3NHZA

Structure of n-terminal domain of mtra
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two component system transcriptional regulator mtrA
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 40
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhzA00
2E4VA 4LE1A 3HXMA 1DBWA 4MRMA 4TN5A 3KLOA 3C3KA 4RK1A 4KMRA 3RVNA 3C6QA 1NY5A 2L18A 2LIVA 5B3JA 5IULC 1M5TA 3NNSA 1RZRD 2A9QA 1ZVVA 1NXPA 1K66A 1Z16A 2AYZA 2IPNA 3KYIB 3BILA 3EGCA 4YS6A 3TO5A 2FEPA 2GBPA 3Q41A 3UKJA 1F51E 3HM9A 4IMJB 1RNLA 5DCLA 4EYOA 3EJWA 4MGEA 4PICA 5EWMA 4RDCA 2PUDA 1EWKA 3TMYA 1JLKA 1NXVA 3IP7A 3HUUA 5TPZD 1FFWA 4RS3A 4ZMRA 5FWXA 1VKRA 2L17A 1GCGA 2A9RA 3ILYA 2FQYA 5KC9A 5BRAA 4D74A 3EAFA 2MSWA 4G0OA 3VNAA 5KWSA 3GL9A 3N0RA 1DCKA 1KRXA 1CEYA 1QO0A 4ZMSA 3HO1A 2ZWMA 2FLWA 6ABPA 1PNRA 5D2CA 2ID9A 3O75A 1GCAA 3GV0A 5GOTA 2PE5A 4WXMA 1BAPA 3DGEC 3M6MD 1ZGGA 2CHFA 1MAVA 2FQWA 3F6CA 3GA5A 5F64A 1P8AA 3UUGA 1DRKA 2L2QA 1S8NA 3KKEA 3RVOA 3DLBA 3H1GA 1TMYA 2X7XA 3D8UA 4ETIA 3H6HA 4UHJA 4LRQA 1M5UA 2I6FA 3KTOA 2JVJA 5HM6A 1JL3A 3N53A 3H5OA 2E4YA 4ETMA 4QYWA 1KMIY 5TQ0A 1USGA 4KPYA 2GWRA 2FN8A 3OQOA 5EWJA 2CD7A 1ISSA 4EUKA 3F6PA 3QX9A 5IUNC 4PYRA 3NNNA 4MS4B 2PLNA 4MR7B 1AB6A 4MPTA 4XLTA 4NQRA 4N03A 2JB9A 2R48A 3EODA 3G1WA 4RXUA 3LKVA 4JOQA 1SXGA 1DG9A 5CNJA 4E7PA 1JHZA 4MAAA 5HSGA 5JNSA 3KYJB 3QLUA 3G85A 1NXTA 2IPLA 1OXBB 1ZH4A 4PE5B 1APBA 4H3KB 3T8YA 3OQNA 1BDIA 2J48A 2A9PA 2WMYA 3KCNA 4WT7A 3RVQA 3NBMA 4CBVA 2PUGA 4NCAA 1USKA 4MR8B 1Z18A 3IPCA 1QKKA 1ZY2A 2PL1A 1USIA 4MQEB 2JBAA 3OLWA 1BVHA 3SQNA 1I3CA 2VK2A 2QV0A 4ML3A 4YGXB 4MQFA 4N0PA 2VUHB 4PEVA 3TX6A 5C5EA 1FFSA 1YK0A 1MIHA 4W5NA 1C4WA 5TPWA 1M2FA 3NHZA 1ZITA 3SNKA 2WB4A 3C97A 2OENG 4KQCA 1DC7A 1Z13A 2H3HA 2PL9A 2IPAB 4JB0A 1DCFA 1W25A 4WUTA 4FE7A 3T95A 2PMCA 1R8JA 4H3HB 3RVMA 3FGZA 2B4AA 3LUGA 4IF4A 4RWEA 4MRMB 4D6XA 4Y9TA 2OQRA 3LTEA 3QX8A 2PAFA 2PUCA 1JX6A 3KLNA 1SXIA 5FWYA 2FXIA 2FKAA 3SAJA 4Z4GA 1JDPA 2ZAYA 4EY3A 4M88A 3GWGA 2LP4Y 3RVKA 3UK0A 5JNUA 1KRWA 4MS3B 2Q5CA 3TB6A 1OXKB 1Z12A 5JNWA 1DRJA 3H5VA 1YTUA 2FEKA 2QZJA 1TM2A 2WWVD 1EWTA 1Z2DA 1U0SY 2A9OA 5CNKA 4H60A 4S05A 5EWMB 4N0QA 4RSMA 4YO7A 2FMKA 2V0NA 4RY8A 2YHBA 3LUCA 5FWXB 2E4ZA 1Z17A 3BRSA 3Q7TA 3NNDA 5DKFA 5KQMA 4LX8A 3VNBA 5BRJA 1Z25A 3JVDA 3N0XA 5IX8A 1DBQA 3MF4A 4EYKA 1SXHA 2NT4A 4ZPJA 2H0AA 1SRRA 2FLKA 4EVQA 3LUDA 5ED4A 5JNRA 2FEWB 4MS3A 4E7OA 1MB3A 2FN9A 3O2SB 2LBPA 1YVUA 3K4HA 5HKOA 1TJYA 4Z99A 2NT3A 2RDMA 3GYBA 1UDRA 4G0YA 2PUEA 3HEBA 3RVSA 2BGGA 4KQ9A 5TQ0B 4NV3A 5IEJA 5CHYA 4XXHA 1D2AA 4IRXA 5EWJB 4W5OA 4G0QA 4OG2A 1QO0D 4JASB 4NCBA 1RXEA 3JVIA 1FSPA 3OMXA 1RZRA 3RVJA 2GI4A 3BREA 4LDAA 3EQ2A 4RXMA 4WWHA 5DGCA 4IMIB 1JFTA 3LUAA 4WZZA 3JTEA 3QEMA 4Z0NA 3O2QB 5JS1A 3IP9A 4O1HA 2PUBA 1A0OA 4DQDA 5IUJC 3LUJA 5HQJA 1IIBA 5TE9A 4XARA 3KSMA 2JBAB 3IP5A 4FB4A 1VPWA 1GUDA 2FVYA 4KRFA 1PUXA 4MQFB 4G0MA 5TPZA 3A0UA 1WETA 5CNMA 1FQWA 4G97A 2AYXA 4FE4A 5IUKC 5TPWB 2LPMA 2XDYA 2JVIA 3MYYA 1VRVA 1LBIA 4W5TA 3H75A 3H5WA 4XASA 1YS6A 3F7NA 3OM1A 3GRCA 1NXWA 1NXSA 2HQOA 3LUHA 4MLCA 4RY0A 4S04A 4HYEA 3CLKA 3Q7SA 3QK7A 3QLVC 4LZLA 3QELA 4GNRA 3FMVA 4KFCA 4DN6A 1YMVA 3O1JC 2E4UA 3I45A 5FWYB 3HZHA 3N6VA 1NXOA 4JAVC 3IP6A 2CWDA 3MQ4A 1PEYA 4RY9A 3EULA 2E4WA 2DRIA 3HDGA 1GLGA 3C3MA 1LJLA 2O20A 3T6KA 1CYEA 1CHNA 1A04A 2N9UA 1EWVA 1TVMA 3KS9A 4KV7A 2RJNA 2JCGA 5FBKA 2IYNA 2FMIA 2IDMA 1LK0A 2WY2D 1DZ3A 3RQIA 2R47A 1P2FA 1JBEA 2QU7A 2QVCA 2NUBA 3H5IA 1DJMA 4EYQA 1F4VA 2R25B 3MA0A 4RKRA 3OLYA 4YRZA 1QP7A 3OQMA 3F73A 3M9WA 2KYRA 4N47A 3CS3A 1BDHA 1TLFA 3DGFC 3H6GA 3OO1A 3Q7RA 2HQRA 4RK4A 3CFYA 4XFKA 2JK1A 4JB2A 1ZAYA 4W5RA 2RGYA 1DC8A 1E6MA 5JNTA 1ZH2A 2VYCA 5KC8A 2NZUG 1JYEA 1H9CA 1DP4A 1MB0A 1JF8A 2GKGA 5TQ2A 2QVGA 3N75A 2FTKE 3GBPA 1RXIA 4ZJPA 3CRNA 4HNSA 2MYUA 1Z2EA 3O2JA 4L4UA 1BA2A 3N8IA 3P9YA 4MR9A 4G0PA 4O1IA 3RVPA 1YS7A 1FFGA 1NXXA 1T34A 3CZ5A 3OMWA 1JH9A 2NZVG 4N76A 1XHFA 4OLBA 1QNLA 2MSLA 2QSJA 3CHYA 5KQGA 3JY6A 2RJOA 1C0EA 3M9XA 4IGAA 3GBVA 4Z4IA 2ID7A 3CTPA 1D1PA 3FDFA 3FFXA 1QP0A 4MS1B 4UHKA 2VUIB 4LE2A 3CG0A 4MYRA 5I4CA 1ZHHA 1U2QA 4D6YA 3JS5A 2HJ9A 2HPHA 2JVKA 2IOYA 4KREA 1NTRA 1QMPA 3Q9SA 3QEMB 5KI6A 3HK2A 1YMUA 1EFAA 1PEAA 2WJAA 3SG0A 2FSPA 5KQLA 3CNBA 3KHTA 4PZ0A 1DCMA 5B3JC 3OLXA 1L5YA 5T3YA 3I09A 3T38A 3URMA 4P98A 2B1JA 3DLHA 1XWWA 4KNYA 4TMYA 3OO0A 3JPYA 3R0JA 2QR3A 5ABPA 2PJUA 3L6UA 3SY8A 2PKXA 3ILHA 1QP4A 3H5TA 5JNVA 3BBLA 4Z4FA 4TLLB 5DTEA 1J56A 3LUFA 4LDZA 1GUBA 2MYPA 4N41A 1LJUA 4MS1A 3NHMA 3I5AA 4Z9AA 2IPMA 5BR1A 2F8SA 4OBBA 1URPA 4F3TA 1D5WA 1E6KA 3QELB 3RVRA 1W9HA 2M1ZA 1RPJA 4F12A 2L19A 9ABPA 2JRLA 5EWLA 3OLVA 3CG4A 3ROFA 2QXYA 1SD5A 3RH0A 3MMNA 3LUKA 3CU5A 3A10A 5IEBA 1QQAA 1ZN2A 3DBIA 4Z4CA 4GPAA 3LFTA 4RXTA 1ZESA 4RV5A 4RK0A 3H1FA 8ABPA 4LE0A 3A3KA 3O1IC 4YP9A 5IBQA 2MYNA 4KZKA 4L85A 4Z9BA 1QQBA 4TLMB 3W9SA 3D02A 6CHYA 3HDVA 1MVOA 4KK3A 5BQ3A 1ISRA 1YIOA 2F8TA 1ABFA 2HSGA 2QW1A 1A2OA 1PNTA 3FFWA 3MM4A 2FMFA 4RK7A 1BDJA 1U8TA 5CNIA 2FQXA 4Q7EA 4EVSA 5C5CA 1E6LA 4Q6WA 4RKQA 3O1HB 2WRZA 2P4UA 4DADA 4RK5A 1QPZA 4OLAA 4RK6A 4O5AA 4G0ZA 3I42A 4G0XA 5E3JA 3QLUC 4OATA 4ETNA 3K9CA 3LMKA 2PUFA 3QLVA 3HS3A 4OTZA 5TQ2B 3KJXA 5KQPA 2CHEA 2GX6A 1JDNA 3L49A 1KGSA 4HNQA 1VLZA 4MR9B 2YHAA 1U04A 2IKSA 2M98A 2WJWA 3ROTA 1Y1LA 3S99A 2FMHA 2R4QA 3O74A 4XAQA 4RU1A 4YLEA 1E2BA 5TQJA 3LKBA 4MLDA 5FBHA 3QEKA 2P9HA 4F11A 1EAYA 4EYGA 4YR7A 4QPJC 4Z4EA 1YK1A 3OM0A 1ABEA 1L5ZA 3IPAA 3H5LA 1Z15A 3FFTA 1HEYA 3RVLA 1D1QA 1JFVA 5T7BA 3TD9A 4YV7A 3B2NA 3IDOA 3HV2A 4JP1A 3GT7A 3JPWA 4F06A 2E4XA 1P6QA 4KK4A 4JA2A 1M2EA 4HNRA 4RZSA 1ZDMA 4EVRA 4YCSA 4MS4A 2FW0A 4MR7A 2LUOA 4Q6BA 4NICA 3HSYA 4G86A 5PNTA 4P1ZA 1D4ZA 3QLTA 4F8JA 1K68A 4ZYLA 3SM9A 3CZCA 3E3MA 4IILA 1ZGZA 1LBHA 2MYTA 4KVFA 3E61A 2PUAA 1AB5A 4B09A 3EDCA 5GQSA 3Q15C 1JFSA 3N0WA 4MR8A 2W42A 1JYFA 5IC5A 1EHCA 3H1EA 4MQEA 3OLZA 3DZDA 1PHRA 3C3WA 4QICA 4Z4HA 3HVRA 3EQZA 3CKMA 2TMYA 4YWHA 1NATA 4EGSA 3KG2A 5JS2A 1XHEA 3HCWA 3A0RB 1P6UA 1JWLA 1DBPA 3LOPA 3BRQA 7ABPA 3HJFA 5EWLB 2MSKA 3MIZA 5DLEA 1Z26A 2HQBA 4WXEA 1B00A 3O21A 4QYMA 3HUTA 4W5QA 1U2PA
chains in the Genus database with same CATH superfamily
1U1FA 4LE1A 3IBGA 5B2EA 3V1KA 1DBWA 1T5IA 3G5MA 4MRMA 4JLKA 4N8EA 3PKZA 2P75A 3I4LA 1AZSC 3O4HA 4ZEWA 1Y4ZA 1J9EA 3I6IA 4YP6A 3ANLA 4Q12A 4M1ZA 1G19A 3NONA 1UPXA 1Z06A 4EDFA 4G5XA 3QPAA 1RQ7A 5DNUA 2QTNA 2DFTA 3RFTA 1NUTA 1UJCA 2FJ0A 1TQ6A 2Z5LA 3PXEA 4Q34A 3RRJA 4CT0A 5BN1A 4Q9LA 2ZXUA 4D02A 2YN2A 4AIRA 4HDAA 5DGTA 4MV3A 4AJ2A 4FN4A 1K75A 3RK1A 1SZJG 4REQA 5BNWA 2JJ2D 5J4KA 2AI2A 1C41A 2PU7A 3AHDA 2Z0MA 4EA7A 1ZOSA 4BATA 4ZMRA 1MBZA 1FLDA 1NYLA 2XB4A 4MEAA 3OJOA 5ALZA 1JT2A 2E87A 3I6QA 3I04M 1MEEA 1ZD3A 4J9UE 5KO2A 4RCVA 2BFCA 1T9DA 3BGVA 3TK1A 3JQ9A 4AO6A 2OZVA 4Q9NA 3RGGA 5BT8A 3MGAA 2OV6A 1X2EA 3S2EA 1X70A 2I4TA 2XYPA 3H7AA 2CD9A 3I2KA 3NBYC 1OI4A 1P1CA 4WADA 4WESA 4YR9A 1PDOA 4NNOA 5IJ9B 1KAMA 1WIWA 1YH3A 3W77A 1D4FA 4AQ7A 3CZAA 5F9MA 1J39A 4P8RA 4QUAA 2GN0A 2ZIFA 3OIDA 1C7JA 1J7KA 4XUGB 4MKZA 2CSUA 2FZLA 1RYHA 2Y71A 2ZK7A 4PYNA 3JQ7A 5ECDA 4E5DA 3EG9B 4UAVA 4UHEA 4LKOA 4NOMA 1MABA 3I2IA 4XDYA 2IV7A 4B87A 5JS8A 5LFAA 2F2TA 2WDZA 4OJNA 3PC6A 4LECA 4WIAA 3U4GA 3OCJA 4P3XA 4TSFD 2HOQA 2FN8A 1U3DA 3QVLA 3DR3A 3H2BA 2G63A 3KR1A 5REQB 2PZFA 2EF1A 1FMLA 1KMMA 3THWB 2V7GA 1T4GA 1EJ6A 1EP3B 4UW9A 1TK3A 2ORIA 3F6SA 4CTOA 3NDRA 3T5PA 2PBFA 1H93A 3KWJA 3DXYA 4HK4A 4BKOA 5H4HA 1WXDA 1ECJA 2ZS8A 4KQFA 1ML4A 4R2JA 4XM1A 1IOWA 2BKUA 1DG9A 1G8GA 2VZ8A 4TUYF 3WRYC 1OKKD 4Y1FA 5CLGA 2YRWA 3KUUA 5HDQA 2HLPA 2JJ1D 1NXTA 3AR6A 3HB1A 4JXZA 4GL4A 5IVDA 3HKDA 4K87A 3P5SA 2GTIA 2QTFA 1WA5A 4JYPA 3ZI7A 3TF5A 2LCIA 2WMYA 4XW2A 1V1MB 3I6BA 4IIUA 3ZWNA 1ZK4A 1K7SN 5BQPA 4MQEB 4OA5A 4UVGA 1GAEO 3K70B 3TGLA 1I5OA 1FNMA 1T3LA 2NXNA 1Y81A 2XB6A 1DVRA 1OCEA 3FPKA 2M9MA 3GG2A 3LC0A 4PEVA 4FDAA 5AT1A 2OKGA 1YK0A 2XB8A 4EYEA 3E7DA 3GDOA 4N3AA 4BVHA 5IN4A 2ZB4A 4AROA 3OJXA 4G26A 1DC7A 1Y37A 3CR3C 3EXAA 3GRYA 1TCVA 4O8CA 2BSXA 3WYAA 4C20A 4DTCA 4BP9A 4DCNA 5AVTA 2EKLA 2HJRA 3KYCA 5BVGB 3FIJA 5HZMA 2JHGA 1W2GA 5F78A 3THYA 4C0SA 1QYRA 3Q87B 5DWDA 2PNFA 1NG9A 3I1JA 4ERNA 5AM2A 1DQZA 10MHA 1SU7A 2RBEA 2PAFA 3GLTA 1KIAA 1SC4A 1NY6A 3IXQA 4NZMA 5CB0A 2ZDHA 4TXLA 3TW0A 4NL4H 4WE3A 2J7PA 1HORA 4RFSB 3IIEA 2LP4Y 2ZYIA 2O50A 4CQLA 1EX7A 3JW8A 3I8XA 2C82A 3DZBA 5JXWA 4TTRA 4Q4HA 2VJQA 3QU7A 3DVRX 3ORSA 2GO1A 2XKJE 3G02A 2O6LA 3HL4A 1EM6A 1RWQA 3OT1A 2ZQYA 2W48A 2VA8A 4LYAA 1I4DD 3EC1A 3LYLA 2C03A 1Z0ZA 2AEEA 3PHJA 3ZY4A 4JHXA 5JT1A 1A8SA 1IEWA 2JHAA 2F62A 2HR1A 3T5AA 1Y4AE 2Q7OE 3AFOA 3QY0A 1I8TA 4CW7A 2Z2ZA 3MWJA 1QVAA 2OCKA 3UJPA 2VI5A 3IAM6 5KQMA 4XVHA 1K6EA 2RI1A 1GEEA 5IBRA 3AU9A 1L7OA 3BJMA 5MGBA 4AWBA 2OCGA 1KF0A 3B1YA 1IDN1 3C3JA 1XPOA 3FROA 3HJRA 4PRLA 1ZOPA 2GASA 2VSNA 1SIBE 5KYUB 3TUIC 1W29A 2E82A 3IIMA 3ZE0B 2IS6A 4K9SA 2H16A 4EG7A 1YOVB 1UT6A 4URWR 2LRHA 5L6LB 1P9LA 5IXYA 3G9UA 1G63A 2J6IA 3MWGA 4DIDA 2VYFA 1CYDA 3GPIA 2AC2A 1B8UA 1DEXA 2V5AA 2XX3A 3FXAA 2HCRA 2OB1A 3JQ8A 4PCUA 2G36A 5CCBA 1KOFA 4XUCA 1T3GA 5DWVA 2R8XA 3WJ2A 4QL3A 2P79A 5T4EA 4UEJA 1EXVA 1G3UA 3PGXA 4H7HA 4F7DA 2NG1A 1TVCA 1P19A 3JQAA 3CV3A 3MINB 4JR0A 4EY8A 3FM9A 1UFVA 2Q9BA 3ZE9A 1ORRA 4YCDA 1EB8A 1I6LA 4G0QA 4M1EA 3U3KA 4D8UA 5C5IA 4MO2A 4DNQA 3JVIA 1NYTA 2PX3A 1VECA 2YJGA 5DBEX 5J5VA 5AVUA 1QHYA 1W48A 1ZM2A 2GI4A 3BREA 4TQUS 4XOIA 5B1HA 5JR3A 2GJ4A 4X94A 3FHJA 2VC2B 2O06A 3PFNA 3CPJB 1NW7A 1UC4B 1XCGB 2JIZD 1AGRA 2QN2A 3PQDA 3E5HA 5JJLA 4QEDA 3PFIA 4QNNA 5DOZA 3AHFA 5JTUA 5BUQA 3AERB 5CR9A 2G1PA 1XZIA 1SPBS 3HSSA 3RVDA 5CT4A 3VGPA 3BQ9A 5CFRA 1SEPA 3O8OA 1RRFA 1BMTA 3IP5A 2I3AA 3L84A 1L7AA 2OK7A 1PT8A 3DWEX 1WETA 5LZ7A 2RGWA 2WJJA 2ZZMA 2X2EA 5CNMA 5DI3A 1JBQA 2FGKA 2GZDA 1VL1A 2IYLD 2FB9A 4MCHA 2Z3VA 3QG1A 2O2JA 4L5CA 2W70A 2R00A 2XQGA 2JIDA 3W5DA 1NE7A 2I76A 3H5WA 1XTVA 1R8QA 4UVIA 1PFKA 4QOGA 4IMPA 3ZUPA 2O3UA 1M10A 3KE9A 4JT9A 1Q44A 4PGGA 2HRBA 2DQZA 3I28A 3QE3A 4OKIA 3CLKA 1E69A 2X1VA 3L8DA 5MFZA 2NZXA 2Z9BA 1ZW6A 2H1VA 4LPSA 2ET6A 2H1LA 4X84A 5C8DA 3F7OA 2BFDA 1MTOA 3JD4A 1QBGA 5KYYB 2O59A 2IL1A 4F92B 3AESB 4O4HF 4RZHA 4MCJA 5K51A 1NXOA 1TW3A 4MWSA 3RRMA 2ETXA 5DEIA 1OLOA 2WOOA 3I52A 3OD1A 1K8XB 2RHRA 2UKDA 4JJAA 4O4JB 3RCBA 3WRYA 4MYTA 1NQTA 4JUBA 1W75A 3Q6IA 3KS9A 3I05A 2QG9A 1LPOA 4FYWA 5FBKA 3JR3A 2WVAA 4MSUA 2J3DA 2WWVD 1J21A 2WM9B 4L8VA 1JDZA 1AT1A 5ALYA 3OWXA 4UU0A 2W37A 4QXQA 3DOFA 1BGXT 1V9CA 2HIMA 2PMWB 2QL9A 2WOJA 1C1XB 3WBJA 3UUWA 4HYTA 3SOPA 3SZ3A 3OLYA 2OHOA 3P0JA 1FTYA 3DNFA 5IFLA 2QV7A 4HH0A 4UUOA 4CFSA 1BDHA 2VDJA 5LOVF 1YJXA 3D8BA 2J3LA 3TZQA 3IO3A 2W2KA 5A4AA 3UPTA 3CLSC 3WK6A 4JJGA 2JASA 4R9VA 1EB9A 1U80A 2C00A 4RPKA 2VK4A 3FAKA 3O47A 4OPMA 1JEJA 1ZH2A 2Z3ZA 3NGLA 4N82A 3SK0A 1TJNA 1KVTA 4RKYA 1MB0A 1WCXA 1Y1PA 1U8EA 3L0OA 5DBOA 3NUQA 4JI5B 3GBPA 2BONA 4ALNA 3UNXA 4HGPA 1QX4A 4HWSA 5IMBA 2PS3A 3UJHA 1U9IC 2QJRA 3LU1A 4CMEC 4DT1B 4YAGA 3ZV7A 2YTZA 3RSLA 3TOSA 5L3VA 4HD8A 1G0OA 2XW6A 4MOWA 3IVXA 2RJOA 2X1HA 5LQMA 3LL4A 5KHAA 3ZTWA 2QG4A 4Y9DA 1NJ1A 5FORA 2YDXA 3AEQB 3ZD9A 5AUQA 4FBMA 1X1AA 4B7UA 3KZ1E 1EEHA 1U2QA 2ZETA 5HMLA 1PZNA 2PSSA 3QP9A 1X39A 3PDIB 1KU0A 1X1SA 3M4ZA 2PRJA 2FW7A 1L4UA 5C1BA 2EQBA 1W4CA 3NIFB 5KQLA 2F64A 5B3JC 1DCMA 1ORHA 5AHRA 4EKEA 2YWBA 3IBSA 2HJGA 4AL4A 2P4SA 1C4OA 4DIKA 1YB1A 4EQZA 4F7WA 1XCBA 4E6EA 4NK5A 1N0HA 3UBTA 4G0VA 3R5FA 3R0JA 3DT9A 5CG1A 2YW2A 1ES9A 3TBHA 4TYYA 4KHPB 4BEWA 4PYQA 3ILHA 4EPRA 2DMRA 4L7VA 16PKA 1YZTA 3REGA 3AFNA 4TT8A 4U2FA 5ALOA 5J43A 3GU3A 5HCIA 1CY2A 1GUBA 3A2NA 1A9OA 2HA7A 4ZYUA 5JJKA 2ALJA 4DS3A 2G77B 1PS9A 1KVUA 2C3UA 2QAGC 2R8ZA 4D0GA 1Y63A 2JLWA 4PXYA 5EXPA 2AEMA 4MRSA 4OUKX 5BNTA 3ROZA 3OCYA 2V3VA 3F78A 3ZCXA 1Z29A 5I9IA 4NESA 1JSZA 5F51A 1GTZA 3FOAA 3CLVA 3PX3A 3QI7A 3EIHA 4UD2A 4M9SA 1CEXA 1RM4A 4YBRA 3IAUA 4OY3A 1YBMA 4BL5A 1YB5A 1PYDA 2IEZA 3QM1A 1E99A 3ONFA 3T4UA 1PX2A 1SXJB 3L8EA 1ODTC 4PLPA 4ZQHA 3VPXA 4DMKA 4CM4A 5F3DA 5TNXA 1D07A 2NTEA 1HYHA 2V7TA 2XWJI 1Y8ZA 4RY2A 2NACA 3UJNA 4K0RA 4N9QA 2ERYA 1ND5A 3R0ZA 1L4KA 1XN4A 3BSYA 3BHJA 3DEZA 3WGMA 4F38A 3O1IC 2BEWA 2W71A 2I4IA 4CM8B 1BHQ1 3QWBA 2GGSA 1N1MA 2C1EA 2Q0HA 2RHHA 3FHOA 3DMYA 4XPIA 3ZHVA 4YONB 1OH8A 2QRGA 5BSKA 3FCOA 1EIWA 1QFXA 2Q99A 1WBJB 2ZI3A 1QE0A 4JC4A 4LYYA 1F5SA 4MRNA 1UP6A 3CT6A 3H4MA 4ITUA 3IGFA 3MM4A 4LMPA 3RVBA 8OHMA 5CK4A 1SU6A 1JILA 3ZIAD 1H2XA 1NAHA 2DUMA 4NDAA 3W34A 4Q4CA 4A8JA 4URYR 4BNKA 3O1HB 3LWZA 4L8YA 2P2ZA 3I2YX 3VAZA 2DFNA 3QYPA 2CCGA 3CE6A 3AGPA 1C14A 4RSGA 4WLOA 5E3JA 3IAEA 3JQ6A 1TT7A 1WXEA 3L07A 4OATA 3USZA 2P5SA 3LMKA 4Q1EA 4KLCA 5JARA 4BX8A 2HTEA 2PJRA 3I62A 1ZNQO 3GJSA 2VP2A 4NJMA 4MVXA 3ZTYA 1EQUA 1J5XA 2XKAA 4NONA 1JFLA 1WUIS 2V7VA 1RC1A 3HABA 3WL5A 1CNMA 1Y7PA 2OCDA 3QENA 3WLNA 4FUTA 2CLOB 2D54A 2PTHA 2EERA 2X3YA 3BJZA 3GVCA 2QVZX 4UBIA 3S3TA 4CU2A 5HK9A 2R4QA 2VNKA 2OMEA 1P5FA 3E3NA 5AVYA 4AY6A 1DKQA 5TGZA 2WNSA 1DX4A 2O14A 3WIEA 5ENZA 4TUYA 2ZIWB 3REQB 4TMFA 5KTRA 2G76A 4HQFA 1JHPA 3IHKA 4IVRA 2WHPA 5G40A 1N6PA 1GFSA 3IPAA 4PO8A 1ZZGA 3UKOA 1NLYA 3H4VA 1NLFA 1QQTA 4KW7A 2O8CB 2DPYA 5A6VA 1WULS 1WXHA 3I73A 4H0NA 4WA8A 5F2EA 1F2TA 1ZBDA 2DT8A 2G25A 3D6UA 3G1TA 3QF4B 4S1PA 3GT7A 5C8YA 3I04A 4J07A 4UFOA 3FKQA 5AKGA 2LDBA 1DUIA 4YMIA 5DHAA 1NI4B 1Z9BA 3NUZA 3RT9A 5A4FS 2PFGA 2YYYA 3RM3A 3KHSA 3RRZA 2FU5C 2ZQZA 4HDSB 3HSYA 1DXHA 4YUAA 4IZHA 4XOUA 3NCTA 3BE6A 3N87A 4CYMA 4I6EA 4X20A 4BVEA 4HDNA 1E20A 1IY2A 1ID1A 5AOAA 1ZGZA 4JUCA 3RRBA 3VO1A 3W5IA 2I3GA 3ZKAA 3S2SA 4W9RA 1LUAA 4C4PA 3OZAA 5CJPA 2BM1A 2J9RA 3P2MA 1MA3A 3FF4A 1U9IA 4CMEA 1I7NA 2C4VA 3ESDA 2NTNA 2Z9CA 3Q7PA 3QKTA 4MWOA 1PFWA 1DWUA 5AJZA 1YR7A 2O3RA 3DO6A 3FR8A 3KK0A 1NIPA 1CV2A 4QUHA 5JS2A 3WYNA 2FPMA 3CB4A 4EB3A 3IELA 3OCZA 2YZ2A 3PUJA 1XLVA 2P0EA 1TX4B 1D1SA 1YONA 4MX8A 5FL3A 2HQBA 4K8RB 3R7WB 4IFBA 1Y6GA 5KOJA 3UAYA 4BMZA 3ZGLA 1Y1TA 3N05A 5EXDA 5FXMA 1F3LA 3TRFA 1GQ2A 3TZEA 3UT6A 2B3DA 7YASA 1IMJA 3LX5A 4JMLA 3HXMA 2DSTA 4G56A 2NGRA 2Q1UA 4MUXA 1HDGO 2FEOA 4GQIA 2Y6VA 3ZHYA 1KI6B 3GXBA 3RHTA 1AV6A 4N3NA 3GR6A 5B3JA 1YWGO 3S2IA 1R0RE 1FQKA 5LQNA 3M2TA 2CLHB 4J3FA 2A9QA 2PM8A 4K9LA 4QXOA 2DH6A 5IHPA 1MOPA 4UBNA 1M6WA 2ZBRA 2GSWA 4I4TA 1EEXB 2Z6UA 3AM3A 3Q41A 2OXFA 4JITA 4L16A 1SVLA 2F1JA 2GLTA 2OECA 1MH9A 2HMWA 2VF7A 3CVOA 1OBCA 4A7PA 3U4MA 4RHUA 1H4VB 2GT1A 4GVXA 3HZRA 4ADSG 2J3QA 1H42A 4RSRA 4MGEA 3WYFA 1NVKA 5EHZA 1X8KA 1C1YA 3G2IA 2QAGA 3D8HA 4BLPA 1Z62A 2O0JA 4MINA 3AHEA 2IV2X 3RAJA 2A9RA 1GD1O 3GXOA 1VKZA 4GMHA 1C3OA 3FSJX 3HBNA 4C3VA 4HLQB 5IJZA 4G0OA 1VYUA 3I9V1 5HKKA 2PX4A 2QP4A 4MUKA 5CA1B 1H4SA 5B37A 5EJMA 4EECA 3ZBPA 3HU2A 1BWSA 4QT4A 4HY3A 2C2HA 3OX2A 1T4CA 3DGEC 5BT9A 3PKJA 3WTCA 3N3AC 2RHOA 2CCJA 4K46A 4QSMA 5EFOA 1G41A 2UUPA 1KJQA 3PQ7A 4TWRA 3TM5A 2E1PA 4LBYA 1BKDR 3ZX5A 2H31A 4N4AA 2QM8A 1BWPA 2R1ZA 2IZZA 4YRFA 1CX9B 1MX5A 3B5JA 3PPYA 4XYBA 3DVLA 3E9MA 4JLMA 4HAOA 4AKSA 4BMCA 2JLXA 4GKJB 1CF2O 1PZHA 1RI5A 5HM6A 5KYWB 3H83A 2IYOA 5D8DA 3RTGA 4QYWA 1G6Q1 3ZIDA 4GR5A 4P3YA 3ITDA 1VJCA 4JVMA 4NCNA 4WA7A 5BUCA 2BSAA 4IX9A 4BYMA 5KKCA 2BTEA 3LBNA 1RYYA 2BKVA 4BV8A 1A69A 2W5UA 1E9CA 1KPGA 3PF8A 3U7QA 5B6JA 4C29A 1KY3A 1Y8QB 1X6VA 2RHGB 4BNXA 1UWVA 2AXNA 2ON6A 4YJ3B 1C8LA 4X0EA 1UZLA 2ZRAA 1GGMA 3VTAA 4BMVA 1TNDA 4LYGA 5KTSA 2DPGA 3F96A 2EJWA 2Z4RA 4JBYA 5T6BA 5JYBA 3WWCA 3GI1A 1VSTA 2O5RA 3VPGA 1K6IA 2HHJA 3HCEA 2GN2A 3E7WA 1ZHFA 2ZG6A 2FSHA 5ECGC 1UFOA 1R8YA 1ZH4A 3LZDA 3NV9A 2PNJA 4CM9D 2XI4A 4R6WA 4F5YA 2LV8A 5HKBA 3KCNA 1K7CA 2XUDA 3QU2A 2NU8A 2CUKA 2H06A 1H2AS 1XAGA 2VTDA 4B79A 3G79A 5L3QA 1ML3A 2C29D 3GD5A 4N12A 1Z5UA 3B2EA 2G1KA 4MQFA 4O4HA 2ZW9A 2W2PA 4AURA 1OBHA 3SX0A 2SKCA 3IAS1 2GAJA 4W5JA 3RSOA 5BPHA 3IAAA 4NULA 5CEFA 3HFJA 5HNKA 1WV0A 3F71A 2YQ5A 2OEPA 2WUDA 2ZWVA 1QBKC 5CH5A 1RKQA 2CXSA 2GK6A 4JJ7A 2CSXA 1M67A 4PTYA 1LBTA 1ZYUA 5ALGA 5AVVA 4RJKA 4L8WB 1JP7A 2EZ4A 3ETJA 3WBBA 1N2OA 2DPMA 2ZTUA 3NQ41 1XZPA 4M0EA 1S3FA 3OZCA 3QBDA 4NSNA 3W0LB 5C53B 3DYBA 2EGUA 4LC1A 1C81A 3U7FB 4YP5A 4HH4A 4K6OA 1XVUA 1PR3A 1X94A 1TAHA 2GJ9A 3SAJA 3FSRA 3V97A 4ZIRB 1JDPA 4KH1A 5BOSB 5KU7A 4ZKEA 4P7GA 5LOVA 3ZVRA 3DEIA 1DOZA 2PMFA 4L73A 1ID8A 2JHCA 4PXAA 4DBLE 1CUYA 1PFUA 1R0SA 2BF4A 2GPWA 1HDYA 3CO0S 3PI6A 5E6RA 3UJ3X 1SQ0A 5FBRB 3UJ7A 4KJZA 4YEDA 1DRJA 5KWIA 1P1HA 4GSLA 1YTUA 3A1WA 2CUZA 1POWA 4RQAA 4CMBA 1Z2DA 4F5DA 3C70A 1FX1A 3HFSA 3TJZA 1FVXA 4KRGA 1S2IA 3KR9A 4BRZA 3OFKA 3ZHBA 3JQBA 5EWMB 3HE3A 4ZRDA 4KL8S 4DCGA 4DANA 2J0UB 1XF9A 1GSIA 4J1TC 4OMUA 4A1OA 4MW7A 2QQ5A 2IXEA 3KAJA 1FFEA 1GUZA 2K6GA 3V7WA 4MV6A 3SOZA 4BE7B 3LY9A 4DG9A 5ITSA 3COWA 3O3CA 5LD2C 1Z0DA 4QEKA 4BQOA 3N2IA 4S1NA 4QSHA 4BB0A 2XT9A 4EI2A 1AMNA 4QFCA 3U40A 4DEYA 1KZGB 3DVQX 2BFEA 2B5WA 1ATZA 1XGKA 5K0ZA 1E4OA 4E4RA 4I4CA 1J0CA 3W6ZA 4CLDA 5AJYA 1EJ0A 2I3DA 3ROQA 2I4OA 5JMWA 3PUHA 4WLUA 1Q1GA 2WM2A 3AKCA 1UOOA 5LL6P 3H0CA 3PSHA 3SDBA 1YIDA 4L8LA 4HMQA 3IP8A 5AKHA 1DO8A 2ZYSA 3IUEA 3PPWA 3P9PA 4Z99A 2D1TA 5LDGA 3M5DA 4L4RA 2EZ9A 1CNEA 2AC4A 2BM9A 3MUEA 4W7IA 4AICA 4KB5A 3HEBA 4KQ9A 5TQ0B 3U13A 1UJBA 1VXRA 2PKRA 3PNLA 3VGJA 3BT7A 2R6DA 3CZPA 1V7ZA 5IJAA 1VYTA 3C87A 1N8TA 1JEQA 1Z6ZA 1YJAA 2J0VA 2XQKA 4K9RA 2JHFA 4PX2A 1GXSB 4DLPA 2BGTA 3DB2A 4MMXB 4Q3OA 1XL1A 3NJ4A 2VF5X 3LTNC 1L7NA 3ESBA 1EVJA 1GITA 1WQ1R 1KDTA 4X1KB 4Z86A 3IJRA 3WQRA 5L51A 2E3JA 3T06B 2VWGA 3FNHA 3OFNA 4U5XA 3W2HA 1S3GA 4EARA 4JOSA 1X13A 2W58A 3FGPA 3RTCA 4JB8A 3LUJA 3WZ2A 1SCNE 1UUFA 4UTXA 2ZJAA 1J42A 4AZ3A 2XSZA 4REOA 3ZH9B 1K08A 1Y1RA 4LXUA 4P3PA 2GVNA 3DDHA 3I4CA 3LWBA 5BSWA 2Y0BA 2AFVA 2FFQA 1NASA 2QLNA 5D1HA 4J4BA 5ADVA 1U2GC 3R7NA 3E9YA 2XB9A 1Z5GA 3GFQA 1HNZB 7MHTA 5GJVC 1C7RA 3D7NA 3U44B 2FG7C 3HI6A 3E7FA 3R40A 4WZBB 1U7HA 5JD4A 2DUNA 3AW9A 1SUIA 1ZD4A 3IA7A 4IX1A 3MN1A 5EKDA 4UTOA 1HE1C 2C9CA 4DN6A 1P2UA 4UAJA 2UZ3A 1GP2A 3D7LA 3FY4A 1A4XA 1H1DA 1E1RA 3KP1A 4P84A 3KE8A 1TAQA 4HC4A 1UPUA 3TLGA 2V98A 2MTBA 3X1DA 3UICA 4CMKA 4HQ0A 3PC7A 4TRRA 2HZBA 1PEYA 1DC5A 3ZDYB 5KNBD 2P2NA 2OO5A 3BE4A 1KAOA 2O4UX 3DKRA 5TDHA 1QUFA 3AUSA 3JASB 4FT2A 4K40A 4K6CA 4DCTA 2WTMA 2HK9A 3G8DA 3OX1A 3K8OE 1W6UA 5BQ5A 4ZAZA 4P36A 4W7HA 1NGSA 4LXYA 2JCGA 4IIFA 3RR2A 4HV4A 2HXGA 5EJEA 4BO6A 5D84A 3G8AA 4PLHA 5A2QA 1GZ7A 1P2FA 4WOCA 4QTTB 3WGQA 4C22A 3RYFA 2A58A 5HOQA 1IY1A 4ND6A 4EYQA 3ZCQA 1W8IA 4RMNA 3C74A 4DCOA 2V3CC 2R25B 2DZDA 1GTSA 3FB4A 2IWHA 1WUKS 1QIHA 1CS0B 2GCPA 3KJGA 3QV2A 4KYUA 4LHXA 1GPKA 4RABA 3RUFA 1H0RA 1CR6A 4NRDA 3W7VA 5JJ5A 4ZK6A 1DJQA 3FSGD 3IKTA 3KSZO 3P0IA 3F8WA 3RAFC 2ONJA 4OHBA 5JMOA 2II6A 3I6MA 4W5RA 3GH3A 1YKFA 2GAAA 4IHJA 4ZVMA 5K0BA 1DC8A 3FFBA 2C7VA 2AUMA 2UVQA 3G7SA 3OIFA 4HNVA 4O59O 4PO3X 1WPRA 5EYPA 4ER7A 1OE0A 1XRLA 1VPVA 4E09A 1RXIA 3HYCA 2PQMA 2MYUA 1Z2EA 3KJFA 2LW7A 3NGMA 4MARA 3TLZA 5EEHA 3VPCA 4B0PA 1P5HA 2C7GA 2V55B 3LCMA 3P9YA 1OFVA 2C2WA 4PSVA 3FOEC 1EUYA 3EPLA 1DUVG 2XXJA 4GSKA 2HLNA 4CEJB 2RAFA 5EI5A 3LA6A 1O97C 3E1GA 5T5QA 4G67A 1JHDA 2KHZA 2NNWB 5HYVA 4H2DA 3JY6A 4PPGA 1OLXA 1RHKA 5CH3A 4E2WA 2FP4A 1U98A 1YBFA 2ID7A 4L3VA 4D5GA 1MZPA 1ZW1A 2FPOA 3NEPX 4MV5A 2VUIB 4OHYA 4TV8B 2C0QA 3AZQA 3OZDA 3EH1A 4O2BB 5SZKB 4QREA 2HPHA 4ZAYA 4P3NA 2JEOA 2V03A 2O9JA 3HWX1 4OXYA 1DKRA 1FRVA 1PZEA 4W9NA 3LPNA 4NG4A 1QHXA 4XR9A 1YMUA 3GFPA 4XX0A 5TJHA 2B94A 1K88A 1IM2A 3VQTA 2FSPA 1UKVY 4KAJA 3CCFA 4G0UA 2VSYA 1KK3A 2VRBA 4AUEA 3FCYA 2IRWA 3T38A 5LIPA 4CEHA 4FEAA 4NFLA 3LAWA 3BTOA 4H59A 3F6YA 4IJWA 2QR3A 4NMXB 1OZGA 3L6UA 2I8LA 3A36A 2VHYA 5ALVA 2PA0A 1VZ2A 4EA6A 2WM3A 1G3QA 4KO1S 4D3ZA 4AY3A 2OORC 3ET4A 3PD0A 3ZC3A 4AYXA 3NHJA 1Q12A 1ZSYA 4O2AF 2ZSAA 4IGKA 4EG4A 3HTXA 1Z8DA 3F3SA 1E8DA 4Z9AA 4MGYR 3KKPA 3NC4A 1N0VC 1AE1A 1XJ0A 4B4OA 1E6KA 4C6SA 3VNSA 5EUCA 1JKMA 3FMPB 5TT0A 2M1ZA 3V1NA 2EKPA 4X8OA 3CJQA 4OA8A 2RH4A 2A5YB 4QVKA 3R4CA 2C4NA 3HXKA 2V59A 3OHMA 3TQTA 4NHOA 1N78A 1PR2A 1TOAA 2UXCB 5I7UA 4BO5A 4NU6A 1P1JA 2BUBA 4RVHA 3O0DA 4D9FA 4C78A 1JLMA 4RK0A 5EZYF 2XDQA 4C0HA 8ABPA 1UDCA 4RVSA 5IG2A 5ITZB 4Z9BA 2PD3A 4DA4A 4IM7A 4YROA 1X19A 4YRIA 2DGDA 5FOUA 1Z0FA 4HP8A 2B8JA 5BQ3A 1F9AA 3GLVA 5LP6C 5AKEA 3WGUA 2APJA 4DLVA 4PIPA 4QLOA 1H2RS 4C87A 1N0IA 3FAZA 1T5SA 3T9CA 2YFQA 2Y76A 1HRDA 1UT5A 3AHIA 4Y2QA 1JWAB 3A3OA 4WASA 3UTCA 5DM70 3EX7C 1W2HA 2EDCA 3A6HA 3PUYA 3PQ5A 1QQ7A 1Z4OA 2OLJA 1QCYA 2XNJA 1DRWA 3D6FA 4Z9FA 5JJBA 1ESZA 2XAUA 4NWIA 5EKUA 3NTRA 5KNDA 3GNQA 1PJTA 5FOXA 1M74A 1FL9A 3K9CA 3P26A 2WHYA 4MP8A 4TWJA 1PGNA 3AUKA 4JYMA 2IYTA 2PO5A 1UFQA 1YRQA 2HDNB 2V7UA 1T0JB 3LCVB 4RWZA 2FPSA 3KYDB 1UBKS 1A2KC 3QY9A 4GWKA 4PTLA 4X7BA 1C9YA 3PRKE 1C8BA 1TK9A 4N8DA 2G71A 3DC2A 1PYOA 4F71A 1ONSA 1Z7YA 4GMXA 1I3MA 3RD5A 3O74A 4YT5A 3PB3A 4MLPA 5TB5A 2WWGA 4CLHA 4Q21A 3RSSA 2AR7A 3QEKA 4RPLA 4JZKA 5JC8A 3I32A 4LBVA 3ZU2A 1PWYE 3TR5A 1J2YA 3OM0A 4CFZA 1ZVQA 3T3MB 4OI2A 2J7PD 4I9FA 4QECA 4W6ZA 4F1WA 1E59A 2QJFA 4P80A 1V9LA 1YFKA 3VVMA 2IIPA 3IAFA 3NWJA 4LPKA 5D86A 2FWRA 4FI3F 3OM9A 4DLYA 1WKCA 4P0TA 3ZQ4A 4CCYA 2XWSA 3MTEA 4ZDKA 4EMSA 1ZNWA 2ATCA 5IDXA 3UT5B 4N5IX 1YDWA 1OY1A 1Z8FA 4R8LA 4RLHA 5KVVA 5C35A 3DOIA 4Q19A 3K5HA 1JDTA 1CIVA 1J8MF 1STOA 2NSLA 2NUPA 2VDNB 1XXHA 3EE6A 3CZRA 4KN6A 4O8ZA 1BVRA 3GMSA 3N86A 4F21A 3JD0A 1GSOA 5JH7B 3CZCA 2C2KA 4IILA 2OC4A 2EKBA 2W6OA 2WINI 1L3CA 4GLFA 4PZUA 2I3ZA 1MQAA 4FMCF 4TMVA 1UEJA 1FQOA 1UBLS 5HHTA 1JNYA 1JFSA 5K7SA 1JYFA 1SA0A 4HB4A 4EFLA 3H1EA 3VMMA 1VLQA 1NW3A 2D2IA 3CJRA 3OLZA 3ZK7A 2IYZA 1BJRE 2OL4A 1GZVA 5C7LO 4YWHA 4E2XA 1WU8A 1LW6E 1KKMA 4G9BA 4JEUA 4RACA 5FNVF 4JXXA 4M0FA 3PRHA 4MUNA 2XJ4A 3VTFA 1EUDA 2E49A 2PXCA 3G0GA 2A14A 2YUIA 4GUDA 9LDTA 1QHNA 2QPAA 4ILKA 4GAEA 5DLEA 4CG3A 4ESEA 3VV3A 4W5QA 2X0KA 4TT3D 1U2PA 3JQAD 2IEYA 4XDGA 3RC3A 4MKFA 1M1NA 1IN8A 4PHGA 4TN5A 4E5PA 1CRWG 3BGDA 3BHNA 3S6JA 1EK6A 3Q5DA 2JI4A 3H4IA 1T1SA 3FYUC 1DBIA 4NAUA 4JLNA 3CYFA 4MDHA 1Z16A 2AXQA 1YB4A 1I6KA 5EIBC 2A8YA 4GI2A 1OHHD 4FGSA 5D7NA 4H9GA 1GTRA 2ETVA 5K3BA 4WPGA 4GZMA 4ZWNA 1JEYB 5EC8A 3TO5A 4E5SA 2ZBEA 1JFFB 2FEPA 4Q3AA 4RL4A 2MIIA 3AONB 2HBQA 2YFKA 1A9XB 4LVUA 3EEBA 1HYBA 1F1BA 2OORA 4QFDA 4YMWA 3AHHA 4A2QA 2V1UA 5ALUA 1TC1A 4MVJI 2J1LA 1GUAA 3CX7A 3HCRA 4ZGGA 4YMSA 2A0FA 5BNZA 1T26A 4GIBA 1GZ5A 2CJXA 4ZC8A 3VR5H 3EEQA 4QJBA 2Z57A 3LHDA 4O4LA 5GONB 4MZXA 1T4BA 1UP4A 2ZBVA 4R9RA 3TZKA 2AD1A 1H2ZA 6ABPA 4AO7A 1PNRA 5EP2A 8MHTA 3HCBA 4QBIA 5AJWA 2DC1A 3D6NB 5GOTA 4BUCA 2BTQB 2GBIA 2WNHA 3G0DA 5F2NA 1YQDA 3ODGA 4DLTA 3LZCA 2NYAA 5ERGB 2ASVA 3DLBA 4BNGA 3FPJA 3RLIA 1V3QE 2AG6A 3O4FA 4OJTA 3WO0A 3GNLA 1K6MA 4JN6B 4NBUA 4KSCA 4MDEA 3LPMA 3QE0A 4Q1VA 3ND7A 4JROA 2J4CA 2QUZA 4B47A 3ZKWA 1RP7A 1TM4E 3FYTA 1SCQA 3OZ7A 4FXPA 2CT8A 5G0VA 3PUIA 1AQIA 1SR8A 1BFKA 2BMWA 4P7KA 4EUKA 3U3JA 4DNXA 4I99A 3RARA 3JQGB 1E1CB 4QPNA 1T0BA 3RIGA 4CLEA 3H1AA 2QZZA 3LKVA 2BFFA 3HN2A 3OZEA 5HKLA 4JENA 1C80A 4F93B 2ZXEA 5JVDB 2X0DA 2B1QA 5CFPA 2ZAGA 5H3HA 4PRKA 2D0OB 3ZE1B 3H0EA 1L5HA 4FCVA 1Q1BA 4NY1A 3OQIB 4M9QA 4E0BA 2VPWA 1E3TA 1W30A 3CMCO 1AIPA 4H6WA 3OQNA 4HRXA 4CBVA 1Y5MA 4KIGA 4P22A 4PU0A 5EAIA 3RV3A 4AG5A 5LCXA 1P2VA 3V1MA 2UZ0A 3C7KA 1KI7A 1I3CA 3KPJA 1Q0ZA 3B9BA 3QBJA 4N1AA 3H9EO 4AKEA 4LY3A 5ECWA 2OMKA 4RA6B 3A1VA 5DXAA 1MOSA 2V6MA 3TIFA 3TX6A 5IWCA 1Z5NA 1L7MA 4AUNA 4AD8A 2Y1XA 3GNSA 3EEOA 3H05A 2YMQA 3ZCUA 4F3RA 1RQNA 2XHEA 2JAUA 2XOKA 5CLFA 1ILEA 5EMNA 2P62A 4RGYA 3N9IA 2H5EA 5GY7A 1DCFA 1QZTA 1W25A 3OF5A 4QWWA 4UBJA 4PX9A 4FFLA 5DXJA 1B41A 1GKIA 3SVZA 1V5EA 4BZZA 4DQKA 2QVLA 3E82A 3LUGA 1P73A 2G5GX 4IF4A 5JZSA 4LFBB 2BE9A 1YHZA 4ZZIA 3VUFA 5C0OE 3AUJB 1HM5A 5LXTF 2BFNA 2ADMA 2G82A 2W0SA 1M6HA 3KPVA 1SXIA 5EPEA 5EZ6B 4CTNA 4KXMA 1GPMA 4PG8A 5BSFA 2H1OA 1VPLA 1PR1A 3KZKA 3U0BA 4N6OA 4MTLA 5LZ2A 3ZW9A 1UQUA 3DMNA 5ADHA 4H4DA 3J81k 4D9BA 1H4QA 3U60B 2E18A 1DTSA 4QNMA 2ODWA 3HLKA 3TB6A 4C4YA 2VP5A 1EVIA 5F12A 3ZXYA 4IUBS 4BQIA 5IJWA 1UBFA 1JAHA 1QH8B 3I76A 3R7SA 1KO4A 3K70C 1FUEA 4HZUB 2J9FB 2V0NA 4J0GA 3DONA 2E4ZA 3R0IA 3U17A 1I10A 2FZGA 2J9GA 4RKWA 2VP6A 2IZ0A 3H8SA 2CNBA 3SQXA 1EXWA 3DPSA 3HCFA 3L0BA 1ST3A 4JBGA 4LX8A 3ELYA 2QN7A 5PGMA 1X3SA 4RC9A 1X7WA 1VMIA 2EJUA 2IH5A 2G9QA 1FVOA 1GKUB 1YZLA 2OWDA 1A7AA 1XJWA 2ZSEA 4IDAA 2OHIA 1Y6RA 3MRXA 1WCV1 3T7AA 5F9HA 4F2GA 2ZUDA 1ZWKA 3CN9A 4LJ5A 4MK4A 4OO3A 4TTAA 4QJ5A 4L6CA 5TF4A 1SBNE 2BI8A 3O2SB 3TQFA 3ZEIA 3H18A 4BDSA 2BV3A 3GFSA 3BWDD 2RK4A 1CY1A 4QAJA 4Z3KA 2VDWA 4Y8VA 1P9RA 3FYUA 1S2NA 2JZCA 3EXHC 3U7HB 1GDTA 4J29A 5BNFA 1LBEA 2CLKB 2B7BA 3KU1A 4CQNA 4HPJB 2IEBA 4RJLA 5CHYA 1DRUA 1D2AA 2FX5A 1S7GA 1GUFA 2HY7A 1CR4A 1B6TA 4YWJA 3FZGA 1JHYA 4IKOA 2AF3C 2JLRA 1W46A 2QVYX 4WBXC 1OX6A 5IN5A 4TQAA 3RVJA 2XUFA 3L8HA 3H2HA 3KQNA 4KR2A 1A8HA 4RXMA 3QU4A 4AULA 4QTYA 1U4NA 1THMA 4GX2A 3VHLB 1D04A 3LUAA 4UEOA 5IAKA 1G4AE 1SCBA 1CUIA 2PGJA 3BE5A 4MDFA 4Q7JB 4FT4A 3JSXA 1EFLA 4M8LA 1A0OA 3DDZX 3ELBA 5KPJA 1UOPA 3THXB 3GRZA 3CWCA 1ADGA 1CZKA 3G6WA 2W2XA 1VG9B 4W8GA 4UNIA 3IR5A 5CLLA 2V96A 3KV3O 5DRTA 2F48A 3BFPA 4C30A 3PPVA 1X1BA 4FQ8A 2GD1O 1EUCA 2I03A 2ENWA 4DA7A 2XUAA 1WZIA 2AFIB 4NYIQ 3KJZA 3CW8X 4ZHSA 1FMJA 4LF6B 1O8BA 1J0BA 1SBCA 4IO0A 4LZLA 4BNFA 4COKA 1TJPB 4UVEA 1M72A 1IRIA 5HQTA 1LDBA 1M6YA 1XCMA 2HCTA 2WV9A 4ZAFA 2P41A 3DL7A 4ARBA 2BEKA 5AXCA 2QD2A 1GU0A 4CIWA 5CYGA 4A8HA 1YKGA 2VP4A 2Y4NA 2CLLB 1G8JA 4YVFA 5JEEA 2OBNA 3FGNA 4HXGA 4PY2A 4AC9A 4B3XA 3GLHB 4MIEA 1LLQA 3IT1A 1XZBA 1PD0A 1WPXA 4M3NA 3S2GA 4C4ZA 3R8FA 3WY9A 3Q8MA 1TUIA 3AZPA 5ED0A 2XQJA 2BM0A 3PNMA 1Y1QA 1HMPA 2YICA 3BICA 1ANKA 1M8GA 3M3HA 1MJHA 3U0VA 2GK7A 3CLSD 2PZAA 2AZXA 3F0TA 1TAGA 1U7DA 2NUBA 3AEKB 1YV9A 3ENVA 5HIIA 2HFJA 1XO1A 1RXUA 2G7ZA 1F4VA 2HLDA 2GCIA 1U8FO 4ECEA 3EUWA 2PZBA 3UVEA 4N47A 4FYKA 2HMVA 5JISA 2ADFA 2C54A 2W98A 2HNKA 1RHUA 3RIXA 1ZRSA 3CPSA 3QNWA 4BB9A 2N75A 1C30A 2XUJA 3ESCA 1SWWA 5LMNB 2CB9A 1FRZA 2VHVA 4FGLA 1IN6A 1Q92A 4IQ4A 1ZAYA 1G18A 3B1JA 4EHNA 4F04A 2QNBA 1JH8A 1V2GA 1U7OA 4NE7A 3YASA 3QA9A 5JAQA 2GXAA 5HJ5A 3EASA 1K4MA 2VYCA 3ZJYA 1DP4A 4AT1A 3QWAA 1UMBA 5T67A 2IELA 1WSWA 2WU4A 1C5KA 5DB4A 2YZ7A 2CLIB 4FHFA 5JBNA 5CDUA 2F4VB 1T1GA 2PZLA 4U2DA 5AKYA 3WSVA 3E6AA 3O8QB 3RVPA 3WK7A 3W5VA 3ZWMA 1SOVA 3NBKA 4JI0B 1S4MA 3LY8A 1KFCB 2BRUC 1D0SA 4IJ5A 3GLFA 3U6KA 3VHRA 4CHGA 3RIMA 3HNRA 1EWYA 2CVOA 1OWOA 1KEEB 2WLTA 4RAQA 4O29A 3G23A 1R15A 3K71B 2F9MA 1W5EA 4IJQA 4MS1B 2G6TA 1P9NA 2OOSA 2QTBA 2ZYVX 4JC8A 1KWKA 4BFLA 4J16C 4LHVA 3WKAA 2E89A 2HJ9A 2O57A 2OAQ1 2JVKA 5BY2A 5KHOC 4A36A 4HKTA 4Q4LA 5J1TB 4UAUA 3RS8A 1RM3A 4FHEA 1BWRA 1DSSG 1CVLA 1HTWA 4JIMA 4LV5B 4OM8A 4TXHA 5FPPA 3UV3A 5BSGA 3T1VA 3WRXC 4H6XA 4KI7A 4PLFA 4QLBA 3UXMA 1HNWB 1I2CA 4PVDA 3R44A 4X1IA 4DAOA 3F9IA 2GF0A 3LL7A 1E58A 2ZJ7A 4B73A 3RPEA 2QYSA 4EYSA 3HY4A 4P92A 1K4KA 3A2KA 1BCRA 2O0KA 2OQIA 4XEHA 4QGHA 3UHOA 5ABPA 5DTIA 3OT5A 2GM4A 4ARVA 3Q85A 3PD1A 4Z4FA 1HZZC 3H9GA 3EAGA 1Z3IX 4OP1A 4N41A 3G2NA 1LJUA 2ZOSA 3ZNQA 1AM4D 1NURA 1ZU4A 2QTZA 3EXHA 3WK4A 4PPQA 4II2A 4F3TA 1AC5A 1V8FA 3I3SR 3B13B 3L1VA 5FV7A 1E6WA 3FPEA 4CU5A 3RAEC 3B9RA 2AJLI 4DKJA 5J5AA 1PLLA 2GFHA 4PG5A 1NUUA 2A5LA 5AHXA 4YRTA 2C4TA 3LRPA 5D5PA 2CFOA 2GBLC 2CF6A 1IHPA 2WKSA 3AF0A 3HCCA 3LQRA 4KNVA 4OYHA 3UENA 4O2LA 1JJAA 3A4YA 4QM6A 1TQ2A 4LSZA 2H9YA 2BP7A 3OZGA 3KQQA 4Z9YA 2JIRA 4D4GA 1NPDA 4DFDA 3CSUA 1XMJA 1FZTA 1GNTA 1Z73A 1JSCA 3D6JA 3JVEA 3KZVA 5ARCA 3SDZA 3TH5A 4WY8A 4KXWA 4X1YA 2PD4A 3V4PB 5JO0A 3L4SO 4PBRA 1XYYA 5LBIA 4E30A 4HN4B 3K05A 4G2TA 4EGFA 5CA0F 3WYDA 2EWVA 1K9VF 1T5OA 2HF7A 2FWAA 4QDJA 4ARZB 3V2GA 1ADFA 2CF5A 4HG2A 3KDPA 1MVOA 1C7EA 2I34A 1TZBA 1CKEA 2H4JA 3QVJA 4GZLA 1O94A 1YIOA 4Y2YA 4DPMA 4EPWA 1H3FA 5HFNA 1BVUA 1A5ZA 4A0GA 3OUZA 5DP2A 1Q20A 1U8TA 2J5KA 1H2BA 3UOGA 4D0RA 1Y5NA 2P68A 1U0GA 4G5HA 1F48A 2DY1A 4DM3A 4EG6A 1TCBA 1U3GA 5K09A 2JFQA 3BL8A 4HR7A 3W5SA 2IGTA 5ELXA 1JRLA 3KSDO 4UEWA 5BSTA 5EJ6A 1AMUA 4NEQA 2IXDA 4FX2A 3NHBA 4WK6A 2VQFB 1CW2B 4DB2A 1GL7A 2EC5A 2Q5JA 2OSVA 2W22A 2ZANA 2VUSA 3AJEA 3M6UA 5EIOA 4I6JA 5FPTA 1PKEA 2W6MA 1DV2A 2CL5A 3BWBA 2GESA 3DFZA 4WNCA 1NW8A 1DI0A 2GHQA 2WABA 4K9OA 4DLUA 3RKRA 1F2VA 2O2EA 1QGED 5JANA 1M1UA 2CL0X 1NVUQ 4M1TA 5B7QA 4IHQA 3ZLTA 1IHDA 1MNAA 621PA 4JC5A 4WNYA 1LQ2A 3PC3A 4INZA 3ZBUA 4NS4A 1WCWA 4D80A 1VPEA 4IFIA 4JLAA 1ABEA 1XHLA 2PPVA 3BK2A 1DEHA 2JIBA 4JQYA 1N3LA 3SQMA 2XCSB 2XVMA 1QGZA 3K2QA 4QOEA 4OHFA 5E2IA 2OXIA 3TD9A 4URXR 2CNLA 1BCSA 1P33A 1DIAA 2A7QA 1J0AA 3IC5A 4FR5A 1QAOA 4HSEA 1XDBA 1JALA 2FPIA 4QDXA 4FBGA 4W5WA 4PNHA 4MKXA 5AHOA 4YJGB 1F4LA 1VJRA 5CPBA 4OI1A 2OYRA 3TCXB 1W1WA 3U3RA 1OD6A 4P6VF 1M34B 3RUIA 5PNTA 4BE9A 3MGCA 4DV2B 3P27A 4CDNA 2PSEA 1XL0A 4HN2A 5DCUA 3OF3A 4BNWA 2VJKA 2DX7A 2XVAA 4TMKA 2F8LA 4IDDA 2FRDC 3DL4A 1XXHE 5JWRA 3GUZA 1A1SA 1J0DA 2NU9A 4F4FA 4M38A 3H65A 4QYXA 2PANA 2GEKA 4WCVA 5LXTA 4IDBA 2Q45A 1I0ZA 3PIDA 3MJVA 4V03A 2PZ8A 3F6RA 2BRUA 1DFGA 4OJQA 4EZEA 4BMYA 1I7QB 3A1SA 4H7IA 3A0RB 4M1YA 1YC2A 1ZIDA 2XLBA 3F3YA 2PIDA 3HQ4O 4HTFB 1LBSA 1N8KA 3BL6A 2OZEA 1XQYA 3LDAA 4KWIA 5COBA 4HMPA 4A2PA 7ABPA 2HPVA 2V1XA 4CR7A 1T3SA 1NUQA 1Y3BE 2JS7A 2OKCA 2X76A 3GFVA 5FL7A 3WK9A 4NDZA 4J16A 1JKXA 1J2EA 1P7ZA 1RI1A 2HK7A 3KJIA 3OQHA 4LXXA 4QELA 3LIPA 5AR1A 1CFJA 1ZM3A 4WJKB 4UREA 2Y93A 3I2GA 5KDLA 4ZKDA 1ZK2A 4OGKA 3WRXA 4BKPA 3EVEA 3RYCB 2P9EA 3IPYA 4KGVA 3B82A 5TGTA 4IWNA 3RU9A 3TBFA 2J09A 3PQCA 2BI4A 1YI1A 1Z0JA 2HO5A 4GEKA 3IEKA 1IHXA 4JR1A 1M1ZA 1OWNA 1N2EA 2EIXA 1U4OA 1NIJA 2JIPA 2PR2A 1Z6AA 2ZIXA 3DZKA 3OFND 5CMLA 4ZVSA 3UO8B 4YRSA 3NOXA 3N0TA 2AFRA 1OMOA 3GEPA 2NSHA 4MXDA 3E58A 4CUZA 3DV9A 2HBRA 2QROA 4DEVA 3BFXA 4FK8A 4N49A 4KYVA 4Y9RA 4EYOA 2POCA 3D31A 2NP6A 1KO8A 3WLJA 4N5LA 3PQ8A 2PUDA 3U7IA 3VO2A 2XSZD 1I2DA 3NYWA 1OV6A 1NTOA 1NXVA 1XNRB 1JAIA 2JGFA 3E3LA 3HDHA 1VKRA 5FWXA 4BNHA 4F2WA 1YB2A 5HZGA 4B3FX 3QBTA 3H04A 2A78A 3OZIA 3HP7A 4I5IA 3DB1A 4WNAB 4Y6GB 4D56A 1P0QA 2GBLA 1P2DA 2YV2A 4ZV7A 2YXEA 3HO1A 4L4YA 1OXUA 3V33A 2FZ5A 2HI0A 5AW4A 2BEVB 4D4JA 1NVMB 2X7HA 1MO3A 1Y7TA 2TMDA 4JQCA 2HN9A 4LZWA 4OKNA 5FUBA 5SICE 2QRJA 3VPBA 5C52B 5JOQA 4YPVA 3MS4A 1YDMA 3A7DA 1NXQA 3FG9A 3UUGA 1KMCA 3G17A 3GGJA 4KPUA 2UYYA 1NOKA 3FYSA 1N5DA 4JXKA 1KQFA 3MRSA 3QLEA 4EKNB 1XI2A 4FOTA 1KP2A 2DHCA 1WVIA 3ADDA 4KX5A 4RA9A 3ITNA 4F6LA 2O48X 2VZ9A 4PPYA 1SHKA 1US8A 3BRWA 3OAAD 2P40A 2PH7A 4FHCA 4XWYA 1M66A 1USGA 1M6NA 1Z4MA 1KI4A 1PV1A 3AI3A 3DS8A 5JD3A 4EO9A 5EGSA 3JU3A 3M6FA 3TJMA 1RYMA 1TTTA 2Q1YA 3IEVA 2G72A 3QX9A 2GBGA 4O2RA 5IUNC 4QDUA 1KZ9A 2B82A 3H3FA 1GRVA 2PLNA 2ZT7A 4JJFA 1SN7A 1B3BA 1M2VA 1UZNA 2P78A 4IIEA 3EODA 2QMYA 3SJUA 1OTYA 3GJ0A 1P3JA 1OXMA 4KVAA 4QYIA 4DA8A 2NP7A 3GDFA 1RD4A 2F00A 3AMVA 3HA5A 1WNFA 1TGYA 2P2CA 5A5GA 1OXBB 4EH1A 1HLFA 1N5JA 3EDYA 1J5PA 2Y0EA 3PQ2A 1VSUA 4PLVA 4X5OA 1FK8A 1I6MA 2WIAA 4MJXA 2CKDA 4WK2B 4NCAA 1Z6PA 4H0CA 1USKA 1W0CA 4L9SA 1KDYA 1EK0A 2X4GA 3IEUA 3X2FA 1FC0A 3Q98A 1TQ8A 2JBAA 2ZRKA 3OEHA 4V2IA 5D01A 4BC0A 1BVHA 1A2BA 4YJFA 2LR0A 3PRJA 4CTJA 3V7FA 3R7DA 3PLAE 4YRKA 2B21A 4ZEXA 1IPEA 5DFAA 2WTEA 3EPJA 1T36B 1DL5A 3L7JA 2GYYA 2YHIA 1YQQA 3RU2A 4X24A 3FVRA 4XD7A 3SQLA 4CLOA 2X2OA 2GB4A 1GPAA 1PF7E 3IB6A 1ZUNA 4BX0A 3N2EA 4FE7A 2JGKA 5DULA 4ZVVA 1IZYA 2WG2A 3BSSA 1MDFA 4RMJA 4D0NA 2ZR8A 3PXBA 3T94A 5HRUA 2CE2X 5ALEA 1E8NA 3VU9B 4ENQA 4J3JA 5HKAA 5JY6A 4OMFG 1ZNYA 1NLMA 3KVYA 4M0KA 4R1TA 4BO4A 4DQ0A 3STVA 4BRWA 1EJ2A 1GAJA 1M33A 2OHVA 1RBYA 1N9ZA 4JL5A 3UWOA 3QXCA 1C2TA 3E2PA 1VMEA 3BGWA 5CB8A 3WAGA 3RIEA 3E9CA 3DZIA 3LQKA 4RMGA 4XWTA 1GNLA 4DMHA 4LAFA 1T0PA 2FK7A 4LBZA 2YY7A 2J33A 2PRKA 1BN7A 2FEKA 2BN4A 4X95A 1JG6A 1DJPA 1VRWA 1WB4A 2ZPTX 1YQWA 3HDYA 3IE0A 3PI7A 1IUKA 1O4VA 2IPXA 4LRYA 2XQIA 3X1KA 4QHSA 5FDFA 3U16A 2CFRA 3BD7A 4XYMA 3CRMA 5LR6A 1YRYE 2DVMA 5G4LA 2IYYA 4I14A 5BWCA 2HUPA 1SKYB 2JIMA 4JA0A 5LYJB 1COWA 4NCHA 3SEQA 5B6IA 3FGOA 3UK6A 3UGQA 3SQOA 3DE6X 3K0FA 2QTMA 4U2CA 1SKQA 3IS3A 3T7CA 1X1QA 4S0XA 6AT1A 3O92A 2GFIA 4O02B 4CKBA 4BN5A 4QASA 3PC8A 5K20A 1QH9A 1XD8A 3OCWA 5L9AA 4YMHA 3TPFA 1AZLA 1NF3A 3NYRA 4ZPXA 1U0BB 3I1IA 2OCAA 1MU0A 4KAAA 3PFBA 3U3ZA 2Z4TA 3HP4A 4CT5A 3HGQA 3L05A 3KQWA 1F8UA 1PSDA 3SNHA 2H18A 2G40A 5K0GA 4ZHQB 1Y3IA 3I37X 1IJBA 1TJYA 1W34A 3KBBA 1AQLA 3ONDA 4UBMA 5EHQA 2WYOA 3KB6A 1OAOC 4G0YA 4WK0B 1PG5A 2G5PA 3AUAA 2PH1A 1UM9B 2IKQA 3EY4A 4YI3A 1AKEA 4DVGA 3GPDG 3C3CA 5HX7A 5LPNA 1KDZA 4GXNA 3ASYA 2CMGA 4CCWA 5LNK1 4W5OA 2BGLA 4H31A 2GPJA 3AETA 4FFOA 1DQRA 1L5RA 2H85A 4COOA 1Y8AA 1Z5VA 5EXTA 2BSQA 1NG1A 1Q0UA 2A5GA 2ZI4A 4JYCA 3FLEA 1BQ3A 5MF6A 5K8JB 3NFYA 3HBAA 5K8TA 2HT1A 4XSHA 2B34A 4IMIB 5L3RA 2JEYA 5L7TA 3QFRA 3QBEA 2XZTA 2L82A 2JLSA 3BKXA 3UMJA 3E9DA 5E1DA 1XNHA 3LFUA 5AJUA 2QIPA 5CIQA 5ITVA 2JW5A 1AKMA 3RHSA 5JXIA 1LSJA 1XTZA 3SLRA 4ZT3A 4DJ5X 2DQYA 5IT9A 2XMPA 5CVCA 2IUYA 4FB4A 3VOTA 3IDSA 1CUFA 1UWKA 1HTBA 1ZISA 3GQBA 4YDSA 3SC2B 3X2SA 5KNDD 1B4DA 1TRKA 2P90A 3L0PA 3O6VA 2VOJA 2P6NA 4LCJA 3FJOA 2PT5A 1OLUB 2LPMA 4QPZA 1U0HC 1AUQA 1PBNA 2BFBB 4G0NA 5GM1A 3TSWA 3H75A 1HT0A 5IARA 3TQIA 1BYUA 1XMSA 3F7NA 3R1IA 4I50F 2HKIA 2P3OA 3KPYA 1PT9A 1F2DA 2G5TA 3HJHA 4MLCA 4ENUA 2W83A 1KXZA 3L4JA 3FCEA 4ONEA 4U7PB 3QELA 4GNRA 2OBYA 3KUXA 3Q72A 1TK2A 1CTQA 1N9KA 1YMVA 1DAEA 3RJ5A 2NO9A 5JI2E 4NE2A 2I3BA 4CPDA 1ZOIA 1UKCA 3IXMA 2AFHE 3B6ZA 1NNSA 1I1HA 2NPIA 1K98A 3H11A 3RYIA 3NBAA 1TW2A 3ILSA 3FYDA 4Y98A 1FYEA 2YZNA 4EJ2A 3QGMA 3PUKA 1QC5A 4ZU6X 3GCZA 1KQNA 3A1UA 3FVQA 4R7TA 3MS7A 5AM1A 1EWVA 4CKXA 1EGQA 2I33A 1M6EX 1FJ2A 3I64A 2GEBA 5SZJA 3ZK9A 3DBVO 1Z37A 2WUGA 3TTYA 5HS4A 2VPIA 3AIKA 4GXTA 3B6JA 1AH2A 2GJ8A 2X15A 3H5IA 3O5AA 4P35A 1DJMA 4BFUA 3L7AA 3TW8B 5JAPA 3EGDB 2ZT6A 3CX8A 3L82B 3BQNB 4HAZA 2W6CX 1JLLB 2QIOA 3UW3A 3LX6A 4LQLA 2XMDA 5LWQA 2P67A 3TLMA 1RXYA 1RM5A 1Y8RB 1JTFA 3VR1A 3OF2A 3ZBTA 4V39A 2JAXA 1UBMS 4PSAA 3KTAA 1Z38A 4A0FA 3I61A 1I7PA 4GPTA 2B6NA 2VBCA 1JPJA 2ATXA 4RVNA 4R31A 1W44A 2VWQA 1O97D 5BW5A 2ZAMA 4PYOA 2X1LA 3HY6A 3OPYA 2JAWA 2Q1XA 2G7MC 1H4TA 5C37A 1JIUA 2WWHA 1PT7A 2WYHA 3K6KA 3PDCA 4DLAA 1T9KA 1Z07A 5CLIA 4XSVA 5T64A 3ZQKA 1VHQA 2DPLA 2C3MA 4LW8A 4MR9A 3EIOA 1W85A 1YS7A 4GU5A 1BFUA 2XUZA 4RIIA 1W59A 2HDWA 2YC4C 3SXUA 2HK8A 1VTKA 2XWPA 1QNLA 3M5WA 4GWGA 1N1EA 4V38A 5BV1A 1AO0A 2COUA 3CHYA 4TMWA 1K7FB 5K8VA 5KEIA 4G5GA 4QT0A 2Q4BA 1WDKA 3ENQA 3KKLA 5DLDA 1GQOA 4DIMA 5HWSA 4LEIA 4C7OA 2NPFA 4C2TA 1YFLA 2BFWA 5I7HA 1PJ2A 1ODJA 2I65A 2V7QA 1Z4KA 4IIJF 1S02A 1NVFA 2BE7A 3AI2A 3H86A 4RVOA 2ZRCA 4JLDA 1Z2PX 1ADCA 1PJZA 3PXUA 1PCXA 3NTQA 2VP9A 2W2QA 3OU2A 1P0MA 2XE4A 3OFSA 2A92A 3U81A 4BJHB 3OZXA 2QGNA 1WKBA 2JD0A 2XZDA 4DJDC 4E5NA 1L7BA 3D1VA 2JAHA 2ZVDA 1O0SA 1BROA 4X3PA 1BDBA 5BN5B 2XUGA 4DUGD 1SFRA 2E1RA 2ZU6A 4QU9A 1XWWA 1Z39A 4U2KA 3K1AA 1JXQA 4OIFA 4F1KA 1UAGA 3EDQA 3NHPA 1GFIA 5BMVA 1P31A 3PC4A 4M0UA 3UB2A 1TYZA 4UEKA 5JNVA 3AHJA 2EFCB 1DEAA 2NVUA 4HNAB 2KLBA 1VE9A 1XCLA 2UDPA 3JRXA 1RRMA 3JZFA 1KH3A 2NAFA 3EZLA 1G60A 1XP5A 3ZDEA 1T2VA 1OIWA 1KEWA 1A50B 2PS1A 3PHLA 1MRSA 4RAOA 4WUVA 3UYKA 4ER0A 2BH9A 5BN4A 5KOHB 5J3JA 1KETA 4UQOA 1NN5A 1UPAA 1JB9A 3MEQA 2BJVA 1HY3A 3DD5A 1EM8B 1IBCA 2RHBA 4PG7A 3CWZA 3PFGA 4BTLA 4EL5A 1KJNA 1PLJA 2FZCA 3FUTA 4D6PA 4O0MA 4UHHA 2NUTB 3M1YA 1RWPA 2R97A 1N7JA 3MPOA 2C99A 5C3MA 4QA9A 1IATA 3QKSA 4R9UC 5I8PA 3DZHA 4M7OA 4CKEB 2PQ0A 5IP5A 1HF3A 2BR3A 4O5OA 2DECA 2YV5A 2WWRA 3VYRB 2JAPA 1RVV1 1PK8A 3A70A 3FBTA 4DIFA 1Z6XA 2XA1A 2DBQA 3H97A 3S4YA 3S68A 4F60A 4PXSA 2ZYGA 5F1OA 2FFHA 4BIIA 2CDCA 2MYNA 2VOEA 1JEDA 1YIAA 4L85A 3PTZA 3P9CA 2SICE 3TOZA 3WLFA 1KS9A 1XE3A 4B84A 2R9VA 3FDJA 3OJFA 3W5JA 3N07A 2INGX 2FDRA 4G89A 2RI0A 3OJCA 1FP2A 2XMCA 4EI8A 4EVSA 2WWYA 3JZAA 1CJMA 1D09A 1UPBA 1YQUA 4LVOA 4CEIA 4IYJA 2EJBA 1UOQA 1QF7A 1Q5PA 2WT8A 3QTLA 1HE8B 4IIGA 4E5UA 2WIJA 1FJXA 2Y92A 3ZDZB 1BJKA 4Y1GA 3L0IB 2Z09A 3WLQA 1I5EA 1YRWA 2P3SA 3QPDA 3F6BX 4I1SA 2GXQA 5F2KA 1KPIA 5LA6A 5JU6A 4OKSA 2AJCA 2YH2A 1ILWA 4RLQA 3GBSA 1FS6A 1RYNA 1WDLA 1XRJA 1M2JA 3EQ6A 2XOKD 3IP1A 4S2UA 3CPHA 4DLLA 3L46A 3SXJA 4RV9A 4EB6B 1CQPA 1XTKA 4KXVA 1XQ6A 4LKRA 4D4LA 4DPLA 4LISA 2XMQA 3ILVA 3A4IA 3WICA 4TYMA 5CUQA 1CQWA 1NOJA 4GBED 4ZZ1A 2LWIA 1EE1A 1L7VC 4XAQA 1KJ8A 4OH7A 1LFDB 3A2LA 2D5LA 3CVVA 3LKBA 4DR1B 5EY5B 5EJGA 1TFRA 4AO8A 4KTTE 2JI7A 1ICEA 1S8OA 1SHTX 2IOHA 3L7NA 3QKRB 3I9JA 3LI2A 2R44A 4ZOEA 1S7CA 3GIWA 4OXXA 1QYDA 4FFBA 5CTAA 2C78A 1Y3HA 1DX9A 1FDIA 5ALQA 1WKVA 3DC7A 1OI2A 1T2CA 1D1QA 4PN7A 1JFVA 4M22A 1X80A 4TS3A 4Q4AB 2GM5A 3RQSA 3T41A 2JGEA 1LDNA 3BWCA 4XYLA 1G6KA 4LOHA 1P6QA 3QWFA 4JA2A 4TZTA 4IG9A 1KY2A 5JQGB 1JDSA 1JAXA 1L8XA 4YRJA 2VPXA 2XECA 1THTA 3DF7A 4LJYA 5E38A 1XTSA 5EZ5A 1AUPA 3TZHA 4BBPA 4PR0A 2ZIZA 2NADA 2PZGA 4ZQFA 4U7GA 1YBVA 2W4QA 2GRAA 4YCBA 4GDFA 1QIDA 3QZUA 3L8MA 3ZWYA 3EDCA 2EIHA 1I6WA 1NSTA 2FEMA 3LCJA 3LHKA 3NPAA 3BMCB 3MWKA 3EQ7A 4Y6RA 3WO1A 3ZZ0A 3HKBA 2ZJBA 3UPDA 4AY2A 2VXYA 3K0HA 4DZRA 1AKQA 3K1TA 3HVRA 4Y1RA 3R9WA 5ENVA 1J9GA 3OM8A 2BFAA 1PFGA 3P9XA 4AY5A 4EG0A 1DQPA 1K7YA 2RD2A 5BXQC 1NP7A 1IHOA 4E22A 3ZXSA 1JIXA 1Z4PX 2ODPA 4AUKA 1P9WA 4Y7DA 2DFLA 2D3WA 3ANNA 1RAAA 5EIBD 4HEHA 3FW1A 1E3DA 1EVLA 5D85A 4P4SB 5JYEA 1NQAO 2YVQA 4R68A 1UBSB 1I2BA 1A71A 1P1BA 2QBYA 4Z0PA 1OU4A 2O6HA 3N0VA 1AHNA 4C7BA 2X8JB 3BULA 3K0AB 4TL8A 4XVQA 3OP4A 2R6HA 2FPKA 2J46A 5AKXA 4L74A 1L4NA 2CXRA 3V8BA 1DAMA 1I36A 3HRKA 3AF1A 4M55A 4ASUD 1MX9A 4AP9A 1L9KA 5ER9A 1U6JA 4AKTA 1DGQA 1UXKA 1ZQ1A 2IS1A 3UKJA 4KIUA 3CF4A 4IXTA 2ROQA 2ZI7A 1U8CB 2F3PA 4AMGA 1SBZA 3C4QA 3L40A 2RGXA 4UUAA 5DCLA 5TJ9A 5KTMA 4EG1A 2IOQA 3KQTA 1IRXA 4I1IA 1N3YA 2HJVA 1RAHA 1DWPA 4RD3A 4PYLA 1QG6A 4UAGA 3HUUA 2VF2A 2ZRFA 5AQ1A 1FDWA 5DPMA 3WLPA 5JHHB 4HLUC 1KMHA 3ROGA 5FFMA 1DBRA 2AWNA 3UA4A 4RTPA 2AMFA 5FQOA 1A27A 1H1TA 4TWIA 2WI8A 3DJFA 1ITZA 2WIDA 1V1RA 5D2CA 1Y9EA 2JJ8A 2GERA 1ESNA 1LEHA 2ZE8A 4GR9A 5B1IA 2VPYA 4WXMA 2X0EA 3WZLA 5GZ6A 4QOIA 1R9MA 2CHFA 7REQB 1P8AA 4CL0A 2XXAB 3UWSA 3AKDA 3GEDA 4FKZA 1CERA 3DL0A 3BFJA 4ETIA 2QR5A 5HRAA 2OT3B 2XCTB 4LRQA 4WTOA 4AECA 2EV9A 4L2IA 1XU9A 1V41E 2J6BA 2XYQA 3X43A 3G0CA 4ZC1A 3E4DA 3H5OA 2FR8A 5K4AA 4RESA 4LGVA 2P9GA 4AFNA 4ETMA 3PEUA 3JV7A 1UQRA 2HMAA 1JKJA 4XTRA 1IK4A 1EP2B 1RTKA 3L6CA 1J2JA 2DT5A 4PYRA 4U7HA 3D3QA 2WHQA 3G7UA 4KEAA 2LIPA 3QUSA 2WAOA 3KQUA 2WE7A 4N03A 3G1WA 2A9KA 2HLDD 4IOLA 4N6NA 4RXUA 5CNJA 3V1TC 1RQ2A 5HSGA 1SC3A 1E7QA 1Z63A 4I50A 3PJFA 2QXTA 3I01M 3WGIA 3DYVA 3R23A 2NSYA 3IULA 4WN9B 2AW3A 2WF9A 3E22A 3ZZ1A 4CRWB 1YU6A 1SUAA 3ZCTA 2KJQA 3ULKA 3NAGA 3P2YA 2D7JA 4INPA 3UG6A 1XDWA 1NFRA 4TKUB 1M1XB 1MOQA 3E03A 4FOLA 3QPCA 4ZVRA 2PL1A 2GF2A 3KTDA 3UWKA 2QZ9A 1CQIB 1SHJA 3AXTA 2NXCA 4PG6A 2IYVA 3WJ1A 4XIYA 4BNTA 1C0KA 2QE6A 3DDSA 4G8JA 5C5EA 4W5NA 4BNDA 3A58B 4ODIA 5TPWA 4DRYA 1NVTA 2W6PA 4GOKA 4BQFA 1MN6A 5E8JA 4EX6A 5LDDC 3P19A 2OENG 3JALB 4XCQA 4J7AA 1KSFX 4WKNA 4XKJA 1EYZA 3DTTA 3KFVA 2IPAB 1SAYA 2GCNA 2Q5EA 3R5XA 5LQAA 4P0PB 1CEQA 1JLRA 3CXRA 1PQWA 4E2FA 4HB3A 2DUUA 1N25A 2IWRA 1GARA 4MRMB 2PUVA 2WFLA 1B14A 5F33A 2OQRA 4GSYA 4KU4A 1GGEA 1KSJA 1Q22A 3K0BA 3PWZA 1VCMA 1DAGA 4K9PA 4EZBA 4FYYA 2KMLA 2YN4A 5KTOA 2AXEA 2HCBA 2YIVX 4M88A 3THOA 1JU3A 4M0CA 3PNOA 3A1CA 4EF4A 5JNUA 1WZEA 5B2ZA 1IXZA 2YY6A 3W3AA 4IP0A 1V4BA 4YQEA 1Q11A 3V8VA 4JGGA 5AK3A 2NO4A 2YX1A 1UKBA 4QJ4A 4WSOA 1K2VN 3EVGA 4IVPA 3ZDXB 4FIZA 4ACBA 2DR2A 4REQB 2A9OA 4IQ0A 2EEPA 5KTKA 3TZLA 1ST2A 3GHHA 4O4IF 4PAMA 1YS9A 4KQEA 3ISVA 1XAJA 4RY8A 3M5CA 2VJYA 4NARA 5C34B 5AW8A 1L4GA 4LJ6A 5K3FA 1USVA 4YCLA 2V6IA 4IGIA 5JZVA 4PR3A 2BFCB 3R3XA 1L7EA 1C4KA 2JLBA 3H42B 3QI2A 2AX3A 3UOWA 1FDUA 3V4VB 3UANA 2WIGA 1QX3A 2Y1EA 3EW7A 4N7JA 4QVIA 1DBQA 2NU7A 3OLCX 2PPLA 4WESB 3LQ2A 3NWOA 4MROA 2H0AA 4M8NE 1ZHOA 4B3MB 1SKUA 1TM3E 5DYWA 3VDXA 2RI6A 2IX9A 1JEAA 5SYMA 3NBXX 1EE9A 1VL6A 3RTEA 3SS9X 5CDSA 3JTMA 2CL7X 5A71A 1OXXK 1R5NA 1I33A 2LBPA 1KZYC 2OV3A 3SR0A 5TR9A 1JJIA 1TT5A 2G4VA 3GK3A 3JQ7B 3OEWA 3PHCA 1SWVA 3A9TA 2D2VA 1RRCA 1UDRA 1XRSB 1MABB 5ANRB 3AF5A 1X1TA 3PC2A 2HC9A 3QPWA 2HXYA 4NV3A 4P34A 3ESXA 4ND2A 4Z1OA 1CS4C 3M33A 1IJFA 2F9LA 5FH9A 3JVVA 4IJVA 4UVDA 3AJAA 5AVRA 3B1ZA 5BSHA 1N7GA 3Q3JB 3EXFA 2EBHX 1JGTA 4UTPA 1FUKA 5F1PA 1FP6A 3PSAA 4NYJR 4OAQA 2CJWA 1BQEA 1HLDA 1L1RA 1Q74A 3EMDA 5B3AA 3OHSX 2I2AA 1BXGB 1X42A 2QKYA 3PITA 1GZDA 1ZD8A 2IYRA 1CUZA 3HKDB 4HLUA 4O1HA 4Q3NA 4IZIA 4U5QA 3GDHA 5FUVA 1T2AA 1WAMA 2ZRLA 1A1VA 1U99A 1REQA 4FZVA 3D5QA 3LGXA 3PDHA 2YXDA 3SYNA 4MA4A 3GT4A 1XMVA 1FOEB 1PUXA 1WDMA 2D06A 4LXTA 5K0NA 3RW9A 4INJA 2NVOA 4TXMA 4G97A 4NU5A 1QAMA 1GTJ1 2D13A 3SU8A 1YVRA 1XTIA 4NZOA 1NQUA 2R84A 3ABSB 2NO7A 3MXTA 4W5TA 4E1VA 1TO2E 3HYNA 2WT4A 4GPEA 4TVKA 1CDOA 1V43A 3KYCB 3PICA 3ACBA 4TLCA 1HLGA 3LUHA 2VJOA 2WZBA 4WL0A 3THYB 2QQ0A 1BYIA 2CLCX 1KC1A 3N8KA 2A4KA 5I7RA 4UM9B 1IB0A 1VCHA 3FMVA 4AKHA 1U2DA 1YZHA 2FWMX