3NHZA

Structure of n-terminal domain of mtra
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Two component system transcriptional regulator mtrA
total genus 40
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhzA00
4HNSA 4QPJC 1NXXA 1SXIA 4ZMRA 3S99A 2MSKA 2IYNA 3I5AA 2JBAA 1USGA 3A0RB 3UKJA 1YS7A 3N0RA 1FQWA 4YGXB 5ED4A 1JDNA 4YS6A 1W9HA 2HQRA 4RWEA 2PL9A 2MSWA 3MQ4A 4WT7A 4EYOA 3O21A 4RK5A 1NXVA 1DC8A 3MA0A 4W5OA 4LX8A 2GBPA 1DCMA 1HEYA 4CBVA 1APBA 1GUBA 3JVDA 4MLCA 4Z4HA 3H5WA 4L85A 1NXPA 4YLEA 5CNMA 1CHNA 2PUEA 1A2OA 1TLFA 2QU7A 5C5CA 4EUKA 3RQIA 4Z9AA 5IEBA 5JS2A 3NHMA 2MYNA 4XFKA 4G0QA 5TQ2B 3E3MA 4L4UA 4MLDA 3O74A 1LBIA 3GBPA 4Z0NA 3SG0A 3O1HB 3C3KA 5JNWA 1TJYA 1BDIA 1BAPA 3KYJB 3DLBA 3GL9A 5KQGA 2FTKE 3GYBA 1M5UA 4MR7A 1IIBA 2L18A 5FWXB 2FMFA 1ZAYA 3GRCA 1U2PA 2WJAA 4MR8A 3T95A 3GV0A 3ILHA 1ISSA 1JFVA 5JNRA 1XWWA 2GWRA 2W42A 3MMNA 1FFSA 1BDJA 2WRZA 2PAFA 3QEMB 4MS1A 1AB6A 1Z2DA 3KLNA 4JB0A 1SD5A 1Z25A 2GKGA 3E61A 3GBVA 4YO7A 5TQ0B 4FB4A 4H3KB 3TB6A 3RVRA 3QK7A 4KQCA 3LUJA 5JNUA 1NXTA 4LDZA 4Z4IA 1BVHA 1U0SY 1RZRD 1C4WA 1YMUA 4ZMSA 5JS1A 3HZHA 2CHEA 3W9SA 4Z99A 1EWTA 1QMPA 3LUKA 1L5ZA 1M2FA 1PHRA 1FSPA 1U8TA 1GCGA 2FQWA 2A9RA 2QVCA 2FMIA 2PUFA 2IPAB 4WXMA 2FN8A 2PUDA 2IPNA 2FQXA 2CHFA 3QLUA 2I6FA 5TQJA 3Q15C 3OLVA 1JX6A 4G0MA 4H3HB 3SY8A 2P9HA 3QX9A 3ROTA 4RK1A 5C5EA 4OLBA 1E6MA 3CZ5A 3FMVA 3OLZA 1ABFA 4MR9B 2F8SA 1W25A 2X7XA 1KRXA 1DBQA 4NCBA 5E3JA 5JNVA 3F6PA 2YHBA 5DLEA 4H60A 5D2CA 3A10A 2P4UA 5I4CA 4NICA 3EQ2A 4PE5B 1ZVVA 3HDGA 3KKEA 4EY3A 1MB0A 1URPA 3H5TA 4PZ0A 3G85A 5ABPA 3GA5A 3HS3A 2LUOA 4W5QA 3N0WA 1YMVA 3DGFC 3IPAA 4RSMA 1CEYA 1WETA 4GNRA 3C3WA 1JBEA 1Z15A 5HM6A 4Q6WA 3A3KA 1DRKA 3H1FA 1FFWA 3OMXA 4QICA 1QQBA 4LE2A 5IUKC 2E4ZA 3RVLA 4KMRA 4S05A 3OQOA 5FBHA 3OMWA 4HNQA 3RVKA 3B2NA 4D74A 2IKSA 4RY0A 5EWJA 4KZKA 3CG0A 1PUXA 2NZVG 1USIA 4OBBA 4MS4A 1EAYA 3M9WA 4O5AA 4HYEA 3TMYA 2E4VA 3EGCA 5JNTA 1MVOA 4RXUA 3HO1A 3URMA 1DCFA 5HQJA 4ZJPA 2FEPA 1JDPA 2VK2A 5HKOA 4RY8A 2A9QA 2GI4A 3G1WA 1TMYA 3NHZA 4OG2A 3C3MA 3EULA 4RV5A 1P8AA 2HJ9A 5IX8A 3VNAA 3I45A 2BGGA 5FWYA 2FW0A 3CS3A 3NNDA 1ZGZA 7ABPA 1AB5A 1ZDMA 2FSPA 3K4HA 3JY6A 1Z16A 1SRRA 3CFYA 2OQRA 3H5IA 4FE7A 2QXYA 1JLKA 1DP4A 4IRXA 3TX6A 3BILA 4RK6A 3MF4A 3MM4A 4NV3A 4G0PA 1PNTA 2YHAA 3KS9A 4RDCA 3IPCA 3JVIA 1YK0A 1OXKB 3A0UA 1GUDA 4RY9A 3IP5A 4XARA 4Z4GA 2HQBA 5IEJA 4IILA 2NT4A 3Q7TA 2FMKA 4KK4A 3K9CA 2LPMA 4F06A 3IP6A 3LUAA 4IMJB 1DCKA 5CNKA 5TPWA 1E6KA 3HXMA 3CZCA 5CHYA 2LBPA 1MB3A 3C97A 3T38A 4Z4EA 6ABPA 2WJWA 1QPZA 1QNLA 2QVGA 2CWDA 2QSJA 4MQEA 1JWLA 2E4UA 2M98A 3N6VA 2IDMA 4Z9BA 1QQAA 3Q7SA 2FN9A 4YP9A 2L19A 4F12A 2B1JA 1P2FA 2E4WA 1RNLA 2A9OA 2R25B 4MQFB 3CG4A 2WY2D 2PKXA 2MYPA 3ROFA 4MR8B 4YWHA 4YR7A 2PUBA 2NUBA 4W5TA 1QKKA 4G0OA 5CNIA 4KPYA 2KYRA 1RZRA 2FQYA 3H1GA 3KG2A 3SAJA 2F8TA 1R8JA 2OENG 1F4VA 3DLHA 4MAAA 4MS4B 3MYYA 4YRZA 4KK3A 5TPWB 1KGSA 2FEWB 3BRQA 5TE9A 2CD7A 4KNYA 2E4XA 3EODA 3JS5A 3LOPA 4EVRA 1Z18A 1NTRA 2MSLA 1MIHA 2RJOA 3JTEA 3IDOA 3L6UA 5T3YA 3QLVC 2R48A 3H6HA 3OO0A 4IMIB 2JK1A 1DJMA 3O1JC 3R0JA 1JH9A 1VPWA 4IGAA 5FWXA 1YK1A 3KHTA 1B00A 2L17A 4LRQA 4Z4CA 2Q5CA 1EWVA 3HSYA 3FFXA 3QELA 1D1PA 4UHKA 1Z17A 1J56A 5EWLA 5PNTA 1U2QA 4EYKA 3SNKA 3QEMA 2FXIA 3Q9SA 3N0XA 4MS1B 4Y9TA 1QP0A 1XHFA 4D6YA 1ZY2A 3LUGA 1NXWA 4MYRA 2PL1A 4EYQA 3KLOA 1SXGA 4LE0A 5KQPA 1JF8A 3UUGA 4F8JA 2RJNA 2H3HA 4HNRA 1VRVA 2MYUA 4G97A 3H6GA 3SM9A 1DBPA 4LDAA 8ABPA 3KYIB 4O1HA 3OQMA 2HSGA 4ETMA 3F7NA 1RPJA 3TD9A 1Z13A 2B4AA 3O2QB 4XASA 4Q7EA 4ZYLA 2PJUA 3H5VA 1KRWA 5IUJC 1EFAA 1L5YA 5KC8A 1Z2EA 3DBIA 3RVMA 3M6MD 4KFCA 1YIOA 3QELB 3LUCA 3RVJA 5KQMA 4TN5A 3SQNA 4N47A 5BR1A 1RXEA 5BRJA 4G0YA 4W5NA 1EWKA 2FKAA 3F73A 1ZH4A 1S8NA 3HDVA 3NNNA 5TPZA 3CRNA 1GCAA 3RH0A 1SXHA 2JB9A 4RU1A 3BREA 3FGZA 5HSGA 5B3JC 1QP7A 3LKBA 5FWYB 5IUNC 5TPZD 4JASB 1NATA 2TMYA 1VKRA 3QLTA 5IC5A 1RXIA 3KTOA 5KI6A 2JRLA 4MRMB 4MQEB 3CNBA 3CKMA 4KV7A 4E7OA 4QYWA 1M5TA 1ZITA 1EHCA 2L2QA 2R4QA 4B09A 5KC9A 3QX8A 3VNBA 3N75A 1PEAA 3KJXA 3FDFA 5EWMA 4EYGA 3D8UA 5BRAA 4JA2A 4QYMA 4YV7A 3LFTA 5GOTA 3HVRA 4F3TA 2IPMA 2ID7A 2QW1A 4RK4A 1YTUA 2PUGA 4N0QA 2NZUG 5IBQA 1QP4A 1TM2A 4KVFA 1PNRA 2PUAA 4RKQA 3QLVA 4OATA 5FBKA 4TLLB 1Z26A 1JYFA 1JFSA 1JYEA 3CU5A 2QV0A 2AYZA 4PYRA 2GX6A 3M9XA 2ZWMA 3MIZA 4LZLA 2JVKA 4PEVA 5DKFA 5DGCA 3FFWA 3H75A 3IP9A 1DG9A 3ILYA 1A04A 4MS3A 1LJLA 2JBAB 3O1IC 2FEKA 4ZPJA 4MQFA 3L49A 2LIVA 2FLWA 2HPHA 2JVIA 3RVPA 5B3JA 1FFGA 4N0PA 3RVNA 1YS6A 3LKVA 1ISRA 2VUIB 3HV2A 3KCNA 3HK2A 2PLNA 3N8IA 3EJWA 5DCLA 4N76A 1XHEA 4P98A 3EDCA 3LUDA 1DBWA 2V0NA 3UK0A 4RK0A 3HM9A 4RXTA 1VLZA 4TLMB 3CTPA 3F6CA 2DRIA 2QR3A 3OM1A 3HJFA 4ETIA 3QEKA 2FLKA 3Q7RA 3HEBA 2PMCA 4E7PA 4EVQA 4KQ9A 1K66A 1GLGA 1MAVA 4KRFA 4ETNA 1NXOA 4WUTA 1ZN2A 4YCSA 3DGEC 3LUHA 3OQNA 4N41A 2VYCA 4MPTA 2RDMA 4EGSA 4RS3A 2FVYA 2WWVD 4M88A 5F64A 3IP7A 3H5OA 1K68A 4F11A 2VUHB 4MRMA 4P1ZA 4WWHA 3T6KA 1P6UA 3HCWA 2XDYA 1JL3A 4NQRA 4XLTA 1BA2A 4RZSA 4OTZA 3O2SB 3H5LA 3LMKA 5KWSA 1LJUA 1E2BA 2MYTA 4ML3A 2A9PA 2M1ZA 2WMYA 3OO1A 1DC7A 1LBHA 1TVMA 5EWMB 3RVOA 3FFTA 4NCAA 1C0EA 5IULC 5EWLB 3GWGA 4JB2A 4JP1A 4RK7A 1ZGGA 5TQ2A 1OXBB 1ZESA 4Z4FA 3EAFA 1M2EA 2LP4Y 3CLKA 1UDRA 4JAVC 3C6QA 5JNSA 3Q41A 1YVUA 1E6LA 1ZH2A 4PICA 3NNSA 4TMYA 2ZAYA 3GT7A 4JOQA 4XAQA 2WB4A 3KSMA 2AYXA 2H0AA 1Z12A 1NXSA 3I09A 2PUCA 2J48A 4LE1A 4RKRA 4N03A 1JFTA 4MS3B 2PE5A 1DRJA 1D2AA 2JCGA 1QO0D 3HUUA 1KMIY 1USKA 1Y1LA 4WZZA 4MR9A 3O2JA 4Q6BA 3BBLA 1QO0A 4DQDA 2HQOA 2IOYA 1U04A 3HUTA 5TQ0A 3N53A 2QZJA 1D4ZA 1P6QA 4IF4A 5T7BA 3I42A 1CYEA 2NT3A 4XXHA 3TO5A 2R47A 3BRSA 3O75A 3H1EA 4D6XA 3OLYA 5KQLA 1F51E 4G86A 2O20A 3OLXA 4MR7B 4WXEA 1I3CA 4EVSA 2IPLA 2RGYA 1D1QA 4OLAA 3P9YA 5CNJA 4G0ZA 1PEYA 4S04A 3DZDA 3CHYA 1ZHHA 4FE4A 1JHZA 3EQZA 4UHJA 5DTEA 1D5WA 3D02A 9ABPA 2E4YA 3OM0A 5EWJB 3RVSA 3NBMA 3T8YA 6CHYA 4DADA 5BQ3A 4KREA 3RVQA 4MGEA 2FMHA 2ID9A 4DN6A 1ABEA 2JVJA 3LTEA 4O1IA 5GQSA 1BDHA 4G0XA 4GPAA 1NY5A 1T34A 3QLUC 1A0OA 4W5RA 3OLWA 3LUFA 1H9CA 1LK0A 4RXMA 3JPWA 2N9UA 3JPYA 1DZ3A
chains in the Genus database with same CATH superfamily
3G0BA 1M2GA 1U3VA 4RUKA 1TK9A 3OZVA 5CD1A 2EKLA 4K88A 1C9YA 2MSKA 3ZZMA 3QNWA 4C0KA 2YXPX 2ZT5A 4NYJQ 4MAFA 5I5GA 1VCOA 2Z56A 4G1MB 1E64A 1LWOA 1TT5B 1VDZA 2ORYA 3AVQA 4L8GA 4D5EA 3E2MA 3STHA 4AS3A 3QOWA 1KRHA 2D7JA 4JYZA 2F9MA 3GGCA 4TMZA 1Q6ZA 4LY6A 3MA0A 3FTQA 3FDXA 5E9JA 1FC0A 2HEIA 5EXEA 4QDUA 5GOZA 2BGIA 2OGSA 3EWNA 3E9EA 3KEMA 2PX4A 3FGOA 2PJZA 3C70A 4A03A 3JAMA 3M5DA 4IFBA 4ESHA 3VVBA 5LOVA 1R2QA 4HN4B 2ZUWA 3L1VA 3GJTA 1JAXA 3PVSA 4MIKA 3UK2A 1YVEI 4WPGA 1B15A 1FRNA 4C87A 1RJ9B 1U0BB 1E62A 3EASA 4EKEA 3P97A 3VHQA 1JVSA 1VC2A 2F9FA 3C43A 3UHAA 1RI4A 4DSOA 1GUZA 2QDKA 4LJSA 4PSCA 3Q0TA 3WL6A 8ATCA 1KYXA 2HSZA 2BT4A 3RT9A 3S3TA 2Q27A 2ZWOA 3WDKA 1O5IA 1WW2A 1ZC3A 3ENZA 5D86A 1QFYA 2WJHA 4CJXA 2E82A 1NP3A 2EJUA 1Z34A 1KMHB 2FTKE 4KHZA 3THYB 1IIBA 4ZANA 5FBRB 1SUBA 1EZ1A 1OXVA 1WPXA 1RM4A 1XZAA 4GU5A 3IAS6 4PZEA 2XUDA 4CKWB 1XWWA 4QDTA 4WFJA 1S3GA 2BFNA 2Q29A 2WRZA 4RE6A 4M0CA 5ELLA 1IN1A 3RYFB 4U2EA 3TAUA 5FR1A 3O8QB 4DDVA 4JBHA 3TB4A 4QULA 2ASVA 3V5NA 3E61A 1E2IA 3CONA 1GQOA 4PFJA 3HSSA 4Z4IA 3G9XA 1RI3A 2YH2A 4HRYA 3ZDAA 5CJJA 5ALXA 3FGPA 3RS5A 1OW3B 3HCAA 4XSHA 4GLLA 1ONOA 2XSZD 2HA6A 3VMMA 4AF6A 5JYEA 3AKEA 5CLIA 3D4NA 2M9MA 4AQYB 2NZJA 2X2FA 2PLFA 2VLIA 5CIWA 1E0KA 1BYIA 4P7GA 1A96A 1JX6A 1W2WB 4RZUA 3TQSA 4PBSA 2ACVA 4KDRA 3VTKA 1ZHOA 1W85B 4O0LA 1T2VA 3F9CA 3KKQA 1YQQA 4AJLA 4BWYA 2ALJA 3RWMB 1LQUA 1VE1A 4XWTA 3VZPA 4A0QA 2P9BA 4AXXA 1ID8A 2JL1A 4JGGA 1C3LA 1W35A 4ND8A 4A0SA 4NVRA 4PLFA 5DP1A 3DHWC 4C7OB 3V7WA 1OHHA 2LXNA 3F6PA 3GVCA 3C7DB 4JT4A 4LOIA 4JJKA 2BEVA 1P2UA 4OQYA 4OI0A 1OBFO 5A0FA 5IJWA 2HF2A 2OSVA 3IEXA 5BSUA 1WXWA 1JHVA 3A2MA 3KK0A 4Q7LA 3RGGA 4NZPA 1HYBA 3FH0A 5J23A 4AY5A 1T8RA 1JKFA 2BAGA 2NNWB 3D43A 3ON5A 2Q6TA 4E03A 3VU8A 4H7KA 1TZ2A 3IPAA 1L8AA 2F8LA 3PIDA 1ONNA 1A2KC 3S2YA 4BVFA 1YJ8A 5ALHA 2MSDB 5ESWA 1ZSNA 4R0MA 3E9NA 3EG9B 3JD3A 3H1FA 4K05A 1T2DA 1CRPA 4G63A 2GA9A 2ZJZA 3SYMA 3RSGA 1N33B 3F47A 4IFEA 4ZC8A 2NU7B 1I33A 3IQIX 3OMWA 3HDTA 3VSAA 3GOHA 2XHZA 1OGJA 1MX9A 2SBTA 4D4IA 2RIRA 2A88A 3Q2IA 3UPDA 5KCZA 4AIIA 3FCCA 3A9WA 3WY9A 1CUGA 1JDZA 4AUMA 1L4NA 1P29A 1T1EA 3K1AB 3ZLVA 1J0EA 1CRLA 1P4RA 2HF7A 2MINB 4U5QA 3EDYA 4NYIR 2VAXA 4R2MA 5FUQA 1FP1D 5ALZA 4K9KA 5JVDB 4WI1A 1ABBA 1N3BA 1NUSA 3FWPA 1S9HA 3C3MA 3HCDA 3PPYA 4LNUA 4QSMA 2ZIVB 3HDQA 4HB4A 5AQEA 3I45A 3MFQA 4HQ0A 3UA4A 4CKZA 3THOA 2FP4B 5DHUA 4AJJA 3K4HA 3JY6A 1MTOA 1KZ7B 1Z82A 3W5JA 2H2IA 3GGJA 1SAYA 1YRBA 3GARA 2A84A 1FW8A 3AB8A 3PPWA 1KMMA 3PZRA 4HDNA 4IH4A 2ZT6A 1YIAA 4PHGA 1U6KA 4E21A 5C1DA 2IX3A 3BILA 2JGRA 3NGXA 3LVQE 3CVOA 2IEZA 2YOHA 2PPVA 1ESZA 1Q7RA 4O4HA 1G6OA 4URVR 4ZCRA 1YFKA 4ARVA 2LCIA 4FZ3A 3GFTA 1UPCA 5AOCA 3KJQA 1HORA 1HSOA 3KPVA 4AURA 3K2QA 2C57A 2BKXA 2C31A 4IILA 3PQ2A 4ZVNA 3ND6A 2FGKA 3GFQA 4GXTA 3MB5A 3S81A 2EZTA 4X1KB 4NE9A 3F97A 3K9CA 3LO5A 3HKBB 1I0IA 5JVDA 3AJEA 4UBNA 3G2LA 3VC1A 4ARUA 4PIPA 4F2GA 3DAHA 1GPUA 3K8QA 2A6PA 6GPBA 2NTYC 3X1ZA 3TLJA 4WD3A 1NI4B 4R69A 3HVUA 3SC2A 4D42A 1U8UA 4TSFD 3LRXA 1OBOA 5EJ8A 3HZRA 2ZXUA 1VSQA 2PX0A 3TDKA 4Y7CA 1OUMA 1NQTA 1SCQA 2A5FA 3LIPA 2YS6A 3WV4A 3D8RA 4BBPA 2FE4A 1U1EA 4D4MA 1N77A 1NJ2A 2PTGA 1LI7A 4LMRA 4MVJI 1QHEA 4YDHB 3VDMA 2XVMA 5EQJB 1XU7A 3AUYA 1VSTA 3RE1A 2PKXA 3L1HA 2X1VA 3ZY5A 4DM3A 3KT3A 4DIBA 3W2HA 1TO1E 1JAHA 4EO7A 4KQMA 1H8HA 1Q77A 3C5HA 5KX5B 1L4EA 1JKIA 3VI4B 2N47A 2GTHA 2P1RA 5T57A 3STWA 2ZVJA 1M1XB 3KZ1E 3U0BA 1CVLA 2GK4A 4MS4B 4LFCB 2P2NA 4I3FA 3TIIA 5CAEA 2YMLA 3GFSA 3B7WA 4WE3A 3BZBA 5TE9A 2BJVA 3G49A 4V1CB 3A2NA 3EIOA 1E1DA 4H15A 1RYMA 2XY4A 1THMA 3KPUA 3VX4A 1RXCA 4O2LA 4EK9A 1GGKA 2OWEA 3BXOA 4X6XA 2ZK7A 5HA5A 2IEBA 3Q5DA 4F9TA 3CRW1 3SPXA 2DX7A 2DLDA 4ARBA 1XAJA 4IXTA 3KYCA 2PH5A 5IDWA 2KBEA 1XXHB 2RH4A 3DF7A 2WB2A 2P75A 3LP5A 2JAWA 1N6KA 5A4DA 1KOLA 4LYYA 1KTVA 1VPWA 2FX3A 5FWXA 1C9KA 3ZU5A 3E18A 4OA8A 4PO8A 5DBEX 3MJSA 2J3HA 4BJ1A 1U8CB 3K09A 4QRIA 1CZKA 1IPHA 4PNPA 4TUYA 2C03A 1UUFA 5K8VA 3HYSA 3BTOA 4B6QA 4BKQA 3H3JA 4LTNA 2WWFA 5HCUA 3W2TA 2P2GA 4JLSA 2FWBA 4C20A 1QP0A 2OMEA 2I54A 1JG7A 1PT9A 4ER3A 1SXGA 1HEUA 4G24A 5K09A 4S1OA 3UUGA 3P4YA 1QG0A 5D84A 1ZM4A 1IZ0A 2H3HA 3ND5A 3NWOA 4GE3A 1EA5A 1VKOA 3GRUA 3NYIA 5C1PA 3SLRA 2BUBA 2H1RA 1O9GA 1FTQA 4KPGA 1D2MA 4GLOA 4GUAA 2OBNA 1ZS9A 5F7OA 1M34E 1RKVA 1RPNA 1T36B 2VJYA 4AVYA 4JNKA 3E9ZA 4GEKA 1C2YA 2VPXA 4LVCA 4ME6A 4U39A 2XADA 3HJCA 1P8JA 1XDDA 4WJKB 4AJIA 4DSTA 1QCYA 3CLSC 2ODBA 3NM5A 2I8AA 2O1SA 3KUUA 2EDAA 4KAXA 3RVJA 3RRYA 3RRJA 1OX6A 4N47A 4YYEA 5DLPA 4K28A 4Q4AA 3D6MA 1AK2A 4KLZA 4XWWA 4AZ3B 1A2BA 3RFVA 1VL8A 4EY8A 5K8CA 4M8IA 1IQ0A 1MNAA 1M73E 2QTZA 3AUKA 3G5LA 3KKOA 4NNPA 1RQPA 1KQNA 2ECQA 4CT4B 1UBHS 2Y1LA 1ZI9A 3CE9A 1YC2A 5EJEA 5IC5A 5IK2A 3BMOA 4E1BA 2I4LA 3MMSA 3I6BA 3BF7A 3PPVA 2OLKA 3K72B 3DMGA 4KJZA 4DIFA 1DTWB 4E4YA 2OILA 4FFSA 4K81B 4UZEA 1JKJA 2CWWA 3PGXA 1NRIA 3ERCA 1W4RA 4W99A 4WUVA 3W2IA 2COKA 1P4AA 5CA1B 3CR7A 2BHSA 1G8YA 3PNQA 5JZMA 3WGGA 2XUPA 1RKXA 1T6NA 1V5EA 3KJZA 1FRZA 3PPXA 3WYNA 5C80A 5JRDS 1OWLA 3GLHE 2R44A 3NT2A 2DBQA 1W29A 2G0TA 3OZEA 1OI3A 3C98A 4MYSA 5I7SA 3S29A 1L7XA 2QE7A 2PUGA 1XZQA 3TTVA 1RHKA 1G5TA 4BO2A 3F49S 3QKIA 4OB7A 2ZRDA 4OGWA 5E38A 1CUIA 1M6YA 4DYVA 5A1JA 1FFXA 1KP3A 2Y4OA 4ARCA 4UTOA 2RGDA 3VSCA 3K0CC 4JYCA 4U02A 3FY4A 2HMTA 1JYEA 5LA6B 3RG8A 5A3QA 1QR6A 2AG8A 2DC1A 2P0EA 4RFSB 3K30A 1ISFA 3I9V1 4E6PA 3U4QB 5DKFA 4ARIA 1RJWA 1MC4A 4TWJA 3ZE2B 1DQZA 2BI4A 2H51A 1GL9B 1HT2E 1CUEA 2F3UA 2ZAOA 3P0JA 4UJ3A 1OQAA 4IY1A 4Y0AA 5F3RA 1IYZA 3T3DA 4DCTA 2HPHA 2NO6A 2VAVA 2CCJA 4IQ0A 1O8BA 1T3TA 4LHVA 2NXCA 1ZG3A 3DHYA 3HK2A 2FEOA 3U4MA 1Y8CA 3LUDA 4U00A 1DT5A 3U62A 4R68A 2G5GX 4XTRA 4P34A 1KOJA 2P9TA 3BTUA 3FVRA 3HJFA 3KOXA 4ETIA 2GEKA 2JLVA 2Z6UA 2W6OA 1DIBA 3GRRA 4I55B 5JDCA 5L7YA 3DL0A 4ERXA 4GR5A 4MA5A 3RRNA 5A7GA 1V1MB 1XTBA 4MEAA 2F59A 3WYDA 3ABIA 2XUJA 1ZISA 5EMNA 5L4NA 3MILA 1QZZA 1GFIA 1YE5A 1ZHFA 1SULA 2CYAA 3G23A 2VJDA 3QFHA 4K1XA 4NJEA 4RFLA 3E35A 3I5YA 2O7QA 2ZR0A 1VCNA 5JZSA 3F3YA 2CEKA 3GROA 3NT4A 1UIMA 4G56A 4L5AA 3IVRA 4ZDWA 4AMYA 5B55A 3K6SB 2P40A 4ZV9A 3V32A 2W6MA 3X1MA 1QQ7A 2E0IA 4H3SA 2HDOA 4TS1A 1HKUA 2DTDA 1C3EA 3NUGA 3LCMA 1DX9A 4G36A 1T10A 4R0NA 4CRWB 1DQSA 3OO1A 3P2YA 1CJKC 7AT1A 3ZXSA 3FPHA 2GHRA 2QL7A 3KEFA 3T1QA 4NCAA 2IP4A 1PT6A 4IIUA 5F2OA 2XCSB 3OOWA 1G21B 1P6XA 4EI7A 4HNUA 4IBOA 4RPCA 2A1TS 4MKFA 3TZKA 1ZGJA 5IAGA 4Q4HA 5K6AC 2QX8A 2YWRA 1XIVA 2C7VA 1JAYA 3D4PA 3BFPA 4G5RA 5G0TA 5B3LA 1N0IA 4FMDB 4LKOA 4A15A 2JGMA 2Z2IA 3ADPA 4GZ3A 3TUZC 1RAAA 5F21A 1HTWA 1UDXA 3OP4A 1W59A 3T5PA 5DNWA 1LF0A 1NXSA 3PE4A 4MRSA 4PGAA 3ME5A 2IF0A 1CUUA 4AN0A 4FGKA 2QX4A 3PKIA 5I4IA 1BTOA 1A5BB 2G3YA 2JEZA 3A2LA 1DQYA 4K3VA 3GN2A 4G1FA 1L9KA 2W2XA 1TMKA 3QU4A 3T61A 5ICEA 4G0VA 3C24A 5D51S 1K6XA 4RM3A 1YAJA 4U7FA 4LNHA 1CIJA 4YALA 1ZN9A 1PF7E 3FPSA 1CYEA 2C4KA 3GH3A 5JISA 1R5BA 3QYPA 3SJUA 3W1VA 4D8TA 5TF4A 4DLWA 4RV4A 4JYBA 4LCEA 1GTG1 1BC5A 4FPXA 4D6XA 1D1TA 1MB2A 1ODKA 3R4CA 1I1OA 2PGLA 4X9XA 1YC5A 5CCDA 4BAUA 1W52X 3QVGA 2IDKA 1VIVA 5HM8A 4WNIA 2UZ4A 3AG5A 4C0SA 4CUJA 3TMKA 1BD3A 4OLAA 5F3WB 3FPFA 4DCVA 5M29A 3AUUA 1FXWF 1OLXB 4WLOA 3WI7A 4YAIA 5L95A 1FFHA 1W1UA 2PFSA 3JAKB 1F17A 4QU9A 5DTEA 4PAQA 3W5DA 4Y6QA 1WCV1 1G18A 2FSVC 3OM0A 1MGOA 4R8MA 3VGJA 4XQEA 5E6RA 2CY0A 1QAMA 3TH5A 1VFPA 1VZ3A 3FLBA 1KPHA 4WNCA 5FI1B 5CA0F 4BRZA 1Z6ZA 3BBPA 8OHMA 2V45A 3D54D 4ZZ2A 3IAM1 1J1ZA 1EHYA 3HWWA 1XRMA 3T5MA 5A9SB 3L1KA 4GVLA 2DFKB 2DLNA 2G5PA 2Q6VA 2R5NA 5BMVB 3VC2A 1OMOA 1TZJA 3DDUA 2QENA 4XZ3A 1LW7A 4IWNA 1NLYA 3RASA 3I9KA 5A1TA 4AY2A 1Y8RB 4MKRA 4HLNA 1AK9A 4P3NA 3SHFA 3TOXA 5IF9A 2DPXA 2ETXA 1P2GA 4J4BA 3A0RB 1QLWA 5ESXA 3OFVA 4R1LA 4YGXB 3TTUA 4HP8A 3VKVA 5ELXA 2C2GA 1NM5C 3PNMA 1Z0UA 4QM7A 3OQHA 4DXHA 2MSWA 1WDKA 1LLUA 5DW3A 5CRIA 3BGVA 3C4QA 3WTCA 2AZMA 1Y81A 3TLCA 2OBYA 2CL7X 1QBGA 3OTGA 4FFNA 3PLRA 1Q3KA 1DCMA 2D2IA 4IUBS 5B6PA 1GUBA 5AW0A 1G38A 3GLIE 2XJ9A 4BO4A 1KE1A 3A1EA 2HNBA 2AXEA 2PJRA 3AJ8A 2OV2A 3IULA 4MAMA 4PWZA 5DMHA 4GR4A 3WLMA 3PUZA 2W71A 4J0HA 5JS2A 3EFBA 3H2SA 4MUJA 4P4SB 1WBDA 2PE5A 3C8DA 5DHAA 3TSOA 1E3TA 4YRAA 4F93B 2GBFA 3GJ5A 1Z2CA 2PRZA 5C7IO 1K7YA 5JNWA 2JGEA 2Q5JA 1DJNA 2GILA 4FMBB 4OFXA 2PV0A 4WSOA 4MJ3A 3X1XA 1BDBA 1GRVA 1MAUA 3AW9A 2HWYA 4GP9A 3EZNA 4OM8A 5D3QA 4A8HA 3GL9A 3SHTA 4RQTA 5B53A 1RPTA 4PG8A 1K6IA 3FM9A 2IFTA 4GLFA 1YIDA 5A02A 3N0TA 1UBKS 3QE4A 1HURA 3ZQUA 1HX7A 1ATIA 2NUPB 3H5NA 4RJJA 1RSZA 3IFSA 2P6UA 3IMFA 1TPZA 3PVZA 3A6DA 3TLXA 3LZCA 4EEXA 2VA8A 1L4KA 5K51A 4AN4A 4Q4CA 3KU4A 1UP6A 1M6NA 5E8RA 5FR2A 1PGQA 1X9GA 2P30A 4PC6A 1RIFA 1H0RA 1ZZGA 1EM8A 5FI5A 3SKXA 1AS0A 1CY0A 3EPHA 1N8SA 3SDSA 4NYMQ 3INTA 2ZAGA 1MGPA 1TJ5A 4UXHA 3RREA 3CZRA 3IBGA 1QHYA 1ZFNA 5TJHA 4JGBA 2HGSA 4AMVA 1X1RA 2OCKA 5C51B 5EE0A 2RHHA 1GNSA 1ISPA 2V3VA 4ZAXA 3N7TA 3PEWA 5AJWA 5IVHA 2Y4NA 1QFXA 1A1VA 4GICA 3HB5X 4ECAA 1MFPA 2RARA 2YV1A 3GFOA 3HC7A 1QO7A 1RCUA 3C16C 5DI9A 2CVHA 1M8PA 1DI0A 1FB5A 1GDDA 4B2YA 5TF0A 2MMGA 2AOXA 1KWGA 1WKVA 2FOXA 4CWAA 4RO0A 1O96A 1YZTA 3IQWA 2PO5A 4RLSA 1D6JA 1HSZA 1PFWA 1UC8A 4TTVA 2JDID 3UJBA 1J1UA 5AKGA 4DIMA 1WWKA 2BF7A 4I1OA 2SHKA 3USCS 1XL0A 3F3MA 3U3XA 5JNVA 3DUFB 5JWHA 4H60A 1TCAA 3UEOA 1MA3A 4DJDC 2Q5QA 2DFTA 5IAOA 2JCBA 1UIRA 2HAEA 3G0OA 2Z3ZA 3V4ZA 3WAJA 4UTPA 3EIWA 3H5TA 2R65A 3QRWA 4HB0A 3K6JA 1JLSA 1TPYA 3AY7A 2RGXA 2LUOA 3GA5A 4KXFB 4RLQA 4FBMA 4RH0A 5K3EA 4YHHB 1GTMA 2J4FA 4RYLA 2ODPA 4RMGA 2NZXA 1BDMA 4JLMA 1TEVA 1Y5LA 3C3WA 1KEVA 3BD6A 3OPYA 4J4TA 2AHRA 3BDAA 2I3DA 1DRKA 1VLMA 2IOQA 1ZD8A 3A3KA 4PRZA 4X91A 1AT1A 2R11A 4BN5A 4MHTA 3KXPA 2Q2WA 1PR9A 2PZBA 3WR5A 3IALA 1WF6A 2RB5A 3DB2A 4NCJA 1SH7A 2WQ6A 1EB8A 3PHCA 2Q3HA 2AQKA 4Q9IA 2HY7A 1RD4A 2EFJA 4YC7A 1YQTA 2P65A 3QUCA 5C8YA 2ZE6A 2Y1EA 4ERNA 4JK3A 5LMZA 1ACLA 4E0BA 2XZOA 1R4MA 1H5UA 3JZFA 3PC2A 3SDBA 1MW8X 1NVTA 1PL7A 1X9HA 2J46A 1O6ZA 2MSNA 4E5VA 3RTGA 4CR8A 3E0QA 4OG2A 1NFQA 2J1LA 3ASUA 3LPMA 5FIUA 2NWQA 3G6KA 5HNKA 4X66B 3B1XA 5GV7A 2DR2A 4RHTA 2DPHA 3DYBA 3P4UA 4Z7QB 4WAUA 5DHQA 3ONVA 5J4VA 1XA4A 1SRRA 2GKOA 4L75A 1IM8A 1AS3A 2E6KA 3PNSA 3T41A 4D8UA 3EAGA 3CH4B 4JR1A 1Y8RA 1TLLA 2QR5A 1QR2A 3ETEA 4MI9A 4U7WA 3FHTA 1XCOA 3FRJA 4MQBA 2ZVDA 4QTZA 4RK6A 4RTJA 2P2LA 4LOHA 3OZXA 1N4DA 1XDUA 3MM4A 2QX6A 2VP9A 2DEUA 1C0IA 4DCNA 4RCYA 1EIZA 4YT8A 2C0CA 4FFBA 4S1PA 5AKKA 2YHSA 4YP6A 4AZVA 4EJ6A 5BN1A 4YI3A 2DHRA 1C7QA 2JFZA 4JSTA 4YIKA 5LYYA 1ZYUA 4ZDIA 3ENKA 4EUSA 1XMQB 3AYZB 1EFHA 4MH0R 4RDXA 5B4UA 1O95A 2AZDA 3LCRA 3RK1A 3N2ZB 3QFSA 3UK7A 4OGKA 1FP4A 1EDOA 3ITEA 3PCXA 1KS2A 2ZFUA 5DV9A 1IWOA 3C97A 3EFOB 4GWLA 2DBZA 4N3GA 5FV4A 1NVFA 4Z4EA 2V96A 3U7EB 3RBXA 3O6VA 4ZEMA 4J2OA 5BV2P 4OSPA 3UHPA 1J99A 2QPLA 4LGMA 1WD5A 1DKPA 3N6VA 1LW6E 2IDMA 5LYJA 1RE1A 1HNZB 3FUVA 4G5HA 3IT0A 4JI4B 1NBWB 4HY3A 1G0OA 3R24A 3LCVB 4F1WA 1ONPA 3PC6A 1G8FA 3OF5A 3DOEA 1VI5A 5DEOA 5BSVA 4FYKA 2E9SA 5E6RB 3CG4A 3TNJA 4IDHA 1KY3A 2X6TA 3IX7A 4PXAA 4KXUA 1DC5A 1KXJA 5E9AA 1E4EA 1PK8A 1UOEA 1XLVA 2J67A 5FULA 4QJ3A 3SOZA 2V7QA 2CXSA 1PN3A 1Z22A 2NO4A 4Q02A 4W4TA 3LYLA 4ALIA 1ECGA 3ROPA 1H8HD 3WWCA 4OQMA 1WY5A 2BBSA 3T3PB 3KKPA 3TZCA 2Q3EA 3CH5A 3I1YA 3U4GA 5DT9A 4KNYA 1QVVA 2A94A 4GC9A 4G9BA 4ZDJA 4H1VA 3PDIA 5J4LA 1YRAA 1MIOA 4J2TA 2WV7A 2NYUA 1SXJA 4RMHA 1KMQA 2RJOA 2WYOA 5FPYA 5HG0A 1LK5A 1B6TA 3C1OA 3T15A 2JEOA 1RACA 1Y9AA 4CLEA 3CO0S 3EXIB 1E60A 1EJBA 3B5JA 3K9NA 4CEHB 5C8YF 4IGAA 4O25A 1YAHA 1VJ5A 2QLMA 2XTAA 5CEFA 2AFIB 2IU3A 4EFDA 3HSYA 1GPWB 2ZP1A 3QVTA 2NXEA 2XF8A 3ZCPA 3OPQA 3D2CA 3R3VA 1A72A 1HYEA 2AR7A 1ZVKA 2VF2A 3W5HA 1GNTA 1IMJA 1FQOA 1SKYE 1SR8A 1Y9DA 1ZY2A 4P6VF 4QDJA 4CG1A 3J7TA 4D4HA 2W11A 3HHEA 1AV7A 3HJBA 5CLQA 2OECA 5IZCA 1JF8A 5J4YA 2R6FA 3C5CA 2VNKA 2YINC 4UMDA 4BQPA 1Q1ZA 3JCZA 3AV0B 3C6ZA 4HNRA 4EMTA 1CW2B 4A0FA 1XPRA 2FFRA 1A7KA 2P3QA 4HN2A 4R9UC 4AJ9A 3FNQA 2JJ1A 3D9QX 2PN1A 5I4KA 1F5NA 1SNYA 2HSGA 5LZ4A 1NUUA 4LWQA 1F6WA 3B51X 4C4ZA 2IU6A 1Z37A 4C07A 2OO7A 3LYHA 2ZXEA 2C2OA 2ZIZA 3SYNA 3TRJA 4HLUA 1KJ9A 3WWDA 1E0JA 4KBGA 1RLMA 1KI2A 2K7ZA 4H4EA 3T5CA 3UENA 3D3QA 1EFAA 1HZZA 1Q19A 3MTBA 3LUCA 4W9MC 4LJ8A 5CBPA 2QW0X 1S5PA 2QF7A 3LD9A 4JITA 3AQ4A 4K0RA 1P2BA 3ROQA 1LVGA 2DSNA 2YJZA 3WB9A 4ZOAA 1R0RE 3FG9A 4EABA 2C97A 5TPZA 2UXDB 4DW8A 3RS2A 5KSWB 3FA2A 3COWA 5HSGA 1HPLA 3TOCA 1QP7A 4R1MA 2DXIA 1PV1A 4RORA 3SF8B 1P60A 3A14A 3NAMA 3PEFA 3UYKA 4HT3B 1XI2A 3ODPA 5T4BA 1X7WA 4CTOA 3WBJA 1UMDA 4IOLA 3TX2A 2J3EA 2H18A 4D97A 2BLLA 1PO7A 3E03A 4XIYA 1JLHA 3VOAA 4KV7A 3HN7A 2CJYA 3IO5A 4CMEC 3CY6A 3U1TA 1QWOA 3WRWA 3T7IA 2ZIWB 1CUAA 1WXHA 5DM0A 3PPIA 3KWMA 5BWBA 3RS0A 1G19A 4QFBA 2ORVA 4ZXPA 3BMQB 3FDJA 4HDMB 3EEFA 4Z3OA 3V1TC 3OLCX 4JA2A 2WZBA 3N28A 3M49A 4II3A 4OLFA 3JQGB 4ZI7A 4N0QA 2VIIA 3JYLA 5HF8A 1RXWA 5A3JA 2ZM6B 3QLVA 2ORIA 3W77A 5C2JB 5TEVA 4IDCA 521PA 4JODA 4ATNA 4JLDA 3DV2A 3IHLA 3UJDA 2OQVA 4XUGB 1UPXA 3L93A 5HBGA 1BVUA 2WHQA 4M0DA 1QPGA 3VR3D 4B82A 4F9EA 3IKTA 2UXCB 1ODTC 1P0CA 1OIWA 1VHJA 4UNRA 2WZQA 4HCJA 3DULA 3KVYA 1ZINA 1SU8A 2BZ1A 3BIFA 5CYPA 4C08A 2HLDD 3EPLA 5LLSA 4DF3A 3LFUA 2DP4E 4X7RA 4BMZA 3PHGA 4AO7A 5AW1A 2CXTA 2ZJ0A 3MCTA 3L49A 2VOEA 2FPOA 3D0QA 3D4BA 3L7BA 4XX1A 5FQNA 4B3BA 4UQLA 4JUBA 2X0FA 5IW8A 1PT7A 3MYRA 3HRHA 1GARA 4K9MA 5FA5A 1KO5A 1Q0RA 1UANA 4RF5A 5JIBA 3KEQA 3GMSA 5WRFA 4PZYA 4AO6A 2OGWA 2I2AA 4UD2A 2AXQA 2G09A 1QF7A 1AGPA 5AI8A 2QR3A 4V3CA 1LI4A 3A1SA 4HB2A 1NNEA 3UT6A 3TJMA 1AO3A 4EKGA 2ZWVA 4F4FA 3QKSA 5TGZA 5JLJA 3UO8B 5I7FA 2WLTA 4B4KA 1FLNA 2GBGA 4I99A 5DLQC 4UU8A 4E11A 3KXIA 2E6UX 3P9KA 1YBVA 1PTKA 4TVSA 5DGHA 3LUHA 1CJSA 2IVZA 3AF2A 3DG9A 4D92A 4N41A 1O89A 2VP2A 4O2BA 3DZKA 5AK5A 1BXKA 1Q57A 2YYSA 2HJGA 4JL6A 1I2CA 5HGJA 2VBFA 4FQ8A 4F11A 2A9KA 3DOIA 1RLIA 1CQWA 3UQZA 1P6UA 4CCYA 5AVJA 4I1UA 2II6A 3SX0A 4GZMA 2GCIA 4POAA 5KUTA 3AUAA 5EUCA 5H7XA 3F6BX 4TLDA 4DT1A 3MJEA 3KUKA 4TS9A 3EBPA 4GZ6A 3TR0A 1O94A 1DC7A 3WKAA 1EUZA 2Y2UA 1ULZA 3KQLA 4LTDA 1MHTA 1Z0DA 2F4NA 2RIPA 1X8LA 1C0EA 3L82B 2OBBA 4KNWA 5H83A 4A0GA 1UAAA 2NZYA 2OD7A 3L7KA 3ZCTA 5CIYA 2VQEB 2CV0A 4DLXA 4X3OA 5KZMB 1E8NA 3CLKA 1QV9A 2OAQ1 3BMOB 4P08A 4RY2A 1I7DA 4K8OA 4RPKA 1PGJA 4B2LA 4QBHA 3RAGA 1N5JA 4YAGA 2ZTMA 2FP4A 5CW2A 4EYEA 4TMYA 2DLCX 5LLTA 4QOIA 4JOQA 1CS0B 2AS0A 3UJCA 1RZUA 3ED1A 3FB1A 3H9GA 4QPDA 4TWBA 5HF5A 1K3TA 1IZYA 2J85A 4UDNA 3TUIC 3ZQJA 2VQDA 5GJVC 3PDHA 4PC2A 2DQSA 5EN4A 5IZCC 2JCGA 3DCYA 2ZB2A 4Y2PA 4QOHA 4OCZA 3UWKA 4A73A 2EQBA 3LWNA 2PWPA 4YMLA 3QA3E 2NPOA 3G7SA 3WYFA 3SGLA 4X7BA 3U3OA 3AR2A 1J7JA 2YN4A 3A27A 1KFEB 2P5UA 3OZWA 1PR0A 2J0SA 3DXXA 1TK2A 4QA9A 1L5NA 1OCEA 1DG3A 2BKAA 4I46A 5KTKA 2WOOA 2JF0A 5DE3A 1TKCA 1E4VA 2E37A 3VHXB 3WGOA 2C59A 1IUPA 5SZHB 2BHNA 2QG4A 4KACA 3VVLA 4EHNA 4ESEA 4EKYA 2QN7A 4GMDA 4UUAA 4J75A 4B7XA 1NP6A 1X39A 2V97A 1SVMA 5JH7B 2QUJA 1I4OA 2AE1A 3GO4A 4W8GA 3P9RA 5EJ7A 3JZIA 1JDJA 1XRRA 3BK1A 1EM6A 1ZXLA 1WCYA 3DL4A 4ZHSA 2EEPA 4ZEOA 4EB6B 1FFCA 4BQFA 3OWHA 1ZQ9A 3PTLA 3R6GA 4R16A 5AIAA 1Z6GA 1KI8A 1PFGA 5TSDA 5KOIA 1N32B 3IOBA 3AX6A 3LTEA 4KSYA 4GPAA 1NY5A 3COVA 3ZDZB 2CDCA 3K0BA 3BKWA 2OESA 4J0KA 1CVRA 4LHYA 1H9CA 3EFHA 4KEAA 2Z6QA 1U63A 5HYVA 3OBIA 2PIDA 5IK2D 1IJEA 4KH1A 1KYQA 3KHKA 5J5VA 3KJNA 3ZDDA 1SXIA 3EDQA 1JHUA 4EW6A 3TGLA 2W6IA 4UHBA 1Y4UA 2ENUA 2Z3WA 4RHXA 3UY4A 2W6PA 2P7IA 3RR2A 3QUBA 2AN3A 4Q3BA 4WMLA 1KC1A 3LJKA 4BNMA 4M9ZA 1N6IA 2RHOA 1GAXA 3GEBA 1KFCB 3CX4A 2Z5LA 4FYYA 5M2QA 1BKDR 5HUJA 3T7SA 3CMMA 1MX5A 4LZNA 1JWAB 4Z0TA 1OI2A 3I64A 1V3VA 3VPFA 4Z4HA 3UBTA 1IONA 1A9QA 5C7OO 1ZX1A 4GZ5A 4D0GA 1GZ5A 1QHGA 2XMSA 2GM3A 1E9BA 3B13B 4G85A 4KCGA 3T35A 4BU1A 4PC1A 3RQIA 4Z9AA 1AGXA 1N7GA 1UDCA 3FCSB 3NTUA 4YUYA 1GWNA 4JL8A 5FH9A 4FGUA 1PFYA 1YZNA 3NPMA 2IH2A 2PKEA 3LL4A 4K0KB 3GBPA 4WA8A 2NVOA 5ALUA 3ZK9A 1SXJD 4P5EA 2DUJA 4RENA 1VYHA 1NA5A 4BO8A 3LBIA 2O59A 1ZXXA 2VCYA 4B3FX 4OJKA 2OQIA 4GL2A 2A9FA 1U0EA 4JJGA 2J9YB 4REQB 4Z1MD 2R5WA 5GONB 3I2JA 1ISSA 4DRYA 5JNRA 2F62A 1BGWA 2C88A 2ZG6A 3JQGA 4MW4A 4ZI7B 4OQFA 3UZUA 2XKKA 1AD2A 3EVEA 4P0TA 4MS1A 3RJ5A 3KLNA 3KJHA 3HADA 2BSAA 3U44A 3I6QA 3N5CA 1ND6A 1Z2NX 2XE7A 5K5EA 1R6DA 1EBUA 4KBFA 1XEXA 5U1PA 1V7CA 1L7DA 4H9GA 3JARA 3K2IA 1YULA 3OF2A 4TKZA 4OJQA 1KAQA 1NBHA 4KZPA 3SHOA 3FMOB 3UT0A 2WM8A 2P2DA 3PHIA 3UG6A 2FZ5A 2RAUA 2WV9A 3RSFA 1JG3A 3NXKA 3OCJA 4B80A 2WJ3A 4E2YA 5EIOA 4EI9A 4EHHA 2Q8NA 4UUNA 5J2UA 4A16A 4P4NA 1EE9A 4OI4A 5GZ1A 1IHYA 1OAOC 3R0QA 2FQXA 1E5DA 2CHFA 1DARA 1AK1A 2YXBA 4BZXA 3OZBA 3KNZA 5IJ9B 4FFDA 4YJ3F 4XOIA 2WHYA 2QD5A 5I7RA 1BKYA 1KAEA 2AXPA 1RQRA 3O0TA 4HDSB 4OJYA 2Q21A 4ALJA 4AQ7A 1Z75A 4DQXA 1AHNA 3P9PA 2AOTA 2R68A 1MJGM 1M1NA 3PENA 2OQ2A 1CUZA 2WVHA 4P7JA 2F00A 3MT8A 4KFSA 4DDWA 3K71B 3H2GA 3FAZA 2PR7A 4CMJA 2FAXA 3SI7A 4L8YA 3GLIA 5LZ2A 1KRXA 4CLRB 5KNBD 2Z6VA 3ZZTA 1TIPA 1T24A 4X00A 5CDGA 2H00A 2PNJA 5LNK6 1AH2A 2PFKA 2YYZA 1RI2A 5HK9A 2C9YA 3VR4D 4PC7A 4F56A 3NKVA 2RONA 3GVIA 3T7DA 4Q7MB 4PE5B 5KQRA 1QH1B 2Y0CA 1OYVA 3QX3A 1HTBA 1YQXA 4BWFB 1H0HA 1DVRA 2Y93A 2DKFA 2ROQA 3EIUA 2H29A 3FCEA 2XT0A 3HJAA 3G85A 3HA5A 3NHJA 1PYGA 1EPUA 3OG9A 3SJZA 4YFVA 3TJRA 1R37A 4KXNA 4FM9A 1J8QA 2ZJ6A 2JFGA 2VJQA 3ABRB 5JWOA 1FFWA 4HGYA 4MRAA 1KR5A 2PSDA 3O7WA 4RGYA 5KWEA 1U2SA 4IJWA 2WYWA 2ZR7A 3NLLA 5KKAA 4L76A 1C9DB 1OLUB 2GJ8A 2WD7B 1QRUA 3TSYA 5HZMA 3DXFA 2FPGA 4K7JA 3QPWA 4M22A 2XA1A 1Z68A 2BEWB 3FVWA 4J2HA 3ZH2A 4B4VA 2BISA 2I6QA 4BNZA 2QSYA 1PR3A 3ELWA 1EKXA 1B14A 2CDRA 1ADBA 4TLEA 3V8PA 1QC5B 3HO1A 2O5EA 5AKEA 2C1EA 4HLUC 1JDPA 1RCFA 4UBMA 4BQRA 1BCSB 3EZ7A 4NARA 3P8ZA 4JVMA 5HDBB 3CIFA 1P8AA 3T3EA 4C2BA 5EKUA 3EN0A 1QYIA 5IDQA 5CK4A 5FWYA 2BGGA 4GI5A 3ETDA 1WV1A 3CUSA 4REMA 3Q7QA 1AB5A 1IM2A 3T34A 3VZCA 1WQ4A 1MDFA 1OBCA 3O3OB 1IB6A 1WM1A 2CJFA 3A6HA 5JPIA 1XVLA 2ZRHA 1IN8A 3IV9A 4LHEA 4E51A 5A4IS 3KQVA 4WCFB 1OZHA 1RBYA 2KE5A 5LQUA 2R0QC 2ZJAA 1G5RA 5T8KA 2QTBA 1GPNA 4B71A 4F2DA 5DHTA 3HFSA 2FI1A 1W36D 4Y6GB 1NJ5A 4FGWA 1ZNZA 1YDHA 3C5WP 3HCPA 3IP8A 4J16C 4DFDA 2HPVA 4F2WA 2PR2A 1ZUNB 1NW4A 1QYXA 3GJYA 1TFRA 3PCRB 2DYKA 1U7ZA 3PJDA 4G25A 4BFXA 2LDXA 3A9CA 4Y67A 4XARA 4QKQA 2F1HA 3A70A 3WLOA 2XECA 3ZWOA 1TB4A 3GA0A 5JC8A 1OKKD 3TCKA 3PD0A 3U40A 1FZTA 1LC3A 1Q0QA 3W8EA 1ZCJA 4B74A 3ILXA 1U0GA 3LHIA 3VR0A 2ZU0C 5F1YA 2O0LA 1TX4B 1WSDA 4Z2YA 2GN8A 3QH4A 2C7QA 3BB4A 3E5RA 5A5VA 2ONKA 3UXYA 2JLAA 2O3UA 2R1VA 3KVRA 4I4TB 5E1BA 4HYTA 4KQFA 2Z9DA 3KR9A 1WUTA 4M1QA 1F8FA 3QOFA 4IIYA 3CBQA 4TMWA 4DLBA 3GLFB 2XOKA 1XN4A 3CM0A 3OPYI 3T5BA 4EX7A 3C5EA 5CLGA 1K4YA 2IEAA 2WJVA 1U2ZA 3HJGA 2R7KA 3LDGA 1J8DA 1RNLA 2ZLBA 3HL0A 1ZSYA 3MSCA 4MQFB 5EERA 2ONCA 4JQZA 1HQDA 1OD6A 2WY2D 1JBQA 5J2TA 4QPZA 2WVGA 4REQA 1ZN7A 1G64A 1YGYA 3Q7EA 1MFZA 1DMRA 1MT0A 2H2AA 3JR7A 1QHIA 1PQPA 4FYHA 5EESA 4DIDA 1OILA 1P77A 3GCWA 3FPGA 1MQ8B 2ZSKA 3I2KA 3LPNA 2Y1GA 4OK5A 4C22A 2JBWA 3N2GB 5F1PA 2LCFA 3F96A 4NCHA 4D4KA 4CT5A 1AVTA 1G6HA 2YJGA 3AIKA 3LY8A 3LCJA 2V5AA 3NO4A 4L8WB 1X7ZA 3SQWA 4E2FA 2ZIXB 3M1AA 4FZVA 4TX1A 3EEIA 1A98A 3FSRA 3ZV4A 4GBGA 1E9SA 2XMRA 3AHGA 3FKQA 3OU2A 3WJ2A 3WGQA 1M0WA 1RCTE 1DRWA 3AHDA 1P7PA 1SJ9A 5DPMA 5EZYB 3O1JC 5AVKA 1JH9A 4KQHA 1IG3A 3W2FA 1T5IA 4DJFC 2FF5A 4AMUA 5J2TB 2NVBA 2O8DB 1UBUS 2QRHA 3RDPA 1EK2A 2QZ9A 1LFAA 4IDOA 1S8OA 2Q3MA 1U2QA 3P94A 1TJPB 2B9VA 2IUTA 4RPLA 3RLIA 4RAQA 2BUAA 4IZIA 4OHKA 3A4NA 4HH4A 2WICA 2ZOSA 3IT1A 4EHJA 2CYBA 4KE8A 3VYSB 2SKCA 1ZW1A 2QRMA 3NHPA 4HWRA 2F43B 2BFWA 5JAZA 4GBMA 5DX0A 3M4NA 5JSUA 4EWLA 1CRZA 2VPTA 2Y8EA 3DZHA 1KGDA 1OZAA 1RJEA 2VBCA 2HJHA 3DMYA 3GCZA 5IH3A 5A5EA 2B4AA 3CLHA 2G25A 3INRA 4B8YA 4ZYLA 3Q8XB 2IY9A 1IEXA 4EFLA 2XA2A 3CVWA 1HA3A 1NN1A 1P1IA 3C3JA 4IJMA 4KVZA 3WFJA 4BZQA 1I51A 1X1SA 4KFCA 1FQJA 1Z2EA 3GT0A 3QELB 1JHOA 3B3GA 2XKBA 5CLJA 1HI9A 1J22A 3SQNA 2BL4A 2G6TA 2CLKB 1P19A 2X41A 1IJKA 4HMPA 3HWRA 2CSUA 4EB3A 1K3FA 5K05A 3DLIA 4LK2A 3OURA 4CGYA 1VIDA 5FOVA 4WKPA 3P2JA 5JY1A 3NM6B 3ILVA 2JCSA 1AGYA 3FGZA 5CTAA 4KGXA 1EXDA 2J0EA 1IHDA 3NB0A 5JJCA 4PSUA 1LX6A 3QNMA 4FLEA 4B35A 5JMTA 5K3OA 2H06A 3OFND 1II9A 4ZCSA 3ZG6A 3W8NA 5JJLA 4DSNA 4NAVA 3U3KA 4Y3UA 4KXXA 2R1TB 3R3WA 2V1UA 1S2LA 3GUUA 3M6WA 4ZP1A 3HL4A 2EBUA 3G2OA 1HK7A 3TRDA 5BUCA 3ONFA 5K4GA 1RVDA 3KQWA 2YKGA 4HG2A 1G59A 2CHQA 1W5FA 4QJ5A 4C76A 3VNBA 1NVDA 3B1ZA 3GLIB 1T4GA 2H17A 1YR7A 3O93A 1RRKA 2HCFA 4CCSA 1WU8A 1XWIA 4NXMB 1V4NA 3H9EO 4YPOA 2DE0X 3PDJA 3OLQA 1X92A 4QZVA 2LKCA 1C9JA 4JDPA 2Z95A 4GF5A 2DWQA 4RK4A 3ZCQA 4G8BA 5BVHA 1ZD4A 2HXGA 1F6DA 3TCNA 1E63A 1YKFA 3WFIA 1BMTA 3WHLA 4M7WA 2QLBA 1RBMA 4XJXA 5KNDD 4JJZA 3A3OA 2AOUB 5IG2A 4HAZA 3CCCA 4J16A 2WAYA 5U4QA 1Z88A 3KAKA 2O5CA 2XQIA 4FOTA 3HPQA 2QV0A 1TTTA 4IZOA 2J3LA 3VBCA 3AVTA 1XP5A 3V1YA 2I4NA 3M9XA 4GD3Q 1U3UA 1K7XB 4QPCA 4UNQA 5IBRA 4EO4A 1TU0A 3ZLJA 1ZAKA 4H7DA 3OOJA 1P0QA 2JBAB 3HLYA 4DR3B 1JN0A 3FDZB 2FEKA 3B3QA 4KOAA 3AFGA 1EFUA 4X5OA 1G7RA 4U1RA 2C8KA 3E1KA 3CO5A 3V2UA 4AYTA 4HQ6A 1EFVA 4EG5A 5J2UF 2FY8A 1YS6A 3OJCA 3WIUA 2JLYA 5K0FA 1GV1A 1WZEA 1N9KA 4FHZA 3ZWDA 3MTJA 1QC5A 4Z51A 1NV8A 1P2SA 2LDBA 2IX9A 1VLLA 5JJIA 4N7JA 4E5DA 1MT3A 5BVGB 1SQ5A 4M7RA 1OXSC 4EKDA 2IC5A 1U7UA 4QL3A 3W5SA 2FZWA 5CT8A 1SQ6A 3T1TA 4EVQA 1OVGA 1RXUA 5E0OA 2BDTA 5B7NA 3PDUA 1I30A 1RJ9A 2ZWPA 3H9CA 3KALA 1H1LA 1T29A 3ZS8A 1OC4A 5FKJA 3ZLTA 1CR0A 3VH2A 4ZHQA 2HQ1A 5IAEA 1YBFA 2HIAA 3NJ4A 4WJZA 4TWIA 3GLFE 4CKYA 4JC5A 5K8IA 1F0PA 1T35A 2WWVD 2HA2A 2WUEA 4EI8A 3UFXA 2D6FA 1OT5A 3UOAB 2ODQA 4FX5A 5JXWA 4WWHA 4P22A 1VPTA 2AFHB 3JQDA 4JL5A 1M2KA 4OQ4A 4EB6A 1IY0A 3HN6A 1XLUA 1F48A 4TQUS 4JWTA 5G41A 2W4QA 2QUIA 2FSVA 1WSBA 1KYYA 2CW5A 2J4CA 3AR6A 4WADA 3DC2A 2QD4A 3P5SA 4NU5A 4DDMA 2NU9B 2G72A 3OJOA 3PKZA 1PJ3A 2EG9A 2OO5A 4ZAYA 1HL3A 1POWA 4K46A 4C0XA 1XFAA 4HGRA 3AVXA 4AUKA 4GT1A 4IS3A 4LHWA 4MUXA 3HPRA 4KWIA 3TZEA 1YHNA 2ZUDA 3MQFA 4RD6A 3DW3X 4X1OA 4DRXB 4MIEA 4JSRA 4KQGA 1MW9X 4P2GA 4R9VA 4OHZA 3ZDFA 3L4EA 2AZXA 3C6QA 1LSJA 2WHXA 4TXJA 5AW8A 1ZH2A 3QXJA 4ER7A 3R74A 2J7PD 5IPFA 4CGZA 1EXVA 1DMSA 1YUMA 2FETA 2DQZA 3BD7A 4FOPA 3VPAA 2VDPB 4U7HA 1MEEA 2BE9A 1Z63A 1U2GA 2F7SA 2ZBEA 1LDNA 2HDHA 3WL3A 2FOLA 1M2NA 1ZBDA 2P90A 2A5YB 1YQUA 2L42A 3TQIA 1JPNA 3OJWA 4MW7A 5ALWA 2PL5A 3GUCA 2XTJA 2X23A 1THZA 1TIKA 4F96A 5AKHA 1BVYF 5A4FS 1K7FB 1AUVA 2HQOA 3EXHA 4G89A 4LJ9A 3EVNA 3DH0A 4PVCA 2F67A 2ZW9A 3TQCA 2CL0X 1O9HA 4AF8A 4IOJA 5L6LB 4BNNA 1QTQA 4IDDA 4JB8A 3STUA 2PSJA 3VR2D 1JE1A 1WP4A 4KDEA 4US2R 1M5RA 1XD8A 2DHQA 1LFDB 3G7UA 3GLQA 1R9NA 5BUSA 1V1RA 4L5YA 3UMSA 4ETWA 4NDNE 5CFZA 1DG1G 1TO6A 3ADCA 1JNYA 2ZZNA 2YBDA 4G9EA 1TCVA 2UYQA 5JADA 3CUEF 3VNQA 3VXKA 1JSRA 4AO8A 2IYAA 4XCVA 3PXUA 2BOVA 1KI4A 4I8IA 3D02A 3IESA 4W5JA 1RJDA 2HWKA 1WS6A 2ENWA 3RVSA 4XVRA 3OT1A 4YAEA 6CHYA 1PW7A 2D1TA 3N87A 1IL0A 4IEFB 2PCLA 1QGUA 3O4JA 4LZAA 4G5GA 3UHFA 5HMLA 4BFUA 2RHGB 1EFRA 3L8DA 5G0SA 4O4LB 2QMHA 4KDCA 2VTEA 4Q3KA 2RKWA 5AKXA 1T34A 4M1TA 5AESA 2DCMA 5C4GB 3FCAA 2N9UA 1ZIYA 4MJ7A 5LKAA 1J24A 1NBEA 2VSQA 3SXUA 4XWKA 1WIWA 4HDOB 2A5LA 5JSQA 1BROA 3LQRA 3BGIA 2ZIUB 4MW5A 4NMMA 1V6CA 1BS1A 3M6IA 4X64B 1TTPB 4B8WA 1ULAA 2BGWA 3UICA 1JIUA 1V96A 2ZSUA 2A9VA 3EC2A 1V9SA 2PSSA 3AG6A 5T4EA 4MQMA 2ZT8A 4UCFA 1H6BA 3RSOA 4CKCA 4TUYF 3V7FA 4IHAA 5EVJA 1IC6A 2VHUA 3UKOA 2P6MA 5A06A 4BMSA 4EKIA 4CIBA 4ZVTA 3U7QB 1NUAA 4N0EA 4CR7A 2GPYA 5IABA 1C4OA 3EUAA 3PYLA 5MGBA 5ISMA 4YPFA 1RYYA 2O2ZA 1C0KA 2QLNA 1QZUA 5ALIA 5EOVA 4YLEA 4ZJYA 1X77A 5GV8A 1QQ6A 1TYEB 5ES3A 3GQBB 1WNFA 1Z4NA 2X0DA 1H2AS 5BSFA 1BXRB 5TQ2B 3FR8A 4NBNA 1S3IA 2CKMA 1DB3A 3COJA 3IMKA 2YY7A 4UDYX 1RRFA 2WJPA 2O7RA 2RI1A 4PNEA 4LW8A 3MGBA 3SE0A 4DNFA 3HBAA 4JJ7A 4TN1A 5CVVA 1Y7IA 3NV9A 5KSPA 1M5UA 1TA9A 2G82A 3A36A 4CIWA 4Z54A 5G02A 3GRCA 5TT0A 1S01A 2H1HA 3FTNA 1TAGA 1PD1A 4MDEA 1JWBB 5HOQA 3Q3VA 5FXMA 1CE8B 1D0IA 3MRSA 3MMNA 4LRYA 1X15A 5BW6B 3QEMB 2FDXA 4EJ2A 4X6YA 3V4SA 4FD3A 1LVUA 3WNBA 1GCIA 2O8CB 1IB0A 4Q9LA 4BRUA 4Z7NB 4YO7A 1JZTA 9LDBA 5K03A 1MENA 5C46F 3G5AA 1G98A 3S27A 1LNZA 4CMBA 1R0ZA 4ND6A 3T0FA 3AM4A 4F71A 3E3OA 3CRZA 4B3HA 1CF2O 5JS1A 3GFVA 4K6CA 3W9SA 1Q6YA 4RA9A 3WLHA 3TDMA 4LV5B 5CFOA 3QVSA 2E7ZA 4F21A 2HN9A 1UKCA 2WABA 1ZJWA 3EH2A 1QVAA 1LD3A 3N5KA 3UJ3X 1N2CE 1U2DA 3BUSA 2IW3A 2IPNA 4ZRDA 2PUDA 5EGNA 3EVGA 4QECA 1FS6A 3HFGA 3IP3A 2V4ZA 4JJAA 5C4MA 4M9RA 4AJEA 4PLVA 1WZNA 2AG5A 4KTTE 4ZAGA 4QX6A 4Y2VA 1J2UA 5ALQA 4MV9A 4FWTA 1CQXA 5CBPB 2ZJBA 1FX1A 2SKDA 5EXSA 3O8OB 1NULA 1D0VA 2JASA 4DWWA 2XR1A 3NJ8A 1UZAA 3BHNA 3ZHOA 1N1MA 4FHEA 2W2LA 4ZYUA 1WA5A 2VKQA 3NKLA 4A8JC 3QF4B 4ZO8A 5I9TA 4D4GA 4QBKA 1ZGCA 1XCMA 1ZGBA 3FHLA 3IC5A 3VYRB 1Z45A 3SIXA 1MC1A 4MW2A 4Y2UA 1MJNA 5H02A 4MCIA 3V2GA 1MABB 2IL1A 3IUQA 1QIHA 4B6PA 4DARA 5C9ZA 5MGNA 5IT0A 1ECJA 1UMDB 4XGIA 5IYZB 2FCAA 4GFDA 4OMUA 4HXEB 4WXPA 4YYZA 1COWD 4QHTA 5GJWC 2B36A 4W5QA 4JY7A 4MRVA 4R6XA 1QOZA 4GNRA 3QWHA 2B61A 4F91B 1WXEA 2DFVA 4C4RA 4Q6WA 3A1DA 5BY2A 5L9AA 4RTOA 3D3WB 1W2GA 5LQKA 2BYTA 2IHUA 4D25A 2NVWA 1GSAA 1L7OA 1K97A 1VHDA 1S7GA 2QORA 2UUBB 4H2DA 4NS1A 2FSUA 4OHXA 3B2NA 2PMFA 1C4KA 1RAEA 4M9UA 2C3PA 5EWJA 3GG9A 1PUXA 3FTDA 4MUFA 4K9OA 3JWEA 3G9TA 1EBBA 1Y8QA 3L7OA 3MOGA 3ZNNA 3TMYA 3GGGA 2W70A 2I4IA 3JQ7A 2WIAA 1L8XA 2IYPA 3RWOA 5KS2A 3CR3C 1YU6A 3LQQA 2GI4A 4Z9YA 1XZIA 1REQA 1TMYA 2HWXA 2Q9AA 3RHFA 3W6PA 5FNVA 3VKUA 2JLUA 4JWKA 4GHWA 4CCWA 4WLVA 2VXBA 3R3HA 3ACCA 4RVNA 5K0ZA 3AR9A 2GXQA 1BU5A 1DTWA 5KNCD 2ZE5A 4N0DA 4K9RA 1P0FA 2KMLA 4FC6A 3IL2A 3PXCX 2K6GA 3RPEA 4OHBA 4AUEA 1N1GA 2Z83A 5KTSA 2JFBA 2OUIA 3I05A 1T8PA 4R51A 4WY5A 1TYCA 3E8SA 1PNTA 2QRKA 1C7EA 5A2GA 5FPTA 3UNXA 3KIPA 4GBED 3A0UA 2PA3A 1YCGA 4KMOA 1GUDA 3EUWA 4FINA 1H2FA 2AUTA 1CRQA 5G1NA 2V8BA 2M6RA 2BKVA 1L5QA 3LX5A 4NHEA 3R7WB 1KFBB 5KYUB 1T6BY 3N1UA 1Y48E 3EZGA 4BLTA 1C3JA 2PGNA 1MO4A 1C7IA 4HGNA 4KI7A 3ZUGA 4CMGA 3PRHA 4CEJA 1TFUA 4GI7A 3LK7A 2TS1A 3T38A 1WHTB 2VDNB 1MA0A 1SG6A 3Q7PA 2IZ0A 3OCYA 4FMCB 3KDSE 2Z09A 4N82A 3QM1A 1VXRA 3UB4A 3RRFA 1XJWA 3IMGA 1OA1A 1P45A 3T9BA 5LQMA 1D07A 1N9GB 4QT0A 4F4HA 1AKYA 3KWLA 1B4DA 1S2IA 4HTFA 3SHQA 2VFAA 4HMOA 1RHUA 4HDSA 1K98A 3IELA 4LXUA 4ENWA 2IYYA 1E79A 2NO9A 2LE0A 4CF6A 4EJSC 4I9NA 4DQUA 5ITVA 5CLFA 4TQ9A 5DCWA 5CNIA 1J49A 1Z8NA 3RC8A 5I8PA 3KG2A 5EE1A 3SAJA 4IDAA 1F4VA 4XJVA 2C4HA 4E3WA 4RULA 5G40A 5HQ3B 1XCBA 2HDNB 1DHRA 2WT9A 3ID6C 3L1IA 4YQFA 5A5FA 1WXGA 2JFNA 2WHEA 3T0IA 2ZATA 3WNZA 5IKMA 1DELA 1ZI6A 4UXIA 3UB3A 5AVSA 3GLGB 3DWGA 3VHXA 3M83A 5IT4A 2WWTA 3GRFA 3WLSA 2MSLA 2ZTHA 2BBOA 2VH2A 2JI6A 3GW8A 1VRWA 4B3MB 3ORFA 1HG0A 5KYTA 3NIBA 1SPXA 3QI2A 4GGPA 4KN9S 3H6HA 3LSYA 3PXAA 2ES4A 4UTXA 5JT1A 9MHTA 1PAUA 1ND5A 5C37A 5J40A 2LD4A 3EGWA 3FYSA 5HFNA 4F6LA 4FEYA 2NTEA 4LYDA 4CLDA 4G5OA 4C7VA 1CF9A 4KRXA 1QGZA 2H85A 3N2KB 4BVKA 4EEZA 5PNTA 3I9V6 1CRWG 2QNBA 1B8OA 1U2EA 3QUQA 1NPTO 1JQ5A 4KQ6A 5FBZA 4HQLA 3NUZA 4MWBA 4CZ2A 5JH7F 2C84A 1DJQA 1OXTA 1XHFA 2CNKA 3H8SA 5H68A 1SC9A 4Q1EA 3REGA 3S2FA 5BURA 2J5KA 5T5QA 2KS6A 1DGQA 2XCIA 1YB6A 4Q4HB 3AOGA 5ARDA 2R62A 1E2DA 2FN3A 2HH9A 1XYYA 2O2IA 2AEJA 3RC7A 2Y0DA 4ISCA 2VXOA 2XVXA 3NAQA 3QXXA 3BXFA 2PMEA 3MAGA 1E20A 5SY9A 5I51A 4LZOA 3L04A 2F1IA 1F38A 1LDBA 1ZJ5A 1ZCZA 4CM8A 4MW6A 1Y9ZA 3OBBA 5ARCA 4BE7B 3DBIA 4EQ6A 4KIJA 1MUUA 3PQ4A 3FSGA 4PHHA 2ET6A 2O7NA 4HS4A 3TQTA 1KVTA 1OBVA 1SKBA 3C2QA 3TLAA 1RU3A 3V7YA 2DOKA 2H54A 2F90A 4CIDA 3HDVA 1HL7A 3RS7A 4DWOA 4Q93A 4WOCA 2PX6A 2W37A 3RH0A 4NAUA 5ICSA 4DY4A 3BN3A 2ISCA 3MT7A 3NU1A 3GGPA 3MUOA 4H31A 1LA2A 3QLTA 3K96A 2PBZA 5TB5A 1M33A 4IXDA 2XCUA 1G9XA 4TKUB 2VYNA 2JRLA 3C6XA 3R7SA 4JT8A 3R0ZA 3VKGA 1HQKA 3PS9A 1R6BX 4DMFA 1HDEA 1V39A 4A36A 2AQ8A 3BWXA 5BQOA 3A4TA 4YIHA 3SOPA 4W7HA 1CTQA 1UAYA 4U6NA 5AXBA 1UQUA 3SYKA 3NVDA 1FU4A 1IAVA 5KC9A 1UXHA 5AHKA 2WPNA 1FSSA 3U13A 3UMVA 5JYCA 2P67A 3A32A 5BRAA 4F3TA 2FG5A 4Q37A 2VRCA 3ELYA 5GMOA 3TIVA 1LNSA 3LLVA 4HAOA 3UJ7A 1Z2OX 1SFRA 1G3MA 3DEAA 2XKJE 4S1TA 5ARBA 4EAQA 4AJ1A 5H4GA 3KZNA 1FY2A 3JD2A 4X7MA 2PXXA 4HAIA 5HGXA 1F06A 1W6RA 2WE7A 3LYAA 1RWNA 1C1DB 4EH1A 1L5SA 4QGSA 1U2GC 3MS2A 4LAFA 4KKXB 1S6YA 2B8JA 2VH5R 1GEGA 2I4RA 3CVVA 1KEZA 1WQ3A 3MIZA 4ZAVA 3WYCA 4YRBA 1TYBE 4IOKA 4RVFA 2J87A 3HVHA 4IEIA 1WHTA 3IP9A 3A8TA 3KTAA 5K0CA 2OM2A 4O4IB 5C1OA 4R8LA 3IJEB 2ECFA 4XQCA 3Q3GE 3HUEA 5MN6A 3EJ6A 3I8SA 4WZ6A 1X8KA 3ZWXA 1AUPA 4MUIA 2P2ZA 3R7BA 1Q0SA 4J90A 3VOSA 4HDRB 1V5FA 2LZ0A 4TKLA 2PNFA 3UK0A 3ZNPA 3ESAA 4RK0A 4D0RA 1EWRA 3A4VA 3TVTA 4MDFA 1SUFA 2JLRA 2XB4A 3KZKA 3F6CA 5JMOA 3NBUA 3EE6A 2JA2A 1I2BA 2DUWA 1NRWA 2BP7A 2HI0A 4RGQA 1OFUX 621PA 3LLMA 2P5YA 1W9MA 4PZZA 4WUTA 4OQDA 1KYTA 3ZDQA 5EE3A 3L7MA 3CE6A 4GYWA 4CM9A 1UMBB 1KJZA 3D6UA 4WK6A 4EJSA 2RDMA 3HWSA 5K0LA 1KEPA 4FGSA 4IWXA 1KMCA 1NNLA 1EUCA 4NP6A 5TVGA 2BGMA 4CM9D 4EMUA 4L4ZA 4FYPA 2QYHA 3CLRC 4QXMA 1FFAA 2HZBA 2A92A 4G9GA 5JS7A 1XNQB 2B34A 2C9ZA 5A4KA 5GADl 3HCWA 2YV4A 3ZVRA 1ICEA 5JMPA 4BNJA 3O8NA 1O94D 1QGUB 1YT5A 3AY6A 5EIFA 4PLPA 1DIAA 5TR9A 1N2JA 1YZ3A 3NWPA 1JPUA 1VG8A 2PVPA 4AX8A 1AN0A 5LM3A 4F1KA 4AMZA 2CN1A 4C3ZA 4QTUB 1X7GA 3S28A 5B7QA 1V6SA 3HU5A 1GG8A 4OO3A 3N2KA 1EG7A 5T3UA 5IULC 5JG7A 3SHWA 2RKOA 3TW8B 1Q7BA 1OXBB 1WDMA 3LT1A 3WGJA 1I0LA 3PXDA 1LSUA 2DZDA 3DSRA 5J5CA 2VTBA 2HJWA 1EUDA 1Z6XA 1GA4A 4U8HA 5IVKA 2C78A 4OQEA 5ANRB 3ZGVA 1Y6RA 5D6OA 3S40A 1N5OX 3LC0A 4PICA 3L43A 3AB3A 3LIIA 1ZCFA 1M6VB 2C9BA 3GT7A 4HQNA 3W0LB 5LMNB 1NMZA 4OHYA 1Z12A 3PTAA 1PFKA 2QEQA 2QM3A 4JVSB 1RBZA 4LE1A 4FHDA 4P80A 4YQZA 3TVDA 1E9CA 4M0EA 3Q1LA 5BW4A 1RAGA 3AP3A 2EBHX 2XUQA 3KLPX 4MQLA 1JFTA 5KVQA 4QUKA 4I1SA 4Q00A 1D2AA 4F6RA 2ZRJA 4ZCPA 4NJMA 5CDFE 3FPCA 5B2EA 3IKLA 4RMNA 3Q3HA 4EGFA 4OREX 3BKXA 2QW8A 1P6QA 3HI4A 1PNOA 4IF4A 5T7BA 1F8UA 2UVPA 5I7WA 1YQWA 2V7VA 2HV9A 2DMRA 1CFJA 3O75A 4X63A 1H9BA 4LOJA 3SYTA 4BFWA 3H17A 3GUVA 1BN7A 1MOZA 2FDRA 2NX2A 1GZ4A 2PH7A 5TC4A 2Z3VA 3JSXA 5H81A 5JROA 3LS2A 4P32A 1EEXB 1FYXA 1OAOA 4OQLA 1QVWA 1ECBA 2H1VA 1RKUA 1P61B 3D0RA 3GI1A 4JFAA 3C7TA 5CNJA 3UOGA 3ND7A 4DAEA 3WGLA 1WB4A 4AKGA 1EFDN 3OAAA 4X20A 3OIGA 4XEUA 1RFLA 3ZV3A 4UHJA 3U2QA 3H42B 3KKLA 4YCNA 3EZ9A 1E3EA 5TV2A 4BAGA 3MWFA 5FEMA 2W2QA 1P1RA 3DP7A 3ZU6A 3IO3A 3KLMX 1SC3A 4S2UA 5K0GA 2WM9B 2KM1A 3GLSA 2AJTA 4G5QA 3D6HA 4JLWA 4ER5A 3ZHBA 2QM0A 3LQ4A 4QUIA 5GQSA 4O1IA 4QUAA 5JSFA 3I04A 4JYPA 3WRVA 2OHOA 5B64A 1G5QA 2GJ9A 4PG7A 2WAMA 3SX4A 1IZ9A 3I9OA 3KT0A 5H8WA 1USWA 5IU6A 1YRYE 1BMQA 1KS9A 2BHLA 2ADFA 2XUGA 4CETA 3JPYA 2FJ0A 3KT6A 5K0TA 2HLDA 1PS9A 3HYNA 3FNGA 1HDCA 5B1IA 3ZY2A 4PG4A 5UKDA 3WHPA 3A28A 3GLRA 1Z5PA 2Q50A 1USGA 3G8YA 3I5AA 1Z3IX 3KJIA 4URHA 5DYYA 5BQPA 5ED4A 2H9YA 3HSKA 3L41A 1CJMA 4DR7B 4KW7A 5CURA 4KSBA 1BQ4A 3SICE 3RKRA 4ARAA 4HNHA 4FN4A 1U3GA 4JBXA 3FW1A 4C4AA 1PVVA 4AL4A 1HLPA 2WHPA 4AG6A 3KU1A 1A88A 4D5GA 1QG4A 2GBPA 4JI2B 2OSBA 3OIUA 2XOXA 4H4DA 1NF3A 4EPXA 5KWIA 4MLCA 3UAGA 3DDZX 1PKXA 2SECE 3DVRX 3HP1A 3O4HA 4MJLA 4XD7A 1SVKA 1E5VA 3DBRA 5CNMA 4UVGA 2VXYA 5DBGA 1QIFA 3K1YA 5IYZA 3A37A 1FLVA 4WY2A 1H0SA 2ZUFA 2OXEA 3PE6A 2JNWA 4GOMD 1HE8B 4RDHA 5E8JA 1KJIA 1ISGA 4Y0VA 2OGZA 4IIJA 4RNDB 1XUOA 1X86B 1FP4B 2QGFA 2WSSD 2ZQ5A 1FFYA 4ZV7A 4PYQA 1NVUQ 2JFXA 5E9WA 1Q50A 2GA8A 2XD4A 1PT8A 5F1KA 4AF7A 1UZNA 1I10A 4BVBA 4EF6A 1TCCA 2R4UA 5AUOB 3L07A 1NU8A 3QXSA 4G5XA 3WADA 2AF3C 1PLJA 1M1ZA 1O03A 4MR8A 4YK7A 1Q91A 1YA6A 2H9AA 3ZJ4A 3H05A 4ZVOA 3K92A 4PZDA 2DY0A 1ODFA 1NNSA 4C6TB 4I2VA 1SHUX 3CF2A 2B1GA 1OXUA 3ZDRA 5BXQC 1MLDA 2XUOA 1RPAA 2CZGA 2HXYA 3RS3A 1O2DA 4V24A 1UFKA 2PKCA 2EDCA 4MWDA 3SMQA 3L9XA 3LDAA 3SS9X 4FB4A 3GNTA 2H16A 3MS7A 4C0WA 5KYUA 4WBNA 3IQHX 5ALDA 1SVNA 1MB9A 1NBMD 4U2KA 3IQDB 5JI2E 5IBPA 4KAAA 3VISA 1ESDA 3D7MA 3EC1A 4Z0PA 3RI3A 3W34A 1V1RB 2QA5A 1PHRA 3LUKA 5KKCA 1LDMA 4MVYA 3SHVA 3UT5A 4L72A 3VOBA 1YZKA 2E3JA 1SWWA 5AM3A 1NF2A 3MJ4A 4JP5A 3F5DA 1ISIA 5I9BA 2Z2ZA 1DIGA 3UPUA 3V1UA 2Q2OA 4NYIQ 2INGX 1JLLB 3GN1A 2A3RA 3KQPA 4YEDA 4JR0A 1IBLB 2WWWA 3RFXA 4PLWA 2NZ8A 4OL9A 1I6WA 3P20A 4QXQA 4OLBA 3LECA 1IXRC 4IJVA 2H31A 1SZPA 2NM0A 3T5DA 3AGPA 2YL2A 4EUNA 1BS9A 3VPGA 3EPKA 1NZJA 2Q9CA 4XM2A 1IMOA 2QP9X 2WMOB 3ADOA 4ZZ0A 2Q3DA 2B4KA 4ENPA 4ND7A 2GPTA 3NKFA 4MCAA 3SLKA 4DLYA 1X19A 4Y9RA 5KEIA 4B3RB 1ZR2A 2QLFA 4HX9A 3OZSA 3LFHA 5CFPA 1PVDA 1XSEA 4XTCS 3QWFA 2AMLA 1URPA 3E22A 2O2HA 3GNQA 1U1CA 4MI3A 4OYLA 1M8KA 5F12A 4MROA 4HQFA 3RV3A 3O3MB 1ELOA 1C7ZA 2G9ZA 2VAMA 3UA3A 5DTRA 1MPXA 1GCUA 5CDFA 2YWBA 1OAKA 2ZUVA 4MP6A 2FZEA 4IOMA 2PX3A 2A5GA 2IZ1A 3DL2A 1HR0B 1J8FA 1SOWA 1ULSA 3OQVA 3G9ZA 4UVHA 2HPAA 1K7SN 3QKWA 1GUYA 4WCFA 4D82A 4BV3A 1JE0A 2ZBDA 2I3AA 3D8TA 3W8DA 4JN6B 2ZU6A 3D7LA 2XNKA 1YRQA 2VEOA 4NYJR 1Y3IA 5I9MA 3SSMA 3V4OA 4OFWA 4AJPA 4G67A 4HWSA 4TM7A 1HNXB 2W4IA 4IX9A 2VUSA 4OD0A 4HZGA 4DR5B 1MQAA 2WSYB 5MHTA 2O3TA 5DT2A 2GZMA 4DLRA 6REQA 3BMNB 4IMPA 1C1XA 5AJXA 2EEZA 2XWSA 4MKXA 3KAQA 3URMA 3BD8A 1AHIA 4WCDA 2VK2A 4K6HA 3FVTA 1HRDA 2NXWA 4G1VA 1XAIA 4RQUA 3ZH9B 4RLFA 4JH0A 221PA 2CYCA 4OH7A 3UMMA 3RTEA 1OU4A 1OTXA 3PX7A 1E3DA 1P4SA 3L6EA 4FXOA 3CZAA 1ONBA 2VHTA 1H1LB 5CM2Z 3U3RA 3MLBA 3W8RA 3DB1A 4RW0A 2FSPA 2QT9A 1ODCA 3D31A 3L2OB 2GZ2A 3EIQA 2QJRA 1M6EX 4HV4A 2PVSA 1X7HA 4GMXA 4OQZA 1P72A 2C20A 3FBGA 5B58T 3D7SA 3OPMA 5K20A 3USES 2XOEA 2VJLA 4Q3NA 4PBTA 3E8MA 3UB2A 4MRNA 2YHAA 4L2IB 4RIIA 3U7IA 4H1TA 4QU5A 5DXFA 3AHCA 4Q7QA 3NTRA 1FUUA 1KR2A 2HJRA 2J3QA 3KQQA 1Z08A 3IE2A 1RPZA 5SZJA 1S1CA 1KPIA 3H2ZA 2FMKA 1JBKA 2DTEA 3BTSA 3LUAA 1MOPA 3IEKA 4C7JA 2EERA 3GLUA 2OXCA 4I4NA 1P5JA 1CZLA 1JEOA 1LTHR 1M74A 5TPWA 4NH4A 4D2IA 2GNPA 2OXTA 4M0FA 3SQDA 1YL6A 3N8DA 4FOSA 3WL5A 2I7XA 3P5BA 4JVLA 1XRNA 2JLZA 4BJHB 2H1SA 1BZYA 3HKCA 1H8EA 1AQIA 1D4FA 2E87A 4GXRA 1P74A 4QUBA 4TROA 2CMHA 4MPPA 4NJOA 5CB4A 4Q1FA 2IH4A 2C5BA 2GBCA 4R2HA 2CEAA 3PQ5A 5I9IA 1WXQA 3NC1C 4DUPA 2VJAA 4DHWA 4KGVA 5BR8B 2ODEA 1EG2A 3MBOA 1I36A 2C2YA 3PTZA 1NURA 2IS4A 1GGNA 1DC3A 4J43A 5KTRA 1IPEA 4XQ0A 2BZGA 4NS4A 4QEKA 3TZLA 3VAYA 3KQTA 4C78A 5AQ1A 1NQUA 2J9FB 3DMTA 4XR4A 4B6EA 1RZRA 2FQYA 4P5DA 4GW3A 5TVKA 3RSSA 4FS8A 1M76A 1RXYA 1NLZA 2EKBA 2O06A 3KB1A 4P82A 5FWDA 5B1EA 3PGVA 4L73A 1ZOLA 3DE7X 1KAMA 1G66A 2AYYA 1HEIA 2FPKA 5M3BA 3MW8A 3G2JA 1LPOA 4GXQA 1CP2A 1TU4A 2F9LA 2PJDA 2RBEA 4OKIA 3JS5A 4XDZA 3ZW7A 3LOPA 10MHA 4PZAA 3ROXA 5I8ZA 4PX9A 1IDOA 4GM0A 3TNYA 1IOWA 1BXZA 3QLVC 3NHLA 5I6DA 5AOBA 1H6AA 3WRXA 3WSVA 5A5DA 4YONB 1IEWA 1OYWA 1IH8A 3N74A 4O1MA 1SCDA 2E2WA 1CU1A 1TIBA 2J9ZB 3JAWB 4C4OA 4TKVB 2QVYX 4YRQA 4LXQA 1WOYA 5C81A 1YR1A 2NUTA 1D1PA 2XPCA 5ILOA 2OGUA 2DETA 4D0NA 1XZKA 4ZTBA 3WB0A 5ALLA 4LC0A 1Q44A 4NBWA 3DUWA 1I2AA 2O6LA 4K2HA