4CMEA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 249
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmeA00
1I24A 4UUPA 5KIAA 2ZB4A 1HE3A 3ZWOA 2NUAA 1PR9A 2V7PA 3VTZA 3I9OA 4PLFA 4OQZA 2RIRA 4E2XA 3D4OA 1G1AA 2D8AA 2OOSA 2AW5A 3JQ6A 4MO2A 5I9LA 4CMJA 1ULSA 4R51A 3HDHA 1GY8A 1PGNA 3KSZO 4PLPA 1M6HA 4DLAA 5AYVA 2EERA 4GAEA 1U9JA 5T5QA 5MDHA 1JLLA 1JA9A 3ZH2A 3VZQA 3WDSA 4CV3A 4YT8A 3TOZA 3H9QA 5TT0A 4FSHA 1Y8QB 3L4SO 2ZKLA 3L77A 4FBGA 1SPXA 4NBWA 1E5QA 2BLLA 3ANNA 3HG7A 3A1NA 3CH6A 5IZCA 2C07A 4J7XA 1QORA 4EITA 3DEYX 5K6AA 3ETEA 3Q11A 1HZZA 2P4QA 2CF6A 1NR7A 3NUGA 5EL0A 2BI8A 1EDZA 1M67A 2NM0A 2JCVA 2OL4A 2V6BA 3WOHA 2FOIA 3DTYA 3Q2KA 1GZ4A 3R3SA 5A05A 4PLGA 4NMHA 2GASA 1U7TA 2Q50A 4N5LA 2A94A 1E0DA 1VE9A 3WG9A 4ZGWA 4RPGA 4CUZA 3E48A 3PDJA 4B79A 2DTDA 4NFYA 3IQDB 3I4FA 3INGA 4URFA 4W7IA 5I9MA 3O9ZA 1LSUA 1WWKA 1ADBA 4OXKA 4RLHA 4XGIA 3HB4X 3HQ4O 2BELA 3ADPA 3H5RA 2VWGA 2VZ0A 3K9QO 4FS3A 4WE3A 1P1HA 3HUDA 4ZA2A 1BSVA 4QO7A 1L7DA 1MXHA 4BNLA 5U4QA 3AM4A 1CEQA 3TPCA 5L3ZA 3T4XA 2GERA 3S2FA 2GZ2A 5FEUA 3WTBA 5TRTA 1RJWA 1XHLA 5KWEA 3D5TA 4OKIA 5GZ1A 4KWHA 4KP7A 1WDLA 4NHEA 1V8BA 1LBEA 2R00A 2Y67A 3RIHA 3AUUA 4CM7A 5EIOA 4FJ2A 4JJIA 4OOFA 5JDCA 1PJ4A 3OECA 4DC1A 3C7CB 4XGKA 1KS9A 4CL3A 4UREA 1I10A 2C5AA 2X0NA 3ASVA 3I9NA 2Q3EA 4XWYA 3OBBA 4P38A 2JFFA 5DP1A 5G2OA 1ZMOA 2C7VA 1NASA 1NQTA 4Q3AA 3WNVA 3RD5A 4BNFA 5BSGA 1N7HA 4ILKA 3D3WA 3RWBA 4K28A 2GSDA 3WICA 3F6YA 5F1KA 3ZV4A 1ISHA 1N8KA 1Q1NA 3D64A 3EUWA 1MG0A 3JQDA 3PFWO 3FPCA 2VHVA 2J6IA 1P45A 1LC0A 4LCJA 2ZIZA 1NFRA 3NAQA 4BS9A 1ZK1A 2Y0DA 4LVCA 4XIJA 1JQBA 5GMOA 2VT3A 1ISIA 3SJUA 3ZWPA 3B6ZA 1U3WA 2E4AA 1ULUA 4MVJD 5COQA 3HE3A 4JK3A 4GX0A 3LSYA 4EEXA 3RKRA 1NM5A 2Y0EA 1ENOA 2IZ1A 2W8ZA 4DWVA 3WWZA 2OFPA 1ZXLA 4ND3A 2H9IA 4YEDA 4BNHA 1KVTA 3M2PA 3CZMA 1O94A 1PU2A 3KUXA 5C5IA 3X2FA 1EFLA 1DHTA 4NQZA 3B20A 1Y5RA 3LU1A 4OKNA 2EGHA 1OMOA 2YV2A 3HFSA 1YDWA 1HEUA 2J5QA 3PP8A 5HM8A 5TGDA 2Q2VA 1LXCA 3ZDFA 1QV7A 3JQGB 5IG2A 2B4TO 4B4WA 4E2WA 4Y67A 3W1VA 1P74A 5GZ6A 4AJ4A 4CQMA 2E48A 4Z3KA 2Y1GA 4U8GA 1NVGA 4XX0A 2OO5A 3I1JA 5JO0A 2C0CA 1M76A 3BAZA 2DBZA 1C1XA 1ADFA 3AOEC 3DB2A 1TEHA 1XEAA 3I9LA 3LF1A 3PHLA 3NX4A 4EJ0A 4F45A 6LDHA 4BNGA 3ZV3A 1PSDA 1KC3A 1DJNA 1Z7EA 1YVEI 4Y8VA 2QRLA 4I08A 4ESOA 1BTOA 1Z73A 4JX8A 4QECA 1WZIA 1VPDA 1X7GA 4TSKA 1E1MA 2VWPA 3L6OO 3WJAA 3GGOA 3FR7A 2EF1A 5G0TA 4M1QA 1B8VA 1NPTO 3RC2A 4BQRA 1I33A 1YB4A 3VKVA 1HTBA 2GN6A 2CVZA 2AEJA 3L9XA 1D8AA 5IZ4A 4M89A 4YJGB 1ADGA 3DWFA 3IUSA 4CLRA 1WDKA 1EQUA 3G1UA 1HDZA 2AQKA 3BTSA 2Y0CA 4FGSA 5BSFA 3INTA 4DPKA 3HWRA 5KJFA 4TKMA 1EVIA 3V2UA 2UVDA 1BXGA 5U1PA 5K0ZA 1ISFA 1BW9A 2H63A 1FDTA 2XPCA 3O26A 5ENVA 4MVJP 1GTMA 4O63O 1EUCA 3GA0A 2HCTA 5A5FA 1ZO8A 4FOOA 4HBGA 5C3MA 5EMHA 3GGPA 4P4GA 1XLTA 5A9SB 2EWMA 3V8BA 2AE1A 5JLAA 4EGFA 4C4OA 2D5CA 3AY6A 4IXTA 4KDEA 4LMPA 5FI3A 4UVGA 1LDNA 5IFLA 1QR6A 1H2HA 4R54A 1JWAB 1ZUD1 1PS9A 3GN1A 4W9NA 4FB5A 4FD3A 5L7YA 2G5CA 1A4IA 4IJVA 1BW9B 2NADA 3AI1A 4RPJA 3W4IA 1YGYA 5A04A 5KNLA 3JQFA 4BNJA 1A71A 4J90A 3UXYA 3E03A 1LLQA 4XEHA 5IN5A 1UZMA 3LLSA 2CVQA 4R5MA 3WGHA 1PWZA 3PXXA 4JBHA 4CV2A 1ZJZA 1XU7A 5JAQA 2I66A 3DR3A 1AGNA 5EQFA 2GGSA 1HDOA 1H6BA 2YY7A 3FNHA 2OMEA 2NU6A 3AY7A 3QQPA 4ZQGA 1U3UA 4R1NA 2DC1A 5AXDA 1N9GB 5L95A 5HBRA 2AXQA 3BHMA 4GBJA 3Q9NA 2O2SA 3RBZA 2CDAA 2DTEA 3E18A 1XIVA 1B7GO 1FXSA 1U8FO 3L0DA 5ILGA 3U4CA 3U9LA 4AJ1A 5JYDA 2Q2WA 3GNQA 4DVJA 4H16A 1MP0A 1QLHA 4CL8A 1VM6A 1Y6JA 3T7CA 4BNWA 1EUDA 1JKIA 1Q0LA 3KB6A 3GAFA 1QSGA 2Y1FA 1DC6A 4WPGA 2BHLA 1UXIA 2VHWA 3T4EA 3ZW9A 2YQ5A 4WCFC 4CV0A 4CQMD 4BV9A 3AFNA 3LLVA 3WWYA 3LDHA 1HRDA 1E6UA 4XB2A 1L1FA 1EE9A 2VNAA 3ZU4A 3ZZNA 1HDGO 4IQGA 1R4NA 2LDBA 4RQUA 1J6UA 2VYNA 3K2EA 2OGUA 4ZQBA 3ETDA 5DN9A 3RU7A 3GG9A 3SJ7A 1Y5MA 4HFRA 1AN9A 3DBVO 2ZJ0A 4IY1A 4LRTB 5JYEA 2QRKA 3S1LA 1RKXA 3DONA 1YRLA 1ZSYA 2VNSA 1I36A 1BRMA 5J23A 3LT2A 1PJBA 1RM0A 1DB3A 2QIOA 5JMWA 1DIRA 1Q0HA 4QSMA 1LDGA 1MG5A 3NTRA 1EK6A 4YAJA 3B1FA 5L4LA 1H94A 1GQYA 2X23A 4WLEA 1PTJA 5G0SA 1B3RA 1XQ1A 4R1TA 4D79A 4TQGA 1XKQA 1CWUA 4J2HA 3QWAA 2W98A 1PZHA 4XQEA 3ZGYA 4RF5A 1YBVA 4WNIA 1HDRA 4E30A 1DFIA 1E1KA 4E5PA 4TVBA 3KYDA 2YHUA 3ITKA 1H6CA 1PL6A 4NBVA 2P9CA 1IOLA 5B37A 4M49A 2CD9A 2AQHA 5B4UA 3QSGA 4INAA 2QZ9A 4Z0TA 4FIZA 3VVBA 1B15A 1UR5A 1PX0A 4KOAA 3L6EA 3HADA 2CF5A 4MVJF 1YQDA 3MWEB 1BWSA 3AW9A 1H6AA 5AOVA 1I5RA 2O48X 2Q1SA 1X14A 1O0SA 3ZWXA 1I01A 1M66A 4HY3A 4Z0PA 1PR3A 4MVJG 2BGLA 4E3ZA 1HE2A 1E92A 3MTJA 4DLLA 1KVRA 2O7SA 4YCAA 1P1FA 4JROA 1BXZA 1X15A 4ZQEA 1UXJA 1UXKA 1T2FA 4YVFA 4PRLA 3E82A 1UDCA 1LA2A 4JN6B 3PWKA 4DBVO 1OFGA 4Z9YA 3UOGA 4AL4A 1C0LA 5COBA 2X9NA 4PVDA 2X1HA 4I5EA 2VOJA 2AG8A 1XR3A 4Q3DA 1NNUA 3FPLA 2HMSA 4B3HA 4KUEA 4Y9DA 3DBRB 1U2DA 4XQ9A 2ZQYA 9LDTA 4RZHA 4B7CA 3OJ0A 2XXBA 4UULA 3W4JA 3VPSA 5ICMA 2HMTA 2IE0A 3PDUA 4R3NA 2Y1DA 4BB5A 1F06A 4J3FA 3M1LA 2DU8A 1Q2XA 3RUAA 4UVEA 1V35A 2EJWA 1U5CA 1N1EA 1SCUA 4RF2A 3GAZA 3V2GA 2O4CA 3BMOB 4BB6A 4ZN6A 4J1QA 3BXXA 1Y1PA 3TDKA 1PGQA 1PZEA 4OHUA 2GN8A 4J16A 3JYOA 3L07A 4ND5A 3SLKA 1YB1A 3JYNA 1V3TA 4B3IA 4D3FA 2YDYA 5TJHA 5JSFA 1F8FA 4ZICA 1SNYA 4QQRA 2C20A 1E3WB 5C7IO 1EVJA 2C2YA 2VRBA 4N18A 3U4HA 4KUGA 4P8RA 5L53A 3GNSA 2F1KA 3OP4A 2PWZA 1KEUA 3NDIA 2YFQA 2ZQZA 2DQ4A 2BD0A 1NTOA 2JD1A 1GADO 3BHJA 3EZLA 1U5AA 4NPCA 1P3DA 1NAHA 2EP5A 2VYND 4R1UA 5JAZA 4WEQA 4WGGA 2DAPA 3H3FA 1PJ2A 2NVWA 4Q3BA 2B5VA 1DC3A 4ZRMA 2B83A 1NVTA 4CMIA 3VZPA 4DTIA 3FN4A 5L51A 3WLFA 1P0FA 1ZXBA 5CPBA 4MJLA 5AQ1A 1QYXA 4U5QA 4A5OA 3NGLA 4J4HA 2JKVA 1LQTA 4AJ2A 2BFOA 3P7MA 3RUHA 5TSDA 3TRIA 5IXSA 2BI7A 1WW8A 3Q9UA 1PJCA 5BR7A 4PRKA 1VL6A 3WXBA 1E7RA 1V3VA 3DL2A 3S2IA 4CR6A 4AG3A 3P2YA 3H65A 1HSZA 3U0BA 2CVOA 3DZGA 4G2NA 4BGIA 4R3WA 1ZJYA 3DHNA 1AXEA 2IYPA 2IRWA 3WQRA 3PEFA 1UZLA 4PLCA 3EMKA 3PHGA 2DT5A 2CUKA 1BXKA 4MVJI 1XWFA 3WGZA 1DEHA 1W6UA 3VZSA 4BO8A 3D7LA 2O3QA 3GLQA 1MA0A 2FPIA 4MIYA 1JN0A 3IC5A 3CXRA 2EGGA 3F5SA 5ENDA 4IJUA 3RASA 5KVQA 2B36A 3H8VA 4KTTE 4XCVA 1ONPA 4YWJA 5A03A 4YJFB 2ZB3A 5U9CA 1UXGA 1VSUA 4IDGA 5DF1A 1IULA 2I65A 5A3JA 1FMCA 4AJPA 4DPMA 3GFGA 3K6JA 1PIWA 4GX2A 1EE2A 2D0IA 1W0CA 3W6ZA 4ZHSA 1JAXA 1TT5B 3DZHA 2HKIA 1W4ZA 1YB5A 4BMNA 1IB6A 1DO8A 4L74A 2GF2A 4HADA 4CMBA 4NJMA 5ILOA 1ML3A 4IM7A 2HMVA 3GHYA 4FR5A 4D45A 5L40A 5EJ2A 1SOVA 3ENNA 2VZ8A 2HUNA 4UEKA 3F47A 4DRYA 1DXYA 3ZNQA 4MKZA 4MKXA 4A10A 5THKA 3WMXA 3NJ8A 3QRWA 3F9IA 3KBOA 1CJCA 1EMDA 5ITVA 3CUKA 1FDWA 4Z0HO 1EEHA 4ZJUA 1LLUA 1ZSVA 1KY5A 2GYYA 3I23A 2E6UX 4RL6A 3LT4A 4O59O 3INRA 4NI5A 3DQPA 1WNTA 2FZEA 3FNGA 2VZ9A 4L73A 4EYEA 1HETA 2PKRA 2AHRA 1HT0A 1SB9A 1LX6A 4YTEA 5IDWA 4R41A 1R0KA 3E1KA 1LNQA 2VHXA 1X13A 4TZKA 3K30A 3WBFA 4R9SA 4IZHA 3RAJA 4EUEA 2JFGA 1YQXA 1OAAA 3M6IA 4L75A 3ZNNA 7MDHA 4NJOA 3UCXA 1B3BA 3DOJA 2C2XA 3U62A 4ALKA 4GMGA 1VL0A 2TMDA 1YKFA 1N92A 4BUCA 4XA8A 1K6JA 4OXYA 5G0VA 5CAEA 5I7FA 2W2LA 3I5MA 4M86A 1UP7A 3RBVA 3H3JA 1DRUA 3RUEA 3R0IA 4GSKA 4YBZA 3ZWYA 1GV1A 2PY6A 1DRVA 2BGMA 1X0XA 1A7AA 5ITWA 4O0LA 3WGTA 4CR8A 4OOEA 1Y8QA 5DBGA 3ZCXA 2PGLA 4B4UA 1NFFA 3BTVA 4KZPA 2HRBA 5CDUA 3KLPX 2NSDA 3CSDA 4PLVA 1HLDA 1YJQA 4ALNA 4JP2A 2GR9A 3VKUA 3JD1A 3ZNPA 3UF0A 4ZVVA 2X86A 3D4NA 4DGSA 3VC7A 1ENPA 3GDOA 2Q4BA 1E6EA 5GZ3A 1FDSA 3M1AA 2E49A 5CG2A 3ZN2A 5TX7A 1PZFA 1IZ9A 3ZWNA 4CM1A 2GLXA 4FOSA 3MJCA 4OJNA 3JD3A 1ZVMA 3OM9A 4KQWA 1GCOA 4WK6A 4A7PA 3C85A 4CMGA 1ZFNA 2O3SA 1XQ6A 3KRTA 4FPXA 4EUHA 3QA9A 2FSVA 4K6CA 3ABIA 4OIMA 1W73A 3RSHA 3BMNB 4IMRA 3DFUA 4AJJA 4D41A 4GQAA 3BMCB 1E3EA 2EV9A 3TQHA 1Y9AA 2VWHA 1QP8A 2W4QA 1K0UA 2QZZA 4BKPA 4RJTA 4FDAA 3GQVA 5L7WA 2G1UA 1JAYA 3RJ9A 1R6DA 3ONFA 3VPHA 4CM4B 2X4GA 5I8WA 3WGOA 1ZMTA 4GGPA 1V9LA 5EPOA 3GOHA 3H6KA 5AXCA 3GVPA 2IYOA 1OBFO 4YQYA 1U1IA 1MGOA 2BRUA 4IQ8A 5LDGA 3QWHA 4J49A 1C14A 4MP3A 4JP3A 2ZTUA 1GQQA 1V0JA 2YFHA 4NFSA 3VDQA 1Q7GA 5DNAA 1K2WA 3D1LA 5A1TA 2UUPA 4W99A 5HS6A 4DYDA 1NWHA 3IKTA 3H7AA 3DBHA 4QFDA 4R68A 3F46A 5ICSA 4RCVA 4DPLA 1Q0QA 3WGQA 2CNBA 4FFOA 4JQCA 3UKOA 3WQSB 1AXGA 1DJQA 4J4BA 1DIAA 4O6VA 5BT9A 3JQBA 4YPOA 2A92A 3PWZA 4L4XA 3KLMX 4BO7A 2NLOA 2D1YA 2FP4A 3NYWA 1ISGA 1VLLA 5B4VA 4J1SA 3FTNA 1PL7A 1I3KA 2QG4A 1ZK3A 1JU9A 4CMAA 1SOWA 3ZV6A 4G5HA 2XXJA 3DBHB 1JVBA 4II3A 3WB9A 1UAYA 2WWRA 3SVTA 4K6FA 4WCFA 1DPGA 2FWMX 1WDMA 2AE2A 1I3LA 2A35A 3ADOA 3SLGA 4KTVE 4K26A 5L7TA 4B8ZA 3EGOA 1GZ6A 4J6FA 2W2LD 1YL7A 3PJFA 4GKVA 4LMRA 2WDZA 1FDUA 3IAHA 2ZCVA 1RM3A 2OBYA 4C7JA 1ZEJA 4EUFA 1B16A 4D3DA 4AVYA 1MB4A 2HQ1A 4YXFA 1RPNA 3E9MA 2FR1A 1DLJA 4FJ0A 5C7OO 1KY4A 1P9LA 2ZB8A 1ORRA 4R01A 1GYQA 1T25A 5F3RA 3RJ5A 5ADHA 4BO5A 4HFNA 1NAIA 1OI7A 1VKNA 3F1LA 3H9GA 4WCFB 1W8DA 3E5MA 5DZSA 3GVXA 3I9KA 2NWQA 3D3EA 3JQGA 3SC6A 2Z5LA 1KEVA 4IDCA 4WLVA 1UDAA 3WMWA 3ROMA 3S2EA 2CZCA 5CEEA 1B14A 3O03A 3IJRA 1X1TA 2QW8A 3KTDA 1E7YA 4OM8A 3F5QA 4WOJA 4GPD1 2P5UA 2HU2A 4CLXA 4QTZA 3Q1LA 2ZTVA 3DFZA 2DM6A 3AOGA 4N54A 5IDYA 3EVTA 2AQIA 1F8GA 1KEWA 3DZKA 3OETA 1WZEA 3GEMA 4TROA 4FW8A 5MGBA 1ENZA 2ZYGA 1DOHA 4NK4A 4H15A 1DBVO 3CTMA 4FGWA 2GCGA 2P68A 4UUOA 5T64A 5JY1A 4U7WA 3DMTC 1WAMA 3WGGA 1Y8RB 2GDZA 2B69A 5DP2A 1HE4A 1LRJA 2YHIB 1T2AA 4DUPA 4H7PA 3VZRA 1E3JA 4RGBA 2J3KA 5CDYA 2X0IA 4IJKA 3B70A 4YJGA 3PHHA 4BQPA 1D1TA 1D7OA 3QE3A 1UUFA 1VC2A 3V5NA 5DT9A 4NIMA 1MC5A 4EBFA 1VRWA 5CG1A 2WE8A 5JY6A 2A9FA 2WD7B 2P2SA 2PGDA 1Q7CA 1RYEA 6ADHA 4ND2A 3GUYA 3W6UA 2BFPA 5DCUA 4BNIA 5A9SA 2P91A 4QXMA 2O3UA 4MOWA 4RV9A 3QVOA 3NV9A 4J2OA 3MOIA 4FC6A 3X2EA 4B8WA 3EC7A 5L4SA 3GPDG 4D46A 3FNFA 1HE5A 2C7GA 1ZNQO 1HSOA 2EKQA 4MP8A 5HTOA 3D0OA 2ZJ1A 2DKNA 4L4RA 3AI2A 2HDHA 3OEYA 4IMPA 1EFKA 1NQ5A 3H4VA 4E5YA 4HWKA 1RM5A 3JQAA 3NTOA 2J5RA 3ONDA 3IMFA 5BSHA 4JXKA 2JL1A 2VQ3A 1LU9A 4RVGA 1UP6A 4EZBA 4QFCA 2HJRA 3GZ4A 2D3TA 4JGBA 1K6XA 3H2ZA 3DAGA 3IOYA 1LEHA 4NFHA 3PWSA 2YUTA 4BVAA 3RI3A 2X0RA 1SO8A 4ND4A 2RHRA 2EHDA 1EVZA 1SZJG 3IP3A 5IAAA 4KQXA 2ZK7A 1UAGA 2D5AA 4MINA 5BNTA 3BYZA 5IZCC 3JQAB 1N9GA 4OQYA 2VUUA 3ANMA 5K6AC 1NBOA 3B1KA 1Z82A 1P33A 4AJKA 5JMPA 4DQUA 5TT1A 1EBFA 4AJIA 1Y81A 2AMFA 2GNAA 3K8ZA 4WEOA 5B1YA 5DBIA 3F4LA 4CMCA 4J43A 1VJ0A 4YACA 4FCCA 4CMEC 3NDJA 3H9EO 3WQQA 3AFMA 4NR0A 2X6TA 3JQ9C 3V1UA 4EEZA 3MZ0A 5FF9A 1T2DA 4NZ9A 5COAA 3PLRA 4BHTA 4BL5A 1GCUA 3UCEA 1XCBA 5JBIA 2FR8A 3EHEA 2B37A 4PFJA 4L9RA 1Y7TA 5HS4A 3DAFA 3K73O 3AK4A 4J9VA 5TIIA 4BV8A 2QRJA 4CM8B 1D3AA 4PZEA 1NPYA 3AUTA 1OZAA 1P44A 1H93A 3AWDA 3ZWMA 2Z95A 3DC2A 3A14A 4II2A 2Z1NA 4GL4A 1CYDA 5EN4A 1WPQA 4LSWA 4BNYA 2CSUA 1I0ZA 3OIDA 3FTPA 3DZIA 4BNZA 5TS3A 3JD2A 2GPTA 3LK7A 3H9UA 1UDBA 1PGJA 3GPIA 4CJXA 4J0EA 5L4NA 2WMDA 3WYCA 5JCXA 3LQFA 2Q99A 5T8KC 4E2YA 1PWXA 3I6IA 2PKQP 3JCZA 3E9QA 3GDFA 1UJMA 2H6EA 1BGVA 8LDHA 4L4SA 4F6LA 2H5LA 2I3GA 3TOXA 3UN1A 1T24A 1SMKA 3EYWA 4BIIA 5JDCC 4RDHA 3LC7O 1IHXA 3TZ6A 5KTKA 2J3IA 4QEDA 2PV7A 5AXBA 1PQPA 3SEFA 2B0JA 1XGKA 4LK3A 1GV0A 4JIGA 1O89A 1ZIDA 3ETGA 1ONNA 4U0JA 1I3NA 1LJ8A 3GY0A 1I3MA 1DAOA 2D2IA 5G4LA 4QX6A 4JCOA 5L45A 4PIVA 2GD1O 2HMUA 4FFRA 5T57A 4J7CA 4P4LA 1CIVA 5DOZA 2P9EA 5IXYA 2NQTA 3BMQB 3HN7A 3PLNA 4WKGA 1E3IA 3PK0A 5I7SA 1RM4A 3E5RA 3OF2A 5DCYA 5CEFA 3BIOA 3GF4A 2Y68A 1PJQA 2X5KO 4NDNE 2IEBA 2DFDA 2I67A 2FR0A 4NNJA 3KSDO 2EKPA 4WASA 3OQ6A 1EDOA 3WSVA 2UUOA 4AICA 4PG4A 3RKUA 1A7KA 2XF8A 2JJYA 3QWIA 4Z3DA 4OAQA 4N5MA 1PL8A 1DC4A 3VPXA 3RUIA 4QUKA 1H2BA 2B35A 3EZYA 3JQAD 4YRDA 2HMWA 4YAIA 3P2OA 2JHFA 3K5PA 2EJVA 3ROPA 2JD0A 2OP0A 1QG6A 2VCYA 3OFSA 3ZWCA 4IGFA 3CKYA 5JW6A 4JJFA 3V1YA 3FWZA 1GUYA 2IZ0A 4B3JA 1UH5A 3KEQA 4GSLA 3R1IA 3WFIA 4J9UE 1XG5A 4BO4A 5JC1A 2OORA 3DBRA 4FFMA 4CLHA 1TB4A 2E82A 3UVEA 4MIOA 4J1NA 3OA0A 1HYEA 3FRJA 4H3VA 4EDFA 3L4BC 4BO2A 2HRZA 3TF5A 5KKCA 1ZKMA 2Y93A 4PGFA 2EXXA 3VH4A 1BG6A 1SEPA 3VDRA 3BMOA 4DA9A 4PZDA 3LZ6A 3U49A 1KC1A 3ANLA 1YE3A 4K9DA 5B4TA 5CDTA 1XA0A 3C24A 4TRJA 4MVJE 3HJAA 2Q2QA 3SBOA 2YV1A 1T4BA 1EUZA 1FK8A 4PG6A 1HDXA 2HK8A 5G4KB 5KCZA 3O8QA 3PPIA 1E3WA 1TXGA 3N58A 3C1AA 3KZVA 2RH4A 4DMMA 4RF4A 5A02A 1G0OA 5JO9A 1YL5A 2NQ8A 3L9WA 2I99A 3NJ4A 3GEDA 4PG8A 4HXYA 4R1SA 3DZBA 2ET6A 2CFCA 3TNLA 3N7UA 4DC0A 2BH9A 3KETA 4GGOA 2OZPA 1EBUA 1C0PA 2RBEA 4AJLA 2ZYAA 2W90A 2AQ8A 4J1TA 5DBFA 3VH3A 4UVHA 2EP7A 4NG5A 4PCVA 3GN2A 1M2WA 3M2TA 4IIUA 4NH4A 1GYRA 1MFPA 4MKRA 3KXDA 3O8QB 3C7AA 1T2EA 3IP1A 4ZRNA 5F1OA 2GZ3A 2HK9A 3JQ8B 2FPPA 1CQJA 1SEVA 4IINA 1I2BA 1YDEA 4BOYA 3S8MA 2PZLA 1T1RA 5BSEA 3ZU5A 4XYEA 3RUFA 4I5FA 3WR5A 2J3JA 1NP3A 1PJ3A 4WNCA 2PZKA 1LC3A 2PLAA 4TMFA 2VRCD 3WIDA 2WYVA 3HDYA 5B12A 2Q49A 4D42A 5IDQA 3WBBA 4WLOA 4YJHB 3GNTA 3DHYA 1U2GA 1AE1A 3VPGA 1MX3A 1N7GA 2G82A 2PA3A 3FWNA 3I4CA 4WECA 2YQ4A 2G0TA 4BNXA 2JHGA 4G81A 3C3XA 3OIGA 1B2LA 3LYLA 3STHA 1GPDG 4RVHA 1HYHA 3JQFC 1FJHA 2NTVA 2OBNA 3DOCA 1NQAO 4CLOB 1UXHA 2YW9A 4B7UA 4CM5A 3HSKA 3F1KA 2EG9A 4ND1A 4XYBA 2UDPA 4BKOA 5LDHA 4YJFA 4CV1A 3A9WA 1LRKA 5JC8A 5BQFA 1B8UA 2FY8A 2WJPA 5EERA 1SB8A 4YT5A 4A03A 2YV3A 1XSEA 2D59A 4GVLA 1P1RA 2Q45A 1TT5A 4ITUA 4XB1A 3UHAA 2JAHA 4BO3A 4BNMA 5A4DA 1YO6A 4RLSA 3G0OA 3S2GA 3JSAA 3MJVA 1HWYA 1O95A 2V6MA 4WUVA 3GG2A 1K6IA 4XD2A 5TF4A 3WNQA 4GH5A 3JQEA 3W8DA 1K89A 2FRDA 4OXNA 4W7HA 1AHIA 2R6JA 1I8TA 3QV1A 5T67A 3UICA 4Y6SA 1GU7A 2I5PO 3G17A 5JS6A 2VT2A 4ID9A 1K5HA 5IN4A 1ZH8A 2JD2A 5CP8A 3ZU3A 4ZQHA 3K96A 4DIFA 4DXHA 1NWCA 3CE6A 1BDBA 2PH3A 1ARZA 4OSPA 2ZTLA 3A4VA 4E5NA 4YT4A 4FN4A 2J8ZA 4OYRA 2VTEA 4FC7A 4RZIA 4BGVA 3QWFA 1NVMB 4YJDA 3WYBA 2C5EA 3TFOA 2WTBA 1I2CA 4UAGA 4A26A 2PH5A 4HFMA 2IZZA 4DLBA 5F21A 4FFNA 1F17A 1HL3A 3ST7A 3KYCB 1U4OA 1LLDA 5LCXA 4DIOA 4FQ8A 1CRWG 1O9BA 3E8XA 4IDAA 3DAPA 3ITDA 3LC1O 3CINA 4R16A 5IJZA 2C59A 2PFGA 3JYQA 3ZHYA 3QY9A 3HB5X 3ULKA 1NR1A 3WFJA 2WE7A 3ZV5A 2VWQA 4GVXA 1T2CA 5HWSA 3G1TA 2DFVA 3KHUA 2QX7A 4PG7A 3AI3A 1BVUA 1F0YA 2WM3A 2IXBA 2QYTA 4Q3EA 4AFNA 5I7VA 2POQX 4UEJA 1OC2A 2O2YA 5JCJA 4OL9A 2Q1TA 3AOEA 1LSSA 1YQGA 2DPGA 3FSRA 4IPTA 1CERA 3LT1A 4D7AA 5H82A 3C8MA 2QYSA 3HHPA 4BGEA 1A4UA 3BTOA 4MDHA 1U7HA 4LVUA 1PGOA 1XU9A 3H2SA 5A9RA 2O3RA 1DIGA 1BDMA 2EEZA 4IDDA 3L6DA 2VOEA 4Z9FA 3MJSA 2Y1EA 2I6TA 8ADHA 4CM3A 2NV6A 3QWBA 4M87A 1ISJA 3IIEA 4DL9A 3NT4A 3I9MA 3K92A 3TZQA 3BMNA 1U4SA 1A9ZA 1GAEO 3GGGA 4EI2A 3QVSA 3WLEA 4XR4A 3SXPA 3BMCA 1HF3A 1T4DA 3IS3A 5FYDA 4TRRA 4P4NA 3S55A 3TJRA 4N7RA 4RPHA 2DPHA 1DRWA 3IJPA 1R66A 3RBXA 4RVDA 3GMDA 5CHEA 3RCBA 3GT0A 4HP8A 1RWBA 2O7QA 4CM4A 2NVUB 3O4RA 2JCYA 3RVDA 4Q3NA 4FJ1A 3UCFA 5KVVA 1LDYA 2HK7A 3AUSA 1CF2O 3GRKA 5I7EA 1KOLA 1HKUA 3D5QA 4P22A 1C0IA 3LT0A 3ROKA 2NTJA 1ISMA 3AM3A 3TSCA 4J7UA 1QLJA 1R0SA 4JBIA 4XQCA 3WJ7A 2P4HX 3NT5A 4HNGA 4EJMA 4PLTA 1GR0A 4XDZA 5F5NA 5A3VA 4BO1A 2DVMA 2OUIA 3GVIA 3JD0A 3PJGA 2GN4A 4XIYA 4IUYA 3VAZA 3GVHA 3H5NA 1KETA 1VSVA 1PJTA 5TNXA 3PVZA 1PJLA 1PS8A 5CDGA 1CDOA 4KWIA 4DIBA 4CMEA 1IYZA 2SCUA 5H81A 4XZ3A 4J4TA 3PYXA 1YOVA 3TL2A 1WVGA 3HZZA 3QVXA 2VN8A 4GI2A 3JQ9A 4ZD6A 2EKLA 3U3XA 1Z6ZA 2PTGA 4GWKA 1DIHA 2Y66A 1IY8A 2VTDA 5IDXA 3WS7A 3NDRA 5AVOA 1QYCA 1P0CA 2EW8A 2I76A 2DBRA 4ALLA 1U3VA 4WCDA 1NHGA 4D44A 4K1LA 1E7QA 3TZHA 2Y05A 4Y98A 2NU8A 3AU9A 4BO9A 1LUAA 4RPLA 3W4KA 4MVJH 2GN9A 2AA3A 1L7EA 4U6QA 1KEPA 1R4MA 1YOVB 3TWOA 4BO0A 3PJEA 1GUFA 3Q6IA 5AXAA 1R0LA 5KJEA 4J91A 3Q2IA 1H6DA 1H9BA 3TZCA 1ZK0A 3EY4A 3ZI0A 5T8KA 4S1VA 1JTVA 1LSOA 3EVNA 1KBZA 3PHIA 2RHCA 3B1JA 5JCJD 4IGEA 1R16A 2X5JO 3WGYA 3ICCA 4UUNA 1YWGO 1IL0A 2DUWA 3MOGA 4GMFA 2GUGA 3GHHA 1NYTA 4ZQFA 1ONOA 3FD8A 4R69A 1GQ2A 2OP1A 3CZRA 1R4MB 2EW2A 1LDMA 1MLDA 3UW3A 5KJ1A 5KJCA 1TVEA 4E6PA 1PS0A 4I1IA 1O8CA 4NK5A 1RYDA 4YAGA 2HLPA 4E0BA 1YS4A 5F5LA 3I83A 5CPFA 3MWDB 4IBOA 5EQDA 4Q3CA 4RO0A 1R12A 2O3JA 4A0SA 3ZWWA 4DMLA 2JCXA 3BHIA 1A72A 1HXHA 4NBTA 3K2BA 3OHSX 1Q7BA 4AJEA 1Y8RA 3QW2A 4E31A 2YHIA 2NACA 4HV4A 3DO5A 2J3HA 3PQEA 1P31A 2X7HA 5JDIC 4WLFA 1SBYA 3H5AA 3QJ5A 4Q9NA 3JD4A 4E13A 4IS3A 1O6ZA 1O5IA 4XRRA 2C54A 3OSUA 1ZCJA 4B7XA 3D3WB 2PZJA 2UYYA 2Y1OA 1HDYA 3AY3A 1GZ3A 1LI4A 3TN7A 3PTZA 2C29D 2RAFA 2WD7A 2GRAA 4YA6A 1E7MA 4HX5A 4TVOA 1HZJA 1WP4A 3ON5A 1I2ZA 1VI2A 4IZIA 4LCEA 4XGNA 4YRAA 5H83A 2PKQO 2WSBA 4BNTA 4XJSA 4D0RA 5TJ9A 5C37A 4YDRA 2V65A 1IPEA 3KVOA 5CDSA 3PGJA 5DOVA 4IQ0A 4PLWA 1DDOA 1IE3A 2YJZA 1KVUA 1SAYA 1S7CA 2I9PA 3NKLA 5DCWA 5T6BA 4D3SA 3W8FA 4YT2A 1DSSG 4NU6A 1QYVA 3ENKA 3L4BA 3PIDA 1P1JA 3FBGA 1NQOA 2ZB7A 1P1KA 4PN3A 4JBGA 3D4PA 3R6DA 5FFFA 3GEGA 3JQCA 3HDJA 3BA1A 2UV8A 3HN2A 2YYYA 3KO8A 4UVDA 3MJEA 1YBMA 5A5EA 2ZATA 4IXWA 3PJDA 1GDHA 3ASUA 5KOIA 3LC2O 2FZWA 1NX6A 1TT7A 4CPDA 2X0JA 1GEGA 1PJSA 2AEFA 4FFLA 4OMUA 3ROQA 4CQMB 1IUKA 3ZNOA 5KVSA 2FN7A 1G6KA 1BVRA 4WLUA 2DBVO 1PZGA 1E6WA 2BMAA 2ILTA 5HA5A 4CM9A 1C1XB 2D4AA 4S3MA 3DTTA 4I9HA 1C3VA 5GY7A 1ADCA 3HNPA 1Z45A 3PQDA 3OJEA 4GX5A 4I8XA 5TC4A 2CDBA 2VUTA 1PQWA 3ICPA 2PGJA 5JPIA 1AUPA 4IDEA 3UUWA 1M75A 1T26A 3KEOA 4WOKA 1FDVA 5G0UA 2V6FA 4U0KA 3UFXA 3RUCA 4DQXA 3FHLA 4W6ZA 3P19A 3PI7A 4RQTA 4BKUA 1I30A 3N74A 1E1NA 1U8XX 3Q3CA 1VJ1A 4U6SA 2BF7A 1ZW1A 5JAMA 1J4AA 1JKFA 4QT0A 5EINA 1CETA 4CM8A 3OEWA 2NNLD 3OJLA 4CLRB 3EDMA 4CUJA 1IZ0A 4HUJA 4R5HA 3PHJA 4BGUA 2PD6A 3GR6A 3VPFA 1E7WA 2DLDA 3U09A 1BXGB 3BTUA 4CMKA 4XKJA 1Z7BA 4HFJA 4QO8A 1V6AA 1KYQA 3QP9A 2ZTMA 4TZTA 3RROA 1R37A 2O23A 4OH1A 2IODA 3PQFA 4L8VA 3OQBA 4RF3A 2OHXA 4BO6A 5JE8A 3JTMA 1EZ4A 1YXMA 1T1SA 3JQ7A 3NT2A 3T7EA 3DOOA 4JJGA 3JYPA 4L0QA 4L76A 1KVQA 2PZMA 3MEQA 3PZRA 3PIIA 4M55A 4CUKA 2VHZA 2B4RO 2HJSA 2WEKA 3OJFA 3QHAA 3I52A 3IUPA 3QLJA 4ALMA 4E32A 4EW6A 4X54A 1GD1O 4YAEA 4W4TA 1VJTA 2OXIA 4BKQA 2Q46A 1ID1A 2AG5A 3FCOA 3ONEA 3AJRA 3JV7A 3AU8A 3JQBC 1Y9EA 4O5OA 3ZWVA 3CPSA 3BMQA 3GRPA 1GFSA 1ZZEA 3E6AA 3QVWA 4W82A 2JAPA 3JQ7B 2R00C 1DHRA 1X7HA 5ER6A 4LRSB 4A2CA 3PRJA 1QXSA 2VYVA 5F1PA 4BMSA 1GUZA 2QHXA 2VRCA 1A5ZA 1LDEA 1H0KA 5DDIP 2FSSA 1E7SA 3W8EA 4GLLA 2CY0A 3IKVA 4YR9A 1KVSA 1DAPA 4PVCA 3ZWAA 1K3TA 1N5DA 4ALJA 2CDCA 3NRCA 4LN1A 2EIHA 4TRMA 1QKIA 3WYEA 3G79A 1P1IA 1JVSA 1Z75A 4I9NA 1M6WA 4CR7A 3UGKA 3OICA 4XRGA 5JNLA 4A27A 4BNNA 1NHWA 4TRNA 3A06A 3CEAA 1YH3A 1MXFA 3AM5A 4BKRA 1G0NA 2O3TA 3IL2A 4R4JA 4GLOA 1BHSA 4M8SA 4WLNA 1X7DA 3HFGA 4CQLA 1QRRA 1OC4A 3RFXA 1OOEA 1MV8A 3C1TA 1U3TA 2BKAA 4RVSA 5A06A 1NFQA 3Q0EA 4XYLA 3OA2A 4LSMA 3QVTA 4IDFA 3V1TC 1TI7A 4CM9D 2FMUA 3RFTA 2GZ1A 1R4NB 4RVUA 1YBAA 3V2HA 1GPJA 3O38A 3VH1A 2BGKA 3AUAA 1ZK4A 5HRUA 1X0VA 1LQUA 2HSDA 3PFFA 4XYMA 5FI5A 4CQLB 4UUMA 4Z9XA 3WIEA 5FWNA 1AHHA 3U5TA 4BNVA 1N2SA 1X1EA 4A73A 4N5NA 4DREA 5A9TA 2PNFA 3E9NA 5KJ6A 2PD4A 4JNKA 3RFVA 7ADHA 5G4KA 2G17A 4HNHA 4RPKA 1WMAA 1CQIA 1DIBA 2Q4EA 5DULA 3FNEA 1FF9A 5IF3A 9LDBA 2DTXA 1E1LA 2FPGA 1D4FA 4B4OA 1WLYA 4OSOA 1A9YA 1HLPA 3ZHBA 3MCVA 4FFPA 1GL3A 4IS2A 3G49A 4O1MA 5G0WA 4E2ZA 2E37A 3U4IA 4G65A 3GMSA 4IIVA 1NPDA 4CODB 5C7LO 5EESA 5ER9A 3KYDB 3GC6A 1ZK2A 4PLHA 4YQZA 2BFMA 1JWBB 1KIFA 3GZNA 4XDYA 1QMGA 5TQVA 4MIEA 1U28A 1JKJA 4ZU3A 4I9UA 2RCYA 2YZ7A 2X9GA 3JQ8A 3OMLA 1VKOA 2LDXA 1H5QA 3GFBA 3RC9A 2P5YA 4AJHA 2WYUA 1JW9B 4DQVA 3ZW8A 3VVCA 3LF2A 3SC4A 3ZHZA 2ZCUA 3PYLA 4XR9A 3RUDA 3RC7A 1E77A 3GZNB 4J0FA 2O50A 4YJHA 5THQA 3VTFA 2HAEA 5JXWA 2TMGA 4LW8A 5TLSA 3EW7A 1ZEMA 3VOSA 3F3SA 4C7KA 3GUCA 4D43A 4IJWA 1QYDA 1P77A 3GK3A 1S6YA 3QIVA 3WTCA 1D1SA 1H9AA 1VL8A 1E3LA 3TL3A 3RC1A 4E12A 1Z74A 4NU5A 4DYVA 4CLOA 2A4KA 2VYVD 3F4BA 4F46A 1PEDA 2YDXA 4LISA 3DZFA 3GDGA 3H9JA 4XJTA 2H1SA 4R9RA 4NBUA 5JFOA 2I3AA 4WJZA 4CMHA 1F14A 1YONA 4MP6A 4ROSA 4W9NC 1XELA 3LVFO 1UZNA 3DMYA 3KV3O 3EAGA 4IDBA 4HKTA 2PR2A 1EK5A 4PG5A 2X8LA 2NTNA 4UEOA 4E5KA 5JAIA 3RU9A 1EVYA 4YYZA 3HDQA 4F6CA 3OQ1A 4RDIA 2NU7A 3P5SA 3FF4A 4KMSA 1BMDA 2JFHA 3KM0A 3A28A 2BFAA 5CEJA 3FR8A 1MC4A 1V3UA 3U4DA 1R15A 2GO1A 4B4VA 1MUUA 5BNFA 1B8PA 3UAGA 2DUUA 4UVIA 1DFGA 3BZUA 4BNKA 3TZKA 2G76A 1YJ8A 2B4QA 3MJTA 4ALIA 4Z6KA 1HYGA 3WX0A 2RH8A 1IHYA 1SC6A 3G3EA 2FHSA 1GEEA 3PZBA 3K31A 4I5GA 4GX1A 2V6GA 5I9NA 2B5WA 3CMMA 1LRLA 1PQUA 3OJOA 4E5MA 1QV6A 1IPFA 3MJ4A 4CMIB 4PLZA 2NVBA 1E5LA 1WXDA 2WYWA 5CFZA 2C82A 5ES3A 4PLYA 3IDSA 1C0KA 1ZBQA 1EQ2A 1JDJA 3DBLA 4TKLA 1DFHA 3EK2A 3KYCA 3NGXA 3R3JA 4AJNA 3DDNA 4TWRA 3VHRA 4PZCA 1ZSNA 1WMBA 1QYWA 3VH2A 4DBZA 4RORA 4YRBA 1E3SA 3I6QA 4M54A 5KKAA 1C1DA 2AEMA 3PGXA 3ZWBA 2X22A 1LDBA 1UP4A 5L9AA 1J5PA 5LC1A 3GVCA 1YL6A 4CLEA 5BNIA 2Z1MA 2UAGA 3OH8A 4Q39A 4AJOA 4YB8A 3COSA 3DBLB 4BNUA 1I32A 2VHYA 5I8ZA 2IXAA 5JDIA 3KSUA 2CMDA 2W2KA 4KUHA 3SX2A 4E33A 4MPDA 2VUSA 1LTHR 3DXFA 2PK3A 2WD8A 3WSWA 1PGPA 3FI9A 3ZHXA 3RQSA 1GYPA 1KERA 3KOUA 4OO3A 2O4UX 1XDWA 2Q1UA 3TFQA 5K9ZA 4KDFA 3CMCO 2XAAA 3ZU2A 4BMVA 1A27A 1C1DB 1B26A 3MTGA 2ZYDA 3GH3A 4GKBA 4EJ6A 3DMTA 1MFZA 3I3OA 4CM6A 3WGIA 3DZJA 2J5KA 2Q1WA 2IEDA 4GWGA 3DHEA 2PD3A 2W2KB 3I9JA 1J0XO 2HO5A 4NJMB 3C7DB 4YAKA 2Y99A 3CIFA 1NXQA 1TA4A 3JYLA 2P9GA 2R2GA 4JLWA 4CLDA 3NEPX 4NBRA 4I5DA 2X58A 1N1GA 3OIFA 1B0AA 4LGVA 1DLIA 2NVUA 1TLTA 4F3YA 3PYMA 3NTQA 4Y6RA 2NU9A 4E4YA 2Y1CA 1LSJA 1DC5A 4ONEA 1ENYA 2DBQA 1J49A 3C1OA 2XOXA 4XQGA 4RVFA 4E21A 5KVCA 1HDCA 2F00A 3FBTA 2X5OA 2X9VA 3KYBA 2IDZA 4Y6PA 4XYGA 4D0SA 3UH1A 1XYGA 4MVJA 1F12A 4OGWA 3ORFA 1LLCA 2QQ5A 4MVJM
chains in the Genus database with same CATH superfamily
5KIAA 1G98A 2HZBA 4BP8A 1UK9A 2BC9A 2YWCA 3TJMA 4BNDB 2H7VA 4BV2A 4ECAA 2RAPA 2ZBFA 2NUAA 1DCKA 3A58B 2P35A 3I9OA 2VYFA 4ZCLA 4E2XA 3D4OA 2VDQB 1G1AA 2D8AA 2OOSA 1TA0A 2K7FA 2JVJA 1WB5A 2VPZA 3E2MA 2YS7A 2VA9A 4AAYA 1C9JA 1PGNA 2OG1A 3B1XA 4FI3F 2H16A 4DLAA 2EERA 1DQZA 3G6WA 1U9JA 4M2LA 2V0GA 1NMXA 1W4RA 2I62A 1JA9A 3ZH2A 4BEJA 3T3NA 4HI0E 2UZIR 4M9QA 1CNFA 3TOZA 1KQPA 4AN4A 3OCJA 4ZMSA 3H9QA 2KBEA 2W37A 4FSHA 3NWPA 1Y8QB 1PFKA 4WA8A 1EGQA 2ZKLA 3N87A 5DV9A 5IBCA 1SRQA 1SPXA 2V45A 3U60B 8ATCA 2YFKA 2PT7A 3HZHA 2VDKB 1HNNA 3DJYA 2GVNA 3EZ2A 3HDVA 1FYVA 2YJ4A 3O75A 2C07A 4NS4A 4O02B 1RC1A 3HUFA 1C4OA 5JNVA 4JHXA 2PYZA 2M6KA 3DEYX 2NPFA 4EITA 1THGA 2BW0A 1GIAA 3FCXA 3Q11A 2OYCA 1ZIPA 4KV9A 5FWAA 4Z4FA 2JI4A 2P4QA 3NUGA 4UU1A 2IUTA 5CT8A 2DWQA 3C14C 9MHTA 1Q7EA 1R1DA 4P33A 3DB1A 1ZM7A 2JCVA 4UTNA 1CJKC 3QKWA 1OXBB 1Y63A 1RCTE 3KZOA 3R3SA 5A05A 4NAHA 2GASA 3FLMA 4JLDA 3WYFA 1TRHA 3DHVA 1K3UB 5HZMA 3QYPA 3BWYA 2A94A 3QKSA 1M7BA 3G2MA 4ZAYA 4YV0A 1NT2A 2Q4OA 1V95A 2WMYA 4U9UA 1WB9A 4NYIQ 1JYFA 5JZBA 3E48A 1PT7A 2ZJBA 4B79A 4CFSA 1COWA 1WV1A 2HWWA 1KI9A 4NCXA 1GKKA 6REQA 4RLQA 1DOAA 2FAXA 5DXAA 3M6AA 1MVNA 4JU8A 3IT0A 3INGA 1XNJA 4OQDA 3EEOA 3U2QA 3O9ZA 1LSUA 4KAJA 2NZWA 2QRPA 3BWVA 1SHKA 3T9AA 4EHDA 1ZY2A 3GIDA 1EINA 2VDWB 3FSJX 5FA6A 3ADPA 1G3UA 1GKLA 2OBBA 2VZ0A 1P1HA 4ZA2A 1XFAA 2CYCA 3SGLA 1UKZA 4EX6A 3GFQA 4GI7A 4LYJA 2RGXA 2ODNA 2QORA 1X7XB 2MOKA 5J2UB 2ETVA 3TR6A 2H4HA 2FV8A 2BR3A 4JQYA 1Z4OA 5L3ZA 3TPCA 1VG8A 1P2FA 1U31A 2GERA 3GAAA 4XSVA 2IYAA 4C4SA 3EVFA 1LX7A 1OT3A 3CF4G 1VXRA 5LU9A 4MQ4A 4LOIA 1VG9B 4LY3A 5TRTA 1XHLA 1OLXB 3EXFB 2WSMA 1JHAA 4JJZA 1RI3A 1PR4A 1V5IA 1CZUA 3O90A 4JVNA 4I0WB 4MWCA 2I7VA 5GZ1A 4KP7A 1YGPA 1WDLA 5H3HA 1QTRA 2OMKA 1B76A 1IUNA 2PZAA 2VRWA 1GGKA 4R2IA 2IVZA 2YZMA 3AUUA 2WFLB 4AY4A 4DWJA 4WXYB 2Z6AA 2O59A 4OOFA 5JDCA 4F2HA 1IOWA 1Z6YA 3OECA 2ZUEA 4LV8B 1TZJA 3C7CB 3NBMA 4NOJA 4XGKA 3PICA 1MN6A 3P20A 2ZBQA 4EFLA 5KNBA 1Y6FA 1AKMA 4XGQA 4P38A 2QXTA 4KK4A 4C21A 3RIYA 1U90A 5G2OA 2G1KA 1SZCA 1TK3A 1CEXA 4EJFA 5M2QA 1W85B 1Z5PA 3MD0A 2KMLA 3DQZA 3HP7A 4QDZA 4G67A 5F1KA 2DPYA 4M0PA 1U8UA 5ICGA 2XUIA 5ALHA 3D2BA 1KEEA 1QVVA 3WLQA 1Q1NA 3OZEA 3EUWA 4XASA 3H1BA 1OI3A 2BGIA 1X7WA 3EOAI 3MAGA 2ZWMA 3VBEA 5HCNA 2VJYA 3WV4A 2J6IA 5JR3A 2FP4B 5F7JA 1LC0A 2IIVA 4LCJA 3HCFA 4EJ6A 5ITSA 1U2QA 4LVCA 4BTLA 5GMOA 3F74A 3I8SA 3EMDA 3GJ8A 3NM4A 4MICA 4W63A 4F4IA 5COQA 4W5OA 1XZFA 3KZCA 2AOWA 7GPBA 2ANCA 1GCAA 2ZJYA 3HV2A 4AJIA 3PF8A 4ZV4A 2QTBA 1X1SA 4QU0A 3LSYA 2X7JA 4EYSA 1JR2A 2Y0EA 4F9GA 4JI8B 3FVWA 2VP0A 3WWZA 1ZXLA 1A9SA 1OFVA 2H9IA 4BZZA 5LUAA 1KEEB 3M2PA 3CZMA 1JQLB 1KJ9A 1QYIA 2WHPA 4WXHA 4XDGA 1A2QA 2ZWIA 5F4BA 2H31A 2J5BA 2BGNA 4RZ2A 5C5IA 1EFLA 4WJKB 2ZS7A 3D4BA 1AQJA 4REOA 2QM0A 1KR5A 3B20A 4ETMA 1RMYA 2EGHA 2ERCA 4M9XA 2YV2A 4K9LA 5M34A 1BOOA 1NNEA 5EP2A 3PP8A 3RS2A 4GSYA 4M9SA 3W6PA 1F7UA 4I3GA 3IH5A 1OR8A 5LXTA 2B9VA 2IS1A 1GG2A 3GEBA 1LNZA 2DY0A 3TX2A 3W8RA 3NONA 1ZM2A 3NPAA 4Q47A 1B6SA 2FWJA 2OQVA 3QBTA 3SE7A 2VUIB 3HYRA 5FNZA 2WHPB 4Z3KA 1GCIA 1XEXA 4U8GA 5BYKA 2B9EA 2OO5A 3N8DA 3I1JA 1EX1A 1T9CA 1M76A 1P0MA 3BAZA 4DJFC 1KYZA 3PUZA 5HQJA 4MKIA 1H4QA 1TEHA 1XEAA 3FDIA 3PHLA 4Q4DA 1P8JA 2W2PA 5AOAA 4A2QA 4F3KA 3KDSE 4ZCMA 4QBKA 2AR0A 4DR7B 3RIMA 1PSDA 4EUNA 1KC3A 1DJNA 3HKEA 3ZD6A 3H0KA 4HTFA 5EVJA 1BTOA 1LPAB 1Z73A 4BQSA 5LXTB 1RWPA 1VPDA 3AERA 3ORRA 3MXOA 5I7OA 2P6UA 4MWOA 3BDVA 4PONA 2AD5A 2V6IA 4TTRA 4C78A 4UARA 3JVIA 4RKYA 4Y6QA 2JLSA 4M1QA 1NPTO 4G63A 4K9KA 4FYIA 4BQRA 2IC5A 1T29A 2O0LA 1XEXB 2VCEA 1M1NA 1OTYA 4M1YA 4Q05A 1HTBA 3FY4A 4JDPA 2GN6A 1Z5VA 4JEHA 2OWEA 1G4UR 1P0QA 3KEGA 1KE1A 3QPVA 3V00A 5K0FA 1U2TA 1Y3CE 1PD0A 1ZN2A 5DISB 4UCWA 4M89A 4ABTA 3WADA 4CLRA 4AC9A 2FW1A 3HKEB 3E7WA 4XVUA 2Y0CA 4MI9A 3AKDA 1XROA 4HTFB 3LMKA 3GL9A 4AF6A 4G0YA 3FYSA 3GFVA 2Q21A 3SHQA 1B00A 3INTA 2BGGA 4E94A 5CX1A 4DPKA 5KJFA 1EVIA 5CT6A 3VR6H 4YP6A 1BXGA 2LVBA 3DR5A 4BRUA 3VR4A 3C3JA 1BW9A 4O4LA 5ENVA 4FDMA 1GTMA 1WBBA 5EFZA 4RTQA 2HCTA 1W4CA 4FOOA 5C3MA 1GVHA 2YNMC 3LCJA 5A9SB 4LYHA 2MHCA 1T9AA 5CCDA 2C4MA 4FW9A 3ROXA 4F8JA 2WDPA 5JLAA 2QNIA 2D5CA 4K6GA 5G40A 1HR0B 4TZ0A 1JAZA 1HQYE 3QQ5A 5FI3A 5HJ2A 2KE5A 3UHPA 3I9V1 3D4LA 4TSFD 4YP9A 1Q0RA 5EZSA 4JSTA 4R54A 2VKTA 1FQKA 1G20B 1JWAB 5C52B 1ZX1A 1QWOA 4EI9A 4ZU6X 1RW4A 3KZMA 2FG5A 1ULTA 1LQ2A 1X2EA 4IJVA 4KDCA 5LD2C 3CURA 1BW9B 1ZIXA 2RKBA 3UUFA 4FYHA 3CVXA 1DBPA 1CZOA 2NADA 1YZGA 3AI1A 1TM3E 3GO4A 3ZI4A 3M1YA 4QVIA 1WCIB 2AN3A 3L0ZA 3VU9B 3UXYA 4HLUA 1LLQA 5SY9A 3F6SA 3E3MA 3R3UA 1CDEA 5GJCA 1PWZA 3GBPA 3PXXA 4JBHA 3HMKA 1ZJZA 4FBLA 1PBTA 1B23P 2NW6A 5IPFA 2FSFA 4FFVA 4M0FA 3USCS 3AL0C 2FEPA 1N2JA 1LD3A 1WCWA 1Z4NA 5DO9A 2HV9A 2IYYA 4L5IA 1ZJJA 2BFCA 2UXBB 3QUCA 3SMVA 3WYNA 1QGAA 3AVUA 5JD3A 1FNCA 3TQRA 4X1KB 3A4LA 1U3UA 4DCUA 2LE0A 2DC1A 3R5TA 1XTSA 5EE9A 2R8EA 3VOBA 3KQKA 1O94D 3MT7A 2CVPA 3DLHA 1UMBA 1G8MA 3Q40A 3FA2A 4GBJA 1QF7A 2XWPA 3KFVA 3Q9NA 3Q7SA 2NSJA 1RE1A 5J2TB 4RIEA 4MWEA 4ZT4A 2BTOA 2EBUA 1XIVA 3OLYA 2JI7A 2VF8A 1YVDA 2XTNA 5DM2A 5ILGA 2QVLA 4DR3B 4JXJA 2Q2WA 1ZP6A 1AUOA 1FW6A 1QLHA 2A8YA 3DV0A 4P7BA 1ECLA 1VM6A 4XIGS 3T7CA 1JLRA 2OCPA 4AXBA 4HDKB 2N3ZA 4DZZA 1TM7E 2BHLA 2NN3C 2PRKA 5CIYA 2RE8A 4F3TA 3PNLA 1HNZB 3PGA1 3TO5A 4FX2A 4IQ4A 4P86A 1Q17A 3ECAA 4MUIA 5H4HA 1KAMA 4BV9A 4CQMD 4CV0A 2XTMA 1W7AA 3IXLA 2FN8A 3P45A 1L1FA 5AW2A 2G3YA 3HGMA 1EXVA 4MUNA 1J21A 2FWRA 2PLFA 3LRPA 1HDGO 1TK2A 2RJOA 5IUKC 3AHFA 2PMBA 3FZGA 4DA7A 4OEHA 1MBZA 6NULA 2C8KA 3PKJA 3SJ7A 1UBUS 3DKIA 1AN9A 2V1XA 5LIRA 3AVYA 4KE8A 7REQA 3VR3D 4CG1A 2QLMA 5GONF 2R47A 4PYKA 2GX6A 4RXUA 4MR8A 4KYUA 2AK3A 2FX3A 4CBVA 1JMVA 3L8CA 3UZUA 1BRMA 1V8ZA 2YWEA 5AK4A 4EARA 2PUFA 1FPMA 1GG5A 3KAKA 4G4GA 2QIOA 3MAJA 5JMWA 3FAKA 3AB7A 2ZXEA 3KB2A 4EB8A 3NTRA 4OGKA 3MTIA 5AICA 4LJAA 1IFXA 1GQYA 2CVHA 3O3CA 1K9VF 1NULA 1BX0A 1UZUA 1XQ1A 1YACA 4R1TA 5TY0A 1XKQA 2YHBA 4XQEA 2XTAA 5K20A 1E2PA 2W8BA 1E1KA 2MWMA 3L1JA 4U63A 3EBPA 3WMEA 4ESHA 2GPSA 4QXRA 3KYDA 3MRXA 1OE0A 1T35A 2HQBA 2YHUA 4JLBA 3UWKA 4YRPA 3M6MD 3G9UA 1PL6A 5JSKA 5AVQA 4II7A 3RVNA 3PX7A 3QELA 3T3OA 1KIAA 5IBPA 3Q7EA 4ZHQB 5B4UA 2IBTA 4MQBA 4QGFA 4KBGA 4YPVA 4Z0TA 1IUOA 4FMBB 5KHLB 2Z6UA 2A9JA 4HZGA 4AN0A 3L6EA 5B30A 3L0IB 2CF5A 2FKNA 4MVJF 5JQWA 4ZT6A 2PJUA 3U3OA 2DECA 1SCNE 2FX2A 2GBPA 2XYHA 4XUGB 1CUAA 1GFWA 3VU3A 2CNLA 1O0SA 3A7EA 4UC0A 3ZWXA 2W8BB 4OPMA 3K5HA 1UT8A 1E9BA 3PDIB 1AOXA 3TZLA 3GRZA 2BGLA 4MVJG 1H5UA 2H2GA 4MUYA 5BP7A 3I39X 5LNK6 1XL1A 1E92A 2J7KA 1E3TA 2O2EA 3MIIA 3S1AA 1GTL1 1KJNA 1D03A 1XHFA 3JR7A 4KIJA 1J8VA 2O57A 4YCAA 1L5MA 3R75A 2QROA 1X15A 1XL0A 1TUIA 4XIFA 3OTHA 4G4JA 4L9SA 1AB6A 2L82A 3S2UA 4BLQA 1DKPA 4DCSA 5LL6P 3OX4A 3CR3C 2QVGA 1K63A 4JU9A 3ZOZA 4PAGA 1DUVG 2FUG1 3IP6A 3VZCA 5IASA 4KR7A 2H1LA 3A37A 4Z9YA 4GLJA 2NAFA 4TMXA 2QM7A 2JI8A 3Q2OA 4PY2A 3WHPA 221PA 3RWMB 3TBHA 5H80A 4H1HA 3UGQA 4PM4A 4UCQA 5FOSA 4WXPA 4B3HA 3U7IA 4AS1A 4URHA 4R7ZA 4XPZA 3DBRB 1U2DA 2HC9A 2ZQYA 1BWPA 3FAZA 4B7CA 2B4KA 2HA4A 2XXBA 5A0FA 3VPSA 2GO7A 4X84A 1RZRD 1XRJA 3OQMA 1L4YA 1TM2A 1F06A 3ZDEA 3OT4A 3RJMA 4QDOA 5ALNA 4WZZA 2JLXA 3GAZA 4HDRB 2PJZA 1OY1A 1RWOA 4DLTA 3G0CA 4I2VA 3BMOB 5IULC 1MHTA 1RQXA 1OHHD 3TDKA 1R3DA 2VPYA 3B6MA 4Z4CA 3SLKA 3JYNA 2GEJA 3K9LA 3TGWA 5LLSA 2GPNA 2QRGA 3K3PA 3SR0A 1EUYA 1CY0A 5KYGA 1L5FA 2N47A 1YJBA 2R97A 1FFXA 1DKRA 1QAQA 3PKZA 2P6OA 5DGCA 3PF9A 3S28A 4EQ6A 1EVJA 1YK1A 1Q91A 2XYRA 4L0MA 4N18A 4L7VA 4KUGA 1ULAA 4AP6A 4B6SA 5IT4A 1UBKS 1ZI6A 2F1KA 1JR3A 2WIGA 3C3AA 4R84A 1EAMA 2PWZA 3PR2B 3NDIA 2QUBA 3TTSA 3FSGD 2C1ZA 5KTYA 3BHJA 1QUEA 2WW8A 4Y1EA 5TXGA 2PGNA 1FRVA 3QXJA 2UUAB 1SCQA 3H3FA 2K4MA 1T3HA 1I5EA 1SG0A 1ITZA 1BS2A 1DTWA 1PVVA 2G25A 2NVWA 2PEYA 2I0FA 2Q5JA 3NRBA 4NABA 3W6NA 5SZHB 1UM9A 2ENUA 4FLMA 4ZRMA 2HPAA 1UJ4A 2CLLB 3PNBA 1WHSB 4JYPA 1WY5A 4G8BA 4P53A 5FV7A 5B7PA 1FFXB 1YS7A 1ZXBA 1YA6A 1MJGM 4MJLA 1B93A 1NBMD 3EXIB 4EHAA 1F7VA 3JYHA 4J4HA 621PA 2JKVA 4OGGA 1KU0A 3NQ41 1K88A 5FUBA 4EG5A 3B3QA 1NV8A 4CTNA 3A36A 3UPDA 3K1ZA 5LR6A 2JFNA 4IGKA 3F2VA 3NIDB 3R9KA 4D6PA 3WXBA 4CR6A 3C5HA 2AFIE 3EF1A 4HAUA 2JVIA 3TD6A 4Q4HB 1EYZA 3CZAA 4Q37A 4BGIA 1APBA 1T6XA 4R3WA 4WADA 1WXWA 1X2BA 4JBNA 4J03A 3AGQA 5ULLA 1NR5A 1NVFA 3CKLA 3U40A 3CT6A 4RTNA 4B3FX 3WMGA 4W5RA 2HPHA 3WQRA 5BSKA 3VO9A 4DNFA 1UZLA 4V24A 1QZTA 1Z07A 2DT5A 3NRJA 3PHGA 3UJ9A 4CT5A 2CLIB 2I55A 3HYTA 1N7IA 1ZAYA 1Z0FA 3H75A 1DC8A 3OP4A 3VZSA 5EJ7A 2PLWA 5JZMA 4JA2A 3GLQA 2F9FA 2FPIA 4PZUA 1YZLA 3MYRA 4I9GA 5L6MB 2VJPA 2YN4A 2ANBA 2OM2A 4TKZA 1U1EA 4IJUA 5AJTA 1G18A 5M3BA 5IRCD 1A69A 2YYZA 3BF8A 1TVMA 4RIGA 5K0BA 4WZBA 4G25A 4YJFB 5U9CA 3JRWA 3IESA 1UXGA 3OIYA 1ESNA 2JCGA 4IDGA 5DF1A 1E6LA 4C6HA 1E79D 1RCFA 3K6JA 3G1WA 3DEZA 2D5LA 5JCOA 3KKOA 1Q19A 1TT5B 2BSAA 3JQQA 4G86A 2HKIA 4MCHA 1YB5A 5EHGA 1IB6A 1DO8A 2HGZA 2VHCA 2H1FA 3QIAA 1YTLA 3CLUC 3L8ZA 3KCQA 4IM7A 2XKJE 3GHYA 4P92A 1DEAA 1SWVA 2CHEA 5FLYA 1SOVA 2RBGA 4Q00A 4MGKR 3IEIA 4B17A 4UEKA 2QZJA 3CE9A 4RMIA 4MKZA 5LN1A 3ABRB 1NQUA 4MKXA 4OVKA 3USZA 4A10A 5AIBA 3WMXA 3NJ8A 3HXKA 1WW2A 2H5IA 2G8NA 3FJYA 1CJCA 4QU9A 1GG8A 4KKXB 4EYEA 3Q15C 1K8YB 3A1VA 3AHCA 4ZJUA 2QGFA 4FZJA 3VKGA 1ZSVA 1ZXXA 2GYYA 1JQEA 4DEVA 4RL6A 3FOWA 3FTDA 4H3KB 1VIAA 2HIHA 3B12A 4P3OA 3SM9A 2IY8A 4MQFA 3ZJVA 3MD9A 3ESBA 4YO8A 1TM4E 3IVCA 3TTTA 1B2RA 4O8ZA 5E9AA 5ELLA 2AGVA 3RK4A 1S2OA 1HT0A 3R24A 3FPEA 3F7TA 1KMHB 1LNQA 5J5AA 5EWLA 3ZWYA 1G5IA 4PO1A 1N2ZA 3HRKA 5JARA 5FL3A 4H0FA 3C6MA 2H57A 4IZHA 3RAJA 3T7IA 2JFGA 1OAAA 5KQPA 4KO2S 4AZWA 4LJ6A 5HIAA 7MDHA 1Y1RA 3CWZA 2IZ6A 3BCHA 2QL7A 3IERA 3DOJA 3UCXA 2IS4A 1TTHA 2TMDA 1ZL2A 1YKFA 3EYAA 1TEXA 1NJ8A 3L1IA 1N2CB 5EEGA 1RS0A 3BH6A 1VMDA 2BKEA 5AUPB 5CAEA 5I7FA 4YY3B 3FKSA 3SHTA 5F23A 3UMVA 4FKMA 3RUEA 1LKZA 2JGAA 3C43A 2VS1A 2CHUA 3NBAA 4YCMA 1X0XA 5BN3B 1WA5A 4OP2A 2WOJA 4PYQA 3EIHA 3M34A 3QA3E 1UDRA 4GM1A 4O0LA 3WGTA 4F12A 1RWVA 5EWLB 2Q5HA 4OOEA 5GPBA 4D9IA 1EIWA 1SH7A 1CZHA 2PGLA 4HB4A 4EO4A 3MGAA 4KZPA 4I3HA 2OB1A 4LXIA 2Z30A 1P91A 3CUYA 2YUIA 2A78A 2ZIAA 1N78A 1JHUA 3IVMA 3ZCVA 1MNQA 4AI6A 3ZNPA 1FUKA 4PXSA 1DOZA 3G0IA 3X1DA 2YKGA 1O77A 2E21A 2PPVA 3D0KA 4HEA6 1ENPA 4Y1RB 3SQDA 2HYIC 1FTQA 3GU3A 1U1FA 2YOGA 5IVKA 3R0ZA 1C81A 5CG2A 5D1HA 5HIJA 1EWTA 4RK6A 3UA3A 4GL2A 1ZD4A 2VBCA 3LNCA 1M0WA 3NM5A 4DHEA 4Q3OA 4LDPA 5LOVB 3PC8C 4P0TA 5ALWA 1L5OA 4C88A 4WK6A 1TZ2A 2EL7A 5A0TA 4C2BA 1W0JD 5A1TA 1P2SA 3IHLA 4FPXA 5M04A 1EFPA 3ABIA 1W73A 3SS9X 2AZMA 1G6HA 4J1TC 2PKEA 2X8BA 3K8OE 1EP3B 3QJYA 4G5OA 1DQPA 4YONB 3SS7X 3PNKA 2R7AA 4D41A 2FSUA 3K1TA 5BMVB 1Y9AA 3KKKA 1YUBA 2C77A 3A32A 3AEXA 3H8JA 3K6KA 3QXSA 4JLSA 4RZXA 3T1QA 3VO8A 4CKCA 1R10A 3KZNA 4RFLA 4MVCA 2B8TA 5L7WA 2XVAA 3OQIB 3RTEA 2G1UA 3OPYI 1U2EA 1JAYA 2Q2OA 2Q6LA 3F6PA 2TSYB 3BBPA 3RJ9A 3VPHA 4CM4B 1Z6QA 3EWAA 2D2FA 4PO3X 3EPHA 2GS9A 2O8EA 4DM4A 2FZ4A 2K87A 2QMUA 4NKRA 4I1OA 3N2LA 4HDMB 4FDLA 4YQYA 2ERYA 3R44A 3OBIA 3ACCA 1E2JA 3PGKA 3Q7TA 1MGOA 2D0PB 1LV7A 2J9RA 5HQ3A 2BMWA 3LM8A 1D6NA 3OKCA 3MB8A 4HYEA 3STYA 1H5NA 4FYXA 4MP3A 1YC5A 2VPXA 1R50A 4UJ3A 2XYQA 1GQQA 1V0JA 2YFHA 2ZTUA 3EGVA 4M99A 5EWJB 2GA9A 1NE7A 3D1LA 4NAVA 2UUPA 1C7ZA 4W99A 1MOQA 3G6KA 3S3TA 4AG5A 1NWHA 4DG9A 1DT5A 1F2TB 3H7AA 4XSGA 2E6KA 1BVYF 2MYUA 3RYTC 4CKCB 1CP3A 1TAUA 3C3KA 4MA0A 2Q7OE 5BO5A 1QM5A 2ERXA 1CDZA 4RCVA 1NUUA 1ETUA 5ICSA 2ZRLA 2YV4A 2X14A 2CNBA 3BWMA 4X8OA 2F6RA 3F96A 4FFOA 1NUHA 2ZI4A 1BDIA 3UV6A 2QAJA 1DJQA 1IQPA 1ZCBA 2I8CA 1I4WA 4YIKA 4IDPA 3D8NA 2A92A 4DRXA 3PWZA 1N6IA 3IHWA 3IQWA 4L4XA 2NLOA 2JS7A 2MTBA 2Z56A 4B81A 5DI3B 2PZBA 1PFWA 2C2MA 3FTNA 5BNWA 1PL7A 1KQFA 5LYYA 4NU0A 1ZK3A 4N8DA 1JU9A 1YQEA 2VH2A 4FMDF 5EFOA 4G5HA 2XXJA 4DEYA 1JVBA 3WC4A 4YMGA 4Q02A 5EI5A 1OI2A 4DFDA 3C2QA 3AKZA 1EJ2A 3ICVA 1IM8A 2QAIA 3NAGA 4KXVA 1O8BA 1CUGA 3HO8A 4WCFA 1NW7A 3R7WA 1QQ6A 2A9KA 3ZKAA 5TMBA 1ZVVA 3A2KA 2AE2A 3NVDA 1DKLA 3ADOA 1VMEA 4D9JA 5D6NA 4K26A 4U1RA 3TB4A 3EIUA 2C2WA 4GBGA 4PC3A 4F56A 3WRYA 3CHYA 3I5XA 3EGOA 3ZI7A 2GM4A 1YL7A 3KZXA 4LMRA 3A1CA 2BM0A 2WDZA 4WZAA 1FDUA 3IAHA 5FYQA 2ZCVA 1RM3A 2AVNA 3Q6MA 4D3DA 4L8FA 3OZAA 4QGHA 3T7SA 4EM6A 4E6EA 1I6MA 3WL7A 4KAAA 1DV1A 2H0AA 2HFJA 5AOBA 3M4JA 3KL2A 1RPNA 3E9MA 3O6VA 1DLJA 1E5XA 5AR1A 2ECFA 1KY4A 1P9RA 3O4GA 4K3UA 1FMTA 1GYQA 3RB8A 5LQCA 1UFOA 1PG5A 5AW0A 4HFNA 3F1LA 3H9GA 3MTQA 4WCFB 4TS9A 3SKXA 2WWYA 3E5MA 1RXVA 1TO1E 4DV0B 3K0FB 5ALXA 3A1FA 3I2FA 1CB0A 2W4IA 3JQGA 3TOVA 4MPTA 2GFIA 4EP1A 2Z5LA 1KEVA 4GS5A 1QG4A 3MJFA 4WLVA 2AC2A 1N7JA 4PYJA 2VXOA 5J58A 3U4MA 3WMWA 1F5SA 1VFNA 2CZCA 1GZUA 3OWOA 4JMLA 1S3GA 2BM9A 2C96A 4GU5A 4WZAB 4PX5A 4ZEVA 1X1TA 2ZZMA 1YJAA 3KTDA 3PB3A 3F5QA 4TWAA 5JAOA 4CL0A 3EIFA 2YVLA 3ZJ5A 5LMZA 1N33B 1Q0ZA 2HU2A 3A6KA 3O9VA 4FWBA 4LHYA 1FU8A 2B8JA 2BDEA 2ZTVA 2H2WA 2NPIA 3RYHA 1E20A 2WWWA 4KRGA 4N54A 2F64A 3NASA 2ADFA 4JIMA 1BA2A 3BN3A 3DE0X 4GOKA 2AQIA 4H60A 1F8GA 3TBFA 3MBOA 3IAS6 4GPBA 2PL5A 1BJKA 3F7OA 1JXAA 1RJ9A 2QN1A 3ZK7A 3BKXA 1DBVO 1D0IA 4F5WA 3DLBA 4H77A 4RU1A 3SYTA 3B6JA 2PZ8A 3DMTC 4C4YA 3WGGA 1TZBA 2B69A 4E1AA 1WABA 1YNOA 2YHIB 3CNEA 3KQNA 4BMCA 5K4HA 4GZ5A 4TZ6A 4RGBA 2ZETA 2X0IA 3BB3A 3B70A 4IJKA 2EX0A 2R1TA 3DGEC 4JY7A 3PHHA 4C04A 1O54A 2HCRA 2W6IA 4JLOA 1SU8A 3BD8A 5MFZA 3C48A 1X9HA 3DWIA 5L3VA 1UUFA 1VC2A 2V7TA 4TYWA 3PXCX 2BZ0A 3LHFA 2AK2A 4LJSA 1YFJA 5IU6A 1BGXT 4RELA 1ZOPA 3IAM1 1S4QA 5CG1A 4PWZA 1G9SA 2A9FA 5EJFA 3LECA 1G5TA 1MQ8B 4NE2A 4DOMA 4JOSA 1RJ9B 2P2SA 2WD7B 3MG9A 2PGDA 1HYBA 1NF3A 2ZUUA 3QH4A 5B1DA 3F8TA 4X00A 3TW8A 3V8NA 3TLJA 3TXYA 2BFPA 2J1LA 2P2DA 5DHFA 2QDKA 3ZDRA 2P91A 4QXMA 3AEKB 4ED9A 1IBCA 4JXZA 2O3UA 5FUYA 4MOWA 3NV9A 4J2OA 2O8NA 1ZGGA 2R1TB 5L4SA 3GBVA 1G8KA 4C0WA 3QF4B 1HE5A 2FQWA 2JLUA 2M32A 4G01B 2C7GA 1TCBA 1XDGA 1ZNQO 3BB1A 3E1SA 1CTQA 1E63A 2GXUA 1TW2A 2PMEA 1DAGA 2ZULA 1B6TA 2ZJ1A 2AV6A 2HF7A 2D54A 4L4RA 4Z7NB 5ADVA 1O08A 3AI2A 2HDHA 1KQOA 2JH3A 4IMPA 4LX8A 4E3WA 4UE6A 4HWKA 4Q1DA 4C4XA 1RM5A 3K0AB 3NTOA 5D3MA 2J5RA 3K1AA 2IUFA 3L7NA 1H4VB 3UBTA 4HGPA 2CXPA 1X6VA 3IMFA 4JXKA 3SM3A 2JL1A 2VQ3A 1LU9A 3CUUA 5BSHA 1YAJA 4QFCA 4L5BA 4JGBA 4LF5B 3ZWKA 4TXNA 1YK0A 3CJRA 3IOYA 1LEHA 3PWSA 4FYVA 1L4LA 2MSKA 4FE4A 3W9BA 4QZVA 1MU0A 1A7UA 2QX4A 4BVAA 3SWWA 2I6XA 2OECA 1LVHA 4LRYA 4BE9A 1VA4A 3MAAC 3AR6A 4ND4A 5C5EA 3IP3A 1SZJG 4MYDA 4E70A 4KQXA 2ZK7A 2V9ZA 1KZ9A 2W6MA 1P8AA 5SYMA 1DCFA 1MRNA 3SFTA 5IZCC 1T4GA 4EA7A 1FRNA 1N9GA 2EAUA 5D3MB 2VUUA 3ANMA 4B2LA 4JCCA 1T9BA 4OUKX 5AHOA 4ARUA 1JR3E 1JT9A 4DJ5X 4K9OA 3RRZA 2QBYB 3OCXA 4N41A 3M0EA 3PNMA 2AMFA 2OFWA 1QGED 1XMOB 4JGIA 3UMSA 4J43A 1JTEA 4M6WA 3KOXA 1Y6GA 5CA1B 1G2PA 3NDJA 2EQAA 1A5BB 1OX4A 4WWHA 5ALPA 3H9EO 4HDQB 3MZ0A 4UJ5A 1IY0A 3BGSA 5DYYA 3UFXB 1EXDA 5COAA 1VLMA 2B7CA 2FPSA 4YRTA 1XNRB 3N53A 3NUZA 5K0LA 5GV7A 3DV9A 1ML4A 4IHAA 2WMNB 3QKIA 4IOMA 1QWSA 2B37A 4L9RA 3TMAA 3K73O 5DSZA 3BE5A 4J9VA 5TIIA 4BV8A 1Z36A 2DRIA 1FMFA 3C6XA 1D2CA 1N5IA 3AWDA 2B1RA 2C2OA 4HWOA 5EMKA 1BD4A 5AKLA 2Z1NA 1CYDA 1BMTA 5LU8A 5EN4A 3HKCB 5B1EA 4BNYA 1JLMA 4FEAA 3IBSA 2PS3A 1ECBA 3FTPA 2UYHA 5E1OA 3PQ7A 5MHTA 4DG5A 1G38A 2GPTA 3LK7A 1XI2A 1UWCA 3LCUA 1K5PA 5B2FA 5L4NA 1FXWA 1SVWA 3MW8A 3WYCA 3G68A 3KJZA 3EIEA 1YQ9A 4QT4A 3IQIX 5JCXA 1W36D 2ZWOA 4H2DA 1V1MA 1W2HA 3H99A 5DNEA 3FDFA 3U1BA 4YHHB 3GJZA 3ADKA 4FBMA 4REQA 3GDFA 2H6EA 2GAOA 3NH9A 1QTQA 4BLTA 1C80A 1GR1A 4F6LA 2Z2ZA 3ZJTA 2H5LA 3TOXA 1UMDA 3ZQUA 3UN1A 1Q7TA 1T24A 4CZ2A 2H2HA 1PKEA 1FXUA 4RDHA 3TLEA 5C1BA 1B0UA 1BCSB 1QO0A 1WXFA 2V7BA 1YD7A 2B61A 3SYRA 2H3HA 2FJPA 1HQCA 5J5VA 1QCDA 3SEFA 1L8XA 4G1UC 4LK3A 4AUMA 3ZDBA 4WZBE 1GV0A 4BEBA 1ZIDA 4PO9A 1VECA 4S1OA 3OZVA 1DWQA 3HCEA 3IBFA 2WWXA 5G4LA 4QX6A 3Q9LA 2ZUCA 1BQ4A 1GRCA 3PRYA 4JCOA 1GFIA 3NI2A 2MINB 2QP4A 1EZZA 2WWTA 4JAVC 2HI0A 4WBSA 1UMKA 3BE8A 3T8YA 1YRAA 3R5XA 3RVOA 1BHQ1 2F2TA 4J7CA 4C7VA 2WWGA 1TZMA 2NQTA 2WVAA 1W6RA 1JVNA 1N57A 2NYRA 2B99A 2B5OA 3BMQB 3EUEA 4WKOA 1SBCA 4OU5A 1UMDB 1RM4A 1I94B 4U3JA 3BIOA 3GF4A 5E1MA 3IA7A 2PXHA 2IEBA 4KVAA 2DFDA 5IHPA 2I67A 3A7DA 4OK6A 2WU3A 4MGEA 1KEKA 3QLTA 4L8YA 3AILA 2C5HA 1OX5A 3DE5X 1T6BY 3TPFA 5AK5A 1EDOA 4CU5A 1CZLA 2OZKA 5HK9A 1U0GA 2O2HA 3ORHA 4PG4A 4XE5A 1A7KA 2WIFA 4R6XA 3WKCA 2JJYA 4AICA 4C6TA 4OAQA 1PL8A 4QUKA 2B35A 3EZYA 4X7BA 4YRDA 3JY6A 3REFA 3INYA 4DDKA 3ROPA 1W5BA 2JD0A 2WA2A 1I4DD 3RHZA 1O94C 2JGNA 2JHPA 2VCYA 4LQLA 1U0BB 1MW9X 2WPDD 2Z3WA 3OFSA 3TLGB 1FSZA 1P4HA 4JHLA 3EEBA 4E4RA 3CKYA 3VYVA 4JJFA 1JECA 3NEJA 5JS1A 2ECKA 1S1CA 1DAHA 1GUYA 1UMCB 1JFTA 2J46A 2D6FA 3GXOA 3PU6A 1TW3A 5KNDD 3G0DA 4W8GA 2HR1A 4J2TA 4FFBB 3DEAA 1PK7A 3ONWA 4AIIA 4FFMA 5FXMA 1CUJA 1JAHA 1MJFA 2C4HA 2E82A 2I2BA 2P1RA 4ZEMA 2GCIA 5C18A 2WB2A 4MA5A 1J2JA 3QY0A 4KLNA 5C9ZA 4YYEA 3II6X 4EENA 1JEYA 4H3VA 1P0IA 5J9FA 2H2FA 4BVLA 1CIPA 5KKCA 2PEZA 2WRZA 1J22A 2Y93A 4UDNA 2FB9A 2WJWA 3ZQKA 4AF8A 3VDRA 4DA9A 3FCYA 4PZDA 2ZSFA 3H5LA 3V8PA 3PGLA 1YE3A 4LS3A 1U0FA 1HY3A 3O5AA 1J42A 3D2CA 4ZVPA 4BFTA 1GQSA 3FYUB 1N0VC 4H31A 3T9CA 4EOGA 3SBOA 5AW9A 1T4BA 1F8XA 1FK8A 5G4KB 2C7BA 1CQIB 1ODCA 2ZRGA 3GYBA 2DSTA 3C1AA 3BK2A 4TX1A 1TMOA 1L1RA 1YL5A 4LCBA 4AMUA 2YJ5A 2G1JA 2ZTHA 1JEYB 1I6LA 2I99A 4UTPA 2CWDA 4I46A 3TR5A 4R1SA 4KEAA 1DINA 3P96A 1B74A 4HPJB 4LYFA 4S04A 1FA9A 2ET6A 2X4DA 5JNUA 2YN0A 1WU7A 3EDCA 3LRXA 3PC6A 2BH9A 1TYDE 3KETA 3N0TA 2OZPA 3DG9A 3QNWA 1BYUA 2FWNA 1C0PA 1ZYUA 5CBPA 2ZYAA 5EJ8A 3ED1A 1VPWA 2Q3CA 3MK31 4UZFA 4FKZA 4J8PA 4G41A 3LVBA 4IIXA 4K5QA 4NG5A 4CCYB 3GN2A 3M2TA 3GPLA 4IIUA 4L2IA 1GYRA 4M3NA 5F1OA 2EU8A 2IXFA 4RJKA 1KMCA 1BO6A 4DTCA 2DXIA 4Z86A 5HJ7A 2QXYA 4BOYA 4IUCS 2PZLA 4YXWD 1J06A 2YRWA 4FHZA 1UBRS 1OXVA 2VF7A 2NXNA 4ZKEA 1FBNA 4MITA 2WICA 2R4QA 4Q6BA 3RUFA 2XNKA 5LZ2A 1NBHA 4DLKA 1Z35A 4GOLD 2ZYWX 5KPJA 4GLFA 1ZRNA 3UJ7A 1J2RA 4TMFA 1F2DA 4F84A 2Q29A 3LTEA 1NJSA 2AC7A 2WYVA 2EFEB 3HDYA 4RXTA 1NLUA 3DQQA 2Q49A 3OC6A 4FI3C 4IH9A 4D42A 5IDQA 3WBBA 4PYIA 4YJHB 2JCBA 3GNTA 5C5DA 4MYSA 3DEIA 4N3GA 1MX3A 1N7GA 1SUSA 2JGDB 2Q07A 3N2NA 1AKNA 5EYPB 4EECA 2Z6VA 1DEOA 4WECA 4X66B 1UFKA 3I73A 3THXB 2PV0A 2G0TA 1DBRA 1M73E 2XOKA 3HA2A 5JJBA 2BI4A 2I80A 1KZ7B 3G13A 3G85A 3OIGA 1B2LA 4DYHA 1XAIA 5JI2E 1CE8A 3NETA 4QJ5A 5BVHA 2OBNA 2Z8ZA 3AVOA 1ZDMA 1FLVA 4CLOB 4CM5A 3DPIA 4EFMA 5IT5A 2UXDB 2AMLA 1UC5B 2JZCA 2NT3A 2OXCA 2EG9A 4WKNA 3G8BA 2CNKA 4ND1A 4TT3D 4XYBA 5BWMA 3A4YA 1VZ2A 2PN1A 3SY8A 4TQUS 1PR2A 5FTNA 3WK5A 2GM5A 1M5UA 2IYFA 4CF6A 4F4FA 2FY8A 5IWAB 4A03A 5BORA 4UDOA 1DJLA 2YV3A 5CH8A 5A5DA 1XSEA 2O8VA 4D3XA 2QLLA 5GIPE 2AKAB 2XNDD 3TLXA 1P1RA 1JIXA 3PUJA 3KJGA 3PQ2A 1SUDA 2CXNA 4I81A 3KWJA 3KNZA 5FX2A 1HWYA 2GCNA 4OH7A 4WUVA 4OXQA 1F38A 4KN9S 3BXHA 3KJHA 4EA6A 4XD2A 3Q12A 3WNQA 1W47A 3ZCUA 2FRDA 4OXNA 3MTDA 2QLFA 1CFZA 1ODJA 1Y3DE 3MUNA 4JB2A 2R6JA 4UNSA 4F91B 1NU6A 4F96A 1NSYA 1OROA 4F86A 1YDHA 3RSFA 2VT2A 4LE2A 5IN4A 5CP8A 2NXJA 3WAKA 1FP4A 4HNVA 4HC4A 2FA9A 4WGFA 3EG9A 4K46A 1SIUA 1H05A 1M0TA 4ZQHA 1DNPA 1NWCA 1R27A 1CX9B 1K5GA 2DFNA 5EUBA 3CE6A 4BZQA 1P9OA 4D1YA 2R5FA 2ESRA 1KI1A 5T7BA 4FFSA 3IXMA 3MNFA 2PH3A 1ARZA 3A0UA 2XIJA 2ZTLA 3PUVA 1JWLA 1LI7A 1I4LD 1Y6RA 1ONBA 1L4UA 1DJPA 2G4LA 3DC7A 2J8ZA 2HNAA 4FN4A 1T5OA 4BGVA 3THWA 1B73A 1N0UA 2D0OB 2Q6OA 1X3SA 4AECA 4RZUA 1GPMA 3MCZA 4R2WA 1JF8A 2V6JA 3PEYA 2PH5A 3K1YA 3N2ZB 2JHCA 3COWA 2IZZA 1G5HA 3KJIA 5DX8A 5F21A 3ZLJA