4CMEA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 249
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmeA00
4XYMA 4MVJD 2Y0CA 1N1GA 2HU2A 3ZV4A 4OOFA 4GX0A 2DAPA 2RH8A 4NQZA 3U5TA 2AE2A 1VSUA 1YS4A 3Q2KA 4TRNA 1O89A 1DHTA 4NU6A 5DF1A 1FDWA 3PGXA 1RM4A 3D5QA 2O3QA 3W6ZA 1NR7A 3WBBA 2DBRA 3S2FA 2V7PA 1VKNA 4W4TA 3V1YA 3EYWA 1FMCA 4UUOA 4A27A 1KEVA 5EQFA 1A72A 1WZIA 3AOEA 5JW6A 1Y1PA 3UKOA 1ZIDA 1QP8A 1ISFA 5KCZA 1KS9A 5GZ1A 3AWDA 3OHSX 4CM3A 4BNXA 5BNTA 3H5NA 3FPLA 3PQDA 3OA2A 2QX7A 3DMTA 1XG5A 1GR0A 3GFGA 4R3NA 1ADFA 1N7HA 2BFAA 4II3A 4NK5A 4YJGB 4YJGA 4FPXA 1BWSA 1S6YA 4ALKA 5L4SA 5L7WA 1MFZA 3Q2IA 4LCJA 1E7RA 5KVCA 3WWZA 3CMCO 3UUWA 2V6MA 4OQZA 1O95A 4URFA 4XYGA 2QRLA 3QRWA 2OXIA 3ICCA 1MB4A 5CDSA 3OMLA 3BTVA 3AOEC 3VPXA 3V5NA 4PRLA 3JQ8B 2BD0A 3VPSA 5KJ1A 3JQ8A 1DC3A 5AQ1A 1EE9A 4TRJA 3MJTA 4TRRA 2VYVA 3PK0A 4F46A 3VZPA 5DBIA 1YDWA 2DFVA 5G4LA 3DMTC 3QVXA 3TQHA 1ORRA 2Q46A 3IJRA 3GGGA 1T2DA 1E3SA 3RU9A 1KVTA 2Z1NA 3INRA 1PJBA 3K31A 2JFHA 2W2LD 4CMAA 2BH9A 3CPSA 1JVSA 2FPIA 3B70A 5HRUA 4XA8A 5KKAA 1HRDA 4WLEA 1NHWA 1E6WA 2O4UX 3QVTA 2RHCA 3TZQA 2PZLA 2EJVA 4KOAA 3KYCB 3KYCA 5L4LA 1JDJA 5L95A 3ZWVA 1MC5A 1ZVMA 3EW7A 3PJEA 7MDHA 1UDAA 4YCAA 2JFGA 1C0KA 4J49A 1UH5A 5A3VA 3P2YA 5BR7A 1ENYA 4H16A 2A4KA 3HG7A 5ES3A 2XAAA 1GDHA 2HRBA 1XQ1A 4CLHA 2CF5A 1PX0A 4Y6SA 1E3EA 1U4OA 4GX5A 4OL9A 2C7VA 1QYXA 3GNTA 3HFGA 4OXYA 5AXAA 1NQOA 2O23A 2QHXA 4J4BA 4LGVA 4OXNA 3RU7A 3U9LA 2IYOA 3ORFA 3NJ4A 3HADA 2FPPA 4CM7A 5COBA 2I65A 4BL5A 4E2XA 1BXGB 3PQFA 4JQCA 2YHIA 1BXGA 4LISA 4QECA 4L4XA 4ND2A 5HBRA 4B3JA 3RI3A 2X4GA 4CUJA 1ZCJA 1MFPA 2FHSA 3SBOA 1Z74A 1OZAA 3PJGA 4IJVA 1U4SA 1P0FA 1PGJA 1RM5A 3KHUA 3LLSA 3PHLA 1Y5RA 2JKVA 4RDIA 2A35A 4FFRA 4BNIA 3PWSA 1ZW1A 1Y8RB 4R3WA 3UGKA 3QJ5A 1E3IA 1Y8RA 3KEOA 2VOJA 1YB5A 2OHXA 1VRWA 1CERA 1R4MB 1NXQA 2O3JA 1R4MA 1HZJA 3RAJA 4ALJA 3NDRA 2DU8A 5IZCA 2X23A 1PWXA 4OO3A 4D0RA 3SJ7A 1OOEA 1UJMA 1XELA 1E7QA 4BGIA 2X0JA 1M67A 3H6KA 3GVCA 4IDBA 1E3WB 2NVUB 3QLJA 3PFWO 1E3WA 2FMUA 2NVUA 4W82A 1VJTA 1H6DA 2VRCA 2V65A 2A92A 2EW8A 4PLCA 4UEOA 1QSGA 2GNAA 3GG2A 2JD0A 1JAXA 5A1TA 3QP9A 3WS7A 4BO7A 1GQQA 3ZW9A 1H9AA 4NNJA 4BKRA 1QYVA 4ALMA 1H2BA 1Z75A 3B1KA 5LC1A 3RBVA 3K73O 4IS3A 4CLOB 3PVZA 4ZQEA 3GNQA 4ND4A 2YHUA 2WD8A 4BNZA 3MTGA 3D3EA 1H2HA 2X9GA 3VPFA 4I9HA 1Z45A 5ILGA 5DDIP 3W8EA 2NTJA 1LJ8A 4NK4A 3K2BA 3VZQA 1Z73A 3IIEA 2Q4EA 1LLQA 3IMFA 4UEKA 4GKBA 3VH1A 4RPGA 4WCDA 5IZCC 1H6BA 4ZQFA 1EDZA 1ONNA 3KETA 3MJEA 1B7GO 3I6IA 3F1LA 4HFNA 4FQ8A 1GFSA 2DPGA 4DL9A 5JSFA 2VZ8A 4I5EA 2PTGA 3EVTA 4YACA 5F5LA 2PA3A 4S1VA 4XGNA 4BVAA 2ZJ0A 1B14A 4CODB 1U2GA 2IEBA 3D64A 3VH2A 2PD3A 3ETGA 5ER9A 2Y1GA 4JN6B 2P5UA 2C20A 4MVJP 3EC7A 3AM5A 3WMWA 3FCOA 2Y0DA 1PGOA 4RVFA 3AUSA 3PLNA 1PTJA 3HUDA 3FSRA 5KJ6A 3BYZA 3E5MA 4CV2A 1WNTA 5H81A 3WTBA 4DIOA 1U1IA 2ZQZA 4HNHA 4TQGA 4EDFA 4PVCA 4XYBA 3P19A 1PJ2A 4DQXA 1PJ4A 2X22A 4QX6A 5JXWA 1KERA 3ANMA 1YL6A 4D0SA 1Q0HA 4MVJA 4N54A 1FDTA 1R37A 4AICA 4CM6A 2CDAA 2EP5A 3GEDA 4NIMA 3A4VA 4RF4A 4KP7A 1GYQA 1W8DA 4GMFA 3LDHA 2UDPA 5GZ6A 4YQYA 1P1KA 3QSGA 1B8UA 4P8RA 1E7YA 4BGUA 4E4YA 4RLHA 4BQPA 3E03A 3CSDA 1ENPA 4WEOA 3I5MA 1YL7A 1WDMA 1EK5A 1PQWA 3DZJA 4PG8A 3VH4A 1LDMA 1CQJA 2HAEA 3DHYA 4MIYA 4RPJA 4W9NC 5CFZA 5BNFA 2ZQYA 3HDYA 1GQYA 1ZSNA 1VL6A 3NV9A 5AXCA 3WFIA 4N5LA 4JK3A 5C7LO 5FFFA 3TNLA 3MWDB 1DFGA 4TRMA 1ADCA 3V1UA 3UCFA 3F47A 1PQPA 2ZYDA 4FGSA 4NBWA 1ISJA 4OAQA 4Y67A 2EKPA 3RJ9A 1DC5A 2EGGA 3EK2A 2VN8A 5DT9A 5CDUA 4B7XA 1DAPA 4L4SA 3L07A 1ZSYA 5JLAA 3GVHA 3EUWA 2EWMA 1UDBA 4KMSA 4QQRA 3HB5X 3OH8A 3P5SA 4DPMA 3PIIA 1K3TA 4DMMA 2NU7A 3JQBC 1QORA 3R3SA 4WGGA 1YQXA 4YXFA 2BI7A 2WTBA 4NR0A 5BSEA 1X0VA 4OM8A 1LU9A 2PZJA 3EZYA 4W7IA 3O26A 4CM9D 5G4KB 1TA4A 5G4KA 3ROQA 5JO9A 1LDEA 1JW9B 3E6AA 3EZLA 3JQAD 5EMHA 3F3SA 4D46A 1QV6A 5C37A 1HE2A 1CRWG 3H5AA 3Q11A 2WDZA 1TT5B 3UF0A 3W8DA 4IDDA 1TT5A 2JAPA 2IZZA 3G49A 5L4NA 1I2CA 1KY5A 3LT0A 1EVJA 3ST7A 1MA0A 1T4BA 4K26A 2P9EA 3PHGA 1OAAA 1NQ5A 1HYGA 1LBEA 1XEAA 2J8ZA 1X7DA 2C5EA 2HKIA 1NNUA 3DXFA 2ILTA 4YAIA 4DPLA 1MC4A 4DRYA 3FTNA 5JYEA 4BO3A 4H15A 1NHGA 4I5GA 2W2LA 3C1OA 3ROMA 4BOYA 1T2CA 5I9MA 1I33A 1J0XO 2CY0A 1PJQA 1Z6ZA 3CMMA 2Y93A 4TKMA 4WPGA 3WJ7A 3E5RA 4IBOA 4CJXA 3WQSB 1YBVA 3NTQA 5TX7A 3U09A 4AJIA 4R1NA 4CMEA 3F46A 2Q2QA 5A04A 4L9RA 2PFGA 4O5OA 4FDAA 5T64A 2W98A 4HBGA 3OSUA 4Q3CA 4RV9A 4L4RA 1M75A 4PG6A 1WP4A 3ZV3A 2BRUA 4IUYA 4RORA 1JVBA 3NTOA 3WR5A 1DFIA 4Z9FA 2B5WA 1GYPA 1I3KA 1T1SA 3RQSA 3DHNA 1HTBA 4MKZA 2AEMA 4G5HA 5TSDA 2Q99A 2GZ3A 2WWRA 1KEPA 1ISGA 2Y05A 1F8FA 1F06A 2HMWA 1GY8A 3MJSA 3WQRA 5GY7A 4JBGA 3CKYA 1C0LA 1M6HA 4E12A 1R4NB 3DBRB 4LRTB 1CETA 4WE3A 1R4NA 4YAEA 3KYBA 3ADOA 3OBBA 5IF3A 3GFBA 3ZWMA 2IDZA 4YBZA 4NBTA 4JP3A 1WVGA 1LDNA 3H2ZA 4Z0PA 1WPQA 4CMEC 1R12A 1XLTA 4GLLA 1N2SA 1P3DA 1GADO 2AG5A 3OJFA 3ZNOA 4BMSA 4AJOA 3GF4A 4U8GA 4YPOA 1IY8A 2VUUA 3WGIA 2AW5A 2IZ1A 4M49A 1PQUA 1PS8A 1YGYA 4WLFA 4D44A 1HSZA 2J5QA 3PI7A 2FZWA 1LQTA 5IDYA 3JQDA 2Q1UA 3DB2A 1OC4A 3F1KA 3CE6A 3HN2A 1PS0A 1YRLA 4J2OA 2JD2A 4B7UA 1FK8A 2WYWA 5EN4A 1F0YA 4IJKA 1KBZA 3AU9A 4DIBA 2ZTVA 3JQ9A 2YDYA 3DAGA 1IZ0A 1LX6A 4C7JA 2Q50A 1B2LA 1VKOA 3CZRA 4AJEA 1EMDA 1BGVA 4HV4A 1T24A 4D45A 4AG3A 4RJTA 3AY7A 4BQRA 1KY4A 2GDZA 2ZB4A 3WX0A 3DC2A 2EEZA 5EESA 8LDHA 2YW9A 3M2TA 3PWZA 4HXYA 2PH5A 5B4TA 5TIIA 1ZFNA 3MOGA 3H9UA 2I66A 3RUDA 3HWRA 1UR5A 2PGLA 4W99A 1PJCA 3AUAA 4PFJA 1CWUA 5CDGA 1MG0A 4PLGA 1UP7A 1U3TA 3GAZA 3GC6A 4ND5A 1LI4A 3VPHA 4GSLA 1DDOA 1D1SA 5F1OA 4TVOA 2DFDA 3N7UA 4CMIB 3JQ9C 1JWAB 4ZQGA 4CM1A 2X6TA 3JTMA 5K6AA 2VHXA 3MWEB 3D1LA 1XDWA 1TXGA 3QWIA 3AUUA 4XB1A 2EP7A 3OEWA 4DLBA 4EUFA 3H9QA 3F5SA 4PLPA 1JKFA 3GZNB 1BW9B 2DPHA 4IPTA 5KWEA 3GZNA 5IDWA 1BW9A 2NU6A 5HS6A 3VZSA 2Q45A 4B8WA 2YQ5A 5FF9A 5FEUA 4ID9A 5CPBA 4OGWA 2P5YA 1H93A 3B1FA 2JHFA 3A14A 3GRPA 3VTFA 1XCBA 2HUNA 1GUFA 3VVCA 3GEGA 2H9IA 4RLSA 4IGFA 5JCJD 1PR3A 2WYUA 1EBFA 2GPTA 1LDYA 1E1LA 3W4JA 1V9LA 1A7KA 1KOLA 2QZ9A 4LCEA 3WQQA 2WE8A 2IEDA 4WNCA 5ENVA 3RFTA 3ZWOA 4IIUA 4N7RA 1NFFA 3VVBA 2ZIZA 4IQ8A 3LU1A 3RC9A 4BIIA 3ZV6A 4MDHA 1YL5A 5KJEA 1ZXLA 3WXBA 1LRLA 2NWQA 5ICMA 3DFUA 4BNGA 2GCGA 2OP1A 3ZN2A 4PRKA 4LSMA 2QIOA 4UVDA 4C4OA 4HADA 4BNUA 1DO8A 3GN2A 3GMSA 3DOOA 3VHRA 1UAYA 1NWCA 3M1LA 3ANLA 1W4ZA 1ZMTA 2I76A 2NUAA 4JP2A 5A4DA 2NNLD 4D7AA 1DRUA 1E6UA 1YO6A 3UCEA 3PLRA 1A9ZA 1DEHA 5JE8A 3ZWNA 4CM9A 2OMEA 2NLOA 3VC7A 3NDIA 2P9GA 3FD8A 3IS3A 3Q0EA 3S8MA 1Z7EA 3JQAB 4Q39A 3OJOA 3JQAA 4DQVA 3PDUA 4BO8A 5A02A 1JWBB 3HE3A 3OJLA 4W6ZA 1D7OA 4RF2A 2DUUA 1XIVA 2IXAA 1LLDA 3ZHZA 4CM4B 2Y0EA 3K6JA 4RO0A 5I8WA 5F1PA 1QKIA 2GN9A 3ROPA 5G0UA 2PKRA 2RCYA 3NGXA 1LDGA 3BTOA 2ET6A 1WAMA 1NVGA 3LK7A 2PV7A 2AG8A 4M8SA 4WJZA 3PZRA 2EXXA 3C1TA 4FR5A 5TJ9A 5FYDA 4XDYA 3ZWAA 6LDHA 1ZUD1 3H4VA 1HE5A 3ON5A 2IZ0A 2GR9A 3ZNNA 4CV3A 3ITKA 4HUJA 4R1SA 3ROKA 4PG4A 3KUXA 1XQ6A 2D3TA 2VHWA 2B35A 4QXMA 1P1IA 1LLUA 1BDMA 4INAA 3EHEA 1E6EA 4FFLA 1K6IA 3GY0A 1IHXA 4IQ0A 2X5JO 1PGNA 4WECA 1U5CA 1WDKA 5DCWA 3HDJA 4PZEA 4CLXA 1QYDA 1OC2A 5CHEA 2X5OA 3RCBA 1YB1A 3KYDB 4K28A 4DVJA 3JQ7B 1VM6A 1IULA 2ZTUA 4NZ9A 4Z9YA 4KDFA 1H6AA 2O4CA 3BIOA 5A06A 1ZNQO 4BO2A 3ZU5A 2HRZA 2JD1A 4LMPA 5ILOA 4FJ0A 4R01A 1M76A 1WLYA 3INTA 5B12A 1YONA 1DLJA 1YKFA 1R16A 1VSVA 3MZ0A 2E82A 4J1TA 4L73A 4WNIA 2JJYA 3BMOB 3OQBA 3BMOA 1H94A 1W6UA 2ZK7A 1Q1NA 2B4RO 2O3SA 2QQ5A 5AOVA 5JS6A 2BF7A 1P31A 1HDZA 1X7GA 4WLOA 3SX2A 4ZRMA 4R54A 3BHIA 2BELA 3VTZA 4ALIA 2ZATA 2LDBA 1P1HA 4DMLA 1LNQA 2H63A 1JAYA 3JYPA 3RFVA 4FS3A 5T6BA 4J1NA 3ZWYA 2GN8A 1Z82A 4XKJA 4XQGA 3PJDA 3DAFA 4E2WA 4EJMA 2PGJA 1R66A 3D4NA 1RYEA 3GAFA 3KBOA 3NJ8A 3I9NA 2VTEA 1QMGA 3Q9NA 3WLFA 5TC4A 4FD3A 4DC0A 3NDJA 1NAHA 1IE3A 3U62A 2B83A 2YFHA 3R6DA 3BMQB 4BS9A 4TMFA 1YOVB 3BMQA 1YOVA 3B1JA 1PSDA 3JV7A 5HA5A 3BTUA 1MGOA 1FF9A 1DC4A 2YV3A 2BGLA 5BQFA 4DYVA 5KJFA 4D41A 2YJZA 4F6LA 4R9SA 3LT1A 4J1SA 2CD9A 4YAKA 4NH4A 4CQMD 4MOWA 1C1DB 1B15A 4BNWA 1P44A 2DTDA 1C1DA 4IM7A 3WOHA 4JIGA 4RF5A 1X14A 4YTEA 3T7CA 1GU7A 3ETDA 4OSOA 3VKUA 4DWVA 4XCVA 2BGMA 1I24A 3WSVA 2Z1MA 4UUMA 1NPTO 4E5MA 3KRTA 4GVLA 3VH3A 3WG9A 3AFMA 1UDCA 4Q9NA 2X8LA 3QWFA 4GX1A 3I52A 5KVSA 1MV8A 2JHGA 5DCYA 1NBOA 4CLDA 3QE3A 3RC1A 8ADHA 5IDXA 1JKJA 4GLOA 3GVPA 2QRKA 3JYQA 2NU9A 3ZH2A 3PFFA 3KM0A 3PYXA 1UUFA 3W8FA 1X7HA 1CIVA 3LT4A 1QLHA 3ZW8A 2NV6A 4K1LA 4HKTA 1JN0A 3TZKA 4DBVO 1EQUA 5C7IO 4XR4A 2QYSA 2GF2A 4IZHA 4NBUA 4MVJF 1AXEA 1YQDA 2B37A 3K96A 2BLLA 4RZIA 2PWZA 4MIOA 2OZPA 1FXSA 3ONEA 1OFGA 4NFHA 4RQTA 1O9BA 3W1VA 5EL0A 3U0BA 2PKQP 1Q0LA 4E13A 2YHIB 4HFMA 4CM5A 2Y1OA 3IKVA 1GEEA 4FFOA 5JCJA 3JYLA 3BAZA 3ZU3A 5J23A 2IE0A 2I67A 5H83A 2W8ZA 4YR9A 2I3GA 1Y5MA 3DL2A 3OIFA 1Z7BA 4MVJM 5IFLA 4YDRA 4D3SA 1NYTA 1S7CA 4PGFA 1J49A 4RPHA 3CEAA 1LQUA 4YJFB 1E0DA 4YJFA 3C1AA 1XWFA 4P4NA 3W4IA 3ZV5A 3RKRA 1O8CA 3BZUA 1E1KA 1LEHA 5MGBA 2Y1DA 5T8KC 3Q9UA 2VHYA 3JCZA 3GDOA 1EUDA 3IJPA 4X54A 2CNBA 5LCXA 1EE2A 4JROA 4FFNA 1SOWA 4NHEA 4XZ3A 1CEQA 1H9BA 1YVEI 3CH6A 4YJHB 3GGOA 1ZJZA 2NVWA 4YJHA 5I9NA 2BFPA 5TRTA 5CG1A 4AFNA 3I6QA 4XRGA 1GPDG 3K2EA 4ZQBA 5JC8A 1MG5A 5BSFA 1Y8QB 5A9SB 1Y8QA 5IXYA 4IIVA 2O3UA 1OBFO 4WUVA 5A9SA 3U49A 4OKNA 1EBUA 1B8PA 3BA1A 5EIOA 1Y9EA 4RVDA 2OL4A 4BGVA 4J3FA 2Z95A 4RGBA 2X0RA 4PZCA 1V35A 3MEQA 1DRVA 3D7LA 4M55A 2IYPA 2HDHA 1BSVA 4YEDA 3VZRA 4CV1A 4DUPA 2O3RA 4ZN6A 3FWNA 2AHRA 2EF1A 2J3HA 2VHVA 3H7AA 2ZYAA 3D5TA 4BHTA 3I3OA 2BKAA 1BXKA 3GHHA 4UEJA 4HY3A 1PR9A 1T25A 4JJIA 3M6IA 4EYEA 5A9RA 3CINA 1ZK1A 2GUGA 2P2SA 2R00C 4R51A 4CMJA 3MTJA 1C3VA 1BRMA 3LLVA 3JQEA 3IL2A 1E5QA 1KYQA 2CVOA 4IDEA 1BXZA 3PIDA 1GCOA 4NBVA 1ZO8A 4AJNA 4W9NA 4LVUA 4B4UA 3F4BA 2I99A 5JFOA 2VYND 4H7PA 1DHRA 2POQX 3CXRA 3IUPA 2DVMA 3WGZA 3ZNPA 3G0OA 3JSAA 1WZEA 3U4HA 2E48A 2GYYA 4NG5A 3DHEA 1MXHA 4YB8A 3EDMA 3N74A 2PNFA 2G0TA 2EJWA 3MJVA 1G0OA 1A4UA 3FTPA 4NDNE 3IUSA 1AGNA 5ITVA 4KTTE 5G0TA 1PJTA 3ONFA 4AJKA 4C7KA 1HKUA 3AI2A 2J3IA 5JAQA 4LVCA 3ZNQA 5TLSA 3JQBA 5COAA 2WYVA 3O03A 3RC2A 4BO6A 4YJDA 3GK3A 2JCVA 2NVBA 2WSBA 2PLAA 2PR2A 4N5MA 1K2WA 1NFRA 1J4AA 1R6DA 4YQZA 4XDZA 1G0NA 2FR8A 3PJFA 4YYZA 1K5HA 4FFPA 1MLDA 2CDCA 3IDSA 5KNLA 2EIHA 1KETA 3S2IA 4CMCA 3NGLA 1PJ3A 5L7TA 1HSOA 4FGWA 2V6GA 4WEQA 2HK8A 1GYRA 5G0SA 1A5ZA 1ZXBA 3H9EO 1U3UA 2OP0A 4BB6A 3OF2A 4FJ1A 1O6ZA 3PP8A 5HS4A 2A94A 3AY3A 3RC7A 2I6TA 1ZJYA 4U0JA 2Y1EA 3AI1A 4M87A 5AVOA 3Q3CA 3SEFA 1EFLA 3GEMA 4JJFA 3C3XA 3RD5A 1ZMOA 2EKQA 1F17A 1FJHA 4ITUA 4FOSA 4RCVA 3WMXA 3WWYA 4FFMA 4DTIA 1E1NA 1PEDA 2RBEA 3WICA 3K30A 3FRJA 2ZCVA 5IAAA 3NKLA 3NYWA 2AA3A 4B4VA 4BNJA 1GZ4A 1R15A 4MO2A 4MKRA 4Y9DA 4D42A 1WWKA 1BDBA 1KEWA 1NVTA 1YJQA 2X9VA 4KUEA 3ZZNA 4J4TA 2ZJ1A 3ZGYA 5B4VA 3JYOA 1CYDA 3OJ0A 1UP6A 2EGHA 3UHAA 1BVUA 3SLGA 4Y98A 1AHIA 3ZDFA 4LN1A 1SMKA 4CQMB 5A9TA 5F5NA 4CMHA 4CQMA 4QFCA 3A28A 4GWKA 4XD2A 3F6YA 1B26A 1E92A 1H0KA 4XIJA 1X1TA 4R69A 4F3YA 2Y66A 3WFJA 1HLPA 1T26A 3AFNA 2D4AA 2D2IA 5B37A 3T4XA 3GZ4A 5CEFA 1T2AA 3WNQA 1EQ2A 1Q0QA 4EEXA 2PGDA 3LQFA 4E2YA 1HE3A 3DONA 2DTEA 4IDFA 5ICSA 1F8GA 2I5PO 2PK3A 4L8VA 4R1TA 3RVDA 1I8TA 4BNTA 3GG9A 3RUFA 2ZB7A 1MX3A 4MP6A 4A10A 3UW3A 1QV7A 4ZICA 1NX6A 3RUHA 3VPGA 1R0KA 3KEQA 3A1NA 1PZHA 3E82A 4TSKA 4TVBA 3QWAA 1P9LA 1KC1A 3ETEA 2YV1A 2OGUA 1G6KA 3ICPA 4GKVA 1SOVA 4FW8A 4Y6PA 4R68A 5HTOA 2FR0A 4E5KA 4BO0A 2G1UA 4K6CA 4XJSA 4YAGA 1P1FA 4UAGA 1SZJG 2DBVO 3DOCA 4XWYA 2HK7A 2CFCA 4ALNA 1K89A 5KVVA 4IMPA 1PJLA 5F1KA 5DN9A 3JD1A 2JFFA 4K9DA 4QEDA 1TB4A 1DC6A 3R3JA 3BMCB 3BMCA 1MUUA 3P7MA 4MIEA 4ND1A 3WGYA 3GNSA 1OI7A 1ARZA 2VQ3A 5LDHA 5CDYA 4O59O 4HFJA 1TLTA 2E6UX 3C24A 4PLFA 4A0SA 1EUZA 4OXKA 3OA0A 3G3EA 1VLLA 2NADA 4G81A 2BFOA 3KV3O 1LC3A 5TT1A 4O6VA 4YT5A 1E7SA 4XX0A 1F12A 3QVWA 2F1KA 3OICA 3PWKA 3DZIA 1L7EA 3TZCA 4JXKA 4PLZA 4BV9A 1U7TA 3ASVA 5C5IA 3S2EA 3LC1O 3AY6A 4FN4A 1PU2A 3SXPA 4DC1A 3E18A 2FY8A 2C82A 5IG2A 3RBZA 3VAZA 1DIGA 1Q7CA 2EKLA 2VNAA 5KIAA 4DA9A 4NMHA 5CG2A 3TDKA 2HQ1A 4EEZA 5JYDA 5TT0A 3KO8A 2XOXA 3H5RA 4FC6A 1K0UA 2RH4A 3IC5A 4HP8A 2G76A 1P1JA 2FOIA 4IJWA 3UOGA 1PIWA 4J4HA 2P91A 4RVSA 2UAGA 2OBNA 3GT0A 4EBFA 4EJ6A 1C14A 3L6DA 3RJ5A 1DIBA 2F00A 4BB5A 2AQHA 3IAHA 4DQUA 3VDRA 4E31A 1WW8A 2J5KA 3DEYX 3W4KA 3FNEA 3QY9A 1E77A 2GASA 1U8FO 1GUYA 3JQGB 1ML3A 1I30A 3JQGA 1Y6JA 1N92A 3H3JA 3CUKA 2YY7A 4I5FA 1AUPA 1SBYA 2VZ0A 4GMGA 4PLWA 1W0CA 2VYVD 2UUPA 4J7CA 5DP2A 3ZWXA 1SAYA 1JLLA 2HMUA 3OQ1A 1ISMA 1RM3A 4LRSB 3T7EA 1BTOA 4HNGA 3JD3A 4GBJA 4YT4A 5TNXA 1XR3A 5IJZA 4N18A 4RPKA 3DZKA 1N7GA 3AI3A 1ZK3A 1VL8A 5IN4A 4R16A 3FN4A 3KSZO 3TZHA 4Y8VA 1EDOA 1WXDA 1YBMA 4EGFA 1C1XB 1C1XA 1CQIA 1A4IA 3VOSA 1O94A 4Z3KA 2XF8A 5H82A 3RROA 4UVHA 3SJUA 3AU8A 5JMPA 2WMDA 4JBHA 4KDEA 1V3TA 1Q2XA 2PKQO 2Q3EA 4R9RA 1KVRA 3K9QO 1VE9A 5IN5A 1I3NA 3HFSA 3O9ZA 3KSDO 2J6IA 1CJCA 2R2GA 1ID1A 3TL2A 1Q7BA 3OQ6A 5F21A 4DIFA 1SC6A 4GI2A 4RL6A 3DFZA 2TMGA 2V6BA 3OJEA 1DJNA 3QWBA 4R4JA 4A5OA 3PYLA 5JDCC 3DO5A 1XSEA 3MCVA 2NTVA 4M1QA 2GN4A 4A2CA 1HDCA 1KVQA 3WSWA 1NQAO 2O2SA 1VI2A 3NT4A 5G2OA 1I01A 3C7AA 3D4OA 1UXHA 3UICA 1A71A 5JPIA 3F5QA 3DTTA 4E0BA 1BG6A 5A5EA 3QIVA 4WLVA 4DGSA 3HQ4O 5U4QA 1GZ3A 4P22A 1JU9A 3OETA 3I4CA 5DOZA 4A73A 2P4HX 1LSUA 4Q3DA 5JAMA 5KKCA 1RJWA 1C0PA 3RBXA 1V8BA 2DKNA 4AVYA 4UUNA 1GZ6A 3GMDA 1H6CA 2IODA 3E9NA 4PLHA 3F4LA 3ITDA 4OMUA 4YRBA 1ADBA 3GA0A 1IB6A 1PZGA 3JQFC 1V0JA 4L75A 4B3HA 5A5FA 3EVNA 4I9NA 2CDBA 5L45A 2OORA 4LMRA 3HSKA 3V2GA 1I3MA 2OUIA 3RUCA 1NQTA 1TI7A 2UV8A 3KSUA 1SEVA 3LZ6A 1G1AA 3INGA 1LC0A 1EFKA 3QQPA 4OQYA 2AE1A 3PYMA 3DBHA 1OMOA 4B7CA 1U28A 1RKXA 4EZBA 4RVGA 1YJ8A 3WGOA 2ZB8A 1GD1O 4OKIA 2PH3A 3UXYA 4ZGWA 1E1MA 3ADPA 3B20A 4NBRA 3GRKA 2ZB3A 4XEHA 2BHLA 2C0CA 3TRIA 1C0IA 2AQIA 2QRJA 4A26A 3LF2A 3PQEA 2CZCA 3WGGA 4OOEA 4FB5A 4HWKA 3RFXA 4MPDA 2P9CA 3DZFA 3FWZA 3DDNA 2X1HA 2VHZA 3DAPA 5JCXA 4J0EA 5F3RA 5HWSA 2VUTA 3RWBA 3OIDA 3SC4A 2QYTA 4GWGA 3FHLA 1I5RA 5JO0A 3L77A 2Y1FA 1DAOA 3RASA 4YRAA 2RAFA 1KVSA 3PZBA 4WKGA 1QXSA 1UXGA 2EV9A 2UYYA 5ENDA 1SB9A 1NPYA 1Y7TA 2CUKA 4K6FA 5I7SA 3TZ6A 4G65A 5KJCA 5I9LA 4JNKA 1JTVA 1VJ1A 2D59A 3DR3A 3GUCA 3QVSA 3GVXA 4P4GA 4E2ZA 1TT7A 2VWQA 1HWYA 2BGKA 2ZKLA 3PDJA 4BO1A 3I9JA 3MJ4A 1ULUA 3PGJA 5K0ZA 1DFHA 2Q49A 1HDGO 5BT9A 4F45A 5THQA 4DXHA 4J90A 2ZCUA 3L4SO 4IXTA 1U7HA 4LSWA 4PG5A 4U0KA 1PWZA 5G0VA 3WLEA 3F9IA 1U9JA 3JQCA 1GQ2A 3DBLB 4BNHA 4OH1A 3DBLA 4CUKA 4PG7A 3HNPA 4S3MA 4O0LA 2HCTA 4AJ4A 2PZKA 4NJMB 3KTDA 4NJMA 3QWHA 3COSA 1PL7A 5CDTA 3S55A 1ISIA 1LDBA 1XA0A 4CQLB 3FI9A 2Q2VA 5ITWA 4CQLA 4ONEA 4DREA 3I9MA 4FC7A 3IKTA 4Q3AA 2OBYA 3KB6A 3TWOA 2AXQA 2VCYA 4MVJI 2HMSA 3OM9A 2VUSA 2DUWA 2GLXA 4MJLA 1I3LA 3IQDB 4IGEA 4OIMA 1W73A 1UXIA 1DIRA 2B4TO 3TL3A 1RPNA 1PZFA 3X2EA 2O7QA 2G17A 4FCCA 2OO5A 4OYRA 1UAGA 4I1IA 2C07A 3PRJA 3DMYA 3S2GA 1SCUA 3PPIA 5A03A 4DBZA 3NAQA 2P68A 4E3ZA 2SCUA 1P0CA 2VTDA 3G1TA 4UUPA 4YVFA 3ZU2A 2UUOA 3C85A 2C5AA 3LYLA 3OP4A 5I7VA 3OECA 1U3WA 1X1EA 5L3ZA 1IYZA 4TWRA 4BV8A 4QFDA 4MP8A 4XGKA 4QO8A 2PD4A 1AN9A 1BVRA 3DOJA 4NFSA 4WASA 4KWIA 5DOVA 1ZBQA 1ZSVA 4GH5A 3ULKA 4R1UA 4ZRNA 1YQGA 1HZZA 3ZU4A 4QO7A 2Y1CA 5FWNA 1E3JA 2X86A 3AM4A 4BO4A 3N58A 4YWJA 2RIRA 4Q3EA 4XQEA 3C7DB 1FDSA 3WIEA 5JAZA 4XIYA 3U3XA 5CEJA 3MJCA 4J2HA 1ZH8A 4KUGA 1YXMA 1NTOA 1QLJA 1XKQA 3AM3A 2X7HA 3WIDA 5TGDA 2CF6A 4YAJA 4CMGA 3O8QB 4I5DA 3O8QA 2DC1A 3FF4A 1GL3A 5C3MA 1YH3A 2YV2A 3KVOA 3BHJA 1UZNA 1N5DA 1PJSA 5T8KA 3ABIA 4MVJE 4A03A 2FN7A 1EVYA 2UVDA 3GLQA 3D0OA 3VDQA 4J7XA 1UZMA 1ZKMA 1XGKA 4D3DA 3KXDA 2LDXA 2NQ8A 5JAIA 4ZJUA 5I8ZA 2AEJA 3ZI0A 4YT8A 3WGQA 1HDYA 1E3LA 1NP3A 4BMVA 1M2WA 3TOZA 2H5LA 4D79A 3R0IA 5AXBA 2HSDA 4XYEA 5EQDA 3WGHA 5MDHA 2ZTLA 3GH3A 4ND3A 3G17A 2J3JA 5JMWA 3I9KA 3MOIA 2NU8A 3H3FA 2GD1O 2VOEA 2I3AA 1AXGA 3GDFA 3RIHA 3LT2A 1GV1A 2HMVA 3BXXA 3Q1LA 4E6PA 4BKUA 3S1LA 2EG9A 1NASA 3UFXA 1T2FA 1T2EA 2YZ7A 4M89A 1JKIA 9LDBA 1HXHA 5C7OO 2BMAA 1D1TA 2R00A 3I4FA 5L9AA 2GRAA 1GCUA 2CMDA 6ADHA 2X9NA 1DRWA 3D3WB 4Y6RA 2BFMA 3SVTA 4M86A 3D3WA 4PLVA 4BMNA 2D1YA 1HDXA 3UAGA 4IMRA 4O63O 3PHHA 4CLEA 1O5IA 4BNKA 3LVFO 1HYEA 3EAGA 4QSMA 3WBFA 3ZWCA 3C8MA 5A3JA 2VWPA 1XYGA 5JY6A 1IHYA 1J6UA 3FR7A 3PTZA 1XHLA 4NU5A 4RF3A 2NQTA 3TFOA 4JLWA 5TS3A 2FR1A 1NPDA 4U7WA 1MXFA 4GX2A 3ZCXA 4R41A 1X0XA 3PEFA 3SC6A 1D3AA 2YUTA 3FNGA 1NM5A 1LTHR 1T1RA 4CLOA 3OEYA 4II2A 4XGIA 5GMOA 4PN3A 1IPFA 4XRRA 4AJPA 4TZKA 3V2UA 2HLPA 2ZYGA 3IP3A 2Q2WA 4ZA2A 4E5PA 9LDTA 3OFSA 4QTZA 3RUIA 4Q3BA 3KZVA 2QZZA 1IZ9A 2C2XA 5GZ3A 3PHIA 4MVJG 4ZU3A 1B3BA 1VL0A 1LXCA 1D8AA 1QRRA 3TPCA 1B16A 4KQXA 5ADHA 1VC2A 3QHAA 3E9QA 4J9VA 4PLYA 4B8ZA 4J0FA 3P2OA 3EGOA 2GSDA 1V3UA 2VWHA 3VKVA 4CM8B 2CSUA 4CM8A 5L53A 1IL0A 3B6ZA 1GUZA 1QG6A 3H2SA 2EW2A 1MP0A 4J43A 1P33A 4NFYA 4W7HA 1NR1A 5BSGA 1M6WA 4BNVA 4E33A 1ZEJA 2JCYA 3FBGA 4J1QA 3H9GA 1SNYA 1GPJA 4DLAA 4FIZA 4EW6A 5IXSA 2PD6A 4L76A 3GQVA 5COQA 3HN7A 3WDSA 5KOIA 3G1UA 5G0WA 1SB8A 4OSPA 2NM0A 4L0QA 3UH1A 3I9LA 1YDEA 4XJTA 5EINA 4PIVA 4HX5A 2RHRA 1BHSA 1YB4A 1RWBA 5I7FA 3EY4A 1N1EA 1TVEA 1NWHA 4GQAA 1EEHA 1HDRA 1DB3A 1P74A 2VWGA 1E7WA 2CVZA 4IS2A 1E7MA 4RPLA 5T57A 4KTVE 3RUAA 4CL8A 3NT2A 4EITA 5IDQA 3TF5A 1I10A 1NAIA 3TOXA 1T4DA 2CVQA 3GPDG 1KVUA 1QYCA 1U3VA 5ER6A 2XXJA 3I9OA 3IP1A 2PZMA 4TKLA 3L9WA 4QUKA 1LRJA 4FJ2A 1DJQA 1M66A 2HJSA 2W90A 2C7GA 4WK6A 4RVHA 4U6SA 1ZK4A 2DM6A 2NTNA 3T4EA 3DQPA 2YDXA 4AJLA 2J3KA 4RQUA 3FR8A 4B4WA 1HE4A 1YWGO 3DWFA 3HHPA 1U8XX 2P4QA 3QA9A 1NVMB 3SLKA 4DPKA 3KLPX 4Z3DA 1ZK2A 3KLMX 3U4DA 5DCUA 1UP4A 5L7YA 3QW2A 1UZLA 4MVJH 4BUCA 5B1YA 5CEEA 4BNYA 3U4CA 5THKA 1RM0A 3FNFA 3BHMA 1HLDA 2BI8A 1R0LA 3WYCA 2W2KB 3D4PA 3ZHBA 1LA2A 1LSSA 2W2KA 4JCOA 4AJHA 2D5CA 1SPXA 4CMBA 4WCFB 3HDQA 5JBIA 2WM3A 3FPCA 4WCFA 5AYVA 1HT0A 1KC3A 1FDVA 3I23A 4GL4A 1K6JA 1E5LA 2FSSA 4D3FA 4EUHA 3TJRA 1U2DA 1XU9A 1GV0A 4J91A 4NI5A 3WJAA 4J16A 5EERA 4JX8A 3AUTA 2W4QA 4PCVA 4PVDA 3GOHA 3QV1A 2GERA 2YYYA 2HJRA 4FSHA 1B8VA 1DIAA 3DZHA 1IUKA 1HYHA 2X0IA 1DPGA 2X58A 2GO1A 2O7SA 1ISHA 1ADGA 1A7AA 4JBIA 2E49A 1DBVO 2GZ2A 5JDIA 3AW9A 4MKXA 2E37A 5T5QA 5DNAA 2HK9A 2GN6A 4WCFC 1ONPA 5DZSA 4P4LA 3Q6IA 3R1IA 4A7PA 1P1RA 1LSOA 5FI3A 2OFPA 3H8VA 4CLRB 1PL8A 5CPFA 4CLRA 3JD4A 3LC2O 5K9ZA 5KTKA 4Z9XA 4N5NA 4TZTA 3L0DA 2JCXA 5JY1A 1Y81A 3ANNA 3DZBA 3ONDA 1I36A 2IXBA 3RKUA 3X2FA 3NRCA 3FNHA 4AJ1A 4BKPA 3BMNB 3O4RA 1U5AA 5EPOA 2HO5A 3BMNA 3K5PA 3NUGA 2YFQA 4WOJA 1KEUA 1KIFA 2VT2A 2OOSA 3ENNA 1SEPA 4OJNA 3I83A 4KWHA 4XR9A 1FDUA 4IQGA 3G79A 3UVEA 4R5MA 4B3IA 5JDIC 4JJGA 1J5PA 1LSJA 2R6JA 3JQ6A 3DBRA 4FOOA 1H5QA 1VJ0A 1P77A 3BTSA 3JYNA 3PHJA 2Y67A 2D8AA 1XU7A 1JA9A 2WEKA 1WMAA 2FRDA 1NFQA 5CP8A 4AJJA 4IINA 2H1SA 4GGOA 4IY1A 1R0SA 3AOGA 5A05A 3LC7O 4XQ9A 1L1FA 3I1JA 4UULA 2DTXA 3GVIA 4UREA 4CUZA 3WNVA 2DT5A 1Y9AA 4ZVVA 3EMKA 1I2ZA 2DBQA 3CTMA 4GSKA 4KQWA 1LRKA 1QYWA 2FWMX 4QT0A 2B5VA 3AJRA 3M2PA 4Z6KA 4XQCA 3E48A 2Q1TA 2AEFA 3O38A 4RDHA 5TF4A 1PZEA 4PLTA 1HDOA 4FBGA 3ZWBA 1EUCA 2FP4A 3V1TC 2DQ4A 4E5NA 4XYLA 1DSSG 2I9PA 2IRWA 3LSYA 1PL6A 4YT2A 2H6EA 1V6AA 2Q4BA 4O1MA 1K6XA 1TEHA 4PZDA 4UVEA 3GN1A 5AXDA 4XB2A 3E8XA 3ZHXA 4ESOA 2VT3A 3IOYA 3L6EA 4BKOA 5I7EA 2YQ4A 2XXBA 1D4FA 4CL3A 2B69A 4BO9A 5CAEA 4YA6A 3RUEA 3K8ZA 4J6FA 1EVIA 4CMKA 1YE3A 3A9WA 1CF2O 1DIHA 3H9JA 2O50A 3V8BA 2VNSA 1N9GB 5JDCA 1I2BA 3PXXA 4GVXA 5L51A 1N9GA 1A9YA 4CV0A 1L7DA 2VYNA 1LUAA 2G82A 4E30A 3WYEA 5B4UA 1P45A 4ZQHA 4P38A 3RSHA 5L40A 1DLIA 4JGBA 3HB4X 4LW8A 2C59A 2JAHA 3GHYA 1HETA 4CMIA 4ROSA 3NT5A 4GPD1 2O2YA 1O0SA 4I08A 4AL4A 3TN7A 1X13A 1BMDA 5BNIA 1PGPA 3AK4A 2FSVA 1F14A 4IDAA 3NEPX 4Z0TA 1GAEO 2DBZA 1ENOA 1AHHA 1B0AA 2D5AA 2J5RA 4IDGA 2FZEA 2O3TA 3L4BA 2D0IA 4IJUA 3KOUA 3L6OO 3LF1A 4UVIA 4E5YA 4DLLA 2C2YA 4OHUA 4RZHA 1ZK0A 5JNLA 4ZHSA 3WTCA 2AMFA 3JQFA 4BKQA 2WD7B 3ZHYA 2WD7A 4GGPA 3ZWWA 2GGSA 4TROA 2VZ9A 5DP1A 3GGPA 3L9XA 4BNNA 4L74A 2G5CA 2Q1SA 4E21A 5K6AC 1IPEA 1ZEMA 4WLUA 2AQKA 5JC1A 1LLCA 2Z5LA 3U4IA 4J7UA 2Y68A 2GZ1A 1ENZA 5KVQA 2QG4A 4BGEA 2O48X 1QR6A 5TQVA 2V6FA 5U9CA 3L4BC 5DBGA 5U1PA 3JD2A 5IZ4A 1VPDA 2X0NA 4D43A 2VRBA 3ENKA 3UCXA 3DZGA 4IXWA 4B79A 3NX4A 1X15A 1A27A 1UXJA 3GDGA 5LDGA 4DYDA 2ZTMA 4B4OA 3H65A 4M54A 2XPCA 1ULSA 2C54A 3STHA 1HEUA 4KUHA 3V2HA 3OIGA 2VRCD 5T67A 4E32A 4U5QA 3K92A 4WOKA 4G2NA 1V3VA 2B36A 2WJPA 4R5HA 3DBHB 5EJ2A 2EERA 1CDOA 3WYBA 2EHDA 3TFQA 2HMTA 1DOHA 2PY6A 2AQ8A 3HJAA 4F6CA 4KZPA 4I9UA 4IZIA 4BNMA 2B4QA 5HM8A 4Q3NA 4MP3A 1GEGA 3UN1A 4BNLA 5DBFA 3HDHA 4LK3A 4YRDA 3DBVO 4BO5A 3E1KA 1PGQA 3GUYA 1DXYA 3NTRA 2FPGA 4ZD6A 4IDCA 1GTMA 4J9UE 3M1AA 4BNFA 3WGTA 2WE7A 5BSHA 1I0ZA 1N8KA 4WLNA 2Y99A 1JQBA 4CM4A 3WB9A 5DULA 4CR6A 3GR6A 2E4AA 2JL1A 4NPCA 4UVGA 1IOLA 1EK6A 1WDLA 1ZZEA 4ILKA 2Q1WA 4HFRA 3GPIA 4I8XA 2QW8A 1I32A 2NACA 1ONOA 3A06A 1HL3A 2TMDA 1Q7GA 2DLDA 4ALLA 4MINA 3ASUA 1HF3A 3JD0A 4CPDA 4CR7A 3E9MA 1EVZA 3CZMA 1UXKA 3FBTA 5TJHA 4EUEA 4Z0HO 7ADHA 3ZWPA 1WMBA 3C7CB 3W6UA 4RVUA 1PS9A 5FI5A 4CR8A 1YBAA 1B3RA 4EJ0A 4NJOA 3QVOA 3HZZA 3DTYA 2B0JA 1SO8A 3CIFA 4EI2A 2C29D 3TSCA 1AE1A 2NSDA 2A9FA 2X5KO 3KYDA 1EZ4A 1RYDA 4U6QA 4GAEA 3JQ7A 4H3VA 4AJ2A
chains in the Genus database with same CATH superfamily
1QH1A 2R8ZA 4V0SA 1IUNA 1DXOA 4K2HA 4QGFA 2W70A 1XZCA 3ZV4A 4QEKA 4JGGA 4BX9A 1ZAYA 3ZK7A 4GX0A 1XRSB 2RH8A 4OQPA 3VMFA 4OEHA 2XKJE 1GTRA 1L4EA 4C20A 1P2TA 3UANA 2G7ZA 3WRWA 4LUCA 3NS7A 3Q2KA 3FY4A 3FCSB 3OE7D 4UCFA 3TG8A 2VPQA 4G1MB 1O89A 4GOXA 3D7MA 3DMGA 5A71A 4NU6A 5LBTA 2QR3A 3T06B 3W9YA 1S8OA 1X19A 3D6NB 4YP1A 1UZUA 3SI7A 4B71A 3PGXA 1KRXA 3KB2A 4WIAA 3W6ZA 4EHFA 3ZZTA 1CR2A 1SVIA 4LTMA 4TXNA 3IEKA 1VKNA 2A1IA 1X8KA 1ZRHA 2OHHA 3HCPA 3NNDA 1ZN8A 3HJGA 4L4ZA 4IICA 4YRQA 3VU8A 4DCJA 2CNWD 1KEVA 1XP5A 1KJ9A 2QUHA 1E0JA 5IM4A 1G3RA 4MWSA 2PM8A 4QL3A 1P9OA 2HY7A 4B87A 5AI0A 1H8HA 1ISFA 1UBJS 4MQ5A 4D6PA 3F2IA 3OHSX 2F3SA 3E3OA 4JITA 3HBAA 3H5NA 3OQPA 3U6BA 2YC2C 3FPLA 1IN8A 2QUZA 3K0EA 1XG5A 1KBQA 4L0DA 4ZI7F 3AIIA 1YVPA 5ALZA 2PNJA 5FV4A 2R7KA 1ADFA 1AQLA 1E98A 1LK0A 2AN9A 4OYHA 1Z6TA 4EKIA 2ACKA 3AI7A 3CCFA 4J1TC 4FPXA 1BWSA 3SMQA 3QEOA 1GDDA 3R3HA 1MFZA 3Q2IA 5IFKA 4LDZA 1FXUA 5K0TA 1EWKA 3LV8A 3AF1A 3CMCO 4Q9KA 3UUWA 4OQZA 1O95A 3F7MA 1ABFA 3MBIA 5B1EA 5BSKA 5IUNC 2B99A 1PEAA 4P4TA 5IAJA 4QTXA 2JFOA 1W5EA 2OXIA 3D0RA 2WF7A 1X1SA 4GMHA 4MV3A 1Y4DE 2WVAA 4U7HA 1R6UA 4WN9B 4EAAA 1FLVA 4WN9A 1A7UA 1QPBA 2XTMA 3MYRA 1QKKA 5KJ1A 1Y9JA 3RREA 2GH1A 3ZE7A 1ZUNB 1EE9A 3BGDA 3LLMA 2C0PA 1ZUNA 1KHTA 4LVNA 2Q3LA 3MJTA 5JNRA 3L6BA 3VZPA 3LIPA 4UHKA 1UFKA 5G4LA 3WGVA 4S35A 1BZYA 3A11A 1CQXA 3GGGA 1KE1A 4OHMA 1T2DA 4CL2A 2XJ4A 1E3SA 1KVTA 2BMDA 4B3BA 1YIAA 1PJBA 3NTVA 3PCTA 3ZV7A 4M1ZA 1HDEA 4MICA 3NFYA 4CMAA 4QLAA 1JVSA 1WEHA 2KE5A 4K9LA 4UC0A 4WLEA 1AKNA 4RLFA 2RHCA 3D1JA 1M2JA 1N7IA 2Q21A 3LLCA 3TZQA 4CN9A 2IBTA 1BE0A 2CMHA 2ORED 3RF7A 1Y3BE 3D3NA 1B6RA 4P5DA 4TGLA 4H77A 2BPOA 1SK8A 1MO5A 2XI4A 3ZWVA 5L95A 4HQ6A 4TMTA 3VR5D 2CL7X 3U4MA 2R1ZA 521PA 2IS6A 5A3VA 3M83A 4BFTA 1ENYA 9ATCA 3HG7A 4EM6A 3U31A 2DWUA 3O2QB 1SQ0A 4UEWA 5LDDC 1PX0A 1XJCA 1BXRA 5JJCA 4WRRA 1CRLA 1QYXA 1FY2A 1UL1X 1Z6YA 2LV8A 3GL9A 3GNTA 3KDPA 5BSTA 5I3ZA 1KNXA 3TL6A 1XDSA 5F9MA 3SY8A 2X3YA 3D8NA 4MV9A 2R68A 1DBSA 2PCLA 3HADA 4RFSA 4EG4A 3BULA 4FD2A 5AVWA 1USWA 1PFGA 4E2XA 4LISA 5IJWA 3H2BA 1KMQA 4YP5A 4ND2A 4QICA 5HBRA 4LF7B 3AY0A 2FZGA 3P97A 4MCHA 4CUJA 2AC2A 4QWMA 4RABA 2E4ZA 1JBKA 5KTOA 4RGQA 1KNQA 4NOKA 2GVDC 1OZAA 3KLOA 1GR1A 3PJGA 4UBJA 1ZNZA 1P0FA 5DRTA 5EWMB 5EWMA 5FBRB 4FTWA 2HJVA 3PHLA 2VAWA 2QNRA 4RDIA 3T0IA 2A35A 5AKKA 4K2AA 2ONCA 2SBTA 2H1IA 3FKQA 4LDPA 4DCUA 2VYFA 5DIZA 4EY8A 1V45E 1NATA 1RLTA 3PWSA 4R3WA 1RZRD 1CQPA 2ZRKA 3C7KA 1JG4A 3RU2A 2OHXA 4Z1MA 3KC2A 3UWKA 2IUUA 2PUFA 3EOZA 1XP8A 1CNMA 2DU8A 1LF0A 3O8LA 4RU1A 2X23A 1PWXA 3LWNA 4OO3A 1CY6A 3SJ7A 5LM3A 3B7PA 4LC9A 2X0JA 1LS6A 1M67A 3CE9A 5E4FA 5F2EA 5EKTA 3H3XA 3PFWO 1FE8A 2ZSJA 3DCNA 4DQ0A 4X45A 1ZL2A 1QSGA 2W6ID 4BP1A 4LV6A 1F4VA 3GQBB 1JAXA 4P5EA 4QJ4A 3CF4A 4CF3A 3GQBA 4D3ZA 4QAJA 3LCMA 4BO7A 2Z8YA 4TKVB 4JLSA 4BKRA 1SQGA 2ZU0C 4TTTS 4HGZA 2EKBA 3RBVA 4ALMA 5DGHA 2G7MC 4TKVA 3KTAB 3RG8A 3B53X 1L7VC 1ZXXA 1GPYA 1I5EA 2RHDA 1ZPDA 2QN1A 3KTAA 4X8HA 1WNFA 3WOVA 2YHUA 4MEBA 5KYKA 2NP6A 2BMJA 3WB0A 3OBIA 3VPFA 4DGQA 4HGYA 3W8EA 5DDIP 4GDFA 1RDFA 4BFXA 4OYYA 4B2IA 2NTJA 1SU7A 4NK4A 2HBYA 2W2QA 3K2BA 2PSFA 3IEUA 1Z73A 2Q4EA 1LLQA 2IEGA 3C5VA 1YGPA 4GKBA 5IZCC 1JSCA 2R86A 4WCDA 3GGDA 4B1FA 1GAQA 1EDZA 2XDWA 3I45A 3O9MA 4GBMA 4LPSA 4ZAYA 5SV2A 3P5BA 4IR7A 3MJEA 1B7GO 4HFNA 4P4UA 3ELBA 2DPGA 5JSFA 3EXEB 4I5EA 2XCSB 3EXEA 4DBZA 4ZO4A 2PA3A 4DLSA 4IAOA 3UG6A 1B14A 3G2OA 2JI6A 4ER5A 5JCZA 1JEQB 3QNUA 2JDIA 4PICA 1JEQA 3D64A 2J0VA 3C3PA 2P5UA 3AKCA 4PNPA 4B40A 1URPA 4TTJA 2P9ZA 3EC7A 1NE2A 4A0QA 1N33B 1BJKA 4FDLA 4NYJQ 5HX7A 5CD1A 1MAHA 1JB1A 1TZMA 3FSRA 3T3NA 1XZLA 1NC1A 3G85A 5B1IA 1XN1A 3E35A 1UKEA 1T5TA 1AGRA 4NYIR 4EDFA 2E21A 5DWVA 1J00A 2WD9A 3P19A 1PJ2A 4C1NA 1H42A 2QGZA 3HCCA 1R8QA 3PX2A 2W11A 2HIAA 3U26A 4Q5IA 5JXWA 1KERA 4UZEA 2C83A 2ZUEA 2YTZA 3PF9A 2OQ2A 3IUEA 4FKBA 1PT8A 3MMSA 4MVJA 4N54A 4AICA 4CM6A 5C51B 4NIMA 4AKGA 4C4TA 2HJHA 4RF4A 4ZOLA 1P3Y1 4HQFA 1ODTC 5ITZB 4FDVA 1B8NA 4PC1A 4I50F 2JHAA 5ITZA 1FMFA 1ESNA 4FLEA 4FQ7A 4XLZA 2OC4A 1Y82A 4P8RA 4CKXA 3JRWA 3QUCA 4BGUA 4CEHA 4DY6A 4CEHB 2VBIA 1WZNA 1Z6GA 2N3ZA 5IULC 2ZROA 4WEOA 3USZA 2XTZA 4TYMA 2VRNA 1WDMA 4PG8A 1YZYA 1M0EA 3DMPA 3WKCA 2E4VA 4ZDWA 4UNRA 3G1WA 2ZQYA 1VHTA 3ONVA 1FTQA 3AR6A 3LUHA 2I1WA 4FZRA 3ROZA 2O0JA 1OE0A 1QZZA 4OCZA 2B34A 4IIGA 5FFFA 3L4KA 2DETA 2FMHA 2XE8A 4HXFB 4TYQA 4KGDA 3V1UA 3BH6A 1QHSA 4Q1CA 3UCFA 3F47A 5E4TA 3ZGVA 4FGSA 2GBPA 2A5GA 2PUGA 2XA1A 2V0NA 5A0TA 2EGGA 4IOJA 2EQAA 4GKJB 4N1AA 5DT9A 5B3LA 3HBNA 2F3QA 5CDUA 1T9ZA 3AX6A 4IH9A 3PDIB 3B3GA 1A1SA 1DAPA 3FUVA 1TC2A 1ZSYA 3HFRA 3PDIA 3CNHA 4OP2A 5JLAA 3VR0A 1A9PA 2BMWA 3TJMA 1G8PA 4UHBA 1G4AE 3FZNA 3K0HA 3KDAA 4JYCA 5EIBC 1ODSA 2VSQA 5DM0A 4DMMA 4C9BA 3HUUA 3KUDA 1YFLA 1Q11A 1YQXA 4C04A 1JHPA 1M7GA 2JLZA 2WTBA 4NR0A 4TV9F 4URWR 4OM8A 1XALA 2PZJA 3GX1A 4K6GA 5JCOA 3EZYA 4R8RA 3V6LA 4E1AA 1NRWA 3M6UA 4REOA 2C9ZA 4W7IA 4XARA 3FMGA 5E9WA 1AV6A 4IIBA 1TA4A 2QZ4A 2CT8A 3WLRA 3IGFA 1SUSA 5JO9A 3ROQA 3L0ZA 1DAFA 3EZLA 2IPMA 3DW1X 4CIAA 4IXNA 3OOYA 3F3SA 4TSRA 3A2LA 1WV0A 2M6LA 5C37A 1HE2A 4N40A 4L07A 2AZDA 2WG2A 1N6PA 2WDZA 1MQ8B 5JR3A 3O8BA 2A9JA 2BN4A 5FUWA 1KY5A 3DULA 1DDGA 1G6HA 2FGJA 4X3OA 3ZH9B 3CLTD 1T4BA 2ZRPA 2PXHA 3PHGA 4U7GA 1NQ5A 1HYGA 1E9FA 1A4XA 1FLDA 1SVNA 1X7DA 1XTSA 3NYQA 2C5EA 4PPGA 2HKIA 1NNUA 3SYKA 4ARUA 2ILTA 1LNSA 4BLQA 3COYA 3FTNA 3IE1A 1USUA 1WL8A 3AMVA 4PZ0A 4QYWA 4G0WA 3PVCA 4QZVA 4KLZA 2JI4A 5BSMA 3ROMA 4BOYA 4PZLA 5I9MA 2PANA 4LHVA 1J0XO 4QBIA 1E2DA 1EHYA 4RE6A 2RGYA 1ID8A 1Q3KA 3E5RA 4IBOA 4D4JA 3NTQA 3BGOS 1YJBA 3ENZA 1UK6A 3CUWA 3L0BA 2ZR8A 5HQ3B 3KUCA 3L1HA 2RGWA 5FI1B 4ETIA 4AJIA 3MGGA 1RWKA 3F46A 5A04A 1YTLA 4O5OA 4K7JA 4FDAA 1F0PA 4FT2A 1WCV1 1ZRNA 1DBPA 3V34A 1VMIA 3OSUA 4UXIA 2PT6A 1W48A 4E70A 3PF8A 4RSHA 4L4RA 1M75A 1JPUA 2ODAA 2V5AA 3W2HA 4A8JC 3WR5A 4UXJA 4EHNA 1QZXA 1DFIA 3F96A 4GI3A 1NX9A 4MI1A 2B5WA 2PPVA 5LA6B 1L5FA 3VC2A 3VNSA 4Y9RA 1KGDA 3H1PA 3Q0TA 4I5IA 4PHGA 5LA6A 3DHNA 3RQSA 4CKYA 3G5TA 1V4NA 4YDSA 1RE0A 4EVSA 3EXHC 2Q99A 3ESRA 1PR0A 4K9PA 1KEPA 1RKVA 2MSEB 2WTMA 4L85A 1F8FA 1XTTA 1F06A 2HMWA 2J07A 1SHKA 4LKRA 2HLDD 4M8NE 3MJSA 5KAMA 3VPDA 1OLUB 1JAHA 2ORIA 3BN3A 3C3MA 1TYDE 1OLUA 5K3SA 5JROA 4EW3A 4RFLA 4YAEA 3ADOA 2I4NA 3OBBA 3GFBA 3PHCA 3B1WA 5IF3A 4YBZA 1MQSA 1W4RA 1WVGA 2IYEA 4NCHA 3HNRA 3L7NA 1ZD3A 4CMEC 1SCQA 5GOZA 4GLLA 4YRIA 4I3GA 3LVQE 1P3DA 4BLSA 1GADO 3DE2X 2HA7A 1KJNA 1QH8B 4PZ9A 4IJ6A 4AJOA 4ZVKA 1DT3A 3WGIA 1KU0A 2AW5A 2WA1A 1UDXA 2JANA 2IZ1A 1L2TA 3TAUA 2XLCA 1XHFA 4WK0B 1PS8A 3OZGA 4ZI3A 5KZMB 3DZDA 1YDMA 2R5NA 3OT1B 5IXJA 1LQTA 5IDYA 3OEEA 2CYAA 4D97A 2BBTA 2NV0A 4IRUB 3SZRA 2FZVA 2NO7A 1E3TA 3V8VA 4W5RA 3CE6A 2VQSA 1IPHA 2W58A 1QM5A 3QPAA 3HUEA 3KD2A 2HA5A 3AVQA 5FBKA 2VPIA 4UAJA 5B6JA 3EN0A 5LYJB 4GP6A 3WZMA 4B3GA 2XOKA 4E1VA 5CNKA 2FPMA 2BGIA 5LYJA 2M6SA 3RNLA 3ER9A 5IAOA 5AR1A 4PRZA 4IHAA 2PUCA 1TUGA 2IX9A 2EDCA 3VAYA 2ZTVA 1T4MA 2ODEA 4ASUA 2QBYB 3JQ9A 2OPHA 1W29A 2QBYA 1MTOA 3DAGA 1LX6A 2OCKA 3IQWA 1J0CA 1VKOA 2P0EA 3IQGX 1OVGA 3T34A 3ZC3A 2PYDA 2Q6TA 2VXOA 2ZPUA 3QTBA 3ZVRA 4HV4A 3AFHA 3CB4A 3CSUA 1UJ5A 1KZ1A 1T3TA 5LQNA 2HV9A 1XEFA 5K3OA 2QMQA 4P08A 2WKRA 4JAVC 5ALOA 5FTMA 4BQRA 2GDZA 3OT5A 4EA9A 2H11A 3DC2A 3TLKA 4K88A 5EESA 1NJ2A 1W96A 3C48A 5SYAA 2JLCA 5B4TA 3IB3A 1EK2A 2I66A 1BWRA 4PGMA 4QVGA 4ZJPA 4ER3A 4BFWA 2F48A 1T3LA 4HI0E 2P9QA 4Y7DA 4YCLA 1D2EA 1GILA 3I2JA 4L95C 4RY9A 4QYXA 1XMOB 3PPVA 5CDGA 3G2PA 1J90A 4D9EA 4W1SA 3U16A 3S3TA 4KEAA 4IKPA 1KPGA 3SD7A 2PX0A 1N5KA 3EC2A 5DHTA 3SE7A 1MNQA 3HU5A 1AKTA 2DFDA 4XUEA 4CMIB 2GILA 3KEMA 4NZZA 1JWAB 5BNWA 4HDAA 4RC9A 3FMPB 1XMVA 4LECA 4GKAA 1INLA 1U7DA 2VBFA 4D8XA 1A98A 2HA4A 1TXGA 3B2EA 3LX8A 4GLJA 3TIFA 1D2RA 4BVLA 3L8GA 4C43A 3AUUA 1IWBB 1EFRA 4OMDA 2JPDA 5UKDA 3KKLA 4EI8A 2QPAA 1N0WA 4C6TA 4DLBA 1N2CE 5ABPA 1FPQA 1WS6A 3GMTA 4S2EA 4CBVA 2QX4A 2DPHA 2NU6B 5IDWA 2NU6A 3GO4A 3TD2A 1YHYA 2I55A 1JU3A 2YQ5A 2AI3A 3PICA 5EJFA 4DW8A 4HB4A 4ID9A 1OBOA 4OGWA 5CPBA 2VG8A 4HVLA 1H93A 3BE5A 1JLRA 4EARA 4G0XA 3GRPA 2ZVDA 1Q57A 1XCBA 3R3VA 4LJ8A 1XZGA 3L2OB 2HUNA 4I2VA 3GEGA 4BJHB 4XCQA 2CKMA 4YX9A 2M6KA 1E9CA 2H06A 1SVSA 1PR3A 1W75A 2O07A 2ENWA 1EFPB 1LDYA 1PNTA 1LPOA 1E1LA 1EFPA 3QKUA 3QBJA 4MYUA 3W4JA 4LF5B 1PO7A 4LQDA 1WMEA 3EEYA 8ABPA 3MTQA 4WNCA 5FTKA 5ENVA 3RFTA 2ZSBA 3SQNA 2PWYA 3ZWOA 4BBPA 3VHQA 5F76A 5ILQA 4PHCA 3R5KA 4TPKA 4L5YA 1PKXA 4US0R 4FYVA 3TOVA 1IBLB 4Y9UA 4ACBA 3QU7A 1RHKA 4LBWA 3WLSA 5D2CA 5CA0B 3RC9A 5HE8A 1I6MA 3DOIA 3UWOA 1MHPA 5CA0A 4YGXB 3CXUA 4DZTA 2QUKA 4MDHA 4EVQA 1T4CB 2ZUFA 1FVHA 4OX9Y 4U6NA 1GLVA 1ZCBA 1T4CA 1Y1SA 1PP4A 1ZXLA 3AT1A 5FFNA 1BD3A 5KJEA 1LRLA 3KT6A 4W5WA 4FSXA 4X93A 5ICMA 5D5PA 3L1KA 3OLXA 3PFGA 4KLNA 1FX0B 2RE8A 2OP1A 4QQKA 4TT3A 3FVRA 4Y2PA 4RJKA 1G59A 4FNOA 2HHJA 1PFWA 3CLHA 3LJKA 4EGQA 4GICA 1WV1A 2O2GA 1W4ZA 1FLAA 2NNLD 2ANBA 2QPTA 2HNBA 2BL4A 2E5WA 1VBMA 1ZRSA 2NUTB 1PN3A 3C3BA 1S1CA 1YO6A 4NNOA 2NUTA 3SYLA 3WL7A 1Z5OA 3ZWNA 3L92A 3V1NA 4CM9A 1W0JD 3KIPA 4AY3A 3S8MA 3GT7A 4X44A 4MLCA 4DDMA 4D92A 4Q39A 3OJOA 2PMBA 1BYUA 1GITA 1GPBA 4CU5A 1PV1A 1OFTA 2GWHA 4GNRA 4IX1A 1MDFA 3A1DA 4REMA 3A6LA 4CDNA 4RF2A 2DUUA 3DPIA 4BXOB 2HF9A 2WABA 3SP1A 3K6JA 2ZYRA 4RO0A 1WETA 4BXOA 2QIPA 3IPYA 3WMEA 5IT4A 2XRMA 4DA7A 3WB2A 1KQGA 1N2XA 2QDKA 4DV0B 2PBLA 3OFNA 2ET6A 2B30A 3LK7A 4AY4A 4M9QA 1S9DA 3SEQA 3HKDB 5H3CA 3A3YA 2AVNA 3HKDA 1PI3A 6LDHA 1KYIA 2QU7A 5AI6A 2WFMA 4WY8A 1PUXA 5LL6P 5LD2C 3AVOA 3AHGA 4I6JA 5KTSA 3OQNA 4QYTA 1TVMA 1NYLA 2C5BA 4B80A 4W4TA 1XQ6A 4V2UA 2D3TA 1I1OA 1L5OA 2GK6A 5H3LA 3SF8B 2B35A 3MMXA 3LG2A 3K1ZA 3SF8A 4INAA 1E6EA 1ZM4A 3TX2A 4AURA 5LU9A 4U2FA 3PEYA 2J9YB 2R1UA 3UT0A 4G9EA 1PGNA 4KNVA 2A0FA 4JVLA 4MCAA 4WECA 5JQGB 3C2QA 4EP1A 1HOTA 1C3LA 2BHTA 2Q2OA 5JQGA 1Z35A 3B6IA 3T5CA 4KACA 1OC2A 2FG5A 3AF5A 3SEZA 1L5ZA 3EUAA 3KYDB 5IUKC 2FZCA 3CLTC 1U28C 3ZQUA 3LC0A 2J33A 3LRTA 4NZ9A 4N41A 2B8EA 3M9WA 3R7BA 3FHOA 1FS5A 1DJLA 1UBGA 2RKBA 1Y34E 2VO1A 3BIOA 2P90A 2YMMA 2Q2NA 3CX7A 5AW1A 4BO2A 3LUCA 4BZZA 4LMPA 3RWOA 2F7SA 2QM0A 1T6YA 4OMFG 1LZKA 3A26A 5C53B 3N2ZB 1U0TA 1YONA 1DLJA 4X6XA 2F4NA 4WFQA 3GJTA 1R6TA 2E82A 3FH0A 2VP4A 1CQZA 2P7HA 2H9YA 2ECKA 1KYTA 3OQBA 5BV8A 1SG9A 4G5FA 4C4PA 4FK8A 2ZT5A 4I3FA 2ISCA 1Q1NA 2LP4Y 4UE3S 3WGMA 4MGZR 2D5IA 1RMTA 4MUKA 5HDQA 4ZHQB 1C3EA 4ZHQA 3HH8A 2BF7A 3IDZA 2XVXA 1A88A 1T9DA 2EX0A 4WLOA 2B2NA 3SZLA 2XQIA 4R2KA 2BELA 5FA6A 3VTZA 2H57A 1P7ZA 2VDRB 3WO1A 1BWPA 5G3YA 3HDTA 2EG5A 5LP6C 5T6BA 3OFVA 4J1NA 1NVDA 2Q6OA 1R18A 1QCYA 2CJYA 4YROA 2OWEA 1J99A 2RGBA 3IHWA 2PS1A 3PNSA 5GINE 3ZHVA 3OVMA 4XQGA 4A6PA 2X2FA 2OOKA 4E2WA 2R8OA 4EJMA 1NYQA 2G9UA 2IF0A 3LKDA 1G20B 4G97A 3T5PA 2VVTA 3QU9A 4LTNA 3QTLA 3KBOA 5EHGA 3I9NA 1QMGA 5TC4A 2RIPA 1CXZA 3KZMA 4FD3A 4QGGA 1J22A 3I6BA 2GARA 1V1MB 1ELOA 4MGHA 1IE3A 1V1MA 3R6DA 3SJAA 4BS9A 5AVYA 3RTAA 4A0RA 4MQ6A 4Q9DA 2CCJA 3W3AH 3OCUA 1KWGA 2X41A 1JDZA 3RAPR 2PJRA 2IGTA 4GBED 3N5CA 2G5TA 2PZGA 5DNCA 2ZU6A 4RTMA 3LA6A 3LXXA 4JLDA 4DYVA 1CRPA 3QVLA 4Y9SA 5BVGB 3O73A 5D3MB 3RSZA 5BVGA 4YAKA 1FRZA 4NH4A 5D3MA 2O8NA 3AHJA 4INPA 1ZD2P 5HJ2A 3TK1A 3PUZA 1SXPA 3HKBB 4IM7A 4UBKA 4B82A 1YFJA 4BEJA 3HKBA 4YK7A 2ZWIA 3V9AA 3VKUA 3X44A 3ETDA 4C22A 1FNNA 3GI1A 5LLSA 4DCSA 4G8DA 1RRVA 1IVNA 4G0MA 1Z0FA 4E4TA 3SS7X 2BGMA 2QG6A 1I24A 3GBVA 2ACWA 3QUQA 4FYXA 4HS4A 4Q7EA 4UUMA 5B58C 4M0FA 2YIJA 4RNCA 3RS3A 4F9EA 3AFMA 1UDRA 2D1TA 2IZ6A 3EQ2A 1UDCA 1U3FA 3VYSB 3AG5A 1DL5A 1NT4A 2QM8A 2WHQA 4YUYA 5I47A 3UMMA 2C7QA 3ASYA 1TQDA 3A0UA 1MV8A 3DCIA 2JHGA 1CUJA 5ED0A 1GJRA 5DCYA 1NBOA 2WJ4A 2QKYA 4WV3A 2JFUA 2Z8ZA 3GVPA 3QKIA 3JYQA 4GLOA 5FUMA 2D1QA 4X64B 5HSGA 4QU5A 3BPSA 3W8FA 4L02A 3G5MA 1QLHA 4TXMA 4K1LA 4LI3X 1YUMA 1IXZA 2I8CA 3H5WA 2QYSA 3AINA 3Q3VA 1LFDB 3KOZA 3FROA 2C58A 1DZ3A 4NBUA 1B4DA 3BGWA 1AXEA 2R97A 1GRQA 1FSGA 4RD3A 1YQDA 3B38A 2B37A 1GQSA 4QDXA 4QREA 4U2KA 4UTOA 3SVTA 4YMUA 1SN7A 3MWLA 4QLOA 4PNZA 1G98A 1XVVA 2NYRA 1GKYA 5FB3A 1G5FA 1RHUA 4JIMA 1O9BA 3EEBA 4JMPA 2QOEA 4MMXB 2PKQP 1Q0LA 5ERGB 2YHIB 4HFMA 5FO0A 1J33A 2Y1OA 4GM4A 3IBTA 1M8JA 2JJ2A 3CWQA 1E3DA 1SU6A 3BAZA 3G2IA 4I9GA 2WMNB 4IHJB 2GHIA 4IHJA 2FEWB 4QBKA 5ESRA 4BTVA 2AG0A 4CDRA 3ED5A 4RK5A 1DBQA 4ZYWA 1Y5MA 3BFKA 1O0CA 1WXHA 2G4CA 3DL2A 2GTPA 3E05A 1WY7A 3UBMA 4EPXA 1N2OA 1KAEA 1Z7BA 4MVJM 4RIEA 1RZ3A 4X66B 4XVQA 4EG8A 1V7PC 1ULBA 2R5FA 2I7VA 2N46A 2WJVA 1EUYA 1K9SA 1J49A 1TCVA 2XWSA 3ABOB 4Q9HA 1R6VA 3W5AA 3EF1A 5JZVA 1LQUA 3FPAA 3WRXA 3VNVA 4CG2A 3K9FC 3F4KA 4FGLA 1RHRA 2BUAA 3RC8A 4EUNA 4TLCA 2WUDA 4BWYA 4F9TA 2QE7A 2Y1DA 4ND8B 3Q9UA 1I7QB 3NU1A 2QW0X 5EHIA 4UARA 3GDOA 4WDQA 4ZC1A 1X74A 4KN6A 5FX2A 3ROFA 3T7IA 1EE2A 3MPOA 4FFNA 5NULA 4G0QA 1K5PA 5HKAA 1GPKA 3IH5A 3QGMA 2VJYA 4NDAA 1GA1A 1PFVA 4XZ3A 4YJHB 1YVEI 1QBKC 3CH6A 3LDFA 4KPGA 2JA1A 2BP7B 4YJHA 5AJTA 1DX4A 3F2VA 5I9NA 2BP7A 1W1WA 2TECE 2ATCA 3FPHA 2C3MA 1HLGA 2PXXA 4NKRA 1GPDG 1FP7A 1QRAA 1SD1A 1E32A 1MG5A 2QI9F 5HK8A 5IXYA 3P0EA 4MULA 4YFYA 3S7TA 2GEBA 3HEAA 4HVTA 5CVUA 3T3IA 3LOUA 4ZCRA 1WUJS 1N5OX 4D3YA 2OL4A 2FPKA 1RRGA 5DM4A 3PXGA 1G55A 2Z95A 2VS1A 4G86A 4LBZA 4RGBA 4I6EA 3U48A 3AF0A 4ZGGA 2X0RA 3IIIA 4PZCA 5CIQA 4EECA 3FUXA 5P8WA 3P2KA 3TKYA 3B51X 1Y1TA 1YULA 2AS0A 3D7LA 4WKNA 1FMTA 4DSNA 4ER6A 3VZRA 4ZEOA 4AKTA 1LI7A 2C5SA 2O3RA 2VJBA 4KSBA 2C4UA 3H7AA 4BHTA 1XZPA 2ZYAA 5T4FA 3VNQA 2HUPA 4JJEA 5CCXA 4UEJA 4HY3A 1PR9A 5A9RA 4Y1FA 4EYEA 4C0AC 4R51A 2R00C 2C61A 4DDKA 4CTMA 4FE7A 4CMJA 4NE9A 2R84A 2D0PB 3DT9A 1VE1A 3ZEAA 1BRMA 3EVCA 6CHYA 1AKUA 3F98A 1N77A 5TEWA 3SKYA 1AB5A 4WESB 4RZXA 3MNFA 1K4YA 3HRKA 3PIDA 4WESA 1RS0A 4MUEA 4ND6A 4NBVA 3UV3A 4DBLE 4LVUA 4B4UA 2A9RA 1QFSA 1KK0A 2I99A 4MMZB 4P84A 1Z62A 4Y2SA 5A3SA 2YRWA 4TMVA 3RVMA 1N2EA 1XK6A 2QUJA 4V0OA 2DVMA 4MB6A 3SKVA 3ILSA 3G0OA 2JATA 3PC3A 2WLTA 4R31A 3U4HA 4AT1A 2E48A 4NG5A 5AK0A 4BJ1A 1K2VN 1UXOA 2FH5B 3HRIA 1MXHA 3Q0IA 4YB8A 5GVSA 2MHCA 2I34A 3FGZA 3FMOB 2ATIA 4BLRA 2XV1A 2Z2IA 3PI6A 3MJVA 3OF5A 4Z8XA 3CJQA 1S0UA 4NDNE 4PANA 3NOVA 5KSWB 1AGNA 2WAOA 5G0TA 4OVKA 2PL3A 1D03A 2ZRQA 3O1LA 1HKUA 5JZSA 3A37A 4IUCS 1NLYA 5FBZA 3V7WA 3C3KA 2HYDA 2IP4A 2P4EA 3FRIA 4CT5A 1W5AA 5SY6A 4AO6A 4W8GA 3RC2A 1TQ6A 2V7VA 3GK3A 1YE8A 1XTPA 3CR3C 4GT1A 2WSBA 2PLAA 4KK4A 3TYXA 2CZGA 1S01A 4N3GA 4A9AA 3R0VA 4PAGA 2F1JA 1NFRA 4ZOQI 1SRRA 1XKTA 3ESDA 3HYCA 4PBSA 4YQZA 5ADWA 2R1TB 4XDZA 3VOTA 3F0TA 2FR8A 2R1TA 3IP8A 1GFWA 1XT6A 4RTQA 3QFRA 1J2EA 4JXJA 2EIHA 3P9SA 2D4HA 2O8DA 1PBTA 1EINA 5DXAA 1GCGA 1HQCA 1PJ3A 1TIKA 1HSOA 3AEZA 3GGCA 1KQ3A 3BX1A 4IDPA 2D6FA 5K3AA 1GYRA 2XT0A 5G0SA 5CK4A 5C5DA 1A5ZA 4B31A 3VV3A 3H9EO 4BRWA 4EI7A 5HP4A 1SBIA 4IGAA 1OTXA 1G3QA 2WNIA 1XRMA 2C4VA 1WG8A 3OF2A 1FP6A 2FUG6 3HP7A 4FOTA 4NCKA 1O6ZA 3PP8A 2BE7A 5HS4A 2VSOA 1CUZA 1X1BA 4IX9A 4DCPA 2C1XA 2G04A 4M87A 5AVOA 3Q3CA 3SEFA 4TUYF 1VDMA 3OMXA 2XE4A 3CH7A 3DWGA 1FJHA 4ITUA 1KAHA 3QOWA 5FTWA 3WKEA 1E1NA 3V7FA 4TSFA 4KMRA 2O19A 4HATA 3PPYA 2ZCVA 1SM4A 3H0CA 3L8DA 3BREA 3SS9X 1UBFA 4BNJA 1RLUA 1R15A 2C4NA 2H00A 4E94A 4MKRA 1HGXA 2ISSD 4ZU6X 3ZD9A 1OGJA 2HOQA 5BR4A 4DANA 3F3YA 5LQDA 1PNRA 1KEWA 1YJQA 1WXIA 1RXWA 1GAXA 3ZZNA 4J4TA 1F7UA 2ZJ1A 4OI4A 4NJEB 1XTBA 1CYDA 1LWNA 4NJEA 1UP6A 1T1EA 2EFYA 3W2EA 1DTEA 2GZHA 4F2DA 4WAUA 4AN0A 2FP3A 4PPQA 2XWPA 1PR5A 3AR3A 3LPLA 1GZVA 3VR3D 1TMGE 1N6NA 4LJKA 4Q9IA 3D2CA 3SK0A 3IV7A 1QIMA 2ZYIA 2XMPA 3OQVA 2IYRA 3WYNA 3ZCQA 5EXXA 4LXYA 2AK2A 3MELA 5M5BA 1IZZA 1JI3A 1GTVA 5CT5A 3FOWA 2BTOA 1SIWA 2HU7A 4FGZA 4J07A 3Q85A 1R0RE 4PWZA 4FMCB 4KXQA 2XRZA 3L0IB 2E6KA 1JL3A 2VP6A 2WF9A 3T4XA 2W6PA 1PDWA 5B37A 4R7TA 2ZAOA 4DCOA 1T2AA 4Q1EA 4U9UA 3KLNA 3LQFA 4IDFA 5BOVA 5DE3A 3RS8A 5ICSA 2I5PO 4JT9A 3RVDA 3TTXA 4K8RB 2HZ7A 4MP6A 1MX3A 4H7FA 3T7KA 4A10A 3UW3A 5LOVF 3RUHA 1J8VA 5EP2A 3VPGA 3IDAA 2B7BA 2HWWA 5JISA 2REQB 4XIIA 2REQA 2VA8A 4YR7A 1AKQA 1P5ZB 1P9LA 3D6VA 1KC1A 3ETEA 4YQEA 4CCYA 2XD4A 2YV1A 3VSEA 1NVAA 2WY2D 1LBHA 5T4BA 4U2GA 5HTOA 4V0NA 1DAGA 4E5KA 3UKJA 4P0TA 1Z5PA 4BO0A 2F1RA 1L7BA 1V5EA 2AD5A 2O1EA 4YAGA 3OC6A 4E5UA 2F64A 3V80A 2HK7A 4WOPA 2CFCA 4ALNA 4IMPA 1G8GA 1PJLA 2J3LA 2XNJA 5D3QA 1PQYA 3FYDA 5JH7B 5DN9A 1WOMA 5JH7A 1N3IA 1TB4A 2VJOA 2ZJ7A 2ORWA 2A5LA 3V46A 1MUUA 3P7MA 4V0RA 5ALNA 3ZYZA 1JU4A 1KHHA 2PG3A 3R24A 4QVKA 3GNSA 1EG7A 2XMCA 2YZGA 1ARZA 2R87A 4G1BA 3O92A 1GPNA 1ZMBA 1O6GA 2E6UX 4A0SA 4BC0A 3V4VB 3G3EA 3PX7A 1F8YA 1TMOA 3AV3A 4G81A 4MQBA 4IUDS 3OQMA 4AF7A 3D6UA 5C31A 4JENA 1Z7YA 4EELA 1E7SA 1EFDN 1ULTA 1UPAA 4M7RA 1BN6A 1KI9A 4P93A 3PWKA 1Z0KA 1L7EA 1HL7A 4WDRA 3UOAB 4P0PB 4ILEA 1SHLA 4BV9A 3T7AA 5MN5A 2QRQA 5C5IA 2GFQA 2V9CA 3ONWA 3LC1O 3K53A 1WSAA 2JZNA 1RHJA 2V1XA 3RM3A 2PSSA 1ZWKA 4BRZA 1RPTA 2VPTA 2WJ3A 1SHTX 1N6RA 3RBZA 2NZWA 2FPLA 3VAZA 4JS0A 4OB6A 5JQWA 4MR7B 1GNQA 1U3DA 1T29A 3CQ9A 4MR7A 5KTRA 2AI1A 5AJVB 2VNHA 4DA9A 1I6WA 2MCFA 3LTNC 4Z4HA 4LZPA 3ZCSA 2HQ1A 3NAMA 4S1WA 4Y2JA 5L3QB 4XE5A 2JASA 3H5RA 3R6WA 1MT0A 2B2CA 1E59A 4XM2A 5IK2A 5B64A 1EZZA 1E6CA 1H2RS 1NOJA 2FLVA 3EGWA 3HXMA 5BV0A 2G76A 1L4FA 1P1JA 2LRHA 2QZSA 4RMGA 3OIWA 2WUWE 3UOGA 2IHVA 1G9TA 4HLDA 4J4HA 1P9RA 4AKSA 3LQYA 1NKVA 1X1AA 5I4IA 1CCWA 1SCBA 2XVYA 4EJ6A 1FVOA 4RBNA 4CT0A 4Z6KA 5IHXA 5C8XA 3NWPA 1DELA 2UZ1B 1O95D 2F00A 3CX8A 3PEUA 3QFTA 2UZ1A 4B35A 1KI3A 2WVHA 4GEKA 4E31A 2J5KA 2QV0A 1V71A 3FNEA 3QPWA 4RM3A 1KJIA 5KWIA 1SA0B 3EFOB 3QY9A 1NBWB 2P0YA 5C9ZA 3UJ6A 1H85A 3KJXA 1YRHA 1U8FO 1VLJA 2DFTA 1GUYA 2ON6A 2QTBA 3A10A 3JQGB 1W0KA 3P20A 4UUQA 1ZLXA 3JQGA 2WSSA 3H3JA 4MUYA 1QQAA 5I7WA 1SXJE 4DCVA 1W0CA 1ZC3A 4WJLA 5KNDH 3T3EA 4R81A 1AQYA 2PUEA 3U4QB 2QD4A 2QP4A 3CSSA 1V8FA 3T7EA 3U4QA 1BTOA 2EZUA 4HLUA 1KO1A 1B73A 2CNNA 3PQCA 4RNDB 2ZS8A 3V42A 3ZHRA 4YT4A 2JK1A 5TNXA 3DF7A 5FLKA 4RPKA 4L6IA 5G40A 1ZK3A 4LYYA 2IC5A 3FN4A 3L5KA 4BU1A 3KSZO 3TZHA 2WUVA 5JVDF 5F1YA 3U39A 3R2JA 1Y3DE 4RH3A 1WXDA 5JG7A 3DV0B 4M0KA 3GRCA 3VBCA 3ZDYB 5MFPA 3DV0A 3NO4A 2JLRA 2BEJA 3U40A 1SFRA 3EWNA 5CGZA 1C4KA 2HSWA 5H82A 4DLKA 2ZBQA 2FFJA 2XD9A 2VTVA 3ANYB 4I8DA 3SJUA 4EHKA 4Y2RA 2QUBA 5JMPA 4C89A 4CDMA 1F51E 1X1DA 1Z33A 2FX5A 3TB4A 3LE8A 1KVRA 4FHGA 2HQRA 4Y1GA 5FPKA 1LPAB 1RTTA 2ZANA 3KSDO 1CJCA 2VHEA 5GOTA 2ZAGA 4EFNA 1SKYB 4MKFA 4PO3X 1Q7BA 4AS3A 3TTWA 5F21A 4M3NA 2IYXA 2IOQA 4O8ZA 4II7A 1Z8NA 4PYMA 1SC6A 2AG6A 4QOEA 1JA0A 1RXIA 4A5OA 2ATVA 4D5EA 2SNIE 3DO5A 5JWOA 3MCTA 4A91A 2XUJA 3H83A 3BBLA 3TQFA 2MTBA 4Z7OB 2NUBA 3NP9A 3FWPA 3TPFA 5AJHA 1N8SA 5BO5A 4DAEA 2X7JA 4HDOB 1VI2A 4KX5A 4C5BA 4BUJA 5M04A 3NT4A 3BA6A 4IOLA 5G2OA 4DSUA 3MTIA 1MKYA 3UICA 3DPSA 2VBGA 5E3HA 3M49A 4CL0A 2ZWOA 4Z0NA 1JT2A 5AM5A 3K1TA 2ZRMA 3QIVA 4KQIA 3KR2A 3L8CA 1JJAA 1QUEA 4YXWA 1L5VA 2YFKA 3HVKA 4AKHA 5CYPA 3AUFA 2P4HX 2VRWA 4PM4A 3E4CA 4Q3DA 1RJWA 3ZJ5A 1K7XB 3RBXA 1YC5A 2WKWA 6GPBA 1C7RA 2PRZA 2DWOA 4PLHA 4DA4A 3E9NA 4Z1MD 2X8JB 1NMZA 4B3RB 4OMUA 2X8JA 2Q8NA 4TLBA 1T9GR 2QRVB 4NS1A 4Y3UA 3W79A 4DA8A 2QRVA 1V37A 3MRSA 3G13A 1HT2E 4J0JA 3H7IA 1G66A 4BATA 4EKGA 3HY3A 3W05A 4NATA 3ZE9A 3YASA 1ZVQA 1FFBA 4UE6A 1KY3A 5CMLA 2W2OA 1NDHA 2OORA 4LMRA 3ZHUA 3JZIA 3MILA 4DOMA 4HGNA 5H3HA 3SDSA 1TI7A 3AFGA 3TX6A 3GZTB 2I4MA 1ZOOA 5JSYA 3F3MA 1GU0A 1OMOA 1RJDA 2PX6A 1UEJA 3OO1A 4URXR 1UBHS 4RVGA 4FWTA 1DKOA 3LL7A 1G6OA 4NMMA 2ZB8A 2E55A 2FSPA 1M8GA 2AIRA 1PFKA 4NBRA 2BY4A 1H1LB 3IALA 4EG0A