3NHZA

Structure of n-terminal domain of mtra
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two component system transcriptional regulator mtrA
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 40
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nhzA00
3UUGA 1OXBB 1Z25A 4MS4B 1U2QA 2M1ZA 1R8JA 4G0YA 1VRVA 5TQ2B 3RVOA 3RVMA 4G0QA 3RH0A 3LUAA 4D74A 3H5WA 2KYRA 4O5AA 1TVMA 1A0OA 4OATA 3IP9A 4KQCA 1FFGA 2JVIA 5PNTA 4YGXB 3M6MD 2FN9A 2L18A 2E4VA 3QLTA 5TPZA 2DRIA 2MSKA 1EFAA 1ZVVA 1VLZA 2R25B 2PUCA 1DZ3A 3LOPA 2ID9A 3M9WA 5E3JA 1ZH4A 3IP5A 1F51E 4JB0A 3N0WA 1C4WA 4Z0NA 2RDMA 1D5WA 4IMJB 5D2CA 3BRQA 5DTEA 2PUEA 3L49A 3EAFA 2V0NA 1TM2A 2L2QA 1JYEA 1XWWA 3BREA 3D02A 5CNJA 5JNSA 1QQBA 3URMA 4Z4HA 1JDPA 2FN8A 1S8NA 3CU5A 3E61A 1W9HA 4RK4A 2GBPA 3QELB 4MS1B 4DADA 4NCBA 4RK6A 3HJFA 3GRCA 5EWJA 3Q7TA 4S05A 5TPWB 4LE2A 3OLVA 1JFSA 2A9OA 1ZAYA 4HYEA 2WJAA 3JY6A 1GCAA 5FWXA 1HEYA 5GQSA 3ROFA 3N0XA 3W9SA 6ABPA 3LTEA 2HQRA 4MQEA 1RXEA 3SNKA 3A10A 3TMYA 2MYUA 4YRZA 4N76A 2HJ9A 1M2EA 1ISRA 1ZY2A 2FMHA 4PYRA 3FFWA 3OMXA 1P6QA 3A0UA 4YR7A 4UHJA 3BRSA 3ILHA 1QP4A 3N53A 4WXMA 1FFWA 3A3KA 4MR7B 4LZLA 1JBEA 3EJWA 3HCWA 3JTEA 1L5YA 2VYCA 4KK3A 4IF4A 2FMIA 2MSLA 3KJXA 4G0OA 1BVHA 1F4VA 1NXVA 2FVYA 2E4XA 3B2NA 3RVNA 3QX9A 1YMUA 4IILA 3CTPA 3O2SB 4ETNA 5JNTA 1YTUA 3CG0A 1ZGZA 3FFTA 4MGEA 4EVQA 3KYIB 1NTRA 4OTZA 4XXHA 2FEWB 3EULA 3KSMA 3LUFA 5T7BA 1GCGA 1P6UA 2WY2D 5B3JC 1ZESA 3HO1A 5KC9A 3LKVA 4MAAA 4RXTA 1U04A 2FSPA 4JAVC 4LDZA 4WWHA 1PHRA 2A9RA 4XAQA 1H9CA 3SG0A 2Q5CA 2ZWMA 4N0PA 5DLEA 3I09A 3CFYA 5HKOA 3CRNA 2L17A 1USKA 4G0XA 4RY0A 1FQWA 1FSPA 1TMYA 4F06A 5IC5A 4MS3A 3KKEA 1BDJA 1JFVA 3SM9A 3N8IA 1AB5A 3H6GA 4Z9AA 5HM6A 3DZDA 2AYXA 1MB0A 4RZSA 1QMPA 1D4ZA 1Z15A 3FFXA 3EQZA 3OLXA 4LE0A 8ABPA 1YS6A 4H3KB 3O1JC 4CBVA 3E3MA 2PJUA 3F7NA 9ABPA 3OQOA 4F12A 2FQXA 3VNBA 3KG2A 5TPZD 3IPAA 4TLMB 3QLVC 1ZDMA 1EWKA 3GYBA 3N75A 4Z9BA 2JVKA 5IEJA 4Z4IA 4ZMRA 2QSJA 2FMFA 5CHYA 1LJLA 3DGEC 1JHZA 5HQJA 1SXGA 2ID7A 2LBPA 3LUKA 4G0PA 3OQNA 4LX8A 2GKGA 2A9QA 2JVJA 2NT4A 3CKMA 3CLKA 3MF4A 4N0QA 1DRKA 3OM1A 5DCLA 2CWDA 3LUJA 1MVOA 1MIHA 4MR8A 1JWLA 4GPAA 5EWMA 1PNRA 4RK1A 4DQDA 3HZHA 4Z4CA 4RU1A 3LKBA 1E2BA 3O2JA 4EGSA 3OQMA 1Z26A 4WT7A 1APBA 1SD5A 3HEBA 5IUNC 3D8UA 3HS3A 3DGFC 5EWLA 2HQBA 1IIBA 3QEKA 2JBAA 1TLFA 4EYKA 1UDRA 1SXIA 4P98A 2H0AA 1LBIA 3FGZA 4W5OA 1PUXA 3H75A 5DGCA 2IDMA 3H5LA 4H60A 2CHEA 3O1IC 2YHAA 4G0MA 5EWJB 4PEVA 1QO0A 2LPMA 2PUFA 4G0ZA 3C97A 5FBHA 2FLWA 3G1WA 3KYJB 1JF8A 3EDCA 1CHNA 4PICA 1EWTA 1W25A 2RJNA 3C3MA 2PUBA 5FWXB 2PE5A 4OLAA 1DBWA 1ABEA 2CHFA 4RKRA 2PUGA 4MS4A 5TQ2A 2WB4A 5B3JA 3QLUA 4G97A 4KK4A 4MQEB 4XARA 2QVGA 1LK0A 1DCMA 3HM9A 1NY5A 2H3HA 2P4UA 2VK2A 1P2FA 3ROTA 1E6KA 4JP1A 4YP9A 1M2FA 2VUHB 5JNUA 4ZJPA 3BBLA 1JX6A 2PMCA 4HNRA 2B4AA 4OBBA 4ETIA 2YHBA 2IPAB 4RXUA 3DLBA 1PNTA 4WZZA 1LBHA 5KQMA 4DN6A 3JPWA 5KQGA 3NHMA 4RV5A 5CNIA 1JFTA 1Z16A 4RSMA 3M9XA 4KREA 1DC8A 3I5AA 1KMIY 3T8YA 3GV0A 3RQIA 3JS5A 2GI4A 4RDCA 3TO5A 2AYZA 3TD9A 4KFCA 4HNSA 5C5EA 3MQ4A 2QXYA 4RKQA 7ABPA 4L4UA 5BRJA 1I3CA 3Q15C 4KMRA 1L5ZA 3C6QA 4O1IA 1JYFA 2HPHA 3CZ5A 3GL9A 4UHKA 4YS6A 4RXMA 3CS3A 3QELA 1B00A 4MS1A 4Z4EA 3EGCA 1EWVA 3JVDA 4KRFA 1QKKA 3QLVA 1Z13A 3JPYA 4EUKA 5IULC 4Q7EA 4S04A 4KQ9A 1JLKA 4RK5A 2WWVD 4LE1A 3DLHA 4MR9A 2PUDA 1DCKA 2NZUG 5ABPA 3Q7RA 3GA5A 2W42A 2LUOA 1QNLA 3A0RB 4IMIB 3SAJA 2JCGA 2NT3A 2E4YA 2IPNA 4WUTA 1BA2A 1DCFA 1P8AA 1KRWA 1ISSA 1VKRA 3C3KA 4MQFA 3GWGA 3RVJA 2WJWA 3SQNA 5KQLA 3MA0A 2PAFA 4ML3A 1WETA 1RPJA 3RVLA 4TLLB 2R47A 3S99A 2PKXA 2FKAA 1YIOA 2PLNA 3BILA 1PEAA 3HDVA 4MS3B 3VNAA 5JNRA 4XASA 2IKSA 3H5TA 2TMYA 2FLKA 1E6LA 3HVRA 2JRLA 3OMWA 5DKFA 3ILYA 3Q7SA 2RGYA 4N03A 4Z4GA 4FE4A 5TQ0B 5TE9A 3HUTA 4YLEA 1QPZA 4P1ZA 1Z12A 3HK2A 4MLDA 4H3HB 4E7PA 4G86A 2FW0A 1XHFA 3HUUA 1USGA 1FFSA 5C5CA 1VPWA 3KCNA 3N6VA 3HXMA 3QEMA 4L85A 2WMYA 3NNSA 1A04A 1SXHA 2FQYA 3GT7A 1QP0A 3H5OA 3T6KA 2ZAYA 5F64A 1NXTA 3R0JA 5EWMB 5JNWA 4OLBA 2P9HA 2LIVA 5FWYA 3SY8A 1ZH2A 3DBIA 1TJYA 1ZHHA 3OLYA 4NCAA 2VUIB 2FEKA 3RVPA 4XLTA 4MRMA 2FTKE 3GBPA 4MPTA 2JBAB 2F8SA 1KGSA 1QO0D 4MYRA 1USIA 6CHYA 2E4WA 3F73A 5BRAA 1EHCA 3T95A 3H1EA 5BQ3A 2QV0A 1OXKB 3I45A 1GUDA 2M98A 4Q6BA 2XDYA 5T3YA 4RS3A 3O75A 3QX8A 1NXPA 3T38A 3OLZA 5IX8A 2I6FA 2QZJA 4GNRA 1LJUA 2MYNA 3LFTA 4XFKA 1K66A 4LRQA 4IGAA 1Z18A 3TB6A 4D6XA 3CZCA 4W5NA 1DJMA 4QYMA 1A2OA 3MIZA 4NICA 1RZRA 4TN5A 3HSYA 1ZITA 2QVCA 3FDFA 5CNMA 1K68A 1C0EA 4IRXA 1URPA 2OENG 3K4HA 1CYEA 4Q6WA 3RVQA 1EAYA 3RVKA 3O21A 3LMKA 3H5IA 4JA2A 1QQAA 3G85A 4KPYA 3NNNA 5ED4A 2IPMA 4EVSA 1DBPA 3CNBA 4RK0A 3IP7A 2F8TA 1KRXA 1YVUA 2A9PA 1XHEA 4N41A 3CG4A 4QPJC 1BDIA 3MYYA 4W5TA 2E4ZA 4JB2A 1ZGGA 4EVRA 1MAVA 2RJOA 4HNQA 4ZMSA 4WXEA 3H1FA 3EODA 5IUKC 3IP6A 3LUDA 1YK0A 4Z4FA 2NZVG 3HV2A 2FMKA 3H5VA 4MR9B 5CNKA 2JK1A 5KC8A 5FBKA 1AB6A 4PE5B 1NXWA 5JNVA 4QYWA 5KWSA 4YWHA 1U8TA 4D6YA 3MM4A 4FE7A 5TQJA 3Q41A 4MQFB 5TPWA 2MYPA 3CHYA 1YMVA 4O1HA 1Z2DA 2B1JA 4M88A 1ABFA 3O74A 5GOTA 1QP7A 4EYQA 2J48A 1D2AA 4JOQA 2PL1A 1CEYA 1U2PA 3MMNA 4ETMA 1BDHA 1U0SY 5IBQA 1DBQA 4EY3A 5JS1A 2QR3A 3O2QB 2R4QA 3H6HA 3N0RA 3OO1A 3OO0A 2IYNA 1RXIA 2GX6A 4KV7A 2HSGA 3GBVA 3RVRA 2OQRA 4F8JA 3NNDA 5IEBA 2E4UA 2L19A 4EYOA 1T34A 1D1QA 1NXSA 2JB9A 3KHTA 3NHZA 3OM0A 4YO7A 5IUJC 4F3TA 1J56A 4MR7A 1DC7A 1RNLA 2PL9A 4RY8A 3OLWA 1NXXA 3QK7A 1PEYA 1Z2EA 3Q9SA 3QEMB 1M5TA 4RY9A 5KQPA 5HSGA 1M5UA 4Z99A 1Y1LA 2N9UA 3H1GA 3TX6A 4E7OA 2NUBA 4YV7A 3I42A 5BR1A 4TMYA 4FB4A 3QLUC 4JASB 3LUHA 4Y9TA 2FQWA 3KS9A 2IPLA 3P9YA 1JDNA 1Z17A 1JL3A 5FWYB 4F11A 4KVFA 2FEPA 4LDAA 2FXIA 5I4CA 2CD7A 5KI6A 4MRMB 1DP4A 3UK0A 1GLGA 3K9CA 4B09A 2O20A 3F6PA 1BAPA 1JH9A 3KTOA 4MR8B 1DRJA 3LUGA 1YS7A 2PUAA 4PZ0A 1E6MA 1D1PA 1NATA 3L6UA 4NV3A 4ZPJA 2MYTA 3LUCA 4W5RA 1MB3A 3RVSA 3KLOA 5JS2A 4EYGA 4KNYA 2QU7A 5EWLB 3JVIA 4NQRA 3EQ2A 3O1HB 1GUBA 3IDOA 1NXOA 1ZN2A 3HDGA 5TQ0A 4ZYLA 4QICA 2MSWA 3KLNA 4OG2A 1RZRD 2WRZA 3F6CA 4RK7A 2IOYA 1SRRA 3IPCA 2X7XA 4W5QA 3NBMA 4KZKA 2HQOA 2BGGA 2LP4Y 4YCSA 3C3WA 2R48A 1DG9A 1YK1A 4RWEA 4N47A 4MLCA 2GWRA 3UKJA 3FMVA 2QW1A
chains in the Genus database with same CATH superfamily
3UUGA 4BP8A 2EU8A 4MQ5A 2C2HA 2X5NA 3E58A 3GH3A 1C8LA 4IJVA 2OFXA 2R6CA 4Q1AA 4ZO4A 5I9NA 3RJ9A 2H5IA 3AJ8A 4XA8A 3ANMA 3BJRA 4KFTA 4PPGA 2GCEA 2MHCA 3ZWYA 2CNWA 3JR3A 1ENYA 2DWQA 3IP9A 4EG5A 4NNJA 1E79A 3COYA 1VRCA 3EK2A 1Z56C 4DMKA 3S2ZA 5IZ4A 4EHNA 4IF6A 1YDHA 2NU8A 2Q28A 5C7LO 5ECYA 1VI2A 2ZBEA 3E5NA 4TMVA 4WFQA 2QUZA 3SXPA 1NPDA 1R74A 3IUPA 3PRYA 3QM1A 2BRUC 5DYGA 2WYWA 1Q1BA 5J40A 1NNLA 3IVGA 1U7UA 3OZDA 3WK8A 2XGSA 4A16A 3AT1A 4ER5A 2IA5A 5HUJA 4LWZA 1AUPA 1NV8A 1MEJA 3ZZ1A 5K6RA 2BI4A 2PUEA 2JLZA 2W6JD 3JQAD 4P7BA 1UFOA 1DMSA 4Z4HA 5C18A 5K05A 3GRUA 5CB6A 2PQ6A 3S29A 1UBOS 2C97A 3MJTA 4RD6A 4NZOA 5JVDB 4MI3A 1W9HA 1JSZA 5MGNA 1HR0B 4LJRA 1XA0A 1KEVA 1XZIA 1O6BA 1MU0A 3I6ZA 4NCBA 1P18A 3A25A 3I32A 4K26A 4BWFB 1LDMA 2F9FA 1MFZA 3H9UA 1QG0A 1XI2A 1BIFA 2BFAA 2QJRA 3F2IA 1KFCB 4MB6A 5EJGA 3TLCA 2X8JB 2IW1A 3E3LA 1NVUQ 3Q85A 3F3YA 3TZEA 3G7NA 2J7PD 3PXCX 1K5PA 2VDQB 1ENZA 2E9SA 1UZMA 2ISSD 1GPDG 2J87A 1E0KA 1G5HA 2X0KA 1E1LA 1UH5A 3G2PA 3W9SA 3VZQA 1J7KA 1OV6A 6ABPA 1WG8A 2PBLA 1KYZA 5LP6A 5LJIA 3K70C 1ZZGA 3RI3A 4BMZA 1M10A 2WIJA 1UBCA 3KXDA 2BGMA 1KAHA 1E5VA 4I4NA 4L27A 3TTSA 4YV1A 4WZAA 1NW7A 4QDUA 3BXZA 1ZEMA 2CF5A 2GESA 3WDSA 5K2OA 5KTNA 3UJ7A 3H1TA 4CKZA 3ILHA 3G7SA 2XCTB 4GWKA 1GPLA 2HCRA 3N53A 5JRDS 1T0BA 3RT9A 1NHGA 3LDFA 4DV5B 4G5HA 3OEHD 5EYPB 3V34A 3BSWA 3MB5A 4CF4A 1Q17A 3Q9LA 3L3BA 2P3OA 5B4TA 1Y9ZA 3PFWO 1FLDA 4IF4A 2ZVDA 3KLMX 4OMFG 1TLTA 2F64A 4LJ6A 1Y34E 2OT3B 3F47A 3FPSA 4W1SA 1X86B 5FL3A 2Y6UA 3VOAA 7AT1A 1YTUA 2AHOA 3O8OA 1I32A 3B1WA 4O2BB 2HN9A 3RPEA 4BMVA 5LL6P 3WNQA 3OU7A 2WSBA 1OYWA 5DRYA 1Q77A 1QYWA 2H51A 4PLTA 3BK2A 3RUFA 4C2TA 3SPXA 1DEAA 2DU8A 1DAMA 4NHEA 5B1DA 2CE7A 4IHJF 4REMA 2Z2JA 1D2MA 3EGIA 3LKVA 3UPDA 4HQRA 2DG2A 2C5BA 1GGEA 3DOCA 4LDZA 5LWHA 1CIVA 3HNOA 3RC2A 4ZCPA 1T9ZA 1KZGB 1JKXA 3C5EA 4Q12A 3WFJA 1WCXA 4BJ3A 1Z0AA 4DLAA 2CSXA 3OPYB 3G2IA 4OK3A 1YL5A 3UJCA 3OM9A 2IV7A 2O54A 2BW0A 4F06A 3T5BA 2HA2A 1B3RA 2VWGA 5FH9A 3HJRA 1G41A 3KKEA 4ED9A 4F0JA 3ZDCA 3H6GA 2F4NA 2JJ8A 3BXFA 2OV6A 4YEDA 1Y3CE 1U80A 2ZBQA 2BEWB 4RESA 1CHDA 3M33A 4J75A 4LE0A 3VBCA 5LYJF 1BW9B 3QW4B 4AL4A 1UBHS 2ZXFA 3ZCQA 2AF4C 2W6ID 2HF2A 2ORVA 1HFWA 2WJGA 3NORA 4HSEA 2OPHA 2O2HA 3NV7A 3RS8A 2Q21A 2M6LA 3DAGA 3AW9A 5DIFA 3IDZA 3CIOA 2GAIA 3LVFO 2C0CA 3RF7A 2R8XA 3KZMA 1YBFA 1NE2A 2I66A 4LHYA 4Y9RA 3OF2A 4PV7A 4ZVOA 4R0NA 2A1IA 1XIVA 4EB8A 4L5YA 1X8LA 1K7YA 3DTVA 3MF4A 5J5CA 3G68A 4RVNA 2PQ0A 1O0CA 1OFIA 1ZIOA 2AZTA 4TKVB 2EHDA 1E5DA 2AZXA 3GRVA 5EHIA 4GOKA 3CO5A 1VCHA 2Y93A 3E18A 5EQDA 1EX6A 1WV0A 1PTJC 1MO3A 2HAEA 4HDRA 2HHCA 4JC0A 2XT9A 2ZITA 4LRYA 3MWYW 1F5SA 3GWZA 2F2TA 3JCZA 1N9KA 4OHUA 3STXA 2HW8A 2BUCA 2DY1A 3A1FA 4KLZA 2I4LA 1WP4A 4C4XA 2PX0A 3GZNA 2VTBA 2OCLA 4OM8A 5E7IA 3C45A 1KAGA 1Z8DA 2QIPA 4R6XA 4JYZA 4HZIA 4Q4HA 2IEYA 5FEUA 2V6FA 5MN4A 1DRWA 2H1FA 1TLLA 1IOZA 1QV9A 2MR5A 5DN6A 3TNLA 3V4SA 5B4VA 3ML1A 4PCAA 2CYBA 4C4TA 3I2IA 1YZKA 2V98A 1ZUHA 2WB4A 5JRZA 5B3JA 2E4AA 1O6GA 2CL7X 1NY5A 2NYRA 3D3JA 3QUQA 2VK2A 4WK4B 5GV7A 1EHYA 5DNUA 1GPJA 5ALSA 3BH7A 4YP9A 4BV2A 4BZZA 4EUSA 3QE9Y 4XWTA 3OFND 3BBLA 3EIQA 3LQ2A 3EIFA 4FYHA 3C7DB 4QAJA 3ZS9A 2JGKA 3HNPA 3JWEA 4MLPA 3R6WA 1V9LA 3QVVA 1NOJA 3WGVA 4DYDA 1B93A 3GX1A 1XMOB 3D8SA 4QOGA 3LXXA 3T3OA 3DP7A 4JBHA 4KREA 4P4SA 4MW5A 1Z0DA 4L2IA 1NLYA 1SHKA 4UEJA 3JS5A 3IQGX 2W0MA 2AYZA 3G2OA 4JSTA 4M7PA 4HNSA 4IIXA 2ZIGA 2QXYA 3RLIA 3WSVA 1N5JA 1J49A 1ZEJA 1P7YA 3GK3A 3BFKA 2OZEA 1XU4A 4LYFA 4MKHA 4OXQA 3SIPA 4FONA 3ZE9A 2HB6A 4MW2A 2QGFA 4N65A 3DNFA 4MS1A 1G7RA 1EWVA 4ZV9A 4CKCA 1U1GA 2QE7D 3KTDA 3ROMA 1RPZA 5JYCA 2V0GA 5AICA 4NXNB 1ONBA 4M55A 3H5AA 1MJ5A 3BFVA 4S04A 1N6PA 1Z29A 2C4HA 4RD3A 3A3YA 4IOKA 3DZGA 4BO7A 1NLMA 2VH5R 5ABPA 3WL6A 3MAAC 4HDKB 3SAJA 2QZ4A 3A28A 3KT6A 4HDMB 3OFKA 4XWYA 3TLMA 5J5AA 5IWAB 3H6KA 1RQPA 3O7MA 3EPJA 4F46A 1W30A 5EUCA 3I8XA 3IAUA 4CLRA 3PSAA 1W5EA 3VPCA 5KQLA 1WETA 2CXRA 2PAFA 5CVUA 4NZPA 5DOVA 4QM7A 3R7DA 2E48A 4MSUA 2PS1A 5EUBA 1GPAA 3CZQA 4LGYA 3MSCA 5FNZA 4XB2A 1J8DA 3H5TA 1GAQA 5JD6A 2FGJA 2CVPA 5C7OO 1ULTA 5A1TA 4B3MB 4NJOA 1GO2A 3DP9A 2H4XA 5LDHA 2C9BA 1X9HA 2ACKA 4UFNA 3PE3A 4WESB 1SCDA 4DLWA 2I7VA 4YLEA 4D4GA 3VVCA 4EIWA 4Y6PA 5H16A 2ZCJA 3DDNA 3KKQA 1GKLA 3KT0A 3QI2A 4P93A 2WM9B 1TJ3A 4PAGA 3BL5A 3G0IA 3PHBE 3CRQA 3GQBB 3AR4A 1F3OA 4G86A 2QUKA 4N5HX 2YN4A 5C5CA 2P4SA 3N6VA 4EF6A 2EEPA 3BRCA 3DEZA 2V6MA 3ELBA 3KZVA 1FRNA 1GU1A 1R0LA 2I55A 4OHKA 3U5TA 3GT7A 4ZVTA 4JQSA 1Y1KE 1ZRNA 4FBGA 1Y6FA 4YRLA 5DEOA 3H5OA 2A5YB 1YZ3A 1K7EB 2QRMA 4UULA 1O3YA 4EAAA 3CURA 3LQFA 2QYHA 5KB3A 3VZDA 4X8MA 1NNI1 2A0WA 3HKDA 1FDUA 2O1SA 4LTMA 3R7AA 5K0JA 4WVLA 3UV3A 3DOJA 4YBZA 3TTTA 2VF7A 4MRMA 1R12A 5E3IA 3TINA 1R6DA 5AVQA 2VJOA 1USIA 2JFQA 4MYTA 6ADHA 1Q16A 2J67A 2B6NA 3R2JA 4HUTA 2E4WA 3ZTYA 4MQMA 1U9YA 2WVAA 2ZSBA 4YRKA 3DKVA 4KR9A 2NU6B 3RTCA 3I8OA 1A5SB 3ZYCA 4DVGA 3EGXA 4PG8A 1W4ZA 1K88A 2Q46A 2VJLA 4JFAA 2IBSA 3RVBA 4BL5A 1Y6JA 2F1RA 4ERNA 1AS2A 1X7GA 5AI5A 3MD9A 4TSRA 4INAA 3IJ5A 1W4RA 3FNHA 3SZ3A 5JOQA 4D0NA 5IARA 2P9GA 4D3DA 4UM9B 2I8CA 4QX6A 2XMRA 1HQKA 2FJPA 3HYNA 3PLRA 5GMOA 4PU0A 1ST2A 3QYPA 4Z0PA 3A1TA 4MW0A 3U13A 3CZCA 4F1KA 4BX9A 4QYMA 2JJQA 1MIOB 4TVOA 1VI5A 5A4AA 3I52A 1YKSA 3HSYA 2FCAA 3UJ9A 2QVCA 4AS1A 1UXOA 3FVVA 2GKOA 2UDPA 4B3TB 3PF8A 2BI7A 1RU3A 1NI3A 2DPHA 3C3PA 2YIDA 1MVLA 1BVUA 1JTFA 1N2HA 4FDTA 3E27A 1GQOA 4Q03A 3R9IA 2I1LA 3PC6A 5IVPA 4MWBA 3KOUA 3QOYA 2OAEA 1SVLA 5ALQA 1E64A 3FDIA 1N2BA 4KWCA 4UMDA 1OLOA 1AQ6A 3SDSA 4PR3A 5EMJA 1Q0UA 2BFBA 3CNEA 4RK0A 2H7YA 2RKOA 3T1OA 4KNVA 1RC8A 1XHEA 3C4JA 4N41A 1TUBB 1CYDA 2V58A 3I39X 3MYYA 3NTVA 4JYCA 4QPJC 2AK3A 1JXQA 1NVWQ 2XF2A 3CB2A 3DZBA 4OOFA 4F4JA 1T2VA 1NVAA 3E1GA 2YJ4A 1L5MA 4X71A 3CF6R 4J16A 2VN8A 4EQ6B 5JYDA 2GTHA 5JHHB 1VE5A 1QWOA 2YINC 2JEZA 2J5RA 2Z3WA 3PNVA 2CVQA 4KN6A 1US8B 4LIPD 4AUEA 4EOGA 2HV8A 1QHGA 4F2DA 4TL7A 2ZDQA 4HUJA 4OGWA 1AB6A 4NEQA 2WVHA 3F6YA 4B2IA 1PR0A 1PI3A 3HO6A 1U8TA 3NWOA 1ZR2A 3C8UA 4C3ZA 2BCJQ 2BEVB 2MYPA 5BPHA 3G6KA 1RHUA 4UZSA 1KF0A 2I03A 2QTHA 2Y1XA 1DTSA 1NV9A 3IRVA 2H85A 2BGUA 2XNCA 2QL5A 4ZC1A 2B36A 3PQ2A 1ULZA 1ADYA 1HZJA 2ZBPA 2UV8A 4XKJA 4ZOEA 3SQLA 1I7SB 3WKEA 3W5DA 1PJQA 1YR3A 4JC8A 4Y2JA 4DUZB 3K0BA 3NJ4A 3ESQA 4LHSA 1FNCA 2FEOA 4KBYA 1W73A 2X41A 2B69A 3JVVA 2YFQA 3FDZB 2GX6A 3BCHA 5H5JA 4B87A 2PFSA 2H2AA 1M7BA 1Z33A 1U9ZA 3AERB 5DM4A 5ECDA 2ODTX 3UFBA 1G4HA 1SCBA 2OY0A 1CZKA 2NTYC 1F1BA 3WMRA 5AI0A 1HUQA 2I7DA 1IG3A 4FNAA 3DSRA 3T3MB 1A1VA 4EITA 5B2FA 3AKYA 3VUFA 2BTEA 1SIBE 2PL9A 5F51A 1RIIA 1CVIA 1E5LA 2XOKD 4B3RB 1FDTA 1Z2EA 1JFTA 3P52A 4OQLA 4HGNA 4E07A 2KBEA 5DBOA 4MVJH 1WWKA 1XKXA 2BM8A 3FSGD 4NU0A 3ZGXA 2XY4A 4D42A 1TC2A 1ZOSA 2GEBA 2H92A 2XTAA 4KXYA 4FFPA 4G23A 5SY4A 5EIXA 1L6RA 1JQLB 4R69A 5HTOA 3DL7A 2FPPA 3MNFA 4RF3A 3TSCA 1BXRB 1CJSA 1WO8A 2YL2A 2DPGA 1XRSB 1U2ZA 3DEJA 4NE2A 5EIHA 1ZVKA 2X9NA 4ENVA 3OWXA 1OLUA 2C5EA 4D3SA 1EBUA 1WDTA 2B1RA 2Z8YM 3KVYA 4JR0A 4PPQA 4HXYA 3PTZA 4I5FA 4LXTA 5J2UF 2R8YA 4M9ZA 2FUG1 4QPZA 3GYGA 1ZBQA 1RKBA 5F5LA 4G37A 1UWKA 2I2DA 3TNFA 1PEDA 4LJKA 2XDQB 5CJ2A 3BPSA 1T36A 2X15A 3OPQA 3SZOA 2YXDA 1ZISA 1V4VA 3B1KA 4LNAA 5JXGA 1CUVA 3LBAA 3LS2A 1UT5A 3H9JA 4JLVA 5ALLA 3IVCA 3DLIA 1VHQA 4EI7A 2AUTA 4IH9A 4LRUA 4AYXA 4G0VA 1Y1TA 4ASUA 3EWSA 2AOUA 1L5KA 3UHPA 1XPUA 1N0VC 3MWGA 4H0NA 3W7AA 2BGGA 1PVOA 2V6JA 2D0DA 2Z1MA 1Y4UA 3BA6A 5G4LA 3OH8A 4UVGA 4QT0A 2VF2A 1JHRA 3SXUB 2R97A 2FH5B 2HKIA 4GL2A 4GO1A 3HBJA 1EZZA 3KLBA 4HY3A 4XX0A 1CY8A 3AUFA 2PNFA 3QNMA 4R1LA 4Q3OA 1ZA1A 2IV2X 2NIPA 3WLRA 3ZH2A 3D4NA 1R0XA 4EKYA 2D1FA 3L4KA 5AKYA 4HL6A 1PSWA 2QTTA 4KH1A 4RW0A 1ZG3A 1IY0A 2WKPA 3WLSA 3KR9A 4TN1A 1KK2A 4BX0A 1UBMS 2IQ5A 4KOAA 2PKCA 4OQYA 1D1TA 5FOTA 1N4AA 1F38A 3ZBPA 2ZBDA 1E3SA 1KYTA 2NSYA 1XHLA 2F1KA 3G0CA 4LHEA 4JI5B 4JXZA 3HP1A 2KLBA 3HVJA 3MUOA 1LDGA 3B78A 1CJUC 4KB5A 1P4HA 3VH3A 3G2KA 4QGGA 4GT1A 4PAOA 4HQNA 1YRLA 5BSEA 1MN6A 2ZYHA 1E7RA 4XRGA 4G67A 1A1SA 5BWBA 3ZHZA 2YQZA 3PUXA 3SBEA 1E2DA 2F8MA 4UVIA 2A9FA 1FP6A 1L6IA 4KN9S 3WL5A 2P5UA 3ICCA 4M9UA 2O7NA 5EE0A 4U7JA 4E1VA 3LT4A 4X62B 3I9V1 4LX0A 2P91A 4EFKA 4DIBA 1GUZA 1FTNA 4ND1A 3LCMA 4D57A 3COJA 2PKYX 3ZU4A 3D8RA 4BKRA 2RB5A 2X0EA 4WA7A 1RXSA 1JFSA 5D6OA 4K6GA 4HI0E 1LY1A 1UXKA 4WDQA 2RGRA 3CZ4A 1W85B 1QH0A 2IYLD 4EMUA 1E2FA 3IELA 2R7MA 4WBNB 2IXGA 3DMDA 4J29A 1DFIA 1Z68A 5COAA 4EB3A 3GLFA 3K6SA 4KXFB 1DKRA 1IDN1 1YQUA 4L0MA 5HM8A 4U8HA 1AZLA 2I7TA 1FVOA 1U8CB 4NJEB 2WMNB 5FLXA 3SMVA 4K2HA 1IN4A 2HNBA 2P62A 1JAIA 4KPUA 3C5CA 1M1XB 1FTGA 2WTEA 2N46A 1RHMA 4JQYA 2QI9F 5DHRA 4YLYA 5AK5A 1F6BA 3O3OB 4CTKA 3NWEA 1JIJA 3EUFA 1NJ5A 1JEDA 1ZNYA 2GZ1A 2VHEA 1GRQA 3MTEA 4I50B 4BNJA 2MSLA 4MRSA 1F4VA 3HL0A 4DJAA 1K08A 1G21B 1GDHA 2X1VA 3CSUA 3EDRA 3WBFA 3ZXXA 4ZDKA 5B7GA 1N36B 1HOXA 2NWQA 2Q2OA 4K3UA 4UXIA 3WO0A 3LBHA 4ETNA 4N3CA 3TBKA 4Z8YA 3AL3A 3LY5A 4IDHA 4ENQA 2DPYA 4KLCA 1ZGZA 4DSNA 2O6HA 1D0SA 1A5AB 2VKQA 3PNQA 2PGXA 1TYCA 3ZZTA 3L7BA 3N9IA 2FEWB 3SCZA 4GRDA 1GCGA 1WB5A 3DHYA 2ZUFA 1KKMA 2D8AA 4M7OA 3CQ9A 3I9KA 1NIPA 3I6YA 3DR3A 4MDYA 2EP5A 2FX5A 1XDDA 3I04M 2WQ6A 1HURA 2C03A 1JILA 3N1UA 4E3ZA 1UBUS 4DF3A 2I2XB 1JGTA 4K0RA 4CM4A 2JG3A 1P39A 1VTKA 3GLHB 3BXOA 2DKNA 2PPLA 1AKWA 1R8SA 5E6SA 1W36D 1WXHA 1X13A 2FSIA 4G89A 1ZH0A 3OTOB 1I4LD 1SVMA 4LOJA 4WK6A 2VT2A 2OO3A 3A7DA 1O94A 2AFIB 2W71A 3JRWA 5TGTA 9LDBA 3OZCA 4ZCMA 3N8IA 2Z9DA 1M83A 3MPOA 4B8WA 4I2NA 4DM7A 4QXQA 5JJ5A 1YVRA 2MWMA 2Y76A 2ZGVA 4ZOAA 5CD1A 3EVZA 1PKXA 1PJ3A 1G1MA 2R6FA 2Z98A 2QMZA 4Q9LA 5JMWA 1ESCA 4NK4A 3Q8MA 5B7NA 2B1QA 2E55A 3CRZA 4JT2A 4QBTA 4U6SA 1I1QB 2FQXA 1VHLA 2YOGA 1W88A 3NBYC 2IEDA 3EGVA 3QYJA 5I7WA 1DIOB 1J33A 4K9PA 2RGCA 1AXGA 2VRBA 2EQAA 3IQXA 1UKBA 5EXPA 5JCZA 3KYDB 4HN2A 2XUJA 1CCWA 3LCRA 2YS7A 4L57A 3CF2A 4Z9BA 1NVEA 3SYNA 1TZJA 4FS8A 3T7CA 4MIKA 4UUBA 2HHAA 1TZCA 1QRDA 3OD1A 1RBZA 3K1TA 1YQWA 3DVLA 3P9SA 4K9RA 1LTHR 2B61A 3LUKA 3U4QA 3CH6A 2GKGA 3KZOA 2O4UX 1CUGA 4RMHA 4L3OA 4V3CA 2AHRA 5DCLA 1PNVA 1SURA 5ITZA 3U16A 4D56A 4BC1A 5LKAA 3W4IA 1E96A 3RIGA 1N8SA 3TOCA 3TZQA 4IAOA 4DDKA 4EGSA 4FW9A 1Z26A 3P96A 3WICA 1FB5A 1YVDA 3HS3A 3OAAD 5C8YF 1FCJA 1RJGA 4CL2A 2BM1A 2ZYTX 3A2KA 1CQXA 1QIIA 1UDRA 2XTNA 1FEZA 3FNFA 2CL5A 2R60A 4P3NA 3VZSA 2A5GA 2QLBA 3AUYA 2CYCA 3OBBA 1M1YA 1TPZA 1M6HA 5KWVA 4FSHA 4QOHA 3U56A 4K46A 3NRJA 5DMXA 4WKPA 2ZCUA 4OH1A 4HNHA 2RGNA 2X5XA 3K5HA 1L5SA 2ANCA 2HLDD 3GEMA 3N2YA 3PZRA 3KYJB 4O4JF 2VDUE 4PICA 5G0VA 1EWTA 3VVLA 1MO5A 1XQXA 2XQIA 3P9CA 2QA5A 4Q4DA 2P6RA 5BVGA 3JD4A 3GVHA 3UFXA 3QFRA 5EIOA 3TRIA 2XLBA 3IAS6 4I6JA 4MS4A 3VYTB 2CCJA 4D4HA 2FSHA 1T8RA 1V41E 4PF1A 3KDPA 2AG0A 1NN1A 4BWVA 1MO4A 1T25A 4UHFA 2DZDA 2QDXA 3MJVA 4WZAE 3SX4A 3TZ6A 4G4JA 1O57A 2EQBA 2G8NA 2GSWA 2J9FA 3A6HA 2W11A 5F1PA 3GJTA 5L3SB 2FU5C 4RO0A 3HFGA 3A58B 4G5YA 4YTEA 3CLUD 2GA8A 1Y4DE 1ZD5A 4XFJA 2CFIA 1P6XA 1KPGA 1U3WA 4NYJR 4LC9A 4PCLA 4RSMA 4CU2A 1Z7GA 3RSSA 1MTZA 2B7BA 2W2KB 1NRJB 2P9EA 2PMKA 3L2OB 1GKYA 3V1TC 4WOPA 2ZRPA 5JPDA 1HI9A 1OFVA 2KJQA 2WSMA 2XBLA 3LA8A 1M6WA 4FZJA 3BWEA 1A77A 4E6PA 1L8OA 3C6QA 3GMTA 3NBAA 4PX5A 4NZZA 1MZPA 4KDCA 2I2AA 3QELA 3UUFA 4F93B 2DFVA 2RHLA 4LECA 5G0TA 4ZHQF 4LXQA 4R6WA 3F8WA 4A5OA 5ALZA 1A9OA 2JI7A 1DIRA 5A02A 1MJGA 2HA5A 4MYHA 1TFRA 3ER8A 1T1RA 4I55F 3UAYA 1SKQA 1KKLA 4LE1A 4Z54A 1RRMA 5CYFA 1NBMA 4YFVA 2HYDA 5ECGC 1E0JA 1BH2A 2Y68A 5AK4A 4DCPA 1DCFA 4HYQA 3H9CA 4IMRA 2IW3A 4JL8A 4AYTA 3PGXA 1H1LA 5EOVA 1CKEA 1U5AA 1KE2A 4BKMA 3L0IB 2RHHA 4C04A 1EYZA 1PBTA 2PV7A 4KXUA 5DYIA 1T1JA 4IV8A 1EX9A 1OR8A 4I81A 4PXAA 3AXSA 2HNAA 5DNVA 3PGLA 4FI3C 1XNGA 2JIOA 3PP8A 1YKGA 2BEUB 5LLSA 3VKVA 3VNAA 4X1KB 2CZCA 4XASA 3WXBA 5JTUA 3KV3O 4BUCA 4EJSA 3N2GB 4XR4A 2P0EA 3ILYA 4F56A 5JROA 4OL9A 2XCSB 2JEYA 3H7IA 4NZYA 1KHHA 1AGXA 2XUAA 4UAGA 3ZWCA 1G9TA 3HUTA 4M1YA 1GG2A 4GLLA 4K40A 2GT1A 1U9CA 3C7CB 3KXLA 1WPXA 4BMOB 2GAAA 4N4AA 5KTRA 1D5CA 2HT6A 3CTMA 1IZ7A 3PWZA 4R1QA 4BV9A 3B9PA 1SOUA 2HQSA 5F9MA 5K3DA 1YB7A 4ZO9A 1SBIA 4ZXFA 1GAXA 4TTIA 3O95A 3GFBA 1T8UA 2PPVA 1K63A 4MGKR 3OC0A 1IMJA 4GBED 4OYYA 2DTDA 3E9EA 3EBLA 1VSBA 5ILQA 2CNBA 1M76A 1Q74A 3P9NA 4E5MA 4DKJA 1C0IA 2FQYA 2ZJ7A 4CKWA 3NHKA 3A4TA 2D13A 1EGAA 4B6GA 2BHTA 3IP3A 4D8YA 6YASA 3BB3A 1FUKA 5EP3A 5IAJA 1XYGA 5AI8A 1NXTA 4QHYA 1ZS9A 1P4JA 3BXXA 4N49A 4PSDA 3R7SA 5JO9A 2QG6A 2PM8A 4MP8A 4UFPA 4QG3A 1OGYA 3FZEA 4IQGA 2W22A 1PJTA 4AF8A 3QXSA 3FOWA 2CFTA 2P67A 4I5IA 4RJ2A 4UHEA 4TL6A 2Z4SA 4WV3A 3CF0A 3TSWA 4WLFA 2PD3A 4J7AA 2FTKE 4ND8A 4DA7A 3Q3CA 5D7BA 4EARA 1QO0D 1PKEA 2VPPA 3P27A 1I7QB 1XQ6A 2XH8A 1J09A 1DWUA 4RLFA 5ALRA 2QTNA 4P7JA 1Y7HA 4HPXB 4IEIA 3A3OA 3O1LA 4K2AA 5J47A 2PVPA 2AMJA 3E7WA 4EY6A 1F0KA 3FWPA 4RS3A 1RI3A 3OZBA 4ZQEA 4DCVA 2R7AA 2GJ8A 4OYHA 3R3ZA 3ZZNA 1R8QA 4IGAA 4U5QA 3QKWA 4LQCA 4WZ6A 1D04A 1QH1B 1KZ4A 2QLNA 3B36A 3ZXIA 1C50A 4CMCA 1XJ5A 3P9QA 2AN4A 5ED0A 3WYGA 1W5AA 1LK5A 4IHQA 3WIUA 3SC2A 1BKSB 4BMSA 1SXQA 4AJ9A 3QWBA 3PEWA 4QA9A 3BZUA 3L6OO 3EY9A 2DFTA 2Z83A 4P54A 5HYVA 5JFTA 3L05A 3P0JA 3Q10A 3OU6A 4UEKA 4I8XA 5CPFA 1X0VA 3VXKA 1PO7A 3R1IA 4TT3A 1IAQA 4R1UA 1DKNA 3HRKA 2DR2A 5IKEA 1Y8ZA 1FC0A 2ADFA 1EAYA 1BDMA 2GD1O 1JHAA 1Z62A 3A6EA 2A9VA 3EXAA 3QHPA 4RWZA 5B1YA 1K92A 1V71A 3DVAB 4L3VA 4D8WA 4RSGA 2WJPA 5H82A 2OFFA 3UYLA 3RTBA 1GADO 3EOBI 2I78A 1O94C 5LQSA 1GA1A 4YK7A 3W7VA 2VP5A 3EEBA 4J49A 2IBMA 3UENA 4A1FA 1SU8A 1GCIA 1VYUA 3T7DA 4ZGWA 1KRXA 3BL6A 2RGUA 3AEZA 3CN9A 2FWJA 3QMVA 1MCZA 4FOLA 1WIWA 4NCJA 1TVEA 2DPMA 2GEKA 4OFXA 3TQHA 4XM0A 3AHFA 2QTBA 5AKXA 1FZQA 2JAWA 2RGAA 1G5TA 3I2KA 4REQB 3OECA 1DBRA 2DJIA 5FD8A 4DJ5X 1WUIS 2PWBA 3F9IA 4BFYA 1LEHA 1JKJA 3CUTA 1EFRA 1RWBA 1JHOA 1R15A 2BCGY 2QD1A 1S4MA 2YJGA 3PT9A 4G0NA 4H16A 3F2VA 1R9NA 2NO9A 4MR9B 2CD9A 2C7VA 3DMRA 5SY9A 2J3IA 4LHZA 5MHTA 3BKWA 1EG2A 4DXDA 4MJLA 5ALKA 2QSZA 4AUNA 3KYBA 1WF3A 2XYVA 4WZBA 5K03A 2EP7A 3MTGA 4F3YA 5K4HA 1JBKA 3HXKA 3K30A 3TDMA 4L73A 3I28A 2RGGA 4PYNA 1U1CA 4B2LA 4G1MB 3TN7A 1ZVMA 2GCOA 4AC9A 1PT5A 3CX8A 4I1RA 1UUFA 4TTVA 3UATA 4G5OA 1K8QA 5DP2A 4KGZA 2A94A 5LU9A 3RK4A 1VJDA 1C9DB 5IBQA 2E1PA 1HDEA 3DOFA 3Q88A 3Q7IA 4HG2A 2Y05A 5EKXA 3SVTA 2HJVA 2VZ8A 3OT4A 1KR5A 4FGLA 4C6HA 5K8IA 1GNLA 3WK6A 2OL4A 4W8OA 4GSLA 2HK8A 4MTLA 1Z8NA 3X1MA 2WF8A 3ITDA 3OZIA 3HN7A 5GVSA 3KRTA 2PZEA 3QY9A 4UBOA 4XEHA 3S44A 4HZGA 3RW9A 1PV1A 4TLEA 5KX5B 3ZWNA 1M75A 4PZLA 4BB0A 1JEYA 1QVRA 3GJ7A 3H1GA 2W2TA 2GBCA 2IYWA 3W3AD 3FETA 3KFXA 3O83A 1Z36A 4LHVA 2ZBUA 1X70A 3QVKA 2Q3JA 2VAMA 4ZZIA 1XMPA 5CFPA 1EUQA 3HU1A 2IPLA 4GOOD 4TSFA 5EI5A 5EZYF 3S4YA 1K5GA 1NR7A 2F1IA 3V4OA 1CZRA 4B4VA 1AQNA 1X0XA 4ZT5A 4DRXA 2X14A 1E6CA 1QCYA 2VDWB 4JLPA 5HVNA 4YI5A 1ZIYA 1D2EA 2CD7A 1ZCAA 2CNLA 2XMGA 1M6VB 5A04A 1DP4A 5BVHA 5CLFA 3GLSA 3IMGA 3GARA 4HYTA 5C37A 3V8PA 2HA3A 1F4PA 1DRJA 3L82B 2GLUA 4LZAA 3RAPR 1A98A 4G8CA 2PKRA 4N18A 3V9AA 1SD2A 3VNSA 3GNSA 1E99A 4O4IA 4JD5A 5BYBA 4KNYA 4PYOA 3RC8A 5HJ7A 4AX4A 2W6MA 5JR3A 2G0AA 4FOTA 3VKHA 1NPTO 4LOHA 1KY4A 2C9CA 1UJNA 2HK7A 2WT9A 3A6JA 4JZYA 1P5FA 3DL0A 1MRZA 3EFOA 4P80A 4AJ1A 1VL8A 1DIGA 2EJVA 2W90A 2FZ4A 1KO1A 3OCYA 4C0JA 1UM9B 2Q4TA 2QROA 3FI9A 3IPCA 3P2OA 3GCDA 1FP2A 1GQ2A 2C82A 3A27A 2C0PA 4HEQA 4P81A 4UFOA 1V11B 4FJ1A 5A9SA 1NG1A 2MINA 3KHSA 1RQ7A 4UHCA 2R1VA 4C4ZA 4IJWA 5AW7A 3KO8A 1XP8A 1QR2A 2DPXA 4U7TB 2FXVA 4J6EA 4L0DA 4PFQA 4UBNA 5CH3A 1IXKA 1QGOA 2FRVA 3K6RA 4ISBA 3E22A 3N3AC 4OQZA 1ISMA 1IB0A 4WVFA 5CYOA 5IK2A 4D74A 3M7IA 2VJQA 2QUHA 4O5AA 1O6CA 2WPNA 4MQ6A 3FCEA 3HCFA 3IT0A 2OC4A 3AWIA 1JIKA 3DE2X 2CMDA 4GXTA 3ZEIA 4A8JB 5B3KA 4P4NA 4R2KA 3DB1A 1FTYA 1WDWB 4FU0A 4HLQB 3ZD7A 2FPIB 4Q16A 1B6SA 2ZB2A 1DZ3A 4PNEA 2VDNB 1GT91 4IGKA 4EJSC 3IIIA 3DONA 2ERXA 2F43A 4GEKA 4YIHA 5EJ9A 5IAOA 3CN7A 1F51E 2F59A 2I2FA 3C16C 4DYHA 3N59A 4B2PA 1C4WA 1XN4A 3LVQE 5C4IA 2PKQP 4E21A 4UE2A 2AJ8A 5D2CA 3BRQA 1ODKA 1TM2A 3EOAI 1XWWA 4PCUA 3VPXA 2XB4A 2GUGA 2RK4A 1ID1A 5IN4A 1YJ5A 2PGOA 1II0A 2D1TA 2IS4A 1NKSA 4DILA 4D0LB 3QPDA 4GS5A 1KVTA 1A8HA 1IHPA 4HBZA 1SBZA 4WJKB 1BOOA 3VR5H 4KQWA 1HY3A 1QS0A 1UJ5A 1EXWA 3E7PA 2Z6QA 2C2MA 3ZK7A 1EAMA 1T29A 5IJ9A 2A9OA 4BQEA 3H99A 2PSDA 3DMYA 1TT5A 1X1AA 1KMHA 2P6UA 2V65A 1EVIA 2W2MA 4KIUA 1S6YA 3K2BA 1P4RA 2V8BA 4R1SA 3N0XA 1U63A 2DQKA 3LY7A 1KI6A 2OECA 4U00A 1FRQA 3ZH9B 3EH1A 4JWTA 2G9QA 4PZCA 3TRDA 2Y1CA 4BE7B 2AGVA 4MKRA 3NX4A 1T24A 1LK7A 1SUFA 2NTEA 2R8OA 2W58A 2Y6VA 4MQUA 1U0BB 2NYAA 1SK9A 4NABA 3V80A 1YAJA 4DDUA 4PYRA 1AGYA 3FFWA 2RE8A 5CA1A 2OCXA 4CR8A 3OPVA 5LFAA 4GI2A 1XZPA 3C6ZA 4UVEA 4QVGA 4P3XA 1NUUA 1S96A 3CZMA 1B1AA 3HM2A 3LZ6A 5AM5A 1TTPB 1YV9A 2QRVB 1LDBA 3COSA 1N9GA 4MINA 4ENPA 2RGWA 2VC2B 3Q4GA 3O0DA 1E3IA 2CJPA 4QU5A 3LL7A 3STVA 4L9WA 3BHNA 4WGGA 2NP6A 3DPIA 5CXUA 2ZRNA 4W6QA 2FZKA 1YMUA 3M5DA 3CH7A 4RJIA 3DF7A 3KT8A 1FFHA 4QQFA 1GSOA 5AKLA 1JB1A 2XKJE 3ZLTA 1SCUB 1MO2A 4R3UC 3AM1A 3GJQA 3WLJA 4QWMA 2QJFA 3K8QA 4PZ9A 4WE3A 3U1VA 4U9IS 3EULA 1ZOOA 2QX8A 1Y33E 1K6JA 3VR2A 3JARB 1OILA 3U81A 1CIJA 4HBGA 1BJRE 2JLVA 3TTVA 3HABA 4IGIA 3CLRC 2AOVA 2CLMB 3HY4A 3I6MA 1WP9A 1RFGE 1XP5A 5BNZA 1KPHA 1XCOA 2H08A 3G0OA 5HUHA 1GVNB 3F6EX 3OQBA 4N0PA 4ZEOA 3PXGA 3W2GA 4CQLB 1G8GA 2O3SA 3NVKI 2JJ1A 3ZJYA 2P4QA 2YTZA 2DF8A 3EA5A 1BFUA 5IC5A 3U4IA 4PXYA 1N7GA 2CXUA 4BAGA 1XK6A 4B5LA 4AMZA 2WHEA 3YASA 4Y2SA 5DB4A 4Y2YA 4HAZA 2AXPA 1SIUA 2J5QA 3ZLVA 4C0BA 5IG2A 4B3GA 1RM4A 5CDSA 1TZKA 3JAWB 3S7TA 3UAWA 4BLRA 4F4IA 2FPXA 2PJUA 2ZYGA 3WAGA 4QDXA 2JGDA 2MIIA 3QPAA 1ZGAA 3DEFA 4IHKA 3UTDA 1OAAA 4PZDA 3ZHOA 4EB0A 2Q6VA 4J90A 4IIEA 4NF2A 2UZ1A 1JAZA 2JANA 4ZMRA 3GLGB 1MT0A 2XCUA 2YZKA 2FJUA 2OBNA 3KEFA 2C9MA 5SYMA 3DGEC 2QD4A 2IUYA 4Y0NA 1F2TA 1LLQA 4KXMA 2B5WA 4RFSB 1X7DA 3ELDA 2DFNA 1XFAA 3TSYA 1BMFD 3ZDBA 2PRKA 3CKMA 2AXEA 3QBTA 3FPJA 2CWDA 3LUJA 4TTTS 2YMQA 3ABRB 3IPRA 4C4OA 1BEEA 4L8WB 2E3JA 4GP7A 4AKSA 1JA0A 1PR5A 2WQ7A 2Y66A 3NIGB 2A57A 1RZ3A 1U0JA 1ZP6A 3D3WA 3EVGA 5CT6A 2YW2A 4CMAA 3ZVKA 4DOMA 2XB6A 3R8CA 1WU8A 5EJ5A 1FUYB 2CV1A 4QYIA 1W94A 2OB1A 1YDFA 1C3VA 5DBGA 2NTNA 4RZHA 3A06A 5DXJA 1B8UA 4DT1B 4DBVO 5C7YA 1TW3A 1PJAA 4H60A 4MI9A 1VGQA 2HQ1A 1GSAA 5L4NA 5BWMA 5H9VA 4KVGA 5LA6B 3RC9A 5FYDA 5D84A 2ZBGA 2OM6A 3T7TA 1R88A 3PDIA 1OMOA 3FSEA 1W25A 4KBFA 1ZIPA 5IMBA 3GJ6A 1UK7A 5AVVA 4KPGA 3MOIA 2OUKA 4RIFA 3T99A 1OHHD 2AT1A 4CKXA 5TQ2A 5JZSA 3U37A 4ZQCB 3GLFE 3TW6A 3QLUA 1L8QA 1X7HA 1M1ZA 3CPHA 4XYEA 4KK4A 1A8IA 2EFDB 1UMCB 2PQMA 2PH3A 2XHZA 4G2NA 1LK0A 1F8UA 1DCMA 1L8LA 2HIGA 5GJVC 2AJCA 1XLVA 2J6BA 4JJKA 5CP8A 3VR4H 4OK6A 5JNUA 3NM4A 4LXIA 1XMJA 3OJCA 5C3MA 2O8BA 1JLMA 1Z5WA 2RH5A 1N2GA 4PSAA 1FMFA 5D5QA 2B92A 4MA5A 2ZIXA 1Z83A 4DN6A 3ZX5A 2W48A 3VI3B 4CG3A 4RV5A 3IUNA 3K3PA 1FL9A 4FPXA 5P21A 1YRBA 4L95C 4C0LA 1F8XA 1UBGA 4ZOLF 1ZSNA 3CM0A 3L1VA 4JBLA 4KVAA 2GI4A 4YT4A 4NFHA 5FNVA 4RKQA 4YBRA 2XCOA 5U9CA 2H4JA 3RTGA 3WHKA 3WQBA 4K03A 4J0GA 4KWEA 4QREA 3HDJA 3AHJA 1T3SA 1WULS 1NUPA 5ICSA 5LP6F 2VP2A 1HKHA 3HCNA 1CP3A 4R1TA 4GE0A 3FYUB 1OGIA 5LMNB 4EUKA 2CF6A 3TM4A 1GZ5A 4FYVA 5SYAA 2UZAA 4S1TA 5A6VA 1SY7A 1P5ZB 1PK8A 3KAKA 4PQEA 4XW2A 4A92A 4JP3A 2BMJA 3I2FA 1L2TA 2H57A 3FUXA 3T1VA 2OA0A 4ZQFA 1SVSA 3A9WA 5J5VA 1W48A 1P8AA 1G42A 4C4RA 1KSFX 5E4JA 1G2IA 1PJ8A 4RS4A 2QBYA 3NBXX 2GDZA 5EXSA 4MRRA 4ML3A 4M1EA 2YBDA 5CJPA 5F12A 5EG5A 4C7KA 2IH5A 2WF9A 5JNRA 1RPAA 3O4HA 4BO9A 3IAAA 1L5HA 3BCRA 3KB2A 1ESNA 1HFJA 1I6WA 2QNIA 4GUDA 5DGIA 1QFYA 4LQLA 2DHQA 1P9WA 3H18A 4FGJA 1KZ7B 2IEIA 4IZ6A 4U2BA 3VU1A 5BN3B 4XJVA 5BURA 3AG5A 2NPFA 1MF7A 3IQZA 5CBKA 2J6CA 1HLPA 4JI4B 3WNCA 1M34B 5TE9A 4IR7A 2QUBA 4O08A 3DQPA 3UXMA 3A6PC 2R68A 5FWAA 1W75A 4BDSA 2A2ZA 4J0IA 5TMBA 3NB0A 3KXIA 3H42B 3W2FA 4ME6A 3DPUA 3IALA 3IAEA 4TTJA 5AJYA 4BLUA 4A82A 2XIJA 1BJTA 4GG1A 2M9MA 4BV8A 4C3UA 1Y6ZA 1V1MB 4C89A 4L85A 4DVJA 1X7WB 1A7KA 1QP0A 1RKUA 3RRJA 3SZGA 1VHDA 2HY7A 4M76B 4ZI5A 5LZ9A 3A11A 1R4NA 4DL9A 4ARCA 3ZJTA 2ZAYA 4AWXA 2DR3A 3MJEA 5SZHB 2I3AA 3A37A 1G18A 2DXIA 1MC5A 3L18A 2F1JA 4XTCS 4B3CA 4OP1A 3NIWA 4AIRA 2YV5A 3QV2A 1ZHHA 3FPKA 3OLYA 4XB6B 2I3ZA 2C92A 1J0AA 2ET6A 1HM5A 3HXTA 1E61A 3E5HA 4WXRA 3ZGOA 3EISA 1UFQA 3D2LA 3FZNA 3D2AA 3IEPA 4ID9A 4NE7A 1MAAA 1A8PA 4Q4AB 4YJHA 4A27A 2C94A 3K9WA 3IVMA 1JECA 1U9IA 4EPYA 3H11B 1H42A 1PDVA 2R79A 1Q6ZA 4MHOA 3U4GA 2FW8A 4G4SO 3WL4A 3TIGA 4TTRA 1ZPDA 2AKAB 3COVA 3IT1A 1GUDA 2WWXA 4IVQA 4Q6BA 1XF9A 2VPWA 1TJPB 3IIJA 3VSDA 1C81A 3F6BX 1H0SA 3K31A 4DLUA 3O75A 2Z6AA 2Q49A 4DR4B 3EA4A 2QOEA 2TMKA 3N8NA 3ZV4A 1FYWA 4IJUA 3WHIA 2JNWA 2MYNA 3OCUA 1EEHA 1TNDA 2AFVA 2QXTA 4XFKA 3F3MA 5ESDA 2IF0A 4XIIA 4AY4A 4L0CA 5JDIA 2R751 1Y3IA 2PN1A 1CULC 2EDAA 4U2GA 1TA4A 2WHYA 3RYFB 2EARA 3SP1A 3KZXA 1U8YA 2VSXA 3HGQA 3PUKA 4KE9A 4UZEA 1F12A 3NHYA 3O4VA 4WK0B 2AZDA 1L3CA 4TXNA 3WGTA 1ZITA 3D54D 5G3ZA 3T0GA 2PZBA 3FDFA 4OJQA 3ZNPA 4EEZA 4EHFA 4Q5IA 4LRSB 1OD6A 1T3LA 2WIKA 1SVNA 2YFYA 1E3WB 1R1DA 1SC3A 4QTZA 1B2LA 1L3BA 2HCFA 2WHQA 3D6AA 2AR7A 3QGMA 3ZV3A 4BO4A 4JYAB 2V7EA 5EE3A 3RVQA 3UAXA 3VU8A 1Z39A 2XX3A 3O21A 5EHZA 3NHLA 5ETJA 4NCAA 1BOFA 4P84A 5CG1A 3ZWQA 3ZQ4A 3ES9A 5BV2P 2O5CA 3GVCA 3L7MA 1JKIA 1C1YA 1CU1A 3UH1A 3CNBA 1VG9B 4CM9A 4DIUA 3DDHA 5C1OA 3FM9A 1I2MA 1DAIA 2A9PA 1W29A 4RORA 2O0KA 4GAEA 1TYEB 3KX2A 4JB2A 1BCSB 1WUHS 2DLNA 3H2KA 2WYOA 3RJMA 2R4TA 2UYGA 1A2KC 2LW7A 4P86A 5ERYA 2Q1SA 3CPEA 3O3MB 4BQFA 2P0AA 4ND4A 4G0UA 4RQAA 4CMBA 2O7RA 1N8NA 2D1SA 1AHIA 5CT5A 1R3UA 3RTEA 5JVDA 4MMYB 4IFTA 4ARSA 4NNPA 5FBKA 4AP6A 1HE4A 3ROEA 3WJ7A 3OI7A 3PA8A 1MOQA 2LR0A 2ROQA 3CUKA 4IYRA 4RBNA 4G4SP 2NN3C 3PR3A 3B1XA 2CFRA 1J39A 1LB1B 2ATXA 1QH8B 3WRYC 2ZUUA 4F72A 1ORIA 5GJWC 4CKBA 2RB4A 3HYCA 2X8JA 4B6EA 3QWAA 5JADA 3MINB 3TECE 2IT1A 5FX2A 3WB2A 4Q3LA 1DV2A 2GCPA 5KNBA 4ZQIA 3V7WA 4X41A 2OMKA 4OHBA 1WNTA 3FZQA 3I9JA 4GBMA 2AVDA 1PFUA 3GFPA 4LOAA 1RP7A 1X92A 1BRMA 5C4GB 4AYWA 2Q2QA 3N70A 1U9JA 4B7XA 5JQWA 5T6BA 2BGKA 2AYYA 1N3YA 1LLFA 2H1CA 2G63A 1L7RA 3HC7A 3S5UA 1XPOA 1F2UB 1EP2B 3NHZA 2Z5LA 2O8CB 4G1CA 3EIEA 1AGPA 3DEKA 3K35A 1E69A 1RWMA 3WQRA 4J91A 5EYPA 4G6ZA 2R11A 5AHOA 3DOOA 4J0JA 4MKIA 3QK7A 4MWTA 5BW6B 2FG7C 4Q7LA 3A2LA 1I36A 1NBWB 3I42A 4O0LA 3BX1A 3L7DA 2RHRA 4YJ3B 2ZRAA 3K9GA 3R5TA 1W4BA 1XEFA 3AR2A 3P2JA 3QLUC 4JASB 4L16A 4JXXA 5THXA 5I4BA 2GARA 1JQDA 4TVKA 4S12A 5EESA 1JL3A 2CDAA 1ULUA 1R9JA 1RKVA 3THSA 5U4XA 3TVYA 4O2BA 4DBZA 1JZSA 3GT4A 1IXYA 4X91A 3TDKA 1FFDA 5GM1A 4ZA2A 5NLLA 4M9RA 4X6YA 5G0UA 5TNXA 1JFRA 2IP4A 5BNIA 3ZKWB 4BX2A 1SHUX 2WFZA 1KBQA 3QE2A 4FE3A 2W2NA 4FQ7A 1T5HX 1NM5A 1T6XA 3I2GA 3R9WA 4PZ0A 3PC8A 621PA 2IY7A 4ZPJA 3PFIA 3LUCA 4U3JA 3VU0A 1WXDA 4OFWA 1Y4SA 2LTAA 3LXMA 1YR9A 5H9WA 3NEJA 4NQRA 1P4GA 3OPYA 2W2LD 4TPKA 3OJEA 3TCXB 3TNYA 1L7DA 4BKPA 2XRZA 2WUVA 1GIAA 4OG2A 3OKAA 2GILA 2WAXA 1W2GA 1QNFA 2GJ9A 1Z2PX 1DAHA 4YJGB 4L5CA 1Z82A 3TIIA 3TR5A 1NJSA 2GETA 3NTOA 3M9LA 3Q2OA 4Q0MA 3RUPA 1YS1X 5HG0A 3QSYA 2BEWA 5CGQB 4CIYA 2MSCB 1GN9A 4NK5A 4R1OA 1DEXA 3JZAA 3ZE7A 4DV0B 1BW9A 5KU1A 3FMVA 3SBXA 5ALIA 5HOQA 5SICE 1EFPA 2FMUA 3AB7A 3H83A 3C48A 4E5DA 4E94A 1U2QA 4XCXA 1E6EA 1ICIA 2B34A 2EBWA 4XGNA 3O4RA 2UUAB 1N1GA 2DMRA 3RAGA 3HDYA 1TVMA 4OATA 3GDOA 5EJIA 2GRJA 1P29A 3H9GA 5ADWA 5E7QA 2QRQA 1M33A 4FGUA 1C4OA 2VATA 3GUUA 1D8AA 3DEAA 3JQBA 3M6MD 3LWNA 2DGDA 1NOKA 1S2DA 4RANA 3GZJA 4QU0A 5EQTA 5ESWA 4DJTA 4Z7QB 1IDOA 2PUCA 2DQZA 2EBHX 3WQHA 2GJ4A 3ESBA 1GL3A 3JQGA 2PZ8A 4UBIA 5BV1A 3S2GA 3FLEA 3ZXUB 4TKVA 3DE0X 5KNDH 1OGJA 2EW8A 2WLSA 1KYIA 1N34B 2KE5A 4NNOA 2YZNA 2ZBFA 2XNSA 5ILGA 3R74A 3W5UA 3WP1B 4EB6B 2IU6A 2IYXA 1KGDA 5EIBD 4HT3B 5JNSA 3CCBA 4DE5A 1D6SA 1C1DB 2G77B 3NHRA 1YR8A 4Q1EA 2NX2A 3CU5A 3E61A 2EIHA 4EZEA 1EDDA 1G60A 1V2GA 1ZD1A 2X19A 3JQAB 1I7DA 2WINI 2RGEA 3HI6A 4QEDA 2B99A 1BXZA 5EIFA 1GSHA 4EEKA 4KJXA 2OQVA 5KNCH 1PX0A 2PU5A 2DKFA 2X7JA 3K53A 4BGEA 4F2WA 5ALEA 4NBKA 5CDUA 3KALA 2FUG6 5JPIA 1FXWA 4H1VA 4NL4H 4FYYA 1KOGA 3ROFA 1IZZA 1CUIA 1UBRS 3OC6A 2O2XA 2E18A 4CE6A 5T41A 3QVLA 1OH7A 1J6UA 2DP4E 4EMTA 3TMYA 1J5EB 1ZK3A 3RJZA 5DULA 1U9IC 3ONFA 4D44A 1ISRA 3K8OE 1J2UA 4M6WA 4W1QA 3DLTA 1A76A 3JAMA 4JDUA 3BSFA 2ZSFA 2OAGA 1O6ZA 3LDUA 1T9AA 3OPMA 4F2HA 2R8BA 4D46A 2H2HA 1J9ZA 1NSYA 2IKQA 2PT5A 3U3MA 1FTQA 4NE9A 4HYYA 2GNPA 2PL5A 3EEQA 4OB6A 1W0JD 2Q6OA 3S2YA 1UPBA 1ZD2P 1XJ0A 5HXAA 3GJSA 2DAPA 3OE7D 4G0OA 1UMBB 4NYIQ 3RSCA 2BFCB 1BN6A 1U0FA 3ZWVA 1AGRA 1QIEA 3F98A 3RVNA 3BWDD 5FPSA 3DT9A 4IILA 4ENWA 4AX8A 2PZJA 1G20E 2R86A 2EFGA 3LT0A 2ETVA 3E4CA 4MGEA 1R6AA 3L92A 1QOPB 4AKIA 1GHTA 4C4PA 1S9HA 3I6BA 2DX7A 2HYIC 3V7FA 1FMJA 3EYAA 1P6UA 5H80A 3WLQA 3ZE2B 1PS9A 4OA5A 2O5RA 5EVCA 3WBBA 1Q20A 3BKXA 1ZH6A 3FUCA 3GG9A 2H63A 2BMAA 4JAVC 4Q01A 4DDWA 4Q7QA 1HKUA 4X94A 3L7LA 1C1HA 2PO7A 3BVPA 4HDKA 1T8SA 1NJGA 3NLLA 5F73A 5JAUA 1K7CA 1L7MA 4PLCA 3ZVRA 4CM7A 3JW8A 3STYA 4QWWA 1J42A 4G1FA 4QBHA 4PZZA 4UD6A 2EVWX 4B7CA 4KX3A 3I9V6 1ML4A 2C61A 2C3UA 3FLAA 4K6CA 1AB5A 1XZCA 3R3WA 5A0FA 1GPBA 5HM6A 2IGBA 2AYXA 2R1TB 1NI4B 4HAUA 4C7OB 1FNBA 3WWCA 4IDPA 4MUIA 3AY3A 4OI4A 4TSKA 1G19A 3PRKE 4WESA 3WX0A 4BYGA 2NV0A 3F78A 4FMDB 2IIPA 1KK1A 1KA9H 3FKQA 5TARA 1MC1A 4LI3X 1YI8A 4ZV4A 1HBJA 4LDRA 3FMOB 3GA0A 3ITKA 2GPTA 2FZCA 3IR5A 2JAQA 2VJYA 1I5OA 5CBPB 1ANKA 1XQ1A 4L75A 3IERA 1Z7BA 4ER7A 1L7NA 2FMFA 5JAHA 4OSEA 1F7UA 4W1RA 2J4FA 5CHYA 4MDEA 2G17A 2ADMA 2ID7A 2LBPA 3PXDA 3P71T 4G0PA 1FS6A 4YMLA 3RSOA 4I1OA 2J8ZA 3B53X 4AN4A 3W1WA 3ZV7A 2X7HA 1UAGA 3DT6A 3GGDA 1OAOC 1PZGA 2FR8A 2VAWA 4LDNA 4N6NA 4ZYVA 2WICA 3ESAA 1M6YA 1UOEA 3ONEA 1ETUA 4JJ7A 4O4HA 4EO9A 5IUNC 1KEWA 1LPNA 5HPYB 3OHMA 1RAAA 3LYUA 2QX7A 1D6MA 1DDIA 1Y7PA 1TLFA 2PANA 3B8HA 2WOJA 4US0R 1ZJ5A 2IU3A 4A8TA 2YV4A 4OHWA 1SXJB 4NC9A 5CDFE 2AG6A 1JAYA 1OI4A 4JB3A 3H75A 1L5QA 2NU6A 5GGYA 1XTBA 3W9BA 3QUCA 4URUR 3ZCXA 1WMSA 2UKDA 1THGA 1ULSA 2ZJ4A 2AQHA 3QP9A 1TXGA 1YQ9A 4F38A 2E5LB 2QHXA 4KHZA 2RG7A 1H2AS 1S1CA 2VEOA 2ZB8A 4FUQA 1SOWA 5AJVB 4CT4B 1CDDA 4FI3F 4Y6RA 5M7EA 4B40A 1VIMA 5IBRA 1J2JA 1EG7A 2ABWA 1Y82A 1MIOA 2HL6A 1N1DA 2Q6IA 3BHIA 3D6FA 1W44A 1CSEE 4COOA 5DF1A 4EUNA 3IHLA 4GI7A 4PAQA 5K01A 1KSGA 1WSDA 1NM5C 1JX6A 1KAOA 2Q3CA 1ZMOA 1Q12A 5LOVF 5C3UA 5FLYA 1XNQB 3SU8A 4MA4A 3SLRA 2R8RA 2NQTA 3JVUA 1GD1O 5B30A 1T6YA 4HF7A 1W0CA 1NMXA 3CEPB 2VPYA 2PLWA 5FJIA 3Q6IA 4P2GA 1ZGCA 2D59A 4RMJA 3T8YA 3TQFA 3DMTC 4MH0R 2DERA 1IQ0A 3V6LA 1K7XB 1WOYA 2QP3A 3R3VA 4ESVA 2FZEA 4P2BA 2HDOA 3GLRA 2I9PA 3AFMA 1ZI8A 1J0EA 1RSZA 1ULBA 2OAP1 4FD2A 3WI7A 2C00A 1JYFA 3DWGA 4LS3A 1HNXB 4HWSA 3DHVA 3B82A 4Y6QA 4YS6A 4YAUA 1DQRA 2BKAA 1B00A 4BVFA 5K3FB 1IOWA 3HCCA 3WNDA 4AJEA 4G9GA 4QU8A 1V3TA 4EQ6A 4PG6A 1Q2UA 3ZHCA 2ECKA 3ZR4B 1ONSA 2JFXA 4Q7EA 2X0FA 5GM2A 4RK5A 1F0NA 2WWVD 1DT5A 1DCKA 1US8A 2PDAA 1QK5A 3CLVA 3ANNA 2FPUA 4AJJA 2WZBA 4Z3OA 3RADC 2WQZA 3QH4A 4PC6A 2C2YA 2WIBA 3SS9X 3TTXA 1ISSA 2Z2KA 1U5CA 3JALA 4IINA 1Q7GA 1XCBA 4BU0A 2YFKA 5B7PA 2BEVA 2O57A 2WJWA 3DQQA 3SQNA 3SIRA 5LQRA 3BGVA 3KIPA 3H2SA 5FWNA 1J9GA 2J7KA 1BE0A 3IH5A 3RVLA 4B6SA 3K05A 3RSGA 3WHLA 2FKAA 4MS3B 4OMUA 2ZU6A 4CV2A 3CJQA 1E7WA 3F5SA 2WE7A 4S2EA 1QDLB 4F04A 4CKYA 2JFFA 2B20A 1Q91A 2LGJA 1YAHA 5BSHA 1GZUA 3DV2A 1GPNA 3H84A 4KMOA 4UD2A 4XYLA 5M34A 1GG5A 2OP0A 2QNRA 3FDZA 2C5GA 4MV9A 4C6SA 3MEQA 4F9FA 5BMVB 4JGGA 3AERA 3ONNA 2TYSB 3PNKA 3WGZA 1YZLA 3IOYA 2VHUA 3HK2A 3GFQA 4DY4A 2GQ0A 2HF7A 4GICA 4BAZA 4KC0A 4DM4A 2WPDA 1KHTA 2PLAA 3AG6A 1TMKA 2XB9A 1PLJA 2VZ0A 4R5MA 3WV4A 2B8WA 1GNRA 3KJGA 1UFKA 2GSDA 1W1IA 3A4LA 4XDGA 1E94E 1ONNA 3L7CA 5ESXA 2DVMA 2G5TA 2IX9A 2F3SA 4JP2A 3NM6B 4IICA 3RFCA 1YBHA 1QE5A 3R5KA 2VF5X 1ZNXA 2W6QA 2XYGA 1VSUA 4W99A 3CC8A 2JGMA 2RK6A 3DKIA 4PWZA 3WSTA 3BXPA 4CIXA 3NHFA 4EECA 5M04A 2G40A 1Z75A 4Q24A 3IP8A 1BXRA 4Z9YA 4FNGA 4U9HS 1PL0A 2HSJA 4GYJA 3U26A 5J3JA 5LLTA 4UNIA 1D2HA 4AWAA 5A05A 4JJGA 2Q6TA 1BJKA 3LDHA 3M83A 1U65A 1TTHA 1MAHA 1KO5A 4ZREA 1TM7E 5HQTA 5T4EA 3VV2A 2D5BA 4IWYA 1H2YA 1OXKB 3I45A 3MPUA 1Q1AA 1PS0A 2OWDA 3L8FA 1GQFA 4D99A 1R16A 4DLVA 3FXAA 2FSFA 2GHTA 3HDTA 3PFBA 1THTA 4NPHA 4W8GA 5FFFA 4F8YA 1YS4A 4DRZA 3ECAA 1DAGA 4LV8B 5FTMA 5KS2A 1EUYA 5AW4A 1V26A 1QRAA 2ZS7A 4L8LA 5M3BA 5CEEA 1HE5A 5IWCA 5IT5A 3AKEA 1GYQA 1HTWA 4H6WA 1M1NB 2WF7A 4JY7A 2NVWA 2YDYA 4XJTA 1RRFA 4D0GA 1LBEA 2ZIVB 3ODGA 4BFTA 1BE6A 1WZCA 3CRRA 5CXSA 1RZRA 2YC4C 3FCOA 3ICEA 3WJAA 3THWB 3ZWOA 4EX6A 1HSOA 4QUAA 4GLOA 4DLNA 2VYND 1LI4A 1ZRSA 4RNCA 5K99A 4TWRA 1EVKA 4LWQA 4YMUA 2HIAA 1WOMA 2PRSA 3H5IA 2MU1A 4ZI3A 4FGSA 2HSEA 1BMDA 2IPMA 2B7LA 2EP8A 2LCFA 2XNHA 4WKOA 4JLOA 1VBFA 1NMEA 1NVDA 3AF0A 4L5IA 2IYUA 3GN1A 1KAMA 3D3KA 1MAVA 2RJOA 5F3RA 1Y5NA 4ZMSA 1I1OA 5AVTA 4FCVA 5K6TA 4WACA 2W2OA 1CS4C 3I64A 2CDBA 1OH5A 1YC5A 2XJ4A 2KM1A 3QBEA 3EVCA 3L04A 1DEOA 2XUOA 1TGYA 3RNLA 1V35A 3WSWA 4CFSA 3IV9A 2B1GA 3ZK8A 2NZ2A 3C2QA 3THYB 3C3JA 1FNSA 1OQAA 1X94A 2CXHA 5F1KA 4FMCB 4X66B 3IIMA 3VDRA 2H11A 2DTXA 3H1PA 1XKTA 2IZOA 5KSPA 3OSUA 1S7GA 1OXMA 3PQ7A 1OH8A 2TRSB 3TAXA 2I4RA 2WSYB 5JNLA 1Z6QA 5BYKA 4DMMA 1ABFA 5CRIA 3HGMA 2K7FA 2ZREA 3GLIE 4QFDA 1Q22A 1W85A 4KPEC 3CWCA 4BRZA 4A2PA 4IFEA 1NJ6A 3ENQA 3IKJA 7REQB 5JS1A 3RQSA 1IRXA 4UUMA 1QQ6A 1W1UA 1NVMB 2ZQZA 4I3FA 2OPBA 4EQZA 3L4JA 4NJEA 3TZBA 2CVZA 1L1RA 1KTVA 2E4UA 1YBAA 4GPEA 3RRMA 1T34A 1QC5B 4XLZA 4DEYA 4BZXA 1HGXA 1J56A 2PSFA 3DXXA 4HQLA 3RG2A 1P7WA 3MJHA 3MWEB 4HB0A 4BJ6A 4ZAWA 3SYLA 4YPOA 1PEYA 1WCIA 2PGDA 3JQCA 4WDRA 4YA6A 4Z99A 1H1DA 4I50A 3W5SA 4E7OA 1IBLB 1E1QD 2BZSA 2QL6A 1WCYA 2VIIA 4QQ8A 1SUDA 1EQ2A 1G21A 2A7XA 1EFKA 2CB9A 4PVDA 2XNDD 3UJBA 4EM6A 5DNCA 3HG7A 5HKKA 1T4BA 4IIBA 5JLJA 2XKAA 1OKKA 4MV5A 2YV3A 4M7WA 1EGHA 2O2YA 1XWIA 1BGXT 3IIKA 4PZPA 1U98A 3KPJA 3OZ7A 3VPGA 1IBCA 1X3LA 4CT0A 4A15A 2JCBA 4QDJA 1B42A 3TI9A 5EKUA 1CW2B 1SZDA 2Y99A 1JH9A 2HOQA 4MZXA 2PTGA 3R24A 5F7ZA 1E6MA 5C7IO 3OA2A 2ZWVA 1D6JA 1A95A 4MWZA 3VDMA 4DXHA 3VO1A 3ZHUA 4BNYA 4U2EA 1UZUA 3OZRA 3Q72A 2QG4A 3ACBA 5J2TB 3VYSB 3GLHA 3RU9A 1CDZA 4OP2A 4R8VA 3T06B 1Z3CA 1JLLB 1C9YA 3HDGA 7ADHA 4REOA 3WLOA 1H3EA 1Y3BE 1NIJA 3INYA 4BBZA 3FBTA 3JQ8B 4FEEA 2Y67A 3HMKA 2AFIA 3OWOA 3ENKA 3G3EA 2EG9A 4LSGA 4D9MA 3OZFA 2F1OA 1C1XB 2HEIA 1VYHA 4HXGA 4KZKA 4WY8A 2XOEA 1PX2A 3EXG1 3SLGA 1VGVA 2A86A 3BG5A 1OTYA 4P08A 4QGBA 4OHYA 1CUUA 1QQ7A 1E8NA 3AY6A 4EGJA 5JDIC 1WLYA 1RPNA 2KMLA 3EIHA 3RJ5A 4YNBA 3LT1A 5A4JA 1N5KA 2ZYAA 4V0RA 1K89A 4G0QA 3TIFA 5TVKA 3KYDA 4KQIA 4Z8XA 5JXJA 4KLNA 1E1NA 4GM4A 2FFRA 3QPWA 1AKNA 5I4IA 3AOGA 3C0KA 1AKEA 3LCJA 3O03A 2PMDA 1XGKA 4JKIA 4YAOA 4B3HA 2FN9A 1GLVA 2WKSA 4HV4A 1XN1A 1PQPA 2MSKA 4TYWA 1JT9A 1P1RA 3OU2A 4HDCA 4M37A 1U4NA 1TQ6A 1MQSA 2WU4A 5ADUS 1DAOA 5AXAA 3LQQA 3N0WA 1KEKA 2OCIA 2ATEA 2YVQA 2ZATA 4D4MA 4D25A 5A6SB 4JKYA 2C98A 1VG0B 4MUGA 1KI2A 2IXEA 4OJYA 3E0XA 3B13B 5HDQA 5LBTA 1JYEA 3UJ8A 3ZGVA 2A7QA 1S02A 2Q0XA 1OA0A 1PT9A 1B8VA 2FN8A 4OGKA 4G65A 5IT9A 3IOMA 1A8SA 1Y7TA 3ZCTA 2C7RA 2YUIA 1T1SA 3B5JA 1T2AA 2HUNA 1CDOA 1KFJB 1B76A 2IHKA 2OWEA 2P7IA 1V8ZA 2Z2XA 3QVXA 2OXTA 4DADA 2NXNA 3I53A 2R5NA 3KQSA 4RK6A 1E6WA 1UKEA 4C1BA 3ZDEA 1RWXA 4RH1A 1RQXA 1T91A 4L4YA 4MVJD 5EUQB 2E89A 4LE2A 5LQKA 4B6RA 7GPBA 3MWKA 2CDCA 3MW8A 4F4CA 3O38A 1IVSA 1AZSC 1E0DA 1LF0A 3AHCA 1YU6A 3EFEA 2P9CA 4V1CI 4LJ8A 4OAPA 1OFTA 3T94A 2QDKA 1SB8A 2Q9CA 4P4TA 5EIWA 1YJAA 4CM8A 2OCPA 3M6FA 3LK7A 1O2DA 1RXWA 1DE0A 2VRCA 4ISCA 4JFRA 4IUDS 1KQPA 2XODA 5JMPA 1Y8RB 2HJ9A 3MT0A 4NCNA 3FJOA 1I4TD 1X80B 4A26A 3AKZA 2PX2A 1Q0LA 1SC4A 5K2MA 3U80A 1WTAA 3RNOA 4X1YB 3TXAA 1OSNA 1AQLA 1BX3A 1F3LA 3FZGA 4J2OA 1Z4LA 2NNLD 3QU4A 4M89A 4R54A 3W5VA 3R9XB 1LX6A 2BFNA 1PJCA 2PUJA 3RREA 3EJWA 3JQ7B 4ZO8A 3UANA 1B0AA 1HWYA 3E3OA 3AVVA 3QQ5A 1L5YA 4ETWA 2IWHA 2IYYA 4OM7A 4KAAA 2W2KA 1I3LA 2BHLA 3AEUB 3EQ7A 4RGBA 1MLDA 1ZJJA 2FVYA 2YJTD 4OMCA 5EEGA 4L6CA 1DJNA 2YZ2A 2A5JA 3OEYA 4XOIA 3VPFA 4AVYA 3O2SB 1KTIA 2V7UA 4IJKA 2Q0QA 3L0YA 2ZI7A 5B5SA 1EWRA 1PWZA 1M2KA 2NSDA 3MS4A 2EKDA 5BNTA 1NTRA 2ACEA 3FCAA 1ECLA 1PQ4A 4TWAA 3UEOA 3DDZX 2WM8A 1UXGA 3RC1A 3MLAA 1VL5A 5LNK1 3LYLA 1ZESA 2XYQA 3HNRA 3G2LA 3NXKA 1FMLA 1J0CA 2A67A 2IPOA 3EDYA 4IY1A 4M9XA 4D45A 1BQ4A 1XTTA 1E6UA 3P9KA 4M87A 4PNPA 2WF5A 3ZQ6A 3PQFA 4NYMR 4X7BA 5E7JA 4RTLA 1V6AA 4RD4A 5IW8A 2VQEB 1YB4A 1VE9A 3NOXA 1UPTA 3O2NA 3CFYA 3U4DA 5HKOA 4BDTA 2P6MA 1UWLA 2Q1UA 2JBWA 3RUAA 4M60A 1PGQA 5J4KA 4RVGA 2AN3A 3UMCA 1Z07A 3RWOA 2Z6UA 2NXJA 1LQ2A 2BEUA 1NBIA 4N3BA 3HB1A 4X1KA 4CTOA 3AJRA 3R7NA 1W36B 2IZ7A 2MMCA 3N2GA 5EJAA 4GNKA 1Z6AA 1P73A 2BMVA 1REQB 3E4DA 4BCCA 3KUDA 3KZ1E 3WBJA 4TYNA 2ZB7A 3GRPA 1PQWA 3X43A 2GJAA 4M9SA 2JI9A 1ZLYA 5EFOA 3GPIA 3PYMA 3AP1A 4IXWA 5IM5A 3CMCO 3L4EA 4YMIA 3DZHA 5TPZD 1U3FA 2IGTA 3HSKA 1N6LA 3PQ3A 1DGQA 3D0RA 2YNMC 3L0OA 3ADOA 4KRGA 3VTZA 4O4IF 1JAXA 4FHCA 2Q5EA 1A5BB 1E9DA 1KSJA 2JVKA 4KO8A 2G9ZA 2VQFB 1ZH8A 3I76A 1RBMA 1YIDA 4HQKA 4ND7A 2LDBA 3G2JA 2FA9A 3KSDO 2VWPA 4MV3A 1NDQA 3OKPA 4TM7A 5EZ6B 2JVJA 5B1IA 3WLKX 4WOJA 2H5EA 2HJHA 5E4FA 3D3QA 4MR8A 3TGLA 1DNPA 4YB8A 1ESDA 3GGSA 1Q0TA 3OF3A 3OZAA 4QUKA 2CV2A 1UPCA 3FI0A 4F5EA 3OG9A 2ZAMA 2JFNA 5AJZA 5E1OA 1YE8A 4D79A 3T3PB 4F45A 4WHMA 1DQZA 2ZRQA 3NT5A 4P98A 5AYVA 3EQ6A 1PR4A 5DW3A 3RIHA 4GP9A 3SIXA 3DBRA 1WPGA 5E0KB 4FFVA 1C5KA 2CHEA 2R1UA 2YHAA 1M7GA 4PRKA 4Q1DA 4BEJA 2VJAA 3FLBA 1C3JA 3JWIA 1GVHA 3EGDB 2AOWA 2YHUA 4QTYA 2PUFA 4WW0A 2HMSA 1MB9A 2ETXA 3IEKA 2HX1A 2YQ4A 2AW3A 4HNUA 1M5RA 1ADBA 2FSVC 3WMGA 2CHFA 1L5NA 3UNXA 5KOYA 2PUGA 4P0TA 1QH1A 1G98A 1A96A 3J81A 1Y5LA 2KWIA 1EDZA 1SBNE 2QVGA 4M86A 4ILKA 1OZFA 3UW1A 1KC3A 5AHKA 5AI6A 3PQEA 5IRCD 1DPFA 1Z08A 2P65A 3KB6A 4XDZA 4U6QA 2J41A 4H7DA 3ZJUA 1FLAA 1P5JA 3NI2A 5L3ZA 2IPAB 4C5CA 1T3ZA 3W79A 5A7FA 4EG1A 4E6EA 1FU7A 2OHHA 4KYTA 4GPBA 3ETEA 5TQVA 3KEQA 3SE0A 3KYCB 4NFYA 4RM3A 1VFPA 2GMWA 4R8SA 2CEKA 2E82A 1M1UA 1XVUA 1XLTA 2XZTA 3DVAA 2HJWA 3OTWA 1KWGA 2BKXA 1E3LA 1U4OA 3DFZA 1ZWKA 1KMIY 3IAM1 4MWDA 3X2SA 1U8AA 5EC8A 5KTTA 2YHIB 4MUAA 3HJUA 4PTYA 4PX2A 1E5XA 3UHJA 2VH1A 3BWCA 1SQFA 2QX4A 1KU6A 4L4UA 4QJ5A 2R6JA 4R1PA 5A4DA 3ICQB 1Y80A 5JW6A 1C30B 4DMGA 3QFTA 4BJ5A 4RXMA 4M9CA 2ZWAA 2FLVA 3BWYA 3LKDA 4HQ0A 1ORVA 4M9QA 3C70A 4AMVA 1WXGA 2P75A 3D0OA 1Z0UA 5JRJA 1OC4A 4OJKA 4REQA 4NXMB 1EK1A 1K6MA 1OOEA 4DV7B 5LZ5A 2J0EA 1JSXA 4CIDA 1MRNA 1FYFA 3LOQA 1VHJA 3Q3HA 4MR9A 5CA1F 3O26A 1ULHA 1Z9BA 4QHTA 1XYYA 2QLFA 4N82A 4QXAA 5DM60 2AKEA 3IMFA 4IMIB 3NANA 5G0WA 5JALA 5LYJB 3ZEAA 5LQAA 1WSBA 3GMDA 5FORA 5KIAA 4F4HA 1RXYA 4I1YA 2JPDA 2HCJB 3NVMB 3OEWA 4JLWA 4M1WA 4ALKA 4C88A 1KP3A 1BS2A 2GZ3A 4DCSA 2OLEA 5B3LA 3O9ZA 5LP1A 2Q7XA 4DR3B 3ZZUA