4MYDA

1.37 angstrom crystal structure of e. coli 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menh) in complex with shchc
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
252
structure length
252
Chain Sequence
b'MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Molecular Basis of the General Base Catalysis of an alpha/beta-Hydrolase Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 98
structure length 252
sequence length 252
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mydA00
5I8PA 4Y7DA 1XZIA 2I3DA 5AKLA 2FJ0A 5T4FA 5BWCA 2PSFA 5A7HA 1YB6A 1IMJA 1MN6A 4B85A 3ZLVA 3DL4A 3CN7A 3M82A 5ALPA 1ZI8A 4CI9A 3GBSA 3W9UA 4XVCA 5AM5A 1YAJA 3F97A 4JH0A 1MU0A 2IX9A 3WKCA 2VJDA 3IURA 1Y37A 4X85A 3I1YA 2WHPA 3IB3A 1DWOA 2VEOA 4MJ3A 4BC1A 1EI9A 3NGMA 4W1PA 2QR5A 3MUOA 3QMMA 2HFKA 4BRSA 1XRMA 4Y2UA 1D07A 5K3FB 4PQEA 3I1IA 4INZA 3KD2A 4UBOA 4KAAA 2WKWA 2IIVA 4DSZA 3V1LA 3DKKA 2JGJA 5A2GA 4OU4A 3C6BA 3STXA 4U2GA 5CXXA 5ALIA 4U2BA 1XRPA 2UZ0A 4KRYA 5AICA 3DJYA 2PL5A 4ITVA 5HFAA 5ALTA 1RWQA 5ALJA 1EXWA 4B83A 4PNZA 5DYTA 2AJLI 2V96A 3B12A 4U2CA 1UK9A 1CUAA 2QKYA 3FNBA 4EZIA 4EY5A 3QPDA 5E4YA 1ZI6A 4L3WA 2ZSIA 4YASA 1W6RA 5CRIA 4DMFA 5LZ4A 4ROTA 2V9ZA 2HL6A 2DHDA 5JAOA 1GXSA 3WK6A 4A5SA 5HFNA 4GXNA 1SC9A 3VDXA 4YX9A 2CJPA 2YXPX 1EVEA 3BIWA 1ZJ4A 4TPKA 3DS8A 2CUTA 4X7BA 1THGA 3AJAA 5LKAA 1XQXA 3QPCA 2BUBA 3U1TA 1W52X 4CG3A 2V98A 1P0MA 3VKFA 5AK5A 5CTAA 5I7UA 2ROQA 4A23A 4HZGA 1BS9A 2AJ8A 4ARAA 2R8BA 2ONCA 2HFJA 1AC5A 5K3CA 1DT3A 1YSCA 3G9XA 4RGYA 1E8MA 1LPOA 1QIEA 2WG2A 2VAXA 3FSGD 1U8EA 3H0CA 2OPHA 2W6CX 1K63A 3V1MA 4Y2JA 1TIBA 2ZJFA 1QFMA 3D4LA 3R3WA 2PM8A 3R3ZA 2OCLA 4CG1A 4W1RA 4G8BA 4QDTA 4AO6A 3D2BA 4JEIA 5IKXA 1XQVA 4MWSA 3Q8WA 1Y7HA 4BDSA 1TCBA 1VZ2A 2HA2A 1N1MA 3WL5A 1XRNA 2B9VA 3N0TA 5JZSA 1BN7A 3MVEA 3ICVA 5DJ5A 1C4XA 2RIPA 1EINA 1A8UA 5JADA 3G7NA 1ZGBA 4B0OA 3KWJA 2HRQA 5T4BA 4RE6A 4BE9A 3DCNA 3F67A 2FUKA 1MT3A 2C5FA 3FAKA 3BXPA 5KWIA 4FWBA 1MO2A 1SCKA 4ZXFA 1NX9A 3TRDA 4BZZA 2VT7A 1CEXA 2WHQA 4GEGA 2QJRA 4WFJA 4BCDA 4ZI5A 5JAPA 2VJAA 4KE8A 1GQSA 4L72A 4UPDA 1ACLA 4AO8A 2HA5A 4B84A 1YR2A 4NZZA 5ALLA 2JGIA 1UK8A 4K2AA 2WSLA 3T52A 3PE6A 5CT5A 2GBIA 1QO7A 4U2DA 2XUHA 2GZSA 3JYHA 3STVA 4NVRA 1DU4A 3DQZA 4EUSA 2G63A 2OGSA 2QUAA 4W1SA 3W2TA 1N5RA 4E46A 1OXMA 5AK6A 2WLSA 1XFDA 1N8SA 3UUEA 4ZV7A 3KSRA 4ZREA 1CRLA 2CEKA 3AUKA 2WJ3A 2ORYA 1HDEA 3EIOA 2G4LA 3S8YA 4G4IA 2BFNA 4BRZA 5SYMA 3IDAA 3F98A 3KOOA 4C01A 3WK8A 4V2IA 5A71A 4CCYA 4H18A 1K5PA 5CBKA 4I4CA 5I9IA 4HRYA 4QDUA 3IIIA 5AIAA 2WTMA 1AKNA 4P08A 3X3HA 2WG0A 4AZ3A 1UK7A 3AFIA 4I3FA 4KAFA 5FDFA 2IITA 2JEYA 4QE3A 3OOSA 1LPPA 4DNPA 3AINA 4B80A 4Y9SA 2C4HA 5ALGA 3LCRA 4FTWA 1BRTA 3W06A 3WK7A 3WWOA 5ALRA 2JGKA 4OYLA 3ICWA 4WDQA 2GBFA 3A2NA 1XKLA 4LXGA 3SK0A 5JD5A 3AILA 2ZYIA 1CFJA 5HKBA 4MEBA 2GYWA 1GZ7A 3HYSA 2O7VA 3ZI7A 3R40A 4UBLA 2JGMA 4KE7A 2WHPB 1UOOA 2CBGA 5FLKA 1T2NA 3E0XA 2D5LA 4H7JA 2O7RA 5FV4A 2JF0A 5C8XA 1BU8A 2XMBA 1WHSA 4OPMA 3QYJA 5EHXA 7YASA 1Y7IA 2AXEA 2QJWA 1H2YA 3I2KA 5K3EA 4QDZA 3IUJA 2XUKA 3DNMA 1TKRA 5CW2A 4F0JA 2ZYSA 4WFKA 2W22A 1XRQA 4G4GA 5DNVA 1CUBA 1TK3A 3V48A 3KDAA 4UHEA 1H22A 4FLMA 4FOLA 2XQGA 4M0FA 5E4JA 5K3DA 4I19A 3BE8A 4BBZA 1IZ7A 1XZHA 5CT4A 2QVBA 5CT9A 2PSJA 4D9JA 2HU8A 4BTVA 2WILA 1YA4A 3JW8A 2XLBA 1MX9A 1S8OA 1J1IA 5DNUA 1QIKA 5DYYA 2XUIA 4DMCA 1P0IA 4FBMA 4HXFB 1EDBA 2HU5A 2CKMA 2PU5A 3ILSA 5CH5A 3H19A 1CUIA 4OCZA 4OU5A 3PUIA 5ALMA 1ZICA 1TRHA 1XZCA 5LZ8A 4Q82A 3ESBA 5AIBA 4EY8A 1JKMA 2JGFA 1CUZA 2WQZA 4MQMA 2XLCA 4H7HA 3WKBA 3PFCA 2Z3ZA 3O9VA 4X71A 5AK4A 2C0PA 1K4YA 1O6GA 3C6YA 5ALFA 2BJHA 4DNFA 1AQLA 5D3KA 2ZYRA 1G5FA 2OGZA 2PPLA 3SX4A 3RLIA 4BAUA 1SOMA 1G42A 5LZ2A 4BCCA 4QZVA 1HPLA 2DFPA 4K5QA 5AM4A 2DQYA 5AKHA 4FLFA 2WUEA 4KE6A 3WIBA 2XI4A 3WA6A 1EB9A 3C45A 2I78A 5SYNA 2I3ZA 3V9AA 2OQVA 4LXHA 1QONA 2VA9A 3PI6A 1UXOA 1VKHA 3BF8A 2YH2A 2QS9A 5A62A 1KU6A 4FMPA 2Y1KA 4H77A 4Y2SA 2BGNA 4DMKA 4BVKA 2XMRA 1CIJA 1TCAA 1U65A 3I2HA 5AI9A 3I2GA 3R0VA 2DSNA 3EF3A 4W9RA 1YCDA 2DHEA 2PSDA 1P0QA 3D59A 4X91A 4PSCA 3DDUA 4Y2PA 1JMYA 2CB9A 4W63A 4U2FA 3HJUA 3RARA 2PKYX 4B0PA 3STYA 1R4ZA 1UKBA 4IH9A 1Q0RA 4UFNA 3IUNA 4MQLA 4WDRA 5D7BA 2K2QB 2DHCA 3U0VA 2D0DA 4B82A 4RNCA 3RM3A 3D3NA 1CUYA 5KWJA 4KRXA 3HC7A 4OB6A 1U2EA 1GPKA 5K3AA 3G9UA 2ACEA 2XUOA 2B61A 4H7KA 3C43A 1ZD2P 2XQJA 4L9AA 4FDMA 5IH7A 1JI3A 2OLEA 3CCCA 3ZLTA 1E89A 2WJ4A 1XZFA 3O4JA 5ALZA 3H2JA 3AZQA 3WJ2A 3HACA 1QIMA 3WYNA 2CZQA 1WPXA 3H17A 2HA4A 4Y2TA 1W75A 1LZKA 4AN1A 5EIEA 1CUWA 3WQHA 2EEPA 1X70A 3VJMA 3P2MA 1QGED 1GKLA 5ESRA 4QLAA 4UBMA 3F9CA 4UUQA 5C8VA 1A7UA 3I6ZA 2EDCA 5KREA 5HF9A 4BP8A 4IH4A 4RE5A 3ZWQA 2GBGA 1L7AA 3C5WP 1A88A 3IBTA 3MGAA 3K6KA 4AB1A 4Y2RA 2XMDA 4TVKA 4MWTA 5AI4A 2JGLA 5BV7A 1R88A 1CV2A 2XQIA 2FJPA 2Y6UA 4N8SA 2Y2UA 5LKRA 2PVSA 5EHQA 2I03A 2V97A 1EDEA 2X76A 5FUMA 1E5TA 1VXRA 5AOAA 4X3CA 4C4ZA 3LS2A 3HLKA 3EQ9A 5DLPA 3I2JA 5EI5A 2RI6A 3C70A 1YASA 5ALYA 1ETHA 1XQYA 1QTIA 3A70A 4X90A 1BEZA 2WHRA 1CUFA 2Q0XA 4NS4A 2EDAA 2WIKA 3BL8A 1UKCA 4LXIA 1DX4A 1NU8A 2VJCA 1CR6A 1CUJA 3GFFA 3H18A 3H1BA 1ZIYA 2XUFA 2B4KA 4BAGA 5FP0A 3WL6A 5FKJA 2ZSHA 4J0HA 1GPLA 3HI4A 1HLGA 3UMJA 1E66A 1QOZA 2WFLB 5AP9A 1SFRA 3OURA 3FYUC 3IUQA 1MNAA 4DLNA 5ALNA 5JAUA 5ALWA 3QMVA 4Q3OA 4HVTA 2HA0A 5HCUA 3OPMA 1BEEA 4QEKA 4C89A 3W9BA 4XJVA 4WY5A 1CUUA 5ALDA 3FYUA 4FFWA 5CMLA 4CCWA 4KACA 2J4FA 5AHXA 4TGLA 3O0DA 3VJKA 2XE4A 2XUGA 1ORVA 1ZD3A 4FFVA 2QMQA 4AN0A 3QM1A 1GT6A 2G5TA 5HKAA 1TQHA 1ODTC 3GELA 2X8BA 5EHNA 1OILA 3ZV7A 1EDDA 4UBNA 4BVLA 3K9BA 5ALUA 5ALSA 1IUOA 5BWBA 3T4UA 2C7BA 5AM2A 4HS9A 1VLQA 2AJCA 3QBJA 1USWA 4GHWA 4N8DA 4G5XA 3G8YA 4JUIA 1XLVA 5ALVA 5ISMA 2OGTA 4QLOA 3WWCA 3S2ZA 1J2EA 4N8EA 3FCYA 5AKXA 4B9AA 4PSDA 1M33A 4B7ZA 4YPVA 1VXOA 4GBGA 1ZD4A 3DD5A 1IUNA 2AJBA 1CUXA 4X00A 2HA6A 2BUAA 1EX9A 4G8DA 5KBYA 3ZPXA 5AI5A 4EHBA 4GW3A 1QIIA 5JANA 2XMGA 1WHTA 3IA2A 5DTJA 3HZOA 1EA5A 2Z5GA 2H7XA 1WB5A 4Y2QA 2JIDA 2LIPA 2BCEA 2PSEA 1Q83A 3ESDA 3NWOA 4PV7A 3R3XA 3E1GA 4M0MA 2WU3A 2ZJ6A 1MX5A 5JATA 3SC2A 1AURA 3HABA 2HU7A 2QXUA 3D2AA 4HAIA 2RONA 2WIFA 2OXEA 3OTQA 1VE6A 5AOCA 1QIFA 1AMNA 5E4TA 4B6GA 1H2WA 1ZI9A 4Q05A 1CVLA 5T4EA 2PUJA 4C87A 5C81A 1LPMA 1XLUA 5HQ3A 1C7JA 5JD4A 1QZ3A 4FNMA 1ORWA 2BKLA 3AIOA 4FBLA 1UK6A 3VJLA 2C5GA 2XUAA 4J0GA 2YYSA 1E8NA 3WKDA 3WYDA 1X2EA 2VTVA 3H2KA 4BCBA 3PUHA 4H7DA 1JJBA 3IVMA 2XMSA 1CUGA 4PSUA 3G0CA 5ALXA 5CH8A 3QMWA 2PUHA 4BTLA 4GI1A 4AZ0A 1U4NA 2QOEA 5C7YA 3WWEA 1LPBB 3DLTA 5AK3A 1JU3A 1LNSA 4PW0A 3GA7A 4IH1A 5T4HA 1GPNA 4YK7A 4H35A 1JU4A 3TEJA 3LP5A 1BCRA 3QZUA 2XDWA 5AM1A 1VE7A 4X97A 1PFQA 1XZKA 3FVTA 5EGNA 5AKKA 4ZV9A 1XRRA 2XMCA 1VA5A 1UOPA 4HXEB 2ES4A 3QPAA 2VAVA 4BAZA 3VISA 4GECA 5HK8A 2WTNA 1XZGA 1EK2A 1WCYA 4UHCA 5HZGA 3WIOA 1BE0A 1UZAA 1MAAA 1WOMA 1F8UA 3V1KA 4Q34A 5LLSA 2XQKA 4QNNA 1R1DA 1FFDA 5FXMA 2OCIA 3G0IA 4JYPA 2AJDA 5AKZA 3CXUA 1LBTA 4KAJA 4HRXA 1XZJA 1TAHA 5LYYA 4DNOA 4X6UA 4G4JA 4LKOA 4EB0A 3EQ7A 2VSQA 3HRHA 4P93A 1QIJA 5ALHA 4C6HA 3DKRA 3R3UA 2O2HA 1FFEA 3EQ8A 1VOTA 4OD0A 3BF7A 4K6KA 5AH0A 2ZVDA 1N5MA 1ZIXA 2HHAA 5FPQA 1DX6A 4IHAA 1E8DA 3L1JA 3FCXA 4PO3X 1A8SA 4B9EA 3CCBA 3BJRA 5E2IA 3A2LA 1H23A 1Z68A 4QDOA 5DNWA 3G9ZA 5JZ9A 4N5HX 1YS2X 4UBKA 5J3JA 4GDMA 2DCMA 5C8ZA 1EHYA 1UWCA 1R9NA 1QFSA 1O6FA 2WFZA 3ANSA 3NOXA 5LZ5A 4BP9A 3M3DA 2RAUA 3AIKA 6YASA 2H7CA 1DQZA 2HRRA 4ARBA 5HK9A 3VVMA 5AI8A 5AM3A 1WPRA 5AI6A 3VXKA 1AGYA 4UBJA 4ZWNA 4AMYA 2C0QA 1XLWA 2QUBA 4KEAA 4Y2YA 1OCEA 2E3JA 3D5EA 3WZLA 5JAHA 2QXTA 1FFCA 3C87A 1JMKC 5AI0A 4MYDA 2GZRA 4FLEA 1FJ2A 4DYHA 3YASA 1JJFA 4LYEA 1MTZA 5JALA 5ALEA 4UHDA 4DNQA 3M81A 3FYUB 4MXDA 4E14A 1A8QA 2XQFA 2J4CA 3R41A 4HXGA 1GKKA 3D2CA 4OYYA 5AKYA 4AXBA 2VT6A 1DT5A 2VF2A 4UHFA 5JYCA 3H1AA 1DINA 5ALKA 1K6EA 4G9EA 3L1IA 1J06A 3FYTA 2HM7A 5ALQA 3FBWA 4WCVA 3V1NA 1FFBA 3JWEA 3WJ1A 4X95A 4F21A 2ACKA 4OB8A 5CURA 3O4HA 4DM7A 4BDTA 4HTAA 5DWDA 2WIJA 5A7GA 5CXUA 1ZD5A 1T4MA 5AKJA 2X5XA 5IVDA 3H2GA 5EHZA 1IVYA 3DEAA 4O08A 3O95A 4X6XA 1LPNA 3A6ZA 1I6WA 3I2IA 1CQZA 5YASA 2QZPA 4EBBA 2HA7A 4DMHA 3OC0A 3KWFA 1R50A 3BIXA 4DGQA 3STWA 5AOBA 2WUFA 2XUJA 4FKBA 1P0PA 4B81A 1RYYA 2WIGA 4MEAA 1WB6A 1YS1X 4C4XA 1QTRA 3GUUA 2JGEA 3WI7A 2DR0A 4L0CA 2RGUA 2NW6A 4ETWA 4XX1A 4UHHA 1XZMA 2WM2A 3WWDA 1GQRA 4CCYB 4QWMA 4DSAA 3BWXA 1YA8A 2GYUA 1AZWA 3PF9A 4G8CA 2P8SA 3HSSA 3DL7A 2PX6A 1CQWA 3WKEA 1BN6A 5K5EA 3L1HA 4KR0A 2WJ6A 3ED1A 4DIUA 5JASA 1XQWA 1UFOA 4BATA 2WUDA 5HF8A 1F0PA 4FHZA 3R3YA 1Q0ZA 5EFZA 3I28A 1CUVA 4QDXA 2Z3WA 1XZDA 4UFPA 5HQ3B 1IUPA 4FNGA 4X93A 3GROA 5LIPA 3O4IA 2VJBA 5CT8A 3M83A 5BOVA 3ZLUA 4S0XA 1J07A 1ZJ5A 2OAGA 5FPPA 3F8SA 1EK1A 3STTA 4H0CA 1B41A 3GZJA 1QIGA 5FRDA 5F4ZA 5LZ9A 2JEZA 1JT2A 3PICA 4BC0A 1SCIA 3D0KA 1QE3A 3QH4A 2YASA 2CMFA 5LZ7A 4X92A 4BYMA 1MPXA 5HF5A 4JNCA 1H2XA 1CUEA 3G0BA 4RPCA 2VQ6A 3FLEA 2VATA 2Z8ZA 3RK4A 1SCQA 1EH5A 3RKSA 3WK9A 2HDWA 2BUCA 2JBWA 3WLAA 2OG1A 3BJMA 5LP1A 4CFSA 1H2ZA 4G1FA 2C58A 3ESCA 5FOQA 3UUFA 2XUPA 4A16A 3H2IA 4AMZA 4OB7A 5AM0A 1VZ3A 3DOHA 1MAHA 1HQDA 3PF8A 5IVIA 5DTIA 1CUSA 5ALOA 4E15A 1CUHA 3C5VA 5D6OA 1R3DA 3C8HA 1TCCA 4ZGBA 1UKAA 2QT9A 3QITA 2GBCA 4GLBA 3WMRA 2Y2VA 2H7YA 4H7IA 3B5EA 4Y2VA 4BE4A 3IUMA 5K3BA 4Q1VA 1E3QA 4NMWA 2OQIA 1GGVA 4CIAA 4P9NA 3BDIA 4J0CA 3ESAA 1C7IA 2ECFA 2J3DA 4J0JA 3Q0TA 3AIMA 4X94A 1RP1A 5AO9A 2WUGA 3I2FA 1X2BA 1DTEA 3FVRA 4F60A 3HXKA 1CUDA 2HA3A 4Z49A 1KEZA 3MUNA 5JD6A 3OG9A 1CPYA 3H2HA 4G9GA 1K8QA 3D7RA 1HKHA 1FFAA 5K3FA 1HBJA 4PF1A 4KJXA 4OSEA 2R11A 3FWHA 4W1QA 3BDVA 3G02A 1DWPA 4AQDA 2OCGA 3TJMA 3WKAA 2XUDA 4WY8A 1F6WA 4U2EA 1ODCA 1LZLA 2GYVA 1ZGCA 3FSGA 3W05A 3LLCA 4GWLA 4WFIA 3FOBA 2Z8XA 3A2MA 2J3QA 2BGRA 1BROA 5HF6A 1BCSA 3HEAA 4IQ4A 3N2ZB 2H1IA 2O2GA 5AJHA 1ISPA 1R9MA 3TGLA 4EY7A 5EIAA 2XT0A 4QA9A 1PV1A 2WU4A 1NU6A 2HIHA 5JZBA 3C6XA 1XZLA 4F5ZA 2DQZA 2WFMA 2QRUA 1QIDA 1W1IA 3WA7A 2ZYHA 3O9MA 3CN9A 4BVJA 1PJAA 2OCKA 1XZEA 3AZPA 3PDCA 4K6GA 1HL7A 1XRLA 5A7FA 3LIIA 5IVHA 3I6YA 2WIDA 2OAEA 2PU7A 1XZBA 3F96A 3DYIA 5JARA 1YAHA 2WG1A 5CT6A 4UHBA 4C4YA 1L7QA 4JYMA 2XMQA 4LYDA 3H04A 2ZJ7A 2B20A 4DTCA 1QO9A 2QTBA 4EY6A 5H3HA 3FLBA 2FX5A 4XIIA 5DYWA 3WWPA 4C88A 1W4LA 1DWQA 3WK4A 2XUQA 1VA4A 3STUA 3G0GA 5JIBA 3E4DA 3WL8A 4UBIA 3ANTA 4M0EA 4EA6A 4BB0A 3DYVA 3LIPA 4J7AA 1Q84A 5CH3A 4IO0A 2WFLA 3VVLA 2QM0A 3G9TA 4KYVA 1G66A 5AKGA 4J0IA 1CLEA 2RHTA 4CG2A 4EY4A 2Y6VA 3B3QA 3AZOA 1XKTA 1DQYA 1L7RA 1XROA 1IZ8A 1XZAA 4J0DA 3WL7A 1MJ5A 4J3JA 1FSSA 3O4GA 2O2IA 1VJ5A 1ZOIA 1EVQA 5A6VA 3WK5A 1QJ4A 1LGYA 1ACJA 4OUKX 4AO7A 2G5PA 2PSHA 4QWWA 2H9YA 1MNQA 1LPSA 5D3ZA 1W76A 4H7FA 1LBSA 3EBLA 1AUOA 2RHWA 2XMZA 3R3VA 3WZMA 4UFOA 4Q3LA 4J03A 4E11A 3IULA 4N5IX 2PBLA 4LHEA 4AX4A 2HADA 1KU0A 1B6GA 1EB8A 3W04A 3SWWA 1QIHA 1F0NA 1AX9A 1ODSA 1WM1A 3E3AA 5IVKA 2BAGA 1THTA 3FLAA 4BZWA 4P92A 5AKIA 4MYSA 1CUCA 4ZRDA 1G4HA 1JJIA 1MX1A 1YB7A 1WB4A 1LLFA 1UT6A 3K2IA 3OM8A 4H7EA 2XB6A 4Y2XA 4CIBA 4J0KA 3DOIA 4K6HA 3NUZA 4LIPD 4WJLA 3KXPA 3C8DA 3I6MA 1LPAB 4KE9A 4Q3KA 1QLWA 4X6YA 5AKEA 1JFRA 3C6ZA 3PFBA 1UOQA 3G0DA 4XWGA 3QVMA 5EIHA
chains in the Genus database with same CATH superfamily
4M8SA 5I8PA 2C59A 1SU6A 4RQBA 2IEIA 1I5EA 1KO4A 3O2SB 4NJEA 5AKLA 3VTAA 3X44A 1V35A 3LDUA 3IMFA 2PV7A 1LQUA 4V39A 5T4FA 3JASA 5HVNA 3NYRA 2HLHA 2PSFA 3OJLA 3KSDO 5A7HA 5CLJA 1N7IA 1JH8A 1P7CA 2F9LA 2IIPA 1J97A 1QZTA 4FINA 3Q87B 4FT2A 1Q17A 3SVZA 1MN6A 1XKXA 5IJZA 1WV0A 4D56A 1C4KA 1VRCA 5EE1A 2Q8PA 3EH1A 4R8SA 1W36B 3VYUB 3RVQA 2PUAA 3R5XA 9GPBA 1Y82A 1EK0A 1ZI8A 2RH8A 4MVJG 3I01A 3KE9A 2G5GX 1FU7A 3GBSA 2Y8EA 4FP9A 3JZMA 3KSUA 2P3LA 3R7LA 4GVLA 5EP2A 5AM5A 1HRKA 2TSYB 3PDIA 4PE5B 1OW3B 3VDQA 3O47A 3G5MA 4RIGA 4URHA 5DSTA 3F97A 4JH0A 2A5YB 3BWYA 3K6SA 1L5MA 2A14A 3P9XA 4L57A 5TSDA 5TGTA 1MU0A 3N6XA 4Q15A 1Z5OA 3S70A 1D1QA 2O5CA 1HOTA 2ATCA 2G77B 2H0QA 4WNIA 1Q92A 1ZOLA 2Q3DA 3WKCA 3TH5A 3IKVA 5IC5A 4ZJYA 3F74A 3H2YA 1VG0B 1Y37A 1RRMA 4X85A 3IV6A 4PCLA 5SV2A 5ICMA 3P20A 1HMPA 3QWBA 5CU7A 2DJ5A 2GARA 2WHPA 3SG0A 2VDNB 4E2ZA 4MJ3A 4AF6A 3MTDA 3QA9A 3SC4A 1ZNZA 2DFVA 2QR5A 3MUOA 3G2IA 4BMSA 1AO3A 1CDDA 3KEOA 5IUJC 1K6IA 3K15A 2XNHA 2O6HA 3Q8XB 3DR3A 2W6PA 2DH6A 2CJWB 3K6JA 4G1VA 4JVSB 4Y2UA 5A4IS 1IY2A 1RACA 4LJRA 3HYLA 2YINC 4JXKA 4LZPA 4PQEA 4DA4A 3T41A 1WW2A 2BISA 3RSOA 2ICAA 3KD2A 1ILEA 4Z51A 4RNDB 3BBPA 1V1JA 4H4DA 3M6IA 4EGSA 4D7AA 1VCOA 1M8GA 2A1UA 4J90A 2W6NA 5AJWA 2UUPA 3N2IA 2JIPA 3ENKA 1CSEE 4ZQFA 4YQEA 1AKEA 2OY0A 1KIFA 4QRDA 1K7FB 5JD3A 1V6CA 1H69A 1ORIA 2R1VB 3ZHTA 4DA9A 4F06A 3GLIA 3UC5A 1RXWA 4CL2A 3T1QA 3RFXA 2BGIA 1L7MA 1XRPA 2OLJA 1PQYA 2UZ0A 2D0OB 2B4TO 4YXFA 1N25A 5AICA 1Z3IX 1JDPA 3OZ7A 1XUOA 2IU4A 2N46A 2WWGA 3HR4A 4WXHA 2VCHA 4EAQA 2WNHA 3I0NA 5DPMA 2GKGA 1X74A 3GJ8A 4IDCA 5HFAA 3SY8A 5ALJA 1IVNA 3VKGA 1EXWA 5F76A 5TPWB 5FWYB 3A05A 5H70A 3AOGA 2CCKA 2Z4RA 3EMBA 1WTCA 2V96A 5KHLB 2XD4A 4WZAE 5M3BA 2RHBA 3EGIA 3BFKA 1TEHA 4C04A 4EJ6A 2VJMA 1FP4B 1SY7A 4R2IA 3QXGA 2WM9B 4EG0A 1Y1KE 2O1XA 3HEBA 4GM1A 1NUAA 1IHOA 4EZIA 1ZINA 4CQJA 1SHTX 2H1VA 3FF4A 5JSHA 1XR3A 2CVFA 4C6TB 2AIRA 1UBNA 2XVYA 3KHTA 3Q5DA 2B25A 4CI0B 4Y1GA 1DKLA 2ZSIA 1Q14A 3R20A 2CNLA 3L8EA 4QPNA 1IM8A 1F14A 4ID3A 4KSCA 3ZWWA 1GPBA 4ROTA 2QTCA 2V9ZA 1I1QB 1YFZA 1L5NA 2Q5IA 1B76A 1UJ5A 2AFHA 2B6NA 4B4OA 2DHDA 3N8NA 4GP7A 5HCNA 1JVSA 3LY5A 1QV6A 3L07A 3PPYA 5CG2A 4LYJA 1ZJ6A 1XL1A 2ZYGA 4KPUB 4QPJC 3URMA 1ZCZA 3EX7C 2O8DA 4P84A 2OZLA 3LX5A 1U6IA 4PZPA 2OB2A 3INTA 1V43A 3A4YA 1Z0DA 2CJPA 4NFYA 3TKAA 2IW1A 2GJKA 3KVOA 4FQ8A 4L85A 1EVEA 3CR3C 5TB5A 1A76A 4I1SA 3NVAA 2NAPA 1MJGM 1T36B 4J75A 4XWKA 1EFPB 4PZCA 5JNSA 3LQ4A 4UULA 3G2LA 4MUNA 4EUFA 2IYRA 2Y27A 3HA7A 2CZGA 2BGLA 3PYMA 4YO8A 3U1TA 2P9QA 1VLZA 1K3FA 1NA5A 3PEYA 4TQUS 1W52X 4CG3A 4PCUA 4YJFB 2ZTSA 4F4HA 3GARA 4J7UA 4QAQA 5KB3A 4ND3A 3E84A 3PGJA 1SHUX 4UPVA 3SI7A 3T12A 2D4HA 1KEKA 3FJ1A 1QCZA 2HRCA 1Y8ZA 3NOQA 5F78A 2H8GA 2WF7A 3BRWA 4JD5A 4PIMA 3GWGA 4RMGA 1OLUA 1J6UA 2P6PA 4X1IB 3L7KA 4Q16A 5EYPA 3QRWA 1VIMA 2BP7B 1ZA1A 1QYVA 3GUHA 4PAOA 1W5TA 4B2YA 4QBGB 4IJ5A 3A2KA 3VKWA 2QR3A 4LMAA 5CA0B 3NV7A 1C80A 4MP8A 3QU2A 5EJFA 1ICIA 3SZGA 5KX5F 3N75A 4JU8A 1E8MA 4RGYA 5B1SA 1JXMA 2OHFA 2QW8A 3GC6A 4JJKA 2VAXA 1G291 3BPSA 1UAYA 2GPSA 3GAMA 4ON9A 4K9OA 3LCJA 4P0PB 4YVFA 2BONA 2ANBA 1XN4A 1Z4JA 1FFXA 4YWJA 4D0SA 1TIBA 3SU8A 2NVWA 1BCRB 5KDOA 3I4FA 1Q0SA 1PHPA 2R6GA 4OBXA 4D4MA 1EK5A 4XDYA 4O0LA 3GV0A 5B30A 1K3UB 3D7KA 3PDUA 2YZNA 5TV2A 4JEUA 3L41A 4MW2A 1LTQA 1JECA 2YDYA 1WXQA 1KI1A 3C1AA 3NAZA 4G8BA 1DZIA 3CW9A 4QDTA 1YS4A 5BNIA 2PR7A 4CKZA 1LRLA 2X1LA 1TDJA 4GLJA 5L4NA 2G4VA 4FSDA 4FI3C 4RWEA 3CX7A 5DHRA 3SKVA 4MWSA 4DJAA 3E7PA 3S8MA 2IH2A 1D6MA 3Q8WA 2R65A 4L02A 3AH8A 4L5CA 2YVLA 1SVUA 2EQBA 4UDOA 1C7ZA 2JJYA 4XX0A 1VZ2A 4HATA 5FLXA 3U7GA 2P0YA 2HA2A 4FOOA 5KCZA 3EGDA 1S1MA 4Z3DA 3RF7A 1NW3A 1SPXA 1ULSA 5E9AA 5L3VA 2IC5A 2YFYA 1WZNA 1B00A 2FG6C 3GGGA 4QGHA 5IXJA 3DE7X 1FPMA 2CZCA 4ZDJA 3QQ5A 1OXVA 4X44A 2C9ZA 5G4LA 3IAS6 3WQSB 4EITA 3ICVA 4R7ZA 4GOND 4W82A 5IN5A 3KXDA 3OPYA 1APBA 4ZOAA 1OV6A 2GPBA 4RD6A 1U8UA 2P77A 2X4DA 3EXG1 2JL1A 3RJTA 2GCEA 3JQCA 4CEIB 4XSVA 4RE6A 1FNBA 2PGJA 4M0PA 4BE9A 1LSJA 3DCNA 3E70C 3H16A 3HADA 3WGOA 5KKAA 4MUFA 3KETA 4GU5A 4PO1A 5L6LB 3D6JA 4A36A 1MT3A 2C5FA 2A88A 3FAKA 4UU8A 5IXYA 2VO1A 1QHIA 1LD3A 4XFDA 3N6VA 3FTFA 1SG6A 3UMSA 5JECA 1NHGA 4FWBA 1MO2A 1SCKA 5FFMA 3LU1A 4Z6KA 5ARBA 3GLGB 2NUAB 3AVXA 2GZHA 2WAXA 3ZYZA 2XDQB 2YWXA 2FHPA 1IXKA 2D5IA 3TRDA 1PK8A 2NYUA 2EP5A 4GKAA 4URFA 1KK0A 2AQIA 2VT7A 4EHJA 1BH2A 1E5QA 2QRVB 4GEGA 5EJ6A 5IFLA 2MMGA 2CC2A 4ZO7A 3GG9A 3HXLA 3AHEA 1JLLB 5T8KC 5AW7A 1TVMA 4IHJF 1R9GA 4H4CA 3UWOA 2RGCA 4YMWA 4O4HA 5JAPA 3MRXA 2MTBA 5K0EA 1GTSA 2DTEA 1P39A 3TLCA 1J24A 2RJNA 3PIRA 1GQSA 3M6XA 4KXMA 3NR2A 1DC5A 1HWYA 4XOUA 1U2SA 1VIAA 1KVRA 2Z2JA 3C6MA 4QYSA 4TMZA 4Y1RB 3ZWXA 1KE1A 1IOWA 3N76A 5DI3B 3ZWNA 1Z2AA 4Z3KA 3UXMA 3IDSA 2XWJI 3OOEA 4EENA 4G0OA 3O92A 2I1QA 1OFVA 2NQTA 3LKZA 1R0RE 2DHQA 2JGIA 4ALNA 4WOBA 4ER7A 1RFLA 2QRPA 5EESA 3MN1A 2OLKA 2WSLA 3BAFA 3JYOA 1ZLXA 4Q4DA 5T8KA 3PE6A 4R9RA 4PBTA 2QSJA 3UA3A 5CT5A 2GBIA 5JYEA 1QVWA 4U2DA 1WY7A 5JMWA 2DB3A 3GRYA 3GGCA 2H4YA 2A1TS 5ERXA 3ZV4A 4TRMA 4CKBB 1VLLA 1NVEA 1X77A 1EIZA 4XPIB 1DKUA 2HQ1A 2ZIWB 4QJ3A 3GHYA 4PZ0A 1DU4A 4LK2A 3LYHA 3S2FA 1I3LA 3A1TA 4XPZA 1SR8A 1VJRA 1P1FA 2IDMA 1EIWA 5A0TA 1I4DD 1P7ZA 5EXDA 3W2TA 2QNRA 3BMNA 5K0FA 1Z2CA 1UEIA 4XYGA 5SY9A 4E46A 3CLUD 3NTVA 3UHPA 1EZZA 4QXPA 2PBFA 4U7HA 2PG3A 1P2GA 3MCVA 1VLMA 5EXTA 4XH9B 3SSOA 4COOA 4ZZ3A 4OA5A 4V24A 2ISQA 2X5OA 4G6ZA 3IYLW 2WTXA 1XJ5A 2QBYA 1WE2A 4ZK6A 1KPIA 1NQTA 3DFZA 1Z73A 4F72A 1QHHA 4LC0A 2G4LA 4Q9DA 4R5MA 4G4IA 2BFNA 1OPXA 3RTBA 2G7ZA 5E8JA 5JCPA 1PJ2A 4LHYA 3GRPA 4MKFA 1OBFO 4CDRA 2BGKA 1X1TA 1QHYA 3LBFA 4U7PB 3VR5H 3DZFA 2CNNA 1KZ1A 3K0BA 1C8KA 1YDEA 3DEIA 3F4LA 3ML1A 3GGSA 4P4SB 2NZ8A 4U9HS 5A71A 3WK8A 3H42B 4ENSA 1XMXA 1WNFA 3CINA 2H4WA 2QQFA 1W5SA 3Q7IA 3B85A 1F0KA 3GCDA 3WV4A 2H5EA 4I4CA 5BOSA 4Y2GA 2ZQ5A 3ETDA 4BO4A 4HRYA 4AZVA 5C31A 3NH6A 3UFXB 4D79A 1H2RS 4QDUA 4A6DA 3A04A 1RVV1 1E2PA 1X15A 3KHUA 2DFKB 1Z75A 1QVVA 5D85A 1AG9A 1NDHA 3FBTA 4UTXA 2ST1A 5JYBA 3IP3A 4NHEA 1ZPDA 4L8LA 5IBQA 1EP9A 3DDCA 4KAFA 3N7UA 5EHGA 5FDFA 4Q3AA 3HFRA 1UF9A 1D2MA 1IEVA 1V3UA 2IITA 2JCSA 5DTRA 4Z0TA 1XTSA 4F2HA 1ZQ9A 2ORVA 4PTZA 4RHFA 1DV1A 5JO9A 3UF0A 3NO4A 2VPXA 4MPPA 1ENOA 3WY9A 2PS3A 3HGQA 4Y9SA 2RI1A 1AY0A 2EFCB 2H2AA 2OZPA 4KFUA 3RYFA 1PDWA 2Y4NA 4ZOBA 1T6ZA 4DBVO 3H65A 1N2EA 2N3ZA 4HNSA 1GHTA 1BRTA 3JVDA 2Q4TA 3DDZX 3DTVD 2ZRBA 4JC8A 1MRSA 5LQSA 2HMAA 2PKQP 4OXYA 5ALRA 5E9JA 3VU9A 1GUYA 1UBHS 1ZOPA 2J9GA 2AX3A 3ETCA 4G63A 1XEXA 4RHUA 1VHDA 2LCFA 3RS3A 3KFLA 2Q1SA 1I24A 5GM2A 3ZWOA 4R9NA 3KUUA 3L0PA 4O2BA 2JI6A 4B2PA 4C07A 4WNYA 1S3SA 3S6JA 4LXGA 5KWSA 1IJKA 2PHZA 4TLMB 3SK0A 3QU4A 4HP8A 4E2WA 2VYCA 1CFJA 2G9QA 2CVOA 3R7NA 2M6SA 3R5TA 2B8EA 1RS0A 3ES9A 4FHGA 2QE6A 4XCVA 3A26A 3K09C 4MS1B 3ZHVA 3V4RA 1PWHA 3FIJA 3CUEF 2RK4A 3KYIB 3MWEB 1GZ7A 2R7KA 4NV0A 2YY7A 4HGQA 3SEFA 4BPRA 3VC1A 3A4TA 1FXWF 5L4SA 4KE7A 4UUBA 4IWYA 5TY0A 3V9PA 3A3OA 4NK4A 1UOOA 4N0EA 3W8DA 5CDGA 1JIIA 4DKJA 2YMPA 1E64A 2Q3EA 1YJ5A 1J7KA 2VHTA 1FMJA 2YJ4A 4WJZA 4AF7A 5D84A 5JXJA 2JLVA 3CLTD 2X6TA 4YUWA 2W70A 1N6OA 5DK6A 3E5MA 2AI3A 3KYJB 4AG3A 3AHHA 3O90A 3ROEA 1L8AA 2D5LA 1TADA 3E0XA 4H7JA 3GG2A 2GXSA 5C3MA 4OMFG 5DZSA 3IJPA 1U2RA 2O2JA 3H3JA 4FR2A 4HHEA 4NK5A 4DUGD 5C8XA 3WMGA 2HMVA 3GA0A 3TR6A 2ZBPA 1XFAA 2WHXA 3N2YA 2HJGA 2A84A 4CMGA 8ADHA 2NUBA 2Z5LA 2XMBA 3N7TA 4L7QA 4QXMA 1T25A 4D9BA 5JJCA 3N58A 4V0KA 1VCHA 3V34A 3AVVA 1IRIA 1XTQA 4K40A 3H3FA 4YHBA 2D1YA 3I3SR 3V55A 3NYIA 4EX6A 1HQYE 1YACA 1H2YA 2IHYA 4L8VA 4UCXA 5K3EA 1ODIA 2BLLA 3JALA 4O25A 2HJWA 5ERGB 4HUQB 3RRZA 2A35A 3ZCVA 2CLSA 4B6JA 5EJ5A 2UXBB 2ZYSA 1AKTA 2GZDA 2WWWA 4WFKA 5AVVA 3U16A 1XRQA 1SUDA 3FPKA 2QX4A 2MWMA 2H1CA 2J85A 3D81A 2H1LA 4G1BA 5DNVA 3DF9A 2PUDA 3SBDA 2V58A 1ZITA 2BCGY 3OF2A 3RAGA 1YMUA 4YJ2B 2IXFA 1PDOA 5ENVA 1QTNA 1TEVA 1UXIA 1U8YA 2JA2A 2FR8C 1V9CA 4QD3A 2JJ2A 3ZHSA 4TZKA 3KDAA 4NS1A 4HWKA 4PS1A 4XSGA 2G8NA 3MJ4A 4PYNA 2GM4A 1J8VA 2HWXA 1XKQA 1HE2A 1N7HA 1U9IC 4FOLA 4DA7A 1IH8A 4RSMA 3DLBA 2FUG1 4I19A 4EI2A 3BE8A 4HSGA 4BBZA 1IZ7A 3F7MA 3VSBA 2XGMA 4JSYA 1ZJWA 2WFAA 4MLZA 5CT4A 4DABA 5TQ2B 4GVXA 5K1ZA 5EMMA 1EVYA 1UMBA 3R9XB 2Q3JA 3GD5A 1OR8A 2MSEB 3VZRA 2ZDHA 5F98A 4UDNA 2ZEJA 4EI9A 3OU6A 4P7GA 2X5JO 2IHJA 3TXYA 2C2OA 1ZC3A 1YA4A 1NJSA 2WILA 3GUCA 2XLBA 5THQA 3AFNA 3QFHA 4OUDA 4Z1MA 4GZMA 2JH9A 1LRKA 3T7JA 2FR8A 4PX9A 3C5HA 3SHVA 3RS7A 4RVOA 1IJFA 1L4GA 1KDTA 3HMQA 1NXXA 4DMCA 4JC0A 1P0IA 4J0QA 3ETHA 1U9IA 3QOFA 3GT4A 3AFMA 3E8XA 1EDBA 3MMSA 3ZH9B 4YYZA 5DCLA 3A25A 3BTOA 1QFJA 1VE1A 2PU5A 3AERA 2I2BA 5CH5A 3H19A 4OCZA 4OU5A 4YT8A 2IE0A 5EIBD 1J70A 2PRZA 4DSTA 1GPH1 1SMKA 2A0WA 4NTZA 4ZOQI 5JCJD 3HYRA 3KX2A 2RBKA 3SBEA 3W2EA 2DETA 4NOMA 1E4YA 1QXSA 1W30A 4GM4A 1JKMA 5KHAA 4EY8A 1IJEA 1CUZA 2WQZA 2N75A 4NDNE 1EG7A 3RTGA 3GLFA 5EXSA 4OQMA 4BRUA 5KTKA 3S2GA 4IP0A 1JA9A 1C3OB 1KS9A 1YT5A 3I1FA 3VYTB 2Q3LA 2Z56A 4GI5A 3A6PC 2EOAA 2Z3ZA 1DFHA 1ZUHA 5AK4A 2FGKA 1K4YA 2PH3A 4M9UA 3T3IA 4OFWA 4Q6WA 2UUAB 3AEZA 4WADA 3MMPA 4Y6QA 4N3NA 5KYWA 2OMEA 2BJHA 2IZ5A 4KUEA 1AKVA 5FUWA 4IOJA 1EGHA 4OGFA 2SKDA 1YUBA 3OJFA 4TXMA 1E4EB 4EB8A 1W59A 1LJ8A 3RLIA 4BAUA 2IYSA 2LDBA 5D2CA 2ZTVA 2BM1A 4W7IA 3EUAA 4CU5A 2V59A 5I7EA 1OYVA 3L7IA 3NEPX 2WYVA 4D6XA 4QZVA 1U9ZA 3KEMA 5AM4A 2R1TA 4WZAB 2E4WA 2A57A 2MDTA 5FUQA 4FLFA 4Q1EA 2DVMA 3FFTA 1DPGA 1FA9A 5LCXA 4QTYA 4G5FA 1RAHA 2BGTA 3ABZA 4DBLE 3PQFA 1KKLA 4FB4A 4RXTA 4Q24A 5TT0A 4N40A 1RXIA 3K9QO 2P9CA 2ZWMA 4CMJA 1F2DA 1N6IA 1OV4A 1P4JA 3M34A 3NONA 4MPJA 3VPSA 3NEAA 3A4NA 1XOIA 4ACAA 1GYPA 5IT0A 4TKMA 4XQCA 3A1WA 2VJQA 4LN1A 3INGA 4GBMA 2CK3A 3GP5A 1NE2A 1OI2A 1ZFNA 4NH0A 4DEVA 5AW8A 3AJRA 3PR3A 3ZCXA 3PI6A 4BX3A 1C50A 2SCUB 1ILWA 3FTQA 1XPRA 1DDIA 1ZIPA 1F9AA 2QS9A 2VHXA 3FVWA 3WGLA 2IPXA 3C4JA 2IH4A 2GB4A 1OFGA 4A8JA 4YONB 4ZANA 4ZAZA 4YRSA 3IRVA 1FXSA 1TJ3A 2FPKA 5DHFA 4URWR 3FETA 1UEXC 2ZT8A 3I34X 2CNWA 2P3OA 2MYPA 2BGNA 4HNQA 4CMAA 3T4PA 1UM8A 3BTSA 3BWCA 5LJIA 4DMKA 5JBQA 3FRHA 2A0XA 5JMOA 1QHSA 2PS9A 1KI7A 2XMRA 1GUFA 4LJ7A 3ACCA 2IX3A 2VDVE 3HKDB 1QMPA 1V48A 4NRDA 4E22A 2QL5A 3ZZ0A 3I2HA 4KGZA 3R0VA 1HFWA 4J3FA 4NCHA 4ZU6X 4NENB 2DSNA 1QOQB 4B48A 4XVHA 5GZ6A 4YRMA 3PJRA 4ENRA 3C4VA 2AE2A 1O0CA 1ENZA 2ZVJA 4PSCA 3TPCA 5BV8A 2WVGA 4ZRMA 4ZDWA 4CF4A 4Y6RA 2BH2A 2NXEA 3U7HB 1NQXA 4RSHA 4RPHA 2CB9A 3B1FA 1SWVA 1RBMA 1U0TA 4W63A 4HGPA 1II8B 3MILA 3JQGA 1H85A 4HQLA 4MVJI 3WBKA 2ZCJA 2F00A 2GTIA 3I30X 1U8XX 1SHJA 5HA5A 1TQ6A 2FEXA 2JB9A 2G5CA 2RHGB 1D5WA 3C3YA 3DXFA 1YD7A 2UVPB 2OK7A 3IKJA 3OJOA 4EA9A 2AG6A 3STYA 3JWIA 1CQJB 4QYXA 1JEJA 3H86A 3KSAC 1R4ZA 3OKPA 4BOYA 3L7AA 1WB9A 3DOUA 1U0NA 1CHDA 2Q0SA 3LDAA 4UFNA 2RC6A 1KP9A 1YIOA 2VF5X 4K3UA 2OBXA 2VH1A 4MQLA 2ZRCA 3U0VA 3C1OA 3HBFA 1FZQA 4LDZA 5FI0B 4BNIA 3RTAA 4DTIA 1AQIA 2XJ9A 621PA 1CUYA 1QFZA 2G76A 5JQGA 5KWJA 1HTTA 3E7FA 4OF4A 5HJEA 3MCWA 1IHUA 2VDJA 2VK4A 3AESB 3PE3A 1G21A 4KMRA 4OK3A 1UAGA 3DDHA 4R9VA 1LI4A 3IR7A 4R84A 4TYPA 3PHBE 2FAXA 4HX2A 4ZTBA 1QHEA 1RAEA 2BM9A 2FEKA 1GPKA 2PX4A 1A9XB 5K3AA 3ZBTA 3G9UA 3OTIA 2PZGA 4XYLA 4ZCPA 4TWJA 3WLPA 4ZJUA 2W98A 4IILA 3IUEA 3ISTA 3LUJA 2HSJA 3JQAD 4RMJA 3V4VB 5B4VA 4MB0A 1AO0A 1P31A 3GDWA 1NXWA 3ODGA 1YIDA 3EEBA 2CXPA 2XUOA 4H7KA 4HWGA 3ZXIA 1NQVA 2RHRA 4O4LA 4RZ2A 2ZBDA 5IAKA 2BHTA 2IFTA 2QQ0A 1ZD2P 4TVSA 4L9AA 5D3MA 5BW4A 3Q5EA 5L40A 2HWWA 4CRWB 5IAAA 1AHPA 2WJ4A 2A0UA 4B87A 1KI2A 3L7CA 1V7ZA 5AUOB 5A3VA 2E1PA 1H9AA 2AKAB 3PFNA 1CYDA 3K0FA 3JQEA 4KHZA 3OZSA 3WI7A 4KZPA 3PTAA 3ZGVA 1G8AA 3IAUA 1V9LA 3MTGA 5J5VA 4NV3A 2E1RA 4A15A 1B6RA 2LDXA 3AI3A 3IT2A 3E2PA 4X8LA 3GJ0A 3A1EA 2HA4A 5EIEA 4A0GA 4PC6A 4AN1A 1AXEA 3HFSA 2MOKA 1QU2A 4K46A 2XGJA 4PLPA 1F1BA 2FSVC 3K2QA 3UTCA 2EEPA 1VG1A 1T8SA 4QXQA 3WQHA 5BSRA 3CUYA 4F84A 3C97A 4YGYA 3WDMA 1QGED 4HVLA 3V8VA 4N5MA 5ESRA 5JSYA 1NBWB 4QLAA 1TEZA 4UKDA 2FDXA 4ZC1A 3V8QA 1XP5A 3CPHA 5AJTA 3G88A 2OCPA 1A7UA 3KSMA 2W2QA 4Q7EA 1M2KA 1MC8A 3ANNA 4PBRA 5ICFA 1Q3HA 2GK7A 1IXRC 3B7WA 2JZNA 5CNJA 1TIKA 2OHXA 4MARA 1S6YA 4Q3DA 5CA0F 2QN9A 4M1YA 3DQPA 1A88A 3IBTA 4FEAA 2FSVA 2PGNA 3OH8A 4F92B 3U5TA 4Z4GA 4BLQA 2V4MA 1KYXA 4LY6A 3O84A 2POQX 3K1AB 3TJZA 2HWKA 4AB1A 5HMMA 3NKVA 1YS6A 3FB4A 2Z0MA 3A6GA 3DLIA 2JIZD 1C8BA 3B6EA 1P2DA 1JAZA 1R5BA 2ZK7A 3BWEA 1ZGHA 2I8CA 2O07A 2AFIE 2EBWA 1ODLA 1E59A 1RI3A 2QVCA 2XQIA 5HCIA 1Y7LA 4URVR 1V4NA 1M8PA 2FQXA 5JSZA 1RJDA 1X92A 4N3BA 3O8OA 1SKUA 2R44A 1MDBA 1R0CA 3WRXA 3CF4A 3ZHRA 3Q88A 1T3GA 1C7QA 2I03A 3W6NA 1KMMA 1TQ8A 1X8KA 1DTWA 2WU0A 2O8BA 1QYIA 2NVBA 1DRVA 1YL7A 3D6MA 3IJRA 3OHPA 2G8LA 1NJ8A 5LR6A 2GXUA 3EIFA 3ZGYA 1NR5A 2IU3A 3OSUA 5AOAA 4C4ZA 4RJLA 3EOZA 3T5DA 3HLKA 3CZQA 1WCIB 1TZBA 3EQ9A 5DLPA 2QVLA 3I2JA 4HNTA 2B4YA 1YJCA 1G2QA 2BMAA 5L7YA 3DE0X 4OK5A 1AGRA 1MIOB 1XTTA 3PRJA 4MS3A 1Y81A 3DM5A 3K4QA 2B92A 2CMDA 3GFPA 4RV4A 2H52A 3N1UA 4V3CA 4UNIA 1OU4A 1DBSA 2ZTHA 3QBEA 4PBSA 2R1ZA 3EPPA 1RXYA 1MC1A 1J2YA 3B6IA 3FB1A 5DNAA 5K0NA 3DAPA 5K7SA 1VBFA 2BI8A 3CBGA 1VP9A 4BKMA 1PJLA 3S8EA 2R00A 4NS4A 2EDAA 2ZBEA 3DOOA 3EZXA 2M6LA 5E6UB 2NP7A 1HDGO 1UKCA 3O3CA 3U1BA 3R7DA 1X7WA 2OCYC 1FDOA 1Q0QA 1CUJA 1EQUA 3CIFA 3R6WA 4I5DA 3VR6D 4YCSA 1ZNWA 2Y0PA 3WV5A 4NYMQ 2DBRA 2KS6A 2TMGA 1IHXA 1NVTA 2PO7A 3DUWA 3R75A 2VL7A 2OCDA 2YIJA 4MUBA 5A5VA 3O2NA 3B60A 4PQFA 4D9NA 2ZM5A 5IK2D 2ZSUA 2A0KA 1H6BA 2C00A 4QGGA 4I1UA 1JLSA 4P98A 1N92A 2A5DA 2F64A 1V71A 4B3DA 1CKEA 5LOVB 2C97A 3WGJA 2JLCA 2OUIA 3ABIA 5H82A 1N8TA 1NVUQ 4XD7D 3WL6A 2H4ZA 3UB2A 1C1DA 3L6DA 4C76A 4YRNA 2ZSHA 3R7FA 2GSWA 4YBZA 4HUTA 2B37A 1ZEMA 3WLIA 2ERCA 4BO3A 1NBMD 1Z4MA 1FX1A 1FDWA 1G18A 2HF9A 1HLGA 4N65A 4C78A 4ZI3A 1OYOA 4H6XA 3UMJA 2AWOA 1F6DA 2BLNA 1Q20A 2WFLB 3LG2A 1M1NB 4HL6A 1R0XA 3H11A 4F97A 4HMPA 1P7YA 3BL6A 3DLCA 3ORFA 4YJDA 5ITZA 2C98A 2MSDB 3E1KA 1IRXA 3B7PA 3IALA 1G4AE 4UNSA 2D54A 4LYAA 3IMGA 1MNAA 2ASEA 2GUGA 5ALNA 1Z12A 3MEQA 1FX0B 2NQ8A 1GPAA 1S4QA 4Q3OA 1ZK4A 2HA0A 1Q5PA 3EDMA 3OLQA 5ECWA 1VYHA 5JH7B 3ELYA 4KXXA 2JIMA 1K4KA 2X86A 3FR7A 3OPMA 2XKBA 3VA7A 1DGQA 1SCBA 4V0QA 2WAOA 4ZVUA 3JX9A 1SBYA 3T8YA 3WSWA 1NJ2A 3RYHA 1RMTA 2WYIA 5EMLA 3ICQB 3QNUA 2FK8A 4RV5A 1SULA 1KFJB 5D7NA 2VQ3A 2YW9A 2AA3A 4FFWA 5JXWA 3NIFB 3MWLA 2G6TA 3OJWA 3IELA 4X45A 2J4FA 2QP9X 3M1YA 2QRGA 2SKEA 2NU7A 3G6WA 2Z43A 3EPRA 4BMXA 4CF5A 3D8HA 2IUEA 2XUGA 4PXAA 4PXSA 1JUDA 4C5CA 5DI9A 1ORVA 4R0VA 2OKGA 1BXRB 2DRIA 3AUXA 4BV3A 4E70A 2P79A 3SS7X 4IL5A 2HMTA 3USCS 3R8XA 3DBOB 2V03A 2HJVA 2JG3A 1HETA 3R5HA 1H8HA 1GTZA 5D86A 1TQHA 1BAPA 1A50B 3DZBA 1ODTC 1EWQA 4WBSA 3W7VA 2PL1A 3ZQKA 3KKLA 2OC4A 1OILA 5AJZA 2BTQB 1N34B 3WGNA 1NBOA 1TLFA 3TR0A 3TEMA 4YECA 3ZV7A 3MGCA 4UBNA 5CVUA 2FH5B 5EG5A 1OAAA 5H4HA 4MRNA 2GZMA 1JVNA 1IUOA 2BVNA 4FILA 2AH5A 1FOEB 4UVDA 3T4UA 3JQBC 2VPYA 4DKXA 4J9UE 3UAZA 3R24A 1SHZA 4A0HA 2B30A 1SNYA 4KIUA 3KYDA 5EIOA 2V6FA 1XF9A 3P2JA 4O1IA 2G40A 3WBBA 5EE5B 2UYGA 5KTMA 3W8RA 4N8DA 4JUIA 3WAKA 2WD8A 4PFJA 3V8MA 2VVTA 3DXYA 1OBVA 3CU5A 1M2EA 4R51A 4TVBA 1ZBQA 4W5OA 1D1TA 3QTLA 3BTVA 1L4EA 2OQRA 1NRXA 3S81A 2VDWA 2OGTA 4QLOA 1S2IA 3CB4A 3IS3A 4JI1B 5HZMA 4WNAB 1MH9A 3QPBA 4N8EA 4X7MA 1UC5B 3ZJ4A 1P18A 3DOEA 1G8KA 1HTBA 4TLCA 1YDGA 3D0OA 1J5EB 3MMZA 4B9AA 3JQBA 3RB8A 5FUYA 3G2JA 3KT0A 1P74A 4J1TA 1V5WA 4DLYA 2J33A 2CJWA 4E2FA 4WXMA 2W0MA 4RL6A 2EWMA 2HBZA 2DR2A 1K1EA 1DTSA 7ADHA 1XDWA 4JJZA 2GKOA 5CX1A 4GKVA 4P7JA 4D6YA 4EW1A 3A6JA 1FJXA 4OFXA 3EG9A 1E1MA 5FWDA 2HA6A 2BUAA 1EX9A 3F3KA 1JL3A 2BFMA 5KBYA 3OFVA 1NF3A 3QKUA 5CIWA 4FFBA 4F5WA 4GF5A 5JANA 3E8SA 4NEHB 3A4MA 4KI0A 3BQ9A 3FWZA 2EEZA 3S1SA 3UC9A 1EA5A 1US8A 5FI3A 2YQ4A 4X3OA 3RE1A 3U7IA 3AR4A 2GUWA 1W0JD 4ARCA 4C7OB 3HSYA 1JIXA 1OI7A 3HNOA 5HR5A 2PSEA 2QYSA 4CLEA 5M29A 2IOHA 2Q6LA 1AGXA 2QTHA 3FNHA 4RD0A 3ESDA 3VOAA 4XWOA 3IV7A 5ELLA 1M3SA 1NR7A 2V6GA 2QT0A 3KLOA 4PV7A 5FHRA 4UQLA 3E1GA 4M0MA 3FCSB 2VT2A 1K66A 3L4KA 1U8AA 5JXHA 1TZJA 5CDSA 3QBTA 1E2KA 1Y9ZA 1WETA 1FUEA 1PEKE 2A9PA 2YDXA 2O23A 1RHJA 1FP4A 1X8XA 1SUEA 2EJWA 2X9VA 4QOJA 4EB6B 2QXUA 2H5IA 3BFVA 4JCCA 4L2IA 1JG4A 2WIFA 2HMUA 4KVAA 4XXHA 2OXEA 3WDKA 2C2YA 4JLBA 4HDCA 1VE6A 2QRKA 3R09A 4A5OA 1KFCB 4C6TA 3K53A 1SVSA 2KLHA 3ADCA 1AMNA 1XVAA 3ODPA 2R8PA 4CQLB 2ACVA 3BRCA 3KU4A 3KOZA 4BNYA 1A1VA 1YHYA 4YAOA 1OGIA 2OBNA 1H2WA 3LCCA 3V6LA 1GN8A 5HJ2A 5AUPB 1ZI9A 2RHHA 2YZ2A 4FFSA 1NUUA 3OLCX 1PKEA 2BI7A 2X9GA 1CVLA 4D43A 4EAAA 4N0QA 1XXHE 4NOJA 1LPMA 1KEVA 4ZCMA 5HQ3A 5H1YA 3DFUA 3K0HA 3VSEA 4MS4B 1IQUA 5BMVF 4N7RA 5LQNA 4R1OA 2JHAA 4JI6B 1IHYA 4UEKA 3FIUA 3ECCA 1DCKA 1UK6A 1D04A 1G7RA 2PT6A 3L8FA 1QS0B 4J4HA 3ZY4A 3KLPX 1EFPA 1G8JA 3VJLA 4HLUC 4J0GA 2I4RA 3WGZA 3V7FA 4BASA 4B40A 4KL8S 4R83A 4DN6A 1PAUA 1E8NA 2RDMA 2BKVA 1QNLA 1EX1A 4R71A 1XU4A 4ZCTA 2OORC 3H2KA 4YJFA 3VU8A 1JHZA 3AUSA 3P96A 2ZSJA 4XQ9A 4AICA 2Q3BA 5EKTA 5MFZA 1AKWA 1TO2E 2Q49A 3A9VA 4ZTUB 1HTWA 5TQJA 5GVRA 3O1HB 2G36A 4XGNA 3S2EA 1KJZA 4YJ2F 5ALXA 3TVTA 1V95A 1AE1A 4GLLA 1QGZA 4X1IA 3RVBA 3T4EA 1VMKA 1YQUA 4EZEA 3EVZA 1QGUB 2PFSA 4TQAA 5KJEA 1M2GA 2O0KA 2P0EA 2PGDA 2X9LA 1U4NA 4N03A 3LQYA 1RLJA 2O1WA 4ZOLF 4A91A 3BSSA 2P4SA 2QOEA 3HDJA 2VZ8A 3L2OB 3S27A 5C7YA 1LPBB 5CVEA 3VAYA 1JB9A 3CX3A 3PV0A 2XB9A 2ODTX 2WAYA 1LI5A 5AK3A 3T61A 3WGGA 4EKYA 1PL7A 1HEYA 2FSFA 4RUKA 1J0CA 1NY6A 1LNSA 2FA9A 2OORA 3A4LA 3L84A 4PW0A 4BZPA 5B7NA 4JV5B 1GPNA 1I7LA 2UUCB 4YK7A 4H35A 1OB2A 4DRZA 1PFVA 1TYDE 1BCRA 1Q0LA 3VAZA 3W06A 4E1AA 2V7WA 2O1EA 3DLPX 3BKWA 3ED5A 3NWPA 3TZHA 3ZBPA 1GNPA 1PFQA 2ZS9A 3VTFA 3GRKA 2ZR0A 3EGEA 1XZKA 1CJTC 3LBNA 2O9JA 2D1QA 3AY3A 3DWEX 4AP5A 2NAFA 1MB9A 3OCJA 4G0XA 1XRRA 3G68A 4NECA 3FOEC 2XMCA 3LGXA 1GRRA 2OM6A 3PI7A 1ONBA 1GSIA 4HC4A 1XCJA 3Q3JB 1L7XA 2ES4A 3QPAA 4TMVA 4DMUB 4GP6A 1UMDA 2HR1A 5DSXA 3QFCA 2I7XA 4GECA 5HK8A 1VJ1A 4IJWA 4B3GA 1NWCA 1XZGA 1XDBA 4QGBA 2ZRLA 2E4UA 3Q41A 1WCYA 4XVQA 1QTQA 3E22B 2IY9A 4XOIA 4NPHA 5HGXA 2HXYA 1RYEA 3DBRB 1WOMA 1YU6A 3NRBA 4PPNA 5FTMA 4U7WA 3ZIAA 3NJ8A 2CLOB 3B1VA 2AMFA 4PLTA 2LZ0A 3L82B 1MRZA 2W6JD 1K7XB 1MGOA 3B6ZA 4NDZA 2XQKA 4QNNA 3WWYA 2I4NA 1XHFA 2PGAA 3NTOA 3S1AA 2CXUA 3LE8A 4AYTA 1R1DA 5NULA 4H0FA 3LNTA 5FXMA 1R8YA 3TUIC 4DDTA 4EG1A 1QDUA 1XD2B 2Z98A 4CEIA 1V41E 2ABWA 2AB0A 3PFKA 2ADMA 3L5OA 3W4IA 3QYFA 4S05A 2DBVO 4JQZA 3CO0S 2GWRA 3O26A 3FPSA 3N2GB 4KVGA 3NTLA 4F6RA 3HJBA 4FCTA 5EJGA 1STOA 1GA1A 1EJ0A 3PQ7A 5FFNA 3THXA 4BMOB 1EEHA 1EUDA 4D9EA 1JG1A 4WEOA 4C4OA 1RXCA 5KYUB 3U44A 5E3JA 1W2GA 5HUHA 4EB0A 5LDDC 4M21A 2AT1A 2RSLA 2YVAA 3HRIA 5EWMA 4UVHA 4K86A 2XZPA 4N12A 4G0VA 2NSJA 5GZ1A 3N2KA 5GZ3A 3A1UA 1A9YA 1FYVA 4P93A 1F17A 1KAGA 1VMIA 2F3QA 2ZBGA 1DOAA 2R8EA 4OEHA 3RJ5A 1QIJA 1RM5A 1Z6XA 5ALHA 4EG8A 3DKRA 3GJRA 3N07A 3DJFA 3GJZA 3B2EA 4CMEA 2O2HA 2P9EA 4FMDB 2FN4A 1A5TA 1G3MA 5DDIP 4EQ6A 3EQ8A 5JSQA 5JXGA 4LQDA 1DEXA 3TXXA 1UPTA 1MJFA 4ADSG 1UP4A 4HLCA 4OVKA 2V0GA 4LJ9A 2ZVDA 2H59A 1DSSG 4RFLA 2G80A 1E8DA 3LC1O 1ISMA 1CC1S 3NHMA 3FCXA 4IJKA 1J0XO 1QP7A 4QTTB 2GCPA 1ZS9A 1QMGA 1G5HA 1WL8A 5HE8A 3D2LA 2PT7A 3R5JA 2QRHA 4PLCA 1C14A 1KQOA 2R6HA 1U98A 2GH1A 1KJYA 1GG8A 1QDLB 2LR0A 2O3SA 3HKCA 4K9NA 1R6AA 5E2IA 2Q21A 1Z68A 4QDOA 3RJMA 2C8LA 1G3UA 1IY9A 4F5EA 1FDUA 3LLUA 4LNUA 1RLMA 1ZO8A 3KOWA 4H6PA 3L8YA 5AJXA 1W5FA 4ZO9A 1LDYA 5J3JA 1NDUA 1IOLA 2C2WA 2P2CA 2PTGA 3NOOA 3IEXA 1CY0A 1ZN8A 3OT1A 4BJHB 3SEZA 2GJ8A 2XV1A 3Q7SA 4UATA 1N6NA 4B6QA 1R9NA 4M1KA 1RTTA 1FUYB 3BVPA 2YWEA 3ANSA 3PWKA 4ZMBA 2DBYA 5J59A 3GBPA 2FN9A 2RAUA 3DE2X 1T0UA 3DE4X 5C53B 1UEJA 2P2YA 3IP1A 2Q0HA 3KB2A 4QYIB 1A1SA 1GPMA 3NBYC 1EFVB 2CXNA 4MGHA 1W2WB 1E9DA 1NASA 2Q07A 1E6CA 3A6EA 1G5QA 1ZRSA 1VE3A 4HZUA 4DSNA 1DQZA 1R00A 2HRRA 3EXEA 3R3JA 4AIRA 4FQ5A 4MVJA 4MWZA 1V1MB 4BVAA 3W5AA 4NE2A 2I8LA 5AI6A 1S8AA 1GU1A 4DB2A 4GT1A 5BURA 2YJ3A 5GVSA 1VSTA 4DNXA 2I76A 4S1VA 4BIIA 2XHZA 4IIJA 2DFDA 3QBDA 1XZPA 4UBJA 3REQA 3AKEA 4L7VA 4P8RA 4B71A 1WPQA 2AFIB 5F3RA 3T3PB 5LP6A 3IVAA 3ESXA 3PZBA 3QVUA 2C0QA 4P4SA 3EXIA 1XLWA 2X1VA 4DIMA 4HDSB 4UE2A 4CKWB 3FMIA 3FY4A 3MQ2A 2RHDA 2X9NA 1ND5A 1TUIA 1XNJA 1ZSVA 4LYHA 4QARA 2HPAA 4YI5A 5LNK1 1I4OA 4FOSA 1XCMA 5JAHA 1NRWA 3QTTA 1CETA 3C87A 2WVHA 1W5EA 4KVFA 5LUAA 4RK0A 2QLBA 5FH9A 4L08A 1P5RA 4R8MA 1GIAA 2F1IA 3SX0A 5LQJA 1EGVB 1N2IA 1GGHA 3HJHA 4P3NA 3YASA 4CF6A 2PS0A 2IPMA 3GN1A 1Z4IA 4IY1A 5G41A 5IEBA 5ALEA 2IXEA 3AI1A 4MHTA 3M81A 2MMCA 3O03A 2IHNA 3RHSA 1GZ3A 2FWPA 4MITA 2V54A 2QTTA 2J7KA 1OVGA 2HV9A 4IIXA 4IXMA 4IZ6A 5CFRA 3ONNA 4XLTA 1F8YA 2J4CA 3D8SA 5E8RA 1FYXA 1XTUA 3KKOA 4HXGA 3GQBB 3JS5A 1GKKA 4P3XA 4H1WA 1EWTA 2JI8A 1VGVA 2YWGA 1DT5A 4FS3A 4RELA 3EDRA 3UJBA 2F62A 5G0SA 5KNBD 4FEGA 4HQKA 1L1QA 2AEJA 4HAWA 2IKQA 5C8YA 3GFRA 1GTVA 3JQ9C 2HM7A 2VUHB 2WJPA 3ON5A 4LMBA 3FBWA 4MRRA 1KYQA 4AJIA 1OBHA 3V1NA 4DIEA 4DV5B 4LHXA 4FYHA 4G67A 5T57A 3SSMA 3CUSA 2WZCA 1YRAA 2VBGA 3T15A 3WJ1A 1S2LA 3IT1A 5FBKA 4OX9Y 3F0TA 3KPJA 2ACKA 4KW7A 1YGYA 1CZRA 3KAKA 4BDTA 7MDHA 2W2XA 2G0TA 4HTAA 2LP4Y 4MUMA 5DN6D 4NESA 3L7JA 1ESDA 2WJWA 2I80A 1YOVB 5DWDA 4YT2A 1Y5IA 1PTJC 4PZZA 1DUIA 1J7JA 1SVMA 1ZD5A 3I3OA 5CXUA 1T4MA 2O14A 4DLVA 5ESXA 2AZMA 5HYVA 1X1BA 3NDJA 5IVDA 5F3WB 2D59A 2KX7A 4RJJA 1KBOA 2PZLA 3PNLA 5SYAA 1VHJA 3H4VA 4FZJA 3DEAA 3O95A 3H5OA 4W6QA 4YCJA 4ROSA 1P2BA 2BBOA 2CVQA 3DWGA 2HAEA 3A6ZA 1M2WA 3KO8A 5I9BA 1ZMTA 2PKQO 3PLRA 4MR7B 1EKXA 2J6HA 3LY9A 1Y3IA 4RESA 1BMTA 3WSVA 1GRVA 1LC0A 2WOOA 5DH9A 3TW0A 4BKUA 3W9YA 1I1NA 5KVSA 3A9WA 2DFLA 3GX1A 2O8CB 3PL5A 5D8DA 2HA7A 4DMHA 2D8AA 5FPYA 3ZY6A 2FX2A 3QLTA 3KWFA 3KHKA 2VNHA 2OSVA 4MV0A 4AY3A 3D3WB 3VZSA 1JFFA 5AOBA 4FKBA 4MAAA 1L5VA 3IBSA 1RYYA 4B81A 2GBPA 1NI5A 1U90A 2VHCA 1N4DA 3AHCA 3EEIA 3W3ZB 1CD5A 1WB6A 2E2WA 1U7UA 2W9XA 3AUAA 3A1SA 3TDMA 3UG6A 1AKQA 1B43A 2P2LA 2C2MA 1O89A 2OUKA 3GWZA 1YS1X 4AG5A 5A04A 1P8AA 5I3ZA 2YMMA 1P91A 3H5TA 3G6KA 1WHTB 5EHIA 4MV8A 5F52A 4AKTA 1GL6A 1R8JA 3AHJA 4YRJA 1OSNA 2DSTA 3LECA 5EKXA 4BGEA 2B8NA 3K5HA 2O6LA 2JGEA 2QNIA 2M9MA 3M1IA 2MYNA 2WWFA 3MJHA 3E9YA 1OT3A 3EVCA 3PQ2A 1T1EA 2RGUA 2NW6A 3CUKA 4L0CA 4JK3A 5HQJA 3W34A 5CCEA 3CVYA 2JD0A 4KGVA 3V7UA 3NETA 5H3CA 4DLWA 4LX0A 4TKUB 4UCQA 3G8BA 3DUFA 5CXSA 3TKYA 4QWMA 1ORTA 3U7RA 1I14A 4DSAA 2CE7A 2GYUA 1RJEA 4ONEA 4RL4A 3KFXA 4HDMA 4W99A 2FEOA 4E3WA 3WRWA 1Z28A 1T5DX 2FY8A 2H1HA 3ZW8A 5FBVB 3KYBA 2P8SA 3DL7A 1O5OA 1TT5B 4HF7A 4DLXA 3PKJA 4OFBA 4EO4A 4AJ4A 1KOJA 4HB2A 4EG4A 3TLGB 2Z08A 4CZ2A 4RA9A 5DLDA 1C0PA 1RJFA 1OI4A 1MV8A 1GDHA 1SQSA 1JJ7A 3M70A 2DT5A 3FDJA 2JLXA 1T8RA 2GAIA 1XEWX 4V0LA 3AVWA 3A4VA 1QE0A 3R5SA 5ICEA 2Z2XA 3FPCA 1EM8B 4G01B 4MYCA 5LOVF 4ER0A 3R8FA 1NVAA 4U5XA 2YJ6A 5DCUA 5TNXA 3QVKA 4NU5A 1VSQA 4I4LA 3D4IA 4DCGA 5TLSA 3HB1A 5L3SB 4GWKA 3WQQA 4RTJA 1IK4A 4YWHA 4PRYA 4QDXA 1BVYF 2VZ0A 2Z3WA 3AQIA 4C30A 1FTYA 2F67A 3ITNA 4FNGA 1OBOA 2ZS7A 3KR1A 1DEHA 1QE5A 3KKQA 4K2HA 1LU9A 5CLFA 2A1TR 3GROA 4R7GA 5D01A 4RSGA 2BF7A 2BN4A 5CT8A 1PF7E 2VJBA 3ZZUA 4A8HA 3U48A 3T3NA 1Y1QA 1KYYA 5HIJA 5GPBA 2UAGA 4MJXA 2Q4EA 4A10A 1JBQA 3G89A 3NX4A 1UOEA 1QV9A 2JHFA 3NCHA 4UEWA 5FPPA 4DV3B 4FDTA 1C3OA 1XDUA 4NATA 4WXRA 5F4ZA 1VB5A 5K6TA 4AFNA 3W2GA 4HB3A 3CY6A 4LYYA 4Z3OA 4KR2A 3D0KA 3AEQB 3EFOB 4RMNA 1HL3A 1T3LA 4LBVA 2JAXA 4KSBA 1B0PA 5EMHA 1WULS 1YI0A 1K9VF 2G0NA 4YEDA 5G0VA 4X92A 2OAQ1 1JJAA 3WB0A 2ZUBA 1YR6A 3ESZA 4KTVE 3SXJA 4JNCA 3MAJA 3ACBA 3IBYA 1E3JA 4OXRA 3HJGA 3IJEB 4YV2A 2YRXA 4M9QA 4MI1A 3FLEA 3HCAA 4FFMA 4H31A 1P60A 1EH5A 3K96A 1SU7A 4GPAA 4RS3A 3ZE2B 1J49A 1EGAA 4HMQA 4F6CA 3E7XA 2OBMA 3GBVA 3DNFA 2DH5A 4JJIA 4WAUA 2HDWA 2BUCA 1E60A 2DCUA 3WLAA 2E82A 3WNDA 3CZCA 5LP1A 3RS5A 2GVZC 4CL0A 1H2ZA 1WD7A 3LT0A 4YY3B 4EDHA 5HSGA 2VXCA 3KXLA 3GPLA 4PU0A 2N1BA 2XUPA 4Y6OA 1SEPA 3DV9A 4CYMA 4C0LA 1A77A 1QYWA 2XA9A 1O57A 3H2IA 1UPAA 1VE9A 1H5NA 5A3RA 2PMCA 2Q2OA 9LDBA 2VJOA 4M46A 1IBCA 2DLDA 1HG0A 3FOZA 4WGGA 2IHTA 4PG7A 4N41A 1TUBA 2PH1A 4YRAA 4OKIA 4MQEA 4GFDA 4IDBA 1N5KA 2FCRA 4JSTA 3M9WA 2GPJA 1UBUS 4QFBA 4GUAA 2PVPA 4RD3A 4RK1A 2EATA 1PE0A 1Z0IA 3C5VA 3TCKA 4XQ0A 5EJMA 3MWKA 4BWYA 1ODJA 2QT9A 5E38A 3T34A 4B8WA 1U6KA 4Q7LA 3WRVA 1L7NA 4L51A 4EFMA 1NL3A 4E33A 1TJ4A 4DM4A 2ECPA 5CLQA 3F6RA 5CVVA 1FW6A 1G8FA 5IMBA 3W5UA 2GRJA 3BXXA 3EHDA 2IODA 3G13A 2O0MA 1FQKA 4H7IA 5B6JA 1T1IA 3A4IA 4LKRA 1TKCA 3SHFA 2C07A 1K8XB 3KJXA 3OZCA 2VP0A 3QKWA 1A8IA 1P45A 4FKMA 4NENA 4BE4A 2CL6X 3IUMA 3RT7A 4YPFA 4EO7A 2AOWA 4N4AA 4FX5A 1Z5WA 2ZAOA 4R6XA 2W37A 3I5AA 2FE4A 3KE8A 2GPTA 4TYWA 3RFCA 4DLKA 1U7WA 5K0SA 4CIAA 1II8A 3PXAA 2WSYB 3H7AA 4FE7A 4LRWA 4P9NA 3BDIA 4J0CA 3ZQJA 1IN4A 3NNSA 1LK0A 2PZMA 4KIFA 4E13A 5AUNB 4F4FA 1U1EA 4GIBA 5FULA 3G2MA 4J0JA 3Q0TA 1S2GA 3L6EA 4CXMA 3E5NA 1YE8A 2P9JA 5I48A 4GH5A 5FUXA 3G2HA 1JAYA 4MZDA 4I50A 3MT7A 3U3DA 4KREA 1EESA 2AK3A 1PYGA 1SUPA 1RP1A 4OMUA 3LQ2A 3DVSX 4GZ5A 2VJPA 3NHZA 2B9EA 3D43A 4G5QA 5JAQA 3STHA 4AUMA 2BMDA 2WE7A 1NXOA 3FVRA 1U3WA 1T3ZA 4XJTA 1O77A 2JBAA 1BGXT 4ISBA 3GGPA 1UPCA 2IW3A 3D4PA 5KU7A 1AK1A 1T2VA 4Z49A 4Z5XA 1X1DA 4BPBA 4G9BA 4OGKA 2WWXA 4LFCB 2E4AA 1SVLA 1NMQA 3L8GA 3I9V6 1T6BY 3ESYA 5KZMB 4F3TA 3H2HA 2R9VA 1VP3A 3PRHA 4G1EB 4YP1A 4ZI7B 1JA0A 3WFZA 2CHFA 3K5WA 1Z83A 3D6HA 3BG5A 1ADGA 3NFRA 1BE6A 3JR3A 4WKBA 5GGXA 3VI3B 3VVCA 2IH5A 2XB8A 3LTNC 2I3BA 2BRUC 2YS6A 4TL8A 3NUQA 4LOIA 5DX8A 4YCMA 5IBCA 2R11A 4XGRA 1CY6A 5CVTA 4Z86A 3T3MB 2ZP1A 1BKYA 4W1QA 2ZUUA 1SBNE 3K0KA 3QUAA 4EMSA 3G02A 4DREA 3TI9A 1YBFA 4F9EA 2OCGA 3DTNA 4ZZ1A 1Z4QA 4FOTA 4I81A 1U4SA 4CHGA 2YRWA 3WKAA 1D6SA 1SRQA 1JYFA 1E9VA 4MHSA 4I36A 1E1YA 1M2FA 3Q15C 1F6WA 4MUIA 5JNLA 1O94D 1ODCA 1WUKS 1IM2A 2AW3A 2IDKA 4ZAVA 1SQ0A 1H6DA 5K8JB 3W05A 2H1RA 5D5PA 4AY6A 3HM9A 1U0SY 1EBBA 4RABA 1VGRA 2O8DB 5AFSA 2EGGA 4TKVB 1A5SB 2BRUA 4ZEOA 2VRBA 1TJYA 1GGEA 1CY7A 1SBTA 5HF6A 5ELXA 3HK2A 2AOTA 1AA9A 3EZ2A 4NC9A 5IBRA 3TAHA 1OFIA 2OBLA 2VUTA 3VDRA 1CNFA 2HUNA 4IQ4A 4OQDA 3U62A 4TMYA 5CDHA 1WX1A 2H1IA 2QTAA 1PR4A 4QVIA 1DARA 4HI0E 3AT1A 1CY1A 3CONA 5DGTA 2BZ0A 1U8FO 2A4KA 4JEHA 4ARZB 3EB9A 1E0JA 1W8DA 2Z09A 4KUGA 3EN0A 2MU1A 4Q4HB 1IZZA 3ZDRA 3NKLA 1T0JB 3T7IA 2XT0A 3C3CA 3ZS8A 1Y3FE 2GT1A 1T3SA 2EJVA 3UH1A 1L7VC 1NU6A 1WKBA 1CW2B 1ENPA 5K0BA 2CSXA 2R8XA 2DERA 2C92A 3NANA 3CLRD 4RKWA 3RO7A 3E81A 4F6LA 4I4NA 5JZBA 4I9NA 3UWKA 2EU8A 3K1AA 4KKVA 4NNOA 2DQZA 2Q8NA 2QRUA 4D3YA 3L93A 1QIDA 1T9DA 4BQOA 5HWSA 3FNRA 4LXXA 2A9RA 4Y1FA 4ESHA 1TPZA 1QFXA 4UTNA 3ZNQA 2BFFB 3O5AA 1MB2A 1MMFB 5GGYA 1ML3A 2O7SA 5B5SA 4NCKA 3T9DA 4BFUA 2OCKA 3L18A 4BFLA 3F3SA 1T29A 3ID6C 2Q5LA 1RQGA 1EFTA 6PFKA 4A0RA 3IL2A 3MNFA 2FKNA 1RRKA 1XRLA 1G3RA 1IHDA 3D1VA 5FO1A 3O8RA 2ZVPX 1X0VA 1OXUA 2IEYA 1POXA 3FE2A 1COWD 4Y9RA 2WIDA 5ESDA 4EATA 2EP8A 4ITRC 4V0ME 3ZWMA 4BEBA 1QG6A 4JBIA 1AM4D 2IUYA 4DZZA 5JNTA 5K8IA 3IQZA 1ATZA 3H9QA 1GZHB 4QGFA 4GXTA 4CKCB 5K2MA 1DO8A 2G9NA 2R8OA 3DBVO 4ASUD 4N1AA 4F3NA 3OUUA 4F8YA 1EWYA 1AHNA 2IYVA 1YAHA 1NF8A 2VRNA 1ZZEA 4QU8A 4RYLA 5JMTA 3ZZTA 5L8VA 4OKSA 1XP8A 1T10A 4EHDA 1GQ2A 1HQCA 2WAMA 3DMFA 1KH2A 5GV8A 3F90A 2KQUA 4L8GA 5DOVA 3ZWAA 4JL5A 3M4YA 1P0FA 2WF9A 4JQOA 1Z8FA 1J9EA 1QO9A 1T0IA 2BW0A 3DKPA 3LZCA 3FLBA 4NAHA 2PXAA 4MGKR 4PG4A 1S3IA 5I9SA 4IQGA 2BFPA 4F7DA 3GEMA 4C88A 2ZRPA 3OJXA 2LVBA 4RDHA 3ZCTA 1I7SB 4DQKA 1LWOA 5JE8A 5EJ8A 1DEAA 1NQUA 4ZT5A 5K4AA 3SQDA 4B5LA 3UQZA 2O20A 1VA4A 1U0RA 3D6AA 3STUA 1EDZA 1JR3E 5F5XA 5JIBA 4JBYA 4GC5A 4WFQA 5K0GA 5KMGB 2CT8A 3E4DA 1YRLA 2V6IA 4BFCA 2A8YA 2VJKA 1BW9B 2XNSA 3WL8A 1WUHS 2C7GA 2WP8J 4FSHA 4JYBA 3HXOA 1B8UA 2WJAA 4M0EA 2G88A 3QI2A 5CYOA 1JNYA 2FSHA 2R6DA 3T54A 1TKBA 2YR0A 4L8FA 1X8LA 2Z2ZA 4G1MB 3VMFA 4C4PA 1FRFS 1RPNA 3DC7A 1L7PA 3E27A 4TWZA 3ZK9A 3JAMA 2HT1A 4BV8A 1AQNA 4YCNA 3WNVA 5F2KA 4MEJA 5BSEA 2ZI5A 3JR7A 5A0VA 1Y1SA 3JZFA 3LIPA 2V9CA 4TN1A 1EFLA 2GLXA 3FSEA 2BFBA 1ZZGA 1DAOA 2IHBA 3L04A 3GFQA 4OL0A 1OFHA 4UD6A 3DM9B 2WFLA 5EY5B 1M1NA 1A9PA 1M2VB 2GLTA 3M6UA 4XKJA 1G4UR 5K6AC 2BOVA 3V7YA 4WZBE 2NXWA 5C0OE 4QGAA 1Z8HA 3RK1A 1Y5RA 3SQXA 2C54A 2EIXA 3QYPA 1VFNA 4X7PA 2BFDB 5K8CA 2WNSA 3LK7A 4PLWA 4Q9KA 2QAGB 2RH5A 1NUSA 3PUWA 1L7RA 3WRYC 3M8KA 2JBHA 1T9AA 3E8MA 4FONA 4Z9BA 2Q6OA 4L78A 1IPEA 3V3TA 4FIDA 2VBFA 5I4IA 1T4CA 2NT3A 3RVMA 2P2DA 2Q2QA 3C3DA 2AQ8A 3SYLA 1NVGA 3X2FA 1GNQA 3KDSE 5K6AA 2GHRA 1GLGA 2QMUA 3LCVB 2GXAA 2X58A 4N82A 2RHJA 2GJ9A 1FSSA 2QGZA 1XO1A 4BNGA 4K0RA 1CULC 4GMDA 4RWZA 2O2IA 4ZVRA 3NJRA 3TDNA 1MOZA 4KXWA 3OP4A 2WW8A 3TQOA 1R0ZA 3NYQA 4M0DA 2I3GA 2H06A 5BYJA 4ENWA 3ZS9A 1YMQA 5KO2A 4DADA 4W9MC 3MPUA 1V47A 5LFAA 4LJAA 1LGYA 1UCFA 4ZU3A 1DAMA 3ZCSA 2JJMA 1NPDA 2NX2A 1DNPA 2O3QA 3RDPA 1GAJA 1V4VA 4EY3A 5BV2P 5IKEA 1WZIA 2G5PA 5EEGA 4BMDA 4QC2A 4QWWA 1A5AB 2H9YA 2R6FA 1LPSA 1KRWA 4D02A 3H97A 1ZNXA 2Y05A 1Y3CE 3EBLA 4M53A 4TT8A 4U7JA 3R7WB 5BV1A 3ZWDA 2XMZA 4O2AB 3VBCA 3U2QA 4O1HA 3WYBA 1D8TA 1NVXQ 3W1EA 3WZMA 5DGIA 3ZCQA 4HAZA 1LBHA 1UXJA 2DXIA 4DR4B 2E5LB 2FOIA 3FVVA 1WW8A 3CVVA 4HR7A 2OFPA 1BSVA 4JUFA 3IEPA 3D6FA 4X8OA 3DTVA 5TJ9A 4E08A 1ZRMA 4FYWA 4YLEA 1E9FA 2GVDC 5DHAA 1L5RA 2VSXA 2BKEA 2VZEA 4FGLA 4HDNA 4N5IX 5EKDA 3SJAA 5BWLA 3EK2A 2VPIA 3N6RA 4L9SA 1DWUA 1KU0A 2I2FA 5DM1A 1ZGZA 3S55A 2JAWA 1VIYA 2LUOA 2P8JA 3CLTC 3KQPA 4NE9A 5BSMA 3SWWA 1P3DA 2GD0A 1ML4A 1IZYA 4IGAA 3G7UA 2JAPA 4IWNA 2WBLC 3LHKA 2HBQA 2RGDA 2YMQA 3E3AA 1CIPA 3QVLA 4XYBA 5CR9A 4UXHA 5L53A 2QT1A 2BAGA 4TZ6A 1USIA 3QOYA 1MORA 2WJJA 5CW1A 1N78A 3IXLA 1NP7A 4P4UA 2GPNA 2HF8A 3KU1A 2CDRA 3R0XA 1HDZA 2R3SA 1N77A 4BZWA 3JAWA 1Y3HA 4P92A 4ZQGA 2Y0BA 3MBIA 2ZJ0A 4MYSA 3SXUB 1Z0FA 4LOHA 1X7HA 5BVHA 2YV4A 3FNFA 4JNKA 1LW7A 4ZRDA 5M2QA 4K3VA 4UUMA 2B2CA 2TMYA 3GZNB 4QNMA 1JJIA 1G9XA 4KQCA 1PZNA 4X6LA 1OQAA 2QYTA 3KYCA 4P3YA 3OKFA 5G4KB 4GPEA 2DWUA 1TAQA 3K9GA 1E1CA 5I7FA 4LBYA 1LLFA 1UT6A 4DUGA 1QC5A 3OM8A 1PJZA 2CLKB 3CCFA 2C82A 4UMDA 2DWCA 3FCEA