9SB 2DVMA 4YJDA 4RZHA 5TRTA 2Q45A 4RVUA 3JD2A 1QR6A 3NDRA 1YDWA 5TLSA 4W99A 1KY4A 5TS3A 2NWQA 1IUKA 2VYNA 1MC4A 4RGBA 5CDUA 4IJWA 5BSEA 3JQFA 3KEQA 5L9AA 3LZ6A 4HFRA 1FF9A 5JDCC 2YV2A 2BF7A 1SC6A 2HRZA 3CXRA 1DOHA 4KTVE 4IDEA 4Z9XA 1K6IA 4RVSA 4BKOA 5TQVA 1Z6ZA 1O94A 4OXYA 2FWMX 3ZHBA 2B69A 4HX5A 1PJCA 3FNGA 4E0BA 3K92A 1BDMA 1ENOA 1CQIA 1P1IA 1JKJA 1LNQA 2GSDA 3F5QA 4IQ0A 1I2CA 4BNVA 2BI8A 1ISFA 3GFBA 1GV0A 1KEPA 1U7HA 4YTEA 2PTGA 3QVTA 1VJ0A 2VT3A 4BQPA 3V2UA 1ADGA 3PWZA 5U9CA 4BV9A 2HMUA 1XELA 3K2BA 1AXGA 2W2KB 4NFYA 4NU6A 1V0JA 1IPEA 1DO8A 3V1UA 3B1JA 3RC7A 1HE5A 3BHMA 3WGGA 2O50A 4UULA 1PWXA 4CR6A 2IXBA 3KYBA 5B4TA 1PJ2A 5JBIA 3INTA 1K5HA 3WQSB 1D8AA 5HM8A 1LC3A 1YJ8A 2RH4A 4JGBA 2G76A 3INGA 3K8ZA 1LX6A 3HQ4O 1HT0A 5COQA 1ENPA 2NTVA 1FDSA 3RAJA 3JQBC 1LUAA 1AUPA 4EBFA 4BO0A 1EBUA 3SVTA 1T1RA 2VZ0A 1BXZA 5JS6A 1YE3A 4BVAA 4CQMA 3IOYA 1D7OA 3O9ZA 1LA2A 3NYWA 1ADBA 1NVMB 1VPDA 2OORA 1LDGA 3D3EA 2J5QA 3HWRA 3WYBA 2VHZA 4ALKA 3Q2KA 2VN8A 2DT5A 3Q11A 4M8SA 1P0FA 2JD2A 5JCXA 5L3ZA 2Y1EA 1YJQA 4KDFA 3PHHA 4BNWA 5IDWA 3EYWA 4GMGA 4PLYA 5JDIC 3WGHA 3F4LA 3OH8A 4ZICA 4Y8VA 3BHIA 3IAHA 1RM5A 1PX0A 4BNIA 1Q0HA 4INAA 4BNXA 4XIYA 2GN8A 1I3KA 4JK3A 1NR7A 3DC2A 1KC1A 1XU9A 1KC3A 4QO7A 3F6YA 2B5VA 3I9LA 3UVEA 2AE2A 3FNHA 2GASA 3GEDA 4IDCA 4ILKA 3QY9A 3RJ5A 2D2IA 3PQDA 1BXGA 1GDHA 3FBGA 3PPIA 4LVUA 5DULA 1E0DA 2TMDA 5DOZA 2EW2A 2QZZA 2X9GA 2DBVO 2Q99A 4ND3A 2YV1A 3JQAB 1YWGO 1Z75A 2ZJ0A 1I3MA 3KZVA 3L0DA 1ARZA 1TEHA 2BGKA 4CM9A 1M67A 1HLDA 4ESOA 2Z1MA 3LT4A 4CUZA 3LSYA 5DBIA 4J7CA 4CL3A 2E82A 1ZJZA 1KVQA 1ZMTA 3AJRA 3ROQA 3JQ7A 3C1TA 3M1AA 2C07A 2B37A 4P38A 3TPCA 5K9ZA 5CPFA 2GERA 3BMQB 4K6FA 1LLCA 2AG8A 2VHVA 3K73O 3DBLB 1C1DA 1GFSA 1M6WA 3OM9A 2AXQA 5FWNA 5A3VA 2XXJA 3DZIA 3GNSA 1GL3A 4IUYA 4E5KA 1W8DA 4PGFA 4PVCA 3OFSA 3B20A 4QFDA 3V2GA 3I4CA 1W6UA 3NKLA 1SOWA 2FZWA 4HY3A 3WIDA 5TNXA 4E31A 4WLFA 4BNTA 1IHXA 4HWKA 3WGOA 1FXSA 1JAXA 1ZK0A 3GDFA 3KHUA 4JBGA 1PIWA 3NT4A 2YFHA 1DC5A 3I1JA 3VH1A 1A71A 5KJCA 2DUUA 5G4KB 2X4GA 3W4IA 4BGIA 4JXKA 2J8ZA 4ONEA 3PZBA 1I36A 3BMNA 2C82A 1RYEA 4L74A 3TZHA 4NNJA 3EZYA 4XZ3A 3RUEA 4YXFA 2X5JO 2DLDA 1JU9A 4RPLA 3DONA 5ENDA 5FI3A 1MG0A 4EUHA 3ZWNA 2IEDA 3M1LA 3PXXA 3KLMX 1WVGA 4R1UA 4GQAA 3GQVA 4MIOA 4EYEA 3RUDA 2WYWA 5JCJA 1RYDA 3JQDA 1QKIA 5JDIA 1NYTA 3OA2A 3RVDA 2HMSA 4NQZA 5FEUA 1JLLA 1EMDA 3FTNA 1U2GA 1MV8A 1VL8A 3DBVO 4GL4A 4F46A 1GAEO 1LRLA 3HN2A 3ZNNA 9LDTA 3D64A 4TROA 4II3A 4Z9FA 3GVHA 5TX7A 4F6LA 4G5HA 3FWNA 2HJSA 4UUOA 3RKUA 3EGOA 2HUNA 1I01A 4W9NC 4EW6A 2V65A 4D43A 4Q3BA 1AGNA 1FDVA 3QLJA 1EFLA 4XIJA 3SEFA 1QRRA 4EEXA 3CMCO 3CTMA 1NHWA 3HDQA 2Q50A 2WE8A 5DBGA 1KVRA 3WMWA 4RVHA 1ZK1A 4B4VA 1IULA 2VUSA 3DB2A 3DAPA 2OFPA 4DXHA 4HNGA 3VZSA 3AY7A 3C1OA 4ZA2A 3WBBA 1S7CA 2AQHA 3F9IA 3D7LA 1B15A 4RV9A 4E2ZA 4NI5A 3PWSA 1HSOA 3HFSA 1CERA 1H2HA 1LQUA 1QYCA 1Y8RB 2BFAA 4O63O 4GMFA 4IQGA 2LDXA 4UEKA 2EG9A 1XKQA 3MJSA 4BL5A 4PLWA 1ZVMA 4ITUA 4R69A 4MKZA 3U09A 4OYRA 3RFXA 1PGOA 1GYPA 3WNVA 1KVTA 1NAHA 3LT0A 1IHYA 4J4HA 2A94A 3IS3A 4PVDA 2QQ5A 3TNLA 2GZ3A 3WQRA 4GLOA 3DOCA 2J3JA 3DL2A 3KSUA 2GNAA 4IM7A 3KLPX 4RVFA 1LU9A 4ZQGA 1NPYA 3FWZA 3O38A 5HTOA 4I9NA 3OJLA 4WNIA 4CLRA 2DU8A 1AHHA 3GUYA 1W73A 2WD8A 4OIMA 4XB2A 4YAIA 3F5SA 3NUGA 4KDEA 3DEYX 3FBTA 1ZSYA 5KWEA 4RVGA 4FFLA 4QQRA 2GGSA 3MJ4A 1I30A 2UYYA 1M75A 3I6QA 4CMIA 5BR7A 1NBOA 4OAQA 5IDYA 2YYYA 2BFMA 3K31A 3LLSA 4RPKA 5JY6A 1LC0A 2P9EA 4IS3A 1XYGA 4MKXA 4PN3A 3HUDA 4YRBA 1EUZA 1T26A 3MWDB 1LRJA 1CYDA 4YDRA 5FYDA 3M2TA 2UAGA 4N5NA 3ZW9A 5IDXA 2GCGA 3VH4A 3GDGA 1P33A 2DBRA 4KUEA 1LXCA 4YJFA 4BNMA 1C0PA 3EHEA 5C3MA 1KYQA 4IJUA 5CAEA 5JAIA 2C20A 3QVXA 4BV8A 1HE3A 3N74A 1QYDA 3HDJA 2X8LA 2PD3A 2NQ8A 4B3JA 3E48A 4CMCA 4GKBA 3BYZA 4CV0A 3FRJA 2NVBA 3OJ0A 3STHA 3ROKA 1Q0LA 4FJ1A 5B4VA 3R6DA 3H3FA 2B5WA 3ASVA 4GGOA 5JAMA 4MVJH 1DEHA 2Q49A 4OMUA 2HMWA 4DQVA 4NHEA 1PJQA 4KWHA 3BA1A 3WYCA 1BWSA 1E3JA 2NU6A 2Q4EA 1LSOA 3JYNA 1K89A 4Q3DA 3JQCA 4UREA 5HBRA 3GZNB 5FFFA 5EJ2A 4L8VA 2RCYA 2FZEA 3L77A 2EERA 2P4HX 3WGYA 8ADHA 2EW8A 2J3KA 3BMOB 3ULKA 3H2ZA 2NTNA 3NEPX 5A3JA 4P22A 1I3LA 1L7DA 1DRWA 3GHYA 5BNFA 2EHDA 2I5PO 1NTOA 1TT5B 4WOJA 4J4BA 3RUAA 2WD7A 1GU7A 2PZMA 3AI2A 4RL6A 2HSDA 3TSCA 3WSVA 2FN7A 4CM6A 3CZRA 1ZIDA 1HLPA 4DIBA 4EEZA 5CDYA 1R0SA 3IP3A 4TRMA 3UHAA 1MC5A 1MLDA 1T2FA 2JFGA 1B2LA 3ASUA 5TJHA 2X58A 5CFZA 3ZWXA 1R4NB 3WMXA 1SB9A 5JFOA 2XOXA 3GN2A 1DJNA 3EY4A 2IZZA 3KBOA 4HP8A 1U5CA 3D3WA 3A28A 3ENNA 3OICA 1L7EA 4R1SA 5IN5A 1GD1O 3R3SA 2OBYA 2BHLA 4RPGA 4CV1A 1WLYA 4GKVA 3F3SA 5L45A 1IZ9A 5AVOA 3TJRA 5KJ6A 1HDOA 3ONEA 4CM4B 1H9AA 4CUKA 1H6BA 1OBFO 3UFXA 4IS2A 3COSA 4BNKA 1Q7GA 3ZH2A 2OO5A 3PDUA 1DB3A 1H6AA 1YBVA 5A04A 1RM3A 5CG1A 4I08A 1Y6JA 2ET6A 1QXSA 2Y1DA 4MP3A 3UCFA 3UCEA 1V6AA 3JQ6A 3GY0A 2VQ3A 1CETA 1HL3A 4OGWA 3BIOA 4R3NA 3WTCA 2Q2WA 3H65A 5T8KC 4ZHSA 4RF3A 3WR5A 4F3YA 3F46A 2D5AA 1MUUA 3UN1A 3PYMA 2HK7A 4QX6A 2EXXA 3SJUA 3P7MA 4E5PA 5L7WA 3DBHB 3TRIA 1U3WA 4CM5A 3E5RA 4PG6A 1HETA 1OZAA 1B0AA 1XQ6A 1ZUD1 3PIDA 5KJ1A 2PKRA 1LI4A 3OBBA 3OF2A 4XQEA 2O4UX 1NM5A 4IBOA 4F6CA 4O1MA 2A35A 2V7PA 3E03A 3GZ4A 1JA9A 4MO2A 4BO5A 1PZFA 2PK3A 4H7PA 1ZMOA 1O5IA 2RHCA 2PGJA 1IOLA 2VZ9A 4YBZA 4XYBA 1HKUA 4FC7A 3W4JA 2O3JA 2PA3A 3I9NA 1N1EA 2YV3A 4R1NA 3VH3A 4NJMA 4B4OA 1SZJG 1ZK3A 2PR2A 5DN9A 4E12A 3PYXA 1UDBA 3QIVA 2VWGA 2J5KA 5KNLA 3MEQA 3AUTA 2CDAA 3MTJA 4AJNA 2VYND 3GFGA 2GYYA 2VHYA 2VOJA 4AJ1A 4L4XA 3TL2A 1E6UA 4DBZA 5I7FA 3ZWWA 4FD3A 2TMGA 5JC1A 4XDZA 1D1TA 4I5DA 2O3UA 3UW3A 2ZB8A 2EKQA 2VRCA 1WDMA 3E8XA 4DIOA 3ANMA 1N9GB 2BLLA 3DZBA 2Q1TA 4DVJA 1V9LA 2BGMA 2ZKLA 2CUKA 5TT0A 5DDIP 1J0XO 3GLQA 4J0FA 4Q3AA 3VC7A 4NFSA 1KEVA 4P4GA 2RH8A 3WJAA 2SCUA 4Q39A 1LDMA 1HYHA 1YVEI 1C0KA 2X7HA 3IQDB 2W98A 3LU1A 2BFPA 1P1JA 3RWBA 3NTOA 3IDSA 4MVJM 4PLCA 1ZNQO 4DLBA 2QHXA 3SLGA 5I9NA 4NU5A 4OO3A 2FR1A 2QRJA 3GAZA 2EP5A 5TSDA 3EK2A 4IJVA 2YZ7A 3BMCA 4A03A 2I67A 2B36A 2X5OA 1C3VA 3GRKA 3JCZA 4LMPA 1EE2A 3O8QA 3G79A 4PLZA 3JQ8B 2AQIA 1O9BA 3DO5A 1EUDA 3P19A 5BSHA 4LCJA 4TZTA 2NU8A 1P9LA 1L1FA 2VYVD 1EDOA 1RPNA 2JCXA 2WE7A 1A72A 1Y81A 1U3VA 4AL4A 4B4WA 1UR5A 2Q1UA 1DC3A 2YHUA 3DXFA 3OHSX 4RPJA 4AJLA 1E5LA 3HE3A 2JCYA 4PLFA 3QWFA 4R3WA 4YQYA 4E30A 5TT1A 4CQMD 1E92A 1X0XA 2P2SA 1ISIA 2PV7A 3KEOA 4CMEA 5C37A 1AHIA 2D3TA 1IPFA 2QRKA 2X9NA 5A1TA 1NFFA 4XYMA 5A9TA 3UAGA 1N8KA 4EGFA 4MVJG 4WKGA 1U5AA 3ENKA 3PRJA 3H8VA 5KJFA 4GWKA 3OIDA 1SAYA 2X0NA 2X9VA 3U9LA 3HN7A 1K0UA 1T4DA 4WNCA 1B3RA 1IZ0A 5G0WA 3AU8A 4HNHA 1CF2O 2FMUA 1DIHA 3KETA 3DZFA 2XPCA 2D8AA 3VKUA 4ZRNA 4IIUA 3OQ1A 1CEQA 1Y7TA 5L4NA 1C1XA 3QV1A 1YQDA 2VHWA 2FHSA 3GGGA 5B12A 1K6XA 2CVQA 4PLPA 2AMFA 2WTBA 3H4VA 4ALLA 2Y93A 1YO6A 1WMBA 1Q7BA 4ZD6A 3RD5A 3DDNA 1ZCJA 2I76A 2CF5A 1ZK4A 4JROA 2JFHA 4CM3A 1R6DA 4YT4A 5ITWA 4WCFC 3VPGA 4CM9D 4LRTB 1WW8A 2YFQA 1B8VA 1JKFA 4J9UE 4NK4A 4CM7A 4HBGA 3QVOA 4O6VA 3ST7A 4I1IA 1KETA 2OBNA 5GMOA 3RFTA 5JNLA 3I23A 1ZSNA 1FJHA 1YRLA 2CVOA 5G0UA 4H3VA 2D1YA 4TWRA 1Z74A 3S2FA 3ZZNA 1PTJA 3PHLA 3SC4A 4WLEA 4BNZA 1TXGA 2CVZA 5HS6A 2DQ4A 4PRLA 1A4IA 2HAEA 3TDKA 3I9OA 1E7YA 3AY6A 2I66A 4ZJUA 4YB8A 1N2SA 2QG4A 1PR9A 2OGUA 1U9JA 2GUGA 5FF9A 4FR5A 2R00C 3AK4A 2UVDA 2ZB7A 1X7GA 4UUPA 4WLVA 1KVUA 4NBWA 4EITA 1HTBA 3ZHYA 1E3EA 1PEDA 4L73A 1QYWA 4OQZA 4E32A 2WYVA 1P77A 2PZLA 1C14A 1OMOA 4PLTA 3P2OA 3PQEA 4BNUA 1B14A 1PSDA 1Z82A 3H5AA 3CH6A 4ND4A 4PG8A 3JYLA 4NBTA 1F06A 4I5EA 4M54A 1E3WA 1R4MB 3RCBA 1RWBA 4J6FA 1V3VA 2WEKA 5IAAA 4OJNA 1WWKA 1XEAA 2YDYA 1YH3A 1VL0A 3HZZA 1JVSA 3ZWPA 4YVFA 3O4RA 2RIRA 1YDEA 3BTSA 5JCJD 3KYCA 4NZ9A
chains in the Genus database with same CATH superfamily
5BYAA 3OQMA 2C2XA 4OPMA 3B2EA 3CTPA 3O8OB 5B36A 4K9SA 4TM8A 3P9PA 2VRNA 2VOEA 5DHFA 5ALRA 3DOUA 3Q3CA 2ZUBA 3ZKWA 4BNFA 3H6KA 1AZSC 1DAOA 3EUEA 2DFDA 4AF8A 3U7EB 3WYEA 1C8VB 2H2HA 3COZA 3S5JA 4CI9A 2FPWA 4YAGA 4YDQA 2G1JA 3GLFB 4JXXA 1I3OA 1P1CA 3D4LA 3T4UA 1Y6RA 2X8BA 3G5LA 2CHVA 2GD0A 4Q9NA 5F35A 3C4JA 5LC1A 1N5RA 4Q18A 1Z16A 4EJ2A 3GW8A 4PZCA 3RVRA 2SHKA 4PICA 1G5RA 1EVIA 4Y9SA 3P9YA 3S4YA 2I62A 2Q5LA 2XH8A 2GPYA 3UAZA 4ALJA 1MJ5A 2FPLA 4ZTZB 2QTLA 4DNOA 4DA6A 2FSVC 2HK8A 2JLCA 4IZIA 4JR0A 1OH5A 1G6KA 3FYCA 3ZI0A 5LOVA 1OZHA 1WKCA 3DEJA 2GI4A 4KSYA 1LBQA 1UXOA 2E9SA 3SR3A 4A2QA 3BBPA 4UEQA 5J4YA 4WW0A 4MVJA 2VUIB 4B44A 3DFMA 5I7HA 3UW1A 2XMGA 2MR5A 2XEXA 3V9PA 1DIBA 3TF5A 1TDJA 2IIVA 4N3NA 3ZY6A 3TI9A 1PLKA 4QFCA 3STUA 4TMKA 4IICA 4G0QA 1NQOA 5JNSA 1NW9B 3HO8A 1KSGA 3AR5A 4BKRA 1BWQA 2QQFA 1Z22A 4E70A 3AMVA 1N2GA 3E3NA 3K8YA 4JC4A 1FXUA 4C7MA 2P41A 3DD5A 2VHTA 5HZGA 4W7IA 5IU6A 4F7DA 3TJMA 1OXXK 4JLMA 1CY4A 3FUXA 3TLEA 4X1IB 2ZSFA 3M4NA 3PNKA 4G0OA 1OLXA 1UKVY 1XBTA 4LF9B 1FZTA 3BZUA 2DFVA 5JMOA 3WLIA 3OQBA 4BLSA 3IKMB 2ST1A 4KG7A 3VVCA 2XQGA 1CUVA 2XUQA 5A9RA 1T2NA 1TECE 1ZVJA 4OOFA 3BH7A 5DNAA 1E4EB 2A7XA 2IPAB 1SWWA 1R0KA 1MX3A 3KUCA 4MRNA 5JCPA 5KVVA 4JP5A 3AFMA 3DLIA 2FRDC 3IOCA 1U81A 3ISJA 2ZT8A 1YS2X 4FILA 2QVZX 2WLTA 3GVCA 3KOOA 4X00A 3DOEA 5CTJA 4AJ2A 5L6LB 3TZBA 1IWBB 1EXNA 2PUFA 1X7WB 4PCUA 4YLYA 5COBA 4IGEA 1GZ4A 4NBUA 4HO1X 3IOMA 4G81A 3A3YA 3K0AB 3SP1A 6AT1A 2F1HA 4B6EA 5EZYA 5H3HA 4CQMB 1QO7A 4YFYA 3K9BA 4H60A 1GYRA 3QQPA 4B31A 3KFLA 5DXJA 5DXFA 3H17A 4WINA 1FBNA 3RSQA 4N01A 3T0FA 5JBQA 4R16A 1FEZA 4DR7B 4YIKA 2Z8XA 1XZHA 4UBJA 5LDGA 3R7BA 3AOGA 3B5EA 1P5RA 3BA6A 4MV6A 4RD4A 3VZBA 2R6R1 4UHKA 3VBEA 2V3CC 1L4LA 2Y76A 2XE4A 4XRRA 1US8B 4ID3A 2G9NA 5E4YA 2NUTB 4ABTA 3FVVA 2FDCA 3SF8B 3RU2A 4EIWA 1EQ2A 1YV9A 2ZU0C 3UF0A 1TU3A 1AN9A 1X1EA 2CYBA 4R98A 2POQX 1QRUA 4PZPA 3VPGA 4DKXA 2PKWA 3BDIA 3FKJA 4YRJA 1XTJA 3DAOA 4NV1A 3L1HA 5DASA 1NGSA 3A1EA 1QIFA 3BPSA 3JQBA 4Y9UA 5DCWA 3HKEB 3ZWOA 1NVVR 4U2DA 3TBFA 3LC0A 4UUMA 3ZIAD 2BJWA 4GPTA 3G9UA 1G8SA 3IR5A 5B58T 1JKIA 3S2SA 2F4VB 1OKKD 2GMWA 1JDZA 3EG9B 1MA0A 1F4PA 2VUTA 1Z6GA 3PJGA 3T1OA 3Q72A 1XU4A 4PTYA 2FSFA 3R3UA 3EZFA 3GVPA 5H0IA 3V1KA 2XA1A 4FJ0A 4RQTA 3W5HA 3QXXA 4FIZA 1IYZA 4OGGA 2YHIA 4LXHA 1QU3A 3W4KA 4F5YA 3SEAA 1EYZA 4Z6KA 1OIXA 3Q98A 1C8LA 3N76A 1L5HB 4NU8X 1NV9A 2ZIXA 1LBEA 2F3RA 4M98A 5CNMA 3PXBA 1PR0A 3HCEA 2RBEA 5E3HA 3O2SB 4POAA 2IS1A 4ZVKA 1GKLA 5TQ0A 3TRJA 2X76A 3ILYA 3NX4A 4XXHA 1ZC4A 4ZODA 1JHRA 2P8SA 2QMYA 2ATVA 3KEFA 5AICA 2C4HA 5F5XA 4BVJA 3WIEA 2EJTA 4LX0A 4AUEA 5E2BA 1RKBA 1RPTA 2AHRA 1PQWA 3CMMA 4AK9A 4AP6A 4YO8A 1U9YA 2QQ0A 3NYRA 4UAGA 3VJRA 3MMPA 4B85A 2O4CA 4RH0A 2KMLA 3ED1A 2Q7DA 2BGWA 2VJKA 4H7IA 4QT0A 4URHA 5KKNB 4TTRA 2VT2A 4D8WA 4L51A 4AQ7A 1OLUB 4KX3A 5I9LA 1NUSA 4TKZA 1TRKA 4RKFA 4RK5A 4JXJA 3EASA 1BD3A 1BMFA 4GMHA 4XJXA 3FLMA 4GVXA 5AUPB 3L7AA 1KP9A 4CLEA 1S2IA 2WA2A 3M9XA 4HXYA 3G8CA 5G1NA 1I0IA 2O2ZA 4HDNA 4O3MA 4CM8A 4HSGA 2RH5A 3C15C 4AMZA 4RE5A 1ZO8A 1TIPA 5C81A 2FR8A 3QW2A 3WWCA 3M4ZA 4H6PA 2VO1A 2XQKA 3I73A 3TIIA 2HSZA 4F84A 5BSKA 1A9SA 1H5QA 2IYNA 2BWJA 2FW0A 4TGLA 5LZ8A 5TF0A 4G0ZA 2HCTA 3EULA 4Y7CA 2E4WA 2ZPAA 4EG3A 1Z34A 3TNDA 5EHNA 3TOSA 2ZT7A 3KALA 3BD7A 4LWOA 2F8MA 2P1RA 4OLBA 1GZSA 3ZGOA 1WXIA 1CT9A 1ZP6A 2YZMA 5F9FA 1U8FO 1J2JA 2C7PA 1JLLB 3GRFA 3DUWA 4FNGA 3WIBA 1JG7A 1XAJA 1XQXA 1G0OA 1MEJA 2A5LA 4YJFA 4RU1A 1CRWG 5HQ3A 1TU4A 3AF2A 4C4XA 2ZE5A 4RD0A 4J1TA 3K6JA 4HH4A 1JQLB 3F7TA 2YHSA 4S24A 2Z6VA 3GUZA 1Y5MA 2BMWA 3C6YA 3E9QA 4MWEA 4ZA2A 4YMGA 2GM5A 5FTMA 1RCFA 4ZCPA 4UJ3A 5EXPA 1OC4A 1D2EA 1GZDA 2V7VA 1FW6A 3M6IA 4AXXA 3MIZA 3B2QA 3CE6A 4BX3A 1TQ4A 1QQ5A 2CBGA 2IE0A 4R8SA 3RC8A 4LCBA 1SBYA 2AXPA 3MOGA 3AKYA 3OJEA 3FVQA 3QVJA 4P4SA 4ZQCB 1M8JA 2REOA 4NYMQ 3WNDA 2JVJA 2QR3A 2UDPA 3TSZA 4RTQA 3KAQA 3TRDA 1UQUA 4B7UA 1Z6XA 3TOZA 2YOGA 2IUTA 5JTUA 1A4UA 2WU1A 1IK4A 2OFFA 3NEAA 2JIMA 4JI5B 4U9UA 4B3TB 1WB9A 2PBZA 1FX0A 1SG6A 2FU5C 5FWYA 2Y6VA 5MN4A 4ENSA 1FYVA 3UYKA 2Q8NA 2BELA 3GAFA 1KI6A 4OQYA 4NEQA 3B6IA 5DK6A 3AEYA 2VRCD 4QYMA 1P44A 1R0CA 5FO1A 3RTGA 1DBVO 3FJ1A 3VNVA 2LIVA 3EBPA 3GU3A 5LP1A 3EGXA 2D4HA 2G4LA 3ZHZA 2NO1A 4K05A 3W9UA 4ER6A 5IVHA 4UU0A 1WABA 5AIAA 3QX9A 3ETEA 3OT1B 4NOLA 1PT7A 1ZOLA 1WRBA 4G0PA 4IXTA 1OI4A 4LAFA 4W9NA 1JEJA 3LUKA 3X2EA 1KK0A 1C9KA 3BRQA 3PE6A 4CKZA 3H05A 3QRWA 4OL9A 5CGZA 1OB2A 2Y0BA 3CG0A 4KGZA 4AUKA 2WABA 1Q0QA 1AXEA 3KAJA 1UDCA 4CLRB 1XEWX 2JF0A 1TCCA 4JBNA 1WPRA 1H8HD 1T9ZA 2UYHA 2V1UA 4C22A 1C4KA 2PN1A 1OAOA 2I6UA 3MILA 4M2LA 4PCAA 3FKSD 4PGMA 1QQ7A 4UTXA 5CLQA 5AJUA 5E9AA 2OXIA 4HWOA 3WYAA 1ECBA 3PUJA 3U16A 6LDHA 3D4BA 4OQXA 3C45A 5HP4A 3H83A 1FUIA 1AUQA 4WE3A 4E6EA 1PZGA 4DLKA 3V34A 1C9NA 4QNRA 3IODA 3J7AC 4CUJA 1OFGA 2G63A 3ABOB 5FT9A 2C1EA 1CZRA 1XKXA 1TYZA 3L8MA 4HPWA 1BN7A 4MKHA 1V26A 3HUUA 4TQGA 4NF2A 4KRFA 1HYQA 4I2NA 4R2KA 2P35A 3DO8A 1D2MA 3OFNA 1ZHHA 1ID8A 3L1IA 1FSFA 1LSJA 2JFOA 1D2CA 5BWNA 2NTYC 1JG2A 1AF7A 2XTNA 3RVBA 1NVKA 4XUEA 4Z2YA 1DJQA 4BP1A 2N0SA 1E62A 2VPTA 4C6TB 4KXYA 5KNDH 2A6PA 5GJCA 2OG2A 1GV1A 1DKMA 1SPBS 1Z29A 4RACA 1L5WA 2HQBA 4RPCA 3RG8A 5GZ3A 5FLXA 2B1QA 1LLDA 3DMYA 1K4KA 1BDBA 2WMDA 1UK8A 1KK1A 1GCOA 1XZJA 5CT6A 1R37A 1QDLB 3WNQA 4D0RA 2HD4A 4LHWA 3W8EA 3QE3A 1HNWB 2XXAA 4L75A 4TWAA 3M4YA 3ZXXA 1V2GA 4PSCA 4ZV9A 1N6NA 3VU3A 3M8KA 1CUHA 2JBHA 4Y98A 4BMOB 4CGZA 1JG6A 1KGDA 2FN3A 2NU6B 3U6KA 1RXVA 3OE7D 2AOUA 3T3DA 2WV9A 3FUVA 3U1BA 5BUSA 4P82A 4D0SA 3DWFA 4B81A 2ALJA 1LCIA 2K6GA 1F2DA 1RAAA 5J2UB 4RKEA 1V1JA 2IXAA 1MHPA 4WBNB 4UDNA 3W7AA 5KOIA 4LFAB 2MT9A 1KY2A 3MRVA 5K45A 1MD9A 1A77A 2ZGVA 2P91A 1KJZA 4NBKA 1A1SA 1HC7A 1Q15A 2FN4A 2XOKA 3FTDA 3AKEA 2FTKE 1QP4A 2OK7A 2ZYHA 1ICIA 3DJYA 3LW8A 1JFFB 3AI3A 4KAAA 2H0QA 1D6JA 2WJ6A 3AYXB 1ULHA 2SNIE 3DE0X 3W8FA 5KU1A 4P33A 1HE8B 4RIGA 1HL7A 5J23A 3OOHA 5H4HA 1K75A 1PYDA 1YHNA 2MSEB 5HIKA 5J5AA 2H65A 2I2XB 3IAUA 4N0EA 3O9VA 5L8VA 4XJSA 2NO7A 3DNPA 3VNSA 1NYLA 5F3RA 3VYWA 5JQGF 3N28A 3DC7A 4P3KA 4HNUA 3KYDB 3I5XA 3A1DA 1NX9A 1Q1QA 5HVNA 2IELA 3IXMA 4RMIA 3CH4B 4GLFA 3D3WB 1X1DA 1W94A 2WF5A 2V7EA 3TRKA 1P2SA 4M55A 2A86A 2GJ4A 5HJ2A 3MT0A 4ZVTA 1F8XA 5C7OO 1O97C 1HNZB 4ES6A 5JU6A 2ZG6A 1YAHA 3AQ4A 4D3FA 3I5YA 2HGZA 3RGGA 3TE7A 3QXSA 4EPWA 4EG4A 2Z09A 2GBFA 4XB6B 3T7AA 2YQ5A 2C95A 4JXZA 2CJWB 4GLBA 4O4LA 4EUEA 3P4YA 1SU8A 1NVBA 1MG5A 4B5KA 2ISCA 2QTHA 1Z5VA 3MJDA 4LJRA 3ZDYB 1X2EA 2DSNA 2W6MA 1Z0AA 2D2VA 1T8RA 3WK5A 4RQUA 4D9BA 5CNKA 4P36A 1S01A 5T6MA 2R6FA 4BO6A 4K87A 1D1SA 1MHTA 4P2BA 3KQNA 1B26A 4S1VA 4TKUA 1F9EA 3DDOA 1DRKA 1UMCB 2BTEA 3NIGB 4IIDA 1UKZA 1YDFA 4M60A 4R1TA 5D85A 2VKQA 3PBKA 5I8ZA 1GNVA 2FW9A 3GOHA 3LHIA 4DILA 1VJDA 1TI7A 4COOA 1TNDA 1YOBA 3V97A 3LBIA 2JIPA 1RRCA 1N0WA 3KJFA 2GUWA 1H93A 4NZNA 1OAKA 2XRMA 3PC4A 2FPXA 1ZD1A 3T3NA 1N0IA 1A82A 3ZDQA 5A4IS 4HPJB 4A8JB 5CIYA 4LSZA 3T0IA 3L07A 3LRPA 4L6CA 2CLHB 2PH7A 5FPPA 5BY2A 3I4LA 3E18A 4TV8B 1ADFA 3PNPA 1N1GA 4YUVA 1DRJA 4CG1A 1HE4A 4Z3OA 2GR9A 1U5BA 1HZZA 2A33A 2QYTA 3INRA 4M0MA 1QP0A 3F1LA 4GKAA 3FTCA 5AKEA 2DH6A 1S6YA 4YXWD 2Q4RA 3ZJTA 1V5FA 2HK6A 1CUWA 4FEEA 5HF5A 4ZDIA 2GYWA 3UWSA 1FIUA 4IJ5A 3K8QA 1SKMA 1XZPA 4LKRA 1RWMA 1KBOA 2PLFA 3GHHA 3GPBA 4B2PA 5FUQA 1X7XB 4QNNA 1N9ZA 3QXJA 1E2MA 2WYOA 4EA7A 2A5FA 1PBNA 1UT8A 1DAHA 1T6BY 4IEFB 4GMKA 3A8TA 4ECAA 4CL8A 5M3BA 5E3IA 4V0NA 3P5SA 4G1VA 4RWEA 3I53A 3GLTA 3GA0A 7YASA 1A69A 3STTA 4TUYF 4XWTA 3AR6A 4BBZA 1YOVA 2GJAA 5IN4A 5K3OA 4YT8A 1UP6A 1IC6A 3EZLA 1ABFA 4AJIA 1ZY2A 3SX4A 2V7XA 1COWD 4NCBA 1YK1A 1BVYF 5THXA 3HDGA 3A2LA 2VUUA 4KV9A 2O05A 3KO8A 4Y1EA 2P27A 4TS1A 3L9WA 1FFYA 1L7MA 4UDXX 2J41A 2XR1A 3KE8A 4FCCA 1UPXA 1U1IA 3I9MA 4IL5A 2W37A 4FYMA 3UXHA 2GN9A 3U7IA 3WLSA 5KREA 2IZ0A 1FFSA 1KPIA 1L4UA 2JJMA 2O2IA 1P7WA 1VE5A 2ZUWA 4OUKX 3WLRA 4QUJA 3N86A 3QE0A 4NBLA 2CUTA 3VTFA 3ZQJA 4XDYA 1ZYUA 3ND6A 4MMYB 4X1KA 5JPIA 3QMPA 3GF4A 3CLRC 1XKLA 4D41A 1ADJA 3HFRA 3RYIA 3WRVA 3VKGA 2PH3A 5DN6D 2R6AA 1LDYA 1TZBA 1VGVA 4G0XA 1D2HA 1RBMA 4RSHA 3IDQA 5BUQA 4J16C 3R77A 5UKDA 1YA8A 4DDHA 2VJNA 4I1UA 4MR8A 1C3OB 3OPYB 1V8OA 3LDAA 1K8XB 1RAIA 1ZH8A 1J9GA 1NP7A 3BMCB 4BBPA 4C6SA 1R8SA 3WADA 5C18A 2N47A 3WJ2A 4BHTA 1K9SA 5I3ZA 3NT2A 3O8QB 4FR2A 4HQKA 2EWVA 1NMYA 4L2IA 2ZBPA 3W6ZA 4L3WA 1EUDB 3RFFA 3CF2A 5FI0B 3QVMA 1QWSA 4KQGA 4EX7A 3NP7A 2O8EB 1FS6A 4ZOCA 5JARA 2BOVA 5AKXA 1IG0A 1SD2A 3RU7A 4MWDA 3DXXA 1RKXA 2HHJA 4RHEA 3RARA 3DTVD 2E18A 3PFGA 4FWBA 1J6UA 4RLSA 2NXWA 3CUUA 2M1XA 5TIIA 1UZNA 4QJBA 2FQYA 3BFPA 2BEUB 4OXKA 2P2CA 4M49A 1XHLA 3VU9B 1YU6A 4MAMA 3V7FA 4KRXA 3A9UA 4G97A 1ID1A 3SHQA 1MB9A 3E3OA 3M3PA 4D42A 2C7VA 1NI4B 3WLFA 5CLJA 4J2OA 3LECA 3LNTA 2JA1A 3KEGA 1R18A 5SZKB 1FMCA 4EA8A 5EP3A 1N2ZA 1XLUA 4MS3B 1M2WA 4LSMA 3LXRA 1JWLA 2E4AA 2PGXA 2Y2VA 3RUIA 3AKDA 3PSHA 4X0EA 4LGMA 2GPBA 4K1LA 3ZGXA 1F5SA 2KSQA 3VOAA 3OT5A 4FYKA 4UVHA 5JAZA 5HDBB 2HSJA 5JD5A 4G0WA 1ABBA 4MKRA 4YAOA 1WBBA 3WNBA 3PCTA 1BOOA 3R44A 3RGWS 3OQPA 4A82A 3MAGA 1E2KA 1XZLA 4HGQA 3RSSA 4QG3A 3TGWA 5B55A 2QX6A 3C3XA 4HWRA 4Z86A 1JEOA 1QVWA 4ZO6A 4DSTA 1C30A 2Q3HA 1NBMD 1BTOA 4GM1A 4LXIA 3KB6A 4K6CA 4PPNA 3UG6A 2C0QA 5CA1F 1MB4A 1JTVA 1RDFA 3Q3IA 2H7XA 3ZOZA 1FXWA 2W48A 3GYBA 2R44A 4IIJF 3UUGA 2Y1OA 2ABWA 5C2JB 4GVLA 4BWYA 4FGUA 3LP5A 3FPBA 5DNWA 1ZRNA 4BNGA 2VF2A 2G0TA 2P4UA 2PYDA 2W2VA 1MABB 4ZYWA 2PG3A 1QV7A 2AOTA 2OR3A 1L7NA 3F7NA 4H27A 3KQQA 5KIAA 1E9VA 2QQEA 1VFPA 1ZM4A 4XOUA 2EF0A 5L3QA 5DTEA 5KNBA 4JYAB 4XJTA 4MQ6A 2H4HA 4GT1A 4Q66C 2QZ9A 3O4FA 5AK6A 4JEMA 1CR2A 5CXUA 2DTDA 4UM5A 5LQJA 3ETCA 3VZQA 2J7PD 4MJXA 1J23A 4CJXA 4UM9B 3TJZA 3QKRA 3Q7QA 1AKUA 1Y1QA 2HADA 2JK0A 5CFPA 5JZSA 3BAZA 3MGBA 4FYJA 4ZXFA 1T8SA 1UM9A 1PJLA 4DLUA 4AQYB 1N78A 1Y1KE 4BMNA 4MWBA 5K6AC 1FMFA 3H9GA 4DIEA 4I1PA 2ZJ8A 4DIFA 2QMZA 3WAGA 1VGQA 4F8JA 1GZ5A 2IUFA 2OXRA 1UKYA 1PK7A 4AFNA 2Z43A 2Q5QA 3PFNA 5BRAA 1P17A 1U7ZA 2XZPA 3G1TA 4E5NA 2AMJA 3DQPA 3HCWA 3LCJA 5H3LA 3TEJA 3V5NA 4BGEA 4DPLA 4BNDA 3BULA 4ZK2A 3GC6A 4PGAA 3TOXA 2ERXA 2X41A 3FRIA 5LMUB 4H3SA 2PS9A 3NVKI 3ETGA 2WSIA 4KWCA 2ODBA 1E3WB 2TMKA 5CHEA 4M0FA 4FS3A 1AK2A 4KSCA 5JSYA 1T9KA 2OZPA 4WGGA 3HI4A 1XCMA 5JLAA 4G5YA 1D1QA 2RI0A 4IDOA 5J5CA 1R8XA 4D74A 4ED9A 5FORA 3EQ7A 4ROSA 3DTNA 3OC0A 3VR5D 2V8BA 1W4RA 1U2SA 1ZITA 4GECA 4DYDA 4N9QA 3UJNA 5YASA 1UK9A 3IP5A 2BZSA 4IINA 3NYIA 3RU3A 3BTUA 2C7OA 3KJIA 2P8JA 2BZ1A 2YXDA 4P0QB 3T9AA 2W8BA 2ZREA 1NF9A 4QE3A 2ZRGA 4KFCA 1EU1A 5EQDA 3SNKA 4RJLA 3RODA 3VMMA 4MV5A 3OZEA 4GWGA 4W8GA 5B7GA 2ETVA 3D4OA 1QX4A 3GGOA 2EQ5A 1CJBA 1NUPA 2OMKA 2ZIWB 1QF9A 4IDFA 2CZCA 4ZVVA 3ZKWB 1GN8A 3HKBA 3VJLA 4C0XA 1IH8A 5FBQB 4DLXA 1JLKA 1AT1A 4G9EA 4UFOA 1NJSA 1IBLB 1QHHA 4MW7A 4PXYA 4BN0A 1BCSA 1OA1A 1XJ5A 4XCXA 3H87A 1TQDA 4A36A 2HKIA 3DBLA 3HRHA 5FOUA 5AW5A 3C6XA 4JSTA 1XZDA 2GXQA 3GA5A 2M6SA 4RYLA 4CT0A 5TJ9A 4AC9A 5IFLA 2CKMA 2W83A 4RZ3A 1WUYA 2HCBA 2JCBA 1MAUA 2CE7A 4XYEA 4CHTA 3GVIA 2ZULA 5JVDA 2ASEA 2FRXA 3NC0C 4PAOA 3MJEA 5AVKA 4N0PA 1ZGHA 1NT4A 1QYXA 5JXJA 5LOVB 4D9KA 4UE6A 2D1QA 5DSXA 4N12A 3KHSA 1Z0IA 2XWSA 1Q84A 3WYBA 4CKWA 1SJ9A 3EWSA 2ASVA 2UZ1A 3DS8A 3KVRA 1RQLA 4BJ5A 3G89A 2VH5R 1HOXA 2QR2A 4JSRA 2A67A 1CFJA 3D8SA 1U4OA 4UNNA 5DLPA 5LUAA 3ADPA 1VRWA 1O5TA 4G84A 3QPCA 2GRAA 4IGKA 3CU5A 3JU3A 1SHKA 2CVFA 4P83A 2R25B 4KXMA 4WERA 1BU5A 3HJBA 1LH0A 2JGMA 4AKHA 2H85A 3NBKA 4ASUD 5AVSA 2D1FA 3C7AA 3IUBA 3LHDA 1BMTA 1X39A 2CHQA 3QENA 4B74A 4WOPA 5FOQA 5K0LA 2J6HA 3FM9A 3B9PA 4XWOA 1OLXB 1EX6A 2H8GA 4WBXC 2IEGA 5FNVF 2IW1A 2O7RA 3USZA 2W00A 5BW5A 4YMLA 1C3XA 5IT5A 5KTTA 5LQCA 2Q0HA 1Z0DA 2HSWA 3I09A 3OQJA 1ZA2A 5KJEA 5ALYA 3K30A 3OWOA 4N4AA 2B83A 2WTXA 1DKPA 1SXGA 3SZMA 4IIJA 2IP4A 2Q2VA 3H5NA 3QITA 3GLVA 5BT8A 4OHBA 3GFSA 4QXOA 1YKSA 2PJDA 6PFKA 3GT7A 1QKJA 2GDZA 2Z4RA 3FUWA 2VJDA 4YACA 1GG9A 3G2OA 3T54A 2FUEA 3IC5A 5CCDA 2F59A 1N5OX 1Q20A 2PWZA 3IUMA 3CVVA 4N48A 4HV4A 1HH4A 1PL6A 1V3TA 2GX6A 3TFWA 4UVDA 5GADl 5CA0B 4IDQA 1Q7CA 3K9GA 4EOGA 3D0OA 5EZYB 3QKSA 3REOA 4IDHA 5A06A 1I13A 4Q3KA 4TLCA 3L5OA 3H5IA 2WFAA 5IVPA 2VNAA 5JW6A 3J81A 4X5OA 3I01M 5HSGA 3GH1A 3RRNA 1WEHA 4JQYA 2XUFA 1DEOA 2ZSDA 3EVCA 4JH0A 4AJ4A 6GPBA 1AC5A 1XL0A 1L8XA 1YS9A 1J2TA 4RK6A 1BGWA 5BW4A 3E53A 1CUBA 2OT3B 1I1HA 1EP9A 3RS7A 3N1UA 3CH7A 3VOTA 2X7JA 3H9UA 2O57A 3CLVA 5GZ1A 4TM7A 1BGVA 2NXNA 4GX0A 4YAWA 1E7MA 3WLAA 4M1MA 2QRHA 1Y9EA 1U7XA 2H3HA 2R47A 3L7IA 4L8WB 3TOVA 3VZCA 2BYTA 3FSRA 5E38A 1G42A 3E5NA 4IWXA 3MLEA 2YY7A 2GF9A 3ONNA 4YRCA 5AVJA 3NRCA 4G4IA 3NHUA 4HB0A 1VG9B 3GRPA 2UZAA 4FI3C 1YSCA 4UUQA 4DWVA 5DF1A 1BG6A 3IMEA 4TV9A 2AUTA 3WK8A 2DWCA 2HNBA 2EAUA 2RDMA 3CSDA 3DVRX 2H1OA 4Y6SA 3RTCA 2G8LA 2W2NA 4G0UA 2HWXA 3MT9A 2G6TA 2C5GA 2FWAA 2JFXA 3NHSA 4ALMA 1GUZA 3C4VA 5HE9A 4DZRA 3B70A 2R8YA 3KT6A 1CUJA 3PFIA 2GCOA 5A4DA 3IVCA 3Q1KA 1NBME 5JZOA 4U7PB 1CY6A 1YZVA 2D0OB 1D3AA 4RESA 1OE0A 1R16A 2YHIB 4Q1AA 2ZYGA 1TIKA 1PT5A 2NYUA 4KE6A 4MWCA 2B4KA 4PTZA 4AQDA 5LNK1 4GVPA 5JBNA 2ROQA 1DV2A 2ZIXB 2GJ9A 2RGRA 1ND5A 4G4JA 2EATA 5JATA 3QPBA 4DJFC 2IHNA 4IIVA 3BE8A 1P62B 2C9CA 4LIPD 4MSUA 1CQWA 1E89A 3ITKA 4LG1A 5F21A 5TQ0B 3BEOA 1NX6A 2QVYX 4IILA 3PT9A 3FFAA 3T3HA 2BMFA 2RAUA 2ID8A 3T12A 1ZJJA 1P73A 2IYLD 1UFVA 1E6LA 3OTIA 1SRQA 4N49A 2FDRA 1KJ9A 4KNWA 4ER3A 1ORRA 4TMXA 5FL7D 1PS8A 1QIGA 4Y6LA 1HE2A 1OYOA 1SBCA 2UVPA 1XZNA 1XWFA 4GO1A 5EXDA 4LHXA 3EDCA 1NBHA 1TZJA 2J4FA 3LKDA 2OAGA 4ZGGA 4D96A 3HFJA 4ZQHA 2W8ZA 3A2KA 1T35A 3EQ2A 3ILVA 1DFIA 1TEXA 4ZHQF 1KJQA 4KHZA 1VE7A 1A2KC 2PX4A 3FROA 3L0SA 2F1KA 3I6ZA 3NG1A 4MWSA 4XDGA 5KVSA 3U5TA 1SA0A 4HDNB 2XQIA 3AHCA 4K3UA 4CM8B 1DADA 4Z7OB 3DEAA 3I39X 2EBFX 2F8LA 4LSWA 4RZ2A 3GZNA 3SLKA 2V7TA 3D81A 3LLCA 3G3EA 1XTVA 1HTTA 2IBTA 3EUFA 3IQEA 4N5MA 1ISRA 1S9DA 3RFCA 2OCXA 5DCYA 3V8EA 3AIMA 2A0XA 3FR8A 1AMUA 3ND9A 1KNXA 3OQOA 1K06A 2VDNB 2JD1A 3D54D 3NP9A 2CGEA 3SVLA 5C7YA 1EK1A 3BKWA 1UBHS 3LYLA 1WMFA 4OMCA 1GY8A 4H6WA 4UVIA 1KSHA 4PANA 1G0NA 4QU0A 3LQFA 2FPRA 4DS3A 3PHJA 3UXMA 5AW4A 4MHSA 4JP1A 3MUEA 4A0HA 4JP8A 5EEHA 3G68A 5KOYA 2HPHA 1NXOA 4ZT5A 2A5JA 1R8QA 5LYJA 3T7SA 3K16A 3LQKA 5HQ3B 1RBYA 1U0LA 2Y0DA 3U44A 1AKMA 3UOWA 1Q7RA 2G5CA 2EBWA 2QRZA 3L0IB 5KKCA 3ZNOA 2YMMA 3VC2A 4V3CA 1J07A 1YUNA 5DYWA 3SFZA 2D0IA 3PFFA 1WULS 5CVUA 5DSTA 4B84A 4TZ0A 2UV8A 1PL7A 1GPH1 1TYBE 2YMLA 3UO8B 2L0XA 1M1ZA 1R4AA 2F2TA 4TOIA 4WK6A 2C94A 1PQYA 2W0MA 2R66A 1JP7A 1P74A 4UHCA 1M2GA 5HUJA 1JH9A 2PY6A 3FETA 2FX2A 9MHTA 4P4SB 2X3FA 4FCWA 2VHXA 4BAZA 3STYA 1G3IA 1AJEA 1SUCA 4CM4A 2IXTA 3G8DA 2ACWA 1NN1A 5ALMA 1DTSA 1HLGA 3A4LA 5L4LA 3SQXA 4EW1A 2XNKA 1JSCA 1OWNA 5BQ3A 4LGCA 2KYRA 2J4CA 4DR2B 4X90A 2P2LA 3FI9A 1T2VA 1FX0B 5FWYB 2FG5A 2G5GX 2OESA 3EN0A 1IN6A 2UUPA 4WKNA 3WLJA 1KI6B 5ABPA 4S1TA 4OG2A 3BWDD 2H9AA 2JHPA 2Y0CA 1TZCA 4IRXA 3S2IA 2ZJOA 3LZDA 4M8IA 4M6WA 4U3JA 2C2YA 1LV7A 1CE8A 4K0RA 4B43A 4QGHA 3QVUA 1YBAA 1SQ5A 2KBEA 3EGXB 3OSZA 4PW0A 2PIDA 4IYJA 5E2IA 4DJTA 1NN3A 4OJMX 2I6FA 1ODFA 3JTEA 4RXTA 1KO4A 1O97D 3VR6A 3R3JA 7ABPA 2E4YA 2GF2A 1GPYA 1B8PA 2XE6A 2Z5VA 1Y1RA 3E35A 1JJ7A 4K86A 2ZSUA 4RTJA 4X71A 1VSUA 2DZDA 1Z6QA 4IGIA 1DO0A 3H42B 1ATZA 4NMWA 4Z7QB 4XIGS 1J90A 2D1RA 3IJRA 4BFXA 3LH5A 4INZA 3BIWA 4BQRA 2GTPA 3HR8A 4UCQA 3PLNA 1TW3A 5E9JA 3GCGA 2C9BA 1JEEA 1AK1A 2AW3A 2OAEA 4J90A 2YMQA 2O7SA 5KQPA 4D8XA 3AL3A 3M5CA 1T91A 3GP3A 4EP1A 1PNVA 4JU9A 3R7LA 4BO2A 1JHDA 4JS0A 3IAS6 4RH3A 4EG1A 1E58A 2WUDA 4OXNA 5F3DA 3PZRA 2MIIA 2CF6A 3EVTA 2APJA 3ELYA 5IC4A 1GUYA 4YJHB 3I8OA 4MEJA 4ZQEA 3RAGA 4XGRA 3RK1A 1XGKA 5AKKA 5BSRA 2ZJAA 3AR4A 4JODA 3C3JA 3OKPA 4PXAA 4BB5A 4MUXA 5JAHA 1KEUA 3R7FA 3B38A 5J59A 2X2FA 3FCSB 4IKEA 3VPSA 4JD5A 5BMOA 3KB8A 1EM8A 2YUIA 1MO5A 2PGOA 4JJAA 4GAEA 4B9AA 1CP3A 4N3BA 4MW5A 4IV0A 2GYVA 3P9KA 3GRVA 2LD4A 2YDXA 3HGTA 2QDKA 3RTBA 2D1SA 3FCXA 3IIIA 2CJYA 5CVDA 2BHTA 3KKQA 3UJBA 4PO8A 1KORA 3EBOA 3MAJA 1G5IA 4MJLA 4YREA 4PIPA 1N9GA 3KXLA 1TM7E 4XCVA 3U4QB 2J46A 1Q22A 5LKAA 3CCFA 5I9MA 4N5DA 3A06A 5G02A 2B2NA 2AOUB 3V46A 4HNTA 8AT1A 2BIFA 2HEGA 3A58B 2O52A 3L8EA 5ER9A 5A62A 4DR5B 3L8GA 1EJ2A 3MERA 1HUQA 2X5KO 2WJIA 3IE1A 1WUIS 1OZGA 3VAZA 4CVNA 5TMBA 3W77A 4E4YA 1RAFA 5M34A 2REXB 2YQ4A 3S2GA 1JLSA 2I2DA 4JP3A 1P4AA 1KDZA 3ROZA 1ZVKA 1XF1A 1TYAE 5FA8A 2O1XA 3HCRA 1KBQA 1O5OA 4HFNA 1J5PA 4EY3A 4FPXA 4UNPA 2CL7X 4DXAA 1RU3A 1T3LA 4U7TB 2X23A 1KI1A 5FYQA 4U2GA 2R97A 2I9PA 4R84A 5DYNA 2XT6A 4HWPA 1LK5A 5AKYA 2ONCA 5IKPA 1XMXA 3WIUA 3NJ8A 5G0VA 1FP6A 3R8CA 3ENZA 5FUBA 1NXQA 1BFKA 2I65A 3EXIA 3IBGA 4YHBA 1WCIA 4HT3B 2B35A 5JAUA 4KBYA 3FRHA 5EIBC 3WB2A 2NADA 1K6MA 3MWYW 3UKOA 3IHTA 3CLRD 4JJKA 3PEYA 2AOXA 4BJHB 1JR6A 1SULA 1SCJA 2R8PA 5EE5B 4ZZ0A 4QYXA 4Z0HO 5EESA 3L0PA 2AJCA 4KMRA 5B1SA 3WNZA 3W2EA 4TTJA 2WVAA 2HN9A 5H02A 4EARA 3OM0A 2OQIA 1ZW6A 4KXNA 1MO2A 4URYR 5EE9A 5FADA 4NYIR 5I8WA 4AI6A 4C43A 3I4FA 1RWKA 1SUFA 3NHAA 2IPXA 4ZZ2A 1PF7E 4GQBA 4O4LB 2ZCUA 1DXQA 1XL1A 2ZJFA 4R4JA 3C6BA 4JVNA 1PJAA 4F3CA 2DPHA 2G67A 5AKHA 2ZE7A 1BA2A 2GN0A 2LZ0A 2VR1A 4TKUB 1EH5A 4PC3A 3KOUA 2GAOA 1QE5A 2HXSA 4P86A 4CF5A 3F96A 3MQ4A 1JQ5A 4CG3A 3GBSA 1I51A 4G65A 4C0AC 2GVZC 3SSNA 3GGPA 3ICCA 4LW8A 4FDLA 5ALFA 4I9GA 4DC9A 4KIGA 4XQCA 4ENWA 1BD4A 1BE8A 3N5CA 2R7KA 1SIWA 4NJEA 2RHRA 2Q07A 3WWYA 3N5KA 1CHDA 4WT7A 4Z51A 1WCYA 3UHFA 2QJFA 2KWIA 2WJZB 2PJRA 2QT1A 4GPAA 1DG1G 3HACA 1BW9A 1F2TA 2IOYA 1DKQA 5IK2A 1W1IA 3ABIA 4OLJA 2ZTHA 1OGJA 3IB3A 3GG9A 4KDRA 3TZ6A 5A4AA 1U5BB 2WWWA 5CK5A 5AJHA 2BY4A 4U5QA 4I66A 4QUKA 2ZUDA 3N87A 4IIGA 1S8AA 2IYOA 1BEEA 1CVIA 1NNI1 4MK4A 1AQ6A 4J1NA 5ALTA 1SHUX 2AJTA 1JJFA 2AZTA 3HB9A 4IHKA 4IFEA 1D03A 4IXNA 4LYFA 4XFJA 1MC8A 3DAGA 2BE9A 1QORA 1H4QA 4HYYA 3KLNA 1IBSA 1ZI8A 4QGBA 3DJFA 3K0KA 4WKPA 2GDJA 2JNWA 4D4IA 4A9AA 2GZSA 1GEGA 1TM4E 2GD6A 5JIBA 4FU0A 1S3IA 4K6KA 4RKWA 1IIRA 2BGUA 2QVBA 3FOZA 3L6EA 2P1DA 1N25A 4N82A 1YOVB 2EV9A 2DLCX 1B6RA 3MWEB 1P45A 1E5QA 3RNLA 4NCNA 4NCJA 2VZ8A 1DKLA 3ELWA 1RT9A 1SXJB 5EJIA 5FULA 4IDBA 1CDDA 5TARA 3VGJA 3VQTA 2F1JA 1DAGA 4A5OA 3TMAA 1K66A 5KWJA 1QO0D 1MEOA 3QLUC 4CV3A 1UJ4A 3KX2A 2JHAA 2NIPA 1P31A 3TZQA 5BNTA 2EJVA 3RQSA 2QRGA 4MLDA 1UOOA 2F4NA 3OZGA 4WFJA 4ANFA 1X86B 4TS9A 5BQ5A 4AS2A 5P21A 2GF0A 1XK6A 3C5CA 4CLDA 1NW7A 3EFEA 1N6OA 3IT2A 2GCPA 3V4ZA 1KYTA 4D9HA 4L27A 1VRVA 1R4MA 2AMYA 2FUG1 4LXQA 5DYTA 2DUWA 1Q12A 4X1KB 2Z8ZA 5IMSA 3MHPA 2CMKA 2RHLA 2GSWA 3RYIB 2MSCB 1A7AA 4FWIB 4E11A 1B42A 3S8YA 2QT9A 3LP6A 3K9NA 2AE1A 2W2LD 1Y6GA 4NZMA 3PVZA 1EDBA 3G0DA 3MCVA 1GPUA 4MR8B 1YZUA 2OORC 1ABEA 4GFDA 1PUIA 1H0HA 3D6VA 5CDFA 3VDQA 1BE6A 7MDHA 3V80A 4OQ4A 1GQRA 1Z5UA 3I83A 1RRFA 3UTDA 3ZV4A 2IU6A 1WUJS 5FBLB 1O6ZA 2A4MA 2FMIA 2IQ5A 4MPRA 4L2IB 1VG0B 4O33A 4AKEA 2PKQO 3FPLA 4K26A 4W8OA 3ZDRA 2HQOA 2QTNA 4R05A 4X9XA 4UBIA 9GPBA 1E94E 1MO6A 2NVUA 5HDQA 3HXMA 3ICWA 2B6HA 3SHOA 1U2PA 1E9RA 2JHFA 5DX1A 1XHFA 3ZS9A 1PGNA 4ZAYA 3S2EA 4QOIA 1LNZA 3CS3A 3OLXA 5LJLA 2QUJA 5EZ6B 3QFHA 1BHQ1 1KZ6A 1YS7A 4FEAA 1KY4A 5TS3A 4GPBA 2NWQA 3WKBA 2XNDD 2OCLA 2GBGA 2QNRA 2QTGA 1FFWA 4YMSA 3FTEA 5DHRA 4QU8A 5LD2B 3RANA 3QU4A 3ZHVA 3ISTA 3LZ6A 4YFVA 1DUSA 3GEIA 1YQ9A 2CXHA 1XN4A 2HXGA 4JOCA 4YBRA 3M9LA 1SC6A 3NHRA 4KTVE 1E0SA 2Q5CA 4AS3A 4RVSA 3ZWDA 1W47A 1Z13A 2O1WA 4PBSA 3C3AA 4BKOA 4ZOQI 4MW2A 1H5UA 3VNQA 1KJJA 3AVOA 4LJKA 2OO7A 4WXHA 4DG8A 5BR4A 3FNGA <