3NHZA

Structure of n-terminal domain of mtra
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Two component system transcriptional regulator mtrA
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhzA00
1YVUA 3DGEC 2PL9A 2CHFA 3Q7TA 5F64A 4O5AA 4Z4CA 1DP4A 3NHMA 2WJAA 2FEWB 3H5VA 2GKGA 1FQWA 3N75A 2ZAYA 1JFVA 1ZITA 3LKVA 5JNSA 2XDYA 3CZ5A 3FFXA 3O2QB 1H9CA 4G0XA 4ZYLA 1M2FA 1M5TA 5FWXA 3T8YA 1Z15A 1BDJA 1S8NA 1USKA 3QLVC 1C0EA 2M98A 3LMKA 2GI4A 4IGAA 1LBIA 1UDRA 3VNAA 1P6QA 1JH9A 3FGZA 4MQFA 1Z26A 3HM9A 3GL9A 5IUJC 3OLWA 3H1FA 4QYMA 3A0RB 4F06A 1U0SY 3C3WA 2QW1A 4XFKA 1U2PA 1TVMA 2O20A 1F4VA 1M5UA 1PEAA 1DC8A 4LE1A 1TJYA 3HVRA 1ZESA 4G97A 4N47A 1SXIA 2BGGA 4Z9BA 3M9WA 4ZPJA 3O75A 6ABPA 2RGYA 1URPA 1DCKA 2PJUA 3NHZA 4LE2A 3O1IC 5FBKA 5IUNC 3FFWA 3TO5A 1GCAA 4YS6A 3BREA 2JB9A 2GWRA 3G85A 4KNYA 4N41A 1BDHA 4HNQA 4IMJB 8ABPA 1KRXA 4EYKA 3QX8A 4H3HB 2F8SA 4W5NA 2IOYA 3LTEA 3F73A 4B09A 3HJFA 1AB6A 3QLUC 3H5WA 1JWLA 1BVHA 5T3YA 5JNWA 2PUGA 4OLBA 1IIBA 4XAQA 1KGSA 4UHKA 4RY8A 5TPZA 3RVJA 4JA2A 2LBPA 1GUDA 4WXEA 3RVQA 4F12A 1PUXA 4RKRA 1RZRD 4JOQA 4RS3A 4E7PA 1A04A 1SXHA 3EODA 5D2CA 4TN5A 2FQWA 4ZMRA 4F3TA 1FFWA 3QEKA 2FXIA 3DLBA 3H5IA 1EHCA 5DGCA 4ZMSA 3F7NA 2OENG 3C3MA 4RWEA 2IPMA 1VKRA 2R48A 4QICA 1M2EA 1NY5A 2FN9A 5HM6A 5ED4A 2L2QA 2VUIB 3A10A 1DBPA 5IEJA 3ILHA 4OG2A 2WB4A 2IPLA 5JNVA 1Z17A 3H5LA 2FMFA 1LBHA 3H5TA 3RH0A 1ABEA 3L6UA 2HQOA 1DRJA 1XHFA 1MB3A 4Y9TA 4S04A 1PNTA 4H3KB 3URMA 4W5QA 3T95A 1JX6A 3JPWA 1JF8A 3CZCA 4RY0A 2FW0A 1L5YA 5B3JA 2QSJA 4MQEA 1JFTA 3UUGA 5HKOA 5GQSA 3P9YA 3SY8A 4FE7A 2FLKA 1Z16A 3GBPA 3MQ4A 4Q6WA 2PUFA 4MGEA 3KYJB 4IILA 2V0NA 3CFYA 5EWJB 4XASA 5TQ2A 4PICA 3KS9A 3DLHA 3O2SB 4JP1A 3HZHA 4P1ZA 4XLTA 1A0OA 1APBA 3LOPA 3NBMA 3GYBA 5IULC 5TPZD 3GBVA 1VPWA 4YLEA 4KMRA 4YRZA 1PEYA 3QELB 4NV3A 3HS3A 3D02A 4MR9A 3F6PA 5CNIA 1JHZA 1ZAYA 1ZH4A 4ZJPA 3HCWA 5JNTA 1QP4A 2E4UA 3QELA 1AB5A 2E4VA 2H0AA 2R4QA 1W9HA 2HSGA 4RDCA 3S99A 4EYOA 2F8TA 2JVIA 1NXPA 1YS7A 4Z99A 3E3MA 3CLKA 2P4UA 5BR1A 4FE4A 4D6XA 1LJUA 3QLVA 3Q9SA 4MS3A 1U8TA 1MAVA 4LX8A 4YP9A 1NXTA 5KQGA 1TMYA 1DZ3A 3EJWA 4D6YA 4E7OA 1NXSA 5DCLA 4MYRA 5FWXB 2WJWA 2OQRA 2FKAA 4PEVA 1MB0A 1NTRA 3JS5A 1FSPA 1D2AA 2L17A 4FB4A 1A2OA 2A9OA 2NZVG 3IP5A 4HNSA 3LUDA 1YMVA 4MQFB 2MSKA 4NICA 2MSLA 1EFAA 1PNRA 4XXHA 1L5ZA 4ETMA 4OATA 1NATA 1ZH2A 5BRAA 4CBVA 3KHTA 1Y1LA 4JB0A 4LZLA 3Q7SA 1ZVVA 4RSMA 4MLDA 4W5OA 2FSPA 3DBIA 2E4ZA 3I42A 2QVGA 4O1HA 2NT3A 4N0PA 2ID7A 1P2FA 4MPTA 3Q15C 3T38A 1SXGA 3IP7A 4DN6A 2IPNA 3FDFA 5TQ0A 1JFSA 3BBLA 1BAPA 2FVYA 3TD9A 3CG0A 2IKSA 4PE5B 4S05A 1ZN2A 4LRQA 4EVSA 3H6HA 2PMCA 2FTKE 3TB6A 4DADA 1D4ZA 2QV0A 4JB2A 3QLUA 4KREA 5KQMA 2FEPA 4RK6A 3VNBA 3KSMA 4ML3A 1VLZA 3ROFA 2AYXA 4W5TA 2VK2A 1ZGZA 2Q5CA 4WWHA 2PUAA 3HEBA 3HDGA 5EWLB 4ETIA 2GBPA 3UKJA 2QVCA 2MYNA 1F51E 1YK1A 2QU7A 3LUKA 3LUCA 3LUFA 3HXMA 4Z4EA 1ZY2A 5EWLA 1E2BA 1Z2EA 3KLOA 4G86A 3B2NA 4IMIB 1PHRA 3O2JA 1ZDMA 1OXBB 4YO7A 3TX6A 1JDPA 3RVOA 4KFCA 3DGFC 4G0OA 3N8IA 4DQDA 3BILA 2WY2D 3M6MD 3NNNA 3IPCA 4MLCA 4IRXA 4RU1A 1RPJA 4MS4B 3RVSA 1YS6A 3LUAA 2IYNA 3H1GA 3QX9A 5TPWA 4ETNA 4LDZA 3OQMA 3OMWA 1KMIY 4JAVC 4OLAA 4MS4A 1D5WA 5JNRA 1K66A 1Z12A 3EQ2A 3JVIA 1XHEA 1I3CA 4L85A 2QR3A 3D8UA 3JTEA 3OO1A 2CD7A 3ILYA 5JNUA 2PUEA 1YIOA 3A0UA 2IDMA 2IPAB 3OQNA 1NXWA 2QZJA 3ROTA 1BDIA 1K68A 3EAFA 3H6GA 1DCMA 3O1JC 3QK7A 5HQJA 2FLWA 3IP6A 2RJNA 4KK3A 1ISSA 4MQEB 4RV5A 2B1JA 5KQPA 1JYFA 4TLLB 3H5OA 3RQIA 4NCBA 4RK7A 2JCGA 1EWKA 1EAYA 1KRWA 1B00A 1GUBA 1USGA 4RK4A 1QPZA 2L19A 4YGXB 4YCSA 2CWDA 3CRNA 5TQ2B 1DBWA 3GWGA 4NQRA 4EYGA 3N0WA 1HEYA 2WMYA 4Z0NA 2LIVA 1QQBA 1CEYA 4KK4A 3R0JA 5CHYA 5IUKC 2A9PA 4PZ0A 2JBAB 3OM1A 1DBQA 3N6VA 3MM4A 3OM0A 4WXMA 3KG2A 5BRJA 3GV0A 2PL1A 3LFTA 4MR9B 1JYEA 2JBAA 5DKFA 3HSYA 4G0ZA 4MR7A 3GT7A 3H75A 2W42A 5EWMA 3SAJA 3C3KA 1EWVA 2B4AA 1ABFA 4MRMA 4N0QA 4TMYA 5JS2A 2FMIA 3RVRA 4EVQA 3CHYA 4MS3B 2FN8A 1WETA 2NUBA 3E61A 5KC8A 1BA2A 3OMXA 3GRCA 3JVDA 2FEKA 1JBEA 1R8JA 2GX6A 2M1ZA 5KQLA 4JASB 4YV7A 2LP4Y 1Z13A 3C6QA 1QP0A 3TMYA 5KWSA 5CNKA 5FBHA 3N53A 1DRKA 2JK1A 4P98A 3QEMA 2I6FA 5KI6A 3SM9A 1U2QA 5DLEA 3O74A 2PUDA 4MR8A 3RVLA 4QYWA 4RKQA 1GCGA 3LUJA 3HUUA 3LUGA 4G0YA 2FMHA 5TE9A 4GPAA 3OLVA 4F8JA 2FQXA 2R25B 5ABPA 3MA0A 3QLTA 1DCFA 1FFSA 4KRFA 3T6KA 5GOTA 5TQ0B 1MVOA 5JS1A 3I09A 3KTOA 3OQOA 4Z4FA 1CHNA 3OO0A 3SNKA 2YHBA 4G0PA 4MAAA 5CNMA 4OTZA 1E6MA 3CNBA 1JLKA 1RZRA 3NNDA 2ZWMA 2HQRA 1D1PA 4Z4GA 2N9UA 1LJLA 5T7BA 4KQCA 2PLNA 4EYQA 2QXYA 3HDVA 3K9CA 1ISRA 2FMKA 4Z4IA 3RVNA 4F11A 1RXEA 3NNSA 2YHAA 3EGCA 2MYTA 2VYCA 7ABPA 1JDNA 2E4YA 1Z2DA 2HPHA 1TM2A 9ABPA 4Q6BA 1SD5A 4KV7A 3Q41A 2KYRA 3MIZA 4RK0A 3OLXA 4WZZA 3GA5A 3CS3A 3F6CA 2HQBA 3KJXA 3LUHA 4MS1B 5E3JA 3IPAA 3O1HB 2RJOA 5TPWB 4LE0A 1USIA 2PKXA 2DRIA 2VUHB 3MMNA 2WWVD 4N76A 2H3HA 3UK0A 2L18A 3HO1A 4MS1A 5IX8A 4RXTA 3KCNA 1DC7A 1LK0A 1Z25A 3EDCA 4WT7A 1YK0A 3Q7RA 1Z18A 3A3KA 4H60A 5FWYB 2PE5A 1QMPA 1ZGGA 4N03A 2HJ9A 2LPMA 4Z9AA 3K4HA 3L49A 1QP7A 4IF4A 3MYYA 1QNLA 4YWHA 3HV2A 1ZHHA 2MYPA 5FWYA 1SRRA 3RVPA 4KPYA 1QO0A 2MYUA 2TMYA 1EWTA 2PAFA 5CNJA 4EVRA 4EGSA 3N0XA 2JVJA 4HYEA 2E4WA 5TQJA 3SQNA 3RVKA 4W5RA 2MSWA 1RNLA 3EULA 4G0MA 3LKBA 3OLYA 1E6KA 2A9QA 2WRZA 1P8AA 2AYZA 3IP9A 5IC5A 1RXIA 4WUTA 4QPJC 1DG9A 4LDAA 4RK5A 2E4XA 1CYEA 4G0QA 3IDOA 4RK1A 2ID9A 3I5AA 4GNRA 5KC9A 2A9RA 4MR7B 4RY9A 1YMUA 2LUOA 3O21A 1MIHA 5HSGA 4Q7EA 2R47A 5EWMB 2NT4A 3W9SA 3H1EA 3SG0A 4MRMB 5PNTA 3KYIB 4D74A 1FFGA 1P6UA 3FMVA 5BQ3A 1YTUA 1GLGA 3BRSA 4NCAA 5DTEA 3CG4A 3I45A 2NZUG 1T34A 3CKMA 3RVMA 3CTPA 1QKKA 4TLMB 2FQYA 2JRLA 3G1WA 2J48A 3EQZA 3MF4A 4L4UA 3KKEA 4RZSA 4O1IA 3JY6A 3N0RA 4HNRA 3M9XA 5IBQA 1OXKB 5C5CA 2CHEA 3CU5A 4PYRA 5IEBA 4XARA 4EY3A 5I4CA 1QQAA 5EWJA 3HUTA 2PUCA 2JVKA 5B3JC 3OLZA 1DJMA 4RXMA 4Z4HA 3QEMB 1TLFA 3HK2A 4M88A 1NXVA 2X7XA 1NXXA 1D1QA 1QO0D 3BRQA 4MR8B 1NXOA 3DZDA 4EUKA 3C97A 6CHYA 1E6LA 4UHJA 1J56A 1XWWA 3JPYA 3KLNA 4YR7A 3FFTA 1W25A 2P9HA 2RDMA 1C4WA 2PUBA 1VRVA 4RXUA 4KQ9A 1U04A 1JL3A 4KZKA 4KVFA 5C5EA 4OBBA
chains in the Genus database with same CATH superfamily
3IUMA 4EPWA 5HYVA 1TCBA 3O8CA 3EDYA 4RY2A 4X93A 1GGNA 1XLTC 2FA9A 1R0RE 1PN3A 2QTWB 2V98A 4HNGA 5F1PA 3X1KA 5I3CA 4Z4CA 1KVQA 4OHWA 1TQDA 1U8EA 4YAOA 1OBCA 4ZK2A 1EZ1A 2GKGA 3EUEA 2Q41A 2DMRA 2ZSKA 3O93A 1GNSA 1Z4PX 4FFLA 3I1JA 3PIRA 3CPEA 4QC2A 3C87A 1A7JA 3RS2A 3BKXA 3EN0A 4E2YA 1O9HA 5AUOB 2PK3A 1Q17A 3QKSA 1JLRA 2VYNA 3OHPA 5I7AA 4BIIA 4DKJA 3L3BA 4DUGD 1Q57A 3DXXA 5JCPA 3F6EX 4RUKA 4BKPA 1QLWA 1HK7A 2C58A 1YAHA 3WRVA 4I5FA 1ULUA 1VHLA 2O6LA 2NYAA 4HTFA 4DLTA 2BYTA 2XNHA 3NTUA 1Z26A 1W59A 4LZNA 3W4JA 4N9WA 4W1QA 1MEEA 1RM0A 3FCAA 3JQ9A 4RD6A 5C8YF 3AY7A 1O1YA 2OE2A 4MRPA 3C3WA 4EFKA 4DM7A 4Z53A 1DV1A 1ZVJA 2HU2A 2R1ZA 3D2AA 3SZMA 1LI7A 5JZSA 2C04A 2PRJA 3ICPA 4RCVA 5DOVA 4AL4A 4MJXA 5ADVA 1ZRHA 1E1DA 3DKRA 1JXQA 4GOXA 4ZCSA 1GFSA 2V74B 4XB1A 5GM1A 1S8OA 2G06A 3GRYA 1T1SA 4QGGA 1UZLA 5KYXA 3PGVA 1X7GA 1DOAA 1XQ6A 2O50A 2RHBA 2GWRA 3D5EA 1H8EA 1CW2B 2KS6A 4X7BA 1T2EA 1CEXA 5AMXA 5G4LA 1T3LA 2QY9A 1NLYA 3NDRA 4PINA 3ZNNA 5IWAB 1Q0PA 4L5YA 1GO2A 5I3ZA 3AF4A 4BB9A 5CAEB 3LTEA 1UJ6A 2ZJ7A 3KXIA 3OE5A 4UMDA 3FOZA 1RMTA 3E2MA 4PCUA 4RM3A 5HDQA 2BKAA 3HZRA 2VHTA 1PLKA 2WQ7A 3LWNA 3OPMA 5HA5A 1N2CB 3OC6A 4YV2A 3W6NA 1WW2A 1C41A 3KB6A 1V2HE 1A9QA 1PUXA 3ILVA 2PGXA 1G7RA 1TW2A 4JOQA 5KMGA 2P4SA 3NYRA 1HOXA 4UDOA 1MC4A 3INTA 1ESCA 1NVTA 3HL0A 1Y7IA 1QH9A 3L7AA 2QW0X 3QMWA 2O7QA 3S7ZA 4BQRA 3KSRA 5CXQA 2HCFA 3FNGA 3L4KA 3C3JA 1FLAA 5ENVA 3ESCA 1G5FA 1Y34E 1MO2A 2ISCA 5SZHB 1KC3A 3OFND 5KQRA 2EWVA 3FNFA 5E1BA 4BLQA 4AJ2A 1AQLA 2X9LA 3KJEA 1RTKA 2D4AA 1SMKA 3WLOA 3QEJA 2ZKLA 5JAPA 3PQ8A 4FBGA 1I5OA 2ONYA 3O2NA 2PT5A 1NJ6A 3H04A 2WB4A 2C7VA 3NP9A 4HQRA 5BW8A 3A1FA 2ZSHA 1IH8A 3KQYA 1BFKA 3LX5A 3BRWA 3L8EA 1AGYA 3OPVA 4JC8A 2FPKA 3RARA 3RH0A 4ALNA 1P9LA 2OAP1 4U39A 4Y9TA 2CCGA 5LQCA 1XZGA 4DR3B 2F43B 5EHIA 1UJBA 4KGZA 1QRTA 1FYEA 4B6RA 3KSZO 3QKIA 1LCIA 3UV6A 2PX5A 3H0EA 3ZWYA 4E08A 4LWZA 5F12A 5GQSA 1XRPA 3HJUA 4GE0A 3ADKA 1J22A 2BUBA 1U8FO 2CZQA 5BQOA 5MDHA 3NHYA 4MGEA 2Q1SA 4EKGA 5C8DA 2V0NA 1VA5A 3U3RA 4JB8A 2ATCA 4PICA 1QTRA 4OEHA 5E3HA 1B8NA 1JFFB 3G1UA 3JVVA 1NJ8A 4Y7CA 1UBTS 3DBRB 3FOFC 4QM6A 3ITEA 3PT9A 3F6BX 3LCVB 4UUNA 4AN0A 2EFCB 4X61A 1OAOC 4HP8A 5JRJA 3JRNA 5BR7A 2XWBF 5ALUA 1GT6A 3RUEA 2VH1A 2C07A 2HF7A 1I2MA 3V42A 2VOJA 4KMRA 3UMFA 3TTWA 5DMHA 1R66A 3DBLA 4HXFB 2X2EA 2WTXA 4JV5B 3TTVA 1I5RA 3UZUA 1F6WA 5AK4A 5BP7A 3TPFA 2QZPA 3INGA 4MHTA 3S99A 3JQAD 5B1IA 4KR3A 3WGUA 2AC4A 1P0CA 4R9SA 4FLEA 2IEDA 5KCMA 5K6AC 1P3JA 2XIJA 3IAEA 4ZCPA 4RPLA 3V00A 1DBVO 3TDMA 4DLBA 1PP4A 5KNDA 4UNIA 5LQNA 2QN1A 2AJDA 1KJIA 5DCLA 5BNFA 2D7DA 3WK4A 5EMNA 2J0VA 4P0PB 2HY7A 4RDHA 2VHVA 1P1KA 3NM6B 3Q6MA 5B7QA 1F2UA 4DLUA 5C5DA 4B45A 2GZ2A 2ZJ5A 4KQKA 4DMHA 1CUDA 1EXWA 2I8AA 1DDOA 3E2PA 3LUDA 3VH2A 2DPLA 3DT9A 1G8MA 2K4MA 1L8LA 5KVVA 4DA4A 1TJNA 4PO8A 1WXIA 2GAFA 5MHTA 4OATA 1GLVA 1NDUA 1LD3A 5B7NA 4F4FA 1NR7A 2QQGA 1C9YA 2QX8A 5FA6A 2I22A 4DQKA 5CB4A 2P5YA 3QQPA 1KEEA 4PPYA 3I42A 3RFUA 3BTUA 4ZQBA 1R4AA 3D6JA 4ZVPA 1KETA 4H59A 4L16A 5JATA 6ADHA 2XSZA 4BNDB 5JBIA 3AIMA 2IIPA 2G9QA 3SOPA 1E2MA 3T34A 2Q3CA 1J0EA 3H3XA 3K96A 4RIEA 3TLKA 1FFEA 2GOYA 3GCDA 1OFVA 4C4YA 4D9KA 2OGSA 4NULA 4KB5A 2FTKE 5JJKA 3LQ1A 4S0XA 2R44A 1DX6A 1XRRA 1W34A 1E92A 4KQMA 1P18A 4JB2A 4DCUA 4J0KA 4CM4B 4EY6A 4KREA 1ESDA 3NV9A 5F98A 5D51S 5LP6A 2IHTA 4LDNA 5F7ZA 4G23A 2BMDA 2XUJA 3I8XA 4RGBA 5FOVA 2PO7A 2CSUA 5B2ZA 3UGQA 4FYVA 3KQHA 4QT4A 1XZLA 1JQDA 2OCIA 4IZIA 4QEKA 4MUYA 1JPVA 2GBPA 3LDGA 2Q5FA 3P71T 1YKSA 2HAEA 3BSSA 1TM3E 1D8AA 1ZJ5A 4FDLA 1GQSA 3VOSA 3AFMA 4N7MA 1K7FB 3SHVA 4O3MA 3MB5A 3DG9A 3C74A 1ZDMA 3TX6A 1DRWA 2J7KA 3B5EA 1QPGA 2Z09A 1Q20A 1VIAA 1T5LA 2BONA 1J8YF 4LY9A 3LHSA 3SZ3A 2O8DB 4RU1A 3B89A 4HBGA 1WBDA 3H1GA 4A82A 2WVGA 4MDEA 5M5BA 2ENUA 1TF2A 3HN2A 1WOYA 1CUUA 4XUDA 3I2KA 2JLSA 3GFFA 3ZUPA 3WHKA 3KR0A 3OTWA 3A3OA 4ID9A 3DBOB 3D4PA 3SZLA 2QENA 4LNUB 4ZOQI 3TFOA 1X9IA 3O8OB 4RZQA 3KOUA 4QUBA 2CZCA 2C9YA 2H65A 3PJDA 2AKYA 2IYQA 4KN5A 5A0VA 4CG2A 1R5JA 1EWKA 1EAYA 1IPEA 1PT7A 2A9JA 1QPZA 1HFWA 5KTNA 3OCWA 3ZU3A 1ZRMA 4BYGA 1M6VB 1V6SA 4YCSA 4KPUA 1F48A 4P2BA 4QE3A 4Z7NB 4P7FA 3I9KA 3FYUB 3U1BA 1GYQA 3IAS1 2ZBRA 3K1AA 3KKMA 4C04A 4DA9A 4ZCQA 1SHLA 2XTAA 3P2YA 2EZTA 2C4MA 2WU1A 4U4AA 4CMBA 4QU8A 4NBWA 3IDSA 2E82A 1DBQA 4WA8A 3S3TA 2I4IA 3KYDA 4ZEMA 1TQHA 3QPWA 3D64A 1E6WA 5ICGA 4DJTA 1V9LA 4KMSA 3Q40A 4LGMA 5DKFA 4LFBB 3MCVA 3HSYA 1Z63A 1I8TA 3FE2A 3F46A 4ZEOA 3R7AA 1FXUA 4DB2A 2PKWA 3O8QA 2B5VA 4IDBA 1QTNA 3Q4GA 2RGRA 5L3SB 2UYYA 5JIBA 2IYWA 4E0BA 4RD1A 4HQLA 3N0TA 4QQKA 3PHCA 4XVRA 2OXEA 3JVUA 3N2ZB 1XP8A 3RANA 4FI3C 4B6SA 2VP5A 3A7EA 3NONA 4QOJA 4C0SA 1OFHA 2AHRA 1JWAB 2XTZA 4YUVA 2XNKA 4NMMA 1UP4A 1UWVA 4MB6A 4X7PA 3A36A 4HNVA 3NBFA 1M5RA 3PXBA 2Q2OA 4WJZA 1JPUA 4IH4A 1MC5A 1XK6A 4QOFA 5BMOA 3GP3A 4M86A 2M1ZA 2Z0MA 3I9V6 2LP4Y 5KAMA 2D06A 1XTKA 5M3BA 4A15A 1ENYA 1H5QA 4DIDA 4K88A 4PZYA 4Q19A 4L78A 3HWRA 5JDIA 2AG6A 1L5VA 3VBEA 2HCTA 5CB8A 2UV8A 3HSSA 4PPNA 4QECA 4RKQA 421PA 3D7NA 3LUJA 2JLUA 3HUUA 2IVFA 1G5RA 3LUGA 4MICA 4US0R 4YN3A 2XB2A 3AYXB 2VLIA 2R25B 2R86A 2XE8A 2AH5A 3JAWA 3NHSA 1FFSA 2P2YA 3KZOA 1ES9A 2VATA 2MINB 3BD8A 3FTDA 2FPGB 3IELA 3AU9A 3ESDA 3L6OO 3LVQE 2HEIA 4MPPA 5T4EA 4CLEA 2O4CA 3T4PA 4KHPB 3P9KA 1FUEA 3I09A 3WHIA 3PEUA 1KAQA 3OQOA 5JO0A 3SNKA 2IYOA 3MMXA 2ZYAA 3MTBA 1EQAA 4OHXA 4OUDB 1ECGA 4MWOA 4JSYA 4D8TA 2VUSA 1RQRA 1RLTA 1U3DA 3EGOA 3K0FB 1E1QD 2KPOA 4IDOA 2F1OA 4V2UA 3RBZA 3QFRA 5JDCA 4UREA 4EKYA 3W7VA 4OQ4A 4CM1A 2WPDA 1VE1A 2V3VA 1NQXA 1IRIA 4DG9A 1UPTA 4XI9A 2ZSBA 1KDPA 1G20A 1HXHA 2F1JA 3OG9A 3R9KA 3ZNOA 1V7QA 2GBFA 1MJ5A 1N5DA 4RQBA 3RVNA 2C59A 4HATA 2VLBA 1VLMA 5TF0A 3E03A 4JYPA 2UYOA 2E5WA 3GLKA 3D6UA 5K05A 4BLSA 2GZSA 4E5YA 5A7HA 3R3UA 4LPSA 1N3LA 1UJNA 2EVWX 2IU6A 3L46A 3UJ8A 2EOAA 2KBEA 3R6WA 4HDKB 4XLZA 2O8EB 4U7GA 3KV1A 3OOWA 3BORA 4HPWA 1FQJA 4GOMD 2DPXA 3N87A 1TKCA 2FJPA 2Y27A 1V9CA 3HYNA 3DOUA 3MTAA 4JEUA 2P69A 4MS1B 4WZZA 4GYJA 2V7VA 3WK7A 2F62A 2FFHA 4BO5A 3UUEA 3UK2A 3T9BA 4PPQA 5TPWB 4BC0A 5IM4A 4AX4A 1EXVA 2ZYTX 1N5LA 1GZ7A 3CUEF 1FFCA 3PXXA 4YJ2B 4MRSA 1W30A 3ZWBA 2R3SA 1NDQA 5CX1B 2PMDA 5LC1A 1HYEA 1OX4A 4I1SA 5E7JA 5BPFA 4GXRA 2C2MA 3LZ6A 4ND3A 1YS1X 2PSHA 3VJLA 1TYDE 2ZG6A 1AHHA 3A1DA 3IULA 2HADA 4TXHA 3ZIDA 3M0EA 3E3LA 2NU6B 4IZHA 4C3ZA 3BD9A 3DTYA 5EXEA 4YP7A 4BFTA 5JS7A 3T7TA 1RDFA 5KTKA 9MHTA 1R0WA 2GILA 2XQJA 2QBYB 3WB2A 1B1CA 3P20A 5CDHA 2OR3A 5FORA 1DC3A 1XDBA 1IN6A 2GCEA 1V11B 3KOXA 4EGSA 1FNMA 2A7QA 1M2OA 3LBFA 4X6UA 5L3QA 1IJEA 1S1CA 4IHJA 2JLZA 1YB4A 1DDIA 5BNTA 1C14A 3O0DA 3PFIA 4RVUA 4UBLA 1XPUA 3R6TA 1AKQA 2R6HA 5IJZA 2OB1A 1GPBA 2AYZA 3LZDA 5IC5A 1Q19A 2ZBGA 4S1OA 1Z4KA 4RVOA 4X8MA 2DBYA 1XMSA 3OM9A 3QWHA 4BAZA 4OXNA 5CYFA 4P92A 4RA9A 3TPZA 1OGYA 2A88A 4CKBA 2EDAA 4BZWA 2QZ4A 1R4MA 2VSOA 1F3OA 1R4NA 5B3AA 4KGXA 3VSEA 4AWAA 4Z2YA 3ZCVA 1JIQA 3PTZA 2G6TA 3FWZA 2EEPA 1U2GA 5FHQA 1GCUA 4LSWA 2G6BA 1SHJA 1TVKB 3TLYA 4MULA 5D3ZA 1VL1A 2JGMA 2ZE7A 5EIWA 2Y1DA 1GFWA 2BEJA 3CR8A 7AT1A 3EZYA 3AGPA 4IRMA 3RVMA 1IEXA 1KEKA 2QAGA 1KJQA 2OCGA 3AG6A 3NBZC 5DM2A 1JKXA 5CURA 1FYXA 3PXCX 3KRTA 3MOIA 1H0HA 4BO3A 2P3QA 2ZWOA 3FJ1A 1GGFA 1O77A 2OSBA 3EIFA 3MBIA 2R5FA 4R3NA 4RZSA 4D3YA 5B3LA 1JECA 1O95A 2LCIA 2QVBA 3A1VA 4GS5A 4JBNA 4KWHA 1XMXA 3L4JA 4RTOA 2VAMA 3MG9A 1Y80A 1U3WA 1KU0A 4Z4HA 1ZX1A 3QEMB 2ON6A 1CLUA 3F90A 3M6WA 3WDSA 4NJMA 1UOPA 1C5KA 4D3XA 2O2YA 4JVOA 2QUIA 2GARA 1NXOA 2V7BA 2ANBA 3W5IA 4NHOA 1Y9EA 3HB9A 1E6LA 1HDGO 1WDTA 2QX6A 4QOHA 2FEAA 1KI8A 5FLEX 2B21A 1VSBA 1BS9A 4KHZA 3OSZA 4B73A 4G25A 1XNJA 2EFGA 3K1JA 1RADA 2CYBA 2C5LA 2QX7A 1W5BA 5C5EA 4H2DA 1GNRA 2P6MA 2NVWA 2PSEA 4M7RA 3JQQA 1O87A 3Q7TA 2AZMA 5G02A 2DH6A 4GZMA 4PC6A 4TV8A 2FR0A 3D8SA 4JZYA 4NH0A 4RQTA 4M9XA 4ND8A 2C82A 2VEOA 4Y2RA 2HXYA 3UK7A 4KWCA 2HEGA 1KPIA 2Z6VA 3LL7A 3ZGOA 2YXNA 1AQUA 4FZRA 3WFIA 4DMKA 4ZVKA 3TQHA 3QLEA 4MRAA 1WWKA 2PA0A 1PDWA 1RACA 2FUCA 3LJKA 3LWBA 5GV7A 1SB8A 3FPFA 4XYGA 1H6BA 1E3WB 5EIAA 4BEWA 1C9NA 1S8NA 4NBTA 1WU7A 2CYAA 1KDYA 4JR1A 1OKKA 1RWXA 3ZHBA 3U48A 1EE9A 4N9QA 2C78A 4JJFA 2OCYC 3U7QA 5EKDA 4J76A 3B1KA 3G6KA 3ZS9A 3ETJA 4NKRA 5C2JB 1QH1A 1DWQA 2PAAA 3DE0X 2RI1A 2FXVA 2ORVA 2PJZA 3C6MA 3KALA 4QTXA 2F6RA 1HH4A 3FHTA 2WNIA 4R8SA 3RS5A 4BHTA 1SHKA 4LYFA 3I58A 4HWOA 4WCFB 5FWAA 5FTKA 4AK9A 5LN1A 1WX1A 2ZTLA 2WWGA 3BSYA 1HDIA 1N75A 3G89A 4OJTA 4PYLA 4YXWA 1P2TA 4PYOA 5HBGA 3O1IC 1IBMB 3T7EA 1B0UA 3ZV3A 3ZG6A 3TL3A 4F46A 3D0RA 4CF7A 5LYJF 3TO5A 3Q11A 2VNSA 1GCAA 1GGHA 5A4DA 5EIEA 3K70B 4CIWA 3BHNA 4MSUA 1XRSB 3LF2A 4TT3D 4N41A 3KL2A 1EUCB 2XT6A 3HUFA 4MKRA 5JPIA 3NFRA 1OILA 4QWMA 5HFJA 4UQOA 1PS9A 3C8UA 1UQTA 1NFFA 2PMBA 2ZIZA 3PGMA 4E12A 3NHWA 1Z4JA 2IJGX 2JANA 3K0CA 1YWGO 3DTNA 4K1XA 4PC1A 1KI6A 4OLBA 4KEAA 1GSOA 3LDHA 3HKDB 1K7YA 4AX8A 2AFIA 4I55F 2ZJOA 3WB9A 2GVZC 3R77A 4YO8A 2QJWA 2SHKA 4P4GA 4E7PA 3AVQA 3D0QA 4KSCA 3E5NA 2UZ4A 1TM5E 4OKIA 3AJDA 1NX6A 2O1EA 3I4LA 4V1CI 5DB4A 1FFWA 3BGIA 2IZOA 2PR7A 3H5IA 3PFWO 1DC6A 2P9FA 3A9TA 5CH5A 4FD2A 4UQPA 3ESQA 1K75A 1QK4A 3E9NA 1XBTA 3HRHA 4LOJA 5HM6A 4QGFA 4EUNA 1Q2XA 3L6BA 3L04A 4WJLA 3AFOA 4KAJA 4YCLA 1XDZA 1S3FA 4OG2A 3UICA 4K9SA 5LZ9A 3RBAA 1L1QA 2VK4A 4EI8A 1USWA 1LU9A 2IYPA 3MWLA 1OF1A 2AX3A 3AXTA 4IINA 3TXAA 4HXYA 4GW3A 3BB1A 2HQOA 4P7KA 4RHXA 1VL5A 3DLIA 4DW8A 4YASA 3S1AA 2JGDB 4KLRA 3THWA 5KSWB 4QYTA 1BH6A 1CQJB 2VQ3A 3WJ1A 3PFFA 1VMEA 3AFHA 3PRKE 3T5PA 2JA2A 4KAAA 2DPHA 2HI0A 4NU6A 4MGKR 2I4MA 1TA4A 1P2DA 1F0KA 1GP2A 1PHPA 3UMCA 2B82A 2J7PA 3HYCA 2QOEA 2XQVA 3MRTA 4C20A 2W0SA 2OUKA 3WLKX 1ZK2A 1WDMA 1JLMA 4AXBA 2OYCA 2G9VA 4CEJB 3Q1LA 1U0BB 4P1ZA 1AUVA 1W19A 3QEAZ 4G41A 3CJTA 2Y0EA 1A0OA 4FOOA 4RANA 1NVAA 3BXGA 4RABA 1EBFA 2ADMA 3GPCA 4IIJA 3IQFA 1FLDA 1YVDA 1WXDA 4HJXA 1GU1A 5F3WB 2BEKA 3KTDA 1JHVA 2X5OA 3MUFA 3HTXA 3FOEC 5AJXA 3NHBA 3HS3A 4BX3A 3JAMA 2HHLA 2XH8A 4QBHA 2PDAA 4AZ0A 1WSWA 3L05A 2GTHA 2VPXA 1VYTA 5AKXA 2QVYX 4ISCA 2C54A 4G8DA 1AKWA 2E4UA 3NUZA 3GLRA 4RHEA 3D6AA 2R4QA 1PV2A 1NVXQ 3FN4A 3IXLA 3DE7X 1PAUA 3BQ9A 1Z7WA 3RUPA 1NUSA 1Y4AE 4M0FA 5FX2A 2NP7A 4ZA2A 5G1NA 2SCUB 2VP3A 1RW4A 3DMRA 3VYVA 1SUEA 4D6XA 2R0QC 2CSXA 1DEOA 1KVSA 3VV3A 2NO4A 3DMHA 3PNLA 4FCWA 3VTZA 2AW5A 1PE0A 2D2IA 6Q21A 1KZGB 1U98A 3EE6A 1NF8A 2FJUA 2FSFA 1SFRA 4EJSB 4CEIA 1U9YA 5HNKA 3HRIA 3TN7A 5HF5A 2N3ZA 2QE7A 5HF6A 3ODGA 4C6SA 3HUEA 1PR9A 3H7IA 2V6IA 5LL6P 4ZREA 3E27A 4X3CA 1G9SA 2H54A 3H5RA 3NIDB 4I4LA 3WIBA 2RHCA 4DWVA 3M3HA 1G2PA 4H4DA 1O54A 4OJMX 3SICE 5BRAA 1JAHA 5JD3A 1GU0A 1KJZA 2AXPA 3JQ7B 5D85A 5ERGB 3ZDDA 3IE2A 5CLHA 3CT6A 3PDUA 5DYNA 2BJHA 3IJPA 1ID8A 4QULA 4D8XA 3DE3X 3UAVA 3MGBA 1C4KA 1MFPA 2E89A 4PU0A 4BNLA 3IJ5A 2IPNA 3VR5H 1AKUA 3MIIA 3QVGA 4A0QA 4IUYA 4V0QA 2W2LD 2I34A 3CG0A 1SOUA 2PKQO 3T3GA 3RKUA 4I9NA 3HBJA 1UKYA 4ZAGA 2BVNA 1LVGA 1RYMA 2AYYA 1NKTA 3F4LA 3N7UA 3PA6A 2NQ8A 1E6CA 4QHSA 5CIQA 2QPTA 4PGHA 2CUZA 2QGNA 2WG1A 2JBHA 4IZOA 4L02A 2OV2A 3DT8A 2OV6A 1FS5A 1Q1AA 2J6CA 2Q6KA 2FEPA 2VRNA 4DILA 1RJDA 1SVWA 3UKDA 2ZSUA 2DJIA 3SQMA 1X42A 2PUAA 1TOAA 1IXYA 1U31A 1U8XX 3ZX4A 1H4TA 1BOFA 1WL8A 2VJBA 1DAFA 4F2WA 3QHAA 1LF0A 1Q95A 2Q62A 3NHPA 5AK6A 2QSYA 3DAOA 4HR7A 1F0NA 4HG2A 2YIJA 1YR7A 4U2BA 2BDTA 5GJCA 3ZNPA 1PHRA 3B53X 3P97A 4D2IA 3UJ9A 2I2DA 4GZ3A 4KOAA 3ZE8A 4OSPA 4WZ6A 1E32A 4BNNA 1C0KA 4ZHQA 1AZLA 1VCOA 3R3XA 1OXUA 3PXUA 3W3AH 1X94A 1I6LA 4Q4HA 3RVSA 1PNOA 2ZYSA 4NK4A 2ZT8A 3A4NA 1Q0QA 3EZ9A 1EGQA 2AC7A 3GWZA 3HGQA 3T3IA 2MMGA 3S0JA 4F3CA 1FRFS 4ZYWA 2A67A 5HXAA 2P6RA 3MJDA 4J3FA 1B1AA 1UBUS 4MS4A 1L4MA 2ORED 3EQ2A 3Q85A 3PD0A 2QLBA 2EZ4A 3WLTA 3SN6A 2WSYB 1R1DA 3OO1A 4ITUA 1MTZA 3N70A 3WGHA 4DEVA 4E4YA 2WICA 2X5XA 5JEDA 3OQNA 2QMQA 5HQJA 4M21A 1FYDA 1OZGA 4YCNA 4FINA 3IP6A 3MINA 3P19A 1W4LA 4AUNA 2QY6A 4RW0A 2GXUA 4RV5A 4BQQA 6LDHA 2JLVA 2WAMA 4B76A 1I6KA 4H0CA 4JA0A 4LGYA 1CUWA 1MABA 3OE7A 2JJ2A 3U4QA 1BSVA 1HG0A 2PANA 4D0LB 3UMYA 1EGAA 2TSYB 4R0MA 3GWGA 4B32A 3OZCA 1R15A 2H63A 5GM2A 2HUNA 4QSHA 1HEYA 3DEKA 1ADBA 3RM3A 1NBMA 3TTYA 2ZSJA 4BTVA 2IV7A 1PEDA 1OW3B 4KK4A 3WB0A 1C7FA 1NGSA 3NUQA 2WQ6A 2DC1A 4LRTB 4HMQA 2H16A 2VPWA 2H4WA 1R5BA 3GFSA 3OM1A 4YROA 2C29D 4WXMA 4LI3X 1PYGA 2JFVA 4JGBA 2WUFA 5KDLA 1W36C 4MR9B 3H1PA 4AD8A 3BXZA 2HJGA 1LWNA 2CLIB 3HLKA 5KBYA 5C51B 5LLDA 2FR8C 2W6PA 2ZPUA 4H17A 1ISHA 3RT7A 1RC8A 1XXLA 3LG2A 2YXPX 3NBAA 3N2KB 4PCVA 1PL7A 5G0WA 3WQQA 3FLMA 2O2IA 3DV0A 5JD6A 4J0QA 5JS2A 3I34X 1OASA 3UB3A 4HYYA 4R54A 4OQMA 3WK9A 1A5ZA 5BR8B 1E6UA 4R8MA 4CRWB 1KE2A 3BMCB 3KR1A 1OX6A 1JQEA 4QT0A 4YAIA 2NUBA 2IE0A 5AD1A 3QUSA 1TEZA 3I2GA 3CLVA 4ZKDA 3UNXA 1Z73A 5EPUA 3MPOA 5L53A 5EESA 1TCVA 4MVJI 3C3BA 1IAQA 3HJBA 3O1LA 3QWAA 4I6GA 3NWPA 2W6MA 2AN1A 5J2UF 1UMBA 1RTTA 3GZJA 1GCOA 2HA6A 3CEHA 4P98A 3IPXA 3O0TA 3ZCSA 4CKEA 2Z98A 3UEOA 2XITA 4OHVA 2VOEA 4LRYA 3LA8A 4JS0A 5DLPA 1XZQA 4NYMQ 1B2LA 1M1UA 3KJFA 4MR8A 4XGRA 3VZQA 2YWCA 4E11A 3IBYA 2CJPA 3AUJB 3LRPA 1NPDA 2XUGA 2PH1A 3DEIA 3G9TA 3JYPA 1G6Q1 3ANLA 3B8EA 1F0PA 1OWLA 5LDDC 1YULA 4J91A 4LKOA 1GY8A 3AVXA 4B74A 4UEQA 4DGQA 5JJLA 2BP7A 1M76A 3HJRA 1C3OA 3QFHA 1M2JA 4GVPA 1Q0ZA 4RPJA 5GOTA 5IBRA 2QTGA 1KERA 2JIOA 3JRWA 1K5PA 4C76A 3IKVA 3A4IA 3N8GA 4ZQGA 1H8HA 3MUEA 3ZE1B 4QNRA 4B1FA 1G0OA 3K9GA 4UM9D 1CZHA 4FC6A 3BMOA 3FTPA 1G3UA 3NNDA 2YZMA 5DNYB 4BX8A 2H59A 1U6JA 3GJ4A 3H83A 4F5EA 1DOHA 3IR6A 3DKKA 1UWCA 3LGSA 4MKZA 3EXG2 5E1DA 3J7TA 1XJWA 3UA3A 4ND1A 1UEJA 1XDSA 3JQGB 1NIPA 1NHWA 2OWDA 3SD7A 3STHA 4PQGA 2A78A 2HSZA 2VHQA 1WZUA 3EEBA 3K9CA 2FMKA 4ITRC 2FYTA 5BXQC 2QQFA 1VL8A 4WK6A 2C83A 1M54A 1XZEA 1Z7BA 4CF4A 1HQDA 1UPUA 3OZGA 4Q6BA 3CRW1 1S2OA 1KHTA 3VO9A 4BZQA 1SCAA 2WYVA 1TZJA 4LTMA 1U94A 5HIKA 4IG4A 1RE0A 4C01A 4JI7B 3CLRC 3G49A 4KQGA 4MW1A 1Z62A 2BSAA 2HQBA 2X8JB 4FR0A 3IPAA 1UIRA 3SYTA 1ADJA 3AP3A 3V3TA 3ZV6A 3K16A 3GEGA 5AI8A 1LBTA 2A58A 2OZPA 1LH0A 1VFPA 5J40A 3RV3A 3ZK8A 4XOIA 1DKQA 1N6IA 3GD5A 4Y1EA 3WO1A 5JOQA 1ZD9A 2FOXA 2R8EA 4D4KA 1E8DA 2PYDA 2YNMC 4WT7A 2O8FA 1WTAA 4OM7A 4MDFA 1E20A 1K8RA 5LLTA 4C7VA 3I05A 1R9NA 4N03A 4CI0B 3NYIA 3G5MA 3OI7A 1V95A 1ZUD1 3QVJA 3K4HA 3R7WB 1QVAA 1F3LA 5FUXA 3VR4D 1W6RA 3LXXA 2J5QA 3OFVA 1XAJA 4ZODA 3OA2A 1T3TA 4LUCA 3STTA 2O7VA 3JQFC 1O6BA 2CEAA 1EIZA 3OJ0A 3AL0C 1BCRA 1ZK0A 2TMYA 4LAFA 4XIJA 3WG9A 1PT5A 3IOMA 1CIVA 1EWTA 3JALA 4A0HA 4BLWA 3B2QA 1G64A 1YE3A 5L4NA 3V4OA 3OEEA 3HP7A 2NN3C 4DDTA 1OE0A 3O26A 1ZO8A 5AI5A 1E6KA 4BP3A 1U7TA 4US1R 2QG4A 1OR8A 3PEEA 5J23A 1OLXB 4MXDA 3W6PA 1ZCJA 3PUZA 3T7RA 4YC7A 5MF6A 2ZWIA 2VEDA 1LF5A 3DL2A 3GVXA 1L7NA 3HVJA 2XOEA 5EJMA 4TYNA 2OY0A 4I6EA 1DVRA 3IDOA 4G0QA 5FPPA 2XVMA 4GR9A 4NYJR 4GP9A 3T15A 2CY0A 4OYRA 4YMSA 1MX9A 4MR7B 4YIKA 3UMGA 4AS2A 4XD2A 3GPDG 1IBKB 1OH5A 3NETA 2I2BA 2P62A 4JVMA 2P2ZA 3SG0A 1U28A 2FNAA 5JARA 1X1CA 3ZLJA 3TBFA 2AT1A 1I7SB 1IQPA 2V5VA 5JC1A 1GNQA 5INTA 4ZXFA 3T3OA 3TRHA 1GDTA 1ZQ1A 2BMEA 4BX9A 1U4OA 4UTZA 4MUNA 1Z07A 2AKEA 2JKVA 1HEIA 3IAM1 1Q7BA 2ECQA 2ZUVA 3K20A 3NG1A 2PUHA 3FWYA 2N75A 3NP7A 4W7IA 3WNZA 1IATA 1XNQB 3C6XA 1JLHA 3WNBA 1SXJC 3COYA 5AVYA 1BW9A 2IHUA 1DTWA 1HL7A 1SBHA 3L6RA 1YQQA 1M0TA 5F77A 3ROKA 3WMEA 4E5PA 1UODA 4HWTA 1CRLA 1FJXA 1GZHB 1OIVA 2M2IA 4JLUA 4BOYA 1P9OA 1QO0D 2AOTA 2D5BA 4P58A 1RQPA 1QIGA 5DP1A 1Y6GA 4JI0B 3BGWA 4B3MB 4EQ6B 4UHJA 3DYVA 2IDZA 2HH9A 1WAMA 3K2QA 3QUAA 4MI3A 1TRKA 4OXIA 2CWWA 4C7JA 3EOZA 4DOMA 2ZIVB 4X54A 3LCCA 3EVFA 4AKIA 1UZAA 1CNEA 1L7AA 2PVSA 3RSCA 1IZ9A 5A5DA 5F2EA 4A8JB 7REQA 5KIAA 3VKGA 2GAJA 4LOLA 1NYQA 4M9ZA 1J9ZA 3VU9B 1QXSA 3OU7A 2WJAA 5T57A 5HQ3B 2X5JO 5ALDA 4KYUA 1IXSB 5HMLA 5AJYA 5TJHA 4Q3CA 5IAGA 1V6AA 1V25A 3A9WA 2CNKA 4QU5A 3EPKA 1R18A 1J0DA 2V03A 4HDAA 2XDYA 1YBMA 1TJ4A 1YIDA 3FFXA 1RPAA 4W8GA 2C3MA 4KR7A 4OHBA 4MW6A 5FWDA 4C2TA 1VPTA 1CY7A 3KLBA 4Z2AA 3KEOA 2BFFA 2WHPB 2M98A 4TQ9A 3ROQA 1JH9A 3Q7IA 1B23P 2QTZA 2JFHA 1S5PA 1TO6A 2Y76A 1BWRA 4QUKA 4DAEA 3OTQA 3LV8A 3PDJA 3A32A 1JU3A 2F3PA 3A3NA 2PRKA 5FH9A 4X9XA 1BTOA 1U2PA 2OL4A 4XVCA 1II8A 2IXFA 1SXIA 1BHO1 2KE5A 4JEMA 4K3VA 3UMBA 3RLFA 5LNK6 2XNDA 3ZHOA 3TGWA 1J0AA 2IUEA 3V2IA 6YASA 1FSFA 1W73A 3CF6R 2PJUA 2PZBA 3QYJA 2V1XA 4L8LA 1JRLA 4EGCB 4XB2A 3JXEA 3QF4A 5CFOA 1VG1A 4BVBA 2Q4DA 4Q34A 5CJ2A 1I6MA 1V8BA 4DCCA 1IL0A 3IMFA 3INNA 3KKKA 4EHJA 4RSGA 5JU6A 4EH1A 4NMLA 3TTTA 3G82C 1IUKA 4DPMA 2O1XA 3M49A 2RG7A 5F1OA 4F0JA 3FYHA 4MV4A 3QX8A 4OYYA 5TY0A 1CDOA 3RS7A 1ZNWA 3PPXA 4OQFA 1JDBB 1MU0A 1D0SA 5HIMA 2Z1MA 1H9BA 2V7QA 1YQDA 5T3YA 2HWXA 5DLQC 5IMSA 2I67A 1BJTA 2JAQA 4MJ7A 1S8FA 4UBNA 2XXJA 1WB4A 3E35A 3RJ9A 3RVQA 1Q22A 4IP0A 3TEJA 3OQPA 2OC9A 2EGGA 1WKBA 4JY7A 1UC5B 2PZJA 2PZLA 3JSXA 1SXHA 4KVZA 1F5NA 1UT5A 5EC8A 1JZQA 2FZGA 4BAUA 5D2CA 1QGOA 2Q3EA 2C7GA 5A9RA 1CEQA 1VSVA 1O94C 2QUKA 3VR5A 1W4CA 1UH5A 4MIOA 4PLHA 2AKAB 2I4TA 3P32A 1N0IA 1OQAA 2R48A 2W6JA 4PSDA 3W2HA 2EHJA 2YYAA 5IKXA 5FL7A 3A10A 2B2NA 1DBPA 2DU8A 2VPQA 4JELA 2Y93A 2DBZA 3ZGYA 1HDCA 1UKZA 3Q12A 1S2NA 3W4KA 3Q5DA 4O08A 1KYTA 4C78A 1O97D 3AUAA 5E4YA 4BMDA 1ZM7A 3TWOA 4IV0A 4YI5A 3L1UA 4M89A 2QTNA 1RI1A 4DSZA 2PO5A 1WBJB 2G9ZA 3T95A 3JATA 3ZBTA 4RULA 1GM5A 3AFNA 3DL0A 2Z43A 3EJ6A 4GU5A 1LRLA 2G9RA 1BHJA 2BAGA 3SSAA 5CITA 2QSJA 5JR3A 3ZVMA 4G9EA 2V9CA 3P9PA 4E22A 1T5DX 2ZATA 2A5LA 3GK3A 2O2HA 1X80B 1Q3TA 2FLKA 4YP1A 3S4YA 4BO9A 2PSSA 4D02A 2O8BA 2TRSB 3IQXA 5FPTA 5LA6B 4KGDA 3IDAA 4MUFA 3VR3D 1W0KA 1UXHA 5TMEA 3NV7A 3V34A 5BWCA 1UPAA 3W3AA 1FFYA 5EYPA 1ORRA 4HBZA 1UDWA 4N7JA 4IWXA 1UDBA 1VPLA 3FRJA 2WOOA 3AQIA 4TKZA 4WNCA 1ZD1A 1DXOA 1UQUA 3LGXA 4PO9A 3BJRA 1KL7A 3GYBA 4OB7A 5TPZD 4D4GA 4RE6A 1X1RA 1X14A 1Y5LA 2P0AA 1XLTA 4TT8A 4NV3A 1RXVA 2J3MA 5B5SA 2PKQP 1VOTA 3K5PA 2WMNB 4OI4A 3R0VA 4UMVA 1SAYA 1V8DA 2OHHA 3DPUA 1WQ3A 2V6MA 4RDCA 2HSWA 3EZFA 2F1KA 5ICCA 1WUKS 1GKYA 2W7TA 1PJLA 1KXZA 2XB9A 2CEKA 3HWX1 4EYOA 3FWPA 3BFJA 4Z99A 3PUXA 3EWAA 4L08A 4N6GA 4Q02A 4EZEA 4EKNB 3PR1A 4CTMA 2BD0A 1NXTA 4TQAA 3R76A 2B69A 4L6AA 1TYBE 3EVEA 1J42A 2HO5A 3D8TA 1BS1A 1JEQB 1ONBA 3OZWA 2PIDA 1CQXA 1L5HA 2FW6A 3RTEA 3SQOA 5LB2A 4HSGA 4M38A 4HTFB 2IGBA 4WZBA 5FL3A 1R8SA 4CNBA 1YMVA 2VJLA 3K0HA 2DFDA 4YWJA 4CQLB 4BMCA 2YZ2A 4CT0A 1VJTA 1IY9A 1AOXA 2W37A 2UXCB 1UOEA 2FG6C 3HCBA 4TKUA 4W5HA 3RRNA 3WNDA 4AKTA 4CBVA 1YCDA 2A0FA 3UWMA 4UEOA 2OZLA 5CCXA 2IX9A 1Z4IA 5I7FA 1WXXA 4UHFA 4PCLA 4XWOA 1LBEA 3WWDA 1LRKA 2CE7A 5EL0A 4DN6A 1UC4B 1G42A 2FCRA 4N54A 4BKMA 4BYMA 1I9GA 2DTXA 1T1EA 5AQEA 3PPIA 4L22A 1BAPA 4DYVA 1WUTA 4I5EA 1FU4A 2VPIA 1U0RA 2V55B 1FPMA 3OZBA 4JUAA 1O6CA 3AIIA 1V8OA 1JEOA 1CTQA 2XX3A 3UTDA 5ICMA 1THMA 5FBLB 2B83A 4GLOA 3VPBA 2IRWA 2ZIFA 3PNQA 3S2SA 3V7NA 2F9MA 4IQFA 2CF5A 2XE7A 4Q4DA 3LBHA 3BVPA 3KXDA 1G1MA 3QWBA 4WY5A 3TIFA 2R7LA 3L4SO 1FTNA 1NZDA 4YUYA 3NWOA 4W4TA 3SU8A 1X8LA 4IVQA 2AUTA 3TLBA 1VPDA 2MYNA 3PQ5A 4JSRA 5I7WA 3G8BA 4LZPA 1MF7A 4KE9A 2YX1A 1M2KA 4PWZA 2B6HA 2X0JA 3KLOA 3MJVA 4G86A 4L5JA 5AHOA 5KMGB 1OBFO 1TM4E 4PZDA 1XEWX 2W8BA 5CVEA 1JDPA 3VPDA 4OJQA 2FHSA 1GKUB 4UBMA 1JTEA 4DQDA 4G5QA 2JI7A 3ZCRA 1NN0A 2WEKA 3KPJA 3NNNA 4WNYA 3RYIB 4IRXA 3VSDA 4EY8A 3F49S 2YWJA 4BNGA 1YR9A 4YXFA 3NANA 4GPIB 4J4TA 3Q9UA 1QF9A 5H81A 1KI2A 1GPNA 3D4OA 1WNFA 3FKSA 1K63A 4FXPA 3CRZA 3V8RA 3OMWA 5KU7A 2R79A 4TRMA 1G5TA 5JNRA 2AZDA 2QMHA 2VDOB 2WUVA 4DJAA 3A1EA 1OLOA 3OIDA 3U3MA 1UKVY 4DZRA 4DV1B 4FHEA 3E3OA 1P1RA 2XF2A 3A0UA 2Z6UA 2R7KA 1E9EA 2HU8A 4J94A 1BDIA 1JT9A 4R69A 4KWEA 3HFRA 1GV0A 1LV7A 4OBEA 4YJ3F 4G84A 4F9TA 4HB0A 5IARA 4EIWA 5H1YA 3LT4A 4BDSA 3AF5A 2IDKA 3QWFA 1GNPA 5CK4A 3SEZA 5KZMB 5GJVC 3HWSA 2WHRA 2HR1A 2REBA 3WQHA 2J5KA 1MP0A 4DLWA 721PA 1OAOA 2L19A 3WNCA 1KK0A 1K08A 5AI9A 1FMJA 4C0BA 5A5GA 221PA 2YWGA 3R44A 1ZICA 4HDCA 2EWWA 1TADA 1PYOA 2WMYA 2A14A 1E9VA 4FW9A 4OIMA 2B78A 1J49A 4RD3A 4XPZA 2RG1A 3OKCA 4PAWA 1JLSA 1I4EB 3NDPA 3HH8A 1CV2A 3QVKA 5FPYA 2V8OA 4HX2A 3MS2A 4S1NA 4AIRA 2VDJA 2DQSA 3AI1A 1ESNA 5DHAA 4NS1A 1JLLA 2ES4A 2JCYA 3RAJA 4KX5A 5L3RA 2FGKA 3F71A 2FWJA 4YAEA 2ZRPA 4CV1A 4Y2JA 5REQA 5I7EA 2QE6A 4JD5A 3JR7A 4EDHA 2D00A 3TQTA 4ENQA 2AZXA 3COJA 1EWYA 1HT2E 4R40A 4N0QA 2ZBFA 3L7YA 4Z86A 4ALLA 2WFLA 1B8UA 3GY0A 2YIDA 4L0QA 3G68A 3BHJA 1CZNA 3N76A 5ALOA 4DCGA 1E2PA 3AEUB 4WK2B 4X1YB 4DC0A 4BUJA 4EGJA 3GLFB 1R6TA 1CYDA 3W2FA 4RTNA 4I50A 3OKAA 3JW8A 1J2YA 3HI4A 5CDSA 1DDGA 1R64A 1HMYA 2D1RA 2JGJA 2VAPA 2COEA 3C6QA 1F2UB 2J3HA 2XMGA 2XUAA 2YWEA 3EF1A 3MS4A 3UMSA 4EM6A 5C53B 2MSNA 1Y1PA 2C92A 1B26A 1CJBA 1DXHA 1H2ZA 1QZUA 3DKPA 3EBPA 4UJ5A 4ZP1A 3RVBA 5K2OA 4DMFA 4AJNA 2Z2ZA 4II3A 5A9SB 5K6AA 5E1MA 3W05A 5CB4B 4M60A 2B8JA 3NRBA 4DMLA 4A2PA 2IQ5A 4B3IA 2VWGA 1WMBA 2CJWA 2CVHA 2OESA 4GP7A 1V1JA 3AR5A 1GZVA 2ZIWB 2EGHA 2CHVA 4FLMA 4G09A 4XJTA 5AVTA 1BQ4A 5L6MB 2Q7XA 1G8GA 2QYSA 1L8OA 1M2NA 2WE7A 4I36A 1UBKS 4L9WA 4CKCA 5IFKA 2XA1A 3PZRA 4PLTA 2DETA 1FSGA 2FW1A 4P4SA 3ABQB 1XNHA 2HCRA 3FOBA 4Q66C 4Y9SA 4PFJA 5IWCA 3CINA 4TS9A 5A6VA 1LDBA 4AT1A 2QTCA 1U2ZA 1U4NA 4YPFA 5LMNB 1LQUA 4MZDA 4Y1FA 5DYYA 1COZA 5LQUA 2PZGA 3G1TA 4H4CA 1RZRA 3E7PA 3U6KA 3WTBA 1Y7PA 3NOOA 4HRXA 5D3KA 1PWZA 1EFLA 2B7CA 3EYAA 2EGUA 4Z4GA 1PQUA 1SOMA 2HTFA 1LZKA 2N9UA 2P78A 5LP6B 4UEJA 3GF4A 4QHYA 2X6TA 3CBGA 4Q1CA 4V3CA 4MUAA 4REQA 4IEEA 3Q0TA 3OX2A 1OB5A 1DFGA 3SCZA 4ARSA 3PSAA 3DB1A 4B85A 3ECSA 3NW9A 3GEEA 2EZ8A 4FWIB 4QO8A 5CPBA 1HFEL 4XDYA 2HPHA 1ODTC 3DZFA 2BW0A 4F6RB 1MJNA 4P86A 2XB6A 2ZAIA 1PFWA 2FF5A 3K8OE 3KELA 4MMXB 5ECGC 1B0ZA 1Z0ZA 3AM5A 1TX4B 4GAEA 1FOEB 1FLNA 3HCDA 1N78A 1E3EA 3D7MA 3GA5A 3HEMA 3I2IA 4IYJA 5BYAA 1CQWA 4MV9A 4M7WA 4JLBA 1VIDA 4A16A 1Z5GA 2IYZA 4EHDA 4YA6A 5ESRA 1R0CA 3KQWA 4MQ5A 5C80A 2VNHA 5D86A 4OUKX 1F17A 3HXQA 3I6MA 1O5OA 5AVOA 3UBTA 3DLAA 2JFYA 3V1TC 1T3ZA 3J81k 3BUSA 1T2VA 2W43A 3HU3A 3RSHA 4S12A 4DIEA 3G2NA 4M1OA 5IK2A 3RFCA 3VZBA 1G5HA 5IM4F 2G7ZA 2YJTD 1RFLA 2XDQB 3MWGA 4ZWNA 3L6DA 3MCUA 5FP0A 3K9HA 5AKZA 1G20E 4FIDA 5BYKA 2QT0A 3QJGA 1NUPA 1XYGA 4B48A 4MGIR 4B2PA 3F2IA 4OL9A 2QI9C 2QB5A 3OF3A 1D04A 3DQQA 4RTPA 1RRCA 2X9QA 1KAEA 1HRKA 1OLSB 1HE5A 5LWHA 1ZL0A 4LF9B 1MR3F 1IY8A 4GLFA 2R1TA 2C9MA 4NU8X 3SQDA 3C45A 2GETA 3K1AB 2X77A 1P19A 4JC0A 2O8NA 4BN4A 3HA3A 3UJ3X 4X5OA 3UMJA 5FTWA 3NTLA 1OTXA 2ZS7A 1IDOA 4QPJC 4AW9A 1A5BB 5EE5B 8OHMA 4IHJF 1KFCB 3EA4A 3KYDB 4K8OA 3WHPA 4AZWA 1OY1A 1ZH6A 2V65A 3WYEA 1WTCA 1ZVKA 2Z1DA 5KC9A 4CG0A 2GM4A 2ZULA 1NKVA 1HKUA 2QTTA 3O8QB 6NULA 5EMHA 2NT4A 5AK3A 4O6VA 1NNEA 3VKHA 1NLUA 4WL0A 4ZOBA 3MWFA 3QQ5A 3SHOA 1PFQA 1G63A 3AJEA 2OYSA 4RPHA 4FMPA 4KO1S 4YJHA 4BFVA 3LZCA 3GH1A 1J09A 3EMKA 4LTNA 1OB2A 1QGYA 4AO8A 1ONSA 3ZEAA 4Y2PA 3OPYA 3CKLA 1X9GA 2HMWA 4ZTZB 1C81A 3EXAA 4H77A 5ENDA 1FUKA 3G3EA 4MLPA 1DBSA 3JY6A 4J3JA 3PE6A 1TIKA 3K9WA 4HDSA 2PCLA 4GMHA 1XJ0A 3SFZA 1EVKA 4DMMA 3GVCA 4X20B 2ZUWA 3DJFA 3K7EA 1Q3HA 5M04A 4Y9DA 1UZMA 3EZXA 5A4IS 2BFOA 1N2JA 3IEPA 2UUPA 4D4HA 4XUCA 3B5JA 1X38A 4J6EA 6CHYA 2F90A 1QM5A 4INAA 2NUAA 1E7YA 5K01A 2Q21A 3JAWB 5DWDA 3ORHA 4AYXA 1JXMA 1EG2A 1PO7A 1C7IA 1JL3A 1U04A 2C7PA 5ITSA 2XNCA 1EFRA 2HJWA 3DHWC 1YD7A 4BWYA 4JXJA 1BJKA 3O4RA 4A0FA 4UNPA 4RIGA 5TB5A 2BEVA 1RAIA 2O48X 3BICA 3V8QA 1H2AS 1UKBA 3UWSA 2ADOA 5DT2A 1Z74A 3RC8A 2FEWB 3SYLA 1YRHA 3K0SA 2Y3IA 1FYWA 1MB2A 1TJ3A 2CXUA 1YJQA 4G9BA 4XGIA 5H83A 3WXBA 4LRUA 3UJ6A 2OA0A 3WLLA 1XCBA 1G20B 2ZWAA 4JLMA 2BC9A 2ST1A 4TV8F 1NNI1 3EFHA 4V38A 2E49A 1XTBA 1L4NA 5DNUA 2DERA 3H4IA 4NL4H 2W2XA 4B2LA 3AVUA 3DZHA 3EXHC 1Y8QA 1HDOA 3E9MA 3EVGA 3NTXA 3STUA 2OLKA 4Y2YA 5B3JA 1Y9ZA 3FTNA 4WXYB 4YP0A 5LCXA 1MW9X 3UCXA 4D43A 2RGEA 3KWLA 1NQOA 5D84A 4NPAA 1NNUA 1MPXA 3EWSA 4K6GA 3B6KA 4Y2GA 2AWNA 3BERA 3KFXA 1TVMA 1T1GA 2ILTA 3KXPA 1SOVA 2QM0A 3EF0A 3IHLA 1G8KA 4BGUA 1YV9A 2IA5A 1VKOA 2ZSDA 4ZO4A 2WJGA 5SZIA 2RGNC 1Y1KE 2BMFA 1R9JA 3G13A 4YUAA 4GKVA 2YXEA 1GZ3A 4URYR 4A92A 3A4YA 2R6R1 5C7LO 1PW7A 3B70A 3ZHZA 4OXKA 1OX4B 2O4UX 2VJCA 4DR1B 3I83A 2Q46A 4Q82A 5FUYA 1RXWA 2BN4A 2KW5A 3S7TA 4BWVA 1CY2A 2JB9A 1S0UA 5G0UA 3EWNA 2VXOA 4JJ6A 4M0DA 1AURA 4RFSA 3I6ZA 4KNYA 2YV5A 3K0AA 2AQIA 1JQBA 5KKCA 3FUCA 4TL6A 1BN6A 1HX7A 5I9TA 1QHGA 1MPTA 4PZPA 2XWSA 4IIVA 4G0UA 5FOUA 2IOYA 3EHDA 4LY3A 2WIDA 5IANA 1W5TA 4PG4A 1G4UR 2CMFA 1QVWA 2ZR8A 2B30A 1IIBA 4TL7A 5HIAA 1IJBA 1M2OB 2NVUA 1I30A 4PS1A 3HCNA 2LBPA 5EGSA 4EHFA 4ER3A 4WGFA 3KQVA 5JPCA 4TROA 2WWTA 2VYND 4D25A 4XCVA 4C87A 1G3MA 1T8YA 4L8FA 1VYHA 1NW4A 1Z7EA 2FXIA 3DV2A 3UF0A 4BO8A 1JHAA 3E8MA 5M29A 3GW8A 2C2XA 2EBHX 1P2UA 2QRQA 3C3XA 4KO4S 3JYQA 1T8PA 4PYNA 4CKBB 2JH9A 3R0XA 1BWSA 3K6JA 3FDIA 3IUQA 1R4MB 4D7AA 3R8FA 3N59A 4KPGA 1IHDA 1GWNA 4YMVA 3EUAA 1C7ZA 1S1MA 4A10A 3A1CA 3F3MA 2MTBA 5L8VA 5CYPA 3UCFA 2OFWA 1HWYA 3ORYA 3PNSA 3FDZA 4NFHA 2WM8A 3OIYA 3HFGA 1U7OA 1YRYE 4FXOA 5FTNA 2PBLA 3CRRA 3O47A 3RIHA 3IKTA 4KXXA 1EH5A 1Y1TA 1SBIA 2MT9A 2OCBA 1JJ7A 1IOLA 4NR0A 4MCJA 3IMCA 1G55A 4AUMA 2QAGB 4FFPA 1CIJA 1F4LA 3BIFA 1T2CA 3LQFA 4FEGA 1JA9A 2RIRA 5HKOA 3TL6A 1I7QB 3L8FA 1FJGB 1OH7A 3IB6A 4FDUA 1R3UA 1Z16A 2RKBA 2I8CA 3O3MB 1H8ED 1L5NA 1Q7CA 2AFIE 4I4TB 3C2QA 2Y2VA 1ZD5A 4LBWA 4RPGA 4P82A 3ADBA 3JV7A 5KAPA 3LBAA 1W52X 4JP8A 4U2CA 4OO3A 1K7EB 2ZCUA 3GJZA 2FFJA 2IUSA 5B1YA 2XMDA 1HTBA 1VCHA 3LOPA 5HJ7A 2JIRA 2CDAA 5BNWA 1N6OA 3PFGA 3JQRA 1FXSA 1PEYA 1XDUA 2HA3A 2ZI6A 3IP1A 3QELB 3TSYA 2K7FA 1Q1GA 1ZIXA 4Y6SA 3WDLA 3M2TA 1RWQA 3AK4A 3H8SA 4D9EA 4IBOA 4AJHA 3TW6A 2VC2B 3DNFA 1ZAYA 1E64A 4MYCA 1PSWA 3IEUA 5SYNA 3SYNA 5JI2E 2E4VA 2H0AA 2Y68A 4FYPA 1XRMA 3NOVA 4AJJA 4TV8B 2VTBA 4UZEA 3UV3A 1T5IA 4W9NC 4J16C 4ND8B 4DIOA 4UBIA 4FGKA 4FB5A 4IIBA 5IVHA 3JWGA 1K06A 4NE9A 3Q9SA 1UF9A 2P79A 4NBLA 4CE6A 4CKWA 5KVAA 3BWCA 5HTKA 4A8HA 3SIWA 1XRLA 1CBUA 3U6BA 4MK4A 1Q0LA 3BRWD 1L4FA 4MYRA 4XW2A 1RAAA 1NUHA 1OTHA 1JDJA 1RM5A 2OTCA 3EFOA 4HO1X 4JJ7A 1AUPA 4O4JA 2IU0A 4ZRMA 1PJBA 4CIBA 5AOCA 4YONB 5DCUA 2WUWE 4EB0A 3I61A 4D56A 4EZBA 3ZDBA 1KH1A 4G89A 1U7PA 2O3RA 3FTQA 2ZUCA 4YYZA 1PNRA 2W98A 2P3LA 3A8TA 5TRTA 1OZFA 2ZYHA 5CA1A 3EVBA 2O05A 4L8GA 5LZ7A 5JRDS 5CFZA 3R3WA 1LNZA 4HFJA 4L76A 3KE9A 1RAEA 1YZ3A 3FZYA 3GRPA 3FGOA 2GZMA 3QKWA 4GM0A 4IR7A 4Y9RA 2RHRA 2DFLA 3DAGA 1JU4A 1YZTA 2OCDA 2P3SA 1P0PA 3Q15C 4H0FA 1WD5A 4IUDS 4MVJP 5CDYA 3U0VA 1Y7HA 3UUWA 1NP3A 2JARA 1NMZA 1D6JA 2D2XA 4C7KA 4EJMA 3C39A 2NLOA 1RS0A 1Y7TA 1CFJA 2REXB 1GRRA 3LPDA 4Y2UA 4R9NA 2F8MA 1ZD4A 3VSAA 5KYWA 4LISA 1P81A 4RWZA 4WCVA 5LIPA 4B6PA 5FAKA 2XGGA 2WM3A 2WSMA 4GGMX 4RK6A 3SJCA 4PSKA 3VPCA 5JAIA 5JC8A 1Y98A 5AM4A 4B4DA 1ZGZA 3HWWA 4YX9A 2YJ3A 4JYBA 4NCKA 4M49A 2II6A 4YT5A 1R00A 3PHBE 1PCXA 3UFXA 1KI6B 3LQQA 4MKHA 1L7BA 2XAUA 1L8XA 3CNHA 3COPA 1UPCA 3VM6A 3P2OA 1DJLA 2AFIB 4HEA1 4YRCA 3UJ7A 4F1WA 1RPZA 5KNDD 1LTKA 4GC5A 3ADPA 2JCSA 2ZJ3A 4JT8A 5HRCA 3GX1A 1W96A 3OQJA 5J59A 1OXBB 3N8HA 5DEOA 3N9IA 2HOQA 4BLOA 4YCMA 1LDMA 3T5GA 1YJBA 3PUHA 3VDMA 2WY2D 2P35A 4PNZA 1Y3DE 3MHPA 5E1OA 3RSSA 2FWPA 3EZNA 4N6OA 5IN5A 4HS4A 4LDZA 2ZJYA 2F67A 3M33A 1WEKA 2I76A 1TAHA 3IIKA 4S1PA 3IAXA 4NBKA 4ZHQF 3HB5X 3TE6A 4GBED 4JL8A 2OBNA 1JHPA 2IXEA 1XHEA 2GN8A 2NZWA 4FNMA 5ECDA 1I3CA 3ZIAA 5ADUS 1M10A 1BX1A 2DKNA 2XSZD 4OOEA 3S1AB 4DG8A 4INJA 2WD7A 3T5MA 3THWB 4YYEA 2GJ4A 2WJ3A 5E6RB 1ZEJA 4RHYA 3ND6A 2R60A 1DCMA 4XQ0A 4N12A 1E59A 1FTQA 5JCJA 1SM4A 5JXJA 4URWR 4K1LA 5IYZB 1PJRA 3SC2A 4L07A 4KMOA 2O3JA 1JYFA 1WEHA 4U2KA 3QPBA 2GXSA 4CQJA 5K8JB 4RH0A 4LY0A 3WGQA 4N39A 5FLXA 2J59A 1J9GA 1BMQA 4JI5B 5LQMA 3T7CA 1FMFA 2IYEA 3GCGA 3EXG1 3NTVA 4EG7A 2ZU6A 3ELDA 2QHXA 3KBBA 3UXYA 1M1YB 3MBKA 2OFPA 1DI0A 1Q3KA 4IIJB 3IKJA 1JG1A 3R7NA 1C4XA 5AR1A 3DNPA 1JB1A 5F5NA 1GPUA 1LI5A 4BLUA 5HFNA 1GN8A 3R41A 4X1IA 5BRJA 2EF0A 4AZ0B 4I9GA 2A92A 2JBAA 4GKAA 1UMCA 4NI5A 1NW7A 4FDTA 1QYCA 3KOWA 1XZCA 5ALEA 5AUQA 1XZPA 3A05A 1E98A 3GLIB 5U9CA 1JTVA 3E1KA 4EVQA 1MV5A 4U6SA 4UHHA 1YOVA 1BG6A 2ZYRA 2W2PA 3GAFA 3QTBA 5BUSA 5HGXA 5JD5A 4I4NA 1MD9A 2IXTA 3FGPA 4G4SO 1U5BA 2CMHA 2RH8A 4LCJA 4WNAB 2R2GA 3CLUC 4AZ3A 1NN1A 4V0SA 2ZDGA 1JQJC 3ZLBA 4KW7A 4D9CA 1JHQA 4GZ5A 3GFBA 1XVTA 4MVCA 2AMFA 1QAOA 3EPRA 1EP2B 1GSIA 2GTIA 4EJ6A 1FX0A 1N5OX 5AM0A 3L8YA 3HDHA 1ELOA 3UWDA 4FDAA 4AJEA 4ZPXA 1QHHA 3VZPA 1M9NA 4IIHA 1CY0A 2VHXA 1Q77A 4FZ3A 1LLUA 3D8NA 1C7QA 2ZRFA 2Y05A 4KJZA 4PNHA 1UFOA 4TL9A 4M1SA 1M6HA 4E30A 1T4CA 1W2WB 5AKHA 3TQCA 3OLVA 2ZI3A 1BGWA 2CXHA 1Y9AA 3GLGA 1ZI8A 4M36A 2ZUSA 4IL5A 4I66A 3AESA 4L74A 1ZMXA 3OURA 3QVGB 1GGVA 3QXXA 3JQPA 1FNCA 3EC1A 2P9YA 3G17A 2ZT7A 2ISQA 1C9EA 2B4RO 2BTOA 3I8SA 1VSQA 3DPSA 4G0PA 3VZRA 3RBVA 4F56A 2YFHA 1JDZA 1PJ4A 2MSDB 3ADOA 4FUTA 5FFFA 3CNBA 3HR8A 1VA4A 1YZFA 5CPFA 3TG2A 1GGMA 1LNSA 2OHGA 2OLEA 2Z57A 1OBOA 2PR2A 5ALTA 4PX9A 1TO1E 1YRBA 3PS9A 1E5XA 4U0JA 3WRXC 3SHFA 4H7FA 2PS1A 1JPJA 1F38A 1I1NA 2JKYA 4XQEA 4DR2B 2C0PA 4N0MA 3SVZA 2VS1A 3N0VA 4L7VA 3S5UA 3FY4A 2QRJA 3GAMA 3LP5A 4WEOA 1U2TA 4NF2A 5FI1B 2X7HA 1P33A 1PFUA 4IJMA 3FAKA 9ABPA 1KE1A 4D99A 1T25A 3M1AA 1RWBA 3SS8A 3K1TA 5CEFA 3VPSA 2YCLA 1E0SA 3DVAA 2DB3A 3JARA 4BQNA 3GRKA 2W2KB 3ESAA 4PY2A 1N2XA 3PUKA 4P6VF 4BJ6A 3LQ4A 1MLDA 3NC1C 4K0KB 2JPDA 2FQ1A 2NSDA 3H3FA 4Q4HB 3ZWKA 3QVMA 1GARA 1XK7A 4LYJA 3V7FA 1DRUA 2J31A 1ZXLA 3K92A 4O02B 5I7SA 2FV8A 3FTEA 3GUUA 1U3FA 2Y1EA 3KQTA 1FYFA 4X94A 2QAIA 2WM9B 3N58A 3NALA 1NWHA 3E8SA 4S1WA 4AMVA 4C1NA 1GPAA 4LI0A 1ZM9A 1YRWA 2Y1FA 1LEHA 3AI2A 3HB7A 4LWPA 4X8LA 2PXHA 3VBCA 2IYXA 3M4JA 1GQQA 4EI9A 1CUYA 4AURA 1SUFA 5K0BA 1QP7A 2YOHA 3MINB 3WGGA 3IQGX 1M1NA 1P1HA 3VUEA 1W44A 2FK7A 1OA0A 1YQEA 4TKMA 1MABB 2JAOA 2EFHB 4ACAA 1QRSA 1NBIA 3GB9A 2P90A 2NO9A 4JLKA 1NHGA 1WABA 1ECLA 1TU3A 2HB6A 3B1FA 3W78A 2WPDD 3NEJA 5B3KA 3SQNA 1CUFA 4A0GA 4CTOA 1T3SA 1IUNA 2JFNA 2R8OA 2G36A 2JJYA 4LK3A 4PQYA 3JQDA 5DGHA 5BSTA 5CFQA 1KWGA 1B0PA 1HLGA 3BZUA 3E53A 3GFQA 2X6QA 1OI2A 4OP3A 1OH8A 1XWIA 4HJRA 1YNOA 3PWSA 4AULA 2HA4A 2FR8A 2HZ7A 2ONCA 2WWRA 1FCJA 1POXA 2G25A 3U7JA 1KQOA 2O0HA 4HTAA 1ZXXA 3D0KA 5TGTA 5JXHA 1MW8X 4DMCA 4GKKB 4WESA 5LPNA 4G0WA 2P40A 5ILOA 2WT8A 1RJWA 2B4YA 2EW8A 4H3VA 2YJGA 4QFMA 3PWZA 2BFCA 1NN5A 2Q4TA 2VHCA 3DV0B 2J4DA 3KWMA 1T0IA 3E9DA 3HA5A 2OBBA 4D74A 1H3NA 3FMVA 4KR2A 1E9DA 4FQ8A 1YTUA 3EIXA 2H3EA 3CH5A 4O8CA 2VAWA 1D2MA 2D7JA 2EARA 2P65A 4IVPA 3HUDA 3G7NA 2EFDB 4LQDA 3O90A 4OQLA 5EI5A 1ZU4A 3CTPA 5CVTA 1DAHA 3HY6A 3TRIA 3FKQA 3IVCA 2HGZA 3NTRA 3WYDA 2DX7A 5E95A 4U2EA 1BJRE 2JEZA 2XW6A 4O1IA 3U1TA 4HNRA 1NOJA 1J1IA 2CHEA 4D4MA 1UMBB 1AHNA 1N7JA 2QD1A 3HDYA 3I9MA 4MINA 5EWJA 2VCYA 1Q14A 3KK0A 3VR1A 2ZW9A 1G8FA 4DCTA 2XYPA 1W93A 3SMQA 3DMDA 3UG7A 4DWJA 4MR8B 4FIZA 3OFKA 4FMBB 2IYYA 2GF2A 1TKRA 1VKNA 1QYRA 5DCWA 5H68A 3ZHSA 4BWGA 4D57A 1UKAA 4EI7A 4UULA 2IDJA 1RRVA 4GPBA 3WNQA 1XZJA 1TVCA 2BP7B 1C4WA 1C3OB 2RDMA 5I4BA 1MQ9A 4JX9A 2PUBA 1CFZA 3KJQA 2AZ4A 4LXTA 2E1RA 3MLAA 3CUWA 4NECA 2QP9X 5CA0A 2I91A 1DJQA 4NH4A 3FJYA 4XVUA 1VXOA 3ODPA 3INRA 1T8SA 2J5RA 3H9EO 2JFXA 3NHMA 4RDXA 1BA3A 2CL5A 1T8RA 4V0LA 1JQ5A 3GDOA 3VYUB 4JIMA 2XYHA 1NMQA 2OT3B 3FPJA 4TRJA 5ALMA 4J6FA 4C03A 3OEYA 3CGGA 1LS6A 3CZ5A 5CHEA 4KQJA 2YUTA 5LM3A 1P44A 1S4QA 5AVZA 1XDDA 2CMKA 1C30A 4HH1A 3U19A 1DWPA 1SC4A 2NPOA 4R83A 1F8GA 2LV8A 2OVBA 5DWVA 4JKIA 3QLVC 4KSBA 1X92A 3L82B 1A69A 4C21A 4IGAA 1U7UA 1LBIA 3CR7A 2QW8A 5K0TA 3TR5A 2C7OA 4MQFA 4ZI7F 1OT3A 3SF0A 3DM9B 1JH8A 4ALIA 3TLGA 3WLJA 3NEPX 4AY5A 1QF7A 5FBZA 2OPBA 5IJ9A 4X44A 1ETUA 2VPZA 2AA3A 1V3UA 2EBWA 3KD3A 4LE1A 1GU7A 4Q03A 3VR2D 2FOIA 4CF3A 4P3PA 4DDHA 1ZI6A 1JFLA 4ZT2A 2YNMA 4R8LA 5NLLA 1H9CA 2O2ZA 5E4JA 3TOXA 3KIPA 1KS9A 3W8RA 1ZD8A 3UT0A 3ILSA 1NYRA 3GJ5A 1ZH0A 4NWIA 2HX1A 2F4NA 4KYIB 1NQ5A 3U40A 1Q6YA 1KNQA 3LKZA 3E05A 1YASA 1FK8A 3GAZA 4IIGA 5EP3A 3U4DA 2BGNA 5JCXA 4X6XA 3BB4A 1G5IA 3JQFA 2QSUA 1Y3FE 3P0HA 4TMZA 3MJHA 1VBNA 5IAOA 5JZMA 3HLTA 3PZBA 4K9MA 1FDOA 1QFSA 2J4CA 4FFBB 4LIPD 3WDMA 1Y4DE 4GI2A 3R5HA 3QX3A 3F98A 3SP1A 1J24A 3K9BA 2IUUA 4AMUA 3JALB 5TT0A 3ZBPA 1QVZA 5KVSA 5JNWA 1FU7A 3BD7A 3UWKA 2H1CA 2WF9A 2YVAA 3GPIA 4JA2A 3RVJA 4ZRDA 3TQSA 3HM2A 4JLAA 4JJEA 3PCRB 4DV4B 3FCEA 1XZDA 2JHAA 4Q12A 3EF3A 3PYXA 1I2AA 4TM8A 3IAS6 4BNZA 2W8ZA 2FQWA 2R9VA 3TLZA 4R71A 4Q3LA 2CLSA 2Z5FA 4LYGA 5DGCA 1OKKD 1XCMA 3WBKA 4L0CA 5EHXA 1BHSA 5JVDA 1KIMA 1NP7A 1QE3A 2IPMA 1QO9A 2QUBA 3M4YA 3JZFA 4GL2A 4EVIA 3K31A 1QQTA 2VUIB 1H3EA 1KKUA 4M1ZA 2FWMX 2J0SA 4WY2A 1M0EA 2AD5A 1WR8A 4XWTA 1QRUA 2ZETA 3F1KA 1XP5A 3OIGA 4C4ZA 1LBHA 1PK8A 5J5CA 1M6NA 2HJVA 3BGSA 3NATA 2P9GA 3WLHA 2WT9A 3HZOA 1N3YA 2UDPA 3D81A 1J8DA 4R2KA 2VTKA 4RY0A 1SXJA 3IV6A 2PZFA 5DM0A 3B6EA 4P4UA 5B1HA 4ZDJA 3B7GA 5JYCA 1VGQA 3HO6A 3OOEA 3B51X 1MA0A 1P62B 1ZINA 1ZK1A 2ENWA 1NWCA 4FOSA 4QGHA 1GQ2A 2ORWA 2P7IA 4YAKA 2E48A 2F1RA 2JJQA 1BW9B 1J4AA 1YVPA 4NCXA 5HUHA 5GJWC 5K0EA 1JB9A 3BF8A 1UC8A 4A7PA 1XU4A 3RUAA 3ML1A 5BWOA 3Q7QA 2AOTB 1US8A 1GLNA 1Z2NX 2JH8A 2QRZA 3ZY5A 5BWBA 2ZRKA 1G0NA 1SIOA 3KB8A 1GT91 3WKBA 1L4GA 2OXCA 2BGTA 3RS3A 1X8XA 5FEMA 3K1YA 2BE7A 3CWCA 3LQ2A 4E15A 1KJWA 1XMQB 3R9XA 2OGZA 2REQA 4NU5A 3ZDXB 3AJRA 1JHZA 1XN4A 4EATA 1JR6A 5CDTA 3JZDA 4KRYA 7REQB 4MH0R 3DW3X 3WBBA 2PX8A 3ZOZA 4TSFA 1AB5A 3ABRB 3CWZA 4B6GA 4J29A 3BULA 3CUUA 3H5NA 4C5AA 2JHPA 1A9OA 3T35A 3L02A 3W5JA 3WIOA 5COAA 3RROA 3E3MA 2PQMA 3OPXA 3U37A 2VSNA 1ST3A 5D6OA 4W9MC 2BV3A 1CHDA 3R5TA 4X8OA 4YP9A 1RP1A 1DZ3A 3F6YA 1W29A 2PEZA 4HL6A 4D6YA 2BUAA 4E7OA 3TAUA 3ED5A 2PIAA 3WGOA 3SX4A 1D1TA 1MB0A 1C2YA 1ZMOA 2BFFB 2FFRA 4I3HA 2DT5A 3UQYS 1HM5A 2NZVG 1E2EA 3MFYA 1VSTA 4PYQA 4QA9A 4FB4A 1FP1D 3VKVA 5B6JA 1ZG3A 3C7AA 4CIXA 2BOVA 2IPXA 3EXFA 2GEUA 4S1VA 2I6QA 5GWXA 2XQGA 3QZUA 1P0FA 2DUMA 2A5YB 1DZIA 3PDIB 1ZI9A 2F3QA 1E9RA 1WZCA 4LDJA 4B4WA 4QXQA 2J7PD 2C3UA 5L7TA 1NRIA 3VR6H 1P4HA 2C9DA 2QVGA 2WILA 3L0IB 3R2JA 2R6ZA 4TLAA 1DUVG 3BN3A 4BNXA 5KWIA 1SEVA 3PD1A 4D0SA 5F2NA 3TTSA 5LXTA 2HC9A 3CQ9A 5JZBA 3CLTD 4RIFA 1TPYA 3QF4B 1CP2A 1OPXA 2HWUA 4JEHA 3MNFA 5AKJA 3W7AA 3O4JA 3ZV5A 5AVSA 2WQZA 4AN1A 1RZVA 3AEKA 3TB6A 3BE5A 2GN6A 3EEIA 4QUJA 1I3OA 1U7WA 2H2HA 4C05A 2EV9A 5JPDA 3PNBA 3ETCA 3QV1A 3I23A 4Q9NA 3TE7A 1IEWA 3VNVA 5B58T 2YIMA 4WEQA 3EBLA 3TM4A 3DE6X 4JENA 2FB9A 4D82A 4UHBA 4RJIA 2QQ5A 1CQIA 1YGYA 1GEEA 4WZBE 4ZMBA 3EH1A 3G8DA 1EDEA 4B3DA 1FTSA 1KTVA 1YK1A 5LMUB 1KF0A 1OV4A 3HJAA 3LUKA 4LJ7A 1B6SA 1O94A 3LUFA 4PLPA 3TLEA 4ALJA 3CVWA 5FPSA 1IUOA 3ZWPA 3PX7A 1ICEA 5AW0A 4ESHA 1HE4A 3QHPA 2QE7D 2QTMA 3A58B 4S24A 1FBNA 3C7CB 4LHYA 4R9RA 5TGDA 3ISVA 3WI7A 2R11A 1R0LA 2I6SA 3B1YA 5ALGA 4ZV9A 1SC9A 2A1TS 2A0XA 3RFTA 1OWOA 1QQ6A 2OV1A 2IUFA 3O4HA 5E6UA 4DPKA 2BELA 3OUUA 2V6FA 1X74A 2H0QA 5H02A 3E3NA 2IOFA 2QX9A 1E0AA 5K99A 3LT0A 2H0RA 3D8UA 2CUTA 3ORFA 2CD7