4MYDA

1.37 angstrom crystal structure of e. coli 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menh) in complex with shchc
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
252
structure length
252
Chain Sequence
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Molecular Basis of the General Base Catalysis of an alpha/beta-Hydrolase Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 98
structure length 252
sequence length 252
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mydA00
4S0XA 3ZLTA 4Y7DA 1YS1X 3F98A 5LP1A 3CN7A 5ALIA 3V1KA 3D4LA 5T4FA 1K5PA 3DNMA 4HRXA 3KWFA 4BTVA 1R50A 1FFAA 3WI7A 2AJDA 2HA7A 3OPMA 2I3ZA 4DSAA 1EDDA 2XMBA 4HTAA 4B7ZA 2JIDA 5ALDA 5FOQA 4MEAA 1UKAA 3VISA 1BEEA 4BRZA 2C0QA 3C8HA 5AKHA 3RARA 3H19A 2DQYA 3S2ZA 2X5XA 3WZLA 1FFCA 1H2WA 1W75A 4FWBA 1OCEA 2Z8XA 5EFZA 5K3FB 5CRIA 4TPKA 3BIXA 2ZYRA 5ALKA 5ALUA 4FLFA 5AK5A 4A16A 1VA4A 5FP0A 2CKMA 5K3FA 1JJIA 4KJXA 1H23A 5DNVA 5FPQA 1W52X 1EB9A 2GBIA 2ZYIA 4BC0A 4B9EA 1QIEA 4X6XA 4DLNA 2VATA 1JU3A 3C6YA 4KACA 5AHXA 1E3QA 4Y2YA 2WUFA 4O08A 2O2HA 3G9XA 4UBKA 2PM8A 5FDFA 3GUUA 4U2DA 1CUGA 5AM0A 4B83A 3NGMA 4J0KA 2WU4A 5ALJA 1RP1A 1P0MA 3PF9A 4AO8A 1QFMA 4J0CA 2LIPA 3C87A 2OCGA 4RNCA 1EXWA 4EUSA 4U2FA 5CURA 4H35A 4BATA 4GDMA 5ALRA 1MO2A 4J0GA 2OCKA 4UFNA 1VOTA 1DWQA 2C7BA 5A7GA 4M0MA 1TIBA 5A2GA 2XUOA 2VQ6A 1ISPA 4HXEB 3Q8WA 4JNCA 2BGNA 3PICA 3HZOA 5FRDA 2DR0A 1IZ7A 2XDWA 4HZGA 4F21A 2WIJA 3WJ2A 1D07A 1J06A 5LKAA 4U2CA 5DNWA 5HKAA 3WYDA 3FBWA 4ZI5A 2PU7A 3D59A 3I2HA 3BL8A 3HXKA 4XVCA 5HF6A 4KE6A 3LS2A 2I3DA 2WM2A 1FFEA 3H18A 3UMJA 2CB9A 3G0DA 1TQHA 2WQZA 4X7BA 4G9EA 4WY8A 5A62A 2ZJFA 2CEKA 5CH8A 1U8EA 4E15A 2PSHA 4W1PA 1LLFA 2Y6UA 2Q0XA 3DL7A 2XLCA 3L1JA 1LBTA 5CT5A 2PSFA 5HK9A 1O6FA 1UXOA 3HRHA 1FSSA 2XQJA 2PSEA 3P2MA 5H3HA 4B81A 3ESDA 2QUAA 5HZGA 2BFNA 3DCNA 4H7KA 4QLOA 2CBGA 2IIVA 4UHHA 1ZGBA 3H1AA 4LIPD 2V96A 5AOAA 5DNUA 1XZMA 1CV2A 3DKRA 4TVKA 1YS2X 3QPAA 3WA6A 2G4LA 1E8DA 3AIOA 2Y1KA 1C7IA 2XUQA 1C4XA 2XUKA 2CUTA 1M33A 3FCXA 5LKRA 1SCQA 2WG1A 3G0BA 4UPDA 3V1NA 3ICVA 5ALNA 3W9UA 3H2KA 2XI4A 1Y7HA 2FUKA 2GYVA 2OQVA 2ORYA 2WHPB 1A8QA 1SOMA 1EK2A 2XQFA 2VJBA 5JADA 4KRYA 4QE3A 1H2ZA 2WHPA 4J03A 2G63A 4PO3X 4FFVA 1K4YA 1YR2A 4PQEA 3DD5A 4X71A 2ECFA 1XRMA 4YASA 3BIWA 1A8UA 2QTBA 5CT8A 3C43A 4FBMA 1NU8A 3GELA 1E5TA 4Z49A 4H7IA 1UFOA 2ZSIA 3STYA 1ZGCA 4QDTA 5IVHA 3WWCA 1EVEA 3AJAA 2HDWA 3RKSA 5LLSA 5LZ4A 4OYYA 1TAHA 1FFBA 2WFMA 1C7JA 3WWOA 5KBYA 3KWJA 4CCWA 4QDOA 5E4YA 4XIIA 1U4NA 1SCIA 5BOVA 4K2AA 1DQZA 3ZPXA 4BTLA 3V1MA 1QLWA 3BJRA 1XLWA 2HA3A 1GT6A 2GZRA 4M0EA 5DYTA 4XX1A 1ZI9A 2QRUA 2H7XA 3D0KA 1CEXA 3R41A 5JAHA 3EBLA 3WKCA 5JANA 2I78A 3B3QA 1XZLA 4J0HA 5LZ8A 4ZV9A 5KREA 1Q84A 3R0VA 1VKHA 4X95A 3EQ7A 3ED1A 5AKJA 1YSCA 3O4IA 1AX9A 1JT2A 3IUQA 4TGLA 1CUEA 4M0FA 4X94A 1EDEA 3D5EA 1B41A 4BDSA 4MYDA 3FCYA 2HRRA 4OUKX 1R1DA 2CZQA 1IUNA 2GYWA 4LXGA 1N5RA 2FJPA 3H2HA 3FLEA 1CQZA 4Q3KA 1BRTA 4KAAA 2K2QB 1ZICA 1I6WA 2W6CX 3NOXA 1H2YA 4OPMA 3LLCA 1SFRA 3O0DA 5FXMA 1MX1A 4G4JA 1QIDA 1IUOA 1QIFA 3T4UA 4DNFA 1L7RA 3WKBA 3D3NA 3WWDA 4PF1A 5HFNA 4ZRDA 4DNOA 5JALA 3AZPA 3GZJA 4OB8A 2HA5A 5HK8A 4BVLA 4FDMA 1UOOA 4IO0A 1N8SA 5JASA 2Z8ZA 1F8UA 3YASA 5D6OA 4WCVA 1OILA 3BJMA 1EX9A 5C81A 1BROA 2BUBA 4CIBA 4J0JA 3STUA 2PX6A 2P8SA 4BVJA 4IQ4A 4WDRA 2FJ0A 5KWIA 4FHZA 3H04A 5AM1A 2YH2A 5D7BA 5EHXA 3HJUA 5AIBA 4C6HA 3RLIA 3G9ZA 2PBLA 3LIIA 3STVA 2OGZA 4E11A 5K3BA 5DJ5A 2OPHA 3WIBA 5HQ3B 4MWTA 1DINA 3KXPA 1MNQA 3ICWA 4KAFA 4K6HA 4Y2TA 5CH5A 5AKZA 1S8OA 2JGEA 2JGKA 2GBGA 1QTIA 2WKWA 4CG1A 1K63A 3ILSA 6YASA 1MAHA 2XMZA 2VF2A 4GLBA 5AOBA 1QO7A 4FNGA 1VXRA 5J3JA 1XZBA 2VTVA 2H7CA 3WIOA 5AM2A 5DWDA 3ESCA 4GI1A 5ALYA 2BJHA 3F67A 1ODTC 1GPLA 3KSRA 1BE0A 4KR0A 4N5HX 4INZA 1LPPA 3BDIA 2O2IA 3OURA 1VE7A 1XKTA 1MPXA 3QPCA 1BEZA 2W22A 2VSQA 3W06A 1TCBA 2WFLB 1LPNA 3GBSA 1HKHA 1YASA 3F9CA 2OCIA 4K6GA 1CUXA 2QJWA 1MNAA 3BWXA 1U2EA 1XRNA 3A2MA 1ZD3A 1JJFA 2WFLA 4QZVA 3C5VA 4GWLA 4C88A 3DYIA 1QIMA 2XT0A 1B6GA 2BAGA 1UK7A 1QFSA 5CW2A 1XRQA 4Q3OA 4OD0A 1PFQA 1THGA 1K6EA 4PSDA 3K6KA 4I3FA 2JGFA 3AINA 3C8DA 1E8NA 1G66A 3GA7A 3JW8A 2XUHA 4MJ3A 5DTJA 2D0DA 3A2LA 4ZXFA 2QOEA 3O9MA 5ALVA 2CJPA 3JYHA 4YK7A 3AUKA 1Z68A 3IUNA 4Y2RA 5AKKA 1CQWA 4AX4A 4LXHA 4UBMA 1N1MA 4ITVA 3LCRA 3WJ1A 3H1BA 3HABA 3PDCA 5BV7A 3KD2A 4KE7A 1DX4A 4LYDA 2RGUA 2WHQA 5LZ7A 3HEAA 2WUGA 5YASA 1E66A 4AZ3A 4WFKA 3OC0A 1GGVA 4C4XA 3VJKA 5K3AA 3VDXA 4BAGA 3H2IA 2WTNA 4BDTA 3EQ9A 3MUNA 5DYWA 1Q83A 3I2JA 1VJ5A 1X70A 5K3CA 2XLBA 4OB7A 3VJMA 3PUIA 4BZZA 2XQIA 2X76A 3ZLVA 5EHZA 2YASA 4DMKA 3WK4A 5ALFA 1A8SA 1HDEA 4J3JA 4BC1A 1AURA 4G9GA 5ALGA 2YXPX 4DNQA 4EA6A 3R3VA 4MWSA 4WFJA 5EGNA 2EEPA 1XZIA 5AKGA 5ALZA 2Z5GA 4KYVA 5DTIA 3STWA 3TGLA 1XROA 2Z3WA 1IVYA 5LIPA 3SK0A 2WLSA 2EDAA 4K5QA 3OG9A 4WJLA 4B80A 4C4ZA 3N0TA 1XFDA 2H1IA 5T4HA 3CXUA 3F97A 4N8DA 2XUFA 5ALPA 2GZSA 4J7AA 2ACEA 3RM3A 4JH0A 2DSNA 3DLTA 1Y7IA 4AMZA 3E4DA 2RIPA 5HF5A 5A71A 2DQZA 2O7RA 1UOPA 4ARBA 1R88A 4L3WA 2ES4A 4BE4A 1FJ2A 4UHBA 1CUIA 3HLKA 1ORWA 1R9NA 1BN7A 4BCCA 2GYUA 4H7HA 3A6ZA 2ZJ7A 2QT9A 3F96A 3PFCA 2XQKA 3V1LA 3PF8A 1A88A 1CUZA 3G0IA 4PSUA 5FKJA 4DIUA 4DMHA 3SWWA 3A70A 2WFZA 5BWBA 5E4JA 1WHTA 4FMPA 4FOLA 1CUBA 2QVBA 3G7NA 1IMJA 2WUDA 5AM4A 3WKEA 2JEZA 4B84A 1TK3A 3C70A 1CUYA 1PJAA 1ZD2P 5HKBA 3WQHA 1CUWA 1QIHA 4X85A 4B6GA 4B0OA 3ZLUA 2WUEA 3AZOA 1AKNA 3DL4A 2PU5A 4WDQA 1DT3A 2WSLA 1G4HA 3B5EA 3IULA 1JMKC 2ZJ6A 1XZFA 4Y9SA 4UHDA 5ALLA 3CCCA 1E89A 2C0PA 2JEYA 2PL5A 1AUOA 4IH1A 1SC9A 1UOQA 4BAUA 3FNBA 1QJ4A 1WB5A 2WIKA 1BU8A 4UUQA 1X2BA 4IH9A 1CUSA 3DOIA 4OB6A 3ZWQA 3EF3A 1P0PA 3T52A 1VXOA 1W76A 2O7VA 5HFAA 3UUFA 2D5LA 1F0PA 1VE6A 3HSSA 4OYLA 4AN0A 3R3WA 1AC5A 1XKLA 4Y2UA 3FVRA 2WIDA 2XMSA 4GW3A 3VKFA 3L1HA 2XUJA 4NVRA 5ISMA 4ETWA 5CTAA 5JD6A 3WYNA 2H9YA 3I2KA 5JZ9A 2RONA 2XUIA 4F60A 4AXBA 3JWEA 3SX4A 5AI0A 1XZEA 1WPRA 3KOOA 2J4CA 4UBNA 5IVIA 1KU0A 5SYNA 5IVKA 1TRHA 3QZUA 4RE6A 5EI5A 1WB4A 3K2IA 4WY5A 1Q0RA 4Q1VA 1YAHA 4AN1A 1W1IA 1UZAA 3I2FA 1CR6A 4P08A 1Q0ZA 1EI9A 3VJLA 2RHWA 4P9NA 3WKDA 2VT6A 2WILA 3TJMA 4BP9A 3AFIA 4Y2QA 1YCDA 1AQLA 3BDVA 2QJRA 4UFPA 3V48A 2VT7A 2B61A 1T2NA 4U2GA 1WM1A 2OG1A 2HA0A 2AJ8A 4P92A 5CT6A 4ZREA 1HL7A 1DWOA 5CMLA 3PE6A 5BWCA 1XZHA 2QS9A 3IBTA 1XRLA 1VZ3A 1YB6A 5CXUA 4U2BA 2R11A 1XQYA 2B9VA 2JGMA 3FLAA 3EIOA 4EY7A 3ESBA 1LBSA 1QIJA 3CCBA 2VJDA 2VEOA 4UHCA 1CRLA 1CVLA 1UT6A 3B12A 3I2GA 4X6YA 2WIFA 5EHQA 3WK7A 2QMQA 3OOSA 4QA9A 5JARA 1XRRA 1JJBA 2HA2A 1LPSA 2RHTA 3G0CA 2C58A 4NMWA 5JZBA 4FLEA 5AK6A 4EY4A 5E4TA 4Y2JA 1QONA 3I6MA 1QE3A 1CUUA 3LIPA 5ALWA 1HPLA 3D2BA 4CFSA 2XUGA 3M82A 5HF8A 2V9ZA 4ZGBA 2WU3A 2OAEA 4QDUA 1MTZA 3ZI7A 5T4BA 4G8BA 3W05A 4Y2PA 4BE9A 1RWQA 4GHWA 3W2TA 1QZ3A 1T4MA 3QPDA 3U1TA 3A2NA 5I8PA 4RPCA 3VVLA 3BE8A 3QITA 1QIIA 1R9MA 3W04A 4PSCA 4DTCA 4B85A 4A5SA 4L72A 2DHDA 3M81A 4PNZA 2HIHA 4NZZA 4E46A 4LHEA 5HQ3A 3R40A 4FTWA 2GBCA 3UUEA 4QWWA 4DYHA 1CUJA 5EHNA 5FV4A 3DJYA 2QXUA 3OM8A 2XMCA 2IX9A 2JGJA 1ORVA 1MAAA 4IHAA 4YX9A 3O4JA 4C89A 1BCRA 2HU7A 1DT5A 5I7UA 3IUJA 3ZV7A 2HADA 2DFPA 4X6UA 4MXDA 4B82A 3S8YA 1GXSA 5K3DA 1QOZA 1IUPA 4N8EA 3M83A 3E1GA 4DSZA 5FPPA 3NUZA 5AIAA 2BUCA 4W63A 4BCDA 4G8DA 2HA4A 1GKKA 2HFKA 5IKXA 2XMRA 5EIAA 2QZPA 1LGYA 1G42A 4EHBA 2HU5A 1ACLA 5AI6A 2E3JA 1JMYA 2AJCA 1OXMA 5AO9A 2BUAA 5FUMA 5KWJA 1YA8A 2OGTA 5AP9A 4E14A 2WIGA 1WOMA 4PV7A 2ACKA 4X3CA 1AZWA 1ZD5A 1XZKA 3HACA 4KAJA 1CUFA 2XMDA 3FVTA 4OSEA 3WWEA 4AO6A 1GQSA 2WHRA 2C4HA 4Q82A 3BF8A 3C45A 1TKRA 3G0GA 3M3DA 1U65A 4DMFA 4UHEA 4H7EA 1PV1A 4FNMA 1R4ZA 1ETHA 2V98A 3R3UA 1BN6A 3PUHA 4DGQA 2DHEA 4QWMA 1ZOIA 3AIKA 3I1IA 2B20A 5ALTA 3IIIA 1LPBB 3WK8A 2AJBA 3ANSA 1WCYA 4UBOA 1CLEA 5DYYA 4I4CA 1NX9A 5ESRA 1KEZA 1UKBA 5AI5A 1RYYA 2XUDA 5EIEA 1UKCA 4ZWNA 4N8SA 4G5XA 3D2AA 3I28A 2XQGA 5A7HA 4X97A 5AKIA 5AH0A 4BAZA 2NW6A 5CT9A 1H2XA 1CUVA 5C8XA 5AK4A 1WHSA 3WKAA 2WG2A 1J2EA 4OU5A 5ALEA 1JU4A 1USWA 1UK6A 4NS4A 3KDAA 1TCCA 1CIJA 1XLUA 4XWGA 5C8VA 4EB0A 3FOBA 1SCKA 4Y2VA 2HA6A 1JFRA 1WB6A 2WG0A 3NWOA 3R3ZA 5D3ZA 5CH3A 3R3YA 2AXEA 4U2EA 2G5PA 4RE5A 1YA4A 5ALMA 3U0VA 4H7FA 4GBGA 2PSJA 1EDBA 5K3EA 4H77A 3BF7A 4FBLA 4BBZA 5ALXA 3C6XA 5AJHA 4HAIA 1LPMA 3WK6A 4ARAA 1LPAB 1AMNA 1CPYA 5A7FA 4AO7A 1ZJ5A 5IH7A 3C6ZA 4F5ZA 2G5TA 3QMVA 3D2CA 3I6YA 4J0IA 4EZIA 3MUOA 5D3KA 1XZGA 3DYVA 3F8SA 2C5GA 4QDZA 1QIGA 2OAGA 4GECA 1UWCA 3AZQA 4LKOA 4C01A 1CUDA 1THTA 1F0NA 2JBWA 3O4HA 2J3DA 3IUMA 4BRSA 3C5WP 4BVKA 5AM3A 4QNNA 3FYUC 3PFBA 1ZIXA 4JYMA 3STXA 4X92A 3GROA 2WJ4A 1MX9A 3WLAA 3STTA 2HL6A 5CBKA 3WL7A 4HVTA 4A23A 2ZVDA 1JI3A 4KE9A 5C8ZA 5AI4A 5AICA 4HXGA 4OCZA 5HCUA 2Z3ZA 4Y2SA 4HS9A 2ZSHA 4EBBA 1CUCA 4G4IA 4MQMA 5JYCA 3QH4A 2RAUA 1MX5A 3AIMA 2JF0A 3H2GA 3FWHA 2XE4A 5HF9A 1CUAA 4H0CA 4Q3LA 3V9AA 3IVMA 5JIBA 2GBFA 4ZV7A 4P93A 4B0PA 1JKMA 1QGED 3DS8A 4DM7A 3QBJA 5AI8A 1HBJA 4FLMA 2HRQA 1P0IA 4H18A 2VJCA 3FSGA 2VJAA 5FLKA 1A7UA 5T4EA 3BXPA 1J07A 2QUBA 2BCEA 1YAJA 3C6BA 4QDXA 1VLQA 4JEIA 3H0CA 1ZD4A 2PSDA 5C7YA 4W1SA 3QMMA 1UK8A 2XMGA 4V2IA 1DWPA 1UK9A 1XZDA 4UBIA 3WK9A 1EA5A 2ONCA 1KU6A 2XUAA 3FAKA 5AK3A 4BZWA 4FKBA 4JUIA 2VA9A 4X93A 5JD5A 2DHCA 2JGIA 4F0JA 3TEJA 3VVMA 3QVMA 4IH4A 1XQXA 5CT4A 3IA2A 4AMYA 4CG3A 4KEAA 5AKXA 4UBLA 1IZ8A 3H2JA 3HC7A 3IB3A 3QYJA 2BGRA 2QKYA 5A6VA 4J0DA 4MEBA 3ESAA 2HM7A 4BB0A 1VA5A 5JAUA 2X8BA 1EH5A 1EVQA 5JZSA 1LPOA 3FYTA 3G9UA 2WJ6A 4DNPA 1O6GA 2J4FA 1FFDA 1MJ5A 3DKKA 1HLGA 4X00A 2Y2UA 1WPXA 2QR5A 2WJ3A 3G8YA 5LZ9A 4UBJA 4B9AA 1XZJA 2QM0A 2VAXA 4AZ0A 5JAOA 1MN6A 4Y2XA 1QIKA 5IVDA 1DX6A 2AJLI 2OQIA 1ODSA 4EY5A 3CN9A 3G02A 4H7JA 1MU0A 1GZ7A 3O95A 2O2GA 4JYPA 1ZI6A 3HI4A 3TRDA 2H7YA 3WMRA 4PW0A 4ROTA 2PVSA 2R8BA 2DCMA 2PPLA 3DEAA 3WL8A 1Y37A 2Y2VA 5AKYA 1XZAA 2OLEA 1GQRA 1ZJ4A 4Q05A 4RGYA 3X3HA 1EINA 1EK1A 3MGAA 3VXKA 5EIHA 1XRPA 3WL6A 1W4LA 3E0XA 4L9AA 1GPKA 2ROQA 5AM5A 3ANTA 5I9IA 4BP8A 3HYSA 3R3XA 2IITA 5ALOA 3DOHA 4X90A 3WL5A 4HRYA 4UFOA 1BS9A 5DLPA 1LZKA 1CFJA 4GEGA 4G8CA 1CUHA 4AQDA 4UHFA 1LNSA 4WFIA 2WTMA 4BYMA 1J1IA 1QTRA 5AOCA 5F4ZA 3RK4A 1E8MA 1G5FA 2QXTA 3L1IA 4CCYB 3MVEA 5JD4A 3FSGD 1TCAA 2CMFA 2JGLA 3IDAA 1XQVA 2OXEA 3AILA 4GXNA 2PUHA 3H17A 3EQ8A 1DQYA 4CCYA 2ZYHA 2XUPA 2RI6A 4N5IX 2PUJA 4DMCA 1ACJA 3Q0TA 3WWPA 1R3DA 4I19A 1NU6A 2B4KA 4D9JA 3G9TA 4K6KA 3WZMA 3O9VA 4CI9A 3W9BA 2Y6VA 2I03A 2BKLA 4KRXA 4W1RA 1ZIYA 5SYMA 1DTEA 3FLBA 3E3AA 3I6ZA 5AKEA 1L7AA 2PKYX 3K9BA 5K5EA 4C87A 2J3QA 4LYEA 2XMQA 4AB1A 1XLVA 3WK5A 2OCLA 5LYYA 1ZI8A 5AKLA 4QLAA 4HXFB 2HU8A 3PI6A 1HQDA 4LXIA 3QMWA 5E2IA 3D7RA 4Q34A 1P0QA 4MQLA 1YB7A 2YYSA 3N2ZB 3SC2A 1QO9A 2UZ0A 7YASA 1H22A 3WA7A 4X91A 2ZYSA 2VAVA 2XB6A 4FFWA 5JAPA 1BCSA 4C4YA 4EY6A 5LZ2A 1MT3A 5LZ5A 4L0CA 3FYUB 1W6RA 3I1YA 2HHAA 4OU4A 3DDUA 1VZ2A 2FX5A 4EY8A 3DQZA 5AI9A 4G4GA 3FYUA 3QM1A 4CIAA 5JATA 4MYSA 2OGSA 4KE8A 1EHYA 1X2EA 4W9RA 1EB8A 2EDCA 4YPVA 5CXXA 5ALHA 4BCBA 3I2IA 2V97A 4G1FA 1DU4A 1LZLA 1L7QA 3GFFA 1XZCA 1F6WA 4QEKA 3O4GA 5ALQA 1GPNA 3IURA 4H7DA 4CG2A 4W1QA 1XQWA 1AGYA 2HFJA 3OTQA 1GKLA 1ODCA 3LP5A 2C5FA 1N5MA 4XJVA 5ALSA 1K8QA
chains in the Genus database with same CATH superfamily
5ICFA 1E2JA 2XQVA 1L8QA 2D7DA 1U9IC 5A03A 5B3KA 1RQNA 4GBJA 2IIQA 3DFUA 1IU9A 1ECLA 1US8A 2WJWA 4FYPA 5ALIA 2CC2A 5T4FA 2XKAA 4MQUA 2F3RA 4ZC8A 1K5PA 4HRXA 3P52A 3CH5A 5BQOA 3KWFA 3CRVA 2O8DB 5T67A 5HRUA 1VJTA 3FOZA 2DFLA 4BTVA 4K9RA 3SXUA 1BOFA 1O96A 3HHEA 4P84A 1AS2A 1XTBA 1DGQA 2YINC 1C4OA 4MV5A 1UPUA 2YJZA 1U80A 2B3DA 4V1CA 3GEPA 3WI7A 1RZ3A 2HA7A 2ZJ1A 2I3ZA 4DQXA 3DMPA 3V7NA 2OXFA 1KR5A 2VLIA 4M0KA 2QNIA 3EA5A 4WLOA 3U40A 4TWIA 4HN9A 4FCVA 4Y0VA 4B48A 5BSTA 3NXSA 3TLYA 1T9DA 2JIDA 2O23A 3NFRA 4HDKA 4O0LA 5F77A 4CJXA 1NIPA 4X1IB 3QUSA 5CCDA 5FOQA 1USIA 4L8VA 1IWBB 4X20B 1Y8QB 2B0JA 3VZSA 3NT4A 3WBKA 2CV0A 5BNZA 5AXAA 1BEEA 1M1ZA 3ESXA 3USCS 4BRZA 3C8HA 1DZ3A 1EVKA 1GDHA 2J07A 3LBAA 1PFUA 3RARA 3ROXA 2JBAB 3EGOA 4X8LA 3KXDA 4CWAA 3WZLA 3VTZA 3K71B 2YN0A 1ETUA 1TQ6A 2AOTA 1C14A 5MFZA 1QP0A 1FFCA 4GP6A 2EQBA 3LC1O 4L6AA 1MB0A 1RYHA 3V00A 4EEZA 4WKBA 5JQGA 3DWIA 1S89A 1OFUX 4EKEA 1YDWA 4YJ3B 5DP1A 1I6LA 5EN4A 3JD2A 2ZETA 1ZHHA 2BHSA 4NJMB 4TPKA 4BWYA 4EJ0A 4LPKA 4X66B 2O5EA 5LJIA 3DV2A 2K4MA 2R7MA 2ZDHA 2HMTA 1GSAA 3RFTA 2FU5C 1NTRA 2H3HA 3I42A 3KPUA 2WWTA 2K5UA 5DI3B 4MW6A 1OZAA 5AK5A 1X94A 5CB4A 5L3QA 1UUFA 1WTCA 2Z8YA 3E3MA 1CB0A 2FN8A 2OXIA 4F2DA 5BMVB 3TLGB 1JJIA 3HH8A 5DNVA 1VIVA 3UAVA 1Z7BA 5K0CA 3ZGZA 2F1HA 2A9KA 3H6HA 4B3DA 1O08A 3PJDA 4NZNA 5CHEA 1C41A 1OT3A 1X3SA 1M7BA 2GBIA 2UYGA 3EF0A 2QBYB 4FNAA 4BC0A 2VF7A 3FNRA 3PNPA 4W9MC 2A14A 2MIIA 4X6XA 2W6ID 3K8QA 4DLNA 1J8DA 1JU3A 4KACA 4OJKA 3NB0A 4ZQFA 1ZUIA 1TU0A 2Q21A 1NM5C 4JCCA 1K5DA 1YZ3A 3Q5EA 4KUGA 1LQ2A 2YFYA 3TCNA 4DQVA 3G9XA 1ATZA 2QZ4A 2DPMA 2PCLA 3PPVA 4BV9A 4DCSA 4RULA 2YZNA 2V7GA 3QNUA 1XJ0A 2PMFA 4REQA 3T7RA 3DP9A 1T0HB 1OTHA 3BFKA 2VRCD 3DFFA 4B83A 3NNSA 3MLAA 2OP0A 4WUVA 2W70A 3WHIA 2VP9A 4Y2GA 3HP1A 1Z7GA 2WSMA 4J0KA 4LJ6A 4BQEA 5DHRA 1NVBA 3GLIB 1A2OA 4IVNA 5ALJA 3RVLA 5TR9A 1FBNA 1H3FA 3EOAI 3MA0A 3AR8A 5AJUA 3UJ6A 4CEHA 3PF9A 1OC2A 1LFDB 3BX1A 3NRBA 1G7SA 4AO8A 3KJNA 3PRJA 1E2GA 4J0CA 5EIWA 2CUNA 1FUKA 2OCGA 3DVRX 3H9EO 2XDYA 2FUCA 3JU3A 3H16A 3BB3A 4F9GA 1LQTA 4BUZA 2P91A 3DVAA 3GLTA 3N59A 1XEXA 4MSUA 3GD5A 3S55A 3ZE6A 5KMGB 2W43A 2P35A 1W88A 4F4DA 4C4TA 5FULA 1SZJG 1NUAA 4IJQA 3EX7C 4J0GA 3O94A 4UFNA 2HDHA 5DGDA 2QY6A 1RWMA 2IEYA 5DBIA 1KWGA 4LDQA 2FQQA 2D4HA 1LQUA 2AS0A 4UM9B 4F5YA 1HTTA 5JMWA 3U61B 3K9GA 4PICA 1RWXA 3B3JA 1EUYA 4BUJA 5LQJA 5DXAA 4UU7A 1UWKA 3WLFA 5A2GA 1XNQB 2Z9DA 4CT4B 3T7TA 3N2EA 3Q8WA 1SPBS 1NV8A 1Q57A 1RM0A 2F90A 5LP6F 4FYIA 2QMOA 4HDRB 1MO4A 4DKJA 3D3WA 4YRJA 1YK1A 2P9EA 3Q3IA 4FSXA 3AX6A 4LWPA 1D07A 3EZYA 3JTEA 4RADA 2IEIA 4HC4A 2X58A 2NV2B 2A0UA 2OORA 4B3RB 1JHQA 1RVDA 4POAA 1EWVA 5DNWA 4AMBA 1QQBA 4UE6A 3U7QA 2IXDA 1WUHS 3PQFA 1QUFA 1NQVA 4HDQB 1I1NA 5HKAA 1VGQA 3ZWAA 2PKCA 3OX3A 3IRUA 2OILA 1L3IA 3I2HA 2HSJA 3TDNA 5A4AA 1C8BA 1JDZA 2XNSA 4X61A 4RD0A 1IZYA 3LT4A 1QHNA 2ZS7A 4MDHA 1Z82A 1SHUX 4HGPA 4KE6A 1U90A 3LS2A 1FTQA 5C5IA 2BSXA 3RRJA 4K9OA 1K27A 5E9QA 9ABPA 1R0XA 1U1IA 2BFBA 1ULHA 4FIDA 4IF4A 4LJ8A 2CB9A 2ZM6B 2QU8A 1TMYA 4WKOA 3ER9A 4NPHA 1HMPA 1JS1X 1P2UA 1KZHA 3SEAA 3T7KA 1IXSB 2IELA 3N0XA 4TV9A 3ZCRA 1FK8A 3P4YA 1DJOA 2XRYA 3DXFA 1JA9A 1Q14A 1XK6A 1TC1A 2ZQZA 3PDWA 2GERA 4GPBA 4LDPA 3FMFA 4ND3A 4BEVA 3MTBA 1DDGA 2ZAOA 2A1TR 3GR6A 3L0SA 5JMTA 4M1YA 1NW9B 1V3UA 4BLWA 4K40A 1ADBA 5AW6A 4DV1B 5IF9A 1G16A 1XMOB 4JQOA 1LF5A 1YRAA 2FEXA 1EE9A 2PSHA 4FGZA 4WOPA 1N1GA 4BBPA 2WYWA 5DT9A 4H08A 4PLFA 3A27A 5F1KA 1L4YA 3K1ZA 3FPJA 1I1OA 2E49A 5AW1A 2FLWA 4L78A 1NLUA 1GL7A 1D3AA 3OZ7A 2UYOA 3Q2IA 3ZWKA 4CM7A 3IPYA 2DWQA 4Q1AA 1H0KA 3JD0A 4YA6A 1Q3KA 4J91A 4QHSA 5AHWA 2PSFA 3PNOA 3UXYA 3W4KA 5HK9A 1O6FA 4WEOA 5CDUA 3WDSA 5B3JC 1S3IA 4UOQA 4H1WA 2BLNA 4L22A 4DCNA 4ZGWA 4JHXA 3MJTA 3C7TA 4DT1B 1J00A 1ARZA 3DBHB 3G79A 1KI3A 3HN2A 4FS3A 2WWFA 3QFTA 4GG1A 4DJFC 1U3GA 2WVGA 1YZLA 3ICCA 4UU8A 2IHKA 4OP3A 4POOA 3SVLA 1ULZA 4U7PB 1EPUA 2KLHA 2LZ0A 2EBFX 3QU2A 3DCNA 4LBZA 1J0CA 4FYYA 5EL0A 2XA1A 5K0ZA 1E2EA 2CBGA 5IKPA 2IIVA 3JAWB 2JJYA 4P33A 5MN6A 1ZGBA 3PB3A 4F93B 2AK3A 3FWNA 1JKJB 1NI4A 4YV7A 4M0DA 10MHA 1S2OA 1Q17A 2I6TA 1GR0A 4DY6A 3ZBUA 2HX1A 4US2R 3DKRA 4OH1A 5EESA 1ZBQA 1FYFA 2Z43A 1BDJA 2RAFA 2X1HA 3NEAA 1HZZA 4RXUA 4WY8A 2E4UA 5LB4A 2PD3A 1E8DA 3IDFA 3WA6A 4EI9A 5BVGB 1U0LA 3LVFO 3ZW8A 1DEOA 2OEPA 5C1IA 3NJ4A 2XUQA 3UT5B 1C4WA 3LE8A 1C4XA 2XUZA 2XUKA 3NTVA 4I9NA 2P7HA 3ITKA 3FCXA 3HA7A 2D13A 3VC3A 3ZCTA 3EUAA 2F67A 3L82B 5BXQC 4U4AA 1Q3TA 4RK4A 1UH5A 1S7GA 1A77A 4HYYA 2GKSA 2PZEA 2W0MA 3ICVA 3W9UA 4R8MA 4B4WA 3H2KA 4ABTA 2QN2A 1VFNA 2R6R1 3DHWC 3F7NA 2JCVA 1RPTA 3K31A 4AZVA 4LE2A 1X1DA 4ZJZA 3GEDA 4NU5A 1A82A 2OQVA 2C29D 2WHPB 2C7GA 2X40A 5KEIA 3ACBA 1N2CE 3CF0A 1R6DA 1L3CA 2KWIA 2W6JD 2NO9A 4Q16A 3VX3A 2QRNA 2HLDD 1K68A 4NR0A 1EK2A 4N5NA 4K03A 5GJCA 1YL5A 3NHKA 3D3EA 4KRYA 4KXFB 4QE3A 1E98A 1GNTA 1YS7A 4BZXA 5LBTA 2ZSJA 3LUHA 3HNPA 4OA5A 2OXRA 3GPIA 5IAGA 3UW1A 2D0PB 3H11B 3N9IA 4F6CA 3GRKA 3N6VA 3WO0A 3T3DA 1HEYA 5DTMA 5K05A 2JI4A 4IIDA 5B1DA 2H16A 4ME6A 4YASA 4TKVA 5AVTA 5K1ZA 3ZKWA 2OVFA 2P2ZA 2JFUA 2VHCA 3Q11A 5I9TA 3OHSX 3BIWA 5E9AA 1NR7A 5KOYA 1TMKA 3ABZA 3TZHA 2Q6VA 3CNHA 1SXQA 3HJTA 3C43A 2ZE7A 1VG0B 1Z62A 1H5UA 1N6NA 3CEAA 3NHWA 2P7IA 3QWAA 4DHEA 1S3SA 3A6DA 3VVCA 2NVUB 5DN6D 3AK4A 2V55B 4M60A 2FSVC 4MS1A 3RODA 4Z49A 3ILVA 1EX1A 3DSRA 1FNDA 3UOAB 1ZGCA 5BWMA 2AXPA 4G5RA 5KVQA 2CGEA 5J59A 1N2CA 4HVCA 4GICA 1Z4MA 2G4CA 4V0ME 1AN0A 2G8NA 2CFIA 2JZCA 5EWMA 4DVJA 1WMBA 5J4HA 3FJYA 3KJZA 1MJFA 2WM9B 5KX5F 5LLSA 1K8XB 2B78A 2PHZA 2YWRA 3GLKA 1MPTA 3Q2KA 4ZODA 3TLBA 5DN9A 5LZ4A 1JLKA 1AIPA 2WFMA 5LP6A 3VNVA 4DDWA 3NEPX 1VJCA 1E0AA 3GL9A 4DIDA 1FRFS 5GZ6A 3F3KA 2Q4DA 3VC7A 3EXEA 3DTVB 5GVSA 1EX7A 3DGFC 2I9PA 4F8EA 1Y6QA 5MDHA 3OMLA 4XASA 3DE5X 3WGIA 3OM1A 3WB0A 2GN9A 4UM9D 2B99A 3KZ1E 3PJGA 1WIWA 4MQBA 4CCWA 5JV5A 3NCTA 2XE7A 2LP4Y 3GFVA 1SG6A 1U4NA 4PHGA 3A9CA 2C2BA 1RLTA 3I9FA 4NDNE 4UC0A 1MTOA 1JIXA 2Z30A 3PR3A 4WUTA 1U31A 2BF4A 2XCIA 3VU0A 2DYKA 1B8OA 1IZZA 2BHNA 1XAIA 1SKBA 3CMMA 2O1SA 2QYSA 1P77A 1UBRS 1KH3A 1JU9A 3I0MA 2ZB2A 3M89A 3VSAA 5DX0A 1QLWA 4C1NA 4D3DA 3C24A 5LM3A 2YXLA 5BV1A 3PL5A 3CUUA 2HA3A 2QN7A 4YGYA 5EMKA 3TPZA 3THXA 3JRNA 1CE8B 1O5TA 2XYQA 3M9LA 1PJ8A 4LYGA 2D62A 2QRUA 1UXKA 1QCZA 1UPBA 3OIFA 1DKPA 5SICE 2CHQA 2BCGY 2YJ5A 3D0KA 3UA4A 3VNAA 3WRVA 4ZV4A 3OCVA 1CKEA 3KKQA 5FD8A 5BSGA 4V0MA 1CJTC 2H2IA 3RS4A 3EBLA 2DEUA 2H0QA 1ZN7A 4U9HS 3I92A 2AN9A 1NBAA 2LW7A 4UKDA 3WKCA 3DT9A 1WLSA 2J6HA 4G1CA 3QLVC 3R76A 1N2SA 4BO8A 1Y3IA 2Z56A 3GEIA 4YRZA 4DUZB 4M8LA 1CZRA 4NBNA 5LZ8A 1D2HA 1KBZA 5FCDA 2QRGA 1CS0B 2AG0A 3GRYA 1IBCA 2ZJ0A 3JD4A 3GAAA 4RVFA 1JJVA 1Q84A 3T7CA 4F45A 2VI5A 4PU0A 2YJ3A 2AQKA 1F8YA 2YDXA 2Z2ZA 5KNCA 2RBEA 1MFZA 4BFVA 1PUJA 2O2ZA 3O4IA 4L5IA 3ZN2A 2PD4A 1B8NA 1RSZA 2PQ0A 2QTVA 4TGLA 4E21A 1FU7A 5HNKA 1EFVB 3RREA 2X6QA 4YRMA 4M0FA 1MABA 1R4MA 2ATCA 5DIFA 3ASUA 2ZCJA 1U3WA 4MAFA 1EDEA 5FTWA 4JENA 2JFQA 2H7VA 2R48A 1RC1A 4LNUA 2JLRA 1YR1A 1ZITA 3DEYX 3EGDA 2BFDA 3DMYA 4QULA 3UJDA 1LLCA 3B2EA 4GR5A 4UDXX 4EJ2A 3JRWA 4CGZA 3FCYA 3E22A 3PKIA 4KX5A 4MVJF 1O2DA 4QUBA 1IVSA 3L1VA 2JEOA 4R9SA 1R1DA 4NCBA 4RQTA 2IXTA 1DWUA 1P44A 2Q4BA 3B38A 4Z1MD 2CZQA 2C42A 1V4VA 2J4DA 1LLQA 5DXFA 2QRMA 2YIMA 3ANYB 4DIKA 2QPAA 4M8IA 1JEQB 4R1TA 2A35A 3FPGA 3L7JA 1AF7A 1LRKA 1BRTA 3QMPA 1KQOA 4AWBA 4FM9A 2ST1A 2K2QB 1SC4A 2R1VA 4OMCA 4IQFA 3OCJA 4BX8A 2Q3EA 1UKYA 1PO7A 1ZICA 3IV9A 4JGIA 3INGA 5M29A 3LLCA 5A0VA 1M75A 3PQDA 3DBRB 3BEDA 3O0DA 4BB9A 2I4NA 4J29A 2OK8A 1HSOA 3T4PA 4E6PA 1OLSA 1MX1A 2FMTA 5A9RA 4CTOA 3M8KA 3GJRA 5AW5A 4Q7QA 4G9BA 2HLNA 2XY4A 3VTFA 4AKTA 1QIFA 1U2PA 3O8RA 2HLPA 1ULUA 2DRIA 5IJXA 3RK1A 2C5HA 4IJ5A 3KFVA 3D3NA 3WWDA 1KY4A 1L5RA 4P2GA 3USES 4ALIA 5IVHA 4PF1A 1PT5A 2AZ4A 3GG9A 4K6FA 3WIUA 2WC1A 4MYRA 4IZ6A 4XOUA 5JALA 3F46A 1BVUA 1L5HA 5ADHA 1Z75A 1E7WA 3GZJA 2ZJYA 4GZMA 4YCMA 2QR3A 1OZ0A 3EXHA 1Y0BA 3O21A 3WLRA 4FDMA 1I7DA 4LSWA 4N76A 2CW5A 3NP9A 4BQFA 2C4UA 2GCIA 4YRGA 5AK0A 4M76B 1ORHA 2Z8ZA 1QC5A 1F8UA 3ENKA 1KZGB 3IIMA 2JFGA 3BEOA 3SBXA 2I6XA 1L4NA 1JG1A 1MOSA 1TRKA 2CLHB 2FWBA 4TZTA 4ASUA 3WNQA 3T3EA 1IHXA 2JFYA 3OA2A 4NWIA 2DHQA 5B1SA 1QB7A 1Z16A 1Z15A 5ICGA 2D0OB 3VUEA 3PC7A 3QUAA 4EJSC 3OZCA 2N1MA 3J81k 4QEDA 1B3RA 1ORDA 4HEA1 2PX6A 4GM1A 4IINA 2AOUA 4P6VF 3SC3A 4CDNA 4DLYA 5JXJA 3GH3A 1JQAA 1KI1A 3OMWA 3QBDA 1VI6A 4CEIA 3O2NA 2PA3A 1XCLA 1ZH6A 2ADFA 5KWIA 4M7OA 4FHZA 3CLRC 4PX5A 5AM1A 1VE9A 4DLXA 4LDZA 3EGXB 3LLMA 1T1RA 1RXSA 1U8TA 1R16A 1Z0JA 4JDPA 3RFFA 3W78A 5EHXA 1BIFA 1NA5A 3RLIA 1KZ9A 1LNQA 3UOGA 4EHJA 5EJ7A 3G88A 3KQLA 1JHDA 2G1PA 4W8OA 3STVA 5E8JA 1KEPA 4JUFA 4E11A 1EE1A 1UBGA 4KWTA 2CUZA 3L4EA 4RF3A 3F5MA 2OPHA 4L76A 4KQ1A 1F8GA 1JZTA 2NTNA 2O2EA 4P82A 1JDNA 1DPFA 2JI7A 3GAMA 4Z4QA 1T36A 2EKBA 1N0IA 3G7SA 4AZSA 2BFFB 3L77A 3U2QA 4EZBA 1MNQA 5L3SB 5G0WA 2C57A 1R10A 4L9WA 4OGKA 3UCXA 4DJDC 3G8AA 5LMUB 1YA6A 1G0NA 3BICA 3I83A 4K6HA 4QNRA 4Y2TA 5ECWA 5AQ1A 2O07A 2BZSA 3QXXA 4ISBA 2P6RA 4UXJA 1RZRA 3PNQA 2EZ9A 3Q9UA 4YT5A 4RSGA 2GBGA 2VHZA 1YQEA 2Q3BA 2GCOA 4QGBA 1K63A 3NNNA 2XYRA 3DJFA 3DZHA 1KI6A 3ILSA 3WB9A 1AHNA 4DIBA 3P20A 1E32A 3EBOA 4B73A 4Q7JB 3KO8A 2G9NA 3Q4GA 4Z4HA 2HK7A 4KK4A 3IAEA 1Y5LA 4KSBA 5AQEA 2NU8B 3QXHA 1T5SA 4JBYA 4MQ5A 3SF8B 1DARA 2ZJ4A 3SR3A 3F5DA 1Q7TA 2NUTA 2VJMA 2ZRKA 3L0CA 1QO7A 3DTVD 5CCBA 1YTLA 4D8UA 1GUFA 3LF2A 2H3EA 4BMCA 1FJHA 1YACA 3IMCA 2H7CA 4MVJE 1AM4D 1JTEA 2SECE 2ZP1A 4R8LA 4PRYA 1AHIA 1KP9A 2ZI3A 2VCHA 3NDPA 5DWDA 4L0MA 4OI1A 3ZQ4A 1K97A 3ILXA 2CL5A 4MV4A 2V4UA 3ICOA 2QD5A 2QQ0A 3FGPA 3OJEA 3HBAA 4FQ8A 1XV5A 4IIVA 4F12A 1KPIA 2BJHA 2F1OA 3EDQA 4YCSA 1G3QA 1VLMA 4KQ9A 1XPOA 4B75A 2H4JA 1M9NA 2FWMX 3M4ZA 4ZANA 5LXTA 4E09A 4EGFA 1F48A 1CIVA 1KOFA 1Q77A 4QQ8A 1O95A 4S35A 4C2UA 4G6ZA 2WKPA 1VSQA 1VIYA 4J4BA 4YJ2F 1QGUA 1X7ZB 3GT0A 5AJXA 1VE7A 1XKTA 2OQRA 2J5XA 4KMOA 4MRRA 2GD0A 3RYIA 2J9XB 1DLIA 1GA4A 4XYLA 5JRDS 1F12A 2R00A 3GVIA 1JJAA 2VKQA 4I7EA 4I9HA 3AVXA 2BMWA 3O26A 1S4MA 2AKEA 5TQ2A 2FHSA 3AL0C 3VO1A 3W06A 4ZYZA 1D4OA 1UXHA 2FK8A 4J3FA 1NIJA 4XX0A 1GQFA 1JSLA 1LPNA 2O8BA 4MVJA 1YASA 3WQBA 2RK3A 2QAIA 4H4DA 1CTQA 2OCIA 3KSDO 1BEUB 2QJWA 3KYCA 3TK1A 1ENPA 1Z88A 1GRNA 3A2MA 4FDAA 4FONA 1ZKMA 1ZD3A 2WFLA 3SX2A 3H9QA 3HUFA 3OZTA 3RIYA 1ZGZA 4GWLA 3TW8A 2AEFA 3VNRA 4C88A 5KKAA 4ZARA 1N8NA 5EWJB 1RI1A 1JQ3A 1JB9A 3QXGA 1I5EA 3QE4A 3PC2A 1DBPA 5J4YA 2OOSA 3ASVA 5GWXA 1B6GA 1ZYUA 3DMRA 2HMWA 5FA6A 4OKNA 1HM5A 1JDTA 1UOEA 4LWOA 1TGVA 4YP0A 2LD4A 5FI1B 1UM9B 1PKEA 2A58A 4FD3A 3KQMA 2R60A 2Y1LA 3VSEA 2GFHA 4S1PA 5JSFA 5CFZA 1PDWA 2N9UA 3KUXA 4J8PA 3TECE 3KVYA 5DLYA 4XUEA 2Y3IA 2JARA 2YZKA 2ZSFA 3G2LA 3WYGA 1NP3A 4QAJA 4REMA 2EZ8A 5IRCD 1THGA 2A1TS 1NKVA 3DTTA 4L51A 1YF3A 1SXIA 3OQ6A 4BNDA 3QY0A 4AUMA 5JNVA 2PWPA 3AINA 4PEVA 4X1YB 2W4IA 3ZW9A 2KMLA 1QNFA 2COUA 1B14A 2EGGA 3D3KA 2IXFA 1RWWA 3GA7A 2DQSA 5COQA 1TW3A 3E8XA 2XUHA 5K0EA 4MJ3A 1VLLA 1U11A 2B8JA 1Z83A 4LZPA 4P4TA 1N5DA 4PQYA 5B3AA 2XT9A 2I62A 4TL8A 2B1RA 2GN8A 5KJEA 3D43A 3GDFA 3O9ZA 1GILA 5GGXA 4CDRA 4ZXFA 2QOEA 5ED4A 3O38A 1QLHA 1IPFA 4HQNA 2C7PA 1WB9A 1W4BA 3QHPA 5C1BA 4B71A 2GS9A 3NS7A 2IXGA 2CJPA 5LB2A 1UBNA 4OHZA 3N2IA 4P7BA 1L7XA 2DQ4A 3HN7A 1UBKS 3I05A 3OAAD 4OKSA 2DUWA 2W48A 3TKLA 1ONBA 1I5OA 2GT1A 1GAEO 3IQFA 4ZVRA 2QMEA 1HC7A 4NSNA 1QV9A 4AX4A 3RYCA 4DCGA 5ULLA 2Q3CA 2P9GA 4LXHA 3T9EA 2XA9A 4IIHA 2MT9A 1D6MA 1RWNA 1IQ0A 1N1MA 3LCRA 2GBLA 4IIYA 4OI2A 5JJCA 1YDFA 1JHZA 1S02A 5DOVA 4LRQA 1H85A 4V0RA 1LY1A 5BV7A 2N1BA 4NBTA 5G1OA 2GNPA 1NVVQ 2PN1A 4GKAA 4KE7A 3ZUPA 3HM9A 1Y4DE 4OQLA 2YVUA 2IP1A 1LFAA 2RGUA 1NMEA 4NHEA 1D2RA 1UQRA 4GUDA 3V32A 5BMVA 1A2QA 3ZY6A 3BRSA 2R7KA 3PUXA 2QTTA 5C4MA 3HEAA 1EFPB 2P40A 5EJFA 2NU6B 1I1HA 5YASA 1J20A 2OV4A 1E66A 4AZ3A 3JQQA 2H1VA 2VSNA 3A4YA 4KKXB 2IZOA 3W2HA 3LOUA 2C2OA 2DUUA 5MFPA 1U1EA 3KCQA 1W59A 2DBRA 3HKEB 3K20A 1VQ1A 1KIFA 2DH5A 4UXIA 3MGBA 3TF5A 4BDTA 2VHQA 3UCEA 2G7MC 1XTJA 1IM5A 1U3CA 1W0KD 2VSFA 2XIQA 3MPOA 4LXYA 5EP3A 1UMCA 5DYWA 3UMFA 3ZWXA 4V39A 3CRQA 3KAPA 3KP1A 3EA0A 3IR6A 4PZLA 3C85A 3TW6A 2GPAA 2JI9A 4I46A 3I6BA 4KPGA 3DNFA 4WI1A 3TB6A 3B1FA 5A6SB 1Z5NA 4W5RA 3LRTA 1C3VA 1KYWA 4FWIB 1PVVA 2SCUA 2PJDA 3KT0A 1Q92A 2A5YB 5ITSA 4ND8B 3UJ8A 3KHSA 1OFIA 3ZLVA 1PAUA 2IY9A 3RC7A 5L6LB 4KO8A 1RRKA 3C1AA 5BV2P 2D00A 3QXCA 4KZPA 3WHKA 3HDGA 2O1WA 3KKOA 5LMCA 1U8CB 2YASA 5BQ3A 1U5AA 3VU9B 4LNHA 2OGUA 4J1SA 3IVAA 5IZCA 3ODGA 2NXWA 3M70A 3BWEA 3D6VA 4EKIA 1JHUA 1HDEA 3Q8MA 4OGGA 3ZJ4A 3PSHA 2HBRA 4R81A 3S5UA 3KT6A 3WB2A 3CWZA 4D9GA 4AJNA 1L5SA 2ZBQA 4DA7A 2P3OA 3QG5A 4HTFB 4LX8A 3DKPA 2VXOA 4JQYA 3G0OA 1JJ7A 4CU2A 3KT3A 3T3HA 5HQ3B 3DC2A 1YJ5A 5DCWA 2BHTA 2HRBA 3EUEA 1K7CA 2RI1A 3KX2A 3KJHA 4R5MA 3ELBA 2NO4A 4RS3A 4C0SA 2H08A 3ET4A 1OH5A 3TSZA 1FUIA 1P1JA 1L5QA 4CN9A 1QYDA 3C3EA 4AL4A 3U1VA 1ZSNA 3G6WA 4D98A 1R4NB 5ALZA 4RF4A 3P27A 1BKDR 1YQXA 4NJEA 2VF5X 1LC0A 4NZOA 2QX7A 1JR2A 3STWA 1E1QD 3HCNA 4RIFA 1U0GA 3TGLA 3KU4A 3LO8A 4FHCA 4LXTA 3IIKA 4N65A 3H4TA 3BZBA 5DWQA 5BSMA 3V2HA 1FYXA 3Q3CA 4ZT7A 3SIXA 1VL2A 2PFGA 4ND6A 1ZJWA 2KW5A 3PDJA 2YY5A 2WLSA 1VRCA 2UVPB 5EINA 3OG9A 4QOSA 4Z0HO 5CFMA 4ZDIA 1IQUA 4K9PA 4MUGA 3M2PA 4HAVA 1V16B 5AUQA 2V6GA 2XUFA 2QTLA 3UMBA 1TLFA 2GZSA 2BKAA 4J7AA 1XR3A 1DCKA 1QJCA 2CXHA 2VP5A 3E2MA 3H42B 4H16A 4PLHA 1Y5RA 4AP6A 1BHJA 4ARVA 1Y6FA 3CFYA 3I5UA 3Q8LA 2IZ7A 3HVIA 3E4DA 2H0AA 1OFGA 2XJ9A 2FFHA 1KJZA 2OCDA 3EBPA 3NQ41 4A2QA 2DQZA 3SS7X 5B2ZA 1AKEA 2O7RA 2FPSA 4LK3A 4P3PA 3OTIA 4ARBA 1R88A 5BN5A 2ES4A 2VZEA 1Z73A 3HXLA 3MMPA 2OE2A 2JFZA 4GC5A 4R40A 3C98A 4BE4A 1FLDA 4Q9LA 7GPBA 5J4LA 1ORWA 1YZKA 2CXQA 2IE8A 2GPBA 3HUUA 5IWAB 3QIAA 3G49A 4IUDS 2BGIA 4JKYA 4YMIA 5E7IA 3WAKA 1PR3A 3M5DA 3CNBA 3HJHA 2GYUA 3R5XA 5H68A 4ZEMA 5BSHA 4ALKA 4ND5A 1CX9B 3KD3A 2ZTUA 1KETA 3TTWA 1IMOA 5H82A 3TJZA 4D0GA 3PFCA 3I58A 3SHQA 4HGOA 1WXQA 4BLRA 1E1RD 2AN1A 5HCIA 2GK7A 1WG8A 1JTFA 1CUZA 5ANRB 1D0VA 4BKMA 1MVNA 5J2UB 1GUBA 3P0EA 2PFKA 1X39A 1PZHA 4QM6A 1WL8A 1LSUA 1T2CA 2WFZA 4TKZA 3UAOA 5BWBA 1RKBA 4Z9XA 2IHNA 1I2AA 1PLJA 1HDRA 1SD5A 4MR8A 3TBHA 3TAXA 3VRHA 1WHTA 4FOLA 1E9EA 1EYZA 2R6AA 3EH2A 1JLMA 2O3QA 4KHZA 1IMJA 4KGVA 4ZEOA 3F2VA 3E2IA 5CA1F 3W3AA 4UAVA 4O02B 2Q3FA 4A15A 3ZD6A 3F3YA 1QKIA 2PGJA 2ZCUA 4MICA 4B84A 4G56A 3LT1A 1RJFA 4I3GA 1RKXA 2FLKA 5EOVA 3JAWA 1CG6A 1OX5A 1Z6PA 1P8JA 1Q0UA 4W7HA 5CAEB 3ZHXA 1VYUA 1GPWB 1L8OA 2TSYB 4NARA 1GZ6A 4P32A 2FZLA 3DBVO 3MQ2A 3NAGA 3F1KA 1Z28A 3RV3A 4X85A 3TZEA 1HV8A 4LKRA 4MDEA 3BMCA 5DM2A 4EJSB 3HA5A 1G9SA 1ZNWA 4Q02A 4PR0A 5T3YA 3GYBA 4WOKA 3OLCX 3VYUB 1LSJA 4G4SP 1XMPA 4EA7A 1I4EB 2IYQA 3DB2A 3ETNA 4QTXA 4ESHA 4YUXA 5JNUA 2ZM5A 3UT5A 1BRMA 1JA1A 3LUGA 4F84A 4JI6B 4CLRA 2JVJA 2J09A 1FU4A 2X1VA 3TTSA 1OI2A 5REQA 3AKCA 3B5EA 3IULA 1JMKC 3U4GA 5JTUA 3A3PA 2CXPA 1FA9A 2CVFA 4LE0A 1BX3A 1W34A 4D99A 3K0FA 1R8JA 3V9PA 4L15A 3CB2A 5D6NA 5DCYA 5F73A 3I32A 1P1RA 4IGFA 1MO5A 5E2BA 1XJCA 2H1OA 1EVJA 2XZDA 3OT1B 3EIEA 1TVCA 4UHDA 4YREA 1QPGA 1P6UA 4GPIB 5M3BA 2ESRA 2WJZB 5D3QA 1RM4A 2JPDA 3SZUA 1I8TA 1KKMA 1YKSA 1RFGE 1R64A 2IHTA 3VOSA 2PL5A 1AUOA 2FPMA 1S8AA 1FP7A 1K9VF 1SC9A 1Y8RB 5FJIA 1PI3A 2DERA 2X2OA 3F6YA 2MYTA 4ENVA 3HJRA 4D97A 4U7DA 1D6NA 3FNBA 2C9ZA 5LYJF 3DXZA 2ZOSA 1KOGA 2UVQA 2NWQA 2A84A 4HGYA 1LH0A 4HD8A 1IFXA 1NXVA 1ZESA 4HYEA 3OO1A 1WEHA 3UFBA 1FVHA 4CM9D 5JDIA 4PPNA 3TSYA 2IGTA 1M34B 3IV6A 4IH9A 1ISIA 1XZ8A 1JPVA 2D5CA 3BMNA 1CUSA 2XTAA 4KQIA 4N0QA 1RRMA 3T52A 3UMRA 1G9XA 4B3JA 3IL2A 4I36A 2DY0A 3ZDDA 3RYHA 1S2GA 1GUYA 1VE6A 2AVNA 2G3YA 1L0BA 2PRJA 3OCYA 4H27A 4EPTA 4MUNA 2FEWB 3L6UA 4P36A 4OYLA 3UH1A 3EB9A 4G2TA 2IYLD 1V6SA 3C16C 2R68A 4O4IB 4XLLA 3N76A 4FN5A 2HT6A 1MZVA 2ORVA 2Q49A 2XKBA 2ZIWB 2FGKA 2ZPUA 1UPTA 4IWNA 1S5PA 2YIVX 3L07A 3DUFA 4JMPA 2QIOA 2VDJA 1VG1A 3U7EB 4F04A 2CHEA 4P5DA 4EO4A 2IUSA 1KEEA 4R2HA 4IX9A 3EXG2 4FIZA 4W8GA 2GF0A 3VKFA 4CNBA 1OVGA 1P75A 3V46A 1I94B 4TXLA 4DSNA 1DQRA 3QX9A 4MA0A 4NVRA 1MDBA 3EVZA 3I34X 4D8TA 5CFRA 1H2BA 2ZANA 3CR7A 1TVKB 2Z6QA 4S12A 5JWRA 3F73A 3B53X 5AWFC 1HOTA 3PWKA 3QUCA 3SF0A 2B6NA 4RLQA 3KHKA 5FO1A 3QVKA 2I6SA 4JBWA 4DN6A 4PPYA 4ANFA 4MI3A 3LK6A 2BEKA 1M1UA 3PNMA 4FFOA 4ADSG 4IO1A 5IZ4A 3CRNA 4JUBA 4NLLA 3I4CA 4OJTA 2NO6A 2F1KA 4EELA 5JRJA 1WJGA 2A1UB 2P90A 2YFHA 3U31A 2CNNA 2ZUVA 4B6OA 2D74A 3S0JA 6ABPA 2XRFA 5KZMB 1MQ8B 3HXMA 2UAGA 2HLHA 4MV9A 2ZROA 3ZU6A 2AYXA 2G6TA 4RYDA 1KU0A 5HQJA 5SYNA 3L0OA 1OA1A 4RE6A 2GJ9A 5IVKA 2M1XA 1B15A 5EI5A 4PBRA 1ODFA 5CR9A 1H2RS 4WY5A 2V65A 1CE8A 1N5LA 3QJ5A 3QVLA 4KWCA 5CIQA 5CFNA 4G23A 1M8JA 1WDTA 1VJGA 1Q0RA 2VAWA 2VP2A 5EG5A 4BFWA 4Q1VA 1SU7A 1YAHA 3KVOA 4JB8A 2BFPA 2F1RA 2B2CA 3I2FA 4OBWA 3VKVA 3ZIAA 1Q0ZA 1W4AA 1V26A 3A1DA 3VJLA 1L7VC 4UEOA 3U7IA 3T8YA 3UT0A 1OV4A 4OXKA 3WMGA 4NCHA 3IUPA 2FQYA 4NBSA 2NXNA 3WMEA 4C4SA 3HQ4O 1PR0A 1GDDA 4IJUA 4MLPA 3GLSA 1G6HA 3RG2A 3RUEA 4KV7A 3TJMA 4N5DA 4Y2QA 5KVCA 4O3MA 4FUTA 1MGPA 5BWOA 4R2MA 1JDUA 5HTOA 3A6HA 1HO3A 2VOEA 2CVQA 1KZ4A 1SIUA 2QJRA 3V48A 1DBVO 4LWQA 2F1JA 1Z39A 2VK4A 2B61A 1T2NA 3OE5A 3QEMA 3JQRA 2OG1A 5CLIA 5KKCA 5T7BA 2HV8A 3S99A 3BFJA 4FJ1A 5FL3A 2Y99A 2AJ8A 3S4YA 2VRBA 3UIEA 3RVJA 1HL7A 1T5BA 2W6OA 1DJQA 3AT1A 4AIIA 4MMXB 3ROPA 4OUDA 4CVNA 1GYQA 2O2JA 4QM7A 1XZHA 1YBMA 2JFBA 2CJYA 1TNDA 3IBTA 3PG5A 3EOZA 4CLXA 4EMSA 4Z7JA 1XRLA 2HAEA 1Y4AE 3QF4A 2VUUA 3GK3A 3H8JA 3GN1A 4QFDA 3IP8A 2VWGA 3H2YA 5KNDA 1JF8A 1TLTA 5FL7A 5IJZA 3HBMA 2BM9A 2VTEA 4WIAA 1ZGJA 2BEUA 3FLAA 1U3FA 2Q29A 5CA0A 3VR1A 4D3XA 4F7DA 1F2DA 2AKYA 2NGRA 4KQEA 1QIJA 4YAJA 4C78A 4JT2A 3T61A 3CQ9A 2AN4A 4Z86A 3CIFA 1XDDA 4DLWA 1CRLA 2EX1A 1CVLA 1JFFB 2FEKA 3AR5A 3H9CA 3PVZA 4J2HA 5BMOA 3DGEC 4X6YA 5EHQA 3WK7A 4MLZA 4PO1A 3EN0A 1JEQA 4NAHA 3CZPA 1MC8A 4XZ3A 4JLUA 5F12A 3QTLA 1NJ6A 1DE0A 3IUYA 1XAHA 2J0UA 3C6KA 2V7UA 1HNWB 5DSXA 5JAMA 4OQPA 2CJWB 3P2EA 4HPXB 4OIMA 1C0EA 3MTQA 3PPYA 4OXXA 5HUQA 2PT7A 4B8YA 2VJPA 3GIDA 3VR5A 5JARA 1HGXA 2F9FA 3LO5A 3PUYA 4LVNA 2Z09A 1Z38A 3ZE0B 5CFLA 1JJBA 3EEYA 3EZXA 4L5AA 5EJAA 3JWHA 3O31A 3S70A 3SN6A 4DEYA 1LPSA 1V7CA 4YRSA 3HU1A 1TF2A 4RNDB 5AVYA 1QO0A 1YFKA 1H5QA 3ISTA 4RK7A 4B40A 4L8GA 4S1TA 4EB6B 4RJTA 5BPHA 3TFOA 3U6BA 3BUSA 1KO4A 2Z98A 3AUUA 4I8IA 5AK6A 1FFGA 4UEWA 4EY4A 1WETA 3ASZA 5E4TA 1HE8B 4ZO4A 3WGNA 3UF0A 2NPOA 4DG8A 3GARA 5I7EA 1NHGA 2DX7A 1NW7A 1P1CA 3I6MA 2ZCVA 3NHZA 1Q15A 4WKGA 3AVYA 4WVLA 1IXZA 3KHTA 3D2BA 2NUAA 3CLRD 5JT1A 5ITZB 3M82A 4EP1A 1LV8A 4TLDA 3P94A 1KFBB 3GFRA 4FGWA 4HRAA 3V4FA 1KWKA 4ZGBA 2WU3A 3UJNA 2QPLA 1U1GA 5JHGB 5LOVF 1RACA 5DK6A 3QKTA 2HZ7A 5SZHB 5LYJA 4GX1A 3U37A 4C0AC 4QODA 4G8BA 4FZVA 3W05A 1YMUA 4Y2PA 4BE9A 3C7CB 1RWQA 2Y05A 3NLLA 3WRYA 4ZTZB 4ER7A 4HDMB 2CHGA 1H1LB 3OQIA 5DM0A 3EZNA 3RVQA 4EO9A 4CL2A 3GJ4A 2CXUA 2NN3C 3MIZA 1SVOA 2YCBA 3FCSB 3QI7A 3QPDA 3CUSA 2QLNA 3M0EA 1JLHA 1KYQA 1H93A 2DUJA 3DE7X 3RIGA 5I8PA 2WSSA 3N2LA 1FLAA 4JJ7A 3NUGA 4HZUA 3ZS8A 4NMXB 4S1VA 5E9JA 4PPGA 4Y30A 1YO6A 2QDXA 3BE8A 1C7FA 1MT0A 3D1LA 3FTPA 4HMPA 1OKKD 5KX5B 1AZLA 2I1LA 1K66A 1Z4KA 4QIHA 4OXQA 2BEVA 4O2AA 1Q1AA 3VV3A 2VZ8A 4KIGA 1FRVA 4UVDA 2XSZD 3JQBC 4O2BB 5J40A 2DHDA 2IWHA 4EG1A 5A02A 2OV6A 3ESQA 3GQVA 1Z8NA 4Q66C 2JANA 4DPKA 4ZI7A 2XOXA 4LMBA 2B2NA 3C3PA 2CB0A 3ZQUA 2HIHA 3B6IA 2P9BA 5TIIA 1GTG1 2AG6A 3R7SA 5BYKA 2HGSA 2WHEA 3AM3A 5KC9A 2AMJA 4QGSA 3R1IA 2X0EA 5HDBB 2GBCA 2YUTA 4JZKA 2JK0A 3UUEA 4GXQA 2Z08A 2B4YA 1O9HA 2HOQA 4BP1A 4TKUA 1A9ZA 4DYHA 1GHTA 2HF7A 2Q4OA 1QGYA 2YS7A 1B1AA 5KWEA 2ZT6A 2JFXA 3CR8A 4J16C 1WP9A 5M5BA 3H5LA 1OXKB 3DJYA 4MUXA 3NKLA 3KETA 2QXUA 1XLTA 4GLFA 5I47A 4DLAA 2C84A 4Q7MB 2C3MA 2IX9A 1YR6A 3L7OA 4IIEA 4BO1A 1CQJB 5AW2A 4TMXA 3GG2A 2EVWX 3NBKA 3PDIA 4YX9A 1AF4A 1FDRA 1UBTS 4TL9A 2F6RA 1Q1BA 5EERA 3W9YA 4ATNA 4IFBA 2EFCB 2HU7A 3NW9A 4LHSA 3ROZA 5HTKA 1E3MA 3IUJA 1BVYF 3FMOB 4J9UE 1J0DA 2HADA 4C30A 4HB2A 2DFPA 3G85A 3JQ8B 2QN6A 5EYPB 4N0MA 4QU8A 3U3JA 3DDHA 4KO1S 4X6UA 4C7OA 1ZUNA 1Q21A 1M10A 1GXSA 4IHKA 5EHIA 5K3DA 5JAZA 4G0YA 3GH1A 3M83A 3OPXA 4F3RA 3E1GA 5K6RA 5FPPA 3KQOA 3NUZA 5FTNA 1U7UA 4JLBA 1V7ZA 4Q7EA 3W8FA 4GMDA 1ES9A 1EK0A 4LYAA 2QHXA 3IBSA 1U6KA 4MKGA 1VSTA 4BCDA 5D1NA 5CEJA 3SMVA 4BLPA 2HA4A 1RWPA 3E9RA 4I9GA 3VZRA 3CPJB 3BK2A 1D6JA 3WGZA 4CKEB 5GADl 3NAZA 2X1LA 4P3NA 1MW9X 1FFXA 4LK2A 1E1QA 2GVDC 4QRIA 5IKXA 3U6KA 3U4QA 4O25A 4XQGA 2DULA 1E2IA 3GRZA 2XMRA 3N5CA 4CFZA 1VPTA 2JDID 1OB2A 3IR7A 5BSEA 2JRLA 1OH6A 2Z2XA 3T94A 3AL2A 3RIMA 2YVAA 1E6WA 2M6SA 3M1AA 4X1KB 5KJ1A 4WCFC 2B1IA 1Y3DE 1H2AS 3EISA 3ETGA 4CM8A 1FY2A 4CMEC 1AV7A 1YOVA 2E3JA 3D5QA 3ASYA 5JH7F 5EZQA 5FR2A 1RKUA 2IEDA 3O4RA 4RZHA 3DULA 4RKQA 4BGIA 2NYUA 4TTRA 1A7AA 3EW9A 2O52A 5AO9A 4KR9A 4Q4HB 4BIIA 3OOJA 2G88A 3CZRA 3IKLA 3GJ3A 1NW4A 5AVQA 4XFKA 3RVKA 1H3EA 1CNMA 4UZFA 1ND5A 2HN9A 2ID7A 3I12A 4PV7A 3K0CC 3Q9NA 2GNAA 2ACKA 5IJ9A 1Q0SA 3NOVA 4Y6SA 1PNOA 1XZKA 2HWXA 2LBPA 2X6RA 3QWFA 1RJGA 4KAJA 4TRJA 2I7CA 2WSBA 1DO8A 4OQYA 2Q5JA 4WMLA 4JMLA 1BVRA 3RS2A 2GEUA 3IC5A 1BU5A 4EF5A 3ZNQA 3RO7A 3ZIDA 1RD4A 4JA2A 1LBEA 4X9XA 2V74B 1E2UA 1P60A 1OLXB 3BHMA 3FYDA 4RA6B 4PYKA 1IDOA 4II7A 2Z6UA 1W96A 5EWJA 1T34A 3H7AA 4ZT3A 1WMAA 3M3DA 3GLFE 4U39A 2NU7A 1F4LA 3OPQA 2PGIA 4U7GA 1PV1A 4FEEA 4C43A 4FNMA 3O4FA 5JTTA 2O8CB 4GSYA 1KI7A 2IC5A 2V98A 3BORA 3WP0A 1CD5A 4PXAA 3L40A 1BN6A 3HA2A 3LFUA 1U7WA 3KKMA 3GDHA 5THQA 4DADA 3PUHA 3VNQA 3ZD9A 5HE9A 4RLFA 4JVSB 4QWMA 1ULSA 1UM8A 3HCAA 2FYTA 3MJDA 3GFBA 2R5NA 3MTAA 4I5FA 5FI5A 5TPWA 3UKOA 4EFMA 1WCV1 1KJWA 1FQWA 2YXNA 3MYRA 2EQ5A 4G8JA 4JJIA 1F5SA 2C9MA 3MUEA 3NHRA 4QNMA 3TZCA 2FXIA 2CLMB 2GPSA 4C05A 1GLGA 2DBYA 3UAXA 4AF6A 2WHYA 3F7OA 3IIIA 3T1VA 2F43B 2BTEA 2PL1A 2ODNA 3WK8A 3ZZUA 5HKOA 3CJRA 3U3ZA 2G9UA 1S2NA 3OH8A 5BUCA 5KQGA 3P1JA 4LISA 3FUUA 9ATCA 1TKBA 2CJXA 1HFWA 3R3HA 3UTCA 1B0PA 4MKRA 1VCNA 4XFDA 2J3JA 2NVBA 3ICPA 3U17A 1Q0LA 1V1RB 3E3LA 1RYYA 4M53A 4GOKA 4GVPA 4UASA 3GLFA 1I5RA 2VG8A 3TNFA 2F8SA 4DKXA 3VOAA 1HORA 3ROKA 1F2UB 4RVOA 2IW3A 2OUIA 4REOA 3ML1A 3VVBA 1GU7A 3QWHA 1WBDA 2G1JA 4TXJA 3GRRA 5ADWA 1V95A 3BWYA 1DG9A 4HAYA 2EFDB 2QX9A 5K45A 2VNAA 1U7XA 4I4LA 4NC9A 2EIXA 2ZB4A 3UQZA 1N9KA 4ZTUB 1NF8A 2BV3A 2IODA 2W93A 2NW6A 1CR1A 2AYYA 2J6CA 4NK4A 5LN1A 1I6MA 2OD7A 2QRPA 4K8RB 3EH1A 5CT9A 1M2OB 4O59O 1DCTA 4JP8A 4HLCA 1C3EA 3AKEA 4JAVC 3D4IA 1UMKA 2FSVA 2CJFA 4TVSA 5C8XA 1U9ZA 5C52B 3O8OB 2IS4A 1J99A 1ISJA 3CW2A 1T0IA 1ZR4A 2YV4A 5ALEA 4CQNA 1N2HA 1J2YA 3LY8A 2OO5C 2YWJA 2YCLA 2WICA 3HUEA 5FTMA 1GZ5A 1T4GA 3MOIA 4N39A 3KTOA 9MHTA 1TCCA 4HH0A 1E1CB 4NOLA 1NVDA 3AJ9A 1Q3HA 2RKOA 3GQBB 1IOWA 2FK7A 3PCTA 4G07A 3L92A 4JBLA 1AG9A 3FOBA 4KQFA 3S7TA 4C4PA 3RS7A 1KZ6A 4ICIA 4IOLA 3N2NA 3TLEA 1AKMA 2XKKA 1VDMA 2O5RA 4IRXA 1NTOA 3FI9A 3V2GA 1YONA 2FMIA 2WMNB 1NW5A 3R3YA 4JDUA 4LZOA 4N7MA 4YV1A 2P41A 1SHLA 2AXEA 3IP7A 1OGYA 2E87A 2PLNA 4JOQA 4F71A 4MZDA 1YA4A 5EIOA 3LQRA 3KYDA 3CPSA 3B1VA 3FMPB 4O4JB 3A3YA 3U0VA 1SKYE 3L7KA 2D2VA 1YVRA 2Z2JA 4GBGA 3FVWA 5EMLA 1EVIA 4KXUA 1B6TA 1EDBA 2EATA 1E7QA 2V6MA 2YY6A 2TECE 4H77A 4G5OA 3BF7A 3VOTA 4EA8A 4N3AA 4ZO7A 4AJLA 4NJOA 5C2JB 2E4AA 4DJ5X 5AJHA 4D5EA 3MTDA 4YJ2B 2J9YB 3NVAA 4G3XA 4GOMD 4OQNA 3UB3A 1OWLA 3ZVKA 4HBZA 4ARAA 5GONF 3CBGA 2ZBPA 5HA5A 4XTCS 3HSKA 1SY7A 4Q0MA 5A7FA 2PXAA 4JCOA 4YQFA 2N75A 2XVZA 5H83A 4P4LA 1E3WA 5K0NA 4DZTA 2PUTA 1II9A 1JRLA 4CF7A 1G55A 1R0SA 1WZIA 3QMVA 5F2KA 1C8VB 3I6YA 4YCJA 4X8HA 4EZIA 3MUOA 1Y8ZA 3MF4A 3M49A 2ZJBA 3F71A 4QYIB 4MGHA 4DXAA 1TI7A 1UQTA 3H9JA 3QP9A 1GLVA 4QDZA 1WKVA 1ZK4A 3L7BA 5JH7A 2NP6A 5BYJA 4EJMA 3U4MA 1LLDA 1M0TA 4I9FA 3SYMA 2O8EA 5AW3A 2MWMA 4NCNA 2L82A 3AUAA 3AZQA 3B1XA 1UMDA 2PDAA 4YUZA 5MN4A 2VHUA 4C01A 1X7DA 3CPEA 2YXDA 3TVTA 1CUDA 1QAMA 3VV2A 4ETIA 4P7GA 2JBWA 4OHPA 1JEYA 2YOFA 4IFEA 1RXVA 1B4DA 1E2BA 3WNDA 2VDWA 4ML3A 4OQXA 4TTTS 1STOA 5JXGA 4BVKA 5IANA 3M3HA 4QNNA 3PFBA 4C6RA 5K6AC 4MS4B 3OFND 1XMSA 1NJSA 3C1TA 2Q8PA 1NW3A 3BH7A 2D1QA 4X92A 3GROA 1URPA 3O3OB 5KOHB 1OX4B 2VHTA 3JYNA 4G0NA 5JO9A 2XCRB 1XJQA 4MLDA 1MX9A 3UGTA 2Y0EA 1GGFA 2VTBB 3ZXSA 1MVLA 1QK5A 2HL6A 4E5SA 2DF8A 1SELA 1OBVA 2BL4A 2ZTMA 5F7ZA 1TK9A 1KDVA 4B1FA 2R1TB 4A23A 1NQUA 4DJJA 2EX4A 1F3LA 2X86A 4B74A 2FPPB 3U80A 1QVRA 4KE9A 1Q91A 1O1YA 2SKCA 5C8ZA 3WWYA 1PK8A 5AI4A 4YRKA 5EZYB 2W5UA 4L7QA 3RNLA 1RMQA 5KDLA 2W2MA 4OCZA 3QQ5A 3LXMA 3H0KA 2YJNA 3Q3EA 1KZ7B 4R84A 3J7TA 2VJLA 1SZCA 4Q4LA 3VDQA 4CKBA 2Z3ZA 1RCTE 5AW4A 4R9NA 3T95A 3PIDA 1RLJA 4R1UA 1UT8A 4W4TA 1BS2A 4PLWA 3F8WA 4E1VA 3PUZA 4HS9A 2ZSHA 1IC6A 2QYTA 2UZ1B 4HYQA 4Q4JB 3B20A 1GSIA 1WDLA 2DWPA 1J25A 1WWKA 1S1MA 1J9EA 1H66A 1PWXA 1ND6A 1X38A 3E9EA 3KZMA 1P0FA 2QRQA 4MLCA 1YJQA 1OWPA 5J2UA 1CY6A 2VP4A 3KL2A 1D2EA 4DUPA 2G82A 4P38A 4XB1A 1B1CA 1MB4A 1ZEJA 2JF0A 1YI8A 4MP6A 3RFUA 5H80A 5LU8A 4KQMA 2ZI6A 1KFEB 4R68A 3RYFA 4CEJB 2I5PO 2J30A 3FWHA 1N92A 1Q2XA 2BGUA 3PNKA 4QVKA 3OI7A 3NP7A 4L4UA 4YDHB 4HQ6A 5HKKD 5ILOA 1Z0KA 4QOHA 1TQ4A 4MI1A 5FOVA 4Q3LA 3V9AA 4E32A 1XRSB 4OHWA 3BGOS 4QFBA 4CQMB 5CDYA 2CDRA 3ZK7A 2A30A 1T9CA 2Z9BA 2HK6A 4P93A 2ZB7A 5TRTA 4B0PA 3IV7A 2F62A 5KNBD 5AI8A 1HBJA 1G4AE 2J9FB 4WESB 4FLMA 2HRQA 3PXCX 1ZU4A 2H59A 4KMRA 1PS9A 1YIOA 4L8LA 1XP8A 1RI4A 4US1R 5SZJA 1UIMA 3B8HA 4OLFA 4B8WA 4EJSA 2H1HA 1WY5A 3ZGLA 1E20A 1Z07A 1H65A 1BJTA 3CF4A 4EVSA 1DAMA 3D8UA 1XEWX 5KQRA 1WXFA 1EZ1A 5EGSA 1PGNA 1ZJZA 4HFMA 4KSCA 3LM8A 2CYBA 1LB1B 2WZDA 3DR5A 1YQQA 2FE4A 3BIOA 3HY4A 1C3OB 4RVSA 4KG7A 3OO0A 4YJGB 1CY7A 2ZEJA 5A1JA 1Z4OA 7AT1A 1EFDN 4YYEA 5CK5A 4FCCA 1E1DA 2DVMA 4KLAA 1NN0A 1PBTA 1ZD4A 2PSDA 1MJGA 1C0LA 3IHWA 3TL2A 1P45A 2PYDA 1EHCA 4V38A 1UK8A 1V5EA 3GU3A 4RKFA 5K0GA 1O77A 1DWPA 3EZ6A 4UBIA 2EJWA 2JIZA 3KEGA 4KO2S 4ZICA 1O6ZA 2MMGA 2WTXA 4AWAA 3EWSA 1KU6A 4CCSA 2J85A 2MR5A 4HAXA 2ZW9A 3B9PA 3BMOA 3OZUA 2PWZA 4OOFA 4P4SB 3SX0A 3NATA 3ZXIA 4P0PB 1JEAA 3FRHA 1U7PA 1DKNA 1FOEB 2AMVA 4M1MA 3VI3B 4YAEA 1TA9A 2WAXA 1X80B 1RYMA 5JSYA 1OYYA 2JAQA 3A6FA 2QJOA 3MJHA 4U63A 2YVQA 1OKKA 5DI9A 3NASA 2CD7A 3ESRA 3PQ4A 3W7AA 2HUNA 2I55A 3QKSB 2ARKA 4BFTA 2OZEA 3ZS9A 4F0JA 3QVGB 4Y6GB 1F06A 1TM7E 2PZAA 2C1ZA 2XSZA 2VC2B 5CT4A 1ITZA 5AVJA 2G9QA 2XGOA 3FTCA 1DTWB 1I1QB 2QRJA 4AMYA 4KEAA 4CG3A 4OIFA 4XWTA 1OXVA 3HLTA 4N49A 4QOJA 2A3RA 1A2KC 3H2JA 4MI9A 3HC7A 4UBLA 3NDIA 2IJGX 4E03A 4XA8A 2FSIA 2GAIA 4B4KA 4MPRA 5A6VA 1GO2A 2C4NA 3CSSA 3DLAA 3REFA 2GN1A 2I1WA 3ESAA 1R27A 3CNOA 1QMGA 3EOBI 4TQUS 4CIYA 2PY6A 2YHUA 1N9GB 3O8DA 5ABPA 3P5BA 4KPUB 3O1IC 5JCPA 1T6BY 1QK4A 3EQ2A 1EH5A 3OM0A 5BR7A 5GONA 5JZSA 1LPOA 3NIDB 1W5BA 4JLJA 4MOWA 1YI1A 2MYNA 5HMLA 3S29A 5B3LA 1Y6ZA 3G9UA 1DXHA 3KUCA 1O6GA 3DLCA 2J4FA 1MJ5A 3DKKA 1DEHA 2Y2UA 2QR5A 4IMRA 1Q95A 5D3MA 2M2IA 3CA8A 3ND6A 3I01A 5E2AA 1ECGA 2VBCA 2QNRA 4OA8A 4UBJA 4DWJA 5C80A 1Z08A 1U0SY 2V5UA 2VAXA 4BXOA 2GN2A 5DK4A 3VPGA 1DMSA 4PGAA 2WE7A 4DABA 4G65A 3VZCA 2NXCA 2C83A 1K3UB 3E23A 4LI0A 4PC6A 1DV1A 3HCDA 3ORSA 2GM3A 4WCFB 5IVDA 3EIUA 3N0WA 4RJ2A 1ZDMA 3TRFA 4CBVA 4DUYB 1YNOA 2A1UA 4YRQA 5F9MA 3M6UA 4G67A 3K4PA 4US0R 1QYIA 4YP9A 1WV0A 4LF5B 3WIBA 4A82A 3T5PA 3WLEA 3CW8X 4Y1GA 3G02A 3LQ2A 4MUAA 4WX2B 1GZ7A 2VJQA 4B5LA 4CMKA 4GZ5A 3Q6MA 5F1YA 1J0AA 3N2KB 2VH5R 4A0RA 1ZCJA 4NCJA 1SUAA 1PG5A 1ZPDA 3WIEA 2QAGB 3M9XA 4JJ6A 1EJ0A 1EUQA 5JXHA 3H3JA 2H17A 3N7TA 4I2NA 1TYBE 3IEVA 5AM2A 2EJVA 2VH2A 1CP2A 3BWDD 4IGKA 4RAOA 1SBTA 5JJIA 2BDEA 2PVSA 1R4AA 1Z0ZA 1FUYB 1LVGA 2VUSA 1HI9A 4J2OA 1Z2DA 2NPIA 2GR9A 2Y2VA 4URWR 2BZ0A 1VHTA 3PHIA 1Z6YA 2X5NA 1G20E 2EFGA 1A9YA 1GQRA 5AIBA 1NXOA 1O9GA 3DE6X 4H15A 3RC8A 3HCWA 3R5FA 2R6GA 4NY1A 3UB4A 3VO2A 3W5DA 1KI2A 4PX2A 3EFOA 4MI6A 2OC9A 5LL6P 4G5QA 3AV0B 2VT3A 4NE9A 3BE5A 4WH0A 5HIIA 3A6GA 1QZZA 1E64A 3VH4A 1DQPA 4NF2A 1H2EA 5F5XA 3V2IA 1E96A 5DX1A 4D79A 5HMMA 3KEFA 2FV8A 2H2GA 1VL0A 4HVAA 1I14A 1MQSA 4ZO8A 4KI0A 4YI5A 2WZBA 2Y67A 3SNKA 1W4LA 2VK2A 2GVNA 1S7CA 1M8KA 3JZMA 4HUJA 4XPIB 4BNNA 3C4VA 2HMAA 4IGEA 5J43A 4HB0A 1UJ5A 3V8NA 4QVGA 2ROQA 1Z6AA 1GQOA 5AM5A 3B1JA 3GXOA 3ANTA 4TT8A 5HWSA 3FPFA 2O3UA 4BP8A 1NFQA 1BVHA 1QSGA 4C21A 3CT6A 4DQ0A 3GVXA 2XOKD 1RHJA 3L05A 4KMSA 4X90A 2IZZA 3AXTA 4C14A 3S3TA 5BR1A 1KOJA 1DRJA 2DP4E 2J0SA 1BS9A 3CUEF 3VAYA 3ER8A 3QY9A 4FFBA 5BQ5A 1CUHA 1CJKC 3PC6A 4GLLA 3VXKA 4B8ZA 6PFKA 3KQVA 4LFBB 3GEHA 4M1ZA 3MT8A 2W83A 2A9JA 3L6BA 2ECOA 3X1MA 1Q7RA 5B53A 5T3UA 2EJUA 5EMNA 1G20A 1J1IA 3R6TA 1C7EA 4NQRA 4UOEA 3L0BA 2QRKA 2D8AA 1V3VA 5MF6A 1QR2A 1JIIA 5F4ZA 2X0NA 1BYUA 3THWA 1NY6A 2AFHB 4W5HA 4TTIA 3W6OA 1G5FA 5I45A 2QXTA 3L1IA 3L04A 3MVEA 3FPKA 4GRDA 4XLTA 1AQUA 4MUMA 4CQMD 4CM5A 1N3YA 3ISVA 3B60A 1IEXA 4RWEA 2JGLA 1FDUA 3FFTA 3CZ4A 5D85A 3IDAA 3LHDA 5IFLA 4M1TA 1CS4C 3GLGB 1NSTA 2XB8A 3EQ8A 3H17A 2YZ7A 1DQYA 2IQIA 3N0VA 3EGIA 4I2VA 4A0FA 1GVHA 4BMDA 5AFSA 4HNTA 3F6RA 4IEEA 5KTRA 4PCLA 4QGFA 1IY9A 2IT1A 2BRUC 5GTDA 3BSFA 3GNQA 3OF3A 5CGZA 4V1CI 3QE2A 1IB0A 2BM1A 4B3SB 2DLCX 2GYYA 4H1HA 1IG3A 3E7PA 3H8SA 3TQTA 4B3XA 2ZYWX 4EJ6A 1HYEA 5C8YF 3GBPA 4K6KA 4MITA 4S1OA 2ZRBA 3W9BA 3N8IA 4HS4A 2Y6VA 1O9BA 3NHBA 2FNAA 4BVEA 3EXIB 1QYRA 1YHZA 4KRXA 4W1RA 3G5TA 4K3VA 1RLIA 1FDOA 3ZX5A 3I8OA 3GFPA 4O3FA 2UVDA 1FTNA 4KBFA 1DTEA 1TDJA 3FLBA 3E3AA 2RSLA 3OCXA 5TSDA 1V8PA 4KFSA 3WQQA 1L7AA 5DTRA 4NNPA 4ZIRB 1WSWA 1H2HA 1WZNA 3K9BA 4CI0B 4B4UA 3ADPA 4BECA 4A8TA 4C87A 4TRRA 1W35A 2IA5A 2X5OA 5FADA 1FL9A 4LYEA 4YFVA 1L4EA 1NMQA 1ZZGA 3LQ4A 3SKVA 4GLOA 4DARA 3A0UA 5IEJA 1VFPA 4NDAA 5F2NA 1YDMA 1SN7A 1U7TA 4E1BA 1MEOA 4AJ4A 1TXGA 3M4NA 4AY5A 4DZRA 3ZTYA 4BN4A 7ABPA 1VIMA 4DE5A 2OCLA 2V5AA 4RM2A 5LYYA 2Q4EA 3AF0A 4EEXA 1YU6A 2Q3LA 1QXSA 2Y76A 5BOSA 4NV1A 1MJHA 2OSBA 4QLAA 3SDSA 1WRBA 1TD1A 2X8AA 3PI6A 3LAWA 1ODLA 1DOZA 4KWHA 4C7VA 3EXG1 1NYTA 1HQDA 3FMIA 4F2HA 1NOIA 1WZ2A 1CLUA 4DEXA 5HYVA 1GP2A 1BX1A 2OO7A 2Y1OA