4MYDA

1.37 angstrom crystal structure of e. coli 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menh) in complex with shchc
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
252
structure length
252
Chain Sequence
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Molecular Basis of the General Base Catalysis of an alpha/beta-Hydrolase Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 252
sequence length 252
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mydA00
4N8DA 5AM1A 3HZOA 5C7YA 1EHYA 1XQYA 2ZSHA 2PSJA 2DQYA 3G0DA 3IULA 4BCBA 1MTZA 1WM1A 3V1LA 5K3FA 2Y2UA 2HA5A 4QE3A 2AJ8A 5LZ5A 1CUHA 2RHWA 4GECA 2H1IA 4C88A 2BFNA 2HA0A 5ALQA 4BE9A 3FWHA 4XX1A 2XUHA 3V1KA 2EDCA 1TIBA 5FP0A 5AI4A 4AB1A 4Q05A 2O7RA 1DQYA 1K63A 4JH0A 4B81A 1CVLA 5AKLA 3N0TA 4NMWA 1D07A 4RGYA 4DSAA 4FKBA 4QZVA 3GZJA 4A5SA 5CH3A 4ARAA 3MUOA 3WL6A 4J03A 4BCDA 4BB0A 4FFWA 5AM4A 3I2IA 3JYHA 4YASA 3F98A 3FNBA 3WIBA 4U2EA 4PSUA 4PO3X 4FOLA 5T4HA 4X95A 1CUWA 3HYSA 5LP1A 2XUQA 4J0HA 5AKKA 1X2EA 4M0FA 5ESRA 3GA7A 4V2IA 3PF9A 1F0NA 1WCYA 4UBKA 3WKEA 4N5IX 4MQMA 2CJPA 3HXKA 3I1IA 1P0PA 1F8UA 4QWWA 4B83A 1QIKA 2ROQA 3WL8A 2OXEA 4N8EA 2WTNA 1Y7HA 5AKHA 1GPLA 3FLBA 3QITA 3P2MA 4UHFA 2OQVA 5H3HA 4Q3KA 3IDAA 3RM3A 5IVIA 3X3HA 2AJDA 5I7UA 4RE5A 4X6YA 3H2IA 4H7FA 4X71A 4JYMA 3A70A 4PW0A 3BIXA 4FBMA 3O9VA 2RHTA 5HF8A 2PUHA 4W63A 4OB8A 3HABA 1Q0RA 5FUMA 2VAXA 1UK8A 1GZ7A 4KE9A 3PUIA 4BP9A 4AQDA 3FCXA 4Y2RA 4K5QA 4Y7DA 1L7AA 1ZD3A 1JJIA 1MNAA 4FFVA 4PSDA 2VQ6A 3WWCA 5FRDA 5JALA 3ESAA 3PI6A 5DTIA 4U2FA 3HLKA 3G7NA 1CUBA 4UFPA 4H35A 5ALDA 2WFMA 5D3ZA 5CW2A 5AK4A 1W75A 3T4UA 3WMRA 3A2NA 2WIFA 2XT0A 2XMSA 4HZGA 1LZKA 5DNUA 4U2CA 1WHTA 2WFLA 2FUKA 2XUIA 5AJHA 2PL5A 3ZWQA 3AINA 3ESDA 5LIPA 3ESBA 3GBSA 4G5XA 4BVKA 4HRXA 3STXA 1N1MA 5EIAA 3NWOA 2WU3A 1SCQA 1GPNA 1XZIA 1QIMA 2X76A 4FHZA 5A62A 1LPBB 5LZ9A 4D9JA 1OCEA 2JEYA 1K4YA 1ZI9A 3DNMA 4L0CA 2QT9A 4KRXA 3L1IA 3KWJA 5AI0A 4B9AA 1XZMA 4Q82A 5ALXA 3W2TA 2QXTA 4H77A 2PSEA 2JBWA 3KOOA 4JUIA 3BIWA 5JD4A 3VJMA 4GI1A 4ITVA 1DX4A 1LPAB 3HC7A 3WJ1A 1LBSA 1IUOA 1YS2X 3OC0A 2JGKA 2Y2VA 5CT4A 1E89A 3O95A 4G4GA 4INZA 4DNOA 4U2BA 4A16A 2H7CA 2ZYIA 1VA5A 4KEAA 4L9AA 1F0PA 4CG1A 2JGLA 3NOXA 3G9TA 5K3CA 3H2KA 3I2JA 4GW3A 5FPPA 1PFQA 1GXSA 2XUDA 3WI7A 3ZPXA 4CCYB 1CUEA 3OTQA 3K6KA 2BJHA 2ACKA 5DTJA 1O6FA 4OYLA 1EK2A 4H7DA 3TEJA 3ZLTA 1FSSA 4DM7A 1AX9A 3W9BA 3FSGD 2JGIA 1YASA 1XKLA 2YYSA 2HHAA 2WKWA 2XUAA 4UHCA 5ALLA 2RIPA 1QO9A 4P92A 1YB6A 1JJBA 1N5MA 1GPKA 4FLFA 2XQFA 2DQZA 1G5FA 4MXDA 1DTEA 5A6VA 3WL5A 3IUQA 4L72A 3QBJA 4HTAA 1H2YA 1YSCA 4PF1A 2XQIA 2Y1KA 4EUSA 1UXOA 5KREA 2VA9A 5AHXA 2H7XA 2XDWA 4M0MA 4NS4A 1YAHA 4LXGA 4BVJA 3KDAA 2WUFA 2HA3A 4JYPA 1E8MA 1L7QA 3LIIA 3D2BA 1CEXA 5CMLA 3PUHA 4B0PA 2ZJ7A 1JU3A 3D2AA 2OQIA 1XLWA 4AMYA 4RE6A 1PJAA 4FMPA 1XZFA 5ALSA 4DNPA 3DCNA 3HEAA 3IURA 1HBJA 5AICA 2VTVA 4BTVA 5ALIA 2JGEA 4EY7A 3ICWA 5E4JA 3E3AA 4WDQA 4ZRDA 5AKZA 1W4LA 3C70A 3I6YA 1TAHA 4C6HA 1C7IA 4MYSA 1EXWA 4DYHA 4H7IA 4QDOA 3Q8WA 3FVRA 4KAAA 4FNGA 1ACJA 3TJMA 5FLKA 3WKDA 4DSZA 5HZGA 5C81A 1DWOA 3QM1A 1QFMA 3QMWA 4C89A 2OLEA 1QIJA 2PPLA 4CG3A 3MGAA 4X6XA 1BCRA 1CUGA 3DS8A 3M81A 1LPSA 3STVA 4OSEA 2JGJA 5FPQA 5ALRA 4CFSA 1ETHA 1XZCA 3HI4A 1QO7A 4B84A 4AZ3A 1LBTA 4BZZA 2BUBA 4X7BA 5I9IA 4IH9A 1ORVA 3WK9A 4K6KA 5JD5A 3DL4A 1T4MA 1XZHA 2DHDA 1BEEA 1FFEA 3LP5A 3H2HA 4OYYA 2R8BA 2OCGA 2PVSA 2YH2A 1F6WA 5LZ7A 3VISA 4CCWA 3PICA 2QS9A 5ALTA 5ALGA 1DX6A 1SFRA 1YS1X 5K3FB 3HJUA 5A2GA 5ALWA 4HRYA 2HFJA 2UZ0A 3BE8A 5AIBA 3CN7A 1UKAA 5AK5A 5D3KA 1UK9A 1BROA 2IIVA 1XLUA 5CXXA 5IVHA 4K6GA 2GBIA 2VJBA 4AMZA 4BDSA 1H2ZA 1THGA 3QMVA 4F60A 4UBLA 5LKRA 5AI6A 3EQ9A 2BUCA 3F8SA 4P08A 1CUXA 2HRRA 3ED1A 5CTAA 5IVKA 2G63A 3DKRA 1E8DA 3R3XA 1CUDA 4UHEA 2BKLA 5ALUA 5FDFA 1X70A 4AO7A 4WFKA 2R11A 1JMYA 5EI5A 2D5LA 3OURA 4JEIA 1XROA 1DQZA 4BATA 3S8YA 4KJXA 3IBTA 1LZLA 3IUMA 4FLEA 1CFJA 1JKMA 5AIAA 2OGTA 1P0MA 2VATA 3H04A 3B5EA 5BV7A 4K2AA 1WPXA 3OM8A 1BU8A 4X00A 4J0KA 5CT9A 5HFNA 5AP9A 5K5EA 1VE7A 5EHNA 3N2ZB 5C8XA 1UK6A 5JIBA 3F9CA 4BBZA 2ZJFA 3G9UA 3WK6A 4EB0A 1VKHA 5FV4A 5HK9A 1HDEA 3AZPA 3G9XA 3WIOA 1GQSA 2DHEA 1R1DA 2FJPA 4QNNA 5JYCA 1J07A 3PF8A 2DCMA 2WM2A 4OU5A 2C4HA 2WHQA 1UZAA 3H1AA 3QYJA 1X2BA 3H2GA 2QMQA 2XMGA 5ALPA 3JWEA 5CBKA 1DT3A 3D59A 2K2QB 3M82A 4HVTA 1RWQA 5AM3A 1XRPA 1H2WA 1LPOA 1YB7A 4OCZA 4KE8A 1B41A 1XRQA 3PDCA 2WIJA 5HF5A 4XVCA 3WWDA 1MX1A 3O4GA 4AXBA 1KEZA 3DOHA 4Z49A 1W1IA 3TRDA 2X5XA 4ETWA 4LIPD 4EY5A 2V96A 1W6RA 2XQKA 4X90A 2WFLB 3PE6A 3O0DA 1GGVA 3AJAA 1TCAA 1VXOA 5YASA 1XZEA 1VLQA 1CUCA 3C5WP 3STYA 5JANA 4WDRA 1LPMA 3L1JA 2QVBA 4X94A 3FVTA 2GYVA 3FYUA 4H7HA 4B6GA 4EHBA 3U0VA 1UOPA 2ZYHA 4BE4A 4GWLA 1K5PA 5AM0A 3U1TA 4PNZA 3CN9A 3PFCA 1Q83A 2P8SA 2VT7A 3C6ZA 3DEAA 4YX9A 1J06A 4ZREA 3ZLUA 4Q34A 1PV1A 5AI8A 3AFIA 2GZRA 2Z8ZA 4X6UA 1VXRA 4W1QA 4I4CA 3WL7A 4BYMA 2CKMA 3BL8A 4G9GA 1CUVA 2H9YA 4EY4A 3V1NA 2XUFA 2PSDA 3G02A 3WWEA 4DNFA 1CLEA 1CUZA 2ZVDA 1FFBA 2OPHA 1H22A 3ZV7A 1S8OA 1JI3A 4J7AA 5AKIA 4UBJA 5AK6A 2BCEA 2CZQA 1U2EA 3AILA 1NU8A 2HA4A 2JEZA 1U65A 3EQ8A 1WPRA 1UOQA 5JZBA 2NW6A 1XZGA 1LPNA 5JATA 1IUPA 5AM5A 1CV2A 4HS9A 5K3EA 1ZGCA 3ANSA 1B6GA 2ZSIA 1GT6A 2HA2A 4MYDA 4OD0A 1XRLA 1GKLA 2RGUA 3D3NA 1E8NA 2QXUA 2WG1A 4KE7A 1E5TA 2X8BA 6YASA 4G8BA 3I6MA 2WIKA 5F4ZA 3K2IA 1BRTA 1XRNA 4BCCA 1XZAA 2G5TA 2O2IA 5DNVA 3FBWA 2WHPA 4XJVA 3PFBA 3QZUA 4OUKX 3AZOA 5CT5A 3VJKA 5LZ4A 2OGSA 1WB5A 3RLIA 2GBCA 3I2GA 4H7KA 1M33A 1WB6A 2HL6A 4UHDA 3Q0TA 5ALEA 5HF9A 2DR0A 1SOMA 5BOVA 4B85A 5ALFA 2AJLI 4KE6A 4AX4A 4H0CA 4LYDA 2C58A 3K9BA 3AIKA 2GZSA 5BWCA 1R88A 3FCYA 2ONCA 2EEPA 1J1IA 2VEOA 4G4IA 1Y7IA 3LIPA 5ALHA 3B12A 3WK7A 4LXHA 3UUFA 1EX9A 2QJRA 5AKYA 5ALKA 5HQ3A 4IH4A 1MJ5A 4OPMA 4AN0A 5DYWA 4BTLA 2G5PA 3C6YA 1YR2A 5D6OA 1XFDA 1R9NA 1MU0A 4Y2SA 1VA4A 2OG1A 2XUGA 1UWCA 3HACA 3EBLA 3WKAA 1A8SA 4B82A 1ZD5A 5HCUA 5T4BA 4Y2UA 5E4YA 4CG2A 4Y2JA 4XWGA 3BDVA 5AOAA 4C4XA 4LKOA 3E1GA 1Q84A 5LLSA 4OU4A 3FLAA 5EGNA 3NUZA 2XB6A 4MEAA 1QZ3A 1N8SA 3A2MA 1THTA 4U2GA 4G1FA 2WLSA 2XMRA 3CXUA 3DYVA 3H1BA 1XRMA 4DMHA 3WA7A 2B20A 3D2CA 2PSFA 2XUPA 4HAIA 1XQXA 3D7RA 1U8EA 1E66A 3KD2A 4A23A 3C43A 1QIIA 3E0XA 2O7VA 5JARA 1SCKA 1TKRA 4TPKA 5A7GA 4EY6A 3DYIA 1CQZA 3R41A 4E46A 1LNSA 3SX4A 2QTBA 4N5HX 2ZYSA 5HK8A 1QTRA 4DMCA 4F21A 2XQJA 5KBYA 1QIGA 4LXIA 4U2DA 5KWIA 1BCSA 5IKXA 4FNMA 5E2IA 4YPVA 4X91A 2ES4A 2J4CA 4ZI5A 2HRQA 4UBOA 1K8QA 2I3ZA 3O4JA 3O9MA 2VJCA 2CB9A 2WUEA 1WOMA 5AO9A 3I6ZA 3GFFA 3WYDA 2C0QA 3W9UA 4ZV9A 4GHWA 2C0PA 1MX9A 5JAUA 2WJ4A 5A7FA 5DNWA 3I28A 3G9ZA 3WYNA 2H7YA 3ESCA 2B4KA 5EHQA 1MNQA 1RYYA 2CMFA 4DTCA 2W22A 4FWBA 4H7EA 3R3ZA 1TCCA 4BDTA 4W9RA 4W1SA 1YA4A 3DLTA 2C5FA 4HXEB 5ALMA 4PSCA 1W52X 4KRYA 2B61A 2PX6A 4QWMA 3QMMA 4F5ZA 3ICVA 4X85A 3G0GA 3SC2A 1XZLA 1QJ4A 4WFIA 3HRHA 1K6EA 1UFOA 2VJDA 1R9MA 3YASA 4WY8A 4QLAA 4W1PA 4PV7A 4K6HA 1CUYA 2PM8A 4RPCA 4BRZA 1LLFA 1ZJ5A 2XMBA 2HFKA 7YASA 1VZ2A 1DINA 2OCKA 1AURA 4UFNA 1XZBA 2G4LA 4GBGA 1XZJA 2GBGA 3I2KA 3QVMA 5AOCA 2HU8A 1CUJA 4KYVA 5FXMA 1OXMA 3D0KA 3EQ7A 5CH5A 1QIHA 1EDDA 4Y2QA 1AGYA 1QIFA 4UHBA 3QPCA 3R3VA 5HKAA 3R3YA 4J0GA 4UBNA 4E14A 3C6BA 1AUOA 4EY8A 1ZOIA 3QH4A 2HU5A 3T52A 2OCIA 3C6XA 4CI9A 1UT6A 5C8ZA 2VSQA 1BEZA 5K3DA 4KAFA 3A6ZA 5J3JA 1CUFA 4EBBA 4IHAA 4L3WA 4Y2XA 5K3BA 5EHXA 5EFZA 1A8QA 3C8DA 2OAGA 2PBLA 4DNQA 1H23A 3WQHA 2XE4A 4M0EA 3SK0A 5JAOA 4N8SA 5DYYA 4B80A 2QKYA 3WZLA 5JADA 1Q0ZA 3FLEA 5AI5A 3IA2A 2DHCA 3UUEA 1EH5A 5FKJA 1ZGBA 2VAVA 4X92A 1AC5A 3LCRA 1ZI6A 4BC0A 3WKBA 4B9EA 4Y2PA 3R40A 4G8CA 4WCVA 3WKCA 2QR5A 4AO6A 1ZD4A 4C87A 5D7BA 1VOTA 1HQDA 3FYUB 3R0VA 4X97A 2I3DA 3BF8A 2RONA 2WILA 3BDIA 2PU5A 3OOSA 3WA6A 3GUUA 2WUGA 2Z8XA 4UFOA 2C5GA 4C4YA 3BJMA 1KU0A 1TQHA 1T2NA 5C8VA 1DWQA 1EB8A 1Y37A 4AN1A 5BWBA 1OILA 3MVEA 4KR0A 5EIEA 3IUNA 2VF2A 1ODCA 4P9NA 3R3WA 1TK3A 3ZI7A 1JFRA 2E3JA 1WB4A 4GXNA 3H2JA 2ZYRA 1CQWA 2BAGA 4MEBA 5IH7A 2J4FA 1P0IA 3R3UA 2BUAA 1QONA 2XMQA 4BP8A 5AM2A 2I03A 2XLCA 3DL7A 1JT2A 3I2FA 4TVKA 3V9AA 1QLWA 2JF0A 2JIDA 3DJYA 4IO0A 1EK1A 4CIAA 1AKNA 4ZV7A 1RP1A 3CCCA 4QA9A 2PSHA 3O4IA 4IQ4A 3FSGA 3VKFA 3IIIA 2WTMA 4HXFB 1USWA 3EIOA 5I8PA 2XUOA 1FFAA 1G42A 4EZIA 2DFPA 5ALYA 1HLGA 5IVDA 1J2EA 1EB9A 3G0CA 4J3JA 2Z5GA 3H0CA 4FDMA 3QPAA 4TGLA 4O08A 4NZZA 3C45A 4LHEA 3VVMA 1EVQA 2QUAA 4DIUA 4NVRA 3GROA 1HPLA 4X3CA 3TGLA 4Q1VA 2D0DA 3ZLVA 2WHPB 4BAUA 1JJFA 5CRIA 4W1RA 1FFDA 1UOOA 4GDMA 2HA7A 1XLVA 2J3QA 3O4HA 4UBIA 4DMFA 3IB3A 1MAAA 3BXPA 2QRUA 1YA8A 4JNCA 4I3FA 1MPXA 5AH0A 2V98A 1ACLA 3QPDA 1CR6A 1MO2A 3MUNA 5ALVA 2CEKA 2IITA 2V9ZA 3FAKA 3G0IA 2JGMA 1A7UA 3RK4A 4Q3OA 1BN7A 5AOBA 3UMJA 5SYNA 5T4FA 4KAJA 4DGQA 2YXPX 5A71A 3D4LA 4BRSA 1QFSA 1WHSA 3L1HA 4J0JA 1CIJA 1C7JA 1A8UA 5HQ3B 1N5RA 1R4ZA 3W06A 3C8HA 2HU7A 1QE3A 3KXPA 2XMZA 4HXGA 1FFCA 2GYWA 2Y6VA 2WQZA 2WJ3A 4EA6A 4J0IA 1NU6A 2WU4A 2PUJA 3FOBA 3SWWA 2GBFA 3VXKA 5AKJA 1ZICA 2LIPA 1LGYA 2PKYX 2VT6A 2ACEA 2BGRA 2CBGA 4MWSA 5CURA 3ILSA 1C4XA 5ALZA 4ZWNA 4C4ZA 1JU4A 3BJRA 1A88A 4WY5A 1G4HA 2WIGA 1CPYA 3BWXA 4WFJA 1SC9A 3B3QA 1QTIA 5DWDA 3KSRA 1ODSA 1JMKC 1ODTC 1QIDA 3OG9A 3IUJA 1GKKA 4B0OA 3W04A 4FTWA 4GEGA 5ISMA 1ISPA 4OB7A 1AMNA 4FBLA 3V1MA 2FX5A 2HIHA 2Q0XA 5E4TA 3DDUA 2XI4A 4S0XA 4AO8A 1IZ7A 1SCIA 4AZ0A 1EDBA 1LPPA 3VDXA 2B9VA 1EVEA 4E15A 5LKAA 5CT8A 2PU7A 1Z68A 1EINA 2VJAA 5LZ8A 2EDAA 4UUQA 5KWJA 1HKHA 1MX5A 3FYTA 1P0QA 4BVLA 2OAEA 3GELA 2QM0A 5HKBA 3STWA 1AQLA 3E4DA 2XLBA 5DJ5A 1HL7A 4BAGA 2XQGA 1XZKA 1UK7A 2HDWA 1EA5A 1CUIA 2Y6UA 4WJLA 1XQWA 1QGED 1EI9A 2WHRA 4I19A 5CXUA 3D5EA 1ZIXA 4FLMA 5DLPA 2ECFA 3DOIA 5EHZA 3G0BA 3F67A 1E3QA 4QDXA 5JAHA 2XUKA 2Z3ZA 3F97A 4Y9SA 4H18A 3LS2A 2O2HA 1G66A 3OPMA 3V48A 4GLBA 1U4NA 4OB6A 1KU6A 1YAJA 2WSLA 4ZGBA 1CRLA 3H18A 5ALNA 5FOQA 4BZWA 3DQZA 2Z3WA 1R50A 4Y2TA 3WLAA 1IMJA 1FJ2A 4H7JA 3STUA 1ZJ4A 4XIIA 3F96A 5JAPA 2WIDA 2XUJA 2XMDA 3RARA 1MT3A 1ZD2P 2V97A 1AZWA 3FYUC 4DLNA 1I6WA 4CCYA 2W6CX 4UPDA 2AJCA 3IVMA 3W05A 4DMKA 3ANTA 3H19A 4LYEA 5K3AA 1XRRA 4E11A 2QOEA 5AKXA 3M83A 4QDTA 2WG2A 4X93A 3HSSA 3WJ2A 4IH1A 1BE0A 4B7ZA 3WK5A 3EF3A 3JW8A 1DT5A 3BF7A 4J0DA 3VVLA 2ZJ6A 3M3DA 1UKBA 2C7BA 5AKEA 1TCBA 3S2ZA 1CUAA 2J3DA 1CUUA 1QOZA 1YCDA 1UKCA 3DD5A 4CIBA 4G8DA 5SYMA 5LZ2A 3LLCA 1IUNA 5HF6A 4ROTA 2RI6A 4G9EA 2ORYA 2BGNA 3I1YA 5EIHA 2CUTA 2WFZA 4BAZA 1IZ8A 1XZDA 1XKTA 4J0CA 1ORWA 1TRHA 3H17A 3WWOA 3CCBA 1MAHA 4P93A 5AKGA 4Q3LA 4F0JA 2JGFA 1VZ3A 5T4EA 1QIEA 3STTA 3AIOA 2FJ0A 2I78A 3AUKA 2AJBA 3KWFA 1W76A 3C5VA 2AXEA 1BS9A 4BC1A 4PQEA 1EDEA 1L7RA 4UBMA 5JD6A 1VJ5A 1R3DA 3I2HA 4RNCA 3RKSA 4QDUA 5AK3A 2IX9A 3WWPA 3A2LA 2O2GA 2YASA 2WG0A 1H2XA 2QUBA 3VJLA 2XMCA 2HADA 4MQLA 1O6GA 1ZI8A 2HA6A 1ZIYA 1MN6A 5ALOA 4QDZA 2DSNA 4C01A 5JZSA 5CT6A 5JASA 5LYYA 3C87A 3WK4A 4YK7A 3AZQA 1CUSA 2OCLA 2WJ6A 1VE6A 3DKKA 4MJ3A 4ARBA 2QZPA 5ALJA 3WK8A 1BN6A 1DWPA 2WUDA 5HFAA 1DU4A 1IVYA 1NX9A 1XQVA 4QLOA 3AIMA 4MWTA 2GYUA 2RAUA 1GQRA 3NGMA 4KACA 2QJWA 4UHHA 5DYTA 2OGZA 2HM7A 5CH8A 3WZMA 4G4JA 5JZ9A 3G8YA 4Y2VA 4ZXFA 5A7HA 5AI9A 4Y2YA 4QEKA
chains in the Genus database with same CATH superfamily
2Q3MA 3O8BA 4N8DA 1E7MA 4UARA 3I39X 3HZOA 1FU4A 2YIVX 5IAEA 2ZSKA 1XQYA 3NEAA 4QAJA 3HM9A 3RE1A 1WKVA 3FFXA 4ZPXA 2VCEA 1YT5A 4J16C 2OCYC 1DC3A 2JJQA 2XOKD 1UOEA 1KK2A 3WAJA 1B43A 4KN6A 2JRCA 1MTZA 2Y1OA 3EEIA 5FORA 3V3KA 3UAGA 1WM1A 2CFTA 1C9YA 2RAVA 4D81A 4I81A 4N0QA 3GGOA 2ZIAA 2BFDB 3GNSA 1IOWA 1MQAA 1O6ZA 3RSSA 2JK0A 5DX0A 1JXAA 1TFUA 3BAZA 3OESA 4RKFA 4IAOA 4NZ9A 1EXNA 4OFWA 1V5IA 5DBGA 4U9HS 4DCCA 3TM5A 4KPYA 2LDXA 2EKZA 4ISBA 1J5EB 2I55A 1W25A 1E59A 3HKEA 4I1RA 4BV2A 4I5EA 4E1AA 5K8JB 2Q8QA 2EFDB 3AHGA 1YZYA 2KBEA 4RDHA 3DTTA 4MQEB 1HE2A 2JFXA 2FYTA 4IFTA 4ZOAA 2HF9A 2FPPB 4NAUA 5LBUA 3U9SA 1VKRA 4MCHA 5K6AA 1P9WA 2BFNA 3OQJA 5DLEA 3KUKA 4J2HA 5L3QB 4OIMA 4B4WA 1DE0A 2GX6A 3CV3A 3I8OA 3M0EA 5DCYA 4A36A 4XX1A 3VPDA 2C0CA 5HG0A 1E4VA 4WBSA 1JHDA 2ZT5A 5HW0A 4GE3A 4XWWA 1B3RA 2EDCA 4KI0A 3L8EA 4LVCA 1TIBA 2HX1A 2XW6A 3MTEA 3EUEA 5FP0A 4YRZA 1UP7A 1WUTA 1AA6A 3EXHA 4Q05A 2JD1A 3S4YA 2FAXA 1DQYA 1K63A 1U99A 2G1AA 1CZOA 3DQPA 5KOJB 5LB2A 1CEQA 4ZD6A 3DMPA 2GBLC 4BV3A 2JCYA 2DMRA 4ZGGA 1KMCA 4ZAVA 3QXJA 3JQ7B 3TZEA 4K7JA 1EAMA 2OHHA 4NFSA 3STHA 1GPBA 2REQA 2JLZA 4B33A 3UGJA 4B6FA 2VDQB 1XHLA 1PT7A 1M2VA 1VL1A 3H9UA 4RGYA 3TMKA 4KCGA 3Q7IA 5DP2A 4DWVA 3ILXA 3P97A 1FYDA 1MVLA 2NVWA 2JI4A 1L5LA 2Z09A 4EPVA 1Z5UA 3GZJA 3ZY6A 5CH3A 4ZMRA 4V24A 4GZ3A 3Q5EA 4B46A 4S12A 1KXJA 1XNHA 4BB0A 5AM4A 5EZQA 1Z0DA 1KBZA 1Q3KA 2G8LA 2GN8A 3B52X 3NYWA 1SRQA 2JARA 5H83A 2B8WA 2Q2WA 2ZB8A 3HLYA 5U1PA 3U3JA 4CUZA 3GLIA 5KVVA 2QW0X 2JAPA 3EZ7A 4MX8A 3NETA 1M34B 1PJ2A 1M1YE 3C8MA 3LZDA 5JSYA 2IUUA 3TW4A 4Y6LA 3K70B 3L0ZA 2PUTA 3AO0B 1E9FA 1G5IA 1NWHA 1UZUA 2BFPA 3NP9A 3HYSA 4G0XA 4XARA 5E6SA 1SQ5A 3TLGA 2ZAYA 5AKKA 1SXJC 1HYHA 1U28A 3ZWYA 4DDMA 3IAM1 3M5PA 5KVQA 3OJEA 1RFLA 5IAOA 1NTRA 3VGJA 4CIVA 1GYPA 3EVNA 2P7IA 1WD5A 1R6VA 2HLNA 1ADGA 3BXFA 1D1SA 1EDOA 1DIBA 1TCVA 1WW2A 1F5SA 3LUAA 3Q2KA 4ZOQI 1U0LA 2PMDA 4MDHA 3SYTA 2VPPA 2XE6A 2EJWA 5ITWA 1MKYA 2ID8A 2VLIA 3WKEA 3BHMA 4MVJM 4AN4A 1WBBA 5C18A 1R5OA 2YDXA 3OPYI 3MIZA 1SQ0A 5TS3A 4N5IX 3ZS9A 5A4KA 1X8KA 2CJPA 3GEMA 2PVCA 3UC5A 3WYFA 3K35A 1F8UA 1D6MA 2HYDA 3NPAA 3D6MA 1R0RE 4LCJA 4YXWA 3WL8A 4OBXA 5EHGA 1XCGB 2QN6A 2Q4OA 3MB8A 3T7CA 1NVVQ 1Y7HA 5LXTB 3U6BA 1ANKA 3PBKA 1WV1A 3IUEA 4CKBA 1RRPA 3HR8A 3KJEA 1MC1A 1NF2A 1CLUA 4P58A 4XR9A 3GOHA 4TT3D 8ATCA 3C16C 3PJFA 3PVSA 2PN1A 1TCUA 4IIBA 5TSDA 1P7CA 5KTMA 2H1WA 5KKAA 3F7TA 3VR6A 5HQTA 1G6Q1 1JQLB 2BP7B 3DGFC 2D4HA 2XYPA 5I7UA 3ROPA 1O94D 5L6LB 2K7ZA 1T0IA 1V5EA 4L8VA 3C24A 4Q4AB 3H2IA 3AWIA 5I9SA 4PN7A 4KX3A 4KWCA 5KCMA 3NH9A 3ADBA 4H7FA 3X1JA 2Q2QA 4AIRA 1GUFA 2YC4C 3M6WA 2CDNA 2J0EA 1RRMA 4MB0A 2ANBA 1CIVA 3VU9A 3A70A 2ZR9A 4PW0A 2IH2A 2Y05A 5TRTA 2FMFA 2YYZA 1T8YA 4I46A 4R9UC 1QDUA 2J07A 3RIMA 2R1ZA 3L0YA 3UV6A 4Q7MB 2ZVPX 1BJRE 1U6JA 1H8HD 2RHTA 3V2IA 2Z4RA 4W82A 1M72A 4W63A 4L5JA 4NYIR 3TLEA 5FLYA 1QZZA 3HABA 1Z2DA 4WXPA 5FUMA 1VIDA 4B2YA 1MD9A 3K0AA 4IX9A 2OVBA 4YIHA 3R3HA 4HOYA 3T3OA 4FKMA 4LYGA 1PYDA 2H5JA 3VFDA 1ZD8A 5BW6B 3PUIA 1NW6A 4U8HA 4BP9A 3I0NA 4PYJA 4JI4B 1P81A 4IM7A 4MVWA 1T0HB 1XP8A 4E7OA 4Y2RA 1RXEA 2AN4A 2HSJA 3D02A 4Y7DA 1B76A 4MROA 2NTJA 2A30A 1UFVA 3GPDG 4GAEA 2OKCA 2B82A 3HKCB 4FFVA 1P7WA 2QR2A 2A9PA 4PAMA 2F43B 4YQZA 2QUHA 2NXEA 3SIPA 4JR1A 1ZUD1 2AYZA 3Q15C 2HJ9A 1LEHA 3TIFA 5JALA 3PSAA 1LJLA 2AFIB 5DTIA 5F52A 4WH0A 3LDHA 4RDCA 3HLKA 3X2SA 3DDCA 4BECA 4OJKA 3CRVA 4UFPA 1YVDA 3SJUA 4R6WA 1NT2A 4RIGA 4DCUA 2MYUA 3WLIA 1BS2A 3KFXA 2WTAA 2KPOA 3MNFA 2YV3A 5EWJB 1XSEA 2XTNA 3AT1A 3MILA 1XCLA 2EZ8A 1T3ZA 5D3ZA 5F1KA 5CW2A 2MYTA 1XMIA 3I61A 1H6DA 1MB2A 1SU6A 2B8EA 3KZCA 4GXTA 3T4UA 3WYBA 4CIWA 1HXHA 3U4QB 2UXCB 1J97A 2XT0A 2BEJA 3QVWA 2XMSA 5DW3A 4EO7A 1QVAA 1DELA 2ZWPA 3H6GA 1VBFA 4NSNA 3RK0A 4ZN6A 4UOQA 5KNDH 2EFHB 2XUIA 2ACWA 2YQ4A 4N65A 2J59A 5AJHA 3TKYA 4UDYX 4ZEXA 2C2HA 1JDPA 3ESDA 5F9MA 4K9MA 3VU9B 2OO3A 1JFFB 4LXUA 4E13A 1FZTA 1N7JA 3MW8A 3WYCA 4DR6B 1MZVA 4IVQA 3PXBA 1T2DA 4F56A 4EK9A 3CJTA 3T7TA 1PUXA 3STXA 3LT2A 4MICA 4JYAB 4MI1A 2CV1A 3C4JA 4UJ3A 3Q7TA 4YI3A 4ZC1A 1KZ1A 5HA5A 2O52A 3NWOA 1L9KA 3VNAA 3OCCA 5F1YA 4RACA 3RC7A 3O3OB 2C00A 1GPNA 4HVCA 1NQ5A 4D92A 2HSGA 5LP1A 3CVOA 1GFSA 1VMEA 4RD3A 5CCDA 3CF4G 4RW0A 4RIHA 3UEOA 3RBVA 1QIMA 5IAAA 5JRDS 4JP2A 4L5YA 4GL2A 5A62A 1KE2A 1LPBB 2IW1A 4D9JA 4M9QA 5B6IA 1TPYA 3CZ4A 4HTFB 1SR8A 1G1MA 2RHBA 1J9EA 1EWVA 2WP8J 1Z38A 3HO8A 3ONWA 4M1MA 5E9QA 2CL6X 3K30A 1D6NA 3IAHA 3PNSA 1A2KC 1ZNXA 3QPVA 2IBMA 3V46A 2WOJA 4UE2A 1M10A 1KDTA 3AC0A 2W37A 1THZA 4UTVA 2OAQ1 3D8RA 3MZ0A 2R97A 4M38A 3JRWA 5AI0A 4B9AA 2EG9A 3FGOA 1P7VA 4L16A 2ZROA 1CQIB 2JBWA 2EGGA 2YMLA 2G08A 4JLKA 4WCDA 3LHIA 4PHTA 1K5DA 2QTMA 1I4TD 3BIWA 1JDNA 4HL6A 5CAEA 4O4IF 1SQGA 5CG2A 2WJHA 3WQSB 3F78A 3AV3A 4X62B 4EO4A 3K4QA 2NPIA 2ZJ4A 4NBSA 3E05A 4EUHA 1K8ZB 2ZZMA 1PN3A 1YE5A 3MWEB 4MKHA 2FN7A 1T3LA 2J6IA 3ZQJA 4ZYYA 1Y8RA 1B6RA 1IM2A 3L7NA 5F5LA 1YS2X 5ICFA 1AHNA 5SZIA 3GRYA 3OC0A 4R31A 2I54A 1X38A 1E7SA 2PWAA 1IWOA 2Y2VA 4J43A 5CT4A 3O95A 1ZEJA 4G4GA 3NT2A 2DX7A 4U2BA 3EULA 1JDJA 3KKPA 3H6KA 4FPXA 2IEDA 1KYYA 3RH0A 2P7HA 2PQ0A 4YRFA 4CF3A 1R0BA 4NMHA 1DMRA 3I4LA 4OHPA 1KK3A 1S9DA 3OIWA 2WJZB 2N1BA 4UM5A 3DNFA 1LSUA 1VL0A 5FUXA 1UBJS 5FTMA 3TN7A 2X1HA 3Q6MA 5HM8A 4EA9A 1KY3A 5K6RA 2NUAB 3KPWA 3ZZUA 2G9NA 4GVPA 4P81A 1CR0A 1DP4A 3GRZA 4PX3A 1G55A 2BELA 4AZTA 4YR9A 1Y4UA 1GFIA 3QOYA 3TCXB 1E3WB 2FN9A 4IV5A 1M1NA 2XAAA 4WESB 1EBUA 5FR2A 1IDN1 1QYCA 4GIBA 4D8TA 3DTVA 5TNXA 3RYFB 3GD5A 2Q9CA 3ZPXA 1GXSA 3FY4A 4KQWA 4ALKA 1GZVA 4R2MA 3RV3A 3OQVA 1G2PA 4HYYA 2KW5A 5DULA 1Y8CA 3W9YA 2J32A 1VIAA 5I9TA 3TEJA 4NICA 1G8PA 2JHFA 4TS1A 3O1IC 1KA9H 3OPVA 4ND6A 1N6IA 2ECPA 3BUSA 4HWPA 2BISA 4JQYA 5HZHA 1FQOA 3KCNA 1ULZA 1K4MA 3G5LA 2GPYA 3LUJA 4IOMA 3SHVA 6ABPA 1EIZA 2QSUA 1H6CA 3EXIB 2HIGA 2Q8NA 2G4VA 1TPZA 2ZI5A 1FVFA 5CLQA 3QE9Y 2OVFA 2RH5A 3E70C 1OZHA 2JKZA 3KB2A 4Q7JB 4PCLA 3VZRA 4Q7KA 2WYWA 2XCOA 4EENA 5EJFA 2WKWA 2FSUA 1PUIA 4PAWA 5FOUA 4UHCA 2QLLA 3QVTA 4AKEA 1M5TA 5FLEX 3AUXA 3I30X 4TYQA 1O03A 2PUBA 2RIPA 3KE8A 4JKOA 1QO9A 1P0FA 3TRIA 3D6NB 3DHWC 1Y0BA 1TM2A 3B85A 1GPKA 2VWPA 3AF6A 3LBIA 1NPYA 1NUUA 1R74A 2Q8PA 5BO5A 3RRYA 1H0RA 3X2FA 2FKNA 5IVPA 1HKUA 5JV5A 1RLIA 1G5FA 4B32A 4B44A 1OMOA 1FS4A 3M2TA 1QP8A 1TXGA 4L72A 1RPJA 3R4CA 2JFOA 2MR6A 3AEQB 5M29A 1E2LA 4KQ2A 2BKUA 1AKVA 1IBMB 4AMBA 1Y3CE 1YSCA 4PF1A 2IY8A 2Y1KA 4QDKA 1UR5A 1UXOA 3NTOA 4HLQB 2IHKA 3AOEC 2XNSA 2VA9A 3MJVA 4URUR 5KREA 1Z13A 2EF1A 3ZZ0A 2W4MA 1L4KA 5CFZA 3EA4A 16PKA 3JVUA 4RSRA 2H7XA 1YZTA 1FLVA 2QTGA 3B2NA 1E20A 5HIIA 1QTQA 5C4MA 4Y9UA 4LV5B 2O0LA 2PNFA 4NS4A 1IK6A 1JPNA 1VLMA 3KDAA 4B79A 4AWXA 1TIPA 3QW2A 3T5GA 5GTDA 4U00A 2BFBB 2W6JD 2WUFA 5JYEA 3DXZA 2EWVA 1RE1A 3UANA 2X0IA 3AXSA 4K88A 4XKJA 3RYCB 1NJFA 1V4NA 2YZ2A 3EOAI 2DQ4A 1IQUA 2OO5C 1ZLYA 3D2BA 3QV1A 1ECBA 4O2BB 2PQMA 4QXOA 4WAUA 4CIDA 2PEZA 4DA7A 1DLJA 5BYAA 4FOPA 1ADFA 4E5DA 1NXTA 2HMTA 1R3UA 2VZ9A 1F0YA 4K81B 1GPYA 1LSSA 2GEUA 4RE6A 4RO0A 3KZXA 1YZLA 4NF2A 1KSFX 1TVMA 2PTHA 3C6KA 4GRIA 1PZGA 4FT4A 3VYUB 1H2BA 1W93A 1PU2A 1PNOA 2NTEA 2A67A 2QHXA 1ZUIA 1W4CA 4WA8A 5EN4A 4G1MB 3CA8A 1IN5A 4FMPA 3RS7A 1NOJA 3KU1A 4HP8A 1XZFA 1ECLA 3DO8A 3N0RA 4FFMA 1BHO1 2CNKA 3K8OE 1M3SA 1D7OA 3IURA 5GAJA 1TUEA 3FFTA 5J5VA 4NCAA 4XH9B 1HBJA 4BTVA 1R10A 4G97A 5ALIA 2JGEA 1IJFA 3SJCA 2O07A 1NRIA 3HEMA 2GOYA 2PRJA 4H2DA 4UNSA 4V3BA 4ER6A 3ILVA 4EY7A 1X13A 2W2XA 3FUTA 2P9EA 3TM4A 5H3LA 2AZMA 3ZD8A 1NLUA 1EX1A 1WV0A 2VI5A 3KLOA 1DMSA 2LPMA 2PYDA 3MA0A 3QU2A 4O4HB 3SHQA 5AKZA 4ZJUA 2B30A 4BGVA 2A33A 3MGBA 1GTL1 2HK6A 3RVNA 3R6GA 1FB5A 1PJ4A 3ELWA 3JAKA 3RGWS 4KQ9A 2WI8A 4PX2A 2VBCA 1UFQA 4H7IA 3C7DB 3KFVA 2PV0A 4NENA 3V8PA 4MUNA 5BWNA 2YICA 3Q8WA 2IEIA 1T5BA 2NU6B 2VPYA 2PH3A 3RG8A 3S1LA 1U1DA 1CW2B 5EC8A 4M9RA 5BVGB 1G4AE 1U7WA 3WIDA 4GZLA 1NP7A 3Q72A 3IDOA 2MSLA 2G1JA 5FLKA 3QA9A 4G84A 4HDRB 2WAYA 3AEKB 4Z4FA 3V4LA 2VDPB 4Q3DA 2RE8A 1BG6A 2OHFA 3IMKA 1NVKA 3SQMA 5HZGA 2VP9A 4KQMA 2NWQA 5EWMA 1LVHA 4X65B 1MO5A 1W1UA 5DP1A 3UK7A 3BFVA 4MKGA 1OQAA 2ZE7A 1G20A 2QTAA 4O63O 4S04A 1X7XA 5JECA 5E7QA 3U7RA 1KTIA 2AR7A 1V5WA 2QYSA 3GVPA 4HXYA 3WSVA 4DJAA 2QPAA 3OO1A 1CNMA 4EVRA 4QG3A 4O4JB 3L04A 2P79A 1SVNA 4LPKA 3ENNA 1QIJA 2MIIA 2NXWA 4Z7NB 1UDCA 1VDMA 4CIXA 3MCWA 1ZP6A 4IY1A 1ZW1A 4IIEA 2IF0A 2JJYA 3GUZA 3O6VA 1P9NA 1SUDA 4HH3C 2J5QA 3Q9UA 3X44A 1O95A 1O8BA 1RXIA 4MP6A 2ZBFA 5JWRA 5FTWA 3E1KA 5FL3A 1PK9A 2Y4OA 5FPQA 2GZAA 3FMPB 3DAFA 3ENQA 2GTPA 2NZWA 4RZSA 3TSCA 4XYLA 3AF3A 3Q0IA 3HI4A 1QO7A 3IKLA 1HF3A 2C8KA 3JQFA 4F4FA 5EPEA 1N6HA 4HQNA 4JQCA 1JZSA 2D2EA 4X7BA 1P1IA 4N49A 1DCFA 3O47A 4IH9A 2O2DA 1TO1E 7REQA 3D6VA 3ROQA 3WK9A 2ZIUB 2H06A 2IGTA 4HK4A 3ZWOA 3FNRA 1KOJA 3CLUC 3W2FA 5JD5A 4GOKA 3DL4A 3VV3A 3VUFA 4XUCA 1YQEA 2XDQA 1XDGA 3F6YA 3FTCA 1X80B 1KE1A 3QX3A 1II9A 3IDSA 4XSHA 3UBMA 2NZ2A 2AZ4A 1PSZA 4OYYA 4EOGA 2GCOA 1JR3D 3DFFA 3KZOA 3O9ZA 5LL6P 2JFGA 2PVSA 2GK4A 1EWKA 1V8ZA 2FUCA 4KDFA 1VG9B 1ISGA 1F6WA 4A2PA 2C78A 2DUUA 5KYKA 1HL3A 2P27A 1Y89A 3QVLA 4Z4GA 4BMYA 5ALTA 5ALGA 3L8DA 3E3OA 1YS1X 3IHWA 4MA4A 3ZDYB 4OAPA 1M7GA 4FQ8A 3HJUA 4FGJA 5TJ9A 3ELDA 5ALWA 3NHSA 5A0TA 2EVWX 3FOWA 1YDFA 3UKOA 4HRYA 3DMHA 1H85A 4MV6A 1QHHB 5JS6A 1OZ0A 4JJIA 4RVOA 3UWPA 4WVLA 4F5DA 2FZKA 1IXZA 4DIEA 4UUBA 1UANA 4HWTA 1DAEA 4RXUA 1DKQA 1KJZA 4WK2B 2I80A 4CFYA 3TDNA 4DR7B 1ORTA 4WECA 1OFVA 2HPAA 3GX1A 3P5BA 4RD0A 3U3MA 1BROA 2ATEA 2IIVA 2DAPA 2NT3A 5DWVA 1XLUA 2J3LA 2QN7A 5CXXA 4K6GA 1YS4A 2GBIA 4L75A 1QX3A 1Z6ZA 1FYFA 3QKUA 4HWOA 1ISRA 4FEEA 4ZICA 1GRNA 3U4GA 1NJ1A 2NVBA 3KCQA 1YWGO 4ZO7A 1H2ZA 3I09A 3NT4A 4D44A 3OSUA 4YHHB 2FMHA 3RYTC 4F60A 1SHZA 4FILA 3BMNA 1L3BA 2ETVA 1UIRA 2HXSA 1JQBA 5LKRA 1EPUA 3BQ9A 5IFKA 5KYXB 4RTPA 1N6RA 3AHIA 5JUWA 4KH0A 4P98A 1X9HA 3IBGA 4DREA 4MB6A 2QRHA 5IF9A 4M22A 1OAOC 5FIUA 5F3WB 2ONYA 1WY7A 1X92A 4L8YA 1K7XB 4LXQA 2P2YA 1E60A 2XE8A 4KQHA 5CTAA 1YZUA 3KTFA 3RW9A 3MJHA 3DKRA 4UREA 5DNDA 2NZ8A 4L3OA 1V16A 4EYSA 3UFBA 4RSHA 4BASA 4I4LA 3O8QB 4ZCMA 3ZJUA 1YGYA 3NAGA 5F33A 7ABPA 1Q0HA 5H80A 1P18A 1XHFA 4NE2A 3CPSA 2C4KA 2F90A 4WFKA 4AO7A 4E6PA 3N87A 4JY7A 4BGEA 4BKOA 5JDCA 5EI5A 1OXVA 3PQCA 4JLUA 2AZTA 1QS0B 5C5EA 5F9HA 5LOVA 4PR0A 1Z74A 4NC9A 4UUAA 4BQSA 5HX7A 1DQPA 3GLRA 1YQTA 3Q12A 1OGYA 2CLMB 4KO4S 2VHQA 5BR8B 4C7OA 2G7MC 3S2SA 4DVGA 3E8MA 3IUSA 1LZLA 2VHVA 3NHFA 3QV2A 4EZBA 5HOEA 5KNBA 1YQDA 1QC5B 2ZE6A 3KXKA 2X8JB 1J8QA 4FLEA 1ATZA 1EWRA 1F6BA 2N9UA 3M8KA 4PLPA 3MS2A 5FBRB 1R12A 2FEMA 1P0MA 2IYWA 2OGTA 2QWXA 1FK8A 1T1JA 3FR8A 3H04A 4D9MA 2WQ6A 1KDVA 2PGJA 3MN1A 3UVEA 2ATVA 4NJEA 4K2AA 5BV7A 2ZPAA 2Q3JA 3DV2A 2GPSA 2AK2A 1B16A 1OWMA 2AD5A 1OLUB 2KSQA 3HZRA 3HU1A 3FPSA 4O3MA 2DWPA 3AI2A 5BURA 1O08A 1A2BA 1CDZA 2VBFA 1UJ4A 3JD3A 4J0KA 5AP9A 5HFNA 5K5EA 2OYSA 1DKPA 3C3PA 4YRPA 1TYAE 2RC5A 1A9XB 1QKKA 5K0EA 1Y4ZA 4ZT4A 5JMPA 1WKBA 3H11A 3PRHA 4M9ZA 2Q1TA 3RSGA 1UK6A 3UJ9A 1U5CA 3DDHA 1RRGA 1Y3DE 5G3ZA 4RORA 2JK1A 3OFNA 2NQ2C 1XA0A 4X0EA 3DM5A 3WGHA 4YO8A 2ZJFA 3AU8A 4DLLA 3V8QA 2WIAA 4PG8A 5A5EA 1W5SA 1ILWA 5HK9A 3K16A 4RH1A 2PT5A 1H3FA 4KIWA 2O4CA 4W5HA 4DAEA 5HSGA 1EMDA 5BN3B 4KR3A 3R9XB 5BT8A 1EX6A 4MUEA 1GQSA 2DHEA 1FLNA 3LT5A 4UUNA 4KXVA 1KKUA 3EZ6A 5J4YA 3SR3A 4JUCA 5IBRA 3DZBA 3T9AA 3RWOA 1PQ4A 1D4OA 4BRWA 3ZW9A 4A26A 4I9GA 3CWCA 5DO9A 2PXHA 3LC2O 5TGZA 4B34A 3PF8A 4LJYA 2E21A 5ADHA 1KPGA 1CP3A 1V11B 5GOZA 2J7PD 3H1AA 4FU0A 1N2CB 3IXQA 3DLPX 3O91A 1GV0A 4Y6RA 5DEIA 3EMDA 3X1DA 3B1XA 3L02A 2IE0A 5DSTA 1OVMA 3NONA 4CBVA 3LWZA 3FDZA 3DVAA 2ZI6A 3NASA 1EKXA 1AO0A 4B3RB 4RZXA 1G5QA 4F6RB 1SUIA 4YDRA 3EWIA 3SZRA 1OX4A 4V2UA 2K2QB 4MGYR 4IXWA 4PANA 4Q1BA 3KVRA 4XVRA 1OBVA 5FBLB 4PNEA 1XU7A 4Z0NA 1IRIA 5FJJA 3U7FB 1RWQA 2GZ3A 1ZSNA 2GB4A 3A05A 4RMHA 1KP3A 1Y3HA 2V7QA 3E8XA 3ZE6A 2WD8A 1JBQA 5AVUA 1Z56C 5KWSA 3AGPA 4S1NA 3EUWA 5AW2A 5TQJA 3WDLA 4KE8A 4U7PB 3GZNB 5BQPA 4JROA 4G1EB 3QU5A 4WASA 1XTQA 4XFDA 3J7TA 1L5OA 2VPTA 3NEJA 1VE3A 5FX2A 1KOGA 3HO1A 5COAA 2J7KA 3L6RA 1H2RS 4GM0A 3QQ5A 4CHGA 4IJMA 1N7GA 4GQIA 1TUGA 1KEZA 5TARA 3RBZA 2A94A 3BKXA 1O5IA 5JPIA 5C1OA 3ESXA 3EXEA 4EHIA 4LIPD 4F8JA 1SURA 3L7IA 4UMEA 2PJRA 2R1TB 4X90A 1I51A 2O8EB 2WFLB 1E0DA 3PE6A 1WCIB 2GH1A 3M4XA 2NUPA 1CZNA 5HOQA 3AJAA 5LWHA 2AXNA 2O9JA 5LBTA 3AQ4A 3I23A 3PC2A 3UZUA 2O2JA 1XZEA 4HNRA 5IAKA 5D1HA 1F1BA 1R6DA 3K9FC 4ZDIA 2C7PA 2B92A 4MWEA 2DXIA 3S44A 4RX1A 1UDAA 3T41A 2A3RA 5JANA 4CTMA 1DPFA 1N33B 3CJRA 3HU5A 3L1JA 1XALA 4X94A 2VNAA 2C5LA 3HG7A 4X64B 5HJ7A 3W6PA 1B23P 2GYVA 4GWGA 1P1HA 2F1JA 4ND7A 3KKQA 1JFSA 3P9SA 1OREA 3GFQA 2E1RA 2HLDA 2M6RA 3IKVA 5JDIC 4GSKA 3O5AA 2G76A 2XGOA 4H7HA 2J45A 4IFIA 1DC8A 2R6AA 4YO7A 3CUTA 3F71A 4R2HA 4YFYA 4DE5A 4EFNA 1T9ZA 2FP4B 1PV4A 1GR0A 1KPHA 1EG2A 1EAYA 1ZW6A 2IZ1A 3L7YA 4BE4A 2W2MA 2ADMA 4GWLA 5AM0A 1RYZA 3QLUC 4OGFA 4RPGA 3LK7A 3U1TA 3ZJ5A 2FDCA 1GZ3A 3F3YA 4OQLA 1T6ZA 2ZBUA 3DPSA 4EEXA 1P4GA 2ZWOA 3MCAA 4LXXA 4TV8A 2QVZX 2QZ4A 3CN9A 5CPFA 4A2QA 4TUYB 1FRNA 3BRQA 2B36A 4Y6QA 4RY9A 3WB1A 4ENWA 5L4LA 1QGUB 1RC1A 1ZZEA 2QN1A 1Y80A 3TW8B 3UFXB 4CNQA 3EZXA 5HZKA 3UK0A 1AXGA 1NDHA 2NU7B 2H4HA 5H16A 1GA4A 1QYRA 3QEMA 3IEUA 1PV1A 3BEDA 3AP3A 4O29A 2OSVA 4ZVUA 3ZGNA 2ISSD 3UXMA 2FNAA 1SO8A 3OIGA 1NMSA 1OIVA 1W44A 4RC9A 4X6UA 2WSMA 4RJTA 1RMYA 2VT3A 2XT6A 3B1FA 4S1WA 4GKVA 1CF2O 5LP6C 3UMMA 1FMLA 3ABQB 2UZ1A 3WL7A 3II6X 1EDZA 1JHRA 1RR6A 2B2NA 3JVDA 3OT1B 3BL8A 4G9GA 3EH2A 5FULA 4ZODA 1DNPA 3V1NA 3C2QA 4AECA 2APJA 2B0JA 2BGMA 3FNGA 3LBYA 3WWEA 4DNFA 3U7HB 2FMTA 4HNAA 1CLEA 4UULA 1JE0A 3B9QA 3GT4A 8GPBA 1A5ZA 1RM4A 1ZMRA 2OV3A 1Y1KE 2JFQA 3O8CA 2C9ZA 1FFBA 2VYVA 1ZUWA 3P2OA 1V8OA 3MWLA 4Q01A 4RZIA 5LMCA 1T43A 2XDAA 2GFQA 2RKOA 5EIBD 2DYKA 1NWCA 5K4HA 1FXWA 2WA2A 3WZ2A 2J3HA 4Y18A 5JSKA 5IYZB 3RADC 2XNJA 4B3TB 3GN2A 1H1LB 4YJGB 3O0TA 3UICA 3EA5A 4YRTA 4B48A 2UVPA 2Q7OE 2BR3A 2BR5A 4F72A 2J5XA 3GD7A 4IRXA 1JHUA 2A1IA 4UBJA 5KHAA 3VJRA 1IFXA 2AD1A 5SYAA 1KY5A 4QFMA 4RLHA 1HZZA 4WLVA 5CYOA 4AJOA 1QFYA 3TBKA 4YP6A 4LWPA 5KU1A 4ER0A 1BYIA 1GNQA 2DUJA 1EFTA 5CVDA 5JEEA 2J9XB 2WYUA 2BCJQ 3GJSA 3KUCA 5CJ2A 3PGXA 2AQIA 3MGCA 5E7MA 5K0FA 1XNRB 1UOQA 4BKRA 4MLCA 3NTXA 1VCIA 3TG2A 3NORA 4QFCA 1XZGA 1Z5OA 4AROA 2HLHA 2P3QA 4M0LA 5JATA 1N9GB 3L8FA 1OJ7A 3W1WA 2WRZA 4AZWA 3UJHA 2CSXA 3L4EA 3OAAA 3UXHA 1Q0LA 2Y9PB 4QU0A 1OU4A 1U7UA 3ESQA 1XNJA 2QE7A 4R83A 5AM5A 4LRQA 3Q87B 5K3EA 2PD6A 1XI2A 1QQ6A 1XD2B 4RY8A 5GPBA 4LOIA 1ULBA 1RCTE 4FMDB 3IV9A 3RWBA 4MDYA 4UEKA 1GT6A 2V4MA 1P2VA 3HH8A 3QNUA 3BMQA 4OD0A 4QL3A 3IBSA 4UM9D 4WSOA 3VZSA 5CW1A 3EGOA 2RGUA 4PZ9A 3CISA 2JFFA 5FWYA 4WJKB 1AV6A 1UXJA 3O82A 1NN1A 5AHKA 3QW4B 1QP0A 4UNNA 1PEAA 4IUBS 1FIUA 3TPCA 1C3XA 2WHXA 1U9JA 4U7TB 3RKRA 4HB3A 2OBNA 2UYGA 3PRYA 1C2YA 1W8DA 2NSDA 4BNLA 4TMXA 1JEOA 4R8LA 3VHLB 5HS4A 1NAHA 1ZC3A 2GCGA 4YGYA 2P1ZA 6YASA 3UH1A 5I9MA 1FRZA 1T9HA 1Q7CA 2QTFA 3CRNA 1S3IA 3EWAA 3JWIA 4PX5A 5I6DA 4TL9A 5JBQA 3FROA 3SICE 4Q4JA 4Y0VA 1P74A 3NIGB 2HRCA 4OXKA 1J56A 5IXSA 3FR7A 4GDFA 4UTPA 4JBYA 2VP2A 1NASA 2G5TA 3U1VA 1U2DC 1Y9EA 2GA9A 2WV9A 3QWFA 4PTYA 4FDUA 5HE8A 1F6DA 4CM4B 5HDQA 4DFDA 4WTOA 4PC7A 2C9BA 2CGEA 1V3QE 3G68A 4XGIA 5EMNA 1U3WA 4KUGA 4E21A 4A15A 1USUA 2A58A 5EY5B 1C30B 3AWDA 3PFBA 3QZUA 5BNWA 1BMQA 4B7UA 3CNHA 3CT4A 1TEZA 3VJKA 1IRXA 3BE5A 1D1QA 1UQRA 2ZJ1A 2JI9A 1V1MA 3HGTA 1OROA 4NHOA 4ALLA 4DKXA 4LGCA 3TEFA 4LJSA 4M36A 4G86A 4UMVA 4INAA 4N18A 3Q0TA 2IYTA 5ALEA 1MB4A 1SOMA 2DR0A 3GL9A 5K8LA 5A9SB 3F6SA 4PYMA 4D3FA 4E30A 2D1SA 2IWHA 3D7MA 2VA8A 4AX4A 3LBFA 1HT2E 1RWKA 3KDPA 1KXZA 1JDTA 4IGFA 3R9IA 4AZVA 1XJ5A 4KKVA 2M2IA 4LRWA 1V1RB 3ORFA 4BWYA 2GZSA 4B6JA 1XTJA 3CNEA 3FCYA 5EPOA 2EEPA 4G5GA 4OXIA 1PW5A 4UDXX 3UK6A 4EMBA 5LYJB 4ZEVA 4G4IA 4LF7B 2BMFA 3VZBA 5I3ZA 2ZTMA 3GARA 3I5MA 4H7PA 1AB6A 3EEYA 3QX9A 3HVJA 4V1CB 2JLYA 1G8GA 3B12A 3WK7A 2UDPA 1QZXA 3A6DA 2BIFA 3UW1A 4YMTA 1WXGA 1FL9A 3OY7A 5LC1A 3AEYA 4B73A 3U61B 2E2WA 1MTOA 3CUWA 3NO4A 4R1PA 5H0IA 5A4AA 5JNVA 1Y1RA 1MJ5A 2ANCA 3BTOA 4I2NA 3V1YA 2IBSA 4HS4A 5DYWA 1KMQA 3JZMA 4BTLA 1C1HA 3KO8A 2XYQA 4RD2A 1U8XX 3C6YA 3K1ZA 1ENPA 4QASA 1XFDA 2W6ZA 1PR0A 5D6OA 3ZGYA 1RXCA 4F9TA 4F92B 2P3OA 3THYA 4Y2SA 1JFLA 3QLTA 4Y3UA 2O8CA 1VA4A 3WB0A 1BU5A 2ZUFA 2C59A 3WKAA 2A0FA 1ODKA 1H9AA 1S1MA 4QU9A 3LDFA 3ULKA 5K6TA 2F1IA 2GKOA 2GJKA 3DLAA 4MCAA 4TTVA 2WWIA 2PUAA 5E6RA 2RAFA 2FHSA 3R7SA 1QO0D 3RASA 5LD2C 3K4PA 5DMXA 2E48A 3DBOB 2V03A 3IOCA 3K8YA 4F86A 4MWOA 4FYPA 1G8AA 1WCWA 3W3AA 1Y48E 1SB8A 2QN9A 2I8AA 4MS1B 4B76A 4DLKA 1XELA 1CQXA 4MV8A 3P0EA 1J0EA 2BH9A 3F74A 4Y2JA 2AKEA 4G36A 5IXJA 2GN4A 4TSFA 3KHSA 4LKOA 1WZIA 1GCGA 5D1NA 1G8YA 3OHPA 5LLSA 3F5SA 2FR0A 4EAAA 4C0SA 1B0ZA 3G6KA 2XB6A 3NUZA 4AJ4A 2VPQA 1ONBA 2VYQA 1N8SA 3A2MA 3Q5DA 2W43A 1THTA 2AXQA 4JBWA 1SK8A 2R5FA 3KLNA 2Z1DA 2RC6A 5AHRA 4HEQA 3UHAA 1LV8A 2BCGY 3KUDA 1QHFA 3G88A 4L7VA 5FT9A 1GUBA 1IPEA 1K4KA 1KR2A 4Q93A 3B48A 1D6SA 2AI3A 5E3IA 3URKA 2QD1A 2CHUA 5TQVA 4L78A 1K3UB 5FPSA 5K1ZA 4DV7B 2ZJ5A 1UQTA 3AKCA 3A25A 4ZEWA 5KC9A 2V7XA 4ZCPA 1XQXA 4Z4QA 5EQJB 2VTBA 3TAXA 5E3HA 2P0YA 4QX6A 4LCBA 1UUFA 5GV8A 1E66A 1AQJA 1IBCA 3UJCA 4TVSA 2ZW9A 1DBPA 1QIIA 2HTEA 4BYGA 1WULS 4Z9AA 2ET6A 3EXAA 1NMQA 1GZUA 4ETMA 4HKTA 4V0ME 5FUWA 2AJTA 3V7YA 5CVUA 1YKGA 2VYVD 3WR5A 1RZRA 3C0KA 2AMVA 1KNQA 2JCBA 5CNKA 1CS4C 4TTPA 3OSZA 4JKIA 1YVUA 2QZSA 2Z0MA 3GPIA 3R41A 5CGQB 1IXKA 2V6BA 1RD4A 4QO7A 4CDGA 2IXDA 3BB3A 5A0FA 1X3SA 4MGKR 3NC4A 4YNBA 3SX4A 3D7KA 2QTBA 2H31A 4JQOA 4WKGA 2P2SA 4R01A 4DG5A 3S3TA 1SXJA 1ULUA 5AVRA 1SD1A 1PJZA 1TVEA 2DBQA 2XE7A 3ML1A 4U5QA 1TRKA 5EAIA 3LXRA 3MUFA 4A0GA 1QIGA 2PUGA 4TRNA 2VTDA 1XG5A 1G2QA 1VYVA 4FFSA 4W5TA 3L8GA 4JGIA 4QYMA 1AD2A 2I4LA 5D3MB 1PZXA 3BPSA 3U7IA 3WDKA 3ZHZA 4D56A 1Y3AA 4PXYA 5B7QA 3TSYA 4LX0A 4JC4A 1Z37A 4YPVA 1G17A 1YVRA 2E9SA 4JEHA 3I0ZA 3DOJA 3QLJA 2ZUBA 1MAUA 4NX2A 2ZANA 4UAUA 1G9TA 1HM5A 1KORA 4GPAA 3RREA 1YA6A 4UBOA 1K8QA 1FCJA 2HIAA 3V4PB 2XNCA 1ICIA 3P26A 4HEA6 4PINA 2WTUA 3TSWA 4U7JA 5B6PA 2HMUA 1AB5A 2A7QA 3U44B 4KB5A 1LTQA 2J31A 2GCIA 4LA4A 3Q2OA 3C7AA 4WOJA 1PLLA 3P7MA 3WC4A 2WWHA 5BSGA 3ERCA 1VHQA 2E4VA 1JKJB 1YFKA 1P33A 3CF4A 5AO9A 3TMAA 3KJXA 3NXSA 2JIBA 3L6CA 1X94A 1FNMA 1ZY2A 1PDVA 2SHKA 4AS1A 1AHHA 2A3NA 4HWRA 1FXUA 4DRXB 5KNBH 1FSZA 2YN4A 5G0SA 2WJ4A 3IDZA 2GPJA 2ZXFA 1I7LA 3DMNA 1DKRA 1V96A 4IWYA 1W4BA 2O3RA 3DM9B 3DDSA 3CZPA 3S99A 3WYNA 1P7YA 5KEIA 3ESCA 4URXR 2LXNA 3WLTA 1I4DD 2B4KA 4MUJA 4YV1A 4QUIA 2GFHA 2CMFA 3SBXA 3U16A 3G2QA 4DTCA 4FWBA 5TIIA 1CR4A 1ULSA 3VR2D 2Q4DA 2FWIA 1PT6A 1PGPA 1ULTA 2GPNA 3PIRA 4FT2A 1QFXA 3D8NA 4G89A 4IZ6A 2HZBA 3RUAA 2EP5A 1JAIA 4UCFA 4M1TA 3VH1A 3KJNA 4EHFA 4LRYA 4M0CA 5JO9A 3ZS8A 5LB4A 3VPCA 3LKDA 4HXEB 5ALMA 4P22A 1ADBA 3MJRA 3PYLA 4PSCA 5B4VA 1QG4A 1W52X 4HDKA 4GOXA 2PUVA 3C14C 3FOAA 1YS9A 3MLEA 1LB1B 2XZPA 3N74A 5E1MA 5F73A 4QWMA 3M49A 3A2KA 1UP6A 2QXYA 3IIEA 3IBFA 3IP1A 4TMYA 2LUOA 4G4SP 4AP9A 3ICVA 1N6PA 2AQ8A 2WAXA 1PL6A 1KI9A 1PT5A 2IHTA 4GOJA 5EVJA 1G8HA 3SC2A 1XZLA 4HH4A 1HH4A 2JHGA 4FFDA 2COEA 1K6EA 2DLNA 4RESA 4WZAE 4WL0A 3FFWA 4FS3A 2RHJA 3SJBA 3SM3A 4HVAA 4PV7A 2EW8A 4N0PA 4CL3A 1M1YB 2WNHA 2DLDA 3GFRA 1L4EA 2VO1A 3QU7A 4K6HA 1ZN9A 4LZJA 3TSZA 2X4IA 4IWNA 4TYYA 2QMZA 5GADl 2PJUA 4D1YA 3RIGA 1X7YA 2ZAMA 5ERYA 4P3YA 1QBGA 4BRZA 3PEUA 5TB5A 4MW7A 2ZCJA 2OHJA 4Z2AA 3AVWA 2IS6A 1DO0A 1VL6A 2HFKA 2QMOA 3S6JA 1W9HA 4YLEA 1Z08A 1DINA 3OY2A 3ZTWA 1TM4E 3R5KA 4B3FX 3HCNA 5IKEA 5JROA 2BEKA 4C0BA 4TWAA 1ZIPA 3DE3X 1R0KA 1YMQA 1H5UA 3EN0A 3Q11A 4DIDA 4CF7A 3S2IA 4UFNA 2XOEA 5KTNA 4KXMA 1YZQA 5AVVA 1XCJA 2GCEA 1BDJA 2GBGA 2FEAA 3IHLA 3NTVA 6PFKA 1NJ8A 1VE9A 1Z2NX 2HU8A 2NZJA 4S1PA 3OPYB 3NBUA 3IIKA 1VKJA 1QIHA 1S2GA 4BX3A 1KEEB 3VTAA 1BQ4A 4Y2QA 1QIFA 4UHBA 5AXAA 4A6DA 2PGIA 3AKEA 1ZN7A 1AT1A 3GLHE 2BJVA 3R3YA 3V8NA 1Y6GA 5CVCA 3TX6A 1IBLB 4WOKA 3DMDA 3PXEA 1FRVA 1FFSA 4IVRA 1HE8B 1JEJA 4DUPA 4UBNA 4RK1A 1KI8A 2IHBA 5LD2B 4EBFA 1T3GA 3C6BA 4Y9DA 2HI0A 5DHQA 2CYAA 2PLAA 5DASA 4JL8A 4ZQHA 1PRYA 4EF4A 1DUVG 1OWPA 1ZOIA 1LQTA 4L4SA 3RJTA 5KYUB 1GG8A 5KYWA 2WWXA 5B4TA 3ACBA 1W2GA 4KIGA 1UT6A 4JLAA 3LWDA 1JS1X 3T9DA 1UJ5A 1E2IA 2XRFA 2VSQA 4BJ5A 1KAGA 3H4IA 4G2TA 2PPVA 4G4SO 2XB4A 5IJ0B 4NFLA 2Z9DA 1XRJA 3KG2A 4JODA 4TWIA 4BKQA 4CR6A 4TSFD 1NBOA 2CFCA 2JLBA 5DRTA 2G28A 1NY6A 4QREA 4WOPA 3ANXA 5DBFA 5JXJA 1PK7A 1F8YA 2OB2A 2XADA 4JSTA 4L4UA 4OK5A 1XV5A 2A1UA 1TU3A 1KAHA 3NNNA 3KKLA 5CM9C 1VL8A 1TT5B 3E7XA 3LDAA 4L3WA 5DN6D 1TX4B 3GRUA 1BDIA 2ZSDA 4JJKA 5EFZA 3RFUA 1EQAA 3JQGB 3KLBA 1KEPA 4L8LA 4EKGA 2C3UA 4BEBA 2VH1A 3LRTA 1VGRA 4FC6A 1JHPA 4AJ2A 4AULA 5JH7A 2JBAA 3SXUB 4R54A 1BWPA 3UWSA 3WNCA 2RG1A 2OA0A 1UBGA 3SC3A 3SK0A 3WQHA 4LFAB 1IHPA 1X1TA 4H6PA 1LWNA 3HB9A 1IN7A 1P3Y1 5ARBA 4WKNA 4XFKA 2TYSB 3LUDA 1U80A 3SGLA 4YTEA 5FADA 5JD3A 1VHJA 2QW8A 3X1MA 5AI5A 4OBEA 1Y7PA 2YNMD 3BDAA 2ZTLA 4RMIA 2AEJA 1EH5A 4F84A 2LE0A 1JNXX 3UK1A 3GLGE 3MJTA 1R4MB 2OHOA 3LCRA 1PQWA 1QOQB 2EP8A 4UVDA 5EP2A 5JBNA 4BN0A 4BMPB 1BKSB 2B5VA 4BC0A 2WSBA 4QOFA 4DDKA 2C3OA 2GDZA 1IWBB 2P9YA 1EWTA 2FKAA 3KYCA 4TM8A 4GH5A 4WCVA 1J21A 1NYRA 1WG8A 1QRAA 1K8YB 3G8AA 1CB7A 4W99A 3TTYA 4MVJE 4C6RA 2YV1A 4BNFA 5DHAA 1E1KA 5D7BA 5DH9A 2A9JA 3NHJA 1CY6A 3QTTA 5KAPA 4BBJA 1W34A 3R0VA 3T15A 2XVMA 3VU8A 5T64A 4BFXA 5CDFA 1K7EB 4Z7JA 2JFVA 3DVRX 3N2KA 5GOTA 2NP6A 2YJ3A 1FX1A 4PZ0A 1FSGA 2JIZA 3ORRA 4H17A 2VHJA 2D2VA 2PU5A 3RUEA 3LK6A 3OOSA 2EJVA 2HEGA 2RGNA 4UUPA 3BCRA 4B7XA 3VSEA 1RKBA 2GYYA 3F47A 2C5GA 3R20A 2QZ9A 4FGWA 4RJKA 5F1PA 5FWAA 5KWVA 5AXDA 4JP8A 1VG0B 2J08A 1P44A 2G7ZA 1GPAA 1WF6A 2OZLB 2YDYA 5E9AA 1KU0A 2EL9A 1ZMTA 3T06B 5GJBA 4YJHA 1G9XA 5C8VA 4DJFC 3CGWA 3JAWB 3IERA 1I3OA 4GXRA 1JLMA 2GETA 2SKCA 4K40A 3VKVA 3R7WB 3OLCX 2CHVA 1REQB 4BQPA 5K01A 3N58A 5LQKA 2ZKLA 4BO7A 4EL0A 4S35A 3PJGA 5AW9A 4ARZA 3HA5A 4WLUA 5EIEA 4BMXA 3BWDD 4N48A 1E7WA 1US8A 4KGDA 1ODCA 1U2GA 3R3WA 1WTAA 5A05A 1M8FA 1Z26A 1LDMA 2Z5LA 4BO3A 4D4KA 5LMZA 3F6EX 2V3CC 3T7SA 5IDVA 1XXHA 2E3JA 1IPHA 1AZLA 3RHZA 4FGUA 4OMFG 3AESB 3MHPA 2VL7A 4TMVA 5HGXA 1PTKA 5JXGA 2OFFA 3B6KA 3ZXSA 3NQ41 1NSYA 5DX8A 4E4RA 1MABB 5SICE 1RMTA 3R3UA 1NONA 4CF6A 3BTVA 3NWEA 1FDVA 3S5JA 3JTEA 2MMCA 1HTBA 3MERA 4HLNA 1KO7A 5H1YA 3VDMA 5ES4B 1YQUA 2WD7A 3GUCA 2BRUC 2CVOA 2Z1MA 2PXCA 1K86A 4QU8A 4OHKA 2AHOA 4NV1A 2PDAA 1GOTA 3AOEA 2EXXA 3N8NA 4QXAA 1JA9A 1AKTA 3IAXA 1KR5A 4RHFA 5A4FS 2AOTA 2XLCA 1XEAA 3RK1A 1E77A 2JS7A 3ELYA 4HAZA 1SHUX 1NM5C 2A9FA 4QEDA 3A3YA 3OEEA 3DL7A 1SIOA 2Q2VA 4HQOA 1JT2A 3WLLA 3E4CA 4LXYA 4TVKA 2ARKA 4DY6A 2IXTA 3BFXA 3E58A 4KI7A 1QLWA 4Q3EA 5TPZD 5GVSA 3SZLA 5KOHA 1XRSB 3RAGA 2JIDA 3B89A 1L4LA 3G9QA 3KKKA 2JFZA 5JRZA 5KU7A 1UBUS 2VK8A 3TQOA 4EMSA 1RXWA 3ZWNA 4I5DA 4AJIA 2XTMA 4IQ4A 2Q4BA 1MRNA 1PT8A 2C5EA 3FSGA 2XXJA 3CB2A 1DTWA 2WTMA 1MJGM 4HXFB 1USWA 5BMVF 3UMCA 4XM2A 4D3ZA 4Y1FA 2EWMA 2J6CA 2XUOA 2ZTHA 4EUEA 3ADDA 1FFAA 4ZRMA 4QSMA 4KO3S 3AL3A 2DETA 2DFPA 2ZAIA 1QZTA 1QK3A 1F8FA 1HDIA 1HLGA 3N2GB 2OWEA 3MELA 3AFMA 1P31A 1ZEMA 3H5IA 1J2EA 5JSZA 2ZM6B 4BNTA 1Q1QA 3OJFA 1WJGA 1MW8X 2MJLA 2ZUCA 3SBDA 1RABA 3ZGVA 4XQCA 1OBFO 1ZM3A 2YTZA 3P96A 4CMEC 5J4HA 4EUKA 3BWYA 1E6CA 3FX2A 4TWBA 1T2UA 1YF3A 5KYVA 4E5MA 4H0FA 3T0FA 1X6VA 2VNKA 2IIBA 5KTTA 2NZXA 3QUQA 4NZZA 2V8BA 3UOWA 4B6QA 3AI7A 3F7MA 1CK4A 2RGDA 3EGVA 1B8PA 3GFGA 3IAAA 1WW8A 3JZFA 4FGKA 1PJBA 1HY3A 2FPMA 4LHEA 3NDIA 4RHUA 3OM1A 1LI7A 2QYHA 1IN4A 2ZWMA 5K0TA 2C4MA 1EVQA 2QUAA 5FUBA 1NVUQ 1VPVA 2HHLA 3BE6A 3FB4A 3FUUA 4OXRA 1E9EA 4ZVPA 1JEQB 1Z8NA 3C98A 3PUJA 2P91A 1KVQA 2A14A 4JT9A 3TGLA 2C07A 5CDGA 3SM9A 1JJFA 4DWWA 4MJXA 5EMJA 1UOOA 4TZ6A 2PAAA 3C39A 1DUSA 1ZD1A 3NOQA 2UUAB 4UBIA 4X20A 3VR4A 4BGUA 1MG0A 4DMFA 2GAFA 3OX2A 1UJ6A 1PEKE 2P9ZA 4EF6A 4JNCA 3WP0A 5JLJA 3GVHA 3OQ1A 5AH0A 1T2AA 4BFTA 1GNVA 5BSMA 3ZCQA 2REBA 1B1CA 4AL4A 3UQYS 3IT1A 4ZEMA 1R6TA 1V7CA 3QWIA 3BGSA 3FPGA 2WYOA 1KERA 4H60A 3IIJA 5EIWA 2GAAA 3B53X 4QKQA 1R4NA 4JFAA 4NDZA 1YJQA 3FAKA 2KE5A 4D7AA 1ECJA 3B70A 4Q3OA 3UMJA 2ZR0A 4QNMA 4I50B 2QPOA 3FKSD 3ZNNA 4DGQA 2PVPA 2YXPX 3GMTA 1JFVA 4C5AA 2QL9A 1VQ1A 4I55A 4TV9B 4ZVSA 1ZX1A 5FV7A 4AMVA 5CIYA 4ZVOA 1Y5NA 2UYQA 4HWGA 4K2HA 1TE2A 1ZHHA 2E87A 4HBGA 2BGUA 4HEA1 1V6SA 2QY6A 4LUCA 4PYLA 5B30A 5LQAA 2HNAA 3ZQUA 3MQFA 4PZLA 4XLZA 5CA0A 2QZJA 3NALA 4M6WB 4JZKA 4YJFB 1N5RA 2GAIA 4UZEA 4BNNA 5IJWA 3O8OB 3D3KA 4MW6A 5TGDA 1IJKA 3NKVA 3IEPA 5TXGA 1HRDA 5LA6B 1L5NA 5KS2A 2PWZA 4OX9B 2Y6VA 2WQZA 2WJ3A 5FL7A 4FQ7A 1MOSA 5IWCA 3OUZA 1KP9A 3B60A 2DQSA 3FPEA 4N54A 3EVDA 3BXXA 4IDOA 4M0UA 3LYUA 2OFOA 3QHAA 1XT6A 1WBDA 2OLJA 3E1SA 3FOBA 4FN5A 1TYEB 3TW0A 2C8JA 4PNPA 1Z62A 1L5GB 1NDQA 1JHAA 3UHPA 4QBGB 5BUZA 2R48A 1YOBA 1WMEA 1XHEA 2VSFA 1MXFA 1HZJA 2BM0A 3MSXA 1CS0B 2PUWA 2VH2A 2Z6VA 2OHVA 2ZREA 3A6FA 4PYOA 2CWWA 3DBHA 1Z4OA 5CDHA 5JNLA 3BK1A 4M3NA 1SCUB 2CWDA 1W49A 2VT6A 2N46A 3ND6A 4LJAA 1SCJA 4H1UA 2CBGA 1TZCA 4MWSA 4PLZA 4V0NA 3K6SA 3ILSA 1JJ7A 3HMQA 3OQIA 3PNBA 4TL7A 4WXRA 5ALZA 5BUCA 4U4AA 4QQKA 3ICOA 4QTXA 4ZWNA 2AFHA 1RHRA 3LQKA 2GO7A 4ASUA 3A3PA 5E9WA 1OD6A 3OEWA 2PV7A 2BGGA 3BWXA 1JMVA 4JNKA 5CPBA 1SC9A 1YR7A 3QKTA 4BL5A 1ZCBA 3TFOA 3IO5A 5AW1A 1I6LA 5CXQA 1F4VA 1PF7E 1U5BA 2QP4A 3VAZA 3GWZA 4OUDB 3KSRA 5FYQA 1ODSA 2Q9UA 1JMKC 3DFKA 1GU1A 1ODTC 4LMRA 1Z5NA 4P7KA 4PC3A 3MRSA 2G40A 4Z5XA 4RK7A 3TLMA 5IMBA 1E92A 3IUJA 5CYPA 3BMOA 4GL4A 3DFMA 5FAXA 3DT8A 5DYIA 4H3VA 3GDHA 5EEGA 3H1GA 1DEOA 4NYIQ 5BW5A 1XMVA 3N28A 3R0QA 4ODIA 3E15A 4QVGA 4OB7A 4XXHA 5FNVB 4LE1A 3E3LA 1R8YA 1W2HA 1Z07A 1NX6A 3CLSD 3O3NB 1OAOA 2C94A 4FBLA 4H6WA 4RHTA 2P6MA 4TKVB 4BBPA 3QEKA 4R9RA 2O8DB 4R41A 3BZUA 1NUTA 5I48A 5EWLB 4GR4A 4QGGA 1HYGA 3LZ6A 2ZUWA 1C81A 3KAQA 4YJ3B 3A8TA 4MH0R 4RGVA 4C22A 1KVTA 1IZ7A 4DUGA 3BRWD 1Q17A 5DHSA 3IQIX 4JVLA 4DBZA 4OI0A 4IIXA 3LT0A 3M6LA 3DAOA 4M2LA 4YDSA 1QU3A 2XBUA 3VR1A 2O1WA 5TR9A 1LPPA 2XCLA 2C54A 4QAQA 4B74A 2JJ1A 1QKJA 3D3EA 2IHJA 1XF9A 1Y34E 5EJ8A 1JDZA 4WNAA 4JBXA 5LKAA 3WISA 4B5KA 4NQRA 3OTIA 4BZQA 2FR8C 3GFVA 2F1OA 4S3MA 1EEXB 3CSDA 3FWNA 2VJAA 3ZUGA 4IW3B 1DIGA 2FF5A 2QX7A 2ZLBA 1XA4A 2GJSA 2HCTA 3LW8A 4H59A 2AMYA 2IPAB 4JQZA 4LBVA 4U7FA 5JVDF 3DMYA 4AAYA 1B1AA 3TZKA 4WBNF 4ZYVA 2MINB 2GFIA 5J47A 2G1PA 2AL7A 4NKRA 1UM8A 1MV5A 1GAJA 2OAEA 1E1RD 3A4MA 3LP8A 1SZDA 1U0OC 2P4HX 2Y92A 3R3JA 3STWA 2SCUA 3WSWA 4BFYA 2DSTA 1HT3A 2CZCA 1UAYA 2OT3B 2J3MA 2VSYA 3E4DA 1LUAA 1IIBA 4LJ5A 4MV4A 1U7DA 5B3AA 3GJ3A 3GN1A 3Q10A 2WPDD 1E3JA 2BHTA 3ISTA 4A0SA 2EV9A 2O06A 4IEIA 4RK5A 5ENDA 1MAWA 3HB5X 5DHTA 3UWOA 2ZE8A 4EKIA 1CUIA 4GR5A 1XAGA 1BFKA 3B36A 1GLVA 4RVHA 1ZMXA 4DJJA 2Q3BA 4ALIA 4EHNA 2EZTA 3EGDA 1TYBE 2CHGA 3W5SA 5I5GA 1Q14A 3CVUA 2RIRA 4CM5A 2NM0A 2OO7A 1E2DA 4INJA 3T5CA 2Y68A 3CIOA 4HDMA 3ZH2A 4FLMA 1SHTX 1VJ1A 2Q3HA 3IP8A 4KBYA 4LOAA 2BGIA 3TE7A 4DPKA 4BFZA 4EITA 4LF9B 1JEEA 4UEWA 4RNDB 2IV3A 3NV9A 2R6FA 3E7PA 3E9QA 3HTXA 4C0QC 1WQ1R 1V7ZA 4UZFA 4CDRA 3A9SA 4QDXA 4P34A 4C6TB 4LJ4A 5CDUA 2GKGA 2P30A 4IZOA 4K05A 4NBNA 5KYYA 3CUYA 4MUGA 2MHCA 4ZO6A 4FM9A 2RBGA 2FMKA 1M66A 4UU1A 3SPXA 1K7SN 1EFHA 3A26A 4QUBA 3M5WA 4OKNA 2ZIEA 4UJ5A 3WNDA 4ZGWA 1DDGA 4KXWA 2R4QA 1J7JA 1QGAA 4GLBA 3TK1A 4XM1A 4MZXA 1EBBA 3SKVA 3TTWA 5U9CA 1U4NA 4OB6A 3MTIA 2EHJA 2XYRA 2YXDA 2C29D 2ZBRA 5DOVA 1YAJA 3H7AA 2WINI 4ZGBA 4NCBA 3H18A 1N6KA 2B5OA 2OAP1 3RS9A 2VUSA 2OD2A 1HNXB 2IODA 4FJ2A 2G1UA 4ID9A 1T9CA 4OYRA 4OLHA 5FLXA 2EX4A 1R50A 4YT5A 3SQWA 3WLAA 1EFPB 1RW4A 3GJ6A 1Z29A 2V65A 1VB5A 2I34A 4ICIA 2UYCA 3DVLA 1HG0A 2BPOA 4A0RA 2X2OA 1P19A 2JIQA 4HDNA 4Y1GA 1PD0A 5IK2D 5JQGB 1P61B 4LS3A 3STUA 5J4VA 2ZQYA 4D41A 3SDZA 3I6BA 1G21E 3INTA 4HQ0A 1HLFA 4R9SA 4CEIB 3JD4A 3MC1A 3WGOA 1WKCA 2BHNA 2VPIA 5F12A 1TC1A 2XGMA 1JIJA 3AM5A 3I01M 1XL0A 3TXXA 1BXKA 1JXMA 4KVAA 3VH3A 2YVAA 1MT3A 3DDOA 4YRDA 4DM3A 1FTNA 3FYUC 4RVUA 5JAUA 2Q9AA 3U3KA 1SVIA 3SS8A 1M9NA 4PGHA 4GX0A 5EERA 4DLNA 3GAZA 1XWWA 4GPIB 2IYVA 3RVBA 5K20A 2AJCA 3R5FA 1O0SA 5A6SB 5EE0A 1GP2A 4LWZA 4RSGA 4DMKA 4R69A 1Y81A 2HZ7A 4B7AA 3W4KA 4FJ1A 4ZZ0A 3HUTA 3TUJC 1DI0A 2X40A 4YQYA 2P9HA 3LC7O 3WB2A 3IPAA 3ZD6A 4KHPB 3QSGA 4J9UE 4DMRA 3RODA 3M83A 3W90A 1NA5A 4M37A 3BE4A 4QDTA 1RCFA 5B36A 4TX1A 3SC6A 1D0VA 4TKMA 4X93A 3PP8A 3TO5A 3WGGA 1SKAA 5KMGA 2XXAA 3ROGA 3BXHA 1B0PA 4I9HA 1G63A 4BE7B 2WJGA 5ITZA 5C8YF 4KHZA 3WNBA 4ZARA 4JI1B 2P40A 3BL6A 4E2WA 5FL7D 1XIVA 4KNWA 4J0DA 3VVLA 2PMWB 1UT8A 3M3DA 1RM0A 3MOGA 4EPXA 3DOCA 6REQB 1ZNWA 3RSOA 1ENYA 5AKEA 4ARZB 1DVRA 4LK2A 4CKCA 1O54A 3N7TA 1I7NA 5EYPA 1DGQA 3W1VA 1CUUA 2B4TO 3DD5A 1XCBA 1Y8AA 1ZXXA 2NIPA 3D8HA 4KPUB 4R81A 4U6SA 4S1OA 3W2GA 5EJ7A 1E3EA 4JCOA 5JDIA 4TVOA 5IULC 4IIFA 1ODIA 5EKDA 1HEUA 2V7BA 3P20A 1IZ0A 2FGKA 3KQYA 5COQA 4JXXA 2W11A 3LLCA 1KDOA 1CIPA 3KNZA 1G8FA 1DARA 4ASUD 4YUXA 3K9NA 4M54A 3ZWKA 2DPMA 1DDIA 1QUEA 5C1BA 4ROSA 2WJYA 5FPYA 2H57A 3SQLA 2OOSA 2KQUA 4C9BA 1RJ9B 3Q9SA 1MRZA 2C84A 2LDBA 4IXTA 3ZWDA 4O33A 1UP4A 1UMDB 1F14A 1GT91 1VLJA 3FWYA 2QG9A 3QTBA 3C7CB 5DN9A 5EIHA 2WFZA 2XH8A 1G3RA 4J0CA 3LDGA 3F4KA 3QI7A 3CCBA 6ADHA 1MAHA 2PUEA 1N0WA 5AKGA 1SXHA 4MRMA 4F0JA 3FSEA 4CI0B 1KIAA 2JGFA 2VJMB 4E51A 4KTVE 4O4LB 2LTAA 2O05A 4GRAA 5T4EA 3AL0C 2BGLA 1S96A 1DTSA 3K73O 4M21A 5FWXB 3UB3A 2A5LA 2FJ0A 1VLHA 3AUKA 3CNQS 5THQA 1JQAA 1JLRA 3CZAA 4OGKA 4RHEA 1BS9A 1A5SB 3I6IA 5D5PA 1Y4SA 3TOZA 5JAHA 1H4VB 3BBPA 1G8SA 1NW3A 1Y82A 2X0RA 1NHGA 1VJTA 1YKSA 2H2GA 4TMFA 5JD6A 2GPWA 2QBYB 2YVKA 4EGAA 5I01A 4GUAA 1QHIA 4RNCA 1GM5A 1HE5A 4TOIA 4Z8XA 3SHTA 4DA8A 1ZGZA 3A31A 3DEFA 4GSLA 5AVXA 3UAWA 2GEBA 3IMGA 1L5RA 4XB6B 1JE1A 4ZI7F 5DK4A 1LQUA 5GP1A 4MRPA 1RBZA 2V7UA 3A1NA 3A7DA 1YI8A 1XVTA 2O2GA 4Q9HA 1GRRA 4BNMA 1VSVA 4YXFA 2C2YA 3FE2A 1EQUA 4ND1A 5F64A 2YASA 3VPGA 4WZBE 1KKLA 4ZXPA 1T6XA 2NMVA 2QJOA 2WYHA