4MYDA

1.37 angstrom crystal structure of e. coli 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menh) in complex with shchc
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
252
structure length
252
Chain Sequence
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the General Base Catalysis of an alpha/beta-Hydrolase Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 98
structure length 252
sequence length 252
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mydA00
5AO9A 3C6YA 1XZMA 3L1IA 1CUIA 2XUFA 4EHBA 4M0EA 4LXGA 4NZZA 4UFOA 1G4HA 4MYDA 2HRQA 4E15A 5ALZA 3SX4A 1SFRA 1VKHA 1BCSA 2WUFA 3D0KA 2BJHA 5EI5A 4ARAA 4JYMA 2EDCA 3DYIA 1TKRA 3DCNA 2XUQA 3HSSA 3ICWA 5JADA 4HXFB 4HVTA 1QO9A 5DYTA 1H2XA 1VZ2A 5CXUA 5AIAA 4TVKA 3E3AA 3A2LA 1XROA 1JU3A 5T4FA 4DLNA 1K4YA 1MAAA 1EI9A 1UK7A 4LKOA 3DKRA 5ALSA 2V9ZA 3WK7A 1JFRA 3MVEA 1CUFA 2WFLB 4BAUA 1G66A 4NVRA 4XJVA 4ROTA 3G7NA 4X6YA 3FYUC 1E8MA 2AJDA 2Z3ZA 4FMPA 4Q34A 5JD5A 1AKNA 1XRLA 1VA4A 4CCYA 1K6EA 5HFAA 4B9AA 2JGLA 2R8BA 4F0JA 3GZJA 1AC5A 3W04A 1XZIA 4KACA 4DYHA 2PKYX 4EB0A 4XVCA 1QTRA 1E5TA 5C8XA 4J3JA 5AI8A 4ETWA 3N2ZB 4WCVA 2V98A 4OSEA 1BCRA 4A16A 2XQFA 2W6CX 2Y2UA 1LPBB 2HIHA 2XI4A 3C6ZA 3ICVA 2G5PA 1UK9A 1EB9A 2WSLA 3C70A 1ZD5A 2VAVA 3DDUA 1T2NA 1PJAA 3AIKA 4WFJA 4B83A 1R3DA 1QJ4A 3ANTA 4PF1A 3WL8A 3G0BA 5F4ZA 4B81A 1AUOA 2WM2A 1VE7A 5JATA 1ODSA 4QNNA 3H2HA 4GEGA 2CZQA 4FFVA 2XUPA 1F0NA 1A7UA 5JALA 2BGNA 1YB6A 2OGZA 2WG0A 2IIVA 1XLWA 2QOEA 3W9BA 5IVIA 2DQYA 4UFPA 4KYVA 4KE8A 2BFNA 5LZ7A 1CUBA 5DNWA 1VZ3A 5A71A 2OGSA 4CCYB 1ZD3A 4X7BA 2WJ4A 3R3ZA 5AK6A 4OB8A 3HLKA 4G9EA 5JZBA 2ZYIA 1DT3A 4B85A 1QFSA 2OAEA 1CV2A 2GYUA 1EVEA 2HU8A 2XLCA 4Y2QA 1HKHA 3GFFA 2B20A 3G9XA 3LP5A 3WK8A 1GT6A 1OILA 3ESAA 5I7UA 4B0OA 4H7IA 1KU0A 2VAXA 2Y1KA 4IH1A 1GXSA 4FLMA 3BIWA 5EIHA 4Z49A 1CUWA 1GPKA 4ITVA 3PI6A 4Y2YA 1U4NA 1F6WA 3ESBA 2E3JA 2ACKA 3H18A 1K5PA 1QGED 1ODTC 4KE6A 5ALWA 3RLIA 4HTAA 2YH2A 5ALOA 1MJ5A 2J4FA 2RAUA 4AZ0A 4BTVA 5AKJA 4J7AA 3PDCA 5AK4A 1WM1A 4CFSA 3OM8A 3CCBA 1Y7HA 4FNGA 5CTAA 2O7VA 4I3FA 4H18A 4CCWA 3D2CA 2G5TA 3FLAA 4DMKA 1QE3A 2XUJA 2V96A 1JJIA 1JU4A 4A5SA 3R3YA 2AJCA 1JI3A 1GKLA 1H23A 1XZEA 3BDIA 4H77A 3OC0A 2YXPX 5AI5A 5E2IA 5BWCA 2VJCA 1BRTA 1BN7A 2WTNA 4WFIA 4X3CA 3L1HA 3D7RA 5LZ2A 5CMLA 1DINA 3WYDA 4RE6A 2RGUA 1ODCA 3WMRA 1WPRA 2OCKA 1BU8A 1LBTA 3RARA 1QIFA 1YA8A 3PUHA 2HL6A 3HRHA 3IDAA 2Z3WA 1AZWA 1CVLA 4BDSA 2JEZA 4XWGA 3MUOA 4HAIA 5CT5A 1J06A 2XMZA 2XQIA 5CURA 4C01A 5DNUA 3JWEA 1FJ2A 2P8SA 2WHPA 1XZBA 5ALMA 3RM3A 2JGJA 1E8NA 2HRRA 4MEBA 1QIJA 2CBGA 5EHNA 2J3QA 2HDWA 2HA7A 1TRHA 1WHSA 1HPLA 4F60A 3V1KA 3R0VA 2Y2VA 2IX9A 1TAHA 3TGLA 4Y2VA 5C81A 4UUQA 1H2WA 1EDBA 1LPOA 1W52X 4HZGA 2BUCA 5AKYA 5T4EA 3YASA 1R88A 1GQRA 5KREA 5AIBA 1XRMA 2VJBA 4GI1A 1UK8A 4Y9SA 2JEYA 2C58A 2QRUA 4BC0A 2ZSIA 2XUAA 1WCYA 4JH0A 4BZZA 4QDXA 4W1RA 4X93A 2HFKA 1LPPA 1TCAA 3VDXA 1MX9A 3KOOA 3PICA 4CG1A 1E3QA 3IVMA 4PSDA 4LYEA 3D3NA 4W1SA 4H7DA 5SYNA 1EINA 2HM7A 4PSCA 1ZI8A 1EDDA 4OYLA 4BTLA 2WIFA 1QOZA 5E4TA 3A2MA 3O0DA 2B61A 1FFCA 3VJMA 1W75A 4BVKA 5HKAA 4IQ4A 5ALGA 4ZXFA 1QIDA 2JGEA 1CR6A 4GHWA 3EQ9A 4U2EA 5JD4A 2V97A 1X2BA 1KEZA 3G0CA 2XUGA 1CUXA 1XRRA 4IH9A 1XZJA 2OQIA 3HACA 5LZ4A 2BUAA 3OURA 2OAGA 3STXA 4BCBA 4GECA 5CRIA 1ZOIA 2VJDA 1CUYA 4L9AA 2PSFA 2XUOA 1XRPA 1O6GA 1CPYA 1DT5A 3WJ2A 3KSRA 1CUZA 4FTWA 1JJBA 3SWWA 2XT0A 3H2JA 5LZ8A 3ZWQA 3HJUA 5FV4A 4A23A 1LZLA 3C43A 3H04A 5D3ZA 2JGFA 4KE9A 5C7YA 1G42A 3PFBA 5FOQA 1MNQA 2DHCA 2FUKA 1CUEA 1DX6A 5HZGA 5DYYA 3TJMA 2DHEA 3RKSA 1DWPA 3WKBA 5K3AA 5AI9A 5ALLA 1BEZA 3PFCA 3C5WP 5AI4A 3L1JA 4FOLA 4NMWA 3STTA 2QMQA 4X6UA 1IUPA 5AKLA 4G5XA 2DHDA 1DWOA 2ZJFA 3ANSA 3AILA 2HFJA 2ZSHA 1WOMA 5HCUA 3F96A 2OQVA 1LGYA 4TGLA 2Y6UA 1ZD2P 2D0DA 5CH3A 5FPQA 4BAGA 4BE4A 4OU5A 2I3ZA 1LPNA 4G8CA 4QE3A 3P2MA 3VJLA 3HEAA 1B6GA 4M0FA 1LBSA 4S0XA 1XZKA 2XQKA 3WQHA 3B5EA 1NX9A 1UOOA 3F67A 3C6XA 3BJRA 3PUIA 3GA7A 5YASA 3T4UA 1AX9A 1L7AA 3PE6A 3WL6A 2WUDA 4G8DA 4UHEA 3HC7A 3I1IA 3M83A 4FDMA 3LS2A 3WA7A 3AINA 3PF9A 3QBJA 1VLQA 2WJ3A 1XLUA 1YAHA 3F8SA 4BAZA 3WKAA 5SYMA 4BRSA 3E4DA 4PQEA 3C87A 4AQDA 5FPPA 5HF8A 2PU5A 3ZLUA 4H7JA 1MTZA 1THTA 1XFDA 5LLSA 4H7HA 3UUEA 3FVRA 3OPMA 4JNCA 3WK5A 4DSAA 4FLFA 7YASA 2WU3A 4DMFA 3Q0TA 3DEAA 1TCCA 4ZGBA 3AJAA 1XZDA 4PW0A 4INZA 4E11A 5AM3A 1BE0A 1UK6A 3ZI7A 3FLBA 2UZ0A 3DL7A 2BCEA 5JASA 1GQSA 1ZJ4A 4GLBA 4H7KA 2C4HA 2EDAA 3R3WA 4AN1A 3H1AA 1MPXA 1CQWA 2WIKA 3F98A 5I8PA 2G4LA 3KXPA 3D2AA 1XZGA 5EHQA 1SC9A 5T4HA 1F0PA 3V1LA 3WWEA 3O9VA 4B6GA 4YASA 1UFOA 5D3KA 5A62A 2XMBA 4Q3KA 2QT9A 1CFJA 4K6KA 4FHZA 3O4HA 1ACJA 4YK7A 1CUSA 4C4XA 1U8EA 4Q05A 2OG1A 5AK3A 1E8DA 1Q0ZA 4BBZA 4EY7A 5K5EA 1JT2A 3O4IA 3IUQA 2QJRA 2B9VA 5E4YA 1EK1A 1DX4A 1IZ8A 1RP1A 4H0CA 3I6ZA 5LP1A 5DTJA 3ESCA 3C8DA 5ALRA 2AXEA 5A6VA 2H1IA 1YA4A 2O2IA 4B0PA 3B12A 4F21A 3GROA 2PM8A 2VSQA 1XLVA 1LNSA 3I6MA 1Y37A 3K6KA 1UOQA 5DYWA 1YAJA 1AGYA 3WA6A 4BP8A 1R9NA 4OPMA 2HU7A 2QS9A 1QIGA 5DNVA 1ZICA 5CT8A 2PU7A 2ZJ7A 4W1PA 3IA2A 2CEKA 3C45A 1IVYA 2GYVA 2BKLA 4BDTA 5A7FA 2C0QA 5LZ5A 4UHFA 3QYJA 4U2DA 1MO2A 3FAKA 3FNBA 3FYUA 1ACLA 4EY5A 4EY8A 4BCCA 3EF3A 2IITA 5ALFA 4QDTA 4BVLA 1CUHA 2O7RA 4ZV7A 1EB8A 4Y2TA 3G9TA 5JAPA 5JIBA 2QUBA 3BJMA 4CIAA 4CG3A 3WWPA 1TK3A 2RI6A 4GXNA 5CXXA 5DJ5A 4X90A 5ALVA 1VOTA 5H3HA 3G0DA 2FX5A 3WWOA 4PV7A 1P0IA 5KWJA 1WB5A 2WU4A 4UBLA 2XMGA 1JMYA 1LPSA 2W22A 5AH0A 4X85A 3PF8A 4I4CA 3O4GA 2PUHA 3V1MA 4XX1A 3LIPA 4CIBA 3QH4A 3AFIA 4OB6A 4N5HX 2QJWA 3BE8A 3G9UA 2QKYA 1UKCA 4PNZA 4UBKA 5CBKA 3MGAA 2X8BA 1LLFA 3C6BA 1W76A 4GWLA 2WIGA 5ALNA 3FLEA 4WDQA 4ARBA 1XRQA 3S8YA 2C5FA 3AZOA 1CEXA 1ZD4A 1KU6A 1ZI6A 4H7FA 3W9UA 1ZJ5A 4DNQA 4G4JA 4OU4A 5A2GA 5ALYA 5AOBA 4BZWA 4L0CA 1UXOA 4FBMA 3H1BA 1VE6A 2ECFA 1XZCA 3ZLVA 3U1TA 4C87A 3NGMA 1WB6A 4Q3OA 2VT7A 4N5IX 3ZLTA 1DTEA 1YSCA 3FYUB 4N8EA 2DCMA 3OOSA 6YASA 1HL7A 1O6FA 3KWFA 1UOPA 2VTVA 1HDEA 2WQZA 4X92A 2OCLA 3R3XA 5C8VA 4LYDA 1CLEA 4YX9A 4H7EA 3H2KA 3F9CA 4W1QA 5JAHA 4O08A 1VXRA 5FKJA 4UBJA 1H2YA 5CH5A 4Y2XA 1WB4A 5JAOA 1TCBA 1EXWA 1DWQA 4QZVA 1MX5A 2VJAA 1BN6A 3FOBA 4RPCA 3ESDA 4G4IA 3JW8A 4FKBA 2ZYRA 1R1DA 5FXMA 4MWTA 1QO7A 1SCKA 1QZ3A 3I2HA 4EY6A 1U65A 4X71A 1Q0RA 2PX6A 3IBTA 2WILA 1J2EA 4ZI5A 4QWWA 3W06A 3R41A 3STVA 5IVDA 3HXKA 3V1NA 1XZLA 3DNMA 4JEIA 2I78A 1J1IA 3WYNA 1BROA 4X94A 1YS2X 1DQYA 4BC1A 5HKBA 1IUOA 2CB9A 2PUJA 1ZGCA 2YASA 4AMZA 4V2IA 4UBNA 4UPDA 3STUA 1IUNA 1XQWA 3CXUA 4Y2PA 5EIAA 2X76A 2H7CA 4KJXA 1XQVA 4GDMA 1H22A 2JGIA 4X97A 2HADA 5CT9A 3QZUA 2JBWA 4P9NA 3LCRA 5JZ9A 3WIBA 4KRXA 1YCDA 4Y2RA 5E4JA 2XUIA 1QIEA 3VXKA 1XRNA 4J0HA 5FLKA 4AZ3A 2PSJA 2JIDA 1QLWA 5AKKA 1UKAA 5K3BA 5EHZA 2XMQA 1K63A 1FFAA 4B84A 3A6ZA 3D2BA 1RWQA 1USWA 3IB3A 5EFZA 3KDAA 1EHYA 3EIOA 2R11A 2K2QB 5AICA 1IZ7A 5JZSA 1WHTA 2GZRA 1MX1A 4LXHA 2QXUA 4C6HA 2JGMA 4AO7A 2AJLI 1M33A 3QMMA 4E14A 2GZSA 4FWBA 4TPKA 1T4MA 2RHTA 5ALJA 2J3DA 2AJ8A 3AIOA 3O9MA 4MXDA 4LXIA 4Q82A 4KAJA 5ALHA 2Z5GA 1FFDA 4J0JA 3WK6A 4DNPA 2WFZA 4WY5A 2QTBA 2YYSA 5D6OA 4ZREA 1SCQA 3ZPXA 1A8QA 4EZIA 4D9JA 3C5VA 5ALUA 3R3VA 3FSGD 4FLEA 2NW6A 1MNAA 3R40A 4I19A 4WDRA 2H7YA 1DQZA 2XLBA 1CUUA 4HXEB 3WK9A 3AIMA 2H7XA 3QPCA 4RGYA 5K3CA 3FBWA 4QA9A 1LZKA 1NU8A 4BB0A 5DLPA 3WZMA 1ORWA 1ZGBA 3A70A 1BS9A 4K5QA 2WG2A 3I6YA 3LLCA 4GBGA 3EBLA 3DQZA 3TRDA 2AJBA 4IH4A 5IVKA 2QM0A 2GBFA 2Z8XA 5AKHA 2OLEA 3B3QA 3GELA 2HA5A 1YS1X 4FNMA 4B80A 1RYYA 3WK4A 3H2IA 5LZ9A 4GW3A 2XMSA 4B7ZA 5HFNA 3FCXA 5IVHA 1ZIYA 2ZYHA 1C4XA 5ALPA 4F5ZA 1ETHA 2Q0XA 5ISMA 4OUKX 5ALEA 1W6RA 2HA2A 4KR0A 4DM7A 1P0QA 4P93A 2OXEA 4X00A 2QUAA 1QONA 1N1MA 3IURA 3NOXA 2WHPB 4PO3X 4C4YA 3BDVA 4BE9A 4MEAA 4MQLA 2ACEA 5K3DA 3WZLA 4AO8A 5AKGA 1DU4A 5K3FB 1U2EA 5LKRA 1L7RA 3IUMA 5AOCA 5ALKA 4AO6A 5HQ3B 2HU5A 1J07A 2XMCA 1FFBA 3CN9A 4LHEA 5HK8A 4B9EA 3OTQA 4L3WA 3UUFA 4U2CA 4IO0A 1CUAA 1WPXA 4QEKA 4K6HA 4ZRDA 2ORYA 5BV7A 5CH8A 4KE7A 3I28A 3ZV7A 1JJFA 5AOAA 2O2GA 1CQZA 2CUTA 5CT6A 3BL8A 1G5FA 3M3DA 1XQYA 3T52A 3AUKA 2WKWA 3VKFA 2XUDA 3I2GA 3Q8WA 2ZVDA 4UFNA 5HF6A 2D5LA 4MYSA 1QFMA 1AQLA 2PVSA 3D4LA 1S8OA 2CJPA 5IH7A 1MAHA 2VEOA 3MUNA 3FVTA 3E1GA 3FWHA 3WI7A 2VATA 3LIIA 5K3EA 5AP9A 5CT4A 2I3DA 3BWXA 1OXMA 1THGA 3UMJA 4CG2A 3G0IA 1MT3A 1SCIA 3TEJA 4E46A 4QLAA 4AN0A 2OCGA 3U0VA 2DR0A 3NWOA 4K6GA 1N8SA 4G8BA 1ZIXA 5FUMA 1E89A 1JKMA 1EX9A 2WLSA 1CUVA 1XQXA 1QIIA 2WUGA 4QLOA 3IUNA 2OGTA 1CIJA 4G1FA 2WG1A 2HA0A 2XE4A 3HI4A 3DKKA 4EBBA 4Y2UA 1FSSA 2CKMA 3I2KA 5K3FA 5IKXA 1EVQA 2Z8ZA 4JUIA 2VQ6A 3H17A 4AXBA 5LYYA 4G4GA 2C7BA 1AURA 4RNCA 2BGRA 1FFEA 3K2IA 3QITA 3VJKA 2VF2A 3STWA 1R9MA 4EY4A 5FP0A 1ORVA 5AM1A 1CRLA 1ZI9A 3R3UA 4BP9A 5FRDA 1EA5A 4U2BA 1YR2A 2ONCA 1P0PA 5AM4A 3WKCA 4QDZA 2GBCA 2PL5A 2DSNA 2Y6VA 3QVMA 3DLTA 3WIOA 3X3HA 3D59A 2B4KA 5EGNA 4L72A 5KBYA 3FSGA 4N8DA 4YPVA 3D5EA 1PFQA 4HRXA 5EHXA 4FFWA 5ALXA 3KWJA 3I2JA 2JF0A 2ROQA 5CW2A 3G8YA 1QIHA 2XDWA 1HLGA 3QM1A 2PSDA 2XMDA 3SK0A 3GUUA 4KAAA 1QIKA 2C5GA 2QR5A 1K8QA 4HXGA 4LIPD 5LKAA 5ALIA 4BRZA 4IHAA 3QPAA 3DL4A 3DS8A 5AI6A 4JYPA 4FBLA 5ALTA 2XMRA 2X5XA 5JAUA 4W9RA 4J0GA 1CUGA 3DOHA 1C7JA 2WHQA 4AMYA 1HQDA 4B82A 3H2GA 3RK4A 2ES4A 4Y2JA 1Q84A 4MWSA 3BF7A 3I2FA 1SOMA 4J0DA 3ED1A 3I1YA 4OD0A 1CUCA 2WIJA 3BIXA 3O95A 4Y7DA 3M82A 4C89A 4KRYA 3WL5A 3V9AA 3G9ZA 3I2IA 2CMFA 5HF9A 2ZYSA 2VA9A 4BATA 1D07A 4W63A 1GGVA 2WFLA 5AJHA 4EUSA 1B41A 3S2ZA 1LPAB 4HRYA 3W2TA 5HQ3A 4G9GA 1GZ7A 2PPLA 4BVJA 4MQMA 4P92A 1F8UA 5AKXA 3QMVA 4X6XA 5JANA 5BWBA 2XUKA 1C7IA 2DQZA 3CN7A 1BEEA 1HBJA 4RE5A 4U2GA 2FJ0A 4J0CA 1E66A 1VA5A 4Y2SA 2C0PA 3EQ8A 2DFPA 3GBSA 3BF8A 5FDFA 3KD2A 2HA3A 4K2AA 1UKBA 5ALDA 4DTCA 5HK9A 2WIDA 4X91A 4DGQA 4CI9A 5D7BA 1GKKA 5T4BA 2HA4A 2O2HA 5C8ZA 3FCYA 2GBIA 1EK2A 5AKEA 4DMHA 4BCDA 1X70A 4ZWNA 3WWCA 3DYVA 1MU0A 4UBOA 1YB7A 1MN6A 1CUDA 3V48A 4H35A 5JD6A 1IMJA 3FYTA 2QXTA 5AKIA 3WKEA 4N8SA 3O4JA 3ILSA 4ZV9A 1H2ZA 1AMNA 3HYSA 2OPHA 3WL7A 4DNOA 1N5RA 2JGKA 2LIPA 2ZJ6A 3HZOA 4Q1VA 3H0CA 5A7HA 1TIBA 5AK5A 5AI0A 2RIPA 5HF5A 3H19A 4UHBA 4X95A 3W05A 1Y7IA 1X2EA 3DJYA 3DOIA 3M81A 2WJ6A 5J3JA 1P0MA 4WJLA 4J03A 1I6WA 2GYWA 2VT6A 1LPMA 2PSEA 3DD5A 2G63A 5AM5A 1XKLA 4NS4A 1JMKC 4UHCA 4BYMA 4J0KA 5I9IA 4QDOA 4DMCA 4OB7A 3G02A 3BXPA 3QPDA 2QZPA 3IIIA 5AHXA 4C88A 1R4ZA 4DNFA 5JARA 1XZHA 4AB1A 1XZFA 2J4CA 1CUJA 2XB6A 3CCCA 5DWDA 1XKTA 2BAGA 4MJ3A 4KAFA 2WHRA 3VVMA 3AZQA 3IUJA 2HHAA 1NU6A 4UHDA 1XZAA 5AM2A 4QDUA 3N0TA 4U2FA 5AKZA 1YASA 4PSUA 4WFKA 1OCEA 4HS9A 3WJ1A 3WWDA 4OCZA 3HABA 4P08A 3STYA 3AZPA 4OYYA 1Z68A 5A7GA 2XQJA 4DSZA 1L7QA 2WTMA 1UT6A 1UZAA 1UWCA 4UBIA 2H9YA 3WLAA 1PV1A 1VXOA 1GPNA 2WFMA 1A8SA 1EDEA 4QWMA 1R50A 1QIMA 3JYHA 4EA6A 3OG9A 3VVLA 2XUHA 3C8HA 5ESRA 1A88A 2RHWA 3QMWA 4KEAA 4Q3LA 2RONA 3IULA 3VISA 2PBLA 2HA6A 3K9BA 5AM0A 3NUZA 1TQHA 4J0IA 2OCIA 3E0XA 5EIEA 4UBMA 3EQ7A 1ISPA 3A2NA 4C4ZA 4DIUA 5JYCA 5DTIA 1A8UA 3SC2A 4AX4A 4UHHA 2PSHA 5ALQA 1Q83A 1VJ5A 2QVBA 5BOVA 5LIPA 1GPLA 3WKDA 3G0GA 5KWIA 2I03A 2FJPA 1N5MA 1QTIA 2EEPA 2BUBA 4M0MA 1W4LA 2XQGA 4XIIA 3F97A 2WUEA 1EH5A 1W1IA 2GBGA 4WY8A
chains in the Genus database with same CATH superfamily
1JH8A 1ZEJA 3LQFA 1HTWA 3LDFA 4PBRA 1M5TA 4JOCA 4CCSA 1QRAA 4KP7A 3E2IA 1C9EA 2IZ5A 3PDIA 2FRDC 2VHYA 1NNSA 2VP5A 1U8FO 5CVUA 3S68A 4BLTA 5B7QA 4CV2A 1PHRA 2IOYA 4Z4IA 3R9XB 3H99A 1RXIA 3HPQA 5JNTA 2OHJA 4KU4A 4MYDA 4EW1A 1TTTA 1KZ7B 5JS7A 1W5EA 4DG5A 4TT3D 4E15A 4GDFA 2EZ8A 1YK1A 3E2PA 4ASUA 5JMWA 5K4GA 1FTQA 2WUFA 1BCSA 3D0KA 4CMIB 4YMVA 1PWZA 3FOWA 5ERXA 3TQQA 4AAYA 1FP4B 4KR9A 3ZDXB 5LA6F 4MWEA 5BQ3A 4YRJA 1TLLA 4HTFB 4Z7OB 1GKUB 2EDCA 4JYMA 1JG6A 1Z75A 1TIPA 4FSDA 5GGXA 2VK2A 4FEGA 1L4FA 2XUQA 2Q9UA 3E9YA 1S1CA 3HSSA 4Q16A 1WO8A 3IDQA 4Q4JA 5CYPA 2IP1A 2PUWA 2VPPA 5HEKA 4EPYA 3LQYA 4HXFB 4G8JA 1JDUA 4NULA 2O06A 3NO4A 4W5TA 1QO9A 2ZQYA 4K46A 5DYTA 1H2XA 1VZ2A 2I1VB 4DLAA 3DZKA 2J33A 4FE4A 3QX8A 1LI7A 1XD2B 3KWLA 1Q1BA 3W4JA 1Y1TA 3HKDA 1POXA 1R0RE 2H59A 3MWEB 1KAOA 4Y2HA 4HMOA 4JJ6A 3B51X 2J0EA 3ES9A 5DIFA 2QT0A 3DUFB 3PYMA 4NENB 4A7PA 4B6OA 2KI5A 3MTIA 4ARZA 1Z2PX 3DKRA 4RLSA 2M6LA 3TD9A 4YAKA 4HDRA 1Z74A 2XGMA 4IZOA 4UM5A 4C14A 1PLLA 4BASA 2ONYA 5ALSA 2Q2VA 3B9QA 3L02A 4EY3A 3UXMA 4V0LA 5D85A 1WEHA 2PY6A 4OM8A 4UM8B 1QH8B 2OBXA 1CZRA 2G88A 3IKMB 3MVEA 4Q7KA 2OYCA 3M5CA 1OAOA 3CZMA 4IGAA 1FCJA 3EAQA 1PWEA 4F8EA 2JLSA 2DT5A 5DTMA 3C39A 4TUYF 5F3WB 1PFUA 4NCJA 3LECA 1QORA 4I3HA 1X92A 4Q34A 2XEXA 2B35A 3ENWA 3SEQA 4NCHA 4NBVA 4L5IA 2GXSA 3DEKA 1K6MA 4JBGA 5DNCA 1XEXA 3ADOA 2C9CA 2BH2A 1VA4A 3WYBA 4CCYA 2G1UA 1ZAKA 3EA0A 3N86A 1XNJA 4RCYA 4F6CA 3KBOA 4D4IA 4BJ5A 4LGYA 4GRIA 4XSHA 2P9EA 2AKYA 5KNDD 2R8BA 3H0EA 1E6LA 1DS6A 2W2TA 4HUQB 3QNWA 4X20A 1D9XA 5CDSA 3SU8A 3OQIA 1E4EB 1SOAA 3ND9A 2OEPA 4NZPA 4NFSA 1EDOA 2FEOA 1OFUA 3KT3A 3LY8A 4DYHA 3CX7A 3LDUA 5A3RA 1MJGM 1TZCA 1G9XA 2AQKA 3LV8A 3FFAA 2ZT7A 4BFCA 3KLBA 4PFJA 5L8VA 5FR1A 1E5TA 4RTKA 1A98A 5IW8A 2RHJA 5LD2B 2VA8A 4J3JA 3F4LA 2Y9MB 3N2ZB 1RTTA 4WCVA 5AI8A 2V03A 2V98A 3K73O 3MEQA 3JAKB 3EPPA 6AT1A 1FMTA 3NANA 4Z51A 1WB9A 1CR1A 1A2BA 4Q19A 1G4AE 2QLFA 3T9DA 4XLTA 5GV7A 5L6LB 4RFSB 3T7IA 3WXMA 1N6IA 2Y2UA 3I05A 1UEJA 2I2CA 3EQZA 4IGIA 4Q4HA 4WN9A 3WO1A 1QQTA 1GNQA 1U1GA 3T3MB 2YW2A 4IYJA 4PCUA 1Z7YA 2G5PA 3EZ7A 5FOVA 4DXAA 2D6FA 1ZWKA 3TUJC 3NHZA 2WSLA 3MW8A 3K0AB 3Q88A 1V5WA 2NAFA 1U7DA 3RRXA 3GLQA 4E5VA 1V47A 3A1EA 1YVPA 1PUXA 3C3YA 3RYIB 3TB6A 2QTTA 1ZCZA 2B1IA 5L3ZA 3V8VA 5A9RA 3JQ8A 4MCAA 1QHFA 2IYOA 3ORFA 4JT4A 3I5YA 3NBKA 2FHPA 1PJAA 1NZDA 1EP2B 3N59A 4IXNA 4KPUA 5CLFA 5CFZA 1I0IA 4B83A 4EVQA 3A6PC 1L5WA 1A9RA 3OLCX 1XO1A 4LGVA 4FFLA 1AUOA 4FGSA 2WM2A 4HMQA 3PE3A 1IOVA 4HX9A 3AVPA 1E2DA 5JXIA 2GN9A 1AUXA 3TUZC 5ES4B 2CHVA 221PA 4U7HA 4GVXA 1TUEA 3AHDA 4XCQA 4B74A 3VKHA 3C7DB 5EWLA 4AXXA 3TN7A 2PA3A 3EGXA 1T26A 3B6JA 1Y9EA 2VWHA 3JYPA 4MPRA 2FEXA 2C5BA 4A0SA 1NP6A 1H93A 1QVVA 1QE0A 2OGZA 3CPSA 2PRKA 1IXKA 3MT8A 4JUDX 1ZHOA 1P61B 3R5TA 1XLWA 1G16A 2QOEA 1HOXA 2EKPA 4IY1A 2P6MA 1U0HC 2R6FA 3ICQB 4TV9B 4JJEA 1U8CB 1ID8A 2IF2A 2FFQA 1B00A 2JGAA 3D6VA 1VHLA 3JS5A 4UFPA 5ICMA 5KYXA 1J1UA 1PR3A 2VJPA 1Z9BA 3DMTA 3ANMA 3GWGA 1D9ZA 4JLUA 1H5UA 1I14A 4BUCA 4Q4DA 4AJKA 3EVTA 4BJ3A 4EDHA 3WNQA 1JYEA 1MJHA 2PUCA 3S28A 3LCCA 2H5LA 1WMEA 5DNWA 3U4GA 2I8LA 2J9FA 2JCSA 5T5QA 1XCPA 4P7BA 4PPFA 4FGUA 3ROGA 4C4SA 4UMDA 2AOVA 2PT7A 1IHXA 1O58A 1O87A 2ZOSA 4H6PA 4RLHA 4UEOA 4CCYB 1ZD3A 2ATCA 3HBMA 4A8TA 1CJVC 5AJUA 2OA0A 1WUJS 1YL7A 3FDZA 1U0EA 2HJGA 3HZZA 3R3ZA 2AUMA 3WGGA 1HT3A 1T0UA 3JU3A 1DMSA 3I5UA 2WJAA 1KDTA 4RK7A 1HYGA 5AK6A 3HFGA 5FCDA 4BNHA 2C57A 2Q1TA 5DZSA 2Z2KA 4I8DA 2R97A 4GKVA 2FGKA 2YMPA 2PVCA 1P5HA 4LF7B 3VR3A 5GADl 4M88A 1QFSA 3U81A 2H2WA 2DETA 3GEDA 4ALLA 4AD8A 2AI3A 1R5OA 3P2KA 1GL7A 4WZBA 2HU8A 4W5QA 3RGWS 2J09A 4P5EA 3R6GA 2QUIA 4RU1A 1M6EX 1QGUA 4LHSA 5C5CA 2AI1A 3WLLA 3ZCSA 1N25A 1OLOA 3PR3A 5BYBA 1O9HA 4BEJA 3LP5A 4C3ZA 2HMWA 4QGFA 2JATA 1VPTA 1RE0A 4FM9A 4KXLA 1GT6A 2QAGC 4G5GA 2V7PA 4KNYA 3AONB 4P1ZA 4LMRA 1Z29A 2P6UA 3WMEA 2CE2X 1KU0A 1NQVA 1OA1A 4KHZA 4O4HA 1KI6A 2VAPA 3ER6A 5CA0F 2VAXA 4YCLA 4M8NE 2Y1KA 4QPNA 1Q11A 3JTMA 2QD4A 5C4IA 4JV5B 2PGNA 3UICA 3PEUA 4K40A 3ROEA 3W90A 1KI3A 2C5LA 2IVFA 3EA4A 1L1FA 4C6TB 4C21A 4YAIA 4Z49A 2PUFA 2VCEA 1V4BA 2ZBRA 1Y4DE 1U3FA 2O48X 3EIXA 3EXIB 4O2BB 8MHTA 4JHLA 3AVTA 3DXZA 3IHLA 2AYYA 4Y2YA 2PT6A 9MHTA 2SNIE 4DM3A 2CNNA 3TTWA 5L3RA 2I6SA 3V4PB 1NHWA 1SXJB 3VRHA 5BNTA 1U2DC 1RADA 4I66A 1QCYA 3BREA 4CKWB 3H18A 1JQDA 4MI6A 4LY9A 1I2ZA 1QGED 2FPUA 5TF4A 3VZCA 1OU0A 1ODTC 1YACA 3TNLA 2ZRHA 3GPDG 3FF4A 4F06A 4KE6A 3WP0A 5IZCC 1FYDA 1WCV1 2DBZA 1MH1A 1PK7A 3A1TA 3MTQA 3L7JA 1KYZA 1LI4A 3RUIA 3ZXSA 5MN4A 1U31A 5CA1B 1VMAA 3K70D 3HVUA 4YRMA 2G09A 4JLAA 1L3BA 4FNGA 4M21A 1E3SA 4EI2A 3LX6A 2O7VA 3ZVKA 4AJEA 1Z3CA 5M29A 1WULS 3CLSC 3FHLA 4R2KA 1X1TA 1WMFA 4H18A 4E09A 4MUAA 5B55A 2V4MA 1GYPA 1UADA 3D2CA 4JLWA 1U99A 5KB3A 3NEJA 4CM1A 3FVVA 1FTGA 5K2OA 2CFRA 3FLAA 3GRCA 4DMKA 1PGOA 1QE3A 2YOHA 1DKPA 3FOZA 1FUYB 3LF2A 3VNRA 2VHJA 1X1RA 3V7UA 3ZE9A 2G67A 1JJIA 4L7VA 1IBCA 3R3YA 1RXCA 3NBYC 4TRNA 3OFND 5K0CA 5DDIP 1JG1A 4O2RA 3GNSA 1SVSA 1KQOA 2NGRA 4JSRA 5KX5A 3BGWA 2PR2A 3RU3A 1MC4A 3DONA 2J0SA 2CHEA 2VJCA 3LUHA 4NV0A 5LMCA 3G2OA 2F1IA 5CA0A 1WXFA 4LTNA 1OI4A 3RVPA 2O8FA 4WFIA 4BKRA 2PKXA 1WCIA 3D7RA 1PR2A 1HM5A 1XZPA 3ILYA 3SYNA 2JKVA 4ER7A 5FT9A 5LZ2A 1A4IA 3D6TB 4A91A 2P3LA 3WIVA 2H11A 3FBGA 3WYDA 4RE6A 4ZT5A 4G0UA 1NLYA 4EHNA 3TL6A 3PXBA 1MGPA 4YJFB 3D6FA 3DHVA 2H17A 3VAAA 3F5DA 2J3JA 2Y1FA 4O59O 1CIVA 2WZQA 2OCKA 3K4HA 2C8LA 4YAJA 1LBTA 3DZIA 3UJAA 1AT1A 2O5EA 1QIFA 1QHYA 2WK1A 1YVDA 3SXJA 3GLIB 4GQBA 2BFEA 1Y63A 4RHCA 1DUSA 3ZNOA 4DV1B 4ZAXA 2AFIE 5FV7A 5HZMA 3RIXA 3R20A 2VO1A 3EG9A 3PC6A 3GYBA 2Z3WA 4MYHA 4R0MA 1WBDA 4ZOBA 4MSUA 4BDSA 1UM8A 3HWRA 1DXOA 3WADA 2AYXA 4FZ5A 4HAIA 1CZOA 1KI4A 3UMCA 1ZAYA 2F1JA 4AM8A 1FL9A 1SQFA 3IC5A 1LTQA 4UZFA 1WP4A 2WF7A 1G8MA 3EK2A 1DJNA 4Q66C 4NYMQ 3WLRA 3O3MB 3JWEA 5CFPA 3T3IA 5ICGA 5ELLA 3D4NA 1PKEA 5EIFA 1XZBA 2V7TA 2H51A 1N8NA 1ZMBA 2P9QA 3MMSA 1NJ8A 4ZT3A 5I7VA 4ZYTA 4B09A 2ZBDA 3BSSA 3U6KA 4Y6QA 3GZTB 4QQNA 1NNLA 4YTEA 2QX8A 4E21A 3R6DA 1Z2EA 1TDJA 3PQ5A 5LXTF 2IH2A 2J3QA 3O1LA 4A1FA 2HDWA 3HU1A 4KLZA 3RV4A 1YRQA 2HA7A 4B17A 4PNPA 2WAMA 1E1LA 1WHSA 1NQ5A 3I3OA 1HPLA 4B7XA 4WK4B 3R0VA 3UWOA 1VG0B 1XIVA 1TAHA 1R6BX 2J8ZA 3KJNA 5C81A 3GLHA 1NI3A 4MINA 4UUQA 3BICA 4YAWA 1B8OA 1E59A 2GVDC 1JNXX 2H85A 4PIMA 3U3DA 3AM4A 2IZ7A 4BO7A 4YRKA 5IXYA 4HZGA 4IGFA 3DCYA 2GEBA 4AG6A 1LU9A 3C6QA 3K09C 1KEWA 5IHPA 4LJYA 1YRYE 3U9TA 1J9ZA 1GQRA 2GBPA 5JNRA 2AUTA 4BFVA 3QI7A 2HY7A 4TS1A 3AOEA 1QQAA 1UK8A 3CW2A 4Y9SA 3G89A 3ML1A 9LDBA 1ZD8A 2VL7A 4PICA 1D4AA 3BZWA 1SUEA 4WXPA 1OAAA 2YCBA 4C0LA 5I7WA 3GPLA 1BJKA 4HWTA 4ZKEA 2FW0A 5BSVA 1N2ZA 1SKYB 1O95C 3O91A 5BT9A 2I7DA 4MP3A 3EJWA 2FU5C 1SQ6A 3TPZA 1FU7A 5PGMA 4LCEA 3G2LA 4MQFA 4YQZA 1O96A 4WAUA 3EZ2A 2LKDA 1LPPA 5AW0A 5KX5B 2XD4A 1UPFA 3O26A 4E7PA 3ZBTA 2V7XA 1GOTA 3KOOA 3PICA 1RXUA 4L0DA 5COAA 5DO9A 2CKDA 5H3LA 5IJ0B 4Z1MA 5KVCA 4DIEA 3R74A 3D3NA 1FFWA 2AG5A 4K8OA 4URYR 4DWWA 2EXXA 2A1UB 4HQNA 1JLLB 3ACBA 1SUPA 2QE7D 4R1NA 4TZ0A 2HM7A 3K6RA 1Z33A 4B2LA 5AVWA 1HH4A 3FJOA 3T1HB 1JSLA 3ASVA 3DW3X 2H18A 5IN5A 3UXEA 3OCJA 5KOYA 2VDUE 5AW8A 3LFTA 3HJGA 2VPQA 4QO8A 5DBIA 5DN9A 1W47A 2RGBA 4WOBA 2AMVA 2GM4A 2WD9A 5FPKA 1C0IA 3ZY6A 4DANA 1Y3HA 5KSWB 4IQ4A 5JWOA 4Z53A 2AF4C 1RAHA 3B3FA 4R9VA 4Y2GA 4YNBA 3UGTA 1CZLA 1NA5A 3UUWA 4QLBA 1DZIA 3WNCA 2JGEA 2MINA 3L7KA 1IN7A 1R64A 1CR6A 4DRXA 5JJIA 3EQ9A 3N6VA 1Z5VA 3Q2OA 4G86A 4B71A 4JQCA 4BWYA 3NOVA 3SZOA 5C1DA 3PA6A 3U3OA 1B2LA 1SGWA 2CBXA 2H00A 1DG1G 2VG8A 1FFXA 3IPRA 3V46A 4B7AA 4UU1A 1NF2A 4FEAA 4YB8A 1WXHA 4EITA 3PGVA 1CUXA 2GNOA 3ZDZB 5IXSA 4WK0B 2C2OA 2A9KA 2J07A 2OQIA 2QTWB 5C0OE 5AESA 2AKAB 5BQ5A 3EPHA 1WTCA 3IP9A 1GG2A 1XKQA 3IO3A 2O0MA 4QQKA 5TQVA 1RI5A 2HK8A 3OM1A 4QXQA 3GCWA 3QV2A 4RPIA 3AFGA 4OL0A 3WYCA 2VJDA 1CUYA 5JS8A 3UZUA 5H3CA 4R4JA 2J41A 1C1HA 4F2PA 2DC1A 1SZCA 2ZRKA 3WLIA 4EF4A 5AFSA 1Q1AA 3OCCA 2AWOA 2XUOA 3U17A 4GP6A 1DC6A 5C35A 5LNK6 1O6GA 3KVYA 4IKEA 3RNOA 4QKQA 1KI9A 3BILA 3DNPA 4MUGA 3ZJTA 1B15A 3HYCA 2J3MA 1JJBA 1ZJ6A 3LUJA 3UV3A 1SUDA 3SWWA 2IX3A 3H2JA 3IQDB 3QVJA 3KKKA 2AG0A 3M89A 1G2PA 1JTFA 5FV4A 4MIYA 5CJPA 3DG9A 2CJWA 1RZRA 1Y5NA 2B25A 5D3ZA 3TZQA 1F2VA 3D6MA 2C9BA 2JGFA 1YB1A 4ALIA 2DHCA 2AT1A 1WVGA 4JU8A 4A82A 4MV4A 4B4UA 4R71A 2DPLA 4JP1A 3ADDA 4L8WB 1GTZA 5CLLA 1NAIA 1ZZGA 3TQHA 4Z4HA 4MUFA 3CVYA 3TJMA 4N5MA 2ZRDA 3WKBA 2C4UA 2GXQA 2R5WA 5EQFA 1XALA 4N5NA 4EG7A 1GPJA 2PX4A 3A6GA 3P4UA 4NDNE 1IM8A 3PFCA 4PO8A 1AJEA 3OICA 5J23A 3EGDB 5DXFA 5AI4A 1T3LA 4NF2A 4YMTA 1QHHA 1O4VA 2QEQA 4QQ8A 5GV8A 2YXBA 3ZVRA 3TKYA 3ZQKA 2QMQA 1FQJA 4PGMA 3TBHA 1E1QD 4X6UA 4F7WA 3TR5A 4RQBA 3SS7X 3QVXA 4G5XA 3RR2A 4TZ6A 1LJ8A 3PWSA 4C7MA 4OF4A 4ER5A 1IDN1 3DPUA 2HFJA 1T3SA 3ZH2A 2A57A 1NY6A 5HCUA 5JZMA 2A9RA 1LGYA 4LOLA 5WRFA 4ANFA 1H05A 1QHSA 2ZULA 5I51A 2OD9A 1RBYA 2FZ5A 2ENUA 1IDOA 1RWOA 2AN4A 1E3MA 5IUNC 5F76A 1WMBA 2I3ZA 3T0GA 2E2WA 4MQEB 1PBTA 2ISCA 4G8CA 1R4NA 3ZHCA 3VJLA 4QGSA 1DAIA 1WABA 1M6YA 1S9DA 3EIHA 3O8QA 1W85A 4LE0A 5AW7A 5ADUS 1QFYA 3IPLA 2JI7A 1PT7A 3LBFA 1XZKA 2A1UA 2HGSA 2XQKA 2QMHA 4H08A 1NMXA 3I04A 2AEEA 2JFXA 4EL0A 1JNYA 3KQTA 3IBSA 5K05A 4HWKA 1SC1A 2ETXA 4O4IA 5DLYA 3W5HA 2YXNA 2YZ2A 1NX9A 1WQ3A 3KZXA 3LXUX 3OZVA 1UOOA 3D2LA 3ZGYA 1MEEA 4BOYA 4C7VA 1TB4A 2WT4A 3C6XA 3V42A 3BJRA 4BNYA 4CN8A 2I4IA 5LU9A 4EENA 3U3ZA 2GKSA 4OJTA 1AX9A 3A1WA 2NU8B 1P5RA 2AOUB 2WJGA 2BCGY 2HSGA 2O50A 4PRZA 3C4QA 1EFRA 2Q3EA 4MR8A 4QPCA 4EEKA 7REQA 1V26A 2MR6A 3T54A 3O75A 3B6ZA 1KQ3A 3HC7A 3I1IA 3M83A 4HSGA 3GW8A 4LMPA 3LS2A 5G1NA 3WA7A 5EP1A 1N32B 1YMQA 3TI7A 4HWSA 4LYHA 4D4MA 1GT91 4X61A 3R4CA 2PD3A 1X8LA 4URXR 3SX0A 5AHWA 4MGEA 2FEPA 4UCFA 3B7GA 4HDSA 2O6LA 3L6OO 3O38A 3EOAI 4AG5A 1MH9A 3ZJVA 3LH5A 4RW0A 1EFCA 2CMKA 3FZYA 3MMZA 4OQNA 3RK0A 4B43A 5LP6B 2PCLA 4IHJA 4XCVA 5SZJA 5HF8A 3RJMA 4MLZA 3ZLUA 1AA6A 4QTYA 3DMHA 3LW8A 4I1UA 3GJXC 4KOAA 5IH3A 3TK1A 4IDPA 1VBKA 4DA6A 5F23A 1Z63A 1H8EA 5CX1B 3PX2A 1XFDA 1FP7A 2I6GA 4G0NA 1KAQA 3A7DA 4E13A 1GN8A 3OPMA 3WMFA 3UAZA 4MTCA 3ADPA 3H11A 3OZRA 3PQ4A 1Q1EA 4P3OA 2BBWA 2JK0A 2P40A 1OA0A 5FLXA 1TUBB 3RRFA 4KMOA 4XH9B 4ZGBA 4KK3A 4P2BA 5EN4A 3W2FA 4G0VA 1XDDA 4CI0B 3MNFA 1O2DA 1Y1RA 3D8BA 2VC2B 4MQ5A 4A1OA 5KTPA 1YS9A 4R5MA 1J39A 5CAEA 3QIVA 1JG3A 3CHYA 2VHCA 3ITDA 3SOZA 5KTRA 1UK6A 1NUPA 3ZI7A 1E2PA 1L7DA 1R6AA 2ODTX 1VFNA 2LDBA 1XCOA 2NPOA 2BCEA 2WAAA 2DPXA 3W0LB 1N92A 1QF9A 2Q0QA 1ZJ4A 4G0XA 4UPEA 2BFFB 3LT5A 1USKA 1R6XA 2HSWA 4D9MA 1V1JA 4E08A 2K4MA 4HQRA 3VGJA 4OQLA 4MTLA 1KKMA 5KX5F 4WOKA 2IYFA 1B4DA 2YYZA 1MHPA 2Q3DA 5AVJA 3VSBA 3GPIA 1FIUA 5C46F 5K8JB 4OO3A 3CVVA 4EJ6A 2NOAA 3MWJA 3X1YA 4KWCA 4W82A 1QF7A 5EWJB 1H6AA 4IIBA 5GJCA 1GQOA 1H2FA 1E4EA 1OIWA 1XR3A 3BWYA 3DWFA 3IEMA 4MWCA 3QVWA 1FMJA 1N6HA 1R0WA 2I54A 1DQRA 1P2GA 3GXOA 1CQWA 1ZH2A 5JMPA 1G8FA 5TDHA 3RAGA 1E5QA 1A72A 1VIVA 1NN0A 2NZVG 2BIFA 2ZAYA 4TT8A 4TTJA 4ZTBA 2JB9A 3DV9A 4I8IA 1VB5A 1F1BA 1HMYA 5HQJA 2HK9A 1XZGA 1RYFA 1SC9A 4PAOA 2R6R1 1N8KA 4OREX 4XI9A 5EHQA 4X64B 5E8RA 1DO0A 2PG3A 1YR9A 3BL6A 2QQGA 3A9TA 1ZRHA 3TE6A 4RCVA 4OV6B 3WOHA 2FLWA 3IQZA 1PLKA 4AY5A 2RFLA 3HA3A 3T1QA 3CT6A 1ZFNA 4LYFA 5BV1A 4EKGA 2XT6A 4BVGA 1T4GA 4I8XA 1XAIA 3U13A 4ND5A 1J33A 5BVGB 4M7RA 4EQ6B 3O7WA 1VE5A 2WWXA 3KDPA 4D8WA 4MGIR 5A62A 3K0FA 4IJKA 3D7LA 4GKBA 1U0JA 1VP3A 1ULSA 2WJVA 3NHBA 4MKFA 4Q93A 3I83A 5E95A 4AJ9A 4FHZA 2ZUTA 4LJLA 3ZK8A 2O2YA 2JBHA 3G5AA 4E5NA 4R8LA 4PLHA 5B57C 5DXJA 2JD0A 2VP9A 1F5SA 1YVUA 3DE3X 3MLAA 1PFGA 4MNTA 1BXKA 1ZBDA 4OXKA 4N0PA 4YK7A 1CUSA 3V7YA 4L4ZA 1QKIA 1DCTA 3B60A 2W90A 2ZW9A 1FYEA 4NZMA 2VWQA 4UTZA 1TE2A 1NT2A 3BT7A 4RF3A 4R6XA 2OG1A 4P84A 4J8PA 4G0PA 4LJ7A 1P62B 5DNDA 2GFIA 2J5RA 1H1TA 3OQVA 3OFKA 2KQUA 2WKPA 4KPUB 3VPBA 4DABA 1EXDA 5EUQB 1HNWB 1W8IA 1TC2A 3IVGA 3UT5B 4MVJA 1H3EA 5HCIA 4CQJA 1UJ4A 4F9TA 2XVXA 1TM5E 3TE7A 3TFQA 3COJA 3RKRA 2BJWA 3P9YA 1Z7BA 3JD0A 3Q9UA 1ULHA 5DFAA 5IAAA 5EA2A 5IAOA 3H11B 1L4UA 1RQPA 2QTNA 4GOND 4XD7D 4MWZA 5E4YA 3VNQA 1EK1A 4AJOA 5IK2D 2Z2YA 5CW1A 1RP1A 4Q4CA 3I6ZA 5LP1A 2VHTA 2HYIC 1E9DA 2C3YA 1K8ZB 1UDCA 2FGJA 3O7MA 5C3UA 1RDFA 4MKXA 1KPGA 1ZA1A 3S0JA 4EGSA 3ZLJA 1FSPA 3TZCA 1YJBA 2F17A 2X23A 4DKJA 4TS4A 5JI2E 3HI6A 2F48A 2P5TB 4MYCA 1JVBA 2YBEA 3CWQA 1V37A 4B0PA 1Y5RA 1BFUA 1FEZA 1GL9B 3OTHA 3S8MA 3T95A 4B32A 2OFPA 1QMPA 1TTPB 1LNSA 3I6MA 4IKOA 1X87A 4J2HA 4ZZ0A 1XD8A 3JVUA 1MAWA 1RKXA 1HF3A 1Z82A 1XJWA 2PRZA 1VG8A 4WADA 4P0TA 4MX8A 1M1YE 2QDKA 1T0BA 2AG6A 1NQUA 1NX6A 2JAQA 1NM5A 5LUBA 3TNYA 5DYWA 2LRHA 4UNIA 5JH7A 3AEYA 1HEUA 4LOKA 1WE2A 4WN9B 3VO1A 4Q1DA 1YAJA 4ID3A 3VHRA 4O2BF 2NXEA 1GGFA 1M7GA 1W6UA 2VDRB 4I4NA 4BP8A 1WKVA 4CUKA 1BS2A 1R0KA 1XXHA 4M1YA 3D8NA 4IEFB 1BWRA 3T1NA 1GO2A 2QS9A 3FSEA 1VLZA 3WLMA 1ZICA 4BQEA 2H8KA 1ENYA 4GIBA 1O6ZA 1B8NA 2ZJ7A 2IU0A 3T34A 5BMVA 4W1PA 4PLFA 3L7NA 5FO0A 1R6DA 4GZLA 2G7MC 1Z0AA 1D5CA 2DPGA 1IVYA 1W8DA 2Y77A 5F1KA 4A5OA 1T5LA 2Q6LA 4R2XA 5A7FA 5LZ5A 3L1KA 1U6KA 4ZJUA 3OX4A 1DBVO 4DEVA 2OAQ1 3Q4GA 1MO2A 5EHIA 4NFHA 1XXHE 3D3WB 1QDEA 3EH2A 4CKBA 4TWRA 1ACLA 1JN0A 3KQMA 4W7IA 1HR0B 3LO5A 1JZSA 1BMTA 4EY5A 3FKJA 4V0KA 1NF8A 1C41A 3EEQA 1PJ4A 4BCCA 2IDJA 3EF3A 4C5AA 4YI3A 3V4LA 4R9NA 5B4UA 3L8EA 1CUHA 1GCGA 2VHZA 5LQCA 4EVSA 1YNOA 2QRHA 1X86B 1PVVA 2HIMA 3B9BA 1VGVA 4ZVQA 4W5OA 4HF7A 2XIQA 3A7EA 3G6WA 3G2KA 4RK0A 4EKDA 2PUVA 3ICPA 4O2LA 4Q03A 3P9ZA 4U0JA 4F4JA 4AIRA 4J4BA 4ARVA 2ACWA 2BE9A 1SR8A 5B4VA 3OPYB 3LDHA 1Z2DA 4RSHA 2IP2A 3G8BA 3E7XA 3ROQA 1XXLA 2X86A 4BNWA 3DMPA 1WDWB 1AKYA 2WE7A 4WL0A 3V8EA 4CMEA 1YGYA 1GJRA 4AY2A 3CUUA 1Z6AA 1Q7EA 1XN1A 4D96A 4XQ0A 4EYKA 3AY6A 4TS3A 2RB5A 4OH7A 1M2EA 5KWJA 6Q21A 5LL6P 2QRLA 4PHCA 4UBLA 3FJYA 2J7PA 4YCMA 2A0FA 5TIIA 1IM2A 1DQNA 2PV0A 3GX1A 1YQEA 2JFOA 5CDTA 4K9KA 5BOSA 3W8DA 4GOLD 4OUDB 4D57A 4XYLA 4KREA 2JA1A 3LUCA 5DBFA 4E2WA 4GQIA 5DBGA 2ZI5A 3LT1A 4QG3A 2UZIR 3QLJA 3O4GA 1NRXA 2A0KA 2PUHA 4DR7B 4JU9A 1OTYA 2JVJA 3LQ4A 1A77A 3GAMA 1F4VA 4MA5A 3LIPA 4JSYA 4OA8A 1O89A 3BZBA 4HAYA 3P0IA 4CIBA 3DTVA 1TFRA 4MKGA 3RVKA 4OFZA 1NWCA 1E2LA 3QBEA 4MW5A 4HRAA 5J4KA 4CKWA 5JLAA 2QKYA 5K0LA 4UE2A 2POQX 3FCUB 5CG1A 5CFLA 4PNZA 1ZCJA 2UVDA 3H1GA 1K68A 2DFVA 1Q20A 4ICIA 2WSMA 3ZGVA 5CHEA 1GPBA 3TIVA 1T25A 1TQDA 5IYZA 3EXG1 4UQPA 4G5SA 4GWGA 4ZT7A 2B7LA 3KM0A 5LBIA 1US8B 3MOSA 1KVQA 2IWRA 2FWJA 1T6BY 1NP3A 1JMVA 3QE2A 3QWHA 1C7RA 1ZD4A 2ZIEA 1ZI6A 2CVPA 5DM60 5T64A 4M4SA 3NWBA 4MRVA 1PNRA 3R09A 4CF6A 4OU4A 1EXMA 4PX2A 4DSNA 5CA1F 1NJFA 1KKLA 4JEMA 3ZHOA 5EE3A 2RH4A 2D1RA 4KIJA 1UXOA 4X8MA 2XVYA 1UP6A 3O3OB 4EFLA 4QELA 4UKDA 1E94E 3AY7A 4IMJB 1LK7A 3ZK7A 4C87A 2Q21A 3GFQA 1NV8A 1ZUD1 2JFNA 1Z18A 2AQ8A 1WB6A 3HPRA 1P9LA 3LOQA 1YSCA 4YRCA 4PSKA 4Q6BA 2DCMA 1LA2A 4C3UA 1QVZA 3H1TA 3OT4A 2QN8A 5K20A 2BKUA 1ZSNA 3VSCA 2IELA 1UINA 1QP4A 3EN0A 3KWFA 2W70A 4UMFA 1Q22A 4CLHA 1FDTA 4L1KA 2VTVA 3Q7SA 3MAJA 5CCXA 5IYZB 2O2ZA 2C7QA 2HDNB 3GLGA 2X9VA 2B37A 1LC0A 3CRRA 3PXGA 2IYEA 1L0BA 2WQZA 3BA6A 4HK4A 5CA0B 3WGKA 4KLAA 1ORRA 2QP4A 5F3RA 1NC1A 4FFOA 1J0XO 2ZRNA 1FS6A 2V7BA 3L6EA 4H1VA 3LJKA 1G6OA 4RD2A 2OCLA 3D6NB 3R3XA 4U7JA 4F3KA 5C8VA 4LYDA 1CLEA 1BDMA 2F67A 2QRMA 4YX9A 1XL0A 5C18A 1HYBA 3FCAA 4H7EA 4JYZA 4BKOA 5DXAA 3OJWA 2XECA 2YIDA 1T3HA 3MRSA 5JAHA 3W1WA 1JIQA 4O08A 2C7PA 1VXRA 2PR7A 3VVCA 5LWQA 4GSLA 5CH5A 3RBXA 2HT1A 4LYJA 3HFJA 1TMOA 2OQ2A 1H4SA 2X19A 1Y8RA 3RIYA 4KMSA 1DWQA 4OHXA 4I1SA 2J7KA 4JAVC 4ACAA 3PRKE 4I55F 3DV0B 5BSKA 4FDTA 1DEHA 1SKAA 3TQRA 2XJ4A 1QU2A 4B3XA 1CC1S 3QMPA 5FNVA 2OYSA 3ITEA 4FKBA 2XXJA 4R9UC 1XU9A 4Q7EA 1KXZA 3BMQB 3FMGA 4LPSA 1GLNA 1P81A 1L5RA 2ATIA 3AR7A 4LJ4A 4R8VA 4Z0NA 1WZ2A 3ANLA 1SCKA 1SXHA 2X22A 2ZYTX 1KFBB 3NHUA 1UBGA 3DC7A 4ZKDA 2GEFA 1FJGB 2AEMA 2E48A 2IYQA 5A02A 4JXZA 2LTAA 1MP0A 1Y33E 3H4VA 4YJGA 621PA 1VJGA 2G28A 1GSAA 1TEVA 1Y1QA 1P29A 2O4CA 2YBDA 4M9ZA 4MRSA 4MPPA 4X71A 1K8RA 1KOJA 5DGTA 1A1SA 1Q0RA 2I1WA 4TWZA 1TJ4A 4IBOA 5IC4A 2ZRQA 3AEQA 5H7XA 4DLSA 5EJ5A 4HT3B 2EJTA 1RNLA 5BSRA 2NTJA 3C3PA 4BX2A 3GK3A 4M6WB 4G41A 5FTLA 1IBKB 3KQYA 3L2OB 1L8QA 3STVA 1LI5A 3I9NA 3N0RA 1FNSA 3KL4A 3R0JA 3KYDB 3QXSA 1OFIA 3DMNA 3EG9B 2C03A 3IBFA 4GPAA 4AICA 2I55A 2YCLA 2AK2A 1JDPA 1ZDMA 1N6KA 5F33A 2O54A 5IT9A 4HWRA 2QU8A 2Z2XA 3CZCA 4KVZA 3NHWA 2I4NA 4B4OA 1YFLA 3GEPA 3GA5A 1YS2X 2VDJA 4BU0A 3BHMA 4B5KA 3F6PA 4CQMA 5BR4A 2W8ZA 4KQWA 5JXWA 1ABEA 3NEYA 4G5QA 4M1WA 3AR8A 3A4TA 1ECCA 4EEXA 2JHFA 5KTMA 1NQAO 1ZGCA 1IOZA 3L6DA 2E4XA 2A14A 4ZYUA 3K92A 1E7RA 1XUOA 5HGXA 5A4KA 2YNMD 3H8JA 2BC9A 3PK0A 4H1HA 5D87A 4AMZA 5HWSA 3OLVA 1ZKDA 2IYLD 3N05A 4UBNA 5TJHA 1IUNA 1BXRB 1M0WA 2NSJA 1Q14A 3VOTA 4DIKA 3FGNA 1IJFA 3WLSA 4TKLA 4HJXA 1UKYA 3QE3A 1JHZA 3SDZA 3DTNA 5B36A 1BXGB 2ODPA 2X76A 3PPIA 3K0FB 4TKUB 5GVSA 5D1NA 1EGVB 1ABBA 2NVWA 3V5NA 4ZK6A 5LLDA 1F7VA 2O8BB 4H0NA 1M0SA 3ZZUA 4YAOA 1NW4A 2OBLA 1TF5A 4GPBA 2Y1CA 2ZE7A 4DKXA 2NTYC 3HNRA 3K6JA 1Y3FE 3A6HA 4PPYA 4V03A 2G17A 3FHCB 3QZUA 4J2TA 1JX6A 4F04A 4YUZA 2GZHA 5IASA 1NQXA 1QC5A 2OECA 3PWTA 1RXSA 4LISA 3WIBA 4D7AA 5JZ9A 4U9UA 3ZWVA 4U4AA 1JDSA 3FFWA 5ENZA 2FSHA 3J7AC 3IXLA 1TKAA 3O92A 4QX6A 3ROMA 4ZCIA 2N75A 2XUIA 3JQAB 3VXKA 2P9TA 2YY7A 4DBLC 5LD2C 4ZVPA 3HBFA 4PO1A 3RIHA 1GFSA 1YBMA 1T8TA 2XQVA 3OU7A 4IDOA 4KR6A 4LQCA 4YP0A 3WFIA 4AZ3A 3SQWA 1QB7A 3DXYA 1QLWA 1KYQA 1O94A 1US8A 4DMLA 4YP1A 1M2VA 1Y1LA 2O0JA 2WEKA 2FPOA 2JZCA 4TSFD 5ER6A 1K63A 4B84A 1Q1QA 2ZUSA 2IIBA 1JA1A 1D7AA 1THZA 3BVPA 2BMAA 3BCHA 3HXPA 5K8IA 1R9JA 1OKKD 1OXUA 1CQJB 4EKYA 4PG5A 2EF0A 4FQ7A 4ATNA 1CF9A 2GM5A 1ISHA 1USWA 3CZ4A 2M98A 5I4KA 1N5LA 1XBTA 3CEJA 2EYUA 4PXAA 4LHYA 4PNHA 3OD1A 1W19A 4G1EB 4HEQA 2P4SA 2VYFA 2QMYA 2RBEA 4FHGA 1YDFA 3MFYA 3MWEA 2AXQA 3BOSA 3UUGA 1LDEA 5HGJA 4ARCA 1EMDA 2HCJB 2AD5A 2VDWB 4KO2S 4CG0A 1J2YA 3SQMA 1OASA 1C1XB 4BJ6A 4LF5B 4EDFA 4EGCB 2WVHA 4O4IF 3RAEC 1IZ7A 5JZSA 2X5KO 3T7DA 1YI0A 4PC6A 1Z26A 4GR4A 5B7NA 2F7SA 4NESA 2XA9A 2CXTA 2W2XA 1F7UA 2HPAA 5B2ZA 5JYEA 5IEJA 3HZHA 2KE5A 2YWBA 1MX3A 3F7NA 2AJLI 2JZOA 3OZXA 4AO7A 2FF7A 3R7WA 4KYUA 4M8IA 3T5PA 3IE1A 1MOQA 1ZN2A 1XJCA 3K70B 3WYGA 1OC4A 2JHGA 4MVXA 3JX9A 4G09A 4KNWA 4E2FA 3CBQA 4J91A 1REQA 2DE0X 3NHMA 3QOFA 2BISA 4XQGA 5JMOA 1Z6XA 2BZ1A 1KJWA 1UJCA 3AIOA 2Z4TA 2RHLA 2GLUA 1Y89A 1LJUA 1GLVA 3AHFA 1TMYA 1XVIA 2ISSD 1CNEA 4GOOD 4LXIA 4M98A 4O0LA 4Q82A 1IQPA 3LY5A 4YRRA 3ZU6A 3ER8A 4JWKA 2ZTUA 4LVOA 4MB0A 5JPIA 4NAHA 3HXTA 3KX2A 4L16A 4LYGA 5JMTA 3Q10A 4Z4FA 1JGTA 1F6BA 4DNPA 2QTBA 4W99A 4MVWA 2H1CA 3W79A 3WLFA 1AB5A 1II8B 3AJDA 2ZIGA 1CIPA 1UP7A 3CLTD 1JQBA 3K94A 3NEPX 1YVRA 4G6ZA 5JXHA 1TQ6A 2X15A 4D9JA 1T8UA 3T5TA 4R3NA 4OHVA 1ZGJA 5ALUA 3R3VA 2D1QA 4B8YA 1XMQB 4LV5B 3WE7A 2QPTA 5IT4A 4FLEA 3H2BA 4I50B 1AH2A 3V80A 3STHA 2FRVA 3VYVA 3CBGA 5DNYB 4C05A 4ADSG 1L5HB 1JAXA 2H7YA 5KC9A 3C97A 4BGDA 2ZJZA 1FNNA 2HCFA 3VU1A 2ECPA 1J20A 2F00A 3EMVA 2EIHA 4B3FX 5I5EA 4R54A 4HXEB 5HKKA 1ZO8A 3AEKA 1JECA 3PXUA 4IIFA 4PZDA 1FU8A 2H7XA 1RQ2A 1WZCA 1MJNA 2ZVJA 4TRRA 1GGJA 3QPCA 4TN5A 2ZXFA 2X0EA 3ZVMA 3BHIA 5B6JA 4A2WA 5K3CA 5B3JC 3HHPA 2PZFA 3CT4A 1AKWA 4RFLA 1G21E 3H13A 4B45A 4LNUB 5A3QA 5KTNA 5DLPA 3BWBA 1QG2A 3VH3A 2XYQA 3TZEA 5CEFA 2H2DA 2WWTA 3A70A 3HCCA 4NWIA 1I4WA 2IUFA 3BWEA 2WJJA 1U3VA 4K9NA 3TIFA 1YKGA 1DPFA 1OPRA 1T10A 2HWWA 3BTSA 4X84A 5H82A 1DC5A 2Y1GA 4JYCA 4CDMA 1I4LD 2ZUWA 3QA9A 3R0QA 3CKLA 2ODEA 2X4LA 2AJBA 1O95D 4IH4A 4IOMA 4MUKA 4P38A 4F4UA 1TMKA 1H8HA 3JQ8B 3MZ0A 4KQEA 2QM0A 2A9JA 2GBFA 3A9VA 4J1TA 4UJ5A 1YR8A 5HFJA 3ETCA 4LWOA 5T8KA 4HNAB 4C3VA 3WLQA 4JJ7A 1PCXA 2I2BA 2PQ2A 4LSMA 4PM4A 4B3JA 1DL5A 1E7WA 1L7XA 1OPXA 2JH9A 4I50F 4PAQA 5JECA 1G20B 3PD0A 5LZ9A 4Y1GA 1Y6FA 2EOAA 5A0VA 1T5IA 4B7ZA 2Z08A 3WLNA 4AX8A 2PGDA 5DHUA 4F3CA 5DN6A 1ZN7A 5EMJA 4TLCA 4OATA 3OCWA 1DMRA 3MRTA 3DMDA 4UTXA 3C5HA 1I36A 5BNWA 3OZAA 3QEKA 1AV7A 3Q3GE 4RF5A 4RK5A 1VFPA 1ETHA 1E0SA 5DF1A 2CLEB 3ONDA 4JB2A 4KCGA 1BE1A 3N2KA 1MLDA 3PJGA 3SOPA 3GJSA 5KSOA 3R0ZA 3LRXA 4F2WA 4KR7A 4N40A 5CK4A 1P5FA 5FX2A 2HA2A 1ZIPA 1GVNB 2F4NA 5FBVB 3DWEX 4QU9A 3NTLA 1P0QA 1V7CA 2ZCJA 2IV3A 4UQLA 2IYZA 1E2KA 2QUAA 4O5AA 1NXXA 4R2IA 4HB3A 3EVDA 1QG4A 1G291 2FPWA 1EEHA 2GM3A 2W6ZA 3H9JA 4AECA 5TC4A 2Q4RA 4MEAA 3CZQA 2ACEA 5BMOA 1S02A 5KYUA 4JI7B 3SYKA 4OBEA 3TZBA 2OG2A 2HHLA 1FRZA 4O8CA 4ZI7B 1U2EA 3PG5A 2HJSA 2OXTA 1GRNA 1Z36A 2Z6AA 3L8MA 5GAJA 5KNBA 4NCNA 5KPDA 2CDNA 1F17A 3K0SA 1MIHA 4D80A 3MTJA 2QM8A 1DJPA 2IBMA 5KJEA 2ICAA 1JYSA 4MVJI 4XWAA 5FNVF 4BBPA 4EARA 1OUMA 3M2TA 4C7XA 5HQ3B 1NT4A 2BM1A 1W1WA 4Z4QA 3OIVA 5L7TA 1PJBA 1IAVA 2CLDX 3CN9A 3GP3A 1W5AA 2XPCA 1AN9A 1OW3B 1R4MA 1WBJB 3DAFA 3MXOA 1IFXA 4JSTA 4OQPA 5H68A 3X43A 4ZC1A 1UL1X 2ZVPX 3AKYA 4CTMA 3OTQA 4W8HA 2C0CA 1XF1A 3S27A 1USIA 4OX9Y 4DQ0A 3SYLA 5EIOA 4E33A 1LDBA 3GUYA 2VPXA 2YL2A 1WS6A 3EVZA 3OEYA 4EPTA 1WPXA 1U0NA 3M9LA 2Z6UA 2CFIA 4DQUA 2ZUFA 3ISVA 4PYJA 2R6DA 1C8VB 3UPUA 2EWVA 3CR8A 1HWYA 2JASA 3SYTA 4EWLA 1X1SA 1V9SA 1VQ1A 5CDUA 3I1FA 1NJ2A 3NXKA 2I76A 5CH8A 2Q4EA 3PV0A 1PW5A 2AXPA 2Q4DA 3E58A 3I28A 1JILA 3IFSA 3REFA 3SIPA 3GVHA 1JJFA 3JASB 2ZS7A 1PZMA 1ULAA 4LMAA 4F2DA 4CDRA 5JQGF 5MFPA 2E4WA 4BV8A 3UCEA 3M3DA 3B3JA 2MSDB 2XB9A 2R25B 3G5MA 1E4OA 2WKWA 1LV8A 5E4FA 3D0OA 1NJSA 1PQ4A 2F43A 3L0BA 3NDPA 3PQDA 2VZEA 3N58A 2IW1A 2IEDA 3I2GA 3AWDA 5CNMA 5JZVA 1P74A 1SAYA 1OWOA 2D5LA 2FEMA 4WXHA 1JEQB 5GQSA 4JJAA 1W4ZA 4PFQA 1CU1A 2IDKA 3GPCA 4GLJA 4MYSA 3GYGA 1PGQA 1GITA 2HQSA 5IH7A 1E92A 1S8OA 1MAHA 3TLBA 2V1XA 4PYKA 4Q9DA 3T1OA 3FVTA 1G59A 2R8EA 3CLSD 3SJUA 2HK6A 4WACA 3EF1A 4Z8YA 3ZWMA 1MW9X 3LIIA 4LTDA 2H9AA 1XEWX 3R7SA 3OAAD 4JVOA 3BERA 4Q9IA 4US0R 4RX1A 1VBFA 3AV3A 2GVNA 3MWLA 4V0NA 5EKTA 3JAMA 3COYA 4KHPB 3T3NA 1KJ9A 2CMHA 1WVIA 3AKDA 4LYAA 3I92A 1MT3A 1SCIA 1UPCA 3GDWA 1G18A 2JJ1D 3I9V6 4U8HA 4G2NA 3HKDB 1SG0A 1X1EA 4Y6OA 3EXFA 2OCGA 3MCZA 4RSGA 3B13B 3JD2A 4YCAA 5TR9A 2DR0A 4IXTA 2FFRA 1IZ9A 4WZBE 3ZE0B 2XCSB 2WKRA 3SXPA 4EJSA 3GNLA 2CW5A 1C2YA 5ECGC 1B74A 4PZPA 4HDSB 3LHIA 4K7JA 4I1VA 3KXIA 3K35A 1L7MA 3DOJA 4G8BA 1ZIXA 1JKMA 4RH1A 2QVGA 3AP3A 3GDHA 1CY4A 1XLTC 2MSEB 4ZDWA 3ZWXA 3JQ9A 1QCZA 1BDBA 4R69A 3E9MA 2P9BA 2X2EA 3PXDA 1SCBA 1RVV1 4JUBA 3NV7A 1RPNA 3ED5A 5AW4A 1YZVA 3O8QB 4P2GA 2EBFX 2MMCA 4XW2A 3NHLA 5L7YA 1AGPA 5HA5A 3TTVA 2C8JA 3KQUA 3AFMA 2SCUB 4TKVB 2R751 3LP6A 2ZE6A 1AO3A 3DXFA 1CIJA 4CTJA 4G1FA 3JZFA 1QRSA 4GYJA 1KEKA 1XTQA 2B82A 1GSOA 2UYCA 1K9VF 3GGGA 3GA0A 4Y2UA 4QXPA 1FSSA 4RDHA 4EBBA 3I2KA 1JHVA 3RVOA 2X14A 5IKXA 2EW8A 3MCAA 4YQFA 2NU8A 2WTEA 4GC9A 4JLKA 2WJZB 2B6NA 5FBQB 3WRXA 5IPFA 4AWXA 5TLSA 2GF0A 2YKGA 3BWVA 3NHJA 4RVUA 3VR5D 1OGYA 3DC2A 3NONA 3I53A 3GGOA 2EERA 2QX7A 2C7BA 4MICA 1YL5A 4FP9A 3T7EA 3WYAA 1NZJA 2A1TS 4K1LA 1CULC 3ZVNA 2Y1DA 4RNCA 2ZZNA 3F9RA 3HJHA 2COEA 3VC2A 2NVUB 4RHEA 4MS3B 3L4JA 2QLJA 2B21A 4I2VA 4RIEA 4OQZA 3TZHA 3BB4A 1BQ3A 3DBIA 2PLFA 3GRZA 2QAJA 3AUSA 4PWYA 2LXNA 4ZAWA 5JJKA 2HO5A 1W73A 1IQUA 1HK7A 1K4MA 5TQJA 3RAJA 4EY4A 2V6MA 1LFDB 1QLJA 5FP0A 1FVOA 2PZAA 3UHAA 3BM5A 4CUJA 3CPEA 1EVYA 3A9CA 3M5WA 1E3TA 3R6WA 3VR3D 4AJJA 3P5BA 4BP9A 1XZQA 1GRQA 5K3OA 1S3GA 1L3IA 2CNWD 3ON5A 3UYKA 4HV4A 3N1UA 4Z3DA 2IBTA 2ZP1A 3RTEA 1YHYA 1Y8AA 1GAEO 2H4WA 2DGDA 4QXAA 1LBHA 3P9XA 3K72B 4DLKA 4FIDA 4Y9DA 1TF2A 3OHPA 4JD5A 4QDZA 2GBCA 5G1OA 4MV3A 3EEOA 2DSNA 1VM6A 5KPJA 2I0FA 4UARA 1NN5A 3HCEA 2R0QC 1N9GB 1BKSB 1YZQA 2X2PA 4KRGA 2P2LA 4G37A 4EUEA 3R5HA 3WAGA 1TQ2A 1BMFA 2HMYB 2WJPA 4XRGA 4RVOA 3GJ3A 1OI7A 1ARZA 1UDAA 1AY0A 1IHUA 3MJEA 5HG0A 5TMBA 3PLNA 4REQA 1FNMA 3UO8B 3DFFA 4R68A 5EHXA 1TJNA 1KYWA 4GX2A 1Z6QA 4FFWA 4KSYA 1FLDA 2C82A 4NAVA 4NBTA 2XZTA 3V8RA 1HDIA 4WBNF 2ROQA 5CM8B 5CW2A 4PZ0A 4UOZA 4FSHA 2HMVA 3TXYA 1HLGA 4S35A 1PD0A 3RSZA 1KZYC 1P73A 3ZJYA 1DSSG 2NO9A 4K6MA 5EQTA 5EXEA 1SK8A 1YRLA 3S4YA 3GUUA 1N1DA 4PTYA 5J1SB 1PJ8A 4MV1A 4ZTUB 3NAZA 2QR5A 1ZH6A 4GR9A 1RZ3A 1K8QA 2ZZKA 3Q3VA 4HXGA 3TOSA 1U0RA 2G40A 3C2QA 3FYHA 2D8AA 1KZ1A 3JARB 4PX3A 3OZUA 1T8YA 5ALIA 3WHIA 2R00C 4B31A 2UYYA 4EVRA 3DULA 3TTTA 1G8PA 1M5UA 1NUQA 2OB1A 3TSYA 2GJAA 2IYYA 3ZCRA 3C3KA 4QFBA 3CVWA 3KB8A 4HRVA 3HB5X 2V7QA 3TNJA 4F9FA 2QSJA 2WV9A 2RIRA 5BVHA 5CJ2A 4QO7A 3SQLA 1ODLA 3N9IA 4BEBA 3N8NA 3TPFA 5LP6C 5HM6A 3E3OA 2PCJA 3EXFB 5HZKA 2J6CA 3WIUA 1XDSA 2IYPA 3TXXA 4QPDA 1UBFA 4MI3A 3ZNQA 3A58B 3KKEA 3FTCA 1O0SA 2JNWA 2XMRA 1DKUA 4FFMA 4FHDA 2V6FA 4TLEA 4NARA 1NMZA 4AMYA 3U44B 1IHYA 1EG7A 3AF2A 1MB4A 1JE0A 2WSSD 3NDRA 3UQYS 2G8LA 2KW5A 3RK4A 4Z2AA 4D25A 4IO1A 3WSTA 3L77A 1CHDA 4Y2JA 1ZNZA 1J8FA 2DQSA 3AB8A 3IVRA 3MYRA 2COUA 5KTKA 5JCXA 4YUWA 4B46A 4O4LF 1E9VA 1ZD9A 1SOMA 2O2EA 3JSAA 4PLVA 3W2IA 4FNOA 1A5AB 1LS1A 2ZRCA 3RCBA 1FVHA 3KAQA 3LUKA 1M1UA 5HRUA 3QEBZ 2PUDA 5H4GA 3O95A 4DA0A 2TS1A 3A28A 1STOA 4Y7DA 3UT5A 3RBAA 2PUTA 3FDFA 5DRTA 1YR3A 2MINB 4EX7A 2P3QA 4YMSA 3WL5A 1TFUA 3NTXA 4P3KA 2ODNA 3OMLA 2CMFA 2HSEA 2Q29A 4ZCRA 4YH1A 3B6MA 2PD6A 3K9LA 4DLUA 2IH4A 5DK4A 1KF0A 2IL1A 2F6RA 4XJXA 4BATA 1LLUA 1K98A 4HY3A 4LKRA 3C98A 3DOFA 2Q2WA 1WUTA 2W71A 4FGZA 4R98A 2V8OA 3TOCA 1YRWA 3V6MA 3RADC 4Z0HO 1R27A 4ETMA 3BFJA 2D13A 4DJDC 1D2NA 5BYKA 1ORIA 3H97A 3P9CA 3BSWA 4LXXA 1ZSVA 4ARUA 3BXEA 3EHDA 3JY6A 1N9ZA 2HDHA 1HFJA 4EVIA 4H3HB 4CKBB 1N2CE 4WOCA 4LMBA 1Y1SA 2RG1A 3H83A 3W2TA 4LSGA 3GF4A 4TWAA 4ON9A 5IP5A 2PPLA 4RESA 4BVJA 2KS6A 1X7ZA 2WB2A 1C4OA 4FXOA 2HJRA 5F2NA 2E4VA 4MUNA 3QMVA 1KRXA 3MTBA 3GP8A 4AUNA 3DZDA 3ZHTA 4GPIB 1PT6A 4JJFA 2XUKA 1C7IA 1JFFA 2B1RA 1I0ZA 1G8HA 1NWHA 1QH8A 2CGEA 2R1TB 2QN1A 2WFAA 4HNHA 3T7CA 1FRNA 1HBJA 3PFFA 1NLFA 3KC2A 3BA1A 4MW9A 4D5EA 1SHTX 2CD7A 3OQNA 4J0CA 1LDYA 1E66A 5MGNA 3FNQA 3G5UA 5DX1A 2B5OA 1YU6A 1VBNA 2G0TA 1SZPA 2VYNA 3EQ8A 2DFPA 3GBSA 4KDFA 3L5KA 3CS3A 4II7A 1PUIA 4PU0A 5FUVA 4KIUA 4IWXA 5BW8A 5KQMA 5C51B 4BLQA 4LGCA 3G23A 1PT5A 1U63A 3SKVA 1RQXA 2F8MA 3EZXA 4F96A 4UVIA 4DTCA 3OHSX 4RPGA 4ER6A 4J3FA 2FEAA 1KQFA 1SELA 2W2LD 4KQXA 3PQ3A 1MJGA 5FJIA 4DGQA 3L05A 5GJBA 3OF3A 4UASA 1VKRA 1AM4D 2HMTA 2XXAB 3V8BA 2NUAB 1K2WA 1KRHA 1ADFA 5F2EA 1R0BA 2XHZA 4MCIA 3SHQA 2PWZA 3PRJA 4LECA 2O2HA 3ZDDA 5C8ZA 2D0PB 3K5PA 2AC2A 4IL5A 4WN3A 1F8FA 3GO4A 4HEHA 1DZ3A 4A2QA 4A2PA 1QO0A 1A0OA 5JY6A 4OI0A 3VKGA 5CXSA 5E6RB 3U4CA 2VJNA 4DMHA 1L5ZA 2DY1A 5EWMB 5EIXA 4DR6B 1M34B 1JPNA 3P52A 1X70A 4MJLA 2VJLA 1SOUA 3L4BC 4HNAA 4ZWNA 1MU0A 5EY5B 1YB7A 3PRHA 3SF8B 5EKXA 4IXWA 1UMBA 2LZ0A 3NM4A 4Y3UA 2OV2A 1NV9A 5GP1A 4B87A 3A9WA 3SHOA 4IIGA 4DZTA 1IMJA 3R44A 3SICE 4NZNA 1SA0A 1Z47A 4BO4A 2C2KA 4OJNA 2CYBA 2GD1O 4OMDA 4NFYA 4DCSA 4WZ6A 1SOVA 2XGJA 4KFTA 2QK4A 1R4NB 1NUAA 3ILSA 5J2UB 4L8YA 2J9XB 1H2ZA 3OQHA 2RK6A 4ZZ3A 5F73A 2OBMA 3WLPA 3RS2A 3FRHA 2Y92A 3DDCA 1NF3A 1EM8A 5FWAA 4OJKA 4RADA 2PK3A 2ZROA 1TYBE 3UXYA 1E9FA 3TGWA 4UHJA 1JKJA 3DHNA 5FF9A 3HKBB 1ECLA 1Q1ZA 1SCDA 3HH8A 1N5RA 2LIPA 4YAUA 2NSDA 3NWEA 5SZHB 2Q27A 1D1PA 4AYWA 1SZJG 5A7HA 1ESEA 2AYZA 3ILXA 1SXJD 4HDRB 1Q3HA 4FINA 1EUDB 4F6RA 1T3ZA 3HFRA 3NDJA 4WLEA 2HNKA 4QECA 1P2UA 1ORDA 3CY6A 3VO2A 2O3JA 2QAGB 4YCJA 4CYMA 3OBBA 4TYMA 2W83A 2ZYAA 3DGEC 4DTIA 4OX9B 2WOOA 2DR2A 3A31A 3BH0A 3G0HA 4MUHA 2BCJQ 4MPTA 3VI3B 3MTGA 5KYGA 3EDQA 3TW8B 2DUJA 2Q0HA 3AJRA 4I81A 4XA8A 2BGUA 4U00A 4X95A 3W05A 4I2NA 2REQA 3I3SR 3BAZA 1ATIA 2NADA 4GYWA 4RAOA 3DJYA 2QQ5A 4AP9A 3M81A 2OY0A 3MILA 4F84A 1B42A 5J3JA 4V3BA 4LGMA 3WYEA 1XPUA 2FQWA 3MD0A 4UNPA 1SVWA 4ZQHA 4NPCA 4A0RA 4D79A 1JBEA 3V7WA 5JTTA 1RRFA 4JEHA 4D4GA 1GVHA 4ER0A 4M8LA 1C0PA 2ZRGA 2BFOA 4M22A 4N12A 4QOEA 4UDXX 3LPLA 3WSVA 5KYWA 5JTUA 2G63A 2B4AA 3AHIA 5AM5A 1XKLA 4F92B 1XCJA 3GV0A 2C2BA 1AKRA 1MQ8B 1RXEA 2G76A 3DOEA 4UHCA 5DI9A 3N75A 4ZVVA 3VSEA 5I9IA 2B7CA 1W96A 3RDPA 3OT1A 5D2CA 3B1ZA 2MMGA 3EOBI 4GUAA 1PL8A 4Z9XA 3RBZA 1I7DA 4EECA 1P1IA 4JVMA 1L2TA 1GXSB 3G02A 3IIKA 3IKLA 3BXPA 4EGJA 1VMDA 2NXJA 3GUVA 3OLWA 4RPLA 1YC5A 1I32A 3DDZX 3L7CA 5LBTA 2XX3A 3RJ9A 1RYZA 1E3WB 3A1UA 3IIIA 1XPOA 4CLEA 3MS7A 2AX4A 3ZD9A 4C76A 4C88A 5E1DA 2CHGA 4JROA 2CC2A 2BE7A 2Q99A 3X2EA 3PJFA 1FMCA 4HH1A 1TW2A 5HBGA 3AR3A 4F3NA 4JKYA 4R7ZA 2W2VA 1YCGA 3ZNPA 2ZKLA 1W35A 4RC9A 1VSBA 4YALA 4O4HB 4CR7A 4L08A 5E6RA 1BXZA 2XB6A 2QYHA 2ZJBA 4R16A 5KKCA 1TU3A 3AYXB 2WLTA 1NYQA 1SXQA 1PLJA 2Q7DA 1XKTA 2YWJA 4JZYA 5JQWA 1PRYA 5FB3A 2E55A 2QG9A 1I3NA 1NVTA 3K9GA 1X3LA 3NM6B 3W7AA 1QDLB 4N0DA 3SC4A 5LFAA 3JQ7B 2DF8A 2JKYA 5EP4A 5IS2A 3ZK9A 1NU6A 1KBOA 4LJ9A 4TLLB 4EZEA 4UHDA 1OAKA 2P79A 5LQAA 2RHGB 3Q7QA 2Q4BA 1EKXA 2BM9A 3WNZA 2VDWA 3DHWC 1XZAA 4NJMA 4QDUA 1FMFA 1GUBA 3CRMA 3PC7A 4U2FA 4A15A 5IABA 1RHMA 2CUNA 1SG9A 3GMDA 2G83A 4H31A 3WWDA 2V5VA 5F35A 4YMLA 2JHCA 3F47A 3STYA 1P2VA 1RACA 3AZPA 2ZT5A 2QMUA 1E6UA 2HWKA 3LUBA 1FC0A 3DFZA 1B8UA 2NAPA 2XADA 2K6GA 2QRVA 1LVHA 4N0EA 2L82A 1Z13A 1OHHA 4MV9A 4A92A 1XK7A 2ZCUA 3AERB 4I1IA 1PVDA 2D5AA 1UT6A 5HBRA 5T57A 1WQ4A 1KDYA 1A82A 5J5AA 1NBHA 3M70A 4L27A 3S2IA 3W77A 1UWCA 3W8NA 1E1CB 2H9YA 1ZSYA 1XTKA 2GHRA 4Q0MA 4UBIA 5FOWA 3WLAA 1A2OA 4UCWA 4IIJA 3GLFB 2IHVA 4CU2A 5JXGA 1MT0A 3A0UA 3GR6A 3DR5A 2ZYVX 4QWMA 4ZOQI 1F12A 4URWR 1XPJA 2DH5A 1VE9A 2FA9A 5A0TA 3I9LA 2DFLA 4ZV4A 1SEPA 3OG9A 4S2EA 4F5WA 1N3LA 1FUIA 1BXRA 3CUYA 4HWPA 4IHKA 1EUQA 4UXJA 3UAOA 4XAQA 3RS0A 5LP6A 2CT8A 5FTKA 1XA4A 4PPGA 4WLUA 2GCEA 3RFTA 3PVZA 3QMWA 4KEAA 3AG5A 3EIWA 1UC9A 3GLTA 3OMXA 4FGLA 3WDSA 4CM5A 4Q3AA 2ZANA 4Q1EA 3AW9A 3U9LA 2FY8A 3L7BA 1L5LA 1W4RA 2FSGA 2PQ6A 4LDAA 1AHHA 1MENA 3AL3A 1GQFA 5LU8A 5CCEA 3VISA 5FWDA 2EIXA 3FCEA 3QW2A 3DUWA 5FL7A 4B6FA 4BGEA 4E3ZA 5ERYA 3A4MA 3LQ2A 5AVUA 3K9BA 3AETB 2EQ5A 5CYFA 3S2FA 2ACVA 3SF8A 1NQWA 4C07A 3L04A 3QVUA 2OCIA 2GX6A 4V38A 1L5SA 1F0YA 1LC3A 1TNDA 3QVGA 4UBMA 4DLYA 1EVLA 4K6FA 3A2NA 1BKDR 1WXIA 2Q6VA 1L5MA 2OV3A 3CMCO 2W4IA 1PP4A 3HYTA 1Y9ZA 4HQLA 4Q12A 5DTIA 4YUAA 1UBSB 1TQ4A 3RQSA 3QK7A 4UHHA