4JLSA

Crystal structure of e. coli xgprt in complex with (3r,4s)-4-(guanin-9-yl)-3-hydroxypyrrolidin-1-n-ylacetylphosphonic acid
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
133
Chain Sequence
EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine phosphoribosyltransferase
publication title Inhibition of the Escherichia coli 6-oxopurine phosphoribosyltransferases by nucleoside phosphonates: potential for new antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 133
sequence length 150
chains with identical sequence B, C, D, E, H, I, J
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jlsA00
4RHYA 1VSTA 2JKYA 2JKZA 4KN6A 4RAQA 1A3CA 5ESXA 1G9TA 3ACCA 1OPRA 2IGBA 1A98A 3M3HA 2DY0A 5KAMA 1O57A 4P81A 1I0LA 2WNSA 1O5OA 4RQBA 4WN3A 1CJBA 4P80A 1A95A 3DMPA 4P84A 1XZNA 1OREA 1UFRA 1A97A 2E55A 3LRTA 4P86A 1XTVA 4M0UA 1ZN7A 1DQPA 2H08A 3OHPA 2PS1A 3ACBA 3DEZA 2GEBA 4IJQA 4QRIA 5BQPA 2YZKA 5BRNA 5BQOA 2FXVA 1IBSA 3OZFA 1QK4A 2EHJA 4RHTA 4RANA 2AEEA 3ACDA 1LH0A 1MZVA 1GRVA 2HCRA 4OHCA 4Z1OA 5HKLA 1P4AA 1G2PA 5JSQA 3EFHA 1I13A 1ECBA 4FYMA 1R3UA 4ZFNA 1DBRA 2JBHA 4P3KA 5BSKA 1WD5A 1DKUA 1JLRA 1I0IA 4QYIB 1G9SA 4X45A 3O7MA 1HGXA 1BD4A 1JLSA 1AO0A 1NONA 4RHXA 1A96A 4LZNA 4F8EA 4RACA 1VCHA 1D6NA 1UPUA 1BD3A 3GEPA 1P19A 2C4KA 4RABA 4RHUA 5KAPA 5HIAA 1U9YA 4M0PA 1ECFA 2H07A 4X44A 3H83A 1YFZA 1L1QA 4S2UA 4TWBA 1QB8A 1VDMA 5EUCA 1W30A 3GGJA 3KB8A 4RQAA 1DQNA 3S5JA 4M0KA 1QB7A 4JLSA 1QCCA 3DAHA 5IPFA 1TC1A 1QK3A 1BZYA 1J7JA 1I5EA 1ECGA 5ESWA 1V9SA 1I14A 4PAWA 4PFQA 2VFAA 4RV4A 5K51A 3N2LA 1Y0BA 4LYGA 1OROA 3HVUA 1HMPA 1QK5A 1ECJA 2PRZA 1P18A 3GGCA 3G6WA 3QW4B 1Z7GA 1NULA 1TC2A 5JV5A 4RAOA 2H06A 4LZOA 1QCDA 1G2QA 1DKRA 4WMLA 1ECCA 1PZMA 1STOA 1U9ZA 2P1ZA 1L1RA 3NAGA 4P83A 1XZ8A 5E38A 1ZN9A 2PRYA 4P82A 1ZN8A 4RADA 1A4XA 3MJDA 3OZGA 4QYIA 2XBUA 1XTTA 5IAOA 4JITA 1GPH1 3LPNA 1XTUA 3MBIA 4LZAA 1P17A 1UPFA 4LYYA 4MB6A 2JI4A 1FSGA
chains in the Genus database with same CATH superfamily
3OQMA 1AK9A 3P9KA 1ZBQA 4F71A 3BWMA 3VPCA 4I5FA 2DUMA 4OI1A 3G85A 3M5DA 3HJTA 5CW1A 4REMA 4EUEA 4B6FA 2V4ZA 5IMSA 4YASA 3M3HA 3EGIA 3R8FA 2WNIA 5LIPA 1QU2A 1Y9JA 2FZWA 2PVCA 5AKHA 3TTTA 4HFRA 3PEYA 2AUNA 2I6SA 3G2OA 1K5PA 1IZ9A 4MWEA 3EAFA 4PBTA 4QPDA 5E9JA 3FYSA 2AEFA 3L6CA 2BL4A 3W8DA 4Y2VA 4BMXA 5K0TA 4LBZA 3IDQA 3F7NA 4AY5A 2FPKA 1LI7A 1Y8RB 1QTRA 3GJ6A 3FHTA 4UBKA 3DEZA 2EEPA 3JS5A 3G0IA 1DOZA 1L4NA 1GPLA 3X1MA 5BPHA 3ADPA 3JQPA 5HJ7A 2VYNA 4M0DA 1I80A 6NULA 2PL5A 5KNDD 3H1GA 1A1SA 4DL9A 3JQFC 2HBZA 1BWSA 1LSSA 3GX1A 4KL8S 4WWHA 1EYZA 4QL3A 3D0KA 3COWA 4MV7A 4B84A 4RLQA 1KEPA 1D6MA 3HNOA 3LT4A 4AXBA 3FNFA 4HAXA 2OB2A 1V1MB 3K8ZA 4DYVA 1RHJA 3D02A 4L6IA 4R01A 4ZO6A 2Y1LA 1BA3A 1JMKC 1UBLS 3C45A 4YXWD 2J6HA 3N5KA 4IQ8A 1WD5A 2ZAMA 1DKUA 2ZM6B 5I8PA 3T9FA 1EP2B 4DWJA 3UIEA 4DTIA 1DRUA 1F4VA 3KWLA 3LFHA 1BD4A 1C1HA 1U2DC 2YIJA 3NKVA 3QA9A 4G5FA 1N57A 4F9TA 1AO3A 1G19A 2BEUA 2H2AA 5AKEA 3UCEA 4B31A 1QVWA 4BLPA 2JGFA 1SBTA 1YDWA 2YR0A 1ESEA 3D3WB 5KCZA 5K8LA 1NYQA 2E21A 1KMMA 2J9RA 4Z1MD 4I9NA 2QLNA 4P4SA 3H6GA 3CH6A 2Z6QA 3H04A 3KB8A 1BXGB 2FMUA 1VYHA 2RGRA 3FGPA 5FOQA 5HILA 2QD4A 5TQ2A 4TQGA 3MUFA 4I55A 3VZBA 1QO0A 1VB3A 3BJRA 2P2SA 3VC2A 1RQLA 2Q9BA 2E4YA 2WJVA 3UB3A 1N1MA 3DO8A 4HKTA 4L27A 1G0NA 3BC1A 1WO8A 2RHDA 2RHMA 2VYVA 1Y1PA 2E89A 2XUDA 3C97A 4FOLA 3RABA 3EG9B 2J9GA 5EP3A 1BE1A 2PTGA 2CF6A 1PJSA 3AF4A 1T29A 3V7NA 1F2DA 1JHYA 3L46A 2WABA 3UNXA 5AOAA 1T8SA 3W2GA 1FYFA 4EHDA 5FNVB 4OAQA 4P3YA 3OF5A 5GM1A 2LD4A 2XMQA 2P2ZA 4WIAA 3ZS8A 1B8VA 5A06A 1ULSA 5HZGA 2B78A 2MYTA 2YY5A 3WNBA 4OYYA 1H2HA 4NC9A 4OFBA 4LRSB 1EWKA 2PH1A 3OJOA 3GBSA 4KR3A 2QAGC 3GLGA 2VSOA 4QASA 3RS3A 4J3NA 1P39A 3H11A 2Q1XA 5BYAA 3WHLA 1G291 4JITA 4MV0A 1WU8A 1QP7A 2P5YA 4PLZA 3VPHA 4PYNA 3EGDB 3PXBA 1WPGA 1HT0A 1P4GA 4IMIB 2EW2A 4WKOA 2QIOA 4DLNA 7GPBA 4PLCA 1IYZA 3SDZA 5AMXA 3WJ2A 3GQBB 2JG3A 3VGJA 2MOKA 1IE3A 1ZNXA 2GLTA 3S2UA 4BO7A 1QS0A 4DLWA 5K0NA 5TT0A 1FFEA 3WVNA 5FWYA 1A98A 1E1CB 3PUWA 5JAMA 1EIZA 2RAFA 3DPUA 4CI9A 2BKUA 4J8PA 3ZVNA 3WBJA 3MGGA 3V97A 2ORWA 3RDPA 3JQ7B 1QPBA 2Q1UA 1QAOA 1SKYE 1YF3A 3A2MA 1G5HA 3EBLA 3P45A 4UU7A 1P5ZB 1VE6A 4ZWNA 3QLTA 3FZNA 3IV9A 1YBHA 3I01A 5E2AA 4GF5A 5J2UB 4CMEC 4IJQA 3E3LA 3LUAA 4M7RA 4TKUB 1EVQA 4JCCA 3RHZA 4ER3A 3ZKWA 5D3KA 3EUFA 4IEIA 3LYLA 1LBTA 4LY3A 2FCAA 4GT1A 5LBIA 3AESA 1IOZA 2C07A 3F3YA 2CL5A 3EXHA 5H81A 3C85A 2FCRA 3U39A 2JC3A 2XYGA 2VLIA 2YWGA 4NP6A 2Y0PA 2FNAA 2ZSHA 3WAGA 3THYA 1QWSA 4B3TB 2RGWA 4MVCA 3E9NA 4UVGA 1I51A 5IN5A 1L4FA 1TYCA 1J9GA 2YVQA 5AW4A 3B6ZA 3JR3A 1NVAA 4JJ6A 5IT5A 2OD9A 1TM2A 1WQ1R 3U3KA 1U65A 3R0QA 4DSUA 3I76A 3ND8A 4RABA 2G4VA 3RYTC 3EXEA 4EMUA 4G65A 3CBGA 4DFDA 2XE6A 2Q0QA 5CHEA 3PHBE 1WB6A 4B48A 1HNWB 2GSWA 4MUKA 3L93A 3O75A 2WAMA 5C8YA 4A15A 1T26A 1IHXA 3L8FA 9LDTA 1OI7A 4FLFA 3RK0A 2E5LB 1RRCA 2X3UA 4ZC8A 1C9MA 2AK3A 1T13A 3E3MA 5IRCD 2DBRA 2BGLA 2WJPA 4G24A 1ZD8A 3ZHOA 4NAVA 1Z35A 2NXJA 3UBMA 4F86A 1XDZA 5B1EA 3O47A 4C0HA 1KEWA 3AL0C 2COEA 1OYWA 2YMPA 1W94A 5ALNA 1GPAA 3DCIA 4PHGA 4B2YA 1UCFA 1JYFA 3F8SA 4QNNA 1YE8A 5G1PA 2BEUB 1JSLA 2Z4TA 3DYIA 3V7WA 4AMYA 1MHTA 2VH5R 1B74A 1AKWA 2HN9A 3LQRA 5DNAA 5AI0A 3DLBA 1M72A 1HPLA 2J9FA 4BDSA 1R8YA 3SXPA 2JJ1A 3L6BA 1DV2A 4LQDA 1JAXA 4D9KA 2VQDA 2ZB3A 4PPNA 3PHGA 3Q3VA 4I7EA 1NUSA 3VVCA 1Z4IA 5C53B 8AT1A 4UDNA 4C76A 2JHCA 3PGA1 1SQFA 3I34X 4ZT7A 1N2IA 2IYQA 2GD0A 2Q0XA 5TQ2B 4I55B 1FRQA 1E2KA 1A4XA 2OGZA 1LLDA 3LG2A 4V0OA 1DIRA 2FDCA 5DYIA 3OX1A 1KQGA 3QPWA 2M6SA 3HJUA 4IHAA 3RGGA 3V32A 1GPH1 3P0FA 1X7WA 1D2NA 1DAHA 1U9CA 2Y6UA 3E6AA 1CRWG 2GJSA 2OSBA 3K2BA 4PZ9A 2CHGA 4TMZA 5CB0A 2CWDA 4F4IA 2P6NA 1YZUA 5KOJA 1U90A 2JPDA 1I9CA 4S35A 5DMHA 4F85A 3AU9A 1OFIA 3DCYA 3CONA 3DPIA 4LW8A 1S4QA 3LC1O 4BEWA 4GXTA 4RENA 3ZD6A 5B7GA 5KVQA 1JBKA 3TIXB 2OO5A 4KLCA 1ZGCA 5I3CA 5HIJA 1O5OA 5TC4A 2FI1A 4I1VA 1ESCA 4CQLA 5H83A 1W4CA 2OZVA 5F7OA 4ROTA 5FWDA 3VNUA 3DEHA 1CUWA 1OKKD 2OM6A 3GG2A 1QORA 4U6QA 5TEWA 3KEQA 3BHJA 5JYEA 4ZEMA 1VPVA 3OCJA 2WUGA 1RPTA 4G1BA 4WOPA 1Y3BE 4KE9A 2CE2X 4BX9A 3UJDA 4Z3OA 3G6KA 3F6RA 2C7BA 1SQ5A 1CUZA 2B6NA 3USES 3L6UA 4RCZA 4MROA 5LZ8A 4F11A 2AEEA 1BU5A 1HT2E 4FU0A 2VJNA 2IYSA 4R2LA 2XGGA 4EJ0A 8OHMA 5FWYB 4DC1A 3NKFA 3CNEA 2YWJA 1LW7A 2Z5GA 3JWGA 1PW7A 1WD7A 1PFVA 3BRSA 3WB1A 3LWBA 2A0FA 3DMGA 3HMKA 4LCJA 4A92A 4DJTA 3PNLA 4ZANA 2DX7A 3KALA 4EO9A 1PEKE 3SI7A 1T5HX 1SOAA 1RWVA 3T1TA 4Y2JA 2C4WA 1FNCA 3AY6A 5JS6A 3SQOA 3TF5A 1OX4B 3ROMA 5JI2E 1K75A 4Q3KA 4NBTA 3RAFC 4DMGA 4ZVOA 1MC5A 3NATA 4M8NE 4WQMA 4CM9D 1D6NA 3R0XA 3D8NA 3VYSB 3NTUA 1U0FA 3WDMA 2VP4A 4C4AA 2UUBB 1CB7A 4F91B 1HEIA 2HW8A 1I7PA 3CTPA 3W5BA 1XMPA 4RWEA 5JJCA 2QL9A 3KQMA 2JGMA 1QKKA 1AZLA 1P2BA 1RC1A 3AESB 3MSCA 4TRRA 1X8LA 5A04A 5LIRA 1JPUA 4CMHA 5AJXA 3V2HA 1JIIA 2XAAA 3NWPA 3UK7A 1HOTA 1Z5UA 3F4KA 2PJZA 3KDPA 3IA7A 4KG7A 5CVEA 1J39A 5DLEA 2Y71A 3THYB 2DBVO 4HAVA 4WFKA 3VXKA 3X1XA 4NG4A 4A3SA 5JROA 4ZXFA 5DXJA 5JS7A 1TI7A 5BR1A 1HDZA 2WPNA 3BL5A 2QE7D 4A2QA 3GRPA 1ABEA 3IPYA 4Y1GA 5BT9A 3FAKA 5EEHA 3KE9A 1T9GR 3TZHA 3AO0B 5A3VA 3NIBA 3O93A 2DJIA 3E9QA 3OT4A 4U39A 5FI3A 4YMUA 5AK3A 3RVMA 3KCNA 1M67A 4M1KA 3MVEA 3I2HA 2BTQB 3BWCA 2DQSA 3KKNA 4QDUA 4G0YA 4W7SA 1K6JA 3KOYA 1BRTA 5C8YB 1J5PA 2O23A 2FEAA 2SHKA 1KJ9A 1O6GA 4EVSA 2FTKE 1SCQA 4RH1A 1YVRA 3WWCA 4UBNA 3HFGA 3Q2OA 1HQKA 1XZAA 3JD0A 2O8FA 3QVUA 2CLHB 4YROA 3LCCA 3RS4A 3NOVA 5LZ9A 4C6HA 1MGPA 4BMPB 2HSZA 2ZVJA 2PSEA 3PK0A 1DAKA 3BMQB 3AR4A 1NFRA 4ILEA 3WWEA 4TLDA 2HCFA 4JA0A 1XT6A 5GONF 2HHLA 1RAIA 2C2OA 4ROSA 4ZZ3A 2Q6TA 4BVAA 4YRFA 3GLUA 4W5NA 1SZDA 3CM0A 3U2QA 4ZGBA 4REOA 1I01A 1MG5A 1FVFA 1ZHFA 2F1HA 1RAEA 4RY8A 4WK0B 4F93B 5LLTA 5KU1A 3COVA 2YJGA 1BXKA 1I5OA 1U3CA 4MUBA 4X92A 4RMJA 1G64A 4AK9A 1E5VA 4PZEA 1J1UA 2PH3A 2HIHA 3ED5A 3HKDB 3I2YX 3JQRA 4I2NA 2Q6VA 2FP4A 5E4JA 1DIOB 1Y5RA 1GAJA 1TJ4A 2NT4A 2X4GA 4NOJA 4E6PA 4O2BA 1EFVA 1ZW6A 3WNCA 1I3NA 3ABIA 3G2MA 3PQ2A 1I32A 3QBEA 4EJFA 4ERXA 3URKA 1ZOOA 2N46A 4H9GA 4IHJA 1GUYA 3LK6A 5C8XA 3U48A 2HK6A 2A3RA 2Q62A 4WV3A 1XNJA 3AQ4A 1L5FA 1XU7A 1P3Y1 2Q2OA 2QUBA 2YS6A 3E5NA 3DHVA 4XQEA 5JYCA 2H2WA 2B7BA 1D6JA 3F6CA 4J0EA 4YMLA 3WYCA 1KAHA 1MC4A 3HBJA 1NLUA 1PJRA 4CF5A 1R9JA 2RBKA 1Z2PX 4UOQA 4KVAA 2Y1XA 1SEPA 4YECA 4ZCRA 3GLTA 3IUNA 4G4SP 4IXMA 1TFRA 1WL8A 3AOGA 2F3RA 1X3SA 5TQ0A 5K6TA 4HLCA 3LUFA 4TLLB 1NA5A 2VSQA 2ZDHA 4QU8A 3GIDA 3UZUA 3KQWA 1TZJA 1NDUA 2AF4C 3CEAA 3DL7A 2P5UA 4OEHA 3KC2A 3O7MA 3BIJA 1OE0A 4UEKA 5A3SA 5JYDA 1NJGA 3VX4A 4AMGA 4KHZA 3F9RA 4W7HA 3EFEA 4K28A 4E5MA 2VZ9A 4C5BA 2QDKA 2JFVA 2BPOA 3T5BA 1V8PA 2IYVA 1PWEA 1Y63A 4CTJA 1USIA 1AX9A 3MT9A 4RTMA 3ONVA 2P68A 1OFUX 3JASB 3MCAA 4Z53A 3QIVA 2F43B 4LDAA 1R00A 4DBLC 2NTJA 3VAAA 1IATA 4MZDA 4WHMA 1J7JA 1U6IA 4IZIA 3WGZA 5LUAA 1Z6YA 5K0JA 3RNOA 3RC7A 3D7RA 3ETEA 4WNAB 5F52A 2JLWA 5DSZA 3RSLA 1RAHA 4CQMD 3EGXA 5A4DA 1JJFA 2HREA 3KOUA 2BELA 2C8KA 2GZDA 5C1DA 2P0YA 3OX4A 3QPVA 1FYWA 2BMWA 2GAFA 3NASA 5CT9A 5ICCA 2WWTA 1HZJA 1XU4A 2HJGA 4Y0AA 3L7OA 2WKWA 3PD0A 5T64A 1TK9A 3WV4A 2YBEA 2AOXA 3QV1A 4X97A 3LDFA 3G0OA 3ZD9A 1D5WA 1FU8A 1NE2A 2E1RA 1E3SA 1NL3A 4RMIA 4EAQA 4K8OA 5IDQA 3SDSA 2HRBA 3KE8A 4L5IA 1O6ZA 4MUNA 2DM6A 3RTCA 1SXJA 3WRVA 3X43A 3ZR4B 4WT7A 2EKZA 2R6CA 1VQ1A 3UWPA 1ZD9A 5AJYA 1KMQA 1KSJA 1KZ4A 3H4IA 4HDKA 1VA4A 3CUSA 5LXTA 5EZYF 1R4NA 3NOXA 3QEAZ 4DT1A 2Q0HA 5LQNA 4XVCA 2WJ6A 2C82A 4QQRA 1NXXA 2AGVA 1TJYA 2G71A 1HTWA 3FRJA 4TS4A 4DV7B 4XJXA 3CF2A 1RE1A 3N05A 2J1LA 4MYUA 3WJ7A 1DG9A 2CXTA 4LKRA 2ID4A 4V1CI 5CBPA 1Z4MA 3EZXA 3NDPA 3VU8A 2JFQA 4I5IA 4D42A 2CMGA 4XWKA 3HN2A 2A9JA 2GN4A 4IO1A 1ZJ4A 4D4MA 4EKDA 3HXQA 1L7RA 2QPLA 3VYTB 1SC1A 2JDID 2IYLD 4YJKA 1EXWA 1U7TA 3C5CA 4ARZA 1KI2A 4KR0A 2XOKD 3THOA 1NSYA 4MRMB 1SBHA 5DISB 5JAZA 2VJMA 4IIXA 1NZDA 2EKLA 5KKCA 1RKQA 4B74A 2FN9A 3IELA 1T9HA 2AMYA 3MUOA 1FDIA 1GQQA 3UPDA 4KXMA 5BQPA 3QF4A 4OFZA 5DM4A 2OQRA 1MC1A 3E48A 2N1MA 2CJWB 3ESCA 4D9GA 2EP8A 4Q1EA 3U19A 2BBTA 1PT8A 3ABSB 1ZVMA 4ZD6A 3X1JA 1ISHA 1VA5A 4CUZA 1TLLA 1X2EA 3K0EA 5E0OA 4AM8A 3BH0A 5DYTA 4BJHB 3B3AA 2VK8A 4JHXA 2Q46A 2V4UA 2QTTA 3IP1A 4UM7A 5HKLA 5LBUA 1W75A 3GFTA 4C0SA 5A62A 1GP2A 3E1SA 4WLNA 4ZZ2A 2QX7A 2C92A 4YRRA 1FVOA 1E6KA 3BAZA 2PZBA 3A06A 5TVGA 4KR6A 1LGYA 3ENWA 3GUZA 4JB2A 4NONA 2ODAA 2YNMD 3K8YA 1JQJC 4GP6A 3ROTA 4AN4A 1EFVB 2DPYA 1ZSNA 4TRJA 5GINE 1FOEB 3V5NA 1JA0A 3WICA 1T2VA 4Y6OA 3SJAA 4RF5A 2FH5B 3O2SB 4XWWA 3PR1A 1LDYA 1IM8A 1J4AA 4RD4A 4C5AA 3AB7A 1XL0A 4MQEA 2BFPA 4XCXA 4EG4A 1KEKA 3BA6A 4MUHA 5K0LA 4PYMA 2HBQA 1CR2A 3RKUA 3LKZA 3WBKA 4M9RA 2XB9A 2HKIA 4WVFA 1F8FA 3NHMA 4KYTA 1JKMA 4PWYA 4V3CA 5LOVA 3DV2A 4I0WB 1HI9A 1LXCA 4RK4A 5IDXA 1YHZA 4BVEA 4B3RB 1P9OA 5GONB 1QIIA 4DZTA 1UEIA 3MWEB 4BO6A 3AGPA 2VDUE 3EY4A 4NZMA 1VOTA 3BSFA 2ODWA 3BXXA 2ZZNA 4LYGA 4E31A 5I7VA 4IINA 1R9GA 1M1YE 3FLMA 4N5MA 2N47A 4EB3A 4WDQA 1ZH8A 4AF7A 2AQHA 1TUBA 3GI1A 4DR2B 1JEOA 1N6NA 2NXNA 5FA8A 3RVJA 3G7SA 2PKQO 2VPYA 3CG0A 1A72A 4GW3A 4DAOA 5HW0A 4EY5A 4JI0B 3H2GA 1G5IA 4JYBA 5IHPA 2E4VA 2C2HA 2BGNA 2QTHA 4G26A 5KJ1A 1YU9A 3NHJA 4GPBA 4L4SA 3H9CA 1DG1G 3A25A 1NWCA 4E7OA 4GE3A 4B2IA 1ZUNA 1ZN8A 2Z1MA 1LV7A 5JCOA 4ARBA 3HH8A 4R8RA 4RFLA 2FSVC 1CCWA 4D0SA 4ZZIA 1PK8A 1UDAA 3B8EA 4HZIA 3EGXB 4Q9LA 1K63A 1ZXXA 2QLLA 4QBFA 4ZC1A 4J6FA 4FR2A 5DNDA 1OMOA 1FSGA 2R4QA 2CY0A 3AEKB 2J5BA 2AJCA 1ZONA 3HN7A 1CNMA 4HVAA 4Y8VA 4IH4A 1NJ6A 3KEMA 1A9XA 5JVDA 2DGDA 2EZUA 5BWCA 4G84A 2UUPA 2GFQA 5G0VA 1YA8A 2CFCA 2L18A 1JECA 4EHAA 2QY9A 1MX9A 2XNDD 2J5XA 3FTDA 3ZZNA 4N48A 2J33A 2WF6A 3WLKX 2HPAA 3AUKA 4EUNA 4LY9A 1DJLA 3B13B 4KV9A 5FTKA 3M8KA 3RODA 2OCKA 4DG8A 4UTPA 1GTJ1 3OIDA 3DQPA 1PRYA 1VL0A 2ZIWB 4L3WA 1ZGHA 3A9TA 3U4QB 3LV8A 4DT1B 4M1EA 4YS6A 3SICE 3L0BA 4YBZA 1VBNA 4N8SA 3VH3A 5HZMA 4J1TA 4UNSA 2ZAGA 2WIAA 5B1IA 2JI8A 4NFSA 3IBYA 4AZ3B 1J07A 2XMBA 3VTFA 2W2LA 5CBPB 3K9QO 3LFUA 2GEUA 4FFNA 1KVRA 4DLLA 1CRZA 2M2IA 3LQ4A 1U7UA 2EKBA 3H4TA 1RJGA 1ZI8A 2ZRHA 1PSDA 4YRSA 4V1CA 1IEQA 4BMVA 2PRKA 4Q03A 4DV4B 1R50A 3WX0A 4ON9A 4ARZB 2WD8A 3FNRA 2I3GA 721PA 5CFQA 3MD9A 1L7EA 2B8TA 3GFOA 1QQ5A 4FNMA 3WKBA 4CM8A 5AW8A 1CYDA 3M3DA 3U4HA 4BP1A 4B3IA 3X0DA 3AR6A 2VR1A 2J85A 2JH9A 3EQ8A 3GAZA 4OJMX 1I0IA 2CHVA 1TGVA 1SHLA 4D4GA 3OE7A 3ETLA 2Z2YA 3FWHA 1YAHA 4KO8A 2QT0A 4NR0A 1XP8A 1RQ2A 1RQ7A 1ACMA 2M1XA 1N1GA 2Y4NA 1N0HA 3EH2A 3P0HA 2IU4A 1WXQA 4NMLA 2IELA 3DTVB 1U81A 3L0PA 5K4AA 5JJLA 4NVRA 1OH6A 3QTTA 4AXXA 3HXOA 4HPXB 4W9RA 3W7BA 3BFJA 3TLBA 1UMDA 3DE2X 3DTYA 9ATCA 2GDZA 1X1TA 3K09A 5B6IA 1FFXA 5KI6A 1EEXB 4UDYX 2C4HA 1N6KA 1TPZA 3R0ZA 3S5JA 1SB9A 1QX3A 3BDVA 3N2IA 3L7CA 3PFKA 3VHXA 1AMOA 1KH3A 3HBMA 1GITA 1SVWA 3V6MA 5TIIA 1R1DA 3ZDQA 2X0JA 1T4CA 1ENZA 2FWPA 3WK9A 3BORA 4LJRA 1GPUA 2C5LA 4FFSA 3CCBA 5FYQA 1JPNA 1RZRA 4UU0A 3OE4A 2M98A 5JZVA 1C1DB 1IJFA 1IB0A 3DQZA 5FLEX 1THZA 1L4EA 3DMFA 3DZCA 1KIAA 1UINA 2VJCA 1LS1A 3DM9B 2ERCA 2LNDA 3MNFA 4AMUA 5BPFA 5HFJA 3RK4A 5FL7D 3W6UA 4FMBB 4II7A 2AI3A 4I5GA 5D3QA 3D8UA 4RHCA 2GSDA 3WQHA 4FIZA 1X0VA 1VIAA 4NBLA 4R2IA 4MRPA 5DBIA 5KEIA 1DC6A 2F64A 1JKJB 2OLJA 4WTOA 4D80A 1CJSA 2P2CA 4YMGA 5IJZA 5K45A 3G2KA 2HSWA 2V7GA 5F4BA 3PPWA 4Y9DA 5COQA 3ZIDA 2ZRBA 1LC0A 1THGA 4INAA 4GWGA 3QQPA 1O77A 1E3IA 2ATEA 4DMKA 2D1QA 1XJWA 4K2AA 3PQ8A 2LVBA 4QJIA 4UTOA 3BXFA 3FMOB 3BD9A 2C2XA 1TUBB 3ENNA 1ZIXA 4BJ1A 5IBCA 1XYYA 2CDAA 4IYRA 1GKYA 1GQ2A 4C08A 1R0BA 4JBGA 1YIAA 2EKPA 4BWVA 1WXXA 2IGBA 3DVAB 3OIUA 1EFCA 3HA2A 4ZVQA 5DHQA 2QBYB 4YCCA 2ZEJA 3AUUA 4HDRA 3U0BA 1WLSA 3GLKA 3VSDA 4CJXA 2IXAA 3EPRA 2FSPA 2IHVA 2NM0A 2V7WA 4HTFA 4A82A 4HDMA 3W5SA 1ZUNB 1G3MA 4UTRA 4P84A 4POOA 3LXUX 4TUYF 3QXGA 2C2MA 1UDXA 2HBRA 2LCQA 2OCBA 3DW3X 4DM3A 4K3VA 5FBQB 1H9AA 4C0LA 1JRLA 1XVTA 1GKIA 1VYTA 3EQ7A 3PHJA 3HDQA 2Y1GA 2GCIA 1AUXA 4F3RA 1T5LA 3ZY2A 4M55A 3MYRA 4BNUA 5JVDB 4ZI5A 1R12A 1RPNA 1JPVA 2IOFA 5JADA 3LC7O 3AFNA 4FOSA 1NXTA 2IHYA 2BGUA 2FQYA 3BFXA 1X7ZA 3BWEA 3HPRA 4WAUA 1QVRA 2RBEA 2G67A 4CN9A 1N4DA 1NGSA 1PWZA 1ABFA 1LF5A 3NM5A 4BIMA 4Y6LA 2VPPA 2CXHA 1C14A 2WU1A 4P7FA 5D1NA 2GZ3A 3KYCA 4QYIB 3DR5A 5SZKB 4BP9A 2X0NA 1G21E 1YR7A 2HK8A 2YWXA 4C04A 1TM7E 4G0UA 4NE2A 3P8ZA 1TVKB 2G4LA 2JJ8A 2B21A 1P19A 1T1GA 2ETVA 1RJEA 3BL6A 4NBWA 1Y6GA 3NCTA 1W1WA 3U7QA 3QUSA 5EQTA 4IXDA 1T5SA 4R41A 4WKGA 4AUKA 4Q34A 4E11A 5IXYA 5JTTA 1KZ1A 4E12A 5K0EA 4RTLA 5K6RA 1KOJA 2D00A 4X64B 4S2UA 3FWPA 4N5HX 1L5MA 2XUPA 5EHNA 4CU5A 2ODQA 3K3PA 1YI8A 1Q21A 1VG9B 3LHKA 5DO9A 4V38A 3KOWA 3U17A 4PNPA 4G9GA 3CKYA 5I8WA 1I6MA 4F6LA 3UHFA 3P32A 1FU7A 2TYSB 1K8XB 4NEHB 2XB2A 2A9FA 1F14A 2P2YA 1KKLA 4XWOA 4CLXA 5JTUA 3GP8A 4ZOAA 3PEUA 3CGGA 3WQSB 5GPBA 1EIWA 4P38A 2YMMA 2N0SA 2ZATA 1TX4B 5BMVB 1TZCA 3L7AA 4XQCA 4D74A 2TRSB 3GF4A 2IUUA 4IGFA 3GZ4A 4AMBA 4DCCA 3UTCA 2Q5HA 3AUSA 1UMDB 1P0CA 1SQGA 4C7KA 3LRPA 3STYA 4OH1A 1D09A 2HEGA 3PQ3A 1FFXB 2QTBA 2I2BA 1PJQA 3K0HA 4H17A 4MGYR 4O2LA 4BRZA 3H6HA 3A1SA 3R6TA 4P82A 2JCBA 5IK2A 4Q19A 2ADFA 1T4CB 4OOFA 2H9YA 3REQA 4CM5A 4YRMA 1MOSA 3FDXA 5FHQA 4FKBA 3HYTA 1RRMA 4ZO9A 4BC1A 4PSVA 5J23A 1OBOA 5CLIA 1KA9H 2IVZA 1E3JA 5F9MA 3GO4A 3DT8A 4MKZA 3RREA 1E79D 4E5UA 3KD2A 3AF2A 5CB4A 2EFEB 4EFNA 2C9ZA 3DLTA 4PO9A 5FWXA 4Z4GA 2FMXA 3GUYA 1E2UA 2QVYX 1Y98A 3HJCA 1AF7A 3PVZA 2ZWAA 4Z51A 2DT5A 4HHEA 4N40A 4K6HA 3ZX4A 2OQIA 3UWKA 4NMHA 4DY4A 1HE1C 1VBFA 2R751 4EH1A 2P5TB 4V0SA 2FR8A 1KHHA 2AWOA 1RI2A 3AJDA 3LKVA 3DMPA 4XASA 1YR2A 4DMRA 3NO4A 4CM4A 4HDCA 5F1KA 4AQ7A 2QTZA 5I3ZA 1NLFA 4MYDA 1PV4A 4AZ0B 4JMLA 1J06A 3AU8A 3T4PA 1ZRSA 1RKVA 3HJNA 2F3PA 4MV6A 3W8FA 1P3DA 3KZOA 3PNOA 2F4VB 2AXQA 2IZ6A 3IT1A 4IGIA 1WUHS 1OHHA 4KW7A 4X00A 4WCDA 2PFSA 2FY8A 3QE4A 3RRMA 3K1YA 3OY2A 3T34A 3B3FA 4DCTA 1E6EA 5JY1A 7REQA 2AR9A 4X1IB 3FGNA 2G9QA 4YRPA 4CVNA 2Z6VA 3O82A 1PD1A 2KE5A 1NBOA 5DGDA 1CF9A 5FOTA 5FBRB 4HTFB 4EAAA 4HDNA 4S24A 4ER5A 2X8WA 2YJ3A 4RIIA 4H15A 2VK2A 5ES4B 4B45A 5KTNA 3I6IA 3SMVA 1M0TA 3O9MA 3BHNA 1YQEA 3O4JA 1ABBA 4KBGA 3TFOA 4BMZA 1U3VA 4AIRA 1XTJA 1OFUA 4HADA 2QQ5A 3B48A 5EPUA 4C5CA 1LSUA 1RBZA 4C6SA 5AUNB 1JR3E 1O9GA 1SVKA 2II6A 3I9JA 3P0RA 5TQVA 2WILA 2XD4A 3QYPA 2RFLA 3BILA 1P8AA 1LI4A 3IUYA 4LWPA 5LQKA 2JGDB 5I47A 4G23A 4K81B 4M86A 1DKNA 1QQBA 2Q7DA 5FUBA 4BFLA 1X7ZB 3NZEA 1XDDA 2GS9A 1R0CA 1K3UB 3ZHBA 1ZM3A 2I3AA 2YUTA 3Q6NA 4CKBA 2IJGX 1XALA 1M6EX 4ASUA 2WJZB 4Q24A 1P7VA 4EX6A 4IZOA 4HFJA 2O8EB 2EX4A 3KB6A 2GVNA 1XZBA 4TS3A 4FPXA 2R8PA 1XQ9A 3ZQ4A 4MKRA 2FSUA 2MT9A 3KOMA 1IEVA 4YCSA 1RDFA 5AWFC 5JIBA 2P75A 4MV8A 4Z9FA 3U6KA 2LPMA 2SBTA 4MRVA 2OZLB 3ZWPA 1ORDA 4DARA 1OH5A 1LDMA 1RZUA 3RVLA 4RKWA 4OXXA 1E62A 4HX2A 2XPCA 2Q1YA 4YFYA 3TSZA 3T06B 3U7QB 3UV3A 1L8XA 3G0CA 3GN2A 4J7XA 4V3BA 4KPFC 1YQWA 1EAMA 4V0RA 4DG9A 1P45A 1ZD2P 3C5EA 1CERA 2P41A 2ODEA 3A6GA 3FPJA 3ND5A 4NMXB 4TUYB 3IJEB 3QLUC 1XZ8A 4J7AA 2ZBVA 4FT4A 5E38A 3LCJA 1G21A 3QG5A 5ITSA 5U9CA 1J90A 2X77A 5JZ9A 3JCZA 4PYJA 4LXYA 3CZQA 4FXPA 3MEQA 3PKZA 1ISFA 3IP9A 1PV2A 3HCWA 1Y5IA 4JLKA 4RORA 4ZU3A 1GTVA 1GKUB 3NTVA 3WRWA 1H4TA 5JPCA 3LQYA 1F7VA 4BFWA 1WM1A 3FUCA 1SXQA 1L5HA 3QV2A 4QU5A 5LDHA 2V97A 4V2IA 5CGQB 1Z0FA 1SA0A 4QQFA 3KG2A 4NCAA 1KYIA 3JVEA 4J94A 4X20B 4CIBA 5I48A 1Q0HA 1CNEA 3DMRA 4A8JC 1CDEA 1KYWA 1G7CA 4ZXPA 4WK2B 4B7XA 2TECE 2PSSA 4Z54A 1CY8A 3CLSD 4DC0A 4PANA 1SK9A 4QVKA 4RU1A 2MU1A 3MPUA 2Z2ZA 4L8WB 4HCJA 1AHIA 1J2YA 3V8QA 2G3YA 3REQB 3X2FA 1JU3A 5I6DA 2RK3A 4M0UA 2Z98A 3AZQA 3WL8A 3D59A 1H8EA 1JDNA 4DA7A 2LIVA 3FZYA 4PSAA 4YK7A 1NSTA 2C9CA 2XXBA 4AY3A 4P3PA 2VTDA 1NU6A 3NYIA 4AX4A 2R6AA 1E7SA 4QULA 4LF7B 2PX3A 2JIZD 3A6JA 4MPTA 3TOVA 1XTKA 3S7ZA 2HU7A 1PBTA 3G0GA 4PAGA 4D79A 5JMOA 2C7PA 2XE8A 2AC2A 2OGWA 2WIFA 2HYIC 1TA4A 1Z2DA 2FF7A 3ANLA 3G2NA 5FQOA 3EFBA 3ZWXA 2EFJA 3SC2A 1XK6A 1BQEA 4GMGA 3T7KA 2UXDB 1WR8A 2BMVA 3H05A 2WJJA 5DOVA 4CCAA 4LOHA 3ZLVA 1WXDA 4OK5A 2JAHA 4AL4A 4DC9A 4BNLA 3N70A 5A3RA 1F9AA 1HQCA 1LNSA 1NQ5A 4J4TA 1KVTA 2PZ8A 3K9BA 4R1NA 4C2AA 4RXUA 2BGTA 3ZV6A 2YS7A 1VKZA 3B6MA 3O2JA 5E9AA 2CE7A 2B1IA 4JEMA 1WY7A 4AWAA 1AA9A 3TCKA 3JQGB 4EGSA 2GH1A 3TTYA 1EDEA 1NX6A 1T4MA 3TLMA 3VV3A 5LA6F 2JZCA 2IITA 4YQFA 2CT8A 4NDNE 1FS4A 2W83A 3TMKA 3PTZA 7REQB 5LQRA 1NHGA 4KBYA 3C3KA 3C6QA 2P9GA 3GBVA 3CLHA 4FI3F 2ISQA 2COUA 2VWQA 2XUZA 1S01A 1ULUA 1JVSA 3OZTA 4HDNB 1P7YA 4JP8A 4F45A 4G0WA 3S44A 4CHGA 2O2CA 2HJHA 5HEKA 3W5CA 5KBYA 4PZDA 4I08A 2ORIA 5JNTA 2HI0A 3ZTWA 1A5TA 2HMWA 5JNWA 1GN8A 1JQLB 3JRWA 1V48A 2PRZA 2P9EA 4QREA 1KQPA 2DQYA 5BW8A 2P9FA 2PVPA 2ZRFA 4KYIB 4XI9A 4LV5B 2F62A 2C2KA 3I4FA 1DUIA 1K8RA 1SB8A 2WBLC 5TS2A 2OV3A 3RYHB 4EKIA 1U7PA 5ADUS 3OX2A 4G5SA 5H82A 1FMJA 3HNPA 2VOEA 4QUKA 3KQLA 5D6OA 3F3KA 2ZIXA 1G3RA 1X1CA 1ACJA 3GUUA 5IAOA 3WLFA 5DULA 2WKPA 2FVXA 4YAIA 4QEZA 2UVDA 4EHHA 1P4HA 3QLVC 2Y1FA 1Z45A 3I64A 1E77A 3I53A 4L0MA 1CE8B 4DWOA 4PN7A 2VWGA 4IG9A 2X9LA 4L50A 1CDZA 2BFDB 1JALA 4W1PA 2PO5A 4FI3C 5JNVA 5J4HA 5J1SB 3U4IA 1D9ZA 3GJQA 4LJYA 4R3UC 3WTBA 2FR0A 4FB5A 1IVNA 3GCWA 3PITA 1WULS 1UJ5A 2E7ZA 1VMAA 3LA6A 3F78A 4L7VA 4DNPA 2HU2A 6ABPA 4J0HA 4TKZA 2RJOA 3DL0A 5LQDA 3IKTA 2PX6A 2O0JA 5HF5A 2WIDA 4IUDS 2FSGA 1HTBA 2BSAA 5AJHA 1KDYA 2EGHA 2IXDA 2VDOB 4KLZA 2P5SA 5LR6A 2XY4A 1GTSA 1T6YA 3QXHA 1Z5WA 3DF9A 3R8CA 3OHPA 5IAEA 1TTTA 1L5HB 3D2BA 1MRSA 1R0YA 4KN5A 1RSZA 4C7MA 3BDAA 4AKHA 1CW2B 2YV1A 4YO7A 1D6SA 1W88B 2CHEA 5KREA 3FNEA 2GPAA 3BMOA 4BB0A 2CUNA 3LP8A 5A4MS 1H93A 2JJ2A 5TMPA 3L02A 1QHHA 1QYVA 2PA3A 1XOIA 2Q2WA 2IKQA 1I24A 1XVVA 1BDIA 1TU3A 2ALJA 1RZVA 1LPMA 2GKGA 2EZ4A 3FM9A 3GRRA 4EJSC 2VPZA 1A9RA 4F72A 1WCIB 1UAYA 3OZXA 5HG0A 2OV4A 2XZLA 2D06A 4AWBA 4FT2A 1UBGA 1AUQA 1F4LA 4ME6A 5LNK1 1XROA 3ZGNA 1UJ4A 1LUAA 2G06A 2EV9A 4DIKA 5A1JA 1JZSA 1O08A 1S8AA 2JLXA 4ZCQA 5CAEB 3DZFA 1PS0A 3KJXA 4JLBA 4LZNA 2Q50A 4N0MA 4BNNA 4DQXA 4BE7B 4FILA 1WG8A 2VNIA 3JTEA 4DG5A 3CVVA 3EUAA 1EKXA 4IFEA 5KAPA 3T8YA 4IYJA 3M89A 3AHGA 3CLTD 5KNCH 5MF6A 4Q1CA 3R5SA 5TRTA 1GDHA 4IF6A 4G4GA 2NP7A 1Z74A 5AJUA 2C4TA 4RC9A 1BJKA 1CUHA 4FIDA 4PAOA 2GF9A 2ZIZA 3AERA 3SC2B 3WV5A 4V0NA 4CMKA 2XXJA 3W2HA 1UAGA 3CZCA 1XJQA 4YCJA 2GRAA 1GGJA 2WAAA 4OUDA 3SIXA 3A1FA 1A9QA 1PL7A 2BLNA 2WWRA 4OA5A 4AT1A 1DQRA 2GEJA 4UBMA 1EM6A 2EOAA 1T0PA 1RQRA 3NHBA 2YZ7A 3EMDA 2ZSFA 3I5AA 3TW4A 4HVCA 5JD3A 2AQIA 3BF7A 1JLKA 2QJRA 3Q12A 1K06A 4RKQA 1N2SA 4H2DA 1U63A 3GJ5A 2P6RA 4WOJA 3RWBA 4ZEVA 1YVUA 3ZWDA 1KP9A 2V7UA 3OZBA 4ZCPA 5LWHA 1MXFA 2Q21A 4JODA 4RK6A 1QG2A 4MS4A 2YFYA 4NS4A 1SD5A 3HYSA 1M33A 2XVZA 3SVLA 4FZ5A 4C7OA 2PBLA 1DE0A 1LDGA 1WS6A 2HSEA 1DCKA 2VYQA 4UOZA 1F7UA 1UKAA 1QG6A 2OBXA 4LDZA 2ECKA 3TKAA 1ZAYA 3INTA 2OCIA 1EBFA 2I9KA 2O1EA 3FLBA 4PE5B 1YK1A 3OLZA 2VN8A 3RADC 2FK7A 4EHFA 5JU6A 3HA5A 3DOIA 2DWCA 2YZGA 3LYUA 3OHSX 3PA8A 1M0EA 4QGHA 4BO3A 5BWMA 1XZEA 2Q3MA 3IR5A 3QPCA 4ND3A 3VKGA 2OYSA 2POCA 1AKYA 1XR3A 2P1RA 4RVGA 4Z0HO 1GNVA 4ITVA 1P1CA 5KSOA 3ZJUA 1XTBA 3EC7A 1VL2A 1FQOA 3A6KA 3I04A 1MH9A 5ESXA 3OEHA 1VSUA 3MSXA 1RR6A 3AFGA 5DCUA 4D25A 2G7ZA 3PJDA 1CY2A 1W29A 4NZNA 3WLEA 2IIQA 1I2DA 1WHTA 3AH8A 1GNSA 2OZEA 1K08A 4GSYA 2P9BA 4KXWA 3E15A 4RSMA 1FNDA 2V7QD 2CJPA 2IUTA 2W6JA 3B6EA 4FYJA 4M53A 2VCYA 4X6YA 1FQJA 2K5UA 3IAEA 4EDHA 1I7SB 2ZKLA 1X1RA 1AUVA 3GL9A 3LJKA 1ZH6A 1YQUA 4IS3A 2E5WA 3DWEX 5CJJA 3RW9A 4E5VA 1ZC3A 2C4UA 1V5WA 1H2RS 3A2LA 3AV3A 4YRAA 1EWTA 5LA6B 2JBAB 2ZUSA 1PJ8A 1YDHA 4MVJM 3T99A 4R81A 3LL7A 1Q17A 5TB5A 4WGGA 4RA9B 1SUDA 4RSHA 3WRXA 4AB1A 1GT91 5C4MA 5JZOA 3GDGA 1WTCA 4YRNA 4GWLA 2XBMA 4JLMA 3GT4A 3DFFA 3DC2A 1LWOA 4WESB 5JSQA 5FB3A 1FL9A 2GILA 2JHAA 3B60A 4P32A 5CVVA 3OPYB 2XNJA 4OUKX 4Y6SA 4X41A 1WIWA 3PLRA 1DC5A 1W73A 2IUYA 3OTGA 4EJ2A 1IDOA 4BNWA 4ZYYA 1G42A 4N5IX 4B0OA 1SELA 4DXDA 2BP7A 3QXSA 5JFGA 2XMCA 1ZNYA 1UKBA 3HDHA 5LQJA 3DHNA 1C2TA 2Y0DA 2OBBA 3HBFA 4NYIQ 5AESA 3D6JA 3MMZA 5GJWC 1DEOA 4X6XA 2A2ZA 1ODSA 1SHZA 2HJVA 3Q85A 2OILA 1O5TA 4N82A 4EKYA 2R25B 2XV1A 4DCPA 1FCJA 2GK3A 4O0LA 3WMWA 1EWQA 3C0KA 4Q7KA 2ESRA 2GFIA 2X5KO 3FOCA 4AJ2A 1XL1A 221PA 2X40A 4MGHA 1N3LA 1QE3A 1HE8B 2XYRA 1UZAA 2HAEA 4ZQEA 1HLDA 3PJEA 2WMDA 3IDSA 4N12A 3JWJA 1FFWA 5HUJA 2D4AA 3H4VA 2V0NA 4W1RA 4WUVA 3AYZB 3KWFA 4MQ6A 3TD2A 1JWLA 3R3ZA 1XUOA 5TXGA 1AS0A 1Y3CE 5F78A 4DIMA 4D3XA 3RE1A 1SN7A 1DCMA 1XWWA 4G8BA 1AKRA 4GBGA 1BMQA 2BN4A 1KARA 1O87A 3VBCA 5D84A 1GZ6A 3E9MA 2I6QA 1EM8B 3INNA 2GNOA 4FS8A 3KZXA 1T5BA 2WMNB 4ZYWA 1DBPA 3T1VA 4DSOA 2F48A 1REQB 4HQLA 1MJFA 4OXIA 2XB6A 3L07A 2W93A 4IEFB 4L9SA 1QNFA 3INRA 4BN5A 4G0PA 3L7LA 4EX7A 2BISA 5EQFA 1FZTA 4E1VA 3ILVA 3SS7X 2HO5A 4Y6RA 2XBUA 2O2ZA 4R9VA 3W78A 1KU0A 4OUDB 2WLTA 3DUWA 2FOXA 1OSNA 3GRUA 3GUCA 2FMTA 1N1EA 5FTWA 3BMXA 2O8BA 5CPBA 4FMDF 4LMRA 4CKCA 4FMCF 1K4MA 3RVPA 4H7PA 1KZYC 4K9SA 1T2UA 4U9IS 5AYVA 3T7JA 1ML3A 2IIBA 2GBPA 5AXDA 3T3PB 1VSTA 1B7GO 3K30A 2PMKA 1OQAA 4PZCA 2VUHB 4RAQA 4F4UA 2PUVA 3UQZA 3I2GA 1RM5A 1GLVA 3CNOA 3I3OA 1UAAA 1SVUA 4Q6BA 2KM1A 3KQQA 5KX5A 1RTTA 3AF5A 4Z8YA 3MTGA 5IT4A 4BZZA 1L8OA 4RV5A 1I2AA 4HLDA 3ZCQA 1XXHA 2UDPA 5EAIA 4TL7A 4QBGB 4BX2A 3OFVA 2PGLA 4A1OA 2HQ1A 4OLBA 2Y3IA 4W5TA 4Y7DA 1CQIA 1DPGA 4I9UA 2CV0A 2MSEB 2CK3A 3HUFA 4HGRA 3DFZA 2KPOA 3HY3A 1AM4D 1N7JA 3RUHA 1DS6A 2GCOB 1OJ7A 1EUCA 1P31A 3KETA 4CG0A 2BYTA 2D0OB 1FFAA 2QJOA 2HJRA 3SOPA 4CF3A 2NIPA 1XA4A 1JEAA 5MN5A 3ROXA 3HKBA 3OEWA 1A9OA 1NDQA 1PTKA 4IV0A 4LVNA 5K0CA 1WY5A 3TLZA 1WDLA 4ENRA 4RVHA 4DB2A 1XMSA 4ZFNA 3SQNA 1Q83A 1HE3A 1JT2A 3KPYA 5B7PA 3Q7IA 3ECAA 3TRKA 3HWSA 4OLFA 3FYDA 1PNOA 3RVSA 3ZDAA 2RHWA 3VBEA 4EP1A 2RGEA 4HEJA 4WCVA 3BE8A 2CWWA 3B82A 2WJWA 4Q7QA 1ZISA 1JXAA 1ULBA 1RMQA 2OCLA 3D4PA 5J59A 4P0PB 4RD2A 3WXBA 4UPDA 2CFOA 1N6IA 3MQ2A 1TZ2A 4TGLA 2NMVA 4L4RA 2ZQZA 1DNPA 1E94E 1B16A 2PD3A 2PUHA 3DSRA 2HJ9A 1D8TA 4ER6A 1IWPB 5JZSA 1F8YA 3L77A 4IFBA 4D2IA 1C4KA 1OXTA 1SEVA 2C78A 2D8AA 3L0IB 3O3CA 3SLKA 2IF2A 2XB8A 3SS9X 3ZHYA 2F9FA 4LGMA 4CKWA 1GQOA 1EXDA 4P08A 3UWDA 1JIKA 2GCNA 2X19A 2VVTA 4KQXA 2DQZA 4RVFA 1DCFA 1XLVA 4WKCA 5AJVB 4DUPA 4ESVA 1O0SA 2Y0CA 3WMEA 5JCJD 5D86A 4OBXA 1NYLA 3UMMA 5CURA 4WK4B 5IUNC 1BYIA 2BP7B 1FF9A 2ZTLA 5CRIA 3VOBA 1XO1A 2ZBDA 1DEAA 1XTZA 3HCCA 1YC2A 1QRRA 3LA8A 3WWYA 1UBUS 3BWYA 3EZLA 3N75A 4Q66C 4RNDB 1O2DA 1Q74A 4BNFA 4OO3A 1KKUA 4L9WA 3BT7A 2A35A 1QZZA 3OO0A 2OXRA 2VPTA 3FWYA 1NG9A 2JD1A 4R2JA 4RJKA 3SJCA 4YAGA 5B58C 1ADYA 1U02A 3ZQJA 1JNXX 3DJFA 3H1PA 3N2EA 1Z63A 1WPRA 1Z38A 2JB9A 1UQRA 1U0EA 2J0UA 2NU7A 1T3ZA 2VUTA 1ZEJA 2X7XA 3V4LA 2Z3WA 3V7UA 1H3EA 5CIQA 4C30A 3KXDA 4C6TA 3TQFA 5C1PA 4NK4A 1MUUA 4ALLA 2GRJA 3HHPA 4EHIA 5D7BA 5P8WA 1JN0A 1OOEA 1HE4A 2AOTB 3L1KA 3LHFA 3MTDA 1P80A 5G1NA 2VZEA 4RPHA 2YZNA 2MSLA 5H70A 2CLLB 3BREA 1C3LA 3R5JA 3RUDA 4DA8A 2MSCB 4A0SA 4E14A 1JLLA 1U1GA 2NNWB 4ZDIA 3ZHZA 4UPEA 3EISA 3DE3X 4DEYA 3KJIA 4ZMRA 3F4LA 4XPIB 1LNQA 1V4NA 1JFLA 4J49A 2ORED 4TYPA 3VPXA 2DHEA 3AVQA 3L7YA 1M6VA 1W36C 3HO1A 5FO1A 1VHJA 2DY0A 4RM2A 3IUMA 4E51A 1UDCA 1FS6A 1J1IA 3K6KA 1AGPA 4Z6KA 1GGFA 3GLRA 4JQYA 1ZIDA 1G8HA 1HDCA 1XZLA 4B81A 4DNOA 1CVRA 3LRTA 4OQDA 5HNKA 2MINA 2J09A 1N4AA 4H0FA 2GLXA 1H9BA 1CUUA 1BXZA 1N6OA 2O3QA 4IM7A 4E88A 2O8BB 2PS1A 3V1MA 4LJ9A 5FD8A 2XKBA 1GNPA 3CX6A 3OKAA 2I2WA 4R31A 4YUWA 3DYVA 5DX1A 2XBLA 2XF2A 4XARA 4BTVA 1FYVA 1YNSA 1G8GA 1YR6A 3CBQA 2CXUA 3EODA 3PUZA 4MVJD 2WTBA 4WBXC 3ET4A 4BEVA 1WXFA 1TO2E 1GTL1 1V39A 4W7IA 1O1YA 4WCFA 4Z7OB 3ESYA 4JZYA 5KX5B 1PVOA 1PNTA 1YL5A 4F9GA 3A0UA 4WY8A 4OMCA 4GECA 5JHHB 4EFDA 1XXHB 2C7GA 1C3JA 2ACVA 2WYHA 3BHMA 1JFTA 2XEXA 4RJJA 1O94C 1PG5A 1XGKA 1ZS9A 1NLZA 2O52A 5EIHA 1AQNA 3FBGA 1ZJ5A 4Q3EA 1B41A 1L7DA 1OPXA 2C9YA 2VRCD 1OI4A 2HB6A 2YASA 3MFQA 4TTTS 5KVVA 2GJ8A 3ELYA 1GAXA 3UK0A 4RK1A 2I87A 4NK5A 1L3BA 4GZMA 2VP2A 4BBPA 3JD4A 4OHWA 3JQ9C 4ENUA 5ALPA 4R1OA 5I4KA 3G88A 4GI1A 1QHIA 3RRNA 3DNMA 4CDGA 1HOXA 4QUHA 1NOKA 1YUMA 3OBIA 3W5IA 2VCHA 5JJIA 1WMFA 3KOZA 3KSAC 3M4NA 1JMVA 1WZNA 3E2IA 2CNWD 2C2GA 4OLJA 1HY3A 4QYXA 3SLGA 3TBKA 2IH2A 4C7JA 3N74A 1NF8A 4JSTA 1RBYA 5IKMA 1V11A 4FMDB 4LY6A 3G89A 3W2EA 2FEOA 4FMCB 3RUIA 2VNHA 4IIHA 4EPVA 1M34E 3DL2A 3EA0A 4Y9SA 1FPQA 1YD7A 4BVBA 2WG0A 1WRBA 1U0TA 3LF2A 1F0NA 5TGTA 4QGSA 1J8FA 2ZYWX 3HA7A 3WOHA 4DYHA 4G9EA 2C59A 4TT3D 4ZMBA 3AM4A 2QZ4A 3M2TA 2NX2A 2GZ1A 3AXTA 1SZJG 3FDIA 3DMTA 3PDIB 5HYVA 4TTVA 1DXOA 3KL2A 5HK8A 4IJKA 4OHFA 1H05A 3MK31 4YHBA 2MR5A 3M2PA 4L76A 5L7TA 1Z88A 4K0RA 4L0CA 3QI2A 1OXKB 1SUSA 5EPOA 2QAIA 4P4LA 2XF8A 2WUDA 4G36A 1XEWX 3FFTA 5KQGA 4NSNA 1XWIA 2PV0A 2M9MA 3F96A 4JL5A 1EVJA 3Q2KA 2NZUG 2Z3ZA 2W2KA 5AI9A 3VR4D 3U7FB 1DT5A 1YULA 2GAIA 3PBKA 4LBYA 5ERYA 3MB8A 2DBQA 1M1NA 5GVSA 1Z4OA 4YC7A 3NIDB 4EGQA 1W2WB 4MQBA 3JAMA 4KKVA 2ZE8A 5AVUA 3EMVA 1YQ9A 4WXHA 1TOAA 2EFDB 3HWX1 4EHJA 4UUQA 4LWOA 4PYLA 2IHUA 1MB9A 1Z25A 3IUBA 5IC5A 3UGQA 5F64A 2A5GA 1J0EA 1CUSA 1PHPA 5DWVA 2W6QA 5ITZB 3Q0IA 1OPRA 3OIVA 4OKIA 3COJA 1PNRA 3I28A 4HYTA 2LCIA 4PZAA 5THXA 4CQNA 4BCDA 4PVCA 1TCUA 4MAAA 2O0HA 5IVPA 1U3DA 4C4SA 4ITRC 4EK9A 2ZVPX 3FGZA 4CEJA 1QVAA 2QUZA 1FP4A 1JE1A 4OD0A 1ES9A 2GD2A 3JQBA 2W4QA 1QDEA 3GXOA 1KEVA 1SKUA 3IAM1 1J2UA 1EDOA 2A30A 1F1JA 2CVFA 1T91A 2KWIA 3JARA 3NEJA 4JEHA 2D2FA 3D0QA 2A1IA 1VKNA 1YZKA 3K0AB 2J7PD 4WI1A 3R76A 2AFIE 3IHWA 4AWXA 4CV1A 2ZI9A 5SYMA 1EJ0A 1X80B 2J59A 2K4MA 4O4HF 5CDYA 4MS3B 5A5FA 3VR6D 4HWRA 4CV2A 5U4QA 4Z99A 1JLLB 4AP5A 4P0TA 1UKEA 1WUJS 3A70A 5EIXA 4CMAA 4FFBA 4EMBA 4L51A 4KB5A 3QY9A 3MGCA 4G09A 4MGIR 3OKPA 1VP9A 5LNK6 2FGKA 3K20A 1BNCA 1DJOA 3C16C 3K8QA 3WC4A 5LL6P 1M6VB 3NT4A 2AZDA 1YH3A 3PDJA 4QJBA 3PXAA 4TQAA 2R4UA 4QFCA 4N7JA 3GPLA 1T3HA 3WL4A 1CWUA 4KNWA 1VKJA 4CIXA 4UASA 1RIFA 3UT5A 1YVDA 4BQOA 1Y3HA 3L2OB 2QWXA 3Q72A 4I8XA 3IIKA 3TYXA 1PQWA 4LSGA 4G07A 4RHXA 2XGMA 1R9MA 3ABQB 5KSPA 4BBJA 4EEZA 2B9EA 3H87A 2R6JA 1YE5A 1KE2A 2QPTA 3QXCA 2CN1A 4JQZA 2H11A 2I4NA 2GBCA 4FGWA 3KNZA 1C8KA 4DCUA 2FDRA 2GKSA 2O06A 1J9EA 3N28A 4KFTA 1N9ZA 4NV0A 3UOGA 5H4GA 3NFYA 1H1TA 3RQIA 2PUWA 3FDJA 4Q7LA 1JQ3A 4LOJA 3AHEA 1PEYA 3QFFA 4RDIA 4B32A 3MWFA 3ZPXA 2HBYA 5CEFA 2J3MA 3FRIA 3IQDB 1PZGA 1DAFA 3DT6A 1RWQA 1AIPA 1A7UA 1Y7PA 1P7WA 4Z4QA 1PQPA 1XRMA 4YJFA 3ZJVA 4TLEA 2WM8A 2HF7A 4YREA 1CV2A 1QBKC 4X8MA 4ZVMA 4L8FA 4QPJC 1OJLA 1NW5A 4JVOA 1QRTA 5JQGA 1XRSB 3B12A 2CLKB 1FDUA 2I65A 2ACKA 3P9ZA 1E89A 4FE7A 4UHBA 1AV7A 3FPHA 3STVA 3MRVA 1BVYF 1TC2A 4R1PA 3T5MA 4F5ZA 5BW4A 1Q12A 2ZUCA 1CJMA 3R5FA 2XQFA 4I2VA 2GD1O 1PYDA 1RIIA 4H16A 4NATA 1VL5A 2R7MA 4DJJA 3OT1A 2QXTA 3OF2A 4L5JA 3WMFA 5D7NA 4G0NA 1ZCJA 5T4FA 3UJCA 4UCQA 2FQXA 1SC6A 1V11B 4OSEA 1CQWA 2BI8A 4E2XA 1MCZA 3JQAA 3OZGA 4BV8A 1HTTA 2HUNA 3IDOA 4IIEA 3MW8A 4JBLA 5AUQA 4CEJB 3M4YA 1IZYA 1Z26A 4MCJA 1WOMA 5C1BA 1UMKA 1Q0LA 2OGUA 4R40A 1EFRA 1PT6A 1JI3A 4TYMA 1JEJA 1JG4A 4X95A 5ECWA 4CETA 5LXTF 1QLJA 4OMUA 1BHO1 3LT0A 2CMKA 4CTKA 1VBKA 3OJCA 4F92B 1QRDA 3P4UA 1DJNA 2DR0A 1M34A 2JCSA 3RSOA 1GCIA 2UXCB 5G02A 3LBFA 1IJKA 1OFVA 5JSYA 3DXZA 3CMMA 3EBOA 3S0JA 1C7EA 1I5RA 4CW7A 4OIMA 4DV6B 3T3MB 3E7XA 4GLOA 3NYWA 3TNFA 2RH5A 2PMBA 3KKZA 1A8UA 2W2KB 2Q41A 3CZ9A 2ZRQA 2Y68A 5DLQC 5I9LA 3EVGA 1DQPA 1ND5A 4D9MA 3WBBA 2AYXA 3ELWA 3LMKA 5B1SA 3NH6A 2XD9A 1DZ3A 2Z3VA 1HH4A 2P4EA 3HG7A 4POAA 1GA1A 1ULHA 2G36A 2NADA 3MTEA 4BNVA 1ORWA 5LBTA 1GRVA 4L9AA 4LI0A 3WFJA 4YB8A 4L16A 1AK2A 3L05A 3CNNA 4QDOA 4WNYA 4G37A 5H0IA 2P27A 3PEFA 2W5UA 5ADVA 4MUAA 3ESZA 3GYBA 4O8CA 1LLUA 2A1UB 2O14A 3ZDFA 1WBDA 2O8VA 1G38A 4LUCA 1NXPA 2M6RA 4YAUA 2Y93A 1E6WA 2A0YA 3JARB 3OQBA 1PG0A 4RYLA 4YAWA 5LYJF 1TCBA 3D6AA 3RFTA 3KUUA 2C98A 4GMXA 4F9EA 3RU7A 2WF9A 1YASA 1Z0JA 2GPNA 3JAKA 3LYHA 2J3EA 4RK7A 3SIWA 3Q98A 3DPSA 5FPQA 3IEIA 4H4EA 4GYJA 4ZAVA 4FFBB 4GHWA 1YJXA 4EOGA 4OPMA 3TFWA 5LQCA 2V8OA 1LNZA 3NG1A 4WRRA 5KNCA 4HK4A 4LRXA 4YMHA 1LQUA 1WVIA 4OU5A 1I4EB 4M0KA 3M33A 1VL1A 2V6FA 2IV3A 3E9DA 2UZ0A 3HB1A 1FW6A 2F59A 2ZS7A 3HXLA 1Q2XA 4HDSB 2XCLA 3HEAA 4B33A 1T2FA 1Z0KA 2TMYA 4PFQA 3R74A 2CFIA 2NTVA 3GJ7A 3HB4X 3IQWA 1VLLA 3DDWA 3T1OA 4DB4A 2JKVA 1WBJB 4MV5A 1BHSA 5ED0A 5C7YA 2JLQA 1GTG1 4RDXA 2LW7A 4JX9A 1L7AA 3DZJA 1U1CA 4EF6A 3KAKA 2XYHA 2H1WA 1DAEA 1JHZA 1YJBA 2H31A 1VGRA 4XRGA 1MQAA 4KMMA 4KGVA 4TXMA 1UOOA 3R5HA 3EJ6A 3ZGXA 4IW3B 3GYGA 4BV2A 3Q3HA 2WV7A 2XDAA 3ETDA 3FLAA 5L45A 3P5BA 2NXWA 1ENPA 4PBRA 1VLMA 2DFDA 2XIJA 1E8NA 1LTQA 3UHOA 3PKIA 4XRRA 4MWZA 2RGCA 5DTEA 2WFLA 1XG5A 1GPNA 2XHZA 2A9KA 5KMGA 3O94A 5BSUA 2JD0A 2O07A 5IAAA 3G8AA 4IIYA 3C3EA 3H5VA 3HP7A 3NTOA 4MIEA 2I8AA 3CINA 4ZT4A 3C6YA 2QRLA 5HDBB 2OFOA 4HFNA 3FW1A 1KFEB 4PGMA 1IXZA 4PSUA 4HZUA 4OX9Y 2P9TA 1RFLA 1XLUA 1NM5A 2Z8XA 3RVKA 5JQGB 1NJ8A 1YZ3A 1KR2A 2B2NA 1E7MA 1E4EB 1HE2A 4RK0A 3TRHA 4EYOA 1U80A 3TK1A 4M9SA 4J2OA 4QLAA 4C01A 5HKKA 4PG8A 1U04A 2X7JA 3DVRX 3UJBA 1N5MA 2ASEA 1EB9A 5JNUA 2GERA 1QIMA 1KVUA 2WC1A 3AT1A 2X15A 2EJBA 2FPGA 4ZU1X 3W9YA 2YMQA 1FMCA 3CJTA 3SYRA 1HBJA 5AVWA 4M0MA 5IH3A 5IKPA 5JSZB 3GARA 5L3ZA 2W43A 3JQAB 4COOA 1ONBA 3TZBA 1SCKA 2OXCA 5AH0A 3RUAA 4Z9AA 2JW5A 3QKIA 2Z1NA 4NFLA 1Z6XA 4FYYA 3B20A 5A7FA 3GMDA 4A6DA 1Y4AE 3DVQX 5DIFA 4FJ1A 5FR1A 4B8YA 4DCMA 2YL2A 2VQSA 4MYHA 2Z9CA 1QANA 4Z3DA 3WDKA 4EY3A 2ZAIA 3PKJA 5HRCA 3R3SA 4FE3A 5EZQA 3AI7A 1DBVO 3ESQA 1CY1A 5CX1A 4ZHSA 5E1OA 2NO7A 6ADHA 1QCZA 2PUAA 1A76A 1V8DA 1UZLA 1FSSA 1XRLA 2PD6A 2IOFK 3ETCA 4GPAA 4JXJA 2B35A 4L6CA 1UKCA 2B8WA 2ZJ3A 4ISBA 3SR3A 1V5IA 3ISTA 3ZEIA 1RHUA 1YOVB 1ONSA 4HAYA 4ISCA 3GGOA 3NTLA 4XWAA 5L4LA 1CF4A 3ZWBA 4M6WB 2Z1DA 4RK5A 4UREA 1QCYA 3QPUA 2XZPA 1D4ZA 2IX3A 2FFJA 4HAZA 5JBNA 5CVTA 1QTNA 4UKDA 2JK1A 2E6KA 2Y8EA 4YAJA 1H6AA 4A9AA 3CW9A 3GLQA 1GYQA 4GKJB 4Y2GA 4JOSA 3VR2A 2ZTVA 4PXAA 1I1QB 5M5BA 1SIUA 1NBWB 2YCLA 4JR0A 1N75A 4AF8A 1UOQA 4WLUA 3GD7A 3DZDA 3TZLA 2O20A 5FOVA 4D9JA 3LLMA 2PZJA 2XB4A 5KYNA 4J0QA 2WSIA 3D0OA 1RLOA 4NZPA 1SU4A 4ZJPA 1R6VA 1VI5A 2CB9A 2ZSAA 1M66A 3HKCB 3I05A 3WIUA 4IOMA 3LVBA 4GKAA 5TR9A 5JAQA 4DMHA 2ZXEA 4IKEA 1SKAA 3RTAA 4DLVA 4YCLA 5JSHA 2XXAA 4RVNA 2PSDA 2P3OA 4W8GA 2PBRA 4XVRA 1DJPA 2O8DB 2JFXA 1MJNA 3OU2A 1XHEA 2PKRA 2J0SA 1X1QA 4RE5A 1AUPA 1MC8A 4TQUS 3KKPA 5K1ZA 3WWDA 1LK0A 2FPRA 1E98A 2IY7A 3GRFA 5AHRA 1CUDA 3VU9A 3VFDA 4MHSA 4D4HA 1H2BA 4DPMA 5EWJA 2WAYA 3CVUA 2NLOA 2JHFA 2LE0A 6YASA 3O8BA 3Q7QA 3SGLA 5EIWA 2WVJA 3DEJA 5EIFA 1R6XA 1SCAA 1XCOA 2BFEA 2WQ7A 2LCFA 1LJUA 3K9FC 2J3QA 4GOXA 2GESA 3HU5A 2WTMA 4GI2A 1FDVA 4WOCA 3S40A 2OM2A 5A6SA 4C3UA 1YB6A 1NQVA 1FW8A 1TL7C 1E3EA 2AN5A 3Q1KA 3CRQA 3SEQA 3G2QA 1BHQ1 2QMQA 1DAGA 3K1ZA 3NEPX 5NLLA 5IDWA 4OGLA 5K2OA 4DA6A 1TD1A 1A8PA 2CVPA 4N5NA 3I62A 1OW3B 3EF1A 2IH5A 5ERGB 3K1JA 1C30A 3GELA 3T7AA 1GLNA 2GAJA 2TSYB 1A3CA 3LC0A 4BJ6A 1GXSB 2C9MA 1YMQA 4LE0A 4WVLA 4CIDA 3KZMA 4FR5A 1YVEI 3ODGA 5IJAA 5T3YA 1OU4A 1JTEA 1ZK2A 2VJKA 1FYDA 1QZXA 1TO6A 3ONNA 2R44A 3N0WA 4LXGA 3SBEA 5A9TA 5J4YA 5BOVA 5HCIA 3PL5A 2WFLB 1A8HA 3FPAA 3JWIA 1DHTA 3QY0A 4K05A 1ZQ1A 5H5JA 4M1WA 4ZAYA 2F1KA 1ACLA 1X6VA 2YXPX 4UJ3A 4KODA 5KTYA 3OX3A 4QOEA 3OM1A 2DFTA 3FCAA 5JMTA 3N0XA 4QFDA 1CYEA 4OKNA 1RYZA 2YJ4A 4PO3X 2NP6A 1USUA 3VC3A 1JZQA 5ITWA 1FMFA 4QJ3A 2PRIA 1AKTA 4HZUB 4MH0R 4NU5A 4TS9A 4NCXA 1ZIOA 1KY4A 4HJRA 1N6HA 4NCNA 1C0KA 2VYFA 3DE7X 3UEOA 5KUTA 4JKYA 4P4UA 3JQCA 1FDOA 1GAEO 4J4HA 3CRRA 2MCFA 4IKOA 1N3YA 1PU2A 1W5BA 4FYMA 3LBAA 5JALA 3DBOB 1N2EA 3TH5A 4CCYA 4CEIA 2RBGA 2OKCA 5E7JA 2IXBA 3GJSA 3O6VA 1W7AA 3MLAA 1DEHA 1KOGA 1S2NA 1PJBA 3KKEA 2R6DA 3LX4A 4MW4A 1LDNA 1V4VA 4UMFA 2ZJ0A 3I61A 4NU6A 3EGVA 1JDBC 4JJAA 1GG2A 2DHDA 3D7KA 4UE2A 4RHUA 1QR6A 1CD5A 1KJYA 1V8OA 2VXYA 3AOEC 4GQBA 3BWXA 3AOEA 4C4RA 3IEMA 3O03A 4IDOA 3IVCA 3BWDD 1M7BA 1N2HA 2WPDA 2H51A 1JG2A 1GV0A 1M75A 3LF1A 3M4ZA 3DDOA 1IHDA 1P7CA 3ETGA 4MCAA 3W05A 5AQ1A 4QZVA 1E1LA 1B8PA 5T8KA 1DQNA 1QOZA 5T4EA 3IE2A 3QVXA 3DEKA 3W9SA 2CZCA 4C2UA 1NN3A 1LK7A 3O95A 1KBOA 1EE9A 3EVBA 3O0TA 3OJXA 2R8XA 4KPGA 4QRDA 1EA5A 1EBUA 4TS1A 1AQLA 4ID9A 3PFFA 4IXTA 5EHQA 1HKUA 1J49A 1L4BA 3OUUA 2KX7A 5JBIA 1EK5A 4JGIA 4R8MA 1ZZEA 1SZPA 2D1RA 3F7MA 1AHHA 3UUFA 3HCRA 5CA0F 2VUSA 1EFUA 2VA9A 3E2PA 3GDFA 1H2ZA 2BMDA 5FADA 4GU5A 4WZAE 1RBMA 3I01M 1CTQA 1OZGA 2CYCA 4R2WA 1YJAA 3GJTA 4GR9A 1V3QE 2ZRIA 1L8LA 4R0VA 3L4SO 4B3GA 4JBIA 3M7IA 2ZCJA 1AKEA 3V42A 4Y2TA 4QBKA 2WZDA 3W5HA 1E2IA 4MO2A 4FDMA 5MN6A 5AHWA 1C3VA 3ROKA 4CEHA 1OR8A 5PNTA 1J42A 4JU9A 1NTRA 4CDRA 1ST2A 4QYWA 5B12A 8ATCA 3D31A 3GJ4A 3D54D 5L3VA 1N9KA 3KU4A 4N3GA 2CNOA 3OUZA 4D4KA 1J9ZA 2Z8ZA 3R44A 2XXAB 2HWKA 3AVPA 3E18A 4R68A 1GDTA 1TVMA 4FEGA 4QNMA 2Z0MA 1M0SA 4CT5A 2VDQB 4MVWA 1RVDA 5G4KB 4RTNA 5GGXA 1E5LA 3RTDA 2JKZA 2W8ZA 3W7AA 4UQOA 4Y2PA 4E5DA 1E9SA 4UAVA 3E7FA 1R9NA 4GXQA 5K0GA 2QRHA 3GLSA 1GGMA 2QG9A 3WK5A 3OZIA 2ZE5A 3WY9A 3HSYA 1J8QA 3IAM6 3PC4A 1H8HD 5FRDA 1ZG3A 3ZNPA 4F2DA 2Q4TA 3O3OB 2WDZA 4J16A 1J2RA 4U02A 3SAJA 3V3TA 3THWA 4WN3A 1O7JA 3IILA 1Z36A 2R1TB 2FOIA 5ADWA 2XRFA 5DDIP 1CC1S 3EXIB 3IMEA 4FCCA 4PG6A 4CM7A 1QAQA 2EZ9A 3C1OA 3C48A 2I62A 3PTLA 1XTVA 4GOOD 4MV3A 1YJCA 2E6UX 4UFNA 4UZEA 4ZODA 2EWMA 5BQFA 4NNPA 4WKNA 5JWRA 2YWCA 2K6GA 3OMLA 2GO1A 3P7MA 4OHOA 2AR7A 2C31A 1NVGA 2E82A 2QS9A 2ORVA 2YVLA 5KNBD 1C30B 1P2FA 4WXRA 4JU8A 4E6EA 5JD6A 2FHSA 2G77B 3ANMA 4S1NA 3IL2A 2A0KA 4BVLA 2ISCA 3KV3O 1KXJA 4JUIA 2QN6A 4LJ8A 4RETA 1RI5A 3TUJC 1PVVA 4UTNA 1NI5A 1JXMA 2D4HA 2MYNA 4H3KB 4G9BA 3AKDA 4KWTA 1M6WA 1N8SA 4Q9NA 4TV8A 4OHZA 2NZ8A 4LC9A 4UVEA 4PR3A 3ZHRA 3NHRA 2C8LA 3TAXA 2ZB2A 3QBTA 2ZJYA 1V6SA 1MVNA 2Z56A 3GJ8A 1V7CA 1WCXA 3OJ0A 3SZGA 3B9QA 1A04A 4BNIA 1FLNA 4XGRA 2B4RO 3WRYA 4XDHA 2B1RA 3A0RB 3I12A 3L0SA 1JKFA 2P6UA 4QKQA 3T5DA 3M1YA 1BVHA 2ZJBA 5DT2A 3U5TA 2XZOA 2XA1A 4L5YA 2CDCA 3PWKA 4MMXB 3UGKA 4IY1A 4Z8XA 1MDFA 1UF9A 1BN6A 4UHFA 3HQ4O 3ZWCA 1ZX1A 2W2QA 3PU6A 5CLHA 4BBZA 2ONCA 3JQ8B 1U2GA 2H6EA 3QUQA 4JELA 2QRKA 4FYKA 1L9KA 1YRHA 4Q39A 4QO7A 5J63A 4DDUA 2J0EA 1LPAB 1QGOA 1QYXA 3FWNA 3G8CA 4FFMA 1WOYA 2GPBA 1INLA 4ETNA 4CEIB 3K16A 4OHXA 4MKFA 3QYJA 2P30A 3JQ6A 3NBMA 4I1UA 3QMWA 5BSWA 2CUTA 1NBEA 1E0AA 2V6MA 1ZK0A 2IUSA 2G08A 1VIDA 1II8A 3MS2A 1P6UA 2FPSA 2VTBA 1OASA 3EZ9A 3HP4A 1GAWA 4J0IA 1JDBB 1KI9A 3FAZA 3GWZA 5K2MA 1NJFA 2AW5A 2FN8A 2O2YA 5ILOA 4NFHA 3PVSA 1PEAA 4WMLA 1TT5A 2NAPA 4YMTA 5JH7B 4ZTZB 5L51A 5ALWA 1H0KA 4FNGA 2Q5LA 2VQEB 4MDFA 1H42A 2H54A 4FFDA 1COWA 5KTTA 1A2OA 1BS9A 3TZ6A 1QGED 2PCJA 2VYND 1V8BA 2FEWB 4M2LA 3O2NA 2QZJA 4JSYA 1Z2CA 4R8KA 4F4FA 2BR5A 1KYVA 4IBOA 2Y05A 2B8EA 3JWHA 5B2FA 3S2FA 4F46A 2R60A 4FGZA 4FYWA 3U6BA 3BEDA 3K2EA 1PK7A 3QXXA 2AFHE 1R2QA 2Q2VA 3X44A 1HE5A 4CV0A 5CIYA 3T1NA 2JFYA 5KYTA 4XKJA 1T4BA 1KDTA 1W85B 2PS3A 3NBFA 2I2AA 3DKKA 1J2TA 2CLMB 2LIPA 3BULA 3I9KA 1OILA 3QUTA 2VZLA 1H1LA 3FSRA 2PLFA 1H6BA 4FZRA 4QYTA 4A0HA 3U7HB 3QU5A 2K2QB 3RV4A 4Y9RA 1I33A 3A31A 5FAKA 4CF7A 2I3BA 2ZRJA 1YDFA 4NFYA 2OORC 1BQ4A 1W0KA 1L7VC 1O97C 4MJXA 1PJZA 2EFGA 4G63A 1UM9A 1BCRA 2WJYA 2PL9A 3ZDXB 3EEFA 4HAIA 1SVOA 4BNDB 3QKTA 2Q4OA 4ZV9A 2R6R1 4KGXA 4UFOA 5B1HA 1PKEA 2BHSA 1UT6A 4PPQA 1RKXA 5C80A 1WZUA 3LUHA 4X61A 1A5AB 4Y2XA 3VM6A 1AB5A 1TTHA 5TPWA 1Z29A 1QO0D 3HFJA 4O1HA 4A8HA 2I6XA 2CCGA 2XQKA 1VE1A 1Z33A 3LLUA 2VC2B 4JK3A 2PXCA 3FHOA 1XRRA 5CIWA 5CFZA 1T9BA 4OB7A 2VYVD 3P2KA 4RIFA 4ZI7A 4PRLA 3B1FA 1DQSA 1NFQA 1Z8DA 3I1JA 3VH4A 4BNXA 1SM4A 4WY5A 2HMVA 2FW0A 3SPXA 4B6SA 3I9V1 4GFDA 3E7DA 3DP9A 1PI3A 1G20A 1T5IA 4GYYA 1Z39A 3HBLA 4DEVA 3QENA 2QTVB 5FX2A 1HGXA 4OU4A 5EVCA 3S3TA 1QO7A 5A2GA 1ZEMA 1T9GS 4D41A 4PFSA 3LGAA 4BNJA 2W58A 2WD9A 4HVTA 4JNCA 1CLEA 4O4LF 4PLVA 5A1TA 1NW6A 1WMDA 3CZ4A 4R05A 5J4VA 1C9JA 2RKOA 3QTLA 2OFWA 3ADBA 3GHYA 3STXA 2CBGA 3Q9UA 1PIWA 5NULA 1KDZA 1JDUA 2PAAA 5CNMA 1S9HA 1ZNWA 4B3MB 2X2PA 3A3PA 2W48A 2I0FA 1IM2A 1QDLB 1U8XX 2PKWA 4BQRA 7ADHA 2GA9A 3O5AA 3FJYA 5KB3A 2I34A 2BKAA 1J23A 4TV8B 4EWLA 4MX8A 1NVWQ 2Q5QA 1HG1A 3AUFA 2QEQA 3OQIB 5HSGA 2OK8A 2DPGA 3BDIA 2JVJA 4JVLA 2YUIA 2RGYA 5G2OA 2H2IA 4PC2A 3A3KA 3GV0A 3JVUA 4CMJA 5A7GA 4AJIA 5HOEA 2YWRA 1GRRA 2IS1A 4NH0A 8GPBA 3IOCA 2WDPA 4IV5A 1P18A 1GL9B 2ETXA 4BJ3A 2J5RA 3HRHA 3B2EA 2I6UA 2H2FA 4RULA 2ON6A 2M1ZA 3B6JA 4E08A 2FXIA 5CNIA 3VTAA 1Z6PA 5HK9A 1K7XB 1SVIA 2CD7A 3TX6A 3ZHQA 2NV0A 3RVDA 4XX0B 2VHZA 3PSAA 4GXRA 3EULA 1RXUA 4FDVA 4YUXA 3ROFA 2WW8A 3VKHA 1HETA 4J0DA 4HUQA 3A26A 2FE4A 1GCOA 5F2KA 1E0KA 5HR5A 2UUCB 1DUVG 3ZDRA 5D5HA 3IFSA 1E5DA 2NW6A 3WDLA 1O95C 3WWPA 1GTZA 1Q19A 5IM5A 3WBFA 3IVXA 2G4CA 1II8B 2VTBB 5EKDA 4WASA 4QFBA 3OCZA 2JZOA 1EE1A 4A8PA 3GVPA 3H3FA 1BS1A 5B3JC 5FOSA 2O8CA 1EK0A 2FWRA 1W25A 1C7ZA 2HDHA 5KWEA 4K9DA 1E5QA 4Q48A 1TT5B 3FFXA 2IYOA 3DCNA 3PHCA 5FO0A 2RG1A 1O6CA 1Q44A 5GY7A 1NVBA 4BXOA 2RARA 4P7GA 1A8IA 1VPDA 4HWOA 2YZ2A 3DEYX 4IQ4A 2ADOA 2I99A 1ISJA 1CQPA 1JH8A 1T6BY 2ZP1A 3D5TA 2CLSA 2GEVA 3I73A 3RIEA 4JYAB 5JOQA 2GO7A 4UNIA 5ENZA 3TTUA 3LLVA 3PXEA 4BYGA 2MIIA 3PUXA 2OCGA 1PL0A 2AE2A 2QRVA 1FUEA 4CF6A 1N7IA 2WF5A 5BSRA 4X7PA 1JHPA 4LDRA 1E9BA 1H1LB 3G79A 4MP3A 4ID3A 3GEHA 4BGIA 4GAEA 1T3GA 3B89A 3LCRA 1U1IA 3KP1A 1Q7RA 4IICA 4DDMA 1A69A 2C5GA 2ZRDA 4IVNA 3B78A 4OQQA 4BO2A 4DTCA 5KVSA 1UJBA 5DNEA 4P3KA 3C6BA 3I0NA 4K9PA 5TSDA 2QF7A 3NETA 3AEZA 4HNHA 1UM9B 2JJ1D 1OLXB 5C3MA 5J1TB 4JUAA 3AVTA 4OHPA 2A67A 2R1VA 4GYWA 4YMWA 3C70A 2L0XA 3CUKA 1JJIA 4CNQA 2O3SA 1AK1A 1SIWA 3L9WA 5BV2P 4CUJA 7AT1A 2FR1A 2OMEA 2Q27A 2Q4RA 5TPWB 1Y3AA 3HV2A 1QX4A 3A36A 4JJZA 2F8MA 5AHKA 3HXKA 1GEGA 3DXFA 2JGAA 2QW1A 3LS2A 1GEEA 2F1RA 2W2VA 4HMOA 2QL5A 3DG9A 4ZI7B 1B4DA 2RGXA 2GN8A 2UZ3A 3RSQA 3WB9A 4D8VA 5KHLB 1JR6A 3FPBA 4AFNA 2O7QA 5JPIA 1PTJC 3E9YA 3IBGA 1WSDA 2QRMA 4WERA 4Q4HA 5FBWB 1U9IA 1IMJA 3WYDA 2VBGA 1UWLA 1BVRA 5ALZA 4OFWA 4F9FA 2F8LA 1K4YA 5J5AA 3WHKA 3WA6A 4F1WA 4WBNF 3A6PC 4ZV4A 1NWHA 1PV1A 2O3JA 4M3NA 4JROA 4A16A 4AUNA 2H57A 1QIJA 3FNIA 3VA7A 4Z49A 1F8GA 3CH5A 1N77A 4EPYA 1YS2X 3DP7A 1NNSA 1BCSA 2Q3BA 1JSRA 3ESDA 3X1DA 3D5QA 4E15A 1JFFB 3SG0A 5AI8A 3DZHA 4DZRA 1M8JA 2ZYDA 3H1EA 1HYBA 3OZDA 4ZHQA 5B36A 4D26A 3KHTA 4GM1A 1A8SA 1TXGA 3MLEA 1IXYA 2XQJA 5DHAA 1NI4A 4O6VA 5EOVA 3SM3A 3UAVA 1PGNA 4HDAA 3WNQA 3ZGYA 2R3SA 2BGWA 3CF0A 3TG2A 2IEIA 4I19A 4BFUA 3B1KA 3C4JA 1ZPDA 3MAAC 4FP9A 1I4TD 1RU3A 4A5OA 1XB2A 4MVJE 1VGVA 4M4SA 3A9CA 2IYWA 4RW0A 3VO9A 4EF4A 1GSIA 1ND6A 3WADA 2E0IA 4QXAA 1D2GA 1R8XA 4KWHA 4PM4A 1JSZA 4PYKA 1VMDA 3FTQA 4HH1A 4P1ZA 4GP9A 3CVYA 3Q7PA 4E46A 3KSZO 4IIGA 1G9TA 5ALJA 5AI5A 2HR1A 1JKIA 4I81A 3EVAA 4MVJI 4PNEA 5GIOE 4FC7A 4M83A 3KXIA 1SOVA 1EESA 4EG8A 1W1UA 3E9EA 2D74A 3N3BC 2X9GA 3ND9A 2BE7A 1UBMS 1XN4A 1GR0A 2XMGA 4HAOA 5E8RA 3IPCA 1LPNA 1U0HC 4O1IA 4R0MA 1XMIA 4NIMA 3R7SA 2NSHA 5B6PA 4HUTA 4ARAA 3NDRA 2EKDA 2H5LA 1E8DA 1AGYA 2REQA 4YRDA 5DM60 4UVDA 2IHKA 4HGQA 1JXQA 1VL8A 1KDVA 3T3OA 2O8CB 3EAGA 3STWA 2B1QA 4IOLA 3F47A 4TMYA 1WMAA 2FDXA 1JFSA 4JR2A 1EU1A 2MSKA 4KN9S 3RVBA 4EECA 1J56A 4Z4FA 1OIVA 3LOQA 1CVIA 1DBWA 2Q8PA 2QJWA 3E53A 4UUPA 2IV2X 3ZY5A 4DR4B 3C6KA 5COAA 2IU0A 4YTEA 1GFIA 3OQ1A 3PS9A 1NV8A 4X3CA 4YJ3F 1YA4A 1UBHS 5EP4A 2HT1A 1GZUA 3C8UA 1JQKA 1LY1A 2H1HA 2OXEA 1JBEA 5KTOA 5ADHA 5BSMA 1XXLA 4YALA 2XNCA 1GUFA 4D43A 1K9VF 3C43A 2ZUBA 2X3YA 3QM1A 5JS1A 2ODTX 3ILYA 3FG9A 4H7EA 1JV2B 5GOZA 3W04A 1DAMA 1OT5A 2CZQA 2ST1A 4OQYA 5E4FA 4DA9A 4F5WA 2XKJE 2IWRA 3WGVA 2GLUA