1WVGA

Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
356
structure length
352
Chain Sequence
SIDKNFWQGKRVFVTGHTGFKGSWLSLWLTEMGAIVKGYALDAPTVPSLFEIVRLNDLMESHIGDIRDFEKLRSSIAEFKPEIVFHMAAQPLVRLSYEQPIKTYSTNVMGTVHLLETVKQVGNIKAVVNITSDKCYDNREWVWGYRENEPMGGYDPYSNSKGCAELVASAFRNSFFNPANYEQHGVGLASVRAGNVIGGGDWAKDRLIPDILRSFENNQQVIIRNPYSIRPWQHVLEPLSGYIVVAQRLYTEGAKFSEGWNFGPRDEDAKTVEFIVDKMVTLWGDDASWLLDPHEAHYLKLDCSKANMQLGWHPRWGLTETLSRIVKWHKAWIRGEDMLICSKREISDYMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDP-glucose 4,6-dehydratase
publication title Structure of CDP-D-glucose 4,6-dehydratase from Salmonella typhi complexed with CDP-D-xylose.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 135
structure length 352
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.1.45: CDP-glucose 4,6-dehydratase.
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wvgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1wvgA02
3KSZO 2EV9A 2W4QA 2OGUA 3IKTA 2YHIA 3JQ9A 4AJPA 3DZIA 3GOHA 2AQKA 4X54A 3W1VA 1DHRA 4M87A 1NQ5A 1V3VA 1W73A 2HMSA 5HTOA 1T1RA 2AEJA 3I9KA 4E12A 3GAFA 3JQ6A 4E33A 1NASA 4BB5A 5EMHA 4D45A 1DIAA 1UZMA 4BKOA 3R3SA 2VWGA 3OECA 4ZHSA 3ST7A 3WXBA 3I52A 4B7CA 2JL1A 3C7DB 4IDFA 4E5KA 3OICA 4BMSA 3ETDA 3OBBA 2C5EA 1WAMA 2DKNA 5EESA 5GZ1A 2BHLA 3GGPA 3NKLA 4CV1A 2H5LA 4RVHA 1E1LA 4CLOB 1DDOA 1YL7A 3UW3A 5L7YA 3RBZA 1ZNQO 4YPOA 3BA1A 1A9YA 3GVIA 2VRBA 3I9LA 4YJFB 4YWJA 4INAA 5FEUA 1JQBA 2BRUA 1NQAO 1EQUA 1QLHA 1YH3A 2UUOA 1PIWA 2DLDA 1ENYA 2JAHA 1R0LA 1T1SA 1PZEA 4N5NA 4FIZA 1NFFA 3AM3A 1BWSA 1H5QA 3DR3A 4MVJM 3INGA 4E30A 4RF3A 4YJGA 5EERA 1GR0A 3BMOB 3K9QO 4CLHA 4BO5A 4N5LA 4YRBA 1N7GA 4ALIA 4RZHA 1ZSVA 1I2ZA 3DL2A 3UVEA 3EW7A 3NYWA 1DIRA 2V6BA 2Y1DA 4AVYA 2YYYA 4PG7A 1PZGA 4S1VA 1XQ6A 2FZEA 1E3JA 1WDMA 5G0UA 1PJ3A 4YT5A 2X5OA 4E3ZA 1LEHA 2IE0A 5ILOA 5I7SA 3ZWVA 4YVFA 5DULA 2O50A 4ZQEA 2WDZA 4CM6A 4GSKA 2HCTA 2O3TA 3IJPA 4R41A 3DHNA 3KHUA 3WGHA 3INTA 4XIYA 2B5VA 1NM5A 3ZZNA 3IMFA 3U09A 1R4MA 5A4DA 3FPCA 1B8VA 1JKFA 4BKQA 2EF1A 4NFSA 2R6JA 3PHGA 2OFPA 1T2EA 3UFXA 4D79A 1RJWA 3EYWA 1J6UA 1B15A 2X0IA 2ZK7A 5L51A 3EMKA 3W4IA 2CDAA 3H9GA 4GBJA 3RVDA 2AQ8A 4JJIA 2YUTA 3WWZA 4RF4A 3NT4A 2PGDA 1Y7TA 4GQAA 3TZCA 1TVEA 3ZWMA 1EFLA 3ZU2A 1FDTA 4OMUA 2BLLA 4BO2A 4CM9D 2P4HX 4RCVA 3GR6A 1EE9A 4PCVA 1Y6JA 2YFQA 3G79A 3H9JA 3RAJA 4BHTA 4PG8A 1H9BA 4ND2A 4W7HA 1VL0A 2VHZA 4CLEA 3I83A 3BHMA 4IZHA 2NU7A 4KQXA 3O38A 1MXHA 4HNGA 1I36A 4JJGA 2PKQP 5TNXA 4I08A 5JO9A 2AG8A 4R16A 5ILGA 3WMWA 2I6TA 4P4LA 4OXYA 1NTOA 3TZQA 3LLVA 1E7QA 4QEDA 5JDIC 4BNXA 4GX5A 4RLHA 4YJHA 4FFOA 4ZQHA 2NVBA 5JSFA 1JU9A 4QSMA 4B79A 2R00C 1B7GO 1U3UA 4IDGA 4CMJA 2D5AA 4NBTA 3X2EA 5L3ZA 2ZQZA 1DJNA 2Y0EA 2G82A 3I1JA 3I3OA 4XDZA 1IZ0A 4DC1A 1GEEA 3EAGA 4KP7A 1QRRA 1N2SA 4I9UA 4NBRA 3ASUA 4G5HA 2CY0A 3OJ0A 3VTFA 3L77A 3A14A 1NVGA 4CMCA 4CV0A 4N7RA 1QXSA 1K0UA 2FZWA 1DSSG 3LLSA 1UAYA 1HF3A 4MVJG 4GPD1 1ZK0A 4I5FA 1LDYA 1EDZA 4R9SA 4J16A 3WYBA 2CMDA 3DMYA 3OQBA 5FI5A 2IEBA 3GAZA 4GL4A 4BO1A 1YB5A 2HO5A 4TZKA 2JCVA 4NU5A 3HSKA 2FWMX 5TC4A 1EVZA 1E92A 4CM1A 1DFIA 1X14A 1Q0QA 1R15A 1SO8A 1U7HA 4KDEA 1PS9A 2AE1A 3A28A 3PHJA 4M8SA 1CIVA 1GPDG 2EKQA 4E0BA 3U49A 3GNTA 4ALMA 4DL9A 3BTOA 4E4YA 5JBIA 1A9ZA 2DBQA 4E2XA 1ZFNA 3UN1A 4DQUA 1U3TA 4LSWA 1IOLA 5J23A 4HV4A 3M1AA 3WJAA 3ZHXA 1HYEA 3HNPA 1YBMA 3LVFO 1OC2A 3OJEA 4EUEA 3Q2KA 1GPJA 2X9NA 2C20A 3WQRA 1GY8A 2AEMA 4CQMA 3MCVA 4OM8A 4L0QA 4L76A 5EIOA 1DIHA 3OEWA 2OZPA 4NZ9A 3QJ5A 4EGFA 2HJRA 2HRZA 2D59A 2IEDA 1CQIA 2PTGA 4DIFA 1ULSA 4BGVA 4PVCA 4BNIA 4UEKA 3IOYA 1OAAA 4YAIA 1IPEA 2EERA 1LDGA 3HDHA 1DPGA 5JDIA 2V6FA 4Z0HO 2PKRA 3JYOA 1UXKA 1E6WA 1FXSA 2R00A 2D3TA 1A5ZA 1NFRA 2J5RA 2ZTVA 1I3MA 1UUFA 4JP2A 3B70A 4BNUA 2H1SA 1XQ1A 3DZJA 4OKIA 4OXNA 1YL6A 1G0OA 9LDTA 3FNFA 4O5OA 5AXBA 3UICA 2DUWA 5IAAA 5ER9A 3RI3A 4BOYA 3TDKA 5IFLA 1PQPA 1M67A 1XGKA 1E5QA 1VE9A 3F9IA 5JMPA 3KO8A 4MVJA 4BNKA 4CMKA 1KEUA 1HDCA 4JBGA 4PLPA 4BO3A 2GR9A 2PZKA 3ON5A 4J7XA 4BIIA 4L4RA 2D2IA 4XQ9A 4Q9NA 1KETA 4FFLA 3T4EA 3IP3A 3PDUA 4FFPA 1MB4A 2J5QA 1MFZA 3MJ4A 2FP4A 5TT0A 4BO0A 3NJ4A 4ILKA 4EEXA 1H6DA 4P4GA 5DOVA 1Q0HA 4MVJI 4DIBA 2A9FA 3PGXA 1RKXA 3DONA 1KC1A 1VPDA 3RFXA 4EUFA 2PLAA 3CE6A 5IXSA 4J1SA 5A04A 1MC5A 4YAGA 1GFSA 2O48X 5JXWA 4B7UA 3MJVA 3RUAA 4CM4A 4YQYA 1DC3A 5G4LA 2OBYA 3BTSA 4S3MA 2NU6A 3KBOA 1C0IA 4PFJA 3W4KA 3T7EA 2PZJA 1Q2XA 4LW8A 4MJLA 4CUZA 4PLWA 1H9AA 1R12A 3PJGA 1ONOA 4RPHA 3VH3A 3NUGA 2Y1CA 3IC5A 1XIVA 4OL9A 4J0FA 8LDHA 1N1GA 1D8AA 2DC1A 1BG6A 3EVNA 1VRWA 1VJ1A 3HJAA 3E9QA 3FF4A 4RVUA 2GUGA 2JD1A 3GDOA 4FBGA 3BTUA 1PJQA 2YQ4A 5GMOA 4FFNA 3WFIA 2HMUA 3EK2A 3GPIA 1PJLA 4NR0A 1SB8A 1P9LA 2DM6A 1CRWG 4D43A 1HZJA 5CG1A 1BVUA 3BYZA 2VQ3A 3GFBA 2QQ5A 5A3VA 1P3DA 2NWQA 3GA0A 4B7XA 1EVIA 3D5TA 1PL8A 4I5DA 2PWZA 3F1KA 4H16A 2JJYA 1UJMA 3UH1A 3MJEA 1KEWA 1DLIA 3KYCA 4GKVA 3ADPA 3DOCA 5ITWA 2V65A 1HSOA 4NBWA 3OETA 5B4VA 5B12A 1A72A 4HP8A 1U4OA 2DPHA 5ES3A 2CFCA 1JVBA 2BI7A 3OH8A 5KOIA 3ABIA 4O0LA 4BGEA 4CMAA 3AU8A 3DBHA 2EG9A 1EMDA 1VJ0A 3RUIA 3PDJA 1OFGA 5CFZA 4Y67A 1LI4A 3TJRA 3AFMA 3N74A 1PJ4A 1L1FA 2IXAA 3VZQA 2P9GA 2Q99A 1VC2A 2X0RA 5DP2A 4M89A 1PJCA 2VNAA 4CV2A 1NHGA 2B36A 4LGVA 4NQZA 5TF4A 5T67A 2O7QA 1AHIA 1N7HA 3NGLA 3EHEA 3H8VA 4ZJUA 4NHEA 1X0VA 4FSHA 4II3A 2JD0A 2AG5A 2GPTA 3AU9A 3G0OA 5F1PA 3TWOA 3WX0A 4NH4A 5KJFA 2WEKA 1BXGA 2Q45A 1GZ4A 3DC2A 3KSDO 3HN7A 5KVSA 3RC7A 3BHJA 5DCUA 1V0JA 1N1EA 4Z6KA 3WDSA 1X1EA 1VLLA 3FWZA 2Y0CA 2QG4A 3DOJA 5HM8A 6ADHA 1PJTA 4IUYA 1EUDA 4CQMD 3JQ8A 2BFOA 3PWZA 1T4BA 2B5WA 5THKA 1PR9A 1WDLA 3DBRA 3HWRA 3RASA 4YDRA 4QUKA 3GMDA 5IZ4A 5TJ9A 2B83A 1GQQA 2QRJA 4YTEA 3I4FA 2E82A 4CQMB 4MVJE 5ICMA 2VOEA 5BSHA 5I8WA 1P1HA 4Q3NA 1SOWA 1WMAA 4WLUA 5B37A 2G76A 4JROA 4J43A 5DBIA 4RPGA 3GRKA 4EJMA 4WKGA 1HEUA 1CJCA 3WJ7A 4HFMA 1EUZA 1H6BA 1RPNA 4F6LA 4YYZA 3JTMA 4DA9A 3TF5A 3DZGA 4C7KA 4M54A 2XOXA 1I33A 1V3UA 1U5AA 4PVDA 1U4SA 3PEFA 1H6CA 3RC1A 3PFWO 3F5SA 3WYCA 3RUDA 1XG5A 5C7IO 3WBFA 3EY4A 1AGNA 5TRTA 3ORFA 4UVHA 3DZHA 4Q3BA 4WJZA 4NMHA 3ZWYA 3ZNOA 1PR3A 3KTDA 2EWMA 4HFJA 4IXWA 4G2NA 1DFGA 4DUPA 4YJFA 4XWYA 2RH8A 3DAFA 3RUCA 5DCWA 5EPOA 5C37A 1WVGA 3GZNA 3HG7A 4FC6A 4RGBA 4IDEA 2NTJA 1KEVA 4DPKA 1ISMA 1CYDA 2PD3A 3ZWXA 4KUHA 1RM0A 3F5QA 5A9SA 1QYCA 4CMBA 2X22A 3QRWA 3JQCA 1QLJA 1W4ZA 3OM9A 4IXTA 4F3YA 1P45A 2OO5A 1W6UA 4FR5A 2O2YA 3K73O 3L4BC 2J8ZA 3TL3A 1UXGA 4IS3A 3AFNA 4L74A 3A9WA 4URFA 2WD7A 5EQFA 2HMTA 1F0YA 2ZJ1A 4WPGA 3QVWA 2VWPA 1E7WA 4G65A 1E3SA 3RIHA 4R69A 4M86A 1IYZA 5BSEA 5CDGA 3FNHA 3VKVA 3Q0EA 2Y66A 4XZ3A 2Q46A 1BSVA 4CM4B 3GVXA 1NVMB 1ZJZA 1B8UA 1ZO8A 4PG4A 3CZRA 5IN5A 1ZZEA 1YKFA 2RIRA 3ITKA 1H2BA 2QHXA 3G17A 3IUPA 4TROA 4BS9A 3JQ9C 1XEAA 3NEPX 3OFSA 2I5PO 3H5AA 2YFHA 3WS7A 2PFGA 4GVLA 2IYPA 2A92A 1JAYA 1GYQA 2ZB4A 3PIDA 4RDIA 2D4AA 1EVJA 4ZQFA 1ENOA 3P7MA 1X0XA 5T8KC 4AJNA 1V9LA 1ZW1A 4L9RA 2GD1O 3WNVA 5KCZA 4JLWA 3CEAA 3OJLA 4RLSA 3SJUA 2F1KA 8ADHA 2I67A 2Q1UA 1PL7A 3W8EA 3KYCB 3B6ZA 2W2KB 3ZWCA 4EITA 1T24A 4Z3KA 1KS9A 1GZ3A 4H7PA 4XQGA 2E6UX 2PD6A 3KB6A 1P0FA 2AE2A 5CP8A 3KVOA 2NTVA 5CEEA 2HKIA 4DTIA 1LSUA 4K6CA 4QX6A 4D44A 3JD0A 4D46A 3ZV4A 3V1TC 4AJHA 1LJ8A 1D7OA 3VPSA 3I9MA 2HQ1A 2C2XA 1FMCA 3VDRA 3V1YA 3BAZA 3C1TA 3WWYA 1IUKA 1YQXA 3QVSA 1U3WA 3C24A 2Y1FA 5KIAA 1ISGA 2HLPA 4MP3A 4UUOA 5ADHA 2X23A 3BIOA 4NDNE 4IDBA 5ENVA 3AJRA 3JQBC 4F6CA 3IS3A 2NVWA 3F46A 1VL8A 2X0JA 4GKBA 3PI7A 4J9VA 1JA9A 4A10A 1CWUA 2ILTA 2B0JA 2B69A 5U1PA 4YAEA 2JKVA 1M6HA 3T4XA 1BXGB 4JJFA 5IZCC 3ENKA 3PFFA 1EUCA 3JYQA 4XQEA 1Q0LA 1FK8A 3WG9A 1YO6A 4FJ2A 3X2FA 2NM0A 2YV1A 1K6XA 2NTNA 3E1KA 2HMVA 3FN4A 4Z9XA 5KJ1A 2GZ1A 2NACA 3DO5A 1U5CA 4WASA 4XDYA 3WGZA 2D8AA 3OJFA 3DTTA 2QIOA 3H6KA 4ZRMA 1UDBA 3U0BA 1TB4A 1E0DA 1EK6A 4L75A 5CDTA 1IPFA 3E18A 4CPDA 4Q39A 1XELA 3TRIA 4MP6A 2DTXA 2IXBA 4XYEA 3AOEC 1GQYA 3GPDG 3WSVA 2AEFA 2NQTA 4RVDA 5T8KA 5A1TA 4ND5A 2DTDA 1DC5A 4MVJH 3DBLB 1BW9B 3RJ5A 2EW8A 2DPGA 3ZI0A 4GMFA 1LX6A 2G0TA 3Q9NA 2A4KA 2YY7A 5CHEA 1ADCA 3S8MA 1T2CA 3QIVA 4A03A 5COBA 1UXIA 2H9IA 4WECA 3UCXA 4RPLA 4CUKA 1EE2A 5H82A 2HK9A 4H3VA 1E7SA 4OKNA 3TOXA 1LA2A 1LUAA 5TX7A 3ZGYA 1WZEA 5JY6A 3K30A 3KZVA 3CZMA 2YZ7A 3ZWPA 4B8ZA 1H6AA 3H3JA 2UUPA 2HK7A 2YDYA 3GDGA 1I01A 1XKQA 2ZYGA 3LF1A 5DDIP 4JXKA 3SXPA 4D0RA 3GZNB 5JMWA 2PK3A 1K6IA 4M55A 1ZXBA 3HHPA 1UR5A 3L07A 4KTVE 2Y1GA 1SNYA 4U0KA 2JHGA 3BMCA 5A9SB 4YT8A 1ORRA 3D0OA 3PQEA 4CR8A 5MGBA 1LDNA 1PTJA 3U4HA 3V1UA 3M2TA 1DIGA 1ZH8A 4E21A 3UOGA 4FPXA 2B4QA 3JQBA 2WYVA 2CF6A 3GN1A 5KTKA 1QYXA 3L9XA 3VKUA 2PKQO 4R3WA 2CD9A 3DEYX 3W4JA 1HRDA 1PGPA 2EP7A 2WD7B 3TL2A 3NT5A 1HT0A 3A1NA 2FSVA 5IZCA 1Y81A 2VN8A 1LDMA 4CL8A 3EZLA 5THQA 3RKRA 1FDUA 3H2SA 1CF2O 3QP9A 4RORA 4MVJP 2I99A 1A27A 4OOFA 1MA0A 5T57A 1QG6A 2BD0A 1S7CA 4JBHA 4DLLA 1KY4A 5JAZA 1R16A 3ZHZA 2W2LA 3DDNA 1I8TA 1D1TA 3GUYA 4A7PA 3ZWOA 1NQTA 1JWAB 1IHXA 2Z95A 1E6UA 3QA9A 2Y99A 5C7OO 4IJUA 5DT9A 1ADBA 3VPXA 3AOEA 4NK5A 1PL6A 1VKNA 3WTCA 3KLPX 4A0SA 3RFVA 5IDWA 1BTOA 1MGOA 2X5JO 3PYXA 4IS2A 2ZTLA 5JCXA 1E1KA 4PLYA 5A5EA 4J1NA 3GEDA 1A7KA 3OP4A 3M1LA 4J6FA 1Z7EA 3K92A 4KQWA 3KLMX 4QT0A 4LK3A 3AM5A 1Y9AA 2GN8A 4NI5A 3I6IA 4PRLA 1C3VA 5L4LA 4CLXA 4WE3A 3F1LA 1GQ2A 1YVEI 2VHWA 1M6WA 3QVTA 3JQAA 5JDCA 1I3LA 1XU7A 4D3FA 1ZMOA 2IZZA 4BL5A 3GY0A 4WCFB 3UF0A 3NDJA 2O23A 2VHXA 3PQDA 3R3JA 4DQVA 3IJRA 2BKAA 2C2YA 1QORA 2WD8A 1PJ2A 1B14A 3Q3CA 4NFHA 3WSWA 4XD2A 4BKRA 4DPLA 2CDBA 2Y67A 4O6VA 4RF2A 5BQFA 4QFDA 3AUTA 3H9EO 5KVCA 2PY6A 3JQEA 3RJ9A 3RBXA 1J49A 2X58A 3RUEA 1C0LA 4CUJA 3UCFA 1N5DA 3GFGA 3EDMA 1HZZA 3ZH2A 5K6AA 1NBOA 3EZYA 2J3JA 4P38A 1K3TA 3P2OA 3K96A 5EN4A 2CSUA 4MDHA 3FR7A 3BXXA 3FBTA 5BNFA 3QY9A 1E3IA 2I66A 3SVTA 4DLAA 1FDWA 3Q2IA 1GV1A 4YEDA 3ANMA 1Z75A 5COAA 4IPTA 1Q7GA 5IXYA 3QE3A 1XSEA 4AJ2A 5BSFA 1B3RA 1UDAA 4NFYA 5TIIA 1Z45A 2DVMA 5EINA 4B3IA 2AHRA 2VYND 5G0VA 3ZN2A 2BGLA 5F1KA 3HFSA 2VNSA 2QX7A 3IDSA 3K2BA 3DFZA 3O03A 3MWEB 3WGIA 1ISJA 2OP0A 5KJ6A 3MEQA 1IY8A 4EJ6A 1B16A 4RV9A 1DEHA 2FR8A 4QECA 4WLNA 3IKVA 4ESOA 3RD5A 3SEFA 3I4CA 4JCOA 4ZU3A 4CMEA 4XKJA 5L45A 4TWRA 4IBOA 2V6GA 5T5QA 2TMGA 1ONPA 4GGPA 1G6KA 3ULKA 2CVZA 2ZB8A 3WIDA 3NJ8A 1T4DA 3PHIA 1O8CA 2WM3A 4AICA 1JKJA 1E77A 1C0KA 2EXXA 1BDBA 3GC6A 2YV2A 4W99A 2ZTMA 1BGVA 1GUYA 4XGKA 3F6YA 2V6MA 3C85A 5DBFA 5GY7A 4DGSA 4XB1A 3MTJA 3JD1A 4ROSA 3JV7A 1I0ZA 1HDGO 1UP6A 4LN1A 5JAMA 2E49A 3PP8A 4YQZA 3PGJA 4Y6PA 4DBVO 3AWDA 1RYDA 1QYVA 3COSA 5JAQA 1V35A 2EGHA 2ZYDA 3TFQA 4BKUA 2QW8A 2BMAA 4PIVA 4UVGA 3AY3A 3VPGA 5H83A 1OC4A 1Z6ZA 2C7VA 4B4VA 4TVBA 1Y1PA 3N7UA 4O59O 4Z0TA 3UKOA 1JN0A 3F3SA 1GCOA 1AN9A 4XCVA 3WBBA 3PZBA 3GK3A 1MG0A 2Y93A 1YQDA 4JQCA 3HB5X 1LSOA 2CF5A 2UV8A 3F4BA 3GQVA 4R1NA 3AOGA 3H9UA 3TZHA 5F5LA 4LCJA 1I32A 1O89A 1FDSA 4FC7A 2I3GA 3IAHA 4BNMA 1LNQA 3BMCB 1U8FO 5I8ZA 1GYRA 2IZ1A 1I24A 3FHLA 4QQRA 4U5QA 1ZMTA 3AI1A 4Q3DA 3U9LA 3WLEA 3DHYA 3VPFA 1TEHA 1NVTA 3KRTA 4MIEA 4B3JA 3DZFA 1T26A 4PLVA 1ZSYA 3GHHA 3KYBA 3PYMA 4IIUA 3CKYA 2PZLA 4IQ8A 2C54A 3RCBA 4R1TA 3DXFA 5FYDA 3OF2A 2Q49A 5CDUA 2I9PA 1JKIA 1KERA 4MKXA 2I3AA 5FWNA 1U8XX 2DTEA 3JSAA 5T64A 4TRJA 5IDQA 1XA0A 3GNSA 4PZDA 2WJPA 5CPFA 1DRWA 3DB2A 1ONNA 1HWYA 1EQ2A 2P5YA 4N54A 2W2LD 2NU8A 2YQ5A 1X7DA 1LSSA 1NPTO 2J3IA 4PRKA 4XB2A 3DHEA 3W8DA 1HE5A 2HK8A 4LRTB 4U6SA 4MO2A 2GN6A 2ZCUA 4PZCA 3WGGA 5AXAA 4J7CA 5CDSA 3HUDA 1O94A 3RQSA 1ZVMA 2EGGA 5L40A 1HDYA 4PN3A 1BRMA 1ZCJA 1BHSA 2ZB7A 3GGGA 4CMGA 3RC2A 2WMDA 3C7AA 2HUNA 1U7TA 2VHVA 2RAFA 3JQAD 3HQ4O 1QV7A 3GEGA 3QSGA 4UVIA 3RUHA 2AMFA 1E5LA 2ZJ0A 3L4SO 4J4TA 5TJHA 4JP3A 5KVVA 1N8KA 2PH3A 2P91A 1DC6A 1K89A 1HDXA 2QYSA 4D41A 3D5QA 3WOHA 1TA4A 2P4QA 3JQAB 4IMRA 3L6OO 2GERA 2DU8A 3WMXA 5HRUA 3K6JA 4D3DA 4AJJA 1Y8QB 4UULA 2PH5A 3OQ1A 3S1LA 3VZSA 1J5PA 1L7DA 5G4KB 3ZV3A 3GGOA 4IM7A 2PV7A 2BELA 3BZUA 1L7EA 1PQUA 2B35A 3GDFA 1PQWA 4CODB 2AXQA 1O5IA 3D64A 4U6QA 2W2KA 3AM4A 1N9GA 4LVUA 4P8RA 4Z9FA 4Z0PA 5F3RA 5U4QA 4BGIA 2ET6A 1O0SA 1P1RA 3HZZA 3TZ6A 3Q6IA 4Y9DA 2X0NA 4EZBA 3H3FA 2VZ0A 3KSUA 1MFPA 3JD4A 3LZ6A 1LTHR 2LDXA 4L4SA 1GUFA 3QW2A 4ID9A 4UREA 3LSYA 3JYLA 1MP0A 3C1AA 3DBVO 4D7AA 1AXEA 3FNEA 4UUMA 3VHRA 4DVJA 1EK5A 2E37A 1I10A 1T2AA 1U1IA 3HN2A 3C7CB 1JWBB 4AL4A 2HMWA 4EJ0A 4J4BA 1E6EA 4YACA 5LCXA 4J9UE 4DWVA 4HY3A 5I7FA 1MG5A 3LT1A 4JGBA 1V6AA 3KEOA 1ZEJA 2JAPA 3BMNA 3OQ6A 4R3NA 3UGKA 5CDYA 4BO6A 3ZNQA 3KV3O 4H15A 5TS3A 4BGUA 4LMRA 4FB5A 1WLYA 3ONDA 3KOUA 4MP8A 1SZJG 4W7IA 4A73A 4W9NC 3ASVA 5DZSA 1I3KA 1LLUA 4I9HA 2UAGA 1YXMA 4I5EA 4O63O 1Z7BA 1PGOA 4IY1A 4LMPA 4IJKA 4AJEA 2EIHA 2EKLA 5AXDA 1V8BA 1YGYA 4XRGA 1U2DA 2EEZA 3PVZA 5MDHA 2X1HA 2FR1A 3G1TA 1SEPA 4P22A 1UH5A 1EVYA 1GAEO 2FHSA 4NJOA 1C0PA 2Q3EA 4FQ8A 4MKZA 3RU9A 5B4UA 5I7VA 5HA5A 3JQ7A 3SJ7A 3ICPA 4B4OA 4IIVA 1WWKA 4RO0A 4AJ1A 3PQFA 4JN6B 1NAHA 2J5KA 1YBAA 3TQHA 2G1UA 1VSUA 3DBLA 1BW9A 4MPDA 3EVTA 4NG5A 1Y9EA 1ZSNA 3LT4A 4U8GA 4YCAA 3GVPA 1NFQA 1LC3A 4GMGA 4J90A 3DMTA 2UYYA 3HDQA 5ENDA 4N5MA 4CJXA 5IF3A 3KETA 3KUXA 4IDAA 2O3RA 3INRA 3ROMA 3SBOA 4BNLA 4BNGA 4CLRA 4E31A 1B3BA 1HXHA 4FD3A 3ZWBA 1EEHA 2HDHA 1W0CA 4WCFC 1P1KA 1I2CA 2W90A 4BO4A 2OMEA 1MLDA 4FGSA 4YRAA 3DWFA 1SB9A 4YA6A 1P33A 2OHXA 2XXBA 2VUTA 3VVCA 3AI2A 4E5YA 4CL3A 2NNLD 2VT2A 1HDRA 5FI3A 4P4NA 1ENPA 4K9DA 4OH1A 3QLJA 4AJLA 2D1YA 4XA8A 1J0XO 3VH1A 1NPDA 5L9AA 2YHUA 4QTZA 3LC7O 2X9GA 3LF2A 2WYWA 3JD3A 1PGQA 1H2HA 4RF5A 4BNJA 3E48A 3QWAA 1VSVA 3D4PA 1YE3A 2VHYA 1Z82A 2OL4A 3GT0A 4W9NA 4IQGA 1IE3A 4JX8A 5AQ1A 3D3WA 2FPIA 2GRAA 4NBVA 4CR7A 1BDMA 3S2IA 1EBFA 3BMQA 1ULUA 5BNIA 1E7MA 4IJVA 4AJKA 3E9MA 1T2DA 1NR7A 1PGJA 1Z74A 3WNQA 4I5GA 5JPIA 3VPHA 4GI2A 4QO8A 4MINA 4RJTA 1YJ8A 2EW2A 1ENZA 1SOVA 4R5MA 1F17A 3WLFA 4CQLA 3FBGA 1C1XB 2P9CA 3RWBA 3B1FA 2RHCA 1RM4A 4O1MA 4HXYA 4OSOA 1TT7A 3C1OA 2J6IA 3JCZA 3ONEA 5TT1A 3HFGA 1IHYA 1YONA 2FPGA 1KOLA 5HBRA 4Y6RA 1P1JA 2Q2QA 3GUCA 3OIFA 2CZCA 2POQX 1N9GB 2A94A 3K5PA 1NP3A 1HE2A 3M2PA 4AJIA 1IULA 1E3LA 1ZK2A 2JFFA 3H65A 4WEQA 5HS6A 3KEQA 4GAEA 4YRDA 4WCFA 1EZ4A 4TRMA 3ANNA 5IDYA 1X1TA 1LDEA 1Y8RB 2FPPA 1X15A 2CUKA 3DAGA 4KOAA 2B4TO 3SC6A 4CM3A 5L53A 3C8MA 5CEJA 4BQRA 3E9NA 5KKCA 1HYHA 1QKIA 1KVQA 1KYQA 2ZQYA 4A26A 1OOEA 3PPIA 4FOOA 4GX0A 4OIMA 1GDHA 3BHIA 4DMLA 1Q7CA 4E32A 1I2BA 3R1IA 5JS6A 2QZZA 3CMMA 4OXKA 3V2HA 4HFNA 1U3VA 3BMNB 4RQUA 5KVQA 4GX2A 4I1IA 5DCYA 1ADGA 1JAXA 1CETA 1HDZA 2PR2A 3RKUA 4BNTA 4KWIA 2Q4BA 4WUVA 2WTBA 1E3EA 1PWXA 2NV6A 1GD1O 4MVJF 2DAPA 1X7HA 1M76A 4YBZA 4BV9A 2PZMA 1EFKA 2FMUA 4RVSA 5JAIA 4BQPA 3E5RA 2WWRA 2NQ8A 4W82A 2X4GA 4YXFA 3S2GA 3FCOA 4KUEA 3NV9A 4CR6A 1TLTA 2VYNA 4IGEA 1F12A 1ZBQA 3PWKA 1HETA 1XHLA 3E03A 4R5HA 5FFFA 4ND4A 1H93A 4M1QA 1LDBA 4FGWA 3JQ7B 5T6BA 4R4JA 1OMOA 1VI2A 5TGDA 1X7GA 2EJWA 4NBUA 2P9EA 3ENNA 4BNWA 4D3SA 1UXHA 4ND1A 1TT5B 1KVSA 4LCEA 2WE7A 3WQSB 2NUAA 3K2EA 4EBFA 3EGOA 3ROPA 1T25A 5JC8A 3TN7A 2JFGA 2IDZA 1VM6A 3L6EA 3GVHA 4NK4A 4BV8A 4RPJA 3MOIA 4Y6SA 1WP4A 4XRRA 4YB8A 2Y05A 3WIEA 3NX4A 1SMKA 2PNFA 3JYPA 2P2SA 3PLRA 2FY8A 2NLOA 1E1NA 5JW6A 2FSSA 2O3QA 4DBZA 5JDCC 4CLRB 4OQZA 1FDVA 1TI7A 2ZTUA 4BO9A 4NIMA 3O26A 4KTTE 4BNZA 1LQTA 1SAYA 4FDAA 4TMFA 4GLLA 1KC3A 1ZK4A 4DPMA 1DC4A 3MWDB 3WGQA 1EDOA 3PZRA 3IP1A 2GZ3A 4AJ4A 2E48A 1G0NA 4RL6A 2ZYAA 2YW9A 1M75A 1KVTA 4MKRA 1PWZA 3E82A 3WFJA 5JYEA 1PSDA 2VYVA 1K2WA 1DIBA 2Q1SA 4PLHA 5K6AC 4DYDA 4R1UA 5LDHA 3DZKA 1DAPA 2UVDA 2O2SA 5AOVA 1V3TA 2J3HA 2VRCA 2RH4A 5F1OA 3S2EA 3ZU4A 3STHA 3OEYA 1R37A 3ZDFA 4DREA 3FR8A 3SLKA 1YDEA 1LRKA 6LDHA 4MIOA 1JVSA 4DMMA 3TZKA 3D3WB 3GH3A 3JQFC 3PHHA 1Q1NA 1WNTA 2C59A 4HWKA 3BMQB 3ROKA 3OA0A 3RSHA 3NDRA 4PG5A 1QV6A 4L8VA 5BSGA 2J3KA 1HE3A 1BMDA 1SBYA 4CMEC 5JLAA 4WLVA 4BVAA 2RCYA 4OQYA 2HJSA 4AJOA 1CQJA 3JYNA 4CQLB 4ALLA 4BNFA 3LC2O 5HWSA 3TFOA 2OP1A 1SC6A 3CXRA 4BO8A 4A27A 3QWIA 4CV3A 4KZPA 3ZHBA 4XYLA 4PLGA 4K1LA 4TVOA 4LSMA 2X86A 1DRUA 4XJSA 3B1KA 4BKPA 5JFOA 1WZIA 4E5MA 4FFRA 5IG2A 5GZ3A 1ID1A 4HFRA 4OOEA 4U0JA 3JQDA 2VT3A 3H9QA 1YB4A 4KUGA 1B8PA 4OJNA 3VH4A 3LU1A 3AK4A 3QHAA 4F46A 1DBVO 4PLZA 4GWKA 4NNJA 4YR9A 4HBGA 1PX0A 3IIEA 3MJCA 4EYEA 3F47A 3AY6A 1QR6A 1Y8QA 3Q1LA 4WK6A 5G4KA 3I9JA 2VUUA 4DXHA 1HYGA 1KY5A 3MZ0A 1NYTA 4ZVVA 2QZ9A 4DIOA 2VTDA 2X8LA 2VTEA 3H2ZA 1XU9A 5DBGA 1YDWA 4XR4A 4MIYA 1G1AA 4YJDA 1NPYA 5GZ6A 4WOKA 4CM8B 1DXYA 1YJQA 3ADOA 1U28A 3PTZA 4YT4A 4BMVA 1QYWA 3KYDA 2D5CA 3D4NA 4OYRA 4XYGA 1M2WA 3QWBA 4D42A 2WSBA 2RHRA 4U7WA 4IQ0A 4RQTA 2Y1OA 3WGOA 2ZB3A 4KDFA 1ISHA 3ICCA 3QVXA 1RM3A 1P0CA 3G49A 3WR5A 2GNAA 3IUSA 3O4RA 1ML3A 2O4UX 3B20A 4QO7A 1D1SA 2DBZA 1AUPA 5I7EA 3WICA 5JY1A 3FRJA 1MC4A 3ZW8A 1ISIA 3IQDB 4W4TA 2JFHA 3JQFA 2GASA 4R1SA 4XX0A 5K0ZA 2BFPA 3JQGB 2GF2A 2ZATA 4DQXA 4L73A 3CUKA 3UAGA 1P77A 3K8ZA 2Q2WA 4CM5A 1LLCA 2BI8A 1YL5A 3ETEA 1O95A 1NR1A 3Q9UA 1XR3A 2C0CA 2PA3A 3OIDA 1JDJA 2H6EA 1HKUA 2EKPA 3LDHA 3PJDA 2O4CA 1JW9B 2I65A 4GH5A 3OIGA 3PHLA 2GN9A 2NVUB 2GYYA 3NGXA 1F06A 5K9ZA 1GUZA 4R51A 1GU7A 3I23A 5FF9A 3PIIA 3E6AA 2YJZA 3GF4A 4R01A 4WLEA 3ROQA 3DZBA 1JLLA 1HTBA 2XAAA 5EQDA 4FW8A 5C7LO 1A7AA 2YHIB 1P44A 4UEJA 3CH6A 3WQQA 3I9OA 3O9ZA 5CAEA 3LQFA 1LXCA 2C29D 3GG2A 4TSKA 4YT2A 3MOGA 4NJMA 5ER6A 5A9RA 5A02A 7ADHA 4TRRA 2B37A 4YAKA 4J1QA 1P1FA 1KVUA 1HLDA 2ZIZA 2AA3A 2RBEA 5COQA 3H4VA 4B8WA 2VWQA 2GCGA 4XR9A 2AQIA 2VYVD 4N18A 1ZKMA 3GHYA 5TSDA 1WPQA 2DQ4A 1YRLA 3O8QA 3L9WA 4MOWA 4RDHA 3VVBA 1N92A 5G0WA 5BT9A 5ITVA 1XLTA 2PGJA 4J4HA 1VL6A 3CMCO 1B0AA 1M66A 1UP7A 2YDXA 2C7GA 2VRCD 2AW5A 3ZV5A 4A2CA 2DBRA 2TMDA 3FWNA 3I6QA 5L4SA 3ZV6A 3DFUA 3AUSA 4J2HA 5A03A 2CVQA 2WE8A 4IMPA 5KJEA 1XYGA 2ZCVA 4EW6A 3CTMA 4R68A 5CG2A 2OBNA 4D0SA 1QYDA 1YWGO 1YS4A 2BFAA 1NXQA 2VOJA 2XPCA 2DBVO 4YJGB 3V5NA 1SCUA 4BNHA 4IJWA 1F8GA 2HSDA 1R4NA 3G1UA 1UDCA 5U9CA 1PZFA 1LLQA 2Q4EA 3NAQA 4B4UA 1UAGA 1ZXLA 2GN4A 4AFNA 1QMGA 4BB6A 1P31A 1DO8A 1ZIDA 3AUAA 4WOJA 3ITDA 5A9TA 4OGWA 4ZGWA 4E5NA 3CPSA 1SPXA 2P68A 2VZ9A 3Q11A 1E7RA 1NWHA 1YOVA 1QSGA 4XGIA 1IL0A 3FTPA 3TOZA 4ITUA 4WGGA 4Z9YA 3OMLA 3RFTA 2A35A 4QFCA 4IDDA 2NSDA 1E3WA 1W8DA 4TQGA 4CM7A 1O9BA 3HE3A 4JBIA 4R9RA 1A4IA 1R4MB 1A4UA 4RZIA 1PEDA 1XCBA 3VDQA 5KJCA 1R66A 1LBEA 2DFVA 2Q1WA 2WYUA 2X7HA 3GMSA 3TPCA 4EEZA 2G17A 1PS8A 3U4DA 2FOIA 1E7YA 4HKTA 3V8BA 2VWHA 1B2LA 1MXFA 1C1XA 3U3XA 2F00A 4Q3CA 3H5RA 4OSPA 3QQPA 4ONEA 4DRYA 1AHHA 4B4WA 3B1JA 1Z73A 2OOSA 2DT5A 4KWHA 4XJTA 4W6ZA 1WXDA 5IN4A 2C82A 2Y0DA 5BNTA 1A71A 5A3JA 5L95A 4JNKA 3EC7A 4Y8VA 1LRLA 4UUNA 4LISA 4BNNA 4GSLA 3WB9A 4PLTA 2CDCA 4Q3AA 3ZW9A 2I76A 1R0SA 1SEVA 1LC0A 3M6IA 3DMTC 3P5SA 1KVRA 3PRJA 1HSZA 4ZICA 4CMIA 3GZ4A 5G2OA 3WGYA 1JTVA 4E5PA 2Y68A 1ADFA 3VC7A 3R0IA 3AUUA 3P19A 4ALNA 1U9JA 4EI2A 1MV8A 2BGKA 2Q1TA 1NNUA 2XXJA 3KYDB 4OHUA 2IRWA 3HDJA 2O3UA 3GG9A 1Y8RA 3NTOA 3RU7A 1I5RA 4RVFA 1EBUA 4UUPA 2JHFA 2QRKA 3LT2A 3PYLA 4KMSA 3E8XA 5AXCA 3GNQA 1MUUA 4WLOA 4IGFA 1OBFO 4YJHB 4TRNA 1R0KA 3NRCA 3A06A 1C1DA 3UCEA 1T2FA 4J1TA 4UEOA 4XYMA 2VZ8A 4WNCA 2BFMA 2EJVA 3KXDA 4GGOA 4A5OA 3LYLA 4UVEA 5HS4A 2G5CA 2D0IA 4ZA2A 4HNHA 2QRLA 3W6ZA 4K26A 2LDBA 4GVXA 3P2YA 3UHAA 4BUCA 3U4CA 5JNLA 3NDIA 4J7UA 5I9MA 3LC1O 2DFDA 4DC0A 3RC9A 1D4FA 2NADA 5EJ2A 4UVDA 1I30A 1WDKA 3ZNNA 2BH9A 3VZRA 4HX5A 4J49A 1CERA 5JCJA 4ALJA 2V7PA 1H94A 1GCUA 2IYOA 3CSDA 4GWGA 2X5KO 4ZD6A 5LDGA 3FTNA 5A5FA 1H0KA 1DHTA 4II2A 1RWBA 4RPKA 4M49A 1LQUA 3W8FA 3LT0A 3OHSX 5CEFA 2BGMA 3PK0A 4DLBA 2O3SA 2C5AA 5LC1A 3NTQA 1XWFA 2Z5LA 2CNBA 1X13A 5DOZA 4ZQGA 4E2ZA 2CVOA 4RVGA 1S6YA 3PWSA 4PG6A 1VKOA 3V2UA 5BR7A 1YB1A 1TT5A 4I9NA 2IODA 4OO3A 3WGTA 4BMNA 4C7JA 4NJMB 1PZHA 3ETGA 3NT2A 3VZPA 3U5TA 1LRJA 4JIGA 4I8XA 1WW8A 3D1LA 1IB6A 3KM0A 4CLDA 3FD8A 1Y5MA 5DNAA 3W6UA 1AXGA 1GV0A 3AW9A 3L0DA 2UDPA 5KKAA 4EUHA 2JCXA 5C5IA 3ANLA 3O8QB 5AVOA 7MDHA 3FNGA 5G0TA 3G3EA 3FSRA 4CMHA 4J0EA 3SLGA 4UAGA 5KWEA 1GEGA 1K6JA 4R54A 2HAEA 3MTGA 4PLFA 2FR0A 4JK3A 2P5UA 4Q3EA 4E6PA 2R2GA 4FJ0A 1ZEMA 2IZ0A 4K28A 3R6DA 3GVCA 3VH2A 4FFMA 1LLDA 1U2GA 3D7LA 5I9LA 1ISFA 3F4LA 4GLOA 5L7WA 1HL3A 5JYDA 4FCCA 1K5HA 5G0SA 5I9NA 3HDYA 4BNYA 2FN7A 1DLJA 5L7TA 4CLOA 1R6DA 4TZTA 3ZNPA 3GEMA 5F21A 4XEHA 3ZU5A 3S2FA 3VOSA 5DN9A 1R4NB 2GDZA 1F8FA 4ZQBA 2JCYA 5IDXA 4MVJD 1MX3A 4WCDA 4DYVA 3A4VA 3JD2A 1DJQA 1D3AA 4Z3DA 1DAOA 4PZEA 3DQPA 1ZK3A 1PU2A 2GLXA 4L4XA 1YOVB 3ONFA 1UZLA 4NU6A 1WMBA 1KBZA 3BMOA 4ALKA 1ARZA 2GSDA 3BTVA 3QV1A 2O3JA 2VUSA 4FN4A 1Q7BA 3PLNA 2PD4A 4FOSA 3UUWA 1E3WB 5JO0A 3K31A 3ZHYA 3D3EA 1PS0A 2JD2A 3U62A 3VTZA 2BF7A 4ND3A 3ZCXA 1ZK1A 1LU9A 2X9VA 2Y1EA 3FI9A 1OI7A 3OJOA 1NWCA 3S55A 5JE8A 1DFHA 1TXGA 4OAQA 1UP4A 2C07A 4K6FA 2YV3A 2Q2VA 3QVOA 1RYEA 1OZAA 5A05A 2FRDA 5TQVA 3T7CA 1DRVA 1E1MA 4XGNA 3LK7A 4LRSB 3I9NA 4TKLA 2W98A 1CEQA 2HU2A 5DF1A 3QWFA 5JC1A 2XF8A 3DAPA 4WNIA 1B26A 2X6TA 3GN2A 3CIFA 4BO7A 2AQHA 1BVRA 3WTBA 3AY7A 4HADA 5EL0A 1IZ9A 1O6ZA 2NU9A 1RM5A 1PJSA 2EHDA 3PJEA 4XYBA 3SC4A 2EP5A 4B3HA 4CMIB 2HRBA 1PJBA 4J91A 2O7SA 3V2GA 1UZNA 1ZJYA 4G81A 1GL3A 3H7AA 4F45A 5TLSA 3N58A 3HB4X 1DB3A 1FF9A 4ZRNA 5KNLA 3PXXA 2OORA 1KIFA 2E4AA 3RBVA 1XDWA 3L6DA 1NHWA 1HE4A 1P1IA 5AYVA 1C14A 4LVCA 1NX6A 3RROA 3VAZA 1CDOA 1I3NA 2SCUA 3MJSA 4XQCA 4J3FA 3OSUA 1NAIA 1BXKA 4PGFA 3NTRA 4WLFA 4XIJA 1GZ6A 4IINA 1DOHA 3SX2A 2H63A 3QWHA 4CM8A 3TNLA 1YBVA 3U4IA 4AG3A 4E2WA 1NQOA 1UXJA 1YQGA 5H81A 2Z1NA 1C1DB 2GO1A 4CM9A 5ICSA 3GRPA 1HLPA 5IJZA 1Y5RA 2ZKLA 3DBHB 4TKMA 1VJTA 3FPLA 4GX1A 3OA2A 1KEPA 3ZWNA 5C3MA 4IZIA 2Z1MA 4C4OA 2GZ2A 3D4OA 5B4TA 5JCJD 3E5MA 4FJ1A 4ZN6A 2OXIA 3HADA 4HUJA 4FS3A 1GYPA 2W8ZA 3PJFA 3WYEA 3JQGA 1P74A 4PLCA 5L4NA 1F14A 4Y98A 2PGLA 3TSCA 9LDBA 2QYTA 1PGNA 3GLQA 4E2YA 2Q50A 1ZUD1 1BXZA 1GTMA 4IDCA 3H5NA 5A06A 3L4BA 3ZU3A 4BNVA 1FJHA 2VCYA 4QXMA 5F5NA 3MJTA 3EUWA 1LSJA 2OUIA 2B4RO 3DTYA 3RUFA 2DUUA 5B1YA 4EDFA 3AI3A 3DOOA 4E13A 3C3XA 2GGSA 2NVUA 1HDOA 1AE1A 4NPCA 1J4AA 3CINA 4YAJA 3UXYA 3IL2A 5CPBA 3ZWAA 1QP8A 4WEOA 3JQ8B 4J2OA 1GADO 3I5MA 3ZWWA 3DBRB 5DP1A
chains in the Genus database with same CATH superfamily
2ID4A 3IKTA 1AB5A 1DKQA 1Z2DA 3UB4A 2YHIA 5JS6A 1DX6A 2PX8A 1PNRA 1W73A 1W0KD 2HBQA 5JSKA 4JNCA 4G2TA 3OLCX 3BRQA 3OOWA 4U4AA 3JQ6A 2PX3A 4L4UA 2X8BA 4P3OA 5TQ2B 4DCOA 2I91A 4L8LA 2XCUA 5LBIA 3RTAA 1WXFA 5KNBD 1ULZA 1J5XA 2CUNA 3QKSB 1DIAA 3EXHA 3K09C 4EB8A 3GUUA 1Z0JA 2VWGA 3DCYA 4NL4H 4ZHSA 1V1RA 4N3NA 3O2JA 1IXYA 1A5BB 2RARA 2V7WA 3CQ9A 3CVOA 3DHWC 5L3RA 4IDFA 3R2JA 4PSCA 3T54A 3P0RA 4E5KA 2PL5A 2V1XA 3IE2A 3HYCA 3X1KA 1Y48E 3H6GA 3VR6D 3OBBA 2O0MA 2DKNA 4Y2YA 4MK4A 5GZ1A 4IXNA 1IPHA 2H5LA 3QVGB 4RVHA 1DDOA 1N6PA 1YL7A 4C22A 3EZ6A 4DNQA 5EXPA 4XGRA 3RBZA 5ECWA 2QX6A 3G9ZA 3OFVA 3VVLA 4TYPA 4YPOA 2EW1A 4LTNA 4D8TA 5FBVB 3FVWA 1VMKA 2PZEA 3LT5A 2ZRCA 2J0UB 4RA6A 4RETA 4L8WB 2ZTHA 3PNMA 2XNKA 1L4GA 5TQJA 5HX7A 1JIUA 1R0LA 4XUDA 1PZEA 4LQ4A 1BWSA 4ZZIA 2BY4A 4OY3A 5BV0A 1NKVA 3CCCA 3INGA 3VR3D 2BM1A 3AFOA 4JYZA 4QM6A 3A6DA 4JB2A 2ZIGA 3BMOB 1EFCA 4CLHA 1UK6A 1AQYA 4BO5A 3TD2A 2ATXA 3KZKA 5DV9A 4ALIA 3S7ZA 4RZHA 2IS1A 3ACDA 2GJ9A 4HRVA 3ANYB 2V6BA 3U4QB 3SQMA 4FKZA 4HPXB 2YYYA 3HFJA 3D9QX 4PG7A 1PZGA 3PICA 4CI0B 3G2IA 2A9RA 2FZEA 1N1MA 1PFVA 3AR5A 3FLAA 3LPCA 1N5MA 5AM5A 2ZI5A 5CNIA 4EGSA 4GHWA 1CV2A 1QG0A 2IE0A 1ZI6A 3ITNA 4O29A 5A0VA 3DCJA 2GXSA 5SV2A 5I7SA 2R2AA 4YVFA 4EBFA 4G0VA 1N9ZA 2HSZA 3AB8A 1LB1B 2HCTA 3C3WA 4J16C 1E6MA 2HCBA 3D7NA 4R2LA 5DTEA 4V1CI 4OD0A 1P29A 3SAJA 3U7IA 2PGNA 2B5VA 3B2QA 4PNHA 5I45A 3ORSA 3U09A 1XEWY 4UMVA 2BOVA 2ODNA 4WKPA 1JBKA 2E9SA 2VS1A 3R7FA 3TQTA 4BKQA 2G72A 1XALA 2X6QA 5LU8A 5MFPA 3UA4A 1UKBA 2R6JA 2OFPA 1M8KA 4OX9B 3QEOA 4DUGA 2MIIA 3CWQA 3VPDA 1AGPA 2GNPA 1W5FA 3CUSA 4G84A 5CK5A 1YHZA 1AZWA 2PN1A 4NZNA 2J32A 1PDOA 2HXYA 4H77A 5EJFA 3TLCA 7REQA 2CYBA 1NL3A 1T5OA 3KZOA 1B15A 4LZOA 1RQXA 1FFSA 4OHMA 4DLPA 1I7LA 3DEFA 3W4IA 3RIXA 2PRYA 3GLVA 3JZFA 3RVDA 4ICIA 4JJIA 4HB4A 4IG4A 1QFJA 4RF4A 2A0FA 4IQ4A 4QUAA 1IN7A 4PNPA 1SQFA 3FMPB 1YRWA 3NH9A 3R6TA 1PTKA 3V8QA 2FSGA 1J8VA 4R9UC 1TCAA 4CM9D 1TIBA 1ZUNA 2PLWA 2OZEA 3GR6A 4GP9A 2YFQA 1KJ8A 4KXLA 5GJVC 5A62A 2CC2A 4RVNA 3A1EA 4CQJA 4PG8A 2XYPA 4LDJA 1Z8NA 5JQGB 4TWIA 3I83A 2IXEA 4IZHA 1L8QA 2W43A 3P94A 4BQFA 4DLYA 3TTSA 5I3CA 1KZ9A 3EVGA 5INTA 4Q4CA 3O38A 4TTRA 5B5SA 4OVKA 3LL7A 4CL2A 1ZRMA 5TNXA 5JO9A 1JEQB 2Q4OA 1E89A 3AIOA 2I6TA 4ZZ1A 4RS3A 1ZCZA 3AEXA 3UAXA 3CBQA 4YP0A 3CIOA 4YCMA 5JDIC 8ATCA 5IBPA 3BREA 5D7NA 5HFJA 1QUFA 4Y2TA 3MMSA 4GOOD 4U1RA 1Q50A 2DJ5A 5ELLA 2VDUE 1F3OA 1B7GO 3PNSA 5IYZF 1CUHA 2JGMA 5H1YA 1MGPA 1G3RA 3EXG1 4CMJA 4LZWA 1WUTA 2EQAA 4HZUB 1KFJB 2C61A 5L3ZA 1DJNA 2Y0EA 2XBMA 2OT3B 1W93A 2PMBA 3I1JA 3K70D 3D6TB 1D2CA 2I4LA 2F3SA 2OB1A 1GEEA 4UNNA 3ZDRA 5FX2A 3QFCA 2MSWA 1WBJB 5FUBA 4D9JA 1R9JA 4IP0A 1XZPA 2BE9A 1KDPA 5IDVA 4G5HA 3OJ0A 1V8OA 1OYVA 4YRSA 3GJ3A 4MVJG 1GRVA 4TMVA 1CF9A 1LH0A 1UC9A 3HR8A 1LDYA 1SBIA 2HJHA 4RZQA 3IA2A 2PSHA 1R5BA 1YIOA 2WJ6A 4J16A 4R8LA 1KNXA 4A8TA 2HI0A 1ESDA 3D3QA 1MBZA 2I34A 3OQBA 4K8RB 4NE9A 1M2FA 1ZNYA 2VDLB 5M2QA 2CLFB 2NSYA 1QK3A 4JT9A 1V5IA 1AO3A 2B7CA 2FWMX 3HVHA 4ZO8A 1L5GB 4N47A 2JAQA 3LY9A 1DFIA 1VYVA 1W19A 1X14A 3CH7A 1MDFA 3OX3A 3Q8XB 4J0KA 4HPWA 5D5QA 3G13A 3SU8A 4KMMA 2OBLA 1PS9A 2AE1A 3PHJA 2GESA 4EG0A 5I9BA 3LPMA 3VPBA 3IAFA 4HF7A 4RHUA 3VUEA 5DISB 1YFLA 3A3NA 4OBEA 1V8FA 1NA5A 4DL9A 5HR5A 1I5OA 3BTOA 5LOVA 2QLTA 2G25A 3SWWA 2C83A 3UN1A 3IVRA 4OL0A 4DQUA 4F11A 1HDIA 2BFNA 1IOLA 4C7OA 1AKYA 2OD2A 3ZHXA 2QJFA 5DYIA 2ZBRA 3OLWA 2V5AA 4HZGA 1QPZA 3GRVA 1MAHA 4N5DA 4AP9A 1RLMA 2VAXA 2WSSA 5BR1A 1ESEA 2RHWA 1H0SA 4EK9A 2X9NA 4OHXA 4BRUA 2AEMA 1OB5A 3FGOA 3GJTA 1XHFA 1IDOA 1JQEA 1TUBB 3OSZA 2OZPA 3TRKA 3LWNA 4C0HA 5ARBA 3QJ5A 1JDPA 4GDMA 4D79A 4EGFA 3FY4A 4RMJA 3Q72A 3CPJB 4E2FA 4H1WA 1KI8A 2OBFA 2HY7A 2B1JA 5AJWA 1I9CA 3G2LA 2D59A 1YUNA 2OCDA 4OYLA 1SHTX 3AJAA 2LV8A 2JJ1D 2WU1A 1CQIA 3OCZA 4C0XA 2W37A 4DIFA 5IUNC 2JLZA 1ULSA 2OE2A 4ZEOA 4IJ6A 4BNIA 5EZ6B 1N34B 2A9KA 4YAIA 1EJ6A 3P0JA 3L5KA 1RC1A 3T7TA 1EFPA 1EX6A 1II0A 5JDIA 1VCMA 1T8UA 2E4UA 3EARA 3V6MA 2UZ0A 4F60A 3BRWA 4QBHA 1FXSA 4CFYA 2X4LA 10MHA 3LQ1A 3COVA 2D3TA 3CURA 3F67A 3QNMA 3O1LA 4ISCA 5BSKA 1MPTA 1CNEA 1K3FA 1UUFA 4JSYA 1P39A 4OHZA 1YR2A 1ORIA 1XQ1A 1KJWA 2EKBA 2H1SA 2MSKA 3DZJA 3NNNA 3R9XB 3FNFA 1SBNE 5AXBA 3UICA 3EQ7A 1UBKS 3CXUA 3AL2A 4GI7A 4LJAA 4IDNA 1LVHA 2CK3D 3TLGA 3V48A 1Y4DE 3TDKA 3TCNA 4DCCA 1IU9A 2H1WA 4DDHA 1XGKA 3AVPA 4M2LA 2QF7A 5TVKA 1VE9A 3GH1A 3PKZA 5IVDA 2OA0A 1HDCA 4JBGA 1P7PA 1QAMA 3EWNA 4PLPA 1MEEA 3LUJA 2PZKA 3ON5A 1PZMA 4R2WA 4BIIA 4L4RA 2IOHA 3M70A 3QPWA 1TA9A 4GI5A 4ML3A 4UTPA 4Y7DA 2DX7A 1QIIA 2RJOA 1PE0A 1TU4A 3ENVA 1VCIA 3L8HA 3PR2B 2CV1A 2CXNA 1J09A 1MNAA 2X19A 1L7OA 3R0XA 4LC9A 4LV6A 5TT0A 1IDN1 4BU0A 5LLTA 2BDUA 3JARB 3WNVA 5DOVA 4R1PA 1YR9A 1L8AA 4DIBA 2A9FA 2OV8A 1RKXA 2W6JA 4EUFA 1VPDA 3KJHA 4UNRA 1S2MA 2PLAA 3DMNA 3PC8A 4Q7QA 2HBYA 4TLEA 4B2PA 1OI4A 3KWJA 4NBLA 1GFSA 1JMYA 5JXWA 3MJVA 1BEZA 1NUTA 3G8CA 2I55A 1Y1TA 2O2DA 4CM4A 2HL6A 4IKEA 4MAFA 1U2PA 3BTSA 3OM1A 4HGRA 4R9VA 2FYTA 4S3MA 1AHPA 3A9UA 3KBOA 4PFJA 3KPJA 2PZJA 5TGZA 2PRZA 1OV6A 3E1SA 4CUZA 4PFQA 3HY6A 1QO9A 2NYVA 3IVAA 3PE3A 3PJGA 4ED9A 4YP7A 4CF3A 4HEJA 1UINA 4IIEA 1E8DA 3PXDA 4M6WB 3G0IA 2WIGA 4RPHA 5AI0A 5HK8A 1QBKC 3IC5A 5IBQA 1W5EA 2NXNA 4RQAA 1WHSA 3LXUX 4MEAA 2H1FA 4IWYA 3GLUA 4O8CA 5CVCA 3V8RA 3L0ZA 3EVNA 2R47A 3E9QA 1FP7A 4RIHA 2GUGA 4FONA 4RVUA 4ZCPA 2ZVPX 4FBGA 4IUCS 3THSA 1JB9A 4YGYA 3TJMA 5IJ0B 1VL1A 3L06A 1OV4A 3IP6A 4Q01A 5ALSA 4ENPA 3PDIA 2ZS9A 4DQDA 4EQ6B 1P9LA 4I5IA 5L3QB 5ARCA 2EL7A 2VQ3A 4UHDA 1M5RA 3QMMA 4KQ9A 1UBTS 3N7AA 2OOKA 4YP6A 5FPYA 2F4VB 3MJHA 2X8JA 2WP8J 5IUJC 2NWQA 3GA0A 4U2BA 4N8EA 4B7XA 2HREA 4BTEA 3QFRA 1DZ3A 1EX1A 2FN9A 2PWZA 4OQFA 5EFOA 2JGRA 3F3YA 3IBYA 4H16A 1GPH1 1UJMA 2CYAA 2JJYA 3D3KA 3KYCA 5CGZA 5KNDD 2SICE 3PKJA 4RW0A 3ZCSA 3ADPA 3DOCA 4ARVA 1KL7A 3PJRA 3N0RA 3OETA 4L08A 1MO5A 4N03A 3SDSA 5B12A 4PONA 1A72A 1D2RA 1OQAA 3BFVA 3SICE 1E1CA 3MCWA 3MMNA 4WXRA 1NNLA 2ESRA 1BZYA 3H5IA 4YPFA 1D2HA 2Q8PA 4QNNA 1L5RA 3V8PA 3EOBI 1WHTA 3TMKA 3C5VA 5KOIA 4O0LA 1KAQA 5K3DA 3AU8A 1VB5A 2W00A 3B7WA 3IX7A 4DHWA 2VF5X 2VO1A 4E46A 5CRIA 2YJ3A 1JMKC 5EHXA 4YMHA 3CA8A 1SULA 2V3CC 2C4HA 4EKNB 3PENA 3AFMA 3TJRA 4C5AA 1ZGAA 4TKVA 2IK8A 2OD7A 3NAMA 3T52A 5L6LB 1NRJB 1ZGGA 1JDZA 1F8XA 1R88A 2NOAA 3FPHA 4ZOLF 4CF4A 1MX9A 3SBXA 4S05A 2FPRA 4DJFC 1NHGA 1PEAA 5HXAA 1PI3A 2B36A 2GTIA 2HD4A 3BK1A 3PPXA 4NQZA 5TF4A 2A3NA 2O7QA 1S8FA 3UATA 2C7PA 2IHYA 2OB2A 4IVPA 2WKPA 3GYBA 1PQ4A 4HNAA 4PWZA 4C30A 2KBFA 1Z7GA 3BERA 4QWWA 3TNDA 1M1UA 2DR2A 3NMUF 1YIDA 4ITRC 3WX0A 2H1VA 1XOIA 2V4ZA 4NH4A 1WZUA 5KJFA 2V98A 5FIUA 2EOAA 4ZT6A 1K4MA 1RYFA 2WEKA 2YVAA 4YJ3A 1EI9A 3GGCA 3PWTA 2NTEA 4UEWA 1XTVA 3KSDO 3TIIA 2YZGA 4MRVA 3PRKE 2JBAB 1T8SA 3EW9A 3HN7A 1AKTA 4KXUA 4M8LA 2E4XA 3RRFA 5M7EA 1ZC3A 3FNQA 5LKRA 3HGQA 3WDSA 4Z6KA 1XMOB 1G5HA 2X41A 3C3DA 2I22A 6ADHA 4OHYA 2H1CA 4JLDA 2JLVA 4IHAA 2H2WA 1F4LA 2FV8A 2FN8A 2NTYC 4P3KA 1D2NA 2B5WA 4MPTA 3DBRA 3HWRA 4U7FA 1ZWLA 4IQFA 1GG2A 2ZJ5A 2AXNA 1NI4B 5BNWA 1B0UA 2B83A 2O5VA 3UHOA 3VDMA 1IUPA 4FMDF 4LNUA 2BBTA 1SVKA 2P62A 2E82A 2R8RA 5ICMA 1RWWA 1EP2B 2G77B 1TAUA 1EJ2A 1B6GA 4R40A 1P1HA 4Q3NA 5HW0A 1KAMA 1JJ7A 3L7BA 2YVKA 3L8GA 3QBVA 4BJHB 5I51A 4JD5A 3PSHA 2YKGA 2I3DA 3GRKA 3TXAA 5K20A 3U60B 4A0RA 1OT3A 1X87A 1Z4QA 1CR6A 3L8ZA 1E8MA 1RPNA 3I8OA 3M6AA 1N2CE 3TF5A 3EF0A 5JNTA 2AOTB 3BXOA 4Q9JA 1U5AA 3V8MA 3W05A 4BBAA 3TG8A 1U4SA 3PEFA 5F2OA 4BIMA 3LWZA 1PNOA 2NZJA 2YL2A 3RC1A 1UC8A 3F5SA 3K0CA 3KT3A 4FDUA 1NOKA 3RUDA 1NOJA 2ZB2A 4TLLB 1G291 4X1KA 3TW8A 1UOEA 4WN9B 3EY4A 2GDJA 2YWEA 1R4ZA 4X1IA 1RWKA 4U2EA 4UVHA 3DZHA 3ENZA 1F8UA 1AU9A 4KIFA 4AKEA 5GJCA 3L46A 1ZWKA 4ZT5A 4HFJA 4KAXA 4UM9B 4G2NA 3LLMA 1AO0A 1JIIA 2RH8A 3RUCA 3SDZA 1K8YB 2FEOA 3EVEA 4IH1A 5EPOA 2FAXA 3B1WA 3NYIA 3GZNA 4FC6A 4RGBA 3GP3A 1O0BA 1VL5A 2E87A 1QANA 3G68A 2UYGA 3DO8A 4KODA 4IDEA 1REQA 3E27A 4J8PA 1Z5VA 4Q4LA 3KP1A 3ZWXA 4KUHA 4QNMA 1GGKA 4W7SA 2X22A 5BQPA 1UXOA 1X7ZA 2P0EA 3W2IA 3RUPA 1FFHA 1J2UA 1VIVA 2BKVA 3OM9A 3EF1A 1FYXA 1RC0A 4LBYA 1NQXA 4YUVA 3WYFA 2OO5A 4TXLA 1HBJA 4M0EA 1YKSA 1DBIA 5A0FA 1M2OA 1T8YA 3AFIA 4WQMA 2QD4A 3TM5A 2FP4B 4A3SA 3L4BC 2C0PA 1FXWF 3W9SA 2ZGVA 4KJXA 3AFNA 3M4NA 4L74A 1PEKE 4LZLA 3X3HA 5CITA 2WFAA 2CXUA 3THWB 2HMTA 3U39A 3A4MA 2FLVA 1NVDA 4PCLA 1OFTA 2BFCB 3BFXA 1SZPA 3I6ZA 4P9NA 4R69A 2ORYA 1NXPA 1RWNA 1SCJA 1YFKA 3FNHA 1IY2A 2VYQA 1GJRA 3Q0EA 3WMFA 4O4LF 1P2FA 4UNPA 4RIGA 3GVXA 3D3NA 5AKZA 2RI0A 2JARA 1ZO8A 1L4MA 1YKFA 3ITKA 4NXMB 2WUVA 2WKRA 1BE6A 4H18A 2X3YA 3CJQA 1BGXT 3E84A 3JQ9C 1DCKA 2HBRA 5BSTA 5K05A 3B6JA 3NEPX 3H2JA 3TSZA 1Q17A 4HQ0A 1VHDA 4ITVA 3OPYB 4JSTA 3WZ2A 3ZGVA 3ORYA 2CHFA 5KSWB 3KSRA 2QP4A 4GVLA 4AW9A 2ZB4A 1GYQA 3NIFB 4EGCB 1EVJA 3QLEA 5BYJA 3P7MA 4ZI3A 2ZYIA 3FHJA 3GD5A 3THRA 3MVEA 4E14A 5KCZA 2JAXA 1AN0A 4JLWA 4XSGA 3OJLA 3IAUA 2B1QA 3B9QA 1MENA 1YHYA 4G63A 3VKWA 4DR5B 2WIJA 3KJZA 1RYYA 2F2TA 3DKRA 2GMWA 4HDKB 1PL7A 4JUFA 4NARA 1BX1A 5EWMA 4X20B 1CIPA 4EITA 1TGVA 4G26A 1WY5A 3TEMA 3QKWA 2E6UX 1QYRA 2JS7A 2PD6A 2EP8A 1RLTA 3O7WA 4LK2A 3M89A 1V9CA 4MJ3A 2FZ4A 2FPSA 2GWRA 2G7ZA 1GTRA 1ONSA 2I6GA 4ZMRA 4BVLA 4QRHA 4DTIA 1Z25A 1Y37A 3A4IA 2I3ZA 3L6UA 1JJIA 1TUEA 4H6VA 5HZKA 1TAHA 3FLMA 1BWPA 4YO7A 2QTZA 5I8PA 5AI9A 4OLAA 1LJ8A 1HFKA 2YVQA 1D7OA 4LOJA 4MA0A 3VPSA 1EWKA 2C2XA 3HI6A 4G0OA 1JV2B 2F1RA 2AC4A 5HSGA 1E9FA 3SM3A 1U6KA 2JGIA 3BAZA 3C1TA 4KVGA 3A2NA 3G1WA 2VPPA 4DLSA 4KPEC 2VA9A 4JT4A 1OLSB 2P0AA 1YQXA 2P67A 1U3WA 1P4HA 2VXYA 3EXEB 3MC1A 2HLPA 1G1MA 2JKZA 1PTJC 1MAWA 3OTWA 3RRNA 2X23A 4EHFA 5ENVA 1NLYA 1Z7WA 2MMGA 1N2JA 1GNVA 4RHFA 2PPVA 1FU7A 3FHOA 2J9FB 4Y1RA 1R0CA 5ALZA 4BASA 5CX1A 3PI7A 3GRFA 3JWPA 1JA9A 3D8RA 5DB4A 3TW6A 2WYOA 1K7CA 3GJ5A 4YAEA 3T4XA 5E1MA 1QS0B 3MRVA 4ZAWA 1NZJA 3ENKA 4Z4EA 4XQEA 4RWEA 2MINB 2YXNA 1PD1A 2W0SA 5AMXA 1R00A 3RG2A 3RS9A 3RYFB 1MJGA 4QHTA 4MRPA 2IY8A 2Z30A 3DS8A 2GZ1A 3HEAA 1U5CA 4WASA 4ER5A 3MGCA 3K0SA 3HJFA 1UOOA 2PL3A 2HO4A 1Q3HA 1V2HE 2XD4A 4UHCA 2ZXUA 3TKLA 1J07A 1Z9BA 4N40A 1D8TA 3F97A 1SD1A 1U94A 4QOGA 1R50A 1NGSA 1SHZA 2ZXFA 4CPDA 4Q39A 3TRIA 1YBHA 3DH0A 1USGA 5REQA 4MP6A 4NE2A 1S8OA 2DHEA 2QX8A 2Z57A 2W71A 2WWFA 3U4GA 3RSOA 3CF6R 2ATVA 3O3NB 4M7RA 2VQEB 2BCGY 4DMRA 2VKQA 3S8EA 3B5EA 1C29B 2GHQA 4PWYA 1DC5A 1YB6A 4LYFA 2G08A 5KOHB 3GB9A 2CMGA 3QEMB 2ZREA 1X70A 3D8UA 3QVVA 4PAMA 2PMFA 5B58T 5SZKB 3NU1A 4BPRA 4KGVA 3OUTA 4GMFA 4ENSA 2AD5A 1UT5A 3Q9NA 3H87A 2ZSJA 4R9NA 1ZHOA 2A4KA 4EY4A 4RULA 1ADCA 4H08A 5KC9A 4UBOA 3R5JA 4G85A 5COBA 4F96A 5EP3A 1UXIA 4TYQA 3VHXA 1NW5A 1ZICA 4LKRA 1EE2A 2AN3A 5HKKD 1JHUA 5IX8A 1E7SA 2E6KA 3IOMA 2R8EA 1WZEA 2R8ZA 4YMTA 1AGXA 1RW4A 3KZVA 1GZUA 3RTCA 3LNTA 1S3GA 3CZMA 1L5HA 2Q0HA 3EQ6A 4ODIA 1KOFA 3EQ9A 3TMYA 4DOMA 3H3JA 1SUSA 2YDYA 2XDWA 3OEED 2ZYGA 1XKQA 4IYRA 3LF1A 4L50A 1GGEA 4MQEB 5FNZA 1LV8A 1Y34E 2ONKA 4BX0A 3L4KA 1OH6A 4LXIA 5FA6A 2V7GA 3AX6A 3HHPA 3L07A 2SECE 2Y1GA 2H4WA 4XTCS 3EGVA 4XWAA 4GP6A 5GP1A 4IJQA 5K09A 5EZYA 2QL6A 1JYSA 4UASA 3VH3A 3NRJA 1G60A 3D0OA 3PQEA 4PXYA 1YZ3A 1LDNA 1PTJA 3RC3A 4DG9A 4DJ5X 1DIGA 1M7HA 1T0BA 1ZH8A 3UWDA 2BT4A 2FUG6 2B4QA 3K94A 3QXXA 2WYVA 3EXFB 2XRYA 3HB9A 1QYXA 3L9XA 5FQNA 1RI1A 2CD9A 4MITA 3DEYX 4O4HB 3W4JA 2QJRA 2WJYA 3AF4A 1RADA 1RRFA 2WD7B 1T2UA 2H17A 2Z1DA 3OWXA 4KFRA 1ZR4A 3PEWA 3V7WA 2BEUA 3A58B 2XT6A 1U6IA 2VN8A 3C43A 4QYIA 3ZE8A 1AY0A 2FPIB 4UFNA 1INLA 4B45A 3H2SA 4P3XA 4WFIA 5ALTA 3ZZTA 4L5YA 4JU8A 4CEJB 1X39A 3G2OA 5CLLA 3CLHA 3RVMA 1HOXA 4HAXA 2C8VA 3R5SA 1RVDA 1A27A 4HRAA 4OOFA 5AJUA 5HUJA 5T57A 5F2NA 4B0OA 1S7CA 1PW5A 2QGNA 4M0MA 5DW0A 3QU4A 5JAZA 1JQAA 3W5BA 3ZHZA 4M60A 4MR7B 4DTCA 1D1TA 4DFDA 4WNAB 1F2UB 1ND5A 4D80A 3ZWOA 1JWAB 1IHXA 1Q6YA 2QR5A 4LG1A 2D5BA 4G0XA 4IJUA 4M9UA 2K87A 2XUKA 3BEOA 3IDAA 3ZD8A 4CW7A 3Q3HA 5EWJB 2CFRA 5KYKA 5IDWA 1L5VA 1BOFA 2VK8A 1CY0A 3D4BA 3FUVA 4CZ2A 2Y76A 3M9XA 4RUKA 1B1CA 3IURA 4BN5A 5LQKA 5K8IA 1E1KA 3QG5A 1TM4E 2DY1A 4PLYA 1WDWB 2C58A 2VJKA 5ALGA 4E94A 5A5EA 4OHCA 5I7RA 1Z7EA 2ZETA 1ZJWA 2FFAA 1ZUWA 4KQWA 3GOQA 2R751 4ZV7A 4EW3A 1TL7C 1U5BB 4F2WA 3ET4A 4PRLA 4BP3A 3F1LA 1ZMXA 3LHKA 2KX7A 3QVTA 1XPRA 5JDCA 1I3LA 5BYKA 3SS7X 4FP9A 1JG6A 1TIPA 5LYJF 5IS2A 1WR8A 3HV2A 4Q9HA 2FCAA 1E0JA 1HX7A 1ZMOA 2IZZA 2ZAIA 4BL5A 2XB9A 1J8DA 3FW1A 1XB2A 1V95A 2K2QB 2OAEA 4O1HA 3NDJA 4XCXA 1RJDA 1KYXA 3PQDA 2Q29A 2PZ8A 3UJDA 4G0QA 1PL0A 2C2YA 2DUMA 3MXTA 1CUDA 5JNVA 1AD2A 4XD2A 3WWOA 3OBIA 3F7OA 2Y67A 2OESA 1CB7A 1ZIOA 1U98A 4KR3A 2D13A 4OK6A 5HKOA 2C5LA 5CH3A 3WHIA 4BV2A 3REQB 1II8B 1XI2A 5IARA 2B94A 3U44A 3RJ9A 3EIWA 1UPXA 4M0FA 1JR3D 3P9QA 3RUEA 3MA0A 4V0ME 2H4YA 1FX0A 2PLNA 3KKEA 1GSIA 3GFGA 5AT1A 3D0RA 1G5FA 1V11A 3LRPA 3UAWA 2WHYA 3LUFA 4MDHA 4EECA 1G4AE 3FBTA 5E6RA 1E3IA 3QK7A 2PL9A 1X74A 1YR3A 3FMGA 3Q2IA 2VDPB 4OMCA 4YEDA 5B55A 3ANMA 4QE3A 1HNNA 3I5UA 3TBHA 3QX3A 4IPTA 4KAFA 3JVEA 2Y1KA 4P54A 2CFIA 1XSEA 5BSFA 2YWFA 3ZWQA 4NFYA 1DTWB 4W5WA 5TIIA 5EXSA 3JX9A 4P80A 5EINA 3WYNA 4B3IA 4C3OB 1RI2A 2BMWA 2RGDA 4TYNA 5IJXA 2GN1A 3O03A 3I2KA 5BW6B 2OP0A 5KJ6A 3WMGA 4HT3B 1T6NA 4B82A 2X76A 3H5VA 3L40A 4UMFA 4CIVA 2D2XA 5KPDA 2VEOA 4ZU3A 1ACJA 1BN6A 2ZSUA 5TQ0A 2JPDA 2O5RA 4TWRA 4IDUB 2VHUA 4BVJA 1WF3A 4HJRA 4EB0A 3EZFA 4YECA 5K51A 5DMXA 3ZTYA 3HYRA 4B1FA 1LBHA 2Z5VA 3H4IA 4FZJA 2WIBA 1BN7A 4JVMA 3UFBA 3PGLA 4HNUA 5B2EA 1O8CA 5J59A 3RHZA 4AICA 3AP2A 1JKJA 1E77A 1X7YA 4B6GA 3FGNA 3GC6A 3R75A 1F9AA 3HMQA 3VX3A 4W99A 3UCEA 1M8FA 1K6MA 4XGKA 4MV8A 5GY7A 4JWTA 4FGJA 5BXYA 3A2MA 4YC7A 3MTJA 1WUYA 1QGED 2ODEA 2WK1A 3A9VA 3JV7A 4PRYA 5GVRA 4F86A 5K99A 1AV6A 3C5HA 4PSDA 1NP6A 2B7BA 4EQZA 1J0DA 1VJ5A 3EQZA 5HE8A 3S5JA 5CBPA 3PGJA 1AMUA 3IQIX 2YRWA 3L6RA 4KI7A 3COSA 5CIWA 4KLAA 5SY4A 2GAOA 1YTUA 3KWFA 3AY3A 3VPGA 4JYPA 2HZ7A 5DTRA 1M1YE 4C2AA 4Y2UA 4YNBA 5IM5A 3AVYA 2DQYA 1Y1PA 2FETA 1KMIY 3ZU6A 3EISA 1QQ6A 1QVWA 4O59O 4TMWA 1LBSA 4Z0TA 5SZIA 1GCOA 1DAMA 4LSZA 1CY2A 1UM9B 1XEWX 4IR7A 5C80A 3PEVA 3QMVA 3PCRB 4Y2SA 2OYCA 2JIZD 5FV7A 4EY3A 2QAJA 3HB5X 5BMVB 1LSOA 2UV8A 3HRIA 3RU2A 4H4CA 2PU5A 1V41E 3RO7A 4X00A 3L93A 3LI2A 2XQGA 3H2KA 3IAHA 4B4KA 1P0PA 4DZRA 1GVHA 3C3EA 3K0FA 3Q5GA 3ZDEA 5I8ZA 2IU0A 1GYRA 3WC4A 1I24A 1Y6ZA 1Y5NA 2FE1A 4Q3DA 1NVTA 3DZFA 3CVUA 2H16A 3OKPA 3KCQA 2JFQA 3GHHA 2PEZA 4C4RA 3CKYA 4J0IA 1IJEA 2PZLA 4OP3A 2F8SA 4R1MA 1GZHB 1XU4A 3FYUB 3PSAA 3E15A 4I55A 5HKLA 1XMPA 1BJKA 1W4LA 2I3AA 5LA6F 5K4GA 1JFTA 3PEYA 1FYDA 3GNSA 1FRFS 1POXA 3CLUD 3D6FA 3LIIA 4PZDA 5EP2A 5IK2A 3TUJC 2BEVA 4QLAA 1MVOA 1QUEA 4UAJA 1S3FA 3P9NA 4UXHA 4C4TA 2OXEA 2YZMA 1BQEA 3S81A 3C2QA 3QFHA 5CA0F 4KMOA 2W2LD 3B3AA 4GZLA 4X8HA 1X7DA 3V4RA 1N78A 2BGIA 2Z3VA 4JKIA 4KSYA 5HIKA 1A88A 2I2FA 2J3IA 4C0LA 2PJRA 2GNOA 4AZWA 4XB2A 1VQ1A 1VTKA 1WJGA 3W8DA 4TM8A 4C6SA 1TGYA 5EWLB 3AR4A 3IEVA 1C9DB 1IN8A 2AYXA 4LJYA 3KB1A 5SICE 1QGUA 3DWGA 4E6EA 1CQJB 3MWYW 1HKHA 1U0HC 2VL7A 4GOKA 2HH9A 4HLDA 2PUCA 1KZ1A 4KXQA 3RQSA 4WCVA 1IG3A 3EA4A 5JCOA 5MN6A 1MQ9A 2XW6A 3KEFA 5E2AA 1ANKA 4JKYA 3USCS 3ZQ4A 4BC1A 1GPAA 3GGDA 5LQMA 3H83A 3PVSA 2Q0XA 4UM7A 1WB4A 3M82A 4PN3A 4FMCB 1Q0PA 2ASEA 1NW9B 3GJ0A 1BRMA 1ZCJA 4KXYA 2GKSA 4XGQA 1VE1A 2ISCA 3EGDB 2VIIA 1QZ3A 16PKA 1JHXA 3MXOA 1VDZA 3L7YA 4UVIA 1M0TA 4JB8A 1MPXA 4PM4A 2V7XA 2IHNA 4ZI2A 1U7ZA 1N2GA 3IIJA 5JARA 3AETB 1J9GA 5ICFA 3ZR4B 3IAEA 3ZHOA 2D00A 2P4QA 1C4KA 3JQAB 2OENG 1OFUX 4MGEA 1RMTA 4XTRA 3C6YA 3K1JA 4MV7A 4EMSA 2DU8A 1P75A 2ISSD 5HRUA 2PMKA 1WY7A 5ITSA 3ZIUA 1Y8QB 3TPFA 1O5OA 2HJWA 2ZJAA 2EZ4A 1L7DA 4H7HA 4N5HX 4DQLA 4Y1GA 3GGOA 3KXLA 3NC4A 3A3PA 5L3VA 3HTXA 3BZUA 1OTXA 1L7EA 1F60A 1BS9A 1K68A 2H85A 1W5SA 2JZOA 3FX2A 1OFHA 4Y2PA 3WDLA 5IM4F 4P8RA 3RYIA 1EYZA 1NONA 2AFRA 4QKQA 1I7QB 2JASA 3Q6IA 4Y9DA 2VZ0A 4FTWA 2LDXA 3ZCUA 3CISA 1E60A 5TEWA 4E7PA 2JA1A 3KJGA 3LZCA 1N0HA 5H8WA 1GXSA 4X6XA 4G4SO 4ASUA 3FOFC 4LF4B 4L3OA 3TM4A 3DBVO 5HJ7A 1YQWA 1NXWA 4QUHA 1MN6A 4G5XA 2QL7A 4A8JC 1S4QA 4MCJA 4U7DA 3FNEA 2BKXA 3IJ5A 4UUMA 3LC0A 1XV5A 1I10A 2PZGA 2NYRA 3DFMA 5T3YA 5JVDB 3KQNA 3AG6A 3BE4A 4ZQCB 3AEKA 4AL4A 2DHCA 2XTZA 1NSFA 2ZSHA 4EJ0A 4MWDA 4J4BA 5KINB 1G21E 4FLFA 4AMBA 1X7XB 4DWVA 3VU3A 4HY3A 5AM4A 4BFUA 4J2TA 1KDTA 1M0SA 3LT1A 3NC0C 1V6AA 2N3ZA 1ZEJA 4JDPA 4X7MA 3OQ6A 4R3NA 3UGKA 1O1YA 4TT3D 1SXJB 2C9ZA 3COJA 1WO8A 4EPWA 3ASYA 2VG8A 2JIBA 3NBYC 4H15A 4LMRA 4NDAA 1WLYA 4EG5A 3SF8A 1R5OA 2WMYA 4B5KA 2H65A 4GRIA 1SZJG 4Q15A 4M1MA 2HTEA 1PR5A 2AR7A 2D4HA 3H1BA 4Z8XA 1LLUA 4B71A 8AT1A 1G8AA 3MTQA 1NE2A 2YNMA 2BL4A 4BZZA 4LI3X 1YXMA 1Z7BA 1PGOA 4IY1A 4XWTA 1J90A 4FNMA 2EFDB 4Z8YA 2EKLA 2R1VA 4JBNA 5AESA 1YGYA 1UIMA 2YOGA 3O8OB 2VDOB 3MRXA 1A9XA 4F1KA 4X8OA 5FPHA 4HR7A 1GAEO 1G8JA 2QVGA 3CKLA 4QDXA 3L01A 4NJOA 2BBWA 2Q3EA 3EC1A 3RU9A 1Z6XA 3QVKA 1RPAA 3MMXA 5HA5A 3UQYS 5D1HA 2I78A 5A0TA 3TB4A 4KU4A 3WDMA 2CGEA 1P5HA 3T06B 4FCWA 3ICPA 3KVVA 4RO0A 2QK4A 5DNEA 3SHVA 2E0IA 4WA7A 2H8GA 5DU2A 1T3TA 1SA0A 3KUUA 1VE3A 4JYMA 3AJ9A 2PH7A 5FT9A 1ZCBA 5D8DA 2DR0A 3DBLA 1SKAA 1DV2A 1T4GA 2QTTA 4MPDA 2NPFA 3EGXA 3U4AA 3EVTA 4NG5A 4W5NA 3E1GA 1D6SA 4ZMSA 3ER6A 2FZGA 5AUOB 3SR3A 3GVPA 5ALIA 1LC3A 3M6VA 4URZR 4QAJA 1JE1A 4DLXA 5BWLA 1FS6A 1RFLA 2UYYA 3HDQA 3QYPA 4TS3A 3KETA 5HUHA 3KUXA 1QIKA 3VVMA 2HJ9A 2FX2A 2QN2A 1GL9B 2ZW9A 5BUCA 4RA9A 4BNGA 4N8DA 4C05A 4AQ7A 5EIAA 2BFDA 4FD3A 5ALXA 5JTUA 4CIXA 1W0CA 4IXMA 2QNBA 5A2QA 1I2CA 4L5AA 3WLKX 4IRMA 1H0RA 2J3DA 4EH1A 1JFSA 3NHWA 4YRAA 4HNSA 3MCUA 1V5FA 4Q3OA 3O3MB 4YA6A 1COZA 3QBJA 4ZQIA 4B43A 4P82A 2IFTA 4D3XA 4PBSA 4QUEA 2OC9A 3BRSA 3AI2A 1OWOA 4E5YA 1OXXK 1E6CA 4HQLA 1G5TA 1XC7A 1QM5A 4REQA 1Y33E 4EFMA 4U8HA 4GYJA 4BNDA 5BR8B 1ECJA 2VT2A 1HDRA 4PG4A 4RK4A 2JI9A 4P4NA 1V7ZA 3N1UA 1ENPA 3GUHA 3VQTA 2D06A 4K9DA 3QLJA 2D1YA 2QDKA 4WA8A 4XA8A 2O1SA 4HN2A 3W8RA 3NOVA 2YJ5A 4JEIA 1OFIA 3ADCA 4KN9S 5HFNA 3FCYA 4G5SA 1BD3A 2AHOA 2NU8B 3EVDA 1Q2UA 4A6EA 3BORA 3HJUA 4UHKA 4PYJA 5DGXA 3T6KA 1O94D 3ZKWB 4MVYA 5MN5A 4DB4A 3JD3A 1PGQA 2ZQ5A 4RKWA 1CZUA 4RF5A 2O54A 2QTBA 2F55A 1VSVA 3D4PA 1YE3A 4D0NA 1KXZA 1Z82A 3THYA 3FUWA 1XNQB 1BXRA 5AW8A 1K8QA 5HILA 1RMQA 4AS3A 2GRAA 1L4HA 1XVUA 2PAAA 4CR7A 3GBPA 2YN4A 1ULUA 5BNIA 1KSHA 4WI1A 4A0QA 5AW7A 3MS7A 1CQWA 4Y3UA 1D0VA 3QTTA 2QUZA 5EG5A 3LP6A 3IKJA 1N2OA 4H7KA 1PGJA 1KFCB 3AIIA 2Q28A 1N6HA 1SOAA 1ICIA 1J8YF 2GOYA 2MJLA 2VQDA 3DP7A 4RJTA 1YJ8A 2HLHA 3QBEA 3D8NA 3TEFA 1V25A 4R5MA 3UT6A 3CZAA 4BLPA 4CKYA 1GAQA 2NIPA 2P9CA 3KVNA 1ZISA 4L6IA 1SC9A 4FHDA 3RWBA 3EPJA 1RQPA 5FWXB 3B1FA 1SKUA 1DAGA 2RHCA 2J30A 2XCQA 1XLVA 3P97A 4PXAA 3QTBA 5E4TA 4B48A 5CLJA 2GQ0A 3I05A 2H7XA 3ONEA 1V4BA 3LDFA 4FQ7A 1M10A 2XAUA 3IODA 3VPAA 2GARA 4PX3A 1B00A 4FD2A 3EZXA 3EYAA 3OT1A 4Q1CA 3B38A 5JSQA 9ATCA 1Z5GA 3KD3A 2PWAA 2Q2QA 2HLDD 3RYCA 1JHPA 1UBOS 3KG2A 221PA 1SIWA 2JFVA 2A94A 2GD6A 1JSRA 3K5PA 4EMUA 1TF2A 1C7QA 1L5YA 1YI8A 3C39A 3LH5A 1ONBA 1KK1A 1Q1EA 2QY6A 2WFLA 3IQWA 5G40A 2IYVA 2KPOA 5FBZA 3G5TA 4F3TA 2QV7A 3K6SB 4EAQA 1X1TA 3EIHA 3R6GA 4G56A 2XYRA 2QUIA 2FPPA 3SKXA 4G89A 1X15A 3DAGA 4KOAA 1JHDA 3ADDA 2GEKA 5J2UA 3QYFA 4NQRA 3C8MA 4HAVA 4DMCA 2WM9B 3LECA 4UM5A 1UBJS 2I71A 5FR1A 5BRNA 3S1AA 3N2NA 4B3XA 1HYHA 3H3XA 1A9QA 4FXOA 5TV2A 3L79A 4A26A 5LXTB 3HU2A 1XKLA 3R23A 1PCXA 2VQ6A 3HO8A 2C95A 4FOLA 3EA5A 4E32A 1I2BA 3K6KA 3CZCA 4NAUA 3OESA 3B6MA 5P21A 2RBGA 2HM7A 2PNJA 4KW7A 4M76B 3BMNB 4RQUA 2VPZA 3KT6A