4CMEA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 91
structure length 249
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmeA00
1NFQA 4DPMA 3W6UA 2ZIZA 3P7MA 1HXHA 3V5NA 2E82A 3MWEB 2ZTLA 4HFRA 4IQ8A 1YE3A 1KEUA 4HWKA 4IIVA 2EF1A 2NVBA 2ZB7A 4BNIA 3NDIA 2G76A 2VWHA 5HBRA 2EERA 3FBTA 2CNBA 3A1NA 1D1TA 2VZ9A 4ITUA 4J0FA 3CKYA 3RVDA 4F3YA 2NVUB 2UDPA 4BKRA 1JVBA 1L1FA 5IZCA 3HB4X 3HWRA 4FJ2A 4PG5A 4TROA 4W4TA 3QWBA 4MVJI 1ADCA 1RKXA 3AJRA 4DYVA 1MXHA 3WICA 4AJKA 2LDBA 1N92A 3PK0A 1L7EA 2BELA 3U62A 4ZU3A 4WE3A 1EK5A 3ZDFA 1E3SA 3NT2A 1YB4A 4LRSB 2FMUA 2EW2A 4UUOA 3VDRA 4NDNE 4CM9A 4EEZA 4GX1A 1MLDA 1UH5A 2VWQA 4RCVA 3B1FA 4NBUA 1P9LA 5ICSA 2Q4BA 2QYSA 2VRCD 3MCVA 4XX0A 1ZW1A 1M67A 1GD1O 4R5MA 3QVXA 3DL2A 1CIVA 4CM1A 4LRTB 1NAHA 2V7PA 3H8VA 4IMRA 1IZ0A 4N7RA 4PVCA 3DBRB 3WJ7A 1HL3A 2VZ0A 5BNIA 2EJVA 4CR6A 2B69A 2QRKA 1UP7A 3ANMA 3ZN2A 1AE1A 2O23A 1B3BA 4GKVA 5I8ZA 1CRWG 3PDJA 4RVHA 3PYXA 4J43A 2HMSA 1P74A 2J5RA 4YT5A 3KLMX 3M6IA 1DFHA 4R69A 1U5CA 3E48A 3KUXA 4I8XA 1AXGA 4DQVA 4XQEA 1HTBA 2GDZA 3VAZA 3F1LA 1M6WA 2Q1UA 4R16A 5JXWA 3L0DA 1VKNA 1PWZA 4TZKA 3JQFC 5JMWA 3ROMA 3SJ7A 3IL2A 1WDKA 2JD1A 3HDYA 3ZZNA 7ADHA 3MZ0A 4MVJA 2IZ1A 4K6FA 4OMUA 5JE8A 1BTOA 3GLQA 2GZ3A 2CZCA 1H93A 4UULA 3GEDA 2X22A 5AXAA 4O5OA 4DWVA 2X23A 5TT0A 3GOHA 3LT4A 3S55A 1IB6A 5H83A 5B1YA 2FPIA 2OUIA 3BTUA 1ZK0A 1I3MA 1N9GA 1D8AA 5L95A 3KYDA 1IPFA 4F46A 1IULA 3IAHA 4KQXA 4UVGA 1QG6A 5TS3A 1YOVA 2PGDA 3EZLA 4U6SA 4BB5A 1LQUA 1Q7BA 1Q0LA 2CMDA 4IMPA 2H63A 5C7OO 4BNJA 4WK6A 1P0CA 5G4KA 1UXGA 2GO1A 4NK4A 5KWEA 4A26A 2X5JO 2BRUA 2P2SA 5DDIP 2DQ4A 5GZ6A 3VOSA 2FR8A 2Q1SA 2BFMA 1H5QA 1C1XB 1E3IA 1NFRA 4P38A 1QYDA 1V3UA 2DBRA 4B4UA 1NHWA 3C85A 3JQBC 4GGPA 1SMKA 2HMUA 4G5HA 4CLOA 5DBIA 2OGUA 4DLAA 5EIOA 4PG4A 3RUDA 2VTEA 2G0TA 3JQGA 3GHYA 2ZK7A 3BHJA 2XOXA 3JQBA 3QP9A 4HY3A 1KOLA 4EUHA 4RVFA 4K28A 4Q3CA 1JAXA 3HN7A 2I3GA 4KZPA 2O3QA 2ZJ0A 4AJPA 1PJ4A 4CMEC 4PLZA 1UZMA 1U2DA 4WNCA 5ITVA 4B7UA 1OMOA 4IS2A 1LLCA 1Q2XA 2DM6A 2JFFA 1NQOA 3I6IA 1PZHA 3GEGA 1XYGA 3S2FA 4IXWA 3DTTA 2O3TA 2Q50A 3RU7A 4W99A 5L45A 3MJCA 1UZNA 5KNLA 1WZIA 4B4OA 2VWPA 3KEQA 1HSZA 2J3IA 1AHIA 4BO1A 2O2SA 4PLPA 3A9WA 3ZU4A 1Z82A 1PGQA 1F14A 2D0IA 4FR5A 2NV6A 3K8ZA 4IDEA 1MUUA 1QYXA 3OJLA 3ROQA 3W8FA 1HWYA 4E2XA 4QO8A 2E37A 4FC7A 2X0NA 3KHUA 5TX7A 1GQYA 3QW2A 1W73A 4R9SA 3QSGA 4TVBA 1NPTO 2QYTA 3RC1A 1I3KA 1LLUA 4CM5A 3GAFA 3LT1A 3I4CA 3QHAA 4W7IA 3U9LA 1VC2A 2DBQA 3OETA 3OEYA 1IHYA 1R6DA 5EQFA 4R5HA 4E5YA 3ZV4A 2WTBA 3LT2A 3ZHYA 4BO4A 1DLJA 3AFNA 3I6QA 4PG7A 4EGFA 4ND4A 4Q3BA 4YJGA 2A9FA 3TZQA 3H4VA 1JVSA 1KEWA 2AMFA 2C5EA 5DBFA 3D5TA 1GTMA 2CY0A 2G17A 4BQRA 1H9AA 1M6HA 3GNTA 4CV0A 2D2IA 2ZTVA 1HDGO 3R3SA 5FYDA 3ONFA 2O7SA 3WQSB 2BI7A 5HWSA 4BO2A 4ND5A 3HB5X 4NK5A 3UGKA 2NNLD 1C14A 4NG5A 1XCBA 4E2YA 3L6OO 2B5VA 1WP4A 3TZHA 3ZWBA 5AQ1A 4J16A 3TZKA 1I3LA 4JQCA 3PJDA 5BT9A 4CQMB 4B3HA 1EK6A 3H5NA 4U0KA 2FHSA 4ILKA 5TLSA 1DXYA 5ES3A 4E5MA 3AM5A 1UP6A 3CMCO 3R3JA 1DJQA 1T2EA 3H9JA 2WE8A 3ZU2A 4ZQBA 3P5SA 4DLBA 1PR3A 4O63O 1O6ZA 4PG6A 2AG8A 4PN3A 4I5DA 4DIBA 1I3NA 1Y8RB 1A4IA 2BLLA 2P5UA 3CUKA 3NTRA 1TXGA 4MKXA 3I9OA 2BGLA 4GSLA 5JDCA 1Q7GA 1E3LA 2BI8A 3PLNA 4FDAA 4I9UA 1W6UA 7MDHA 4XYBA 4EW6A 1XGKA 4M8SA 4U0JA 1ZSNA 4WLNA 5A1TA 1SC6A 3GG2A 3WSVA 1LSUA 4L76A 4L9RA 3CEAA 3OJFA 2JCYA 1CYDA 1ZH8A 4PLCA 1KYQA 1ULSA 4QX6A 4BKQA 2GN6A 2OHXA 1HDCA 3ENKA 3L4BC 4GAEA 5TRTA 4CM4B 3PGXA 1EDZA 3VVCA 2PD4A 1BWSA 5DULA 1E0DA 3WGIA 2VYNA 4WLFA 1YQXA 4YJGB 2V6FA 4ZRNA 4RPGA 2VRCA 1BG6A 1A7KA 3C7CB 4DC1A 3E9NA 2WM3A 2J3KA 4DQUA 1PJSA 3H3FA 5C5IA 3Q9UA 2XXBA 4GLOA 4J9UE 4P22A 4FW8A 4RO0A 4EITA 1C3VA 3UXYA 4EJ6A 2Y1EA 4FPXA 1C1DA 2FRDA 5TT1A 3M2TA 3ANLA 4KP7A 1E1MA 2R6JA 3RC2A 4AICA 4HFJA 1XR3A 2PD6A 5ILGA 2RIRA 3FRJA 2HCTA 1ZUD1 3IIEA 4J1SA 3E9QA 1EQ2A 1DFIA 3DONA 4WKGA 2LDXA 4NFYA 4BV9A 4JP3A 4ESOA 1WDLA 3TN7A 4R54A 5TF4A 4XYGA 4CLXA 3DWFA 2QIOA 1U8XX 5EN4A 1T4DA 9LDTA 2AEFA 5FI3A 1XQ1A 1P1RA 3GQVA 3FR8A 4H7PA 1UDAA 4CLHA 3OM9A 5T67A 2YQ4A 2R00A 2EV9A 3F5QA 5H82A 1ISMA 3IOYA 4B7XA 1WWKA 1GEGA 1PTJA 2Y67A 3FWZA 4Z9FA 1U4OA 5DN9A 1A71A 5JAMA 4J9VA 3OIDA 3WYCA 2B4TO 1EVZA 1Y5RA 4XGIA 5GMOA 3L4BA 3PYMA 2J3JA 3ETDA 4ND2A 3RCBA 4Z3KA 3BAZA 1CJCA 4TMFA 2X4GA 1R0LA 3JQ8A 4MP3A 5IXYA 1O0SA 2JHGA 3MJSA 3N74A 4BO6A 4TKMA 3QV1A 4GWKA 4GX0A 4ALMA 2VHVA 1PIWA 1ZK3A 3GRKA 4PRLA 5FWNA 3HE3A 5JYEA 2WDZA 3ZWVA 2TMGA 1KERA 1FXSA 2R2GA 3Q2KA 4Y9DA 1C0PA 3IS3A 1SAYA 3VC7A 4BOYA 4NR0A 1BW9B 2O2YA 4RPJA 1MA0A 3HNPA 1VI2A 2V6MA 4OAQA 5C7LO 1ONPA 1H6DA 3WWYA 3GPIA 1DBVO 1QLHA 2DUWA 4PZCA 1BDBA 2Z95A 2BGKA 3F5SA 1E5LA 3T7EA 3HQ4O 1ZMTA 4IDDA 1G6KA 4YQYA 5B4VA 2Q3EA 3K2EA 1PS0A 1MP0A 3DMYA 1DPGA 3JYNA 5BR7A 4AJJA 2DPHA 3NAQA 3ROKA 1B8UA 1MG0A 4R9RA 1W4ZA 3VDQA 4HFNA 3ZW9A 3DQPA 4E2ZA 3UHAA 3I3OA 5I9NA 4O0LA 3AM3A 1P44A 2FP4A 4E5NA 3OIGA 2A35A 1EE2A 1LLDA 1R66A 1X7DA 3H7AA 3K9QO 4YTEA 4WCFA 3RFXA 3ZHXA 3UKOA 1OAAA 1GL3A 2AG5A 3O9ZA 1NVTA 2JD2A 3E03A 3PIDA 3PIIA 1X7GA 1YONA 1VL6A 3OECA 4H16A 1UAGA 2VZ8A 2TMDA 2VRBA 2Y1FA 2V65A 3UAGA 4BKPA 3I1JA 3PQFA 3BXXA 3TNLA 4TWRA 4BNZA 2PH3A 3KYBA 5IJZA 4GPD1 2W90A 1J0XO 3QWAA 4D45A 2DBVO 5U9CA 1GV0A 1RM0A 1U3TA 4DXHA 4XWYA 4S1VA 4HNGA 5THKA 2I66A 3CMMA 1DAOA 2DUUA 4XQ9A 1YB5A 1UXHA 4RJTA 2EGGA 4EUFA 4RV9A 3NDJA 3DOCA 3GF4A 3JD3A 2I3AA 1R37A 4NNJA 2HQ1A 2EWMA 1BGVA 1K6JA 3NTQA 4M87A 5HS6A 3U4IA 4NH4A 1V35A 1YOVB 4M49A 1NHGA 4YJFB 5L9AA 4AJIA 3NYWA 5TC4A 3DZIA 4ZQFA 4ZQHA 1X7HA 3GR6A 1RM3A 2DTEA 1ZEMA 1IHXA 1NQTA 3K92A 5DP2A 3EC7A 1E7SA 4LSMA 2PLAA 1CEQA 3PZRA 3IC5A 3E5MA 4XB2A 4CM8B 2IRWA 4A5OA 5ENDA 1JKIA 2E4AA 3QWHA 2IYOA 3C3XA 1LEHA 4AJ1A 1YL5A 1VKOA 1U9JA 3NKLA 1ZJZA 1O94A 1T2AA 3DTYA 3NEPX 3RUEA 2PD3A 4I9NA 5B12A 3HADA 2GZ2A 5ADHA 3FF4A 3L77A 1HE3A 3G1UA 1YKFA 1D7OA 4NU5A 3FNHA 2EHDA 5JAIA 4IDBA 1WMBA 3ASVA 2ZATA 3LF1A 3RBXA 3ICPA 3FSRA 1U1IA 2CFCA 4BNVA 4Q3DA 3DAPA 1LTHR 3DHYA 3K30A 3PQDA 1PJCA 3G79A 1GUFA 1GYRA 2Y05A 1MFZA 1E3WB 4ZQGA 2ZKLA 3GFGA 3VH1A 3JQ7A 4MP8A 2RHRA 3P19A 3W8DA 5ER9A 4PLWA 1LX6A 3EYWA 3JQ8B 4OH1A 5A03A 4OHUA 4LVCA 1T26A 4OOEA 4BNNA 1GUZA 4Z9XA 3PGJA 4WOJA 1A27A 4Z0TA 3ZHZA 4IDGA 1CDOA 1UR5A 4JGBA 4YAKA 4J90A 1BHSA 3PEFA 5G0UA 4PRKA 2W2KA 3AUUA 4RLSA 2Q1WA 3BA1A 3I9LA 2WSBA 3H6KA 1FF9A 4LGVA 4J4HA 2ZB8A 3QRWA 4PLVA 3DZBA 3JQAA 4NZ9A 1ADGA 5TNXA 3ZNQA 2Y1GA 1EBUA 2UYYA 1K89A 4AG3A 1KVUA 5MGBA 3OHSX 3FBGA 3X2EA 4BMSA 4NBTA 1XDWA 3WLEA 1PJBA 3GNSA 5L4LA 2NTJA 4GLLA 2B35A 4GX5A 3ANNA 1LRLA 1IL0A 3ETGA 5DCUA 3BMQA 4YVFA 1DC3A 4MVJH 4J7UA 3H9UA 2OZPA 4ALNA 3V1UA 3WGQA 3UW3A 1Q0QA 1EUCA 3OJOA 5LCXA 3GMDA 3TJRA 5I9LA 1CWUA 3M2PA 1E1KA 1T2CA 3NUGA 4IGFA 1X0VA 1NQ5A 1O95A 2D5AA 3QY9A 2WYWA 4NJMA 2EKLA 4RPHA 1OC4A 3HSKA 1ADBA 2B0JA 2NLOA 2ZTMA 2WMDA 4IDAA 2XF8A 3QE3A 3VKVA 3ZV6A 4CMJA 1E3EA 4YAIA 2YHIA 1KVTA 3KM0A 1V3TA 1VJTA 2NM0A 4OKIA 1PGNA 5IZ4A 3ZWWA 2FN7A 3WNVA 2VUTA 4ZICA 5HA5A 2YFQA 4OJNA 4GGOA 2GGSA 4GSKA 3TOXA 3GH3A 3G49A 3UN1A 1XSEA 1P33A 5KKAA 4IQ0A 5A5FA 1YDEA 3LVFO 1H94A 1VL8A 4BNXA 1ISFA 2CVZA 1QV6A 4C4OA 1EZ4A 3COSA 3JQ7B 2C2YA 5CDYA 3KYDB 3L07A 1PJ3A 4FFOA 1ID1A 4YACA 1N9GB 1YS4A 3C1TA 4DIFA 2X9GA 1UUFA 3VPXA 2PZKA 4NFSA 5JY6A 2FR1A 1ISIA 1H9BA 1JAYA 1H2HA 1FDWA 1FJHA 3F9IA 1ADFA 2QZZA 3ETEA 4KDEA 4AJNA 3ZV3A 1F8FA 2HAEA 3DMTC 5T5QA 3TZCA 4D42A 5G0SA 3U4DA 1H6CA 1KS9A 4CLDA 2OL4A 2ZYDA 1WAMA 5I7SA 5IXSA 2DBZA 2IXBA 2WYVA 3T4XA 5KTKA 4N5NA 3DHNA 2D8AA 4FC6A 3CIFA 1HE2A 3NDRA 4J1TA 1IPEA 3ZWCA 1HDXA 2X5KO 4F6CA 2P9CA 1GZ3A 2Q99A 3ULKA 1T1SA 2O3JA 5AXCA 4G81A 1HF3A 1KBZA 1OFGA 4FB5A 2YHIB 4CJXA 2B83A 3BMNB 4ZJUA 1O8CA 1HSOA 2PK3A 3FWNA 4E0BA 1KEVA 2EXXA 3RC9A 4D43A 5FI5A 2VUUA 1D3AA 5DT9A 3JV7A 2NTVA 5F5LA 4EZBA 3CZRA 3GZNA 3ON5A 5IAAA 1GADO 3A28A 1N7HA 3GDFA 3B6ZA 2DTXA 4RORA 4LVUA 1Z7EA 1N5DA 3PFFA 4R4JA 1OBFO 1WZEA 1UXKA 2GSDA 3D5QA 3DAFA 1U2GA 3GEMA 3CH6A 2PZJA 5B4TA 1WDMA 4BIIA 3AOEC 1HYGA 2HRZA 1Q1NA 5EJ2A 2C20A 4JLWA 1I5RA 3BTVA 3DDNA 3AFMA 3RBZA 3AOGA 4BMVA 4CMAA 3INTA 5K6AA 1X1EA 1HETA 3KSUA 4IY1A 3ZWMA 3VH3A 4IDFA 1Z7BA 5JDCC 4L73A 1CQJA 1MB4A 4ALIA 3EGOA 1OC2A 3MOIA 4OIMA 4Q3NA 3RI3A 5A4DA 2W2KB 4BNYA 1NP3A 1ZBQA 2WD8A 3LLSA 4JROA 4Q9NA 4YT4A 1HLPA 3ENNA 4BS9A 2X6TA 4R41A 1IE3A 3JQAB 3OSUA 4TRNA 4WEOA 3RU9A 4CM8A 4XGNA 3NT5A 4MP6A 4UUPA 4XD2A 4D44A 1HT0A 2GN8A 2Q4EA 4AJ4A 4Z3DA 5COAA 1DOHA 5CHEA 5C7IO 4XQGA 5FEUA 3TFOA 2Q2VA 3BMNA 4YAEA 1GUYA 2EKQA 1PL7A 1YH3A 1FK8A 2NTNA 4G65A 1HDZA 3FNFA 5JS6A 3L6EA 3PQEA 4KWHA 2QW8A 1B0AA 1M2WA 1YB1A 2PZMA 4Y67A 4CUJA 3H2SA 4AJLA 2B5WA 4QT0A 1LC0A 2HU2A 4RZIA 2YFHA 2EKPA 4OSOA 1K2WA 4OOFA 2G5CA 2X86A 2B4QA 1WNTA 1JDJA 3OIFA 4MO2A 3WMXA 4Z0HO 1DDOA 4PZEA 4RVUA 5A5EA 1G0OA 3QWFA 2ET6A 4BO5A 3OF2A 4GMGA 1P77A 3NTOA 5BSEA 5CP8A 2FSVA 4BNHA 3GFBA 4R3NA 1ENZA 1K0UA 2YV1A 3RQSA 3I9NA 4FFMA 3S8MA 4HBGA 2C7VA 1M66A 2PWZA 3C8MA 5CDTA 2VUSA 3KBOA 5B37A 3FCOA 1V8BA 4DA9A 2C7GA 2J8ZA 4DPLA 2D4AA 3KEOA 3L9XA 3GZNB 1LA2A 3B1KA 2X0RA 4PG8A 2ZYAA 2Z1NA 1U8FO 2WEKA 1Y5MA 1VL0A 2JCVA 3DHEA 3F1KA 3WYBA 4MIEA 3K96A 4RF4A 4M54A 3V8BA 4P4GA 3HUDA 1E3WA 4JP2A 1H6BA 4D3FA 5HRUA 1UDCA 1ISJA 1N2SA 4YYZA 1HDOA 4CM3A 4FBGA 4OXKA 2CDCA 5TSDA 5JCJD 2HK8A 3OA2A 3W4JA 3SJUA 3PFWO 4XQCA 1XHLA 1ZK2A 3U4HA 2OO5A 5KJ6A 4E13A 4KQWA 4GVLA 1R4NB 5K9ZA 4YAJA 1TA4A 4PLFA 5ICMA 2W2LD 2OMEA 3UCFA 4LISA 1LDGA 1WW8A 4P4LA 1GZ6A 4Q3AA 3JQFA 3K2BA 4NJMB 3AK4A 4XRGA 4A7PA 3DZHA 3TL3A 1EUDA 4URFA 1LDEA 1EVIA 1XU7A 1DO8A 1B15A 4YRAA 3KLPX 2DPGA 1WVGA 4JX8A 3IDSA 1B7GO 1PS8A 4I5EA 3EVTA 2NQTA 4IJWA 1F06A 2AEMA 1X13A 1TT5B 2AXQA 4RZHA 4XIYA 1NWCA 1E6EA 4OQZA 1NR7A 3BIOA 1SBYA 1EDOA 1VJ1A 3MJVA 4AJEA 2D1YA 2ZQYA 4KTVE 4Z6KA 1E1LA 4BNTA 2PKQO 4BNKA 1ZEJA 4CLRA 3O4RA 4ND1A 2BH9A 3RKUA 3C1OA 3PPIA 4EDFA 5G2OA 1CF2O 3VTFA 4LMPA 4CLRB 1MFPA 1LLQA 5IN5A 3L4SO 4XEHA 1EVYA 3RUIA 1P45A 3AU9A 3RD5A 3O26A 1P1JA 4A73A 1YO6A 4X54A 1T1RA 4AJ2A 3EW7A 4WPGA 5EPOA 1Q7CA 2O7QA 3Q0EA 2POQX 1I24A 1HE5A 2C59A 4YJDA 5GZ1A 4K26A 2GPTA 1GYPA 1I2ZA 3PLRA 4PLHA 4DYDA 3SVTA 1IOLA 4WECA 4XYEA 4IBOA 3EVNA 5EQDA 3GC6A 4GKBA 4CLEA 5JDIA 1DIBA 2SCUA 3ZWAA 4JJFA 2VNSA 5DBGA 3JD0A 4BGEA 1LSOA 1QSGA 2NSDA 3PWSA 4DRYA 3OEWA 8ADHA 4Y98A 3W4KA 3AU8A 6ADHA 1X14A 3GG9A 3K73O 3EDMA 4NBVA 2YDYA 3N58A 4L8VA 4M86A 3V2UA 3GK3A 3RJ5A 3Q2IA 4FFNA 3H3JA 1YJ8A 4BNFA 4JJIA 1M76A 3LLVA 4MVJG 4BV8A 4WOKA 1HYHA 4B8ZA 1NR1A 4M55A 3H9GA 2GYYA 1DEHA 1SCUA 4TRMA 4UEJA 4AJHA 2DFVA 3BMCA 2F1KA 2QZ9A 2UAGA 4HX5A 4TRJA 1B16A 1LJ8A 3GZ4A 4H15A 4KMSA 3S2IA 2JFHA 2O4UX 3H5AA 2CVOA 4ALJA 2DC1A 2I6TA 2YUTA 1NXQA 4NBWA 1EE9A 3JQAD 2PR2A 3D1LA 1TB4A 3KO8A 4YB8A 4WCFB 1N1EA 4GL4A 1SOWA 4W9NA 3RWBA 2HJRA 5TJ9A 1LC3A 1YBAA 4MJLA 4BO8A 1TVEA 4NJOA 4J4TA 2H1SA 4QXMA 4RF3A 4TSKA 3GVXA 4CR7A 5U1PA 2OP0A 4D3SA 2WD7B 2G1UA 4PIVA 3RASA 4S3MA 1QYCA 3WFJA 4XKJA 1PJTA 2Z5LA 1FDTA 3EUWA 3IMFA 5F1OA 2X58A 4CMEA 1QORA 1GR0A 5BSFA 1DRVA 2D5CA 1KVRA 3LSYA 4IS3A 1I10A 4DQXA 1P0FA 3FR7A 4MKZA 5A9SB 5DOZA 4TZTA 5ER6A 5JW6A 3PTZA 4IINA 4DBVO 5CPBA 4E3ZA 2VQ3A 2X9NA 1I8TA 4MVJF 3E82A 3K31A 5G0VA 1GV1A 1DLIA 3HHPA 4XB1A 3WFIA 2B4RO 4PLGA 4Y6RA 4IUYA 3Q3CA 1SNYA 1VM6A 5F21A 2YHUA 2Y99A 3HFSA 4ONEA 1RM5A 4NBRA 1B8PA 2JHFA 3TFQA 4I9HA 2EW8A 1ZSVA 2BMAA 4CUKA 3ICCA 4R01A 1AGNA 5LDGA 1E3JA 1X0XA 4QSMA 5IDXA 1VPDA 1ML3A 4DUPA 4P4NA 4OXNA 2DKNA 4K6CA 4RQUA 3BMCB 1V9LA 3S2GA 3ZGYA 1P1HA 1QYWA 3GT0A 3HZZA 3A14A 3BHIA 3D4PA 2OFPA 3WIDA 3WGZA 4F6LA 4CL3A 2C0CA 2YJZA 5CG1A 3WG9A 3U09A 5FFFA 4R1SA 1UP4A 1V6AA 1WXDA 3NT4A 2PGLA 3C7DB 5I9MA 5KVQA 4WLUA 2PV7A 3U0BA 5IFLA 3IQDB 1G1AA 4NFHA 3C1AA 1U3UA 3G0OA 4IM7A 1RYDA 5MDHA 1DC4A 3LC7O 4CV1A 4KWIA 4ZVVA 1Y81A 2I5PO 3KVOA 1LDYA 4YXFA 1PZEA 3I4FA 4WCDA 3GGGA 5TQVA 1TLTA 4EEXA 3I5MA 4OGWA 3GUCA 4RDIA 2HUNA 4BHTA 4XIJA 1NNUA 2PKQP 2X7HA 5B4UA 1QP8A 5LC1A 1IYZA 2X0IA 4RPKA 4IZIA 2H9IA 3JQDA 3O03A 5JCJA 2Q2QA 4R1NA 4GBJA 4XDYA 3WSWA 4C7KA 4J49A 1Z45A 5CAEA 1HLDA 2RHCA 4YPOA 2QQ5A 1NASA 2PY6A 3PWKA 1U3VA 3VPFA 3ZNNA 2YYYA 4MVJM 5IG2A 1MV8A 3E1KA 2W8ZA 4N54A 4MVJE 3WOHA 1KIFA 2QHXA 3VPHA 5L51A 1YBMA 1DHTA 5A9SA 4WLEA 2IXAA 5DP1A 2BD0A 4PVDA 4RF2A 3TZ6A 5KVCA 4JXKA 4KUHA 5I7VA 1NPDA 2FWMX 3LF2A 1IZ9A 2CVQA 5DZSA 4OQYA 1DIHA 2AHRA 4II2A 1SZJG 2W2LA 3AW9A 2VHWA 1Y8QB 3PJFA 4L4XA 1U3WA 4CQMA 4E33A 1F12A 4E2WA 2DU8A 4DL9A 4RLHA 3AM4A 2PKRA 1KETA 3DBVO 3PWZA 3PHLA 1R12A 3A4VA 2XXJA 1P31A 2NWQA 1YL7A 3MOGA 3ZHBA 4D41A 4U8GA 1XEAA 2VOEA 4OSPA 1R15A 2RBEA 5DCYA 1BSVA 4YA6A 4YQZA 3OICA 3IJRA 3IKVA 2FPGA 3AUTA 3WGTA 1O9BA 3QVSA 5T64A 2UVDA 2NU7A 2H5LA 2GLXA 3DBLA 3R1IA 1NTOA 2NADA 3AWDA 3PJGA 5J23A 4MKRA 1P3DA 4YBZA 5JCXA 3KYCB 3O8QA 4CR8A 1F8GA 5ENVA 4B79A 4ZGWA 1E1NA 2Z1MA 1TI7A 3T4EA 4BO7A 3PHIA 5EL0A 5IDYA 2RAFA 4YJHB 1YRLA 2FPPA 1KC1A 3UCEA 3VH2A 4Z9YA 1MX3A 1ZCJA 3ST7A 4N5LA 3SC4A 5AVOA 4XR4A 3H9EO 3NJ4A 1DRWA 4U5QA 2Q1TA 5EINA 4J6FA 1VSUA 1ULUA 3UICA 4DPKA 1PGPA 1QLJA 2CSUA 1UDBA 3UOGA 3I9JA 1AXEA 1HDYA 6LDHA 1A5ZA 3CTMA 1C1DB 4GMFA 3WGHA 1PEDA 5CEJA 3MJEA 3LC1O 3D3WA 4L74A 1NWHA 4DVJA 1B14A 4Q3EA 1BXGB 1BXKA 2UV8A 5COQA 1LRJA 1OOEA 4AFNA 4TKLA 4L4SA 1Z75A 1VJ0A 3JQGB 5F5NA 2BFAA 3JCZA 1GQ2A 4LMRA 4XCVA 3GRPA 3V1YA 1PQWA 4II3A 3WLFA 3DMTA 1ZFNA 3GVHA 4E21A 4NU6A 5KJEA 3JQEA 1ARZA 5CEFA 3ASUA 1KY4A 3ROPA 3SX2A 1LRKA 5BSHA 1B2LA 1HDRA 1Y6JA 3PI7A 4I08A 3S1LA 2YDXA 1D1SA 5KJFA 1E6WA 4K1LA 2HDHA 3GA0A 2D59A 2YV3A 2IZZA 3NX4A 3U4CA 4B7CA 1N1GA 4R51A 2A92A 5A3VA 4IJKA 4CQLA 3DAGA 1K3TA 1PGOA 4EYEA 2VOJA 4A10A 4J3FA 2R00C 4R1UA 4CMIB 4HV4A 4LW8A 1LSJA 3QVTA 2IE0A 3L9WA 4EUEA 4E6PA 3WB9A 3CZMA 3U3XA 5KCZA 3IP1A 3JYOA 3OMLA 3RUFA 1P1KA 4QEDA 3GUYA 1K5HA 3EZYA 2D3TA 3TPCA 1E7WA 1ZO8A 1R4MA 3HN2A 3QLJA 3PZBA 2I65A 2JKVA 5I8WA 4RQTA 1DSSG 1RWBA 3EHEA 2Q2WA 2YQ5A 2C82A 3RAJA 4CV2A 3AUSA 2HLPA 3DR3A 3F4LA 3TOZA 1PU2A 2AQKA 4HADA 3ORFA 3NV9A 4BVAA 3DC2A 4DIOA 4PCVA 5L4NA 5T57A 3VPGA 4OL9A 2GD1O 2GERA 4PLYA 2BKAA 3V1TC 1D4FA 1HEUA 4KUEA 1ENPA 1ENOA 1A4UA 3KZVA 2ZCVA 1JA9A 3NGLA 3AY6A 3G1TA 4KOAA 4CMKA 5KVSA 3WDSA 2DFDA 3H2ZA 3IKTA 3DBHA 3WYEA 3JYLA 1PJ2A 4ROSA 3KV3O 4JJGA 1U7HA 4QFDA 5F1KA 2AQHA 3WIEA 4YRBA 3FTNA 4RF5A 1GDHA 2H6EA 1Y7TA 3TQHA 1JKJA 1PSDA 2GZ1A 3WQQA 1JQBA 1ZXBA 5A9TA 4G2NA 3I23A 2WJPA 4GH5A 3INGA 4B3IA 4RGBA 4D79A 1JTVA 3LZ6A 4UREA 3IUSA 4AL4A 3HDJA 1EFLA 1KVQA 5BSGA 2NU6A 4WNIA 5DCWA 1IY8A 3WXBA 5IDQA 3PHHA 5AXDA 3D64A 4RVDA 3CXRA 1EMDA 2EG9A 2HSDA 3ONDA 5L7YA 5JMPA 1J6UA 2CD9A 1H0KA 2P5YA 3WMWA 4BGVA 3L6DA 3FN4A 4B4VA 4I1IA 1UZLA 3GGOA 3NGXA 1M75A 4B3JA 3TDKA 3V2HA 4D0SA 1R4MB 2AQ8A 3ADOA 4ZQEA 1R4NA 1P1FA 1ZKMA 2AE1A 3DFZA 3QIVA 2Y1OA 1XA0A 4XYLA 2ZCUA 1R16A 3KRTA 2FZEA 4OXYA 4BL5A 4CV3A 4DMMA 3WR5A 2P91A 5BNTA 4FFRA 4J1QA 2BFPA 4BO3A 1ZXLA 2OXIA 4BNUA 1F17A 5GZ3A 5LDHA 5CDSA 3GVPA 3RUHA 4XJTA 1LU9A 3QJ5A 4BMNA 1RM4A 1LUAA 2CDAA 3WGYA 2ILTA 1JKFA 3ZU3A 2FY8A 4M1QA 4FOOA 1BDMA 2PGJA 3FNGA 4XZ3A 1Y9EA 2YV2A 4UVDA 5JC8A 3PJEA 1TEHA 3R6DA 4UVIA 2NUAA 2ZJ1A 1DIRA 3RIHA 5CG2A 4U7WA 4A27A 2P4QA 3D3EA 3JD4A 5JNLA 1GAEO 1O89A 5TGDA 3T7CA 1XWFA 3OQBA 4QQRA 4D46A 1SO8A 1C1XA 3EMKA 1G0NA 1ZMOA 4IIUA 3AOEA 3KOUA 2ZB4A 1C0KA 2OP1A 2NU9A 3CSDA 4Y6PA 4Z0PA 4BQPA 3WX0A 4RVSA 2O50A 4CM6A 5HTOA 1MC4A 4A03A 4N5MA 2GN9A 3OQ1A 2UUPA 2CUKA 4ALKA 3HJAA 2YZ7A 3AUAA 3QVWA 3AY3A 1ZJYA 4XDZA 2QG4A 4NQZA 3DBHB 1UAYA 4INAA 4IQGA 1E7RA 3LQFA 5KOIA 2Y68A 3QVOA 4XA8A 1DHRA 3ZV5A 1Y9AA 4ALLA 1NAIA 3I52A 1R0KA 5C37A 2Y93A 1Y8QA 2QRLA 1SEVA 3KYCA 1DB3A 2OBYA 1I33A 2RCYA 1VE9A 1E7YA 3DBRA 4RDHA 3E5RA 4GI2A 1KY5A 4W82A 2I9PA 2J5KA 2IODA 3F47A 3KSDO 1Z73A 3INRA 4J4BA 2W4QA 4AVYA 3CE6A 5JO0A 4CQLB 3DZKA 4IXTA 2I99A 3BMQB 4O59O 3ZWXA 5AOVA 4Y6SA 2O3RA 3JQCA 1K6XA 2FR0A 1V0JA 4QO7A 5A04A 4BO9A 1ZSYA 1J49A 4PFJA 3ZWPA 2VTDA 4JN6B 1X1TA 1NPYA 4HFMA 1EVJA 4XJSA 3GVIA 4PGFA 1FMCA 1NQAO 2Q46A 1H2BA 2C29D 1I2CA 1XLTA 2JFGA 4ND3A 4IDCA 2A4KA 1Q0HA 1BW9A 1RPNA 3KB6A 1A9ZA 4EJMA 5K6AC 1UJMA 1XQ6A 3OH8A 3VHRA 4M89A 3WGGA 5KJ1A 1HZJA 3RJ9A 1ZVMA 4DLLA 1DIAA 2VCYA 4H3VA 1QMGA 1C0IA 3C24A 4A0SA 1QV7A 4D3DA 1LXCA 2GN4A 3GHHA 2E6UX 5G0WA 4FFLA 1QRRA 4P8RA 1QXSA 4E30A 4FIZA 5DNAA 3TRIA 5C3MA 3S2EA 3CINA 1YWGO 1HYEA 1T4BA 5GY7A 3F6YA 1Z74A 1S6YA 3C7AA 4LK3A 1YQGA 3MTGA 4UUNA 1IUKA 3OA0A 1XELA 5CDGA 4TVOA 2HMVA 4PZDA 2GRAA 4XR9A 1AUPA 3OJ0A 5T8KC 2GUGA 1I32A 2B37A 2Q45A 4TQGA 5T8KA 1N8KA 4QECA 2QRJA 1YDWA 3PHGA 4QFCA 1EFKA 1PJQA 2C5AA 3BMOA 3GN2A 4W6ZA 5THQA 3JD2A 2QX7A 4OKNA 4XRRA 2Y0CA 3QA9A 2PTGA 2AEJA 1DC5A 4E12A 1I0ZA 5HM8A 4D7AA 1ZZEA 2AW5A 4AJOA 5T6BA 1GPDG 1FDSA 5IN4A 5L7TA 4JCOA 3TL2A 3ZI0A 4FCCA 4L4RA 2ZYGA 1B8VA 3VZQA 4CMCA 4EBFA 2VYVD 1PS9A 4WCFC 5ITWA 1U28A 4YT2A 2I76A 4FJ0A 3TF5A 1JN0A 4OM8A 4BO0A 3W1VA 4ZHSA 5ILOA 5COBA 3OQ6A 3R0IA 1GYQA 3DOOA 2J3HA 3B1JA 5DOVA 5H81A 4MVJD 3F46A 3OJEA 4BGIA 3VTZA 5A06A 2XPCA 3D4OA 3OBBA 3Q6IA 4WGGA 2VYVA 4NPCA 4NI5A 3H9QA 4UAGA 3WGOA 1JWAB 1DIGA 2HKIA 5L4SA 1DRUA 5JYDA 1TT5A 3E9MA 5F1PA 4CM9D 4YDRA 1GU7A 1JU9A 1E92A 2G82A 4ID9A 3TWOA 5L7WA 3RBVA 2EJWA 1ONNA 3BTOA 3KTDA 1BXZA 5KKCA 1ONOA 8LDHA 3IUPA 4MDHA 1F0YA 3Q1LA 4E5KA 4FOSA 5TIIA 4ZRMA 4LN1A 2BHLA 5K0ZA 1SB9A 3VZPA 3JQ9C 4UUMA 3DB2A 1EQUA 1GFSA 5F3RA 4BNMA 1BXGA 1HRDA 4FGSA 4LSWA 3GDOA 3D3WB 4XYMA 3SBOA 5IDWA 2VYND 3DXFA 4R68A 1XG5A 5EERA 1PX0A 2VHYA 3DOJA 1TT7A 2HK7A 1NX6A 1C0LA 4L0QA 3UCXA 2UUOA 3UF0A 3ONEA 3RC7A 1B26A 2GF2A 4A2CA 5TJHA 4C7JA 2E48A 3QQPA 1WLYA 4JNKA 4YRDA 4BB6A 2X5OA 4O1MA 3HG7A 4XGKA 3WS7A 3BYZA 2X1HA 3FNEA 2VHZA 1ZK4A 4K9DA 2PFGA 3JD1A 3JYPA 3ZU5A 1JW9B 5IF3A 5EESA 2EEZA 4LCEA 4OO3A 2O3SA 5L40A 1W0CA 1T24A 4MOWA 4Y8VA 1PZGA 3MJ4A 5JY1A 3NJ8A 2ZQZA 4KTTE 3TSCA 3O38A 4CM7A 4WASA 4GX2A 4R3WA 2O48X 1VRWA 4KDFA 3BMOB 3DZJA 4FS3A 2FZWA 4CMIA 1QKIA 1XU9A 1BMDA 1WPQA 3AI3A 3M1LA 4IZHA 4CMHA 1NYTA 1W8DA 4IPTA 3FI9A 3V2GA 3WJAA 1J4AA 3P2OA 2OBNA 1PQUA 3ZNPA 2V6BA 3DZFA 4J7XA 3VKUA 1V3VA 3H5RA 3RFVA 4BNLA 2Y66A 1YGYA 3SLGA 3D0OA 1PL8A 2FSSA 3MWDB 2C07A 1BVRA 5AYVA 1QR6A 1FDVA 4FN4A 1UXIA 1ZIDA 3NRCA 4GQAA 4W9NC 2RH4A 3X2FA 5A3JA 5JDIC 4JBGA 2BF7A 3WTCA 3UH1A 3OP4A 2NACA 2BGMA 2PZLA 3U49A 3W4IA 2JJYA 4RPLA 1EEHA 3O8QB 1LBEA 1DFGA 1PR9A 3ADPA 3I83A 4YWJA 3GAZA 3PRJA 4DTIA 3ZWOA 1U4SA 4CUZA 3WNQA 3FPCA 5I7EA 1T2DA 4HUJA 1E77A 1AHHA 4BNWA 3FHLA 3VZSA 3HFGA 5A02A 3G3EA 1NM5A 3E6AA 4JBHA 1YXMA 4D0RA 1I30A 2CF6A 4GWGA 3ITDA 1MXFA 3KETA 1MGOA 4FGWA 4DBZA 3ZNOA 3M1AA 4IJVA 3GY0A 4E4YA 2HRBA 2WYUA 1FDUA 3ABIA 1OZAA 1H6AA 4CL8A 5KVVA 3MJTA 2EIHA 4YAGA 1SPXA 3H65A 4BKOA 4YT8A 1RYEA 1HE4A 2X9VA 4J1NA 1XKQA 2NQ8A 5JBIA 4U6QA 3F4BA 1T25A 3KXDA 2JAHA 2V6GA 4RL6A 5JSFA 1LDNA 3DEYX 1NBOA 5U4QA 2IEDA 4EI2A 2OOSA 1I2BA 3PVZA 4E5PA 2YW9A 1S7CA 1L7DA 1NVMB 4CMBA 2WE7A 2O4CA 3DBLB 1GPJA 4QUKA 3W6ZA 3F3SA 4DC0A 3P2YA 2VNAA 1SEPA 4L75A 3SC6A 4FD3A 2HJSA 3BZUA 3JTMA 4WUVA 2JCXA 2VHXA 3DO5A 1LDMA 2P68A 4OYRA 3WTBA 2AQIA 4YJHA 4UVHA 5CFZA 1E6UA 2XAAA 1GCOA 5FF9A 2EP5A 4CODB 3WBFA 4E32A 2GNAA 2I67A 4CMGA 5BNFA 3EK2A 3VPSA 1PQPA 2C2XA 2RH8A 2J5QA 2X0JA 3PHJA 5I7FA 1ORRA 2HK9A 4DMLA 2P9EA 1BVUA 3GN1A 4IGEA 5JO9A 5IZCC 2WWRA 3LDHA 5G4LA 1I36A 2Y0EA 2HO5A 5JLAA 3WQRA 1GEEA 1GZ4A 1YBVA 4J2OA 3GGPA 2OORA 4J91A 3LU1A 3LT0A 4WLVA 1GY8A 3GMSA 1E7MA 3IJPA 3QWIA 5CEEA 4RVGA 2AA3A 1WMAA 3RFTA 3STHA 3E8XA 3AY7A 1PJLA 1LI4A 1Z6ZA 3JSAA 4YCAA 9LDBA 2E49A 3DZGA 1N7GA 3N7UA 4HKTA 1LQTA 4CQMD 2GCGA 4JIGA 1VLLA 4EJ0A 3D4NA 3WWZA 4TRRA 2YY7A 2HMTA 2PNFA 2VN8A 5G0TA 1T2FA 4WJZA 2NU8A 3AI1A 2IDZA 1MC5A 2CDBA 3LYLA 4HP8A 3SLKA 2IZ0A 4DREA 2DLDA 4MINA 4FSHA 2JD0A 3KSZO 3D7LA 1DC6A 3ZCXA 5AXBA 3OFSA 5KJCA 5KIAA 2GR9A 1NVGA 2VT3A 2Y1CA 5EMHA 5L3ZA 4I5FA 3CPSA 4NMHA 3RUCA 4CPDA 1KVSA 4BNGA 3ITKA 4J0EA 1J5PA 3RUAA 4WEQA 1ZK1A 1YL6A 4ZD6A 3LC2O 3E18A 1RJWA 3PDUA 2PH5A 4I5GA 4BUCA 3HDQA 3Q11A 2CF5A 1U5AA 1P1IA 2IEBA 4BKUA 2NVWA 1I01A 2ZTUA 4DGSA 4GVXA 4FQ8A 3UFXA 5A9RA 4KUGA 1O5IA 3B70A 2B36A 2PA3A 1DAPA 3FD8A 4B4WA 1HKUA 2DVMA 1E5QA 2ZB3A 1YJQA 2W98A 2AE2A 1PGJA 2VT2A 1UXJA 1HZZA 4JK3A 4MPDA 1KC3A 1MG5A 2X8LA 4R1TA 5BQFA 1KEPA 3FTPA 4UEKA 1A7AA 1SOVA 1R0SA 2HMWA 1XIVA 4QTZA 4FFPA 4BGUA 1JLLA 3VH4A 3UUWA 2DTDA 1A72A 3BHMA 1PZFA 4Q39A 3HDHA 3PYLA 3Q9NA 4MIOA 4CM4A 2BFOA 5DF1A 3VVBA 4O6VA 3W8EA 1JWBB 1EBFA 5JFOA 2JL1A 2Y0DA 2WD7A 1YQDA 4JBIA 2P4HX 3DFUA 5G4KB 4B8WA 3K5PA 1YVEI 4W7HA 1CETA 1ENYA 4E31A 5HS4A 4ZN6A 3EAGA 4YJFA 5L53A 1GCUA 1U7TA 3GPDG 1GQQA 2P9GA 3RKRA 4IJUA 3MEQA 4MIYA 3ZW8A 4CLOB 2NVUA 4LCJA 1LDBA 3EY4A 2Q49A 3I9MA 2DT5A 4HXYA 1VSVA 3VZRA 1B3RA 2J6IA 2JAPA 2EP7A 4ZA2A 4NHEA 3AI2A 3ZWYA 3MTJA 4J7CA 2FOIA 3BTSA 3JQ9A 1NFFA 3RSHA 4PLTA 1K6IA 2Y1DA 4MVJP 3GDGA 1SB8A 2O3UA 4N18A 3GVCA 4FJ1A 5JC1A 1EUZA 1Y1PA 3ZH2A 3SXPA 3B20A 3ZWNA 1LSSA 1AN9A 1LNQA 4HNHA 1PWXA 1PL6A 3FPLA 5CPFA 4UEOA 5JAZA 1ZNQO 3PP8A 2GASA 3WBBA 1DJNA 4F45A 3I9KA 3GNQA 2VWGA 5JPIA 1E7QA 2A94A 4YEDA 3G17A 4YR9A 3PXXA 2IYPA 1X15A 1QYVA 4J2HA 3RROA 2F00A 1CQIA 3K6JA 1Y8RA 2EGHA 3JQ6A 3LK7A 1ISGA 3SEFA 3UVEA 1CERA 1BRMA 3JYQA 4WLOA 4NIMA 1ISHA 5A05A 3A06A 5CDUA 2DAPA 5JAQA 2C54A 4UVEA 1OI7A 3U5TA 1A9YA 3IP3A
chains in the Genus database with same CATH superfamily
5FWAA 2CFTA 4IFEA 3BQNB 1U0LA 2ZR0A 1BVYF 2ZIZA 2A88A 4TYYA 1WUIS 1HXHA 3P7MA 3MWEB 4DE5A 5KNDA 3M3PA 1WETA 1QG0A 2YNMC 1ZUNB 3BG5A 4IQ8A 2YFYA 4LZLA 4LAFA 2H4FA 4GEKA 3DYBA 4BNIA 4NU8X 4YLEA 1D6SA 3MTEA 5K1ZA 1QF6A 1J25A 2CEKA 1M2JA 2XDWA 3G2HA 4N03A 1OIWA 4ITUA 4B33A 3C3YA 4I55F 5FULA 2HU5A 3RVDA 2ZZNA 3IEKA 1ISRA 3HB4X 2C97A 4KBYA 2HGZA 4W4TA 3L8YA 2NSLA 3H4MA 4MVJI 1QWSA 5FLKA 3PCTA 3NBZC 2BEWB 3EFEA 3O2JA 3D59A 3WICA 5FIUA 2Q5LA 4JLPA 1WU8A 1D9XA 1N92A 1U7UA 2IZ6A 2Q2NA 3DTVB 1REQA 3U62A 3JU3A 3PT5A 1JDVA 3EVBA 2P5SA 4PR0A 1EK5A 1SFRA 4WE3A 3ZK8A 4AMVA 2VJMB 1ZD1A 1YC2A 4LRSB 1YB4A 2FPIB 4UUOA 1EVQA 4RJJA 3GLFB 1GOTA 3QUQA 2PLWA 4HDOB 1DOZA 2HQOA 4K87A 3ZZUA 3B38A 3SF8A 3NAZA 2VWQA 3SC2B 3IX7A 2WHQA 2R6FA 3WY9A 1P9LA 5ICSA 4MB2A 1V1MA 2CDNA 4XX0A 4H4DA 4DNFA 1GD1O 4R5MA 4KPFC 1OHHD 1SG6A 1CIVA 1KFBB 1GKLA 1Q14A 2PMFA 2XCQA 3DL2A 4LDZA 1BE1A 2WM8A 1IZ0A 4LRTB 3OHMA 4N7RA 2A1UB 5FQNA 2P65A 5JR3A 4FWBA 1THGA 1EXNA 1OJ7A 1SXIA 2M32A 1A98A 5ERGB 2E9SA 4D4GA 3P96A 1JR3E 4OHZA 1KA9H 1P72A 2B69A 4P7FA 1ZCZA 1FTQA 4MQ5A 1NBIA 5K3BA 3HXMA 5J2TA 1PVOA 4MULA 2KBFA 3K70C 2O23A 1B3BA 3C0KA 3DT8A 4FVTA 4PICA 3RS0A 2QTNA 3U61B 3A4LA 3KNZA 4YT5A 2J5RA 2J48A 1E63A 1DFHA 3VTAA 2Q41A 3FROA 3K09A 3OE5A 4IGKA 4XQEA 3OTGA 4NMLA 4PZ9A 2FQWA 3VAZA 4MKHA 1UJBA 1M6WA 3F1LA 4R16A 4DEYA 5C32A 5JXWA 1VKNA 1K68A 2M1ZA 2XT6A 3E3LA 2GAFA 2Y0PA 3PPVA 4U6NA 4KYTA 3QF4A 3MTAA 4TS4A 1ZAYA 3ROMA 2D5BA 1PNOA 3ROFA 2QAGA 2PKEA 2HWWA 3HJNA 5BOSB 4TTQA 4OHCA 1GGFA 4Q1CA 2FVXA 4K6FA 1KJJA 4X85A 3PNVA 4HAVA 3ND6A 4L9WA 3GLQA 1BU8A 4TTIA 4CKCA 3QW4B 4F2PA 1E79A 1HTTA 1SXJD 3GEDA 4UULA 1NVEA 2BAGA 2Q0HA 5HFAA 3M5DA 5EP1A 4AWXA 5M29A 4KAAA 4LXIA 3N5KA 3ZJ5A 3S55A 5KINB 1CP2A 5B1YA 5IEBA 1U8AA 2XMRA 4UHDA 3KJFA 1OBCA 2FPIA 1ZK0A 1N9GA 1D8AA 2XNHA 4FGLA 3T4UA 1ZGZA 4PZLA 4F46A 3W5AA 3E7WA 3LX8A 4LQ4A 3V42A 5BV8A 3MGGA 4UVGA 5HRCA 1U2DC 5GPBA 5LYJF 4UNPA 3QLUA 3GA5A 4QDJA 1HM5A 3VKFA 2MHCA 5KWVA 2ZSKA 1P0CA 2B3DA 1KZ7B 2GO1A 2QZPA 1Y6RA 2OCKA 1MAVA 1JEEA 2BRUA 1IVNA 2FR8A 4F2GA 1CZUA 2BFMA 2GRJA 4P38A 3Q8LA 4JI0B 1HI9A 4K8RB 4J0KA 5KTPA 5FLYA 4P93A 1N6HA 3C85A 2JGFA 3JQBC 1KR5A 1WBDA 1DMSA 4G5HA 1C7EA 1R6AA 3N76A 1ZMRA 1T6XA 4RU1A 1U9IA 4G4GA 3ISTA 3RUDA 2IXEA 5HM6A 1ESMA 2XVMA 2ZK7A 3TUZC 4X60A 1Z0AA 1OWOA 4FILA 4Q4CA 3BHJA 1ZL2A 4HY3A 4IJ5A 5EA2A 5LZ8A 4EKEA 1L5FA 1Y9ZA 2C03A 4V38A 1JAXA 4GMKA 3HN7A 4Z2AA 2DPMA 3C87A 1WHTB 5DRTA 4KZPA 2ZJBA 1KYWA 3DDOA 5IC6A 1Z4OA 1I80A 1YBHA 4QTXA 3DE5X 4WNCA 4B7UA 1FYFA 2XCLA 3KPUA 2GAOA 4D82A 3T1TA 2E55A 4OGGA 1RZRA 1MTZA 2CV2A 4IVPA 1CVIA 2ZPTX 4FW9A 4IXWA 3CNBA 3DTTA 4BTLA 5JVDF 2Q50A 1Z0ZA 4W99A 4N65A 3CLRC 3V9AA 5IRCD 3UJHA 5L45A 4IKOA 1H69A 5AW0A 1A2KC 5IFKA 2ECFA 3IBYA 1CIJA 2VWPA 5D5QA 1HSZA 3VSBA 3A7EA 1SCIA 3A9WA 4KV9A 3BFJA 4R7TA 1F14A 1HORA 1P5ZB 3COVA 4HQRA 5J1SB 3FKSD 4MWBA 2DR0A 2HCFA 1YI8A 4H59A 5I47A 3F2IA 5DLEA 3KXKA 1USGA 3W8FA 1JECA 4K9PA 3TEJA 1RBZA 3ABZA 4E2XA 1ABBA 3TXYA 4J7AA 1MDBA 1XZBA 2MYTA 3C16C 3CWZA 3CEHA 5D8DA 3RC3A 2MYPA 2QRUA 3LGSA 1U9IC 2FZVA 1NMYA 3EDOA 3OPMA 1XDZA 4H7HA 5TX7A 3GFFA 3V8EA 3SSMA 4D8TA 1Z8HA 5J43A 4LQLA 1A8SA 4S1WA 3V80A 3LT1A 1FE8A 3RT7A 3I4CA 4BVLA 1KWKA 2XZOA 3CG4A 1UZAA 5D1NA 1VC2A 4TTAA 4PFSA 1Q6YA 3OETA 2RKOA 3DVLA 1IHYA 2P8SA 2QT0A 3FSJX 4YP1A 4ZVPA 2P77A 1XTQA 5DPMA 1IN7A 3C3EA 2W6CX 5EQFA 3X1DA 5KS2A 4EELA 4KHPB 1K3UB 3ZV4A 5DLQC 1C3OB 2GVDC 1E61A 3A3KA 3ACDA 3AFNA 3LT2A 4JAVC 4BO4A 5HKOA 4GE3A 3TZQA 5HIMA 2A9FA 1QLWA 3DVQX 3H4VA 1WPGA 3P9CA 2EZ4A 1V71A 4M7RA 4Q7MB 5BYBA 1OB5A 2QD1A 2AMFA 3SMVA 1YUBA 1W2GA 3LOQA 5DBFA 1GTMA 2OAQ1 2OV8A 2WZCA 3AG6A 3QUCA 5DXAA 3WV4A 2QRPA 4DA4A 3HY6A 7REQB 1JB9A 2YVQA 4MVWA 4LF8B 2BI7A 3S1AA 4OQDA 1DCTA 1YB6A 4R8RA 4NK5A 2NNLD 3DBIA 4E2YA 5JSUA 2IELA 4US2R 1QFSA 5CVDA 2D0OB 3UB4A 4ACBA 2R62A 4AM8A 3AUYA 3ZWBA 4J16A 1U2SA 3EXIA 1ZDMA 1Q0RA 1Z5UA 3MUFA 4B3HA 2GEBA 1QDLB 3HJTA 1J2YA 1FTGA 1VGQA 2BGJA 4C43A 3ADKA 4NU0A 3A9SA 1PV4A 1T2EA 3LUKA 4Q3OA 5C1IA 5JLJA 1M10A 4KSCA 1WB6A 2QEQA 4GXQA 2GD0A 1EXDA 4FT2A 3N9IA 4F4HA 3ITNA 5KC9A 2BHNA 4WIAA 3MB5A 4KWCA 4GKJB 3H6GA 1QANA 2XE7A 1WOMA 4NOKA 1ELOA 3WK8A 3IBTA 4AUEA 4PN3A 2MTBA 3A8TA 4HPWA 3QJYA 3Q7SA 4MKXA 4LRQA 4F92B 1TXGA 4N7MA 4YX9A 1C7ZA 4MGHA 5HFJA 4Z4CA 1K8RA 4FNOA 1FUKA 4KFUA 2BI8A 3X3HA 3PLNA 4C9BA 4BE7B 3IR7A 3NBUA 5AM5A 4IO1A 1Z0SA 4O25A 1XGKA 2WD9A 1UMKA 5A1TA 1KP3A 3MWLA 5JSYA 1Z8DA 2VAPA 3HI4A 1TOAA 4ZAXA 1LSUA 3IVMA 5FD8A 4WXEA 2WAYA 3KJIA 1WUJS 1AN0A 1HMPA 4HDSA 3ZEIA 1CYDA 2BJVA 5AKGA 4WZAA 1P39A 1ULSA 2ZFUA 4QX6A 3C4VA 3OY2A 1Z4PX 3ENKA 5AMXA 2G08A 4GYKA 2XYGA 5IKOA 3PFHA 4DLKA 1I7DA 4CM4B 3T5MA 2H8KA 4G25A 1EDZA 2CCJA 5I3ZA 1GNRA 5FL7A 2PUAA 1D4OA 4ZZ3A 3WGIA 1ZR2A 4KE6A 5KOHB 2QI9F 3JW8A 5MN5A 4WLFA 2R6R1 4R83A 2QL7A 3Q8MA 3MERA 5ITZA 1BG6A 3C7CB 4DC1A 3FCXA 3NTUA 2J3KA 4B35A 1YJ5A 1E5DA 3H3FA 3OD5A 5C5IA 1XTKA 1A9TA 2IC5A 4RO0A 5AW8A 3OZWA 5J1TB 4QARA 3KZMA 5LR6A 2JLSA 1UWKA 1XL1A 3KXPA 4IIHA 4BPBA 5EWMB 1J8QA 2VF7A 1SBQA 2DGDA 3QV2A 2Z8ZA 3FMGA 1Q0ZA 2R6JA 5AOAA 4WBNB 4NNPA 3IPAA 5KQGA 2VH2A 3QEOA 3T9CA 2KLHA 4PHTA 2J09A 1EYZA 2ZQ5A 4JHLA 4N6GA 3E9QA 3T3EA 2GPWA 1E99A 3SF8B 2QVXX 4NFYA 4JP3A 4BV9A 4JJAA 1TKBA 1U0SY 1TAHA 5FBQB 5TF4A 3S44A 3PNPA 4MYHA 2F8SA 4YDQA 2JHCA 5ALFA 4JQYA 5FI3A 3GBSA 2XDYA 4LV5B 4MIKA 4TYNA 1C9YA 1UDAA 2REXB 1FUUA 2JARA 2CLEB 3K32A 2HH9A 4DDMA 2Q5IA 3OM9A 1QE3A 1TQ4A 1UOQA 1CKEA 2CN1A 2YQ4A 1XMPA 3F5QA 5BPFA 1T4CB 1U1GA 2X8JB 5H82A 3LPAA 3ZK9A 4EAAA 1IBRA 2DEUA 3FWZA 2MIIA 5ECDA 2PRSA 5DN9A 5C1DA 2P2NA 4KPGA 4DJFC 3NWJA 4B75A 5FP0A 4R2KA 5C46F 4XGIA 3AYZB 5GONA 1F51E 1ICEA 1Y4DE 3L4BA 3ETDA 4CDNA 1UJ4A 4ND2A 2JGMA 4EA8A 1PBNA 3OZIA 2FW9A 1P0IA 1O2DA 2CBGA 2RHJA 2JBAB 2ZJZA 1E1QD 2VZEA 4MP3A 4Q1EA 3ZZTA 2FNAA 1O0SA 2JHGA 2AX3A 4GYWA 4LC1A 4M53A 3TW4A 4B3XA 1TKCA 4BO6A 5HUHA 3BJEA 3QV1A 4ALMA 3P9KA 5B3LA 3BFVA 2ZOSA 3HYSA 4MUNA 1ISSA 4PRLA 1HC7A 5DYGA 3LGXA 3GCWA 5FADA 3REOA 4YRNA 2HDWA 3DG9A 1KERA 1FXSA 3JVEA 3PU6A 1YDMA 4ZI7B 3L1VA 1ABEA 1UMBB 5I48A 3L41A 4F71A 4QOSA 3SF0A 2C31A 4JJZA 3H2BA 5JUWA 2O2YA 4RL4A 5JNRA 1I1NA 2C84A 4OAQA 2C0QA 1DL5A 2YYAA 3GZJA 4OI1A 4ZYLA 1AK1A 2O7VA 3F4KA 2UZ0A 4NESA 1JHAA 2WLTA 5KU7A 1QLHA 5HXAA 4LYGA 1KAEA 3OCYA 3KR9A 2Z95A 1O8BA 1U02A 5LLSA 1PDOA 3F5SA 1EP3B 2FTKE 5M34A 1E5LA 2JIBA 1R8QA 5EZYB 1L2TA 4F04A 2CEAA 4MUXA 4OQEA 1ZMTA 2O0LA 4YQYA 4G09A 5B6PA 2FZGA 3SZ3A 3HXOA 3RKSA 5BR7A 4AJJA 1HG1A 1B8UA 4ARAA 2GZSA 3H2GA 4R9RA 3T5AA 1OILA 4UBJA 1UBLS 1W4ZA 1NY5A 3KKKA 3PFBA 2HSJA 4JCCA 4JGIA 3DQPA 1N9ZA 3ZW9A 4QVIA 2V3CC 3UHAA 2JKZA 3SNKA 3I3OA 5I9NA 2CFRA 1DKUA 2V6JA 1JFTA 2VDOB 2FGJA 3D4IA 3AM3A 2ZSFA 1P44A 2OILA 1CY6A 4FLEA 5CVJA 2Y77A 3OIGA 3OMXA 5AJVB 3TSYA 2A35A 4BRZA 4E88A 4H7IA 1R66A 4C08A 2HF2A 3H7AA 2KSQA 3DOEA 1C9KA 4X6YA 3F7TA 1UKCA 1Y0BA 4HI0E 2ZETA 2RFLA 1E94E 1NVTA 2BJWA 2XUGA 4MR8B 4NYMQ 1T2NA 2X2FA 3EWIA 3E03A 3PIDA 1TRHA 3KZXA 5BQPA 4R71A 1YONA 1VGVA 2VZ8A 2TMDA 1FQWA 3AZPA 1GKUB 2FZKA 3IV9A 2P35A 4KK3A 2GN0A 4YECA 4DARA 1GCIA 2IFTA 5CUQA 3N5CA 1CY0A 2VC2B 4I6EA 4JJEA 4RD6A 4RHCA 5E1DA 1VE5A 4H18A 4OQQA 1W5EA 2FPRA 4ZYTA 3CRW1 2FP3A 3M4ZA 2W90A 1YB2A 3QWAA 4D45A 2DBVO 1QGAA 1GV0A 2N9UA 2VQSA 3W5JA 2I2WA 4S1VA 3NQ41 3LZDA 4P36A 2IYTA 3T9FA 3TLGB 2I66A 5B3JC 1L4BA 1TCVA 3E0XA 3MCZA 4RPIA 3L49A 4RH3A 2V9ZA 1I0IA 2V98A 2JLYA 1HY3A 3GEEA 4V0NA 4EY7A 2LNDA 3GF4A 3HKBA 5CBPB 5ITSA 2O54A 2ODQA 4U2EA 1A7UA 3SKVA 3EMDA 1RI3A 1RMYA 1AU9A 4LBYA 5FWYA 1JSZA 1TJNA 1TW3A 1VLHA 4RDXA 4CIAA 3VMFA 1BWRA 1EGHA 4DCJA 1KI9A 3EG5A 2G9RA 2F8TA 2GHRA 2WTXA 3U4IA 1YOVB 8OHMA 1NIJA 3LNTA 2GX6A 2FW0A 4OMDA 4B17A 5L9AA 1GGVA 4AJIA 3C6XA 3VBCA 1PE0A 1RBMA 1XRMA 4RY8A 1Z3CA 2ZUEA 4ZQFA 3WVNA 4FYVA 3ZGZA 3FA2A 3GR6A 1DX4A 3M6FA 4BTVA 3AH8A 3OLVA 2PT9A 3I9FA 3OZXA 2OY0A 1K3FA 2DTEA 4IKPA 1LPSA 2V7QA 4G85A 1IHXA 3K92A 2PRJA 5M3BA 3SK0A 1XNQB 4Z1MD 1E7SA 1OBOA 1N2BA 3F7OA 4YRQA 3PENA 3DL7A 4CM8B 4DDWA 3E5MA 5I7AA 1CUEA 4C29A 3DOIA 4MAAA 4MKIA 2I7VA 3OEHA 1K92A 5G3YA 1CR2A 1W30A 1LEHA 1Y7HA 821PA 1IN1A 1YL5A 1OHHA 3JWIA 4AWBA 3NKLA 3I5XA 1TIBA 3RS8A 4Y2VA 2C2MA 1O94A 1O9GA 2WTEA 4ZGGA 4TS1A 1XTSA 2DFKB 2WW8A 4HH1A 1IRIA 4CKEB 1TKAA 1Z07A 4LXYA 4XCQA 3L77A 4C22A 5ADHA 1HE3A 1NT4A 4TM7A 3FNHA 1V5EA 4G8BA 4ROTA 3MHTA 1ZI9A 1KHTA 1XCPA 4IDBA 4WJLA 1G7TA 3UNXA 1ZR4A 2CK3A 2XVXA 2C3OA 3EGEA 5F64A 2YZMA 4JBWA 3IP7A 3LF1A 4DXAA 4BNVA 3V8RA 3WIBA 3DHYA 2GM4A 1PJCA 2AR9A 3V4OA 2I6SA 3G79A 1Z13A 2VA9A 4JQZA 5B7PA 1KIMA 1GUFA 1GYRA 2Y05A 3DUFB 1L4LA 2IUTA 2YXEA 4NZYA 3ETCA 1T9CA 3EQ9A 5C1BA 4JWKA 4XCXA 4BJHB 1KEZA 1QH9A 3GAAA 4Q1AA 1TJ4A 1M1XB 5BRJA 2JGRA 3HJUA 2WYHA 1LX6A 2GFIA 2PYIA 2VPWA 4JMLA 1XMSA 3WWCA 4LVCA 3QYJA 3AVXA 1T26A 5TMDA 4JUBA 1VZ3A 5DEIA 3BXOA 3H1PA 4S0ZA 2RHMA 4C7OB 1CDOA 1UR5A 1XAJA 3PUZA 5E7QA 1IZ7A 4CKBB 3BXZA 5G0UA 1CUUA 5DLDA 2IQIA 2QAGC 3NEYA 4RLSA 4BVHA 5A6SA 3BA1A 5JZMA 3JAKB 2RAUA 1ZGHA 3H6KA 2MCFA 1UADA 3F73A 4Y9TA 4Z4IA 4QLAA 2IX3A 2PXCA 4J4HA 2ZB8A 4IG9A 3OWHA 1ADGA 5TNXA 4AG3A 3UFBA 3IEVA 3U19A 1KVUA 3NWPA 2FEPA 3SXJA 1BE6A 3B8HA 1NVVR 4NBTA 1XDWA 2RBGA 5BWNA 1IQUA 4LX8A 1ZGCA 1CIPA 2NYVA 1YACA 1WUYA 2VNHA 3G9UA 3LQ2A 2PZBA 1QTIA 2X8BA 4I19A 4NPHA 4C4RA 1HH4A 5K9ZA 1PNVA 2IHJA 2MU1A 4BU0A 4ERNA 3BJRA 3EAFA 3LXMA 2FLWA 1TQHA 3MUNA 3T61A 4YCSA 1NVDA 2OZPA 1P91A 5EGNA 3IDQA 2HM7A 1DQPA 3V1UA 1NNSA 3VO8A 4ZQIA 2HBYA 2QLFA 1X7XA 3CRNA 3MF4A 4S05A 3U44B 1EUCA 4W8HA 3OJOA 3K0CA 1DMRA 1CWUA 2AN1A 2QTZA 5CLGA 1E1KA 1T2CA 4IGFA 4HUQB 1NQ5A 2V7VA 4G0MA 2D5AA 5FEMA 3VNBA 4PYMA 2XCSB 1VSTA 1OC4A 3GFQA 1ZC3A 3GLGE 2OBBA 3HSKA 2NLOA 2ZTMA 4QJIA 2QTGA 2DERA 3QE3A 4M9QA 2Z9CA 3VKVA 3NFRA 2EQAA 1WVMA 3PCXA 4D3YA 3B2EA 3URMA 4DT1B 2AJTA 3UHJA 4YAIA 2YHIA 3QEMA 4OLBA 4D9CA 3CUTA 3HU5A 1KVTA 1TGYA 1W44A 2W0SA 1AH2A 3B89A 2YV4A 5IZ4A 5JMTA 2VUTA 1S5PA 4ZICA 3GA7A 3M83A 2HUPA 1OI4A 5KSZA 1CY1A 2H1LA 3CS3A 4CKBA 9ABPA 4C4TA 1WF3A 3UT6A 4GSKA 4QGAA 2XJ9A 5MFPA 3GH3A 5E1BA 4ETWA 1SG0A 1P33A 2ACWA 5CT5A 2DXIA 2FFQA 4IQ0A 2YWBA 1ADJA 1AKUA 2MSCB 3LVFO 4JSYA 2LD4A 8ATCA 1H94A 1KY3A 2R1TA 3PRYA 1Y42X 2QQ0A 4GYYA 1I0LA 4QOHA 2CVZA 4WOPA 3TZLA 1EZ4A 2QAJA 2A30A 4LOHA 3EGVA 3GLIB 4KIWA 1Q3HA 2C2YA 3H9BA 3KYDB 1HNNA 5BQ5A 1OX5A 1PJ3A 4LDJA 1FP2A 1X3SA 4MV6A 2X9GA 2DKOA 1ZN2A 1C30A 1Y7PA 4UZSA 5JZOA 1QGED 2A58A 3NGMA 4YHBA 2XBMA 3EIUA 2GNPA 2W43A 3DHVA 3DMTC 1T8WA 4GPBA 5IVDA 4D42A 4YRSA 3SR4A 2BFWA 4DUZB 3VKGA 3UHOA 4JLUA 1KS9A 1ZJWA 4F3RA 2OL4A 6GPBA 4HK4A 3LQYA 2VP0A 5K3FB 1HZZC 2EEPA 5CB0A 4WESA 1EIWA 1CY7A 1QIMA 5KTKA 1Z2DA 2IDJA 3ASYA 4LZWA 1JIIA 4DIBA 2N42A 4KRFA 3CIFA 1HE2A 1MIOA 1HDXA 2PMBA 2AWNA 4EB8A 4PR3A 4ZOBA 3ULKA 4MRMA 4Y1GA 5BWLA 1T1SA 2O3JA 2XQVA 4CQJA 1OFGA 4MV4A 2GJ4A 2O1XA 3LHIA 1U7OA 4UHCA 3HU3A 1HSOA 3TLEA 2Q29A 2BW0A 4OPMA 1W75A 4C7MA 3I58A 3PDIB 4TV9A 1UJ2A 2WP0A 3K35A 4PPGA 3AEXA 4J0CA 2PJRA 2PT7A 3GGCA 3CZRA 1UEIA 4D92A 1W19A 5C34B 1NUSA 1GADO 5DM60 3A28A 2A5GA 4H6XA 2UYCA 3WZ2A 2J0QA 3WRXA 4Y7CA 5ICFA 5KOJA 1QQ6A 3HKCB 3DDZX 3KXIA 4LVUA 4GMHA 5E9JA 4R4JA 1EWRA 2RHGB 3L7KA 1RU3A 3WDMA 1KNXA 1VPVA 4OBXA 4EOGA 1MGPA 3H16A 3UOAB 1KQOA 5LDDC 3BD9A 3OKPA 5FUXA 1IHPA 2FJ0A 4TVSA 3LCVB 3GLGB 4F0JA 3L7NA 3CH6A 2ZDGA 3CUUA 2ZI5A 4H2DA 2CYBA 2OPHA 5B4TA 4CEJA 2PT5A 3B13B 1HV8A 4KSBA 4D4IA 4MPRA 4XAQA 1KWGA 3B2QA 3FCEA 4XFKA 2C20A 3FUVA 1Y5IA 2AJBA 3QE0A 1XFAA 4LUCA 1JG7A 3BPSA 4M88A 1CT9A 1DTSA 1RC0A 3AFMA 3IT1A 1PFWA 3INTA 4M3NA 4OVKA 3RF7A 1HETA 4C7VA 4PNEA 2EZ8A 1ITZA 3EZ2A 2D2EA 3GELA 4N3GA 5BUSA 1R6TA 1Z7BA 5AP9A 3TM4A 4EGCB 4ENUA 4JXXA 2ZUVA 4KDCA 421PA 1YTLA 3F0TA 5TDHA 1NDHA 2JIQA 4Q3NA 2BFDB 3RI3A 1CZOA 5A4DA 3L4KA 4A8TA 3PX3A 4Q9NA 1MVNA 2AFIA 3QXHA 1V5WA 4XASA 1CE8A 4Q9HA 4P34A 1IJEA 1JDSA 1Y7LA 2X6TA 3IYLW 4RXTA 3RU9A 5CFOA 1A2OA 2CYCA 3NT5A 4MP6A 3G5LA 4UUPA 4D44A 1U2EA 1HT0A 2GN8A 3ZBPA 1PD0A 3DE7X 1NOJA 3BB1A 4Z3DA 5COAA 3SX4A 1PAUA 4FMDB 4DG5A 4NF2A 4B87A 3ZVRA 1XCOA 2HA4A 4W5WA 3R5KA 1U0HC 3FMOB 4XQGA 4EG5A 4YAEA 2EKQA 3MS4A 1Q20A 2PKWA 3T52A 1FMFA 3VR4D 4TSRA 3ILVA 3OZVA 2Y4NA 2W71A 4RULA 1HDZA 2AD1A 2G1KA 3JPYA 2AD5A 3LV8A 2QW8A 4QYIB 4R40A 3ADCA 4KQJA 1E9DA 4U2CA 2FPGB 3W3AD 1FFXA 1DVRA 2TYSB 2YFHA 1C8VB 3THOA 2OECA 1FZTA 4IOKA 5P21A 3VR6H 1ZM7A 1K2WA 3ZPXA 5EIEA 4AKGA 3OT1A 4TTVA 2B4QA 2WSSD 1WNTA 2QTTA 4MO2A 3BWCA 3ET4A 4WXPA 4PZEA 1QZ3A 3VOTA 1UT6A 3LYHA 1PSWA 1YZNA 1O58A 3OF2A 2IKSA 4GMGA 1CR4A 3NTOA 2COEA 1P7VA 4IIEA 4RD1A 3ZKWA 3LX4A 1HK7A 1W0KD 2FSVA 2WWIA 3KT3A 4GOOD 4JR2A 4RA9A 2X41A 4BQFA 5K0BA 3L0SA 3D7MA 3HN6A 1K0UA 2F7SA 3VNAA 1RQXA 2HMAA 1VJRA 4ML3A 4JKYA 4U2GA 1T1EA 3H19A 1DZ3A 3I9NA 2Y76A 3NBAA 5HGJA 3ZGNA 5EHZA 2MMGA 5DN6D 3HCWA 4X94A 4MRPA 2PWZA 1MAAA 4IH9A 3TKYA 2Y9PB 2XNDD 1JI3A 1X9IA 4PIPA 2QPAA 5B37A 1NQWA 1V8BA 4OA5A 1T10A 4DA9A 4KNWA 3L9XA 3GZNB 3UK0A 2YYSA 3VNSA 4PGHA 3CURA 1KNQA 1IUNA 3P9XA 2ZRMA 4XWGA 1VL1A 1YHZA 4ZREA 4DR2B 3DHEA 4MIEA 5ED0A 5SYMA 3V8BA 3B1ZA 3VPCA 4EWLA 4CEIA 4UD2A 4X64B 2HIHA 3ZDXB 2N46A 3HUDA 4CZ2A 3K9HA 2OO3A 3QTTA 4FQ5A 1H6BA 4RW0A 3KPYA 3N0VA 3TRDA 3R8FA 4D9NA 4JI2B 1LBIA 2AZXA 3ORSA 1EA7A 4FI3F 1XDGA 3HPRA 4FBGA 4FNAA 2CDCA 4MWTA 4MUFA 1YFKA 4X8LA 4D25A 3NRJA 3OA2A 2B1GA 3PFWO 3WSTA 2E1RA 5HCIA 1UK7A 1UPUA 1XHLA 5FBLB 5FRDA 4DMRA 1E89A 1NKTA 2OO5A 3I1YA 5KJ6A 3O8RA 4HS9A 1WZ2A 4Y2GA 2HHHB 4GIBA 3AF5A 4GM0A 4X6XA 1UC4B 4CXMA 2A0XA 3DO6A 4YAJA 4CG0A 4KYUA 3LCRA 4G1EB 3X1XA 2HJWA 2W2LD 4RTLA 3FOCA 2VUIB 3MLBA 1K7SN 1NBAA 2PUGA 5JVDA 4ZEMA 5H4HA 3TFWA 1YDFA 2E18A 1GZ6A 4MR7A 1EFAA 1CEYA 4Y2HA 2Q6TA 4NJMB 2BUAA 5A6VA 4XRGA 5M5BA 1YNSA 4A7PA 2A1TR 5GTDA 2X3YA 1JALA 2E4ZA 2GAIA 3L1UA 3STXA 1CV2A 2HHCA 3DE6X 3HM2A 4TXJA 4YJ2F 2F3UA 1B15A 4DMFA 3W78A 1Y3HA 2GLTA 2QD3A 3B9RA 4MX8A 4G4SO 4PN7A 2XVZA 3EVTA 5LQDA 2CYAA 1X8XA 3CVWA 3Q3IA 3A1EA 1F06A 2AEMA 3FWKA 3W2EA 3SFVA 4OQZA 3BIOA 1RMQA 3N8DA 5HJ2A 3H86A 2WB2A 1GAXA 4Y1RA 1HT3A 1OGIA 1PW7A 1QMPA 3GFSA 1ZOLA 2CLHB 3ZWQA 5E3HA 4BNTA 4P83A 5L6LB 1CFZA 4LPKA 4PQRA 1D2GA 3ORYA 3K1TA 5KX5F 4ND1A 1XEWY 3ADDA 3BCUA 1NYLA 1UWVA 3I3SR 3C1OA 3LQ4A 3PPIA 3X1JA 4EDFA 2JH9A 5AM2A 4PZYA 1KO8A 1UKAA 3KQQA 4NONA 5IN5A 1MJHA 3T1VA 1AA9A 4XEHA 3SVZA 4BX2A 1UINA 4PYQA 1P45A 5LWQA 5EAIA 1KTIA 1RW4A 2FZ5A 3RD5A 1P1JA 3E8SA 4ICIA 1YO6A 4L08A 3NANA 3G0BA 4D9FA 1T1RA 2BUBA 3BWVA 3EGIA 1O6GA 4RFSA 2OBXA 2B1QA 2O7QA 4D0LB 1TZ2A 1VRCA 3NETA 3MM4A 5KYVA 1I24A 4JXZA 1G21E 1UC8A 3R5XA 1WXGA 2IHZA 1MQAA 2G3YA 3C6ZA 9ATCA 5GZ1A 2SCUB 3FDIA 4K26A 5HK8A 2DWUA 5IKEA 1I2ZA 3C70A 4PLHA 2E4YA 1CU1A 4Q15A 4WK4B 3SVTA 1U0NA 2JLUA 2O8BA 1DRJA 3DYIA 5GVRA 1DIBA 4XWAA 1R9GA 1VLJA 4RTPA 3JD0A 1GITA 1QX4A 3L8FA 3ONWA 3RREA 4X8OA 4BGEA 5HNKA 1QSGA 3PWSA 4KDRA 3EQ7A 5KMGB 4ZJZA 3PNLA 1LCIA 1T0PA 2SKEA 2GBLA 3PGMA 2XGJA 1YVRA 3WGUA 2IWHA 2IU6A 3VUFA 1IXRC 2WJHA 3GMTA 1AOXA 2EKDA 3BUSA 2Z2YA 4MUJA 3I6ZA 4B6PA 3X1WA 5K4AA 4X7RA 1C3OA 4FFNA 2FWJA 3EFBA 1YJ8A 3IHTA 5E7JA 3KXLA 1G8MA 1M76A 2BRUC 2PQ0A 1ORHA 3LLVA 4LY6A 4X1OA 5J2TF 3TLGA 4A8JB 4RDCA 3EB9A 2G7MC 1P7PA 2IW1A 1E9BA 2V0CA 4LY9A 4WZBB 2FFRA 1SC4A 2F3RA 1DEHA 3ICVA 1OASA 3PD7A 1PBTA 1UFVA 1IY9A 2X19A 1RKQA 3KUKA 4POOA 5EXSA 2GN2A 3Q3VA 1O87A 4C4ZA 3RVPA 3H6HA 1V6SA 2NPOA 4AX4A 3NIBA 4P84A 4U39A 3IBCA 1P3Y1 3H2KA 2YUTA 4MUAA 5LMUB 3KE8A 3V1KA 2IZ7A 3R6TA 5E2BA 4RETA 5KQRA 5GADl 3JQAD 3P52A 3D1LA 4OD0A 2BBWA 3WLLA 4TOIA 3A1FA 1PKEA 3L7CA 4W9NA 4E5SA 1GPNA 1N57A 1LC3A 1KO5A 2O8EB 1SOMA 4BO8A 4URXR 4RS3A 5IAOA 3PXDA 3QFTA 4J4TA 2H1SA 5EMJA 1CJSA 4RF3A 1PQYA 3GVXA 1RRKA 5HP4A 2WIDA 1UMDB 1C8BA 1USKA 2BM8A 2W6IA 3C6MA 5AKYA 2WD7B 3AWIA 3BQ9A 3L46A 4O1IA 4PIVA 3PC7A 2Q3MA 2WNSA 4C0KA 3LL7A 2Z5LA 4CFZA 1W36C 3ZYZA 2RI1A 2JFYA 3KJNA 2X58A 1JHMA 3KQYA 3OM1A 5ALKA 5F1OA 3D7RA 1ESCA 5IAEA 1XBTA 3RYHA 1A77A 1NMQA 1RWKA 3LSYA 4IS3A 3S2ZA 5BSFA 4WERA 4DQXA 3KT0A 3D1VA 1FP4A 3T9AA 1Y3AA 1WD5A 4ZHQB 2ZCJA 2P1RA 2P9HA 5A71A 1Z18A 1VHQA 3KKPA 5DOZA 2PO5A 5DV9A 5ER6A 5FWXA 5GJBA 4HPJB 3E82A 1MX5A 5I7OA 5KTYA 2G5TA 1YZ3A 1L5HA 4EABA 1GV1A 1XZFA 4K3VA 3HVHA 4FBLA 3RE1A 4PLGA 1X19A 4Y6RA 3ZCRA 4LIPD 1NYRA 3L1HA 5J47A 4JI6B 3IT2A 3S70A 2QW1A 2Y99A 3DUWA 4UPDA 4A15A 4ONEA 1RM5A 3B6MA 2JHFA 5CA1F 2HWUA 2J31A 3O8DA 1M34B 1V45E 4R01A 3QLUC 2PS1A 1UBOS 1TZBA 4QSMA 2N75A 3KK0A 1ML3A 5EVCA 3VAAA 3NP9A 4DUPA 1OPXA 5JZBA 4OXNA 1NQVA 4NE7A 5TARA 1M7HA 2QJOA 2WOJA 3SYLA 3ENWA 3FYTA 3KKMA 5C7YA 5CFQA 4A0GA 4H0NA 3A14A 2IUEA 4DCVA 3BHIA 3D4PA 4HQFA 4XGQA 2BJHA 1Q5PA 4CEHB 4WCVA 5A3SA 4EJSC 4F6LA 3G8CA 3UPUA 4QGSA 3AEKB 3HY3A 2WUEA 1KORA 1WXDA 1ODTC 2H00A 2K2WA 4KVFA 2PGLA 4LYAA 5CT9A 4A82A 1H4SA 3ESBA 1DAKA 1UT5A 3P0JA 4D9HA 1ZVKA 2AYYA 2PV7A 2H1HA 2QUHA 3BERA 3KHSA 5DX0A 3V4VB 1HGXA 4MTLA 1U3GA 1QCDA 3G0OA 3J80A 3JRXA 4EP1A 4TPKA 1MF7A 1YSCA 3DWEX 1P7YA 3LC7O 3OZGA 3CQ9A 2JFVA 2HA2A 4LHYA 4QDOA 4R3UC 4BFLA 5KSOA 1ECFA 1UFOA 4IKEA 1NBMD 3N0XA 1Z6PA 4GMDA 4LE0A 2EZUA 3I4FA 1UQRA 2H4JA 3OZSA 4KQHA 4HC4A 4QXPA 2WMNB 3GGGA 2ZJOA 3LL4A 3G2KA 2G1PA 1P2FA 1B43A 4OLAA 2D5LA 3PUJA 4ZI5A 3STUA 3X43A 2CMFA 2Z6QA 4MGIR 3RS7A 4OGWA 2CLLB 4BHTA 4XIJA 4JOQA 3IJEB 1UXOA 2QJWA 4DLPA 3OESA 3MFQA 5FNVA 1EFUA 5CAEB 2BYTA 2IBTA 1DWOA 1QP8A 4AU1A 4EW1A 1SOUA 4LOLA 3L0OA 4IZIA 2H9IA 3IEXA 5CFRA 1YCDA 3B7GA 1YQ9A 4LS3A 4R1NA 4DB2A 4XDYA 4NICA 3WSWA 1Z45A 1GNTA 1SWWA 1Z4KA 4NC9A 2I03A 4UPVA 1RCFA 2IYUA 1X3LA 1H0HA 1Z28A 5E6RB 1NASA 2PY6A 4UM8B 3LZCA 3ZNNA 1MV8A 2VYCA 1L3BA 5AI6A 1Y3BE 2MT9A 3SQDA 3EXG1 1OVGA 4MVJE 3FLBA 1DEAA 2A8YA 1U9ZA 4TMVA 1Z5NA 2QHXA 2HIGA 4MA0A 1PFQA 4IHJF 4WKOA 3VPHA 1G3IA 3H83A 4QE3A 3EDCA 4K40A 5F2KA 3P9NA 4M0MA 4AC9A 5CCEA 1YBMA 5JJKA 4GXTA 1IZZA 1E5VA 3WLPA 3MXTA 5ELXA 2CHGA 1SVNA 3PGLA 3Q5DA 4PVDA 4RF2A 3TZ6A 4CWAA 4EG1A 3SC3A 4LMBA 4KUHA 5A2QA 2VQEB 2RHTA 1GRCA 3S40A 4JZKA 2FG6C 2AOUB 1CS0B 4RD0A 2ZXEA 4FI3C 1RR6A 2IY8A 1IZ9A 2NAFA 4QLOA 3SJAA 1JIVA 4OQYA 2J3MA 3M6AA 1XWWA 4II2A 1ZI8A 4OEHA 5HTKA 1DKOA 1P9WA 2ZYHA 3SU8A 2P2YA 1SZJG 5JH7F 4QAJA 2YVAA 4G6ZA 3PJFA 4QUJA 4GI5A 1U8TA 3GQBA 5DSTA 4YMGA 4CQMA 5BYAA 4EG8A 5BN3B 3WGLA 4TLEA 4S1TA 2AKEA 4LFBB 4RLHA 4E07A 3L79A 1D5CA 3HBNA 3DBVO 3FNRA 3RLIA 1GG5A 4QODA 3W8NA 1GUAA 1P31A 1TO2E 2Q9AA 1GP2A 5SICE 5IAJA 3SJBA 3U3ZA 3DAOA 3QPUA 2CXSA 1CJMA 2XE4A 3G2OA 3OQPA 4OQMA 2VOEA 1JHOA 3EXFB 1VYHA 1ORTA 2ZSHA 1VKZA 2RBEA 3G6KA 3SYKA 1P2BA 1RHMA 3WYFA 3OICA 5EWJB 1Z34A 4YO7A 5A7GA 2GD2A 3CLTC 3CSSA 1Z26A 1O9BA 2IE8A 5CA0A 1ZRHA 3D8SA 1PWEA 5JS2A 2H5LA 3DLTA 3HPQA 1JV2B 2WV7A 2TMKA 4WZ6A 2JIZD 4IV8A 1RMTA 3AWDA 3UMFA 4DZZA 3ANSA 4ON9A 2ECQA 1P3DA 2FJPA 4MRSA 1SQ5A 2VPYA 2WT8A 4B6JA 3O8QA 1DDGA 4MV9A 4PSDA 5IASA 4LKRA 2C3MA 3AVVA 4B84A 3V3KA 1NONA 2Z1MA 5GWXA 4ZV4A 5IDYA 5CBKA 1XEFA 2J1LA 3UCEA 2Y4OA 4R1QA 1ZUHA 3DMDA 3SC4A 5J4YA 1Z7YA 5DIZA 3H9EO 3NJ4A 4TWZA 2WJ3A 1NN0A 4U5QA 5FDFA 5IT5A 2ZRLA 3CONA 4PSUA 1XYVA 4J0HA 4NDZA 4AECA 4Y0NA 3VZCA 3W77A 4D9MA 2HMYB 1ZCBA 1YQUA 2CSUA 5E38A 4QRDA 1OJLA 2BM0A 4LJ7A 5I7WA 3EEOA 3LQKA 3I9JA 2QLMA 2YBEA 3KQMA 3PE4A 2XUFA 4UQLA 1HDYA 2JAWA 1E1DA 5CYFA 3KU1A 3KPJA 4R1PA 5GAJA 1L7PA 4MROA 3OOHA 2PMKA 4LXUA 3WGHA 1CP3A 4R2MA 3SIWA 4ZVMA 1B14A 1QZTA 4Q93A 2YVKA 1TCCA 2G0AA 1BXKA 2UV8A 4E4YA 2A0YA 1QP4A 4H1VA 3WB0A 5DLYA 3CKKA 3TBKA 3EFOA 1S02A 1GQ2A 1DEKA 3KKNA 4FGJA 4YP6A 3T99A 3T94A 4E21A 1KRWA 1ZFNA 4CFSA 3C97A 5KJEA 3AB3A 1R