4PHFA

Crystal structure of ypt7 covalently modified with gdp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
163
Chain Sequence
NILKVIILGDSGVGKTSLMHRYVNDKYSCTIGADFLTKEVTVDGDKVATMQVWDTGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis,exocytosis
molecule keywords GTP-binding protein YPT7
total genus 46
structure length 163
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phfA00
3GLFB 2XOKD 4TT3A 4OKSA 3RSLA 2XJ4A 3LW8A 4Q4JB 5JFGA 2CCKA 1YRAA 4A6XA 3RHFA 1AGRA 3GP8A 3RSOA 4AYXA 1XMVA 2L0XA 3C41J 3AUXA 3VHXA 1PVOA 3EC2A 3EZ7A 3MWYW 2QBYB 4NMMA 3WY9A 5CM8B 1KY2A 1PLJA 3KX2A 4M53A 3SJZA 2DR3A 1HT2E 2RAPA 3SQWA 2SHKA 1FX0A 3BC1A 2RGBA 5FBWB 4RJLA 2ZRKA 4B2LA 1PZNA 2OESA 1OXXK 1CU1A 3BB1A 1CXZA 621PA 2OLKA 5KNCA 3UG7A 1KNQA 3HR7A 4IOMA 4OQNA 3QNUA 1T8UA 4DDVA 1IBRA 1E9CA 2RHMA 4ZCMA 4P33A 2GJKA 5BN5A 3SJCA 2HYIC 3TH5A 2LWIA 2YWFA 4C7OB 3O8DA 1MR3F 3KQKA 1G16A 1ZYUA 3NBZC 1LS1A 1QHYA 1MT0A 4A9AA 2GCOA 3VR4A 4HUQB 3U3RA 2QBYA 4KYIB 1UKEA 1GNRA 4A15A 2F3RA 5JJKA 1IONA 2ZJZA 2EFDB 2ZQ5A 4YONB 4JBWA 3FDIA 1G1MA 3K0CC 1E2FA 4DCVA 1GNQA 3W90A 2G77B 3LRPA 4PQFA 4TSFD 4YMWA 3KQNA 4C2TA 4B6FA 4TZ0A 3P32A 1P4SA 1DPFA 3AF4A 3QEOA 2GKSA 1SXJD 3IGFA 5FBQB 4WW0A 3J81k 3KXIA 4IVRA 4G5QA 1R0ZA 2BJVA 2WSMA 3SE0A 5B57C 2F9LA 4Q4HA 4LHVA 1ZM9A 4QHTA 1VG1A 1L4YA 4PZYA 3WBKA 4BLQA 2FX3A 4A4DA 4V0OA 1OHHD 2NO9A 1TUEA 1AKEA 5J4LA 3CR7A 3MCAA 2H18A 1GAJA 1L7VC 1QF9A 4RY2A 2OXCA 5FI1B 2ZAMA 1TQ2A 2GCPA 2QI9C 3THXB 1MO5A 4DIEA 4ZKEA 4NCHA 3TUZC 4D80A 1FTNA 4PO9A 3C4JA 3D3QA 4Q4JA 4P4SB 2VF7A 1ESMA 4DIDA 1G6HA 4HDCA 3OFNA 1S1MA 5CIWA 2C98A 2H57A 4QJ3A 5L3SB 5TXGA 1MRSA 3DHWC 1FW6A 1HE8B 1I4DD 2ZVQX 3FMOB 4TL6A 2ORIA 4Q4HB 4LPSA 2CJWA 1KY3A 2O8EB 2CJWB 2PEYA 3C8UA 3CPEA 1AS2A 1H8ED 4JLVA 1YZKA 1Q3TA 1GTVA 1QHIA 2NTYC 4BEBA 2DHRA 1IXZA 3TK1A 5FL7D 5AUNB 5KDOA 2ZSFA 4DRZA 4NZYA 1MO3A 4O2RA 2JIZD 3AGPA 2IX3A 3U5ZB 3G82C 3B7GA 1JXOA 4HLDA 3U3MA 5FPTA 4BFYA 5HZKA 4A82A 3QE0A 3KJGA 3NHBA 1GL6A 3NH6A 3PCRB 5HR5A 4B44A 4WZAE 2K5UA 3TKLA 1XJ0A 5LBIA 3UWOA 2O8BB 3N5CA 1U8YA 1R4AA 1E6CA 2QQEA 1ZIPA 4Q01A 3BJIC 2IXEA 1E0KA 1UADA 2ANCA 1FP6A 1GZSA 2HJVA 2HLDA 3EWSA 4C2UA 4XD7D 1SXJE 5DO9A 4LJ9A 3IQWA 3A6PC 1R0YA 4TLEA 4ARZB 3CKLA 3WNCA 4ZKDA 1ESNA 4UNQA 4MRRA 4NYJR 5FTKA 3RS4A 4WA7A 2ZRMA 2OZEA 4D6PA 2DB3A 3WMEA 4L8GA 2JJ8A 2F1HA 1DOAA 2ZJAA 1NKSA 4LHWA 3AF0A 3SQXA 5JSZA 1W47A 3TMKA 2XSZA 1S2MA 4RD4A 3BFKA 4Y0VA 1W0KA 1JR3A 3H84A 1XMIA 3UANA 1N3BA 3CF6R 2JLSA 4XH9B 2GXSA 2WZQA 2ZE8A 2MMCA 2QGNA 2O0JA 2WWXA 2WPDA 2JIZA 3PUVA 4RD0A 1QZXA 3T06B 3OF5A 3QXXA 5FL7A 1G3RA 1NBMD 4MH0R 3OZXA 4TYYA 3GLFA 1U9IC 2GJ9A 1E9AA 2IUSA 3HWSA 3H1TA 3GLGB 3EIHA 4LBZA 5L3VA 5SZIA 3GJ0A 3BFVA 2IA5A 2CVFA 3LDAA 2RH5A 3QBTA 4AWXA 1GG2A 2IF0A 3AKYA 1QHNA 2OCPA 2EU8A 4TTRA 5JCPA 5AUQA 2QP3A 4BQSA 1W0JA 3CUEF 4M4SA 1Z28A 3THWA 4QL3A 3FHCB 5KUTA 4M1TA 4ZI3A 1UFQA 3SDZA 1R7RA 5IK2A 4Z54A 4PTLA 4ILEA 4BZXA 4FMBB 2ZSAA 2OHFA 3R7WA 2BC9A 4M1WA 3GFOA 1VG8A 3F3YA 4F38A 2C95A 2FH5B 2W58A 5FOVA 5HKKD 1COWA 3AVYA 5EP3A 4YDSA 3RRZA 4DLZA 1S4QA 4G1UC 1S3GA 3VR6A 3WYAA 2J7KA 2QNRA 4RZ3A 5F2EA 3L8YA 2ZXUA 1E0AA 3Q8XB 4ZI2A 5EP4A 3IDQA 3OEHD 2W6JA 4HI0E 3R8FA 1LVGA 5JMTA 2B7CA 1XJCA 2YOGA 3BE4A 5LDDC 4LPKA 5C18A 2VSXA 2ZRGA 1XB2A 4A0GA 1U8AA 2X19A 3PEYA 3MSXA 3VKWA 1JR6A 4B3CA 3ADKA 4LV6A 3CH4B 4TSFA 3AQ4A 4NYIQ 2O8DA 3UATA 1IM2A 3FKSA 5H1YA 4FCWA 4P3YA 4JVNA 1P3JA 1FQJA 4B48A 5F3WB 3T1OA 1GFIA 2GZDA 2CLDX 2CHVA 4QJ5A 4PO1A 1XU4A 1E99A 2WWGA 4Q1CA 3WYGA 1RRPA 1KJZA 1G7TA 1F48A 3LV8A 2KJQA 3SHFA 4C0JA 1T3SA 4RSGA 3TIFA 4KSCA 1XTRA 3ZVMA 1ZMXA 4IW3B 4DSNA 4MKGA 3CLVA 4N0EA 1BKDR 4HAYA 2CL6X 3T12A 1EGAA 1ZC4A 5KNBA 1UDWA 1YZLA 1F6BA 2P6NA 1WBDA 3PUYA 2DY1A 3AH8A 3KJEA 5FTLA 4NCJA 1P60A 4PHFA 4DCSA 1KSJA 1P5ZB 2QMUA 4PC2A 2FU5C 4DXAA 4TLDA 1IXRC 2ONJA 2R6GA 5TB5A 1W4CA 5H68A 2B8WA 4KLZA 1JEEA 4GDFA 4DLTA 3EPHA 2XAUA 1HV8A 1IY2A 1KO7A 3T1VA 1A7JA 4HZUA 1RC8A 3KUCA 3KZ1E 4RCZA 1CR4A 3IHWA 2XOKA 3EPLA 3ZH9B 4UNPA 2CVHA 2F43B 3PEWA 4EKDA 2WM9B 3EAQA 4LV8B 2IUTA 3R9IA 1II0A 5DSZA 4E09A 2A5JA 5FTNA 2ZEJA 2N46A 3Q9LA 3Q72A 4XTCS 2W83A 1KI7A 2QPTA 3U7HB 1CLUA 1E3MA 3OE7D 4O0MA 4IDHA 5J5CA 1VYTA 2AN9A 4QKQA 2YNMA 4GMDA 2QUZA 3W6NA 1RRCA 2RGDA 2W6JD 1ZUNB 3V4FA 2O8EA 1A4RA 1CR0A 1UBFA 4OHVA 4PC7A 3CF2A 1GUAA 2GK7A 3AF1A 3IQXA 1N6IA 3GLIB 2WVJA 1COWD 3AVXA 4HB0A 1GILA 3GQBA 1YZQA 1UPTA 2P5SA 4CYMA 1RFLA 2CE2X 4MRPA 4CGZA 4E22A 1E2IA 2W0SA 5IK2D 1J8MF 4PHHA 4LZZA 1UKZA 5DHFA 2QN6A 4OL0A 5E7JA 4EPYA 3TVDA 4M0LA 3QEJA 3BB4A 5BYJA 2NPFA 1KK3A 3I8XA 3KB2A 4BWYA 1KOFA 2G1KA 4MUAA 2YWGA 4JLMA 5TARA 3IPYA 1S0UA 1T0JB 1ZVQA 3I73A 3VNVA 1WQ1R 1WE2A 2HYDA 2OEPA 2OCYC 1R6BX 2F1IA 3QY0A 2GJAA 4TMVA 4D81A 4B71A 2BMEA 4JT4A 3CNLA 3RRYA 4LX0A 1Z0JA 2A30A 3PUXA 1GSIA 3O8RA 4IEEA 1HQCA 1JR3D 1M1YE 3QKTA 4I1SA 4KYUA 1G4AE 4ASUD 4K8OA 1W7AA 2R8RA 1EESA 1FQKA 1G3IA 2VHCA 3QJYA 2WJIA 4JMPA 4B3FX 1QVRA 3FGNA 4MA4A 5J4YA 1D2MA 4UXHA 3P4YA 2BDTA 3QXJA 3IBGA 2JLXA 4TLBA 3FKQA 3IIJA 3SNHA 2GHIA 4BE7B 4EFNA 4EJSC 1E2GA 1NY5A 4FWTA 2DPXA 3IIMA 2NPIA 2RGAA 2XNDA 2MSCB 3DO6A 4XD7A 4Z8YA 1KIMA 1CJMA 5GJBA 3BOSA 1US8B 2BM1A 3PVSA 4NBSA 4NH0A 3L8ZA 5KDLA 3ADCA 1A2BA 2J5XA 3K09A 1Q21A 4X8HA 3WRXC 1XMSA 3V00A 3AVUA 3GLHE 4TWZA 5CITA 1PUIA 1N6HA 1U9IA 2IBMA 5CJPA 2FOLA 2ZS9A 3B9PA 1ZD1A 3K70B 3QKRB 3D31A 4HDQB 1E32A 1HH4A 1TX4B 5J40A 3FVQA 1D5CA 2EYUA 3VR2A 3QIAA 3KQLA 2GJ8A 4BFSA 4B2PA 2PEZA 1E2NA 4JJKA 1NG9A 4KVGA 4M22A 4LUCA 3QPVA 3ZIAD 1US8A 4FMCB 4A0FA 5H70A 3DOEA 4PAMA 1SVOA 2A9KA 3SJAA 1WA5A 1SVSA 2JDID 2JJ1A 1G18A 4LBYA 2GJSA 1HT1E 1KSFX 2OLJA 3FFBA 4PHGA 1ZNYA 3IEVA 2XX3A 2QAJA 4JLNA 4UQOA 3SHWA 2ZYVX 1XEWX 4KSBA 4DWJA 4US0R 3DPUA 2W2VA 1IXSB 3DVLA 1U0LA 5B58C 2OG2A 3W5JA 3SFZA 4Z1MD 3LQRA 3A36A 1LS6A 1O3YA 4M9QA 4YMSA 4JLKA 4GL2A 2VHTA 3Q3JB 1R0XA 4DLSA 4NONA 5DHAA 1MOZA 5EE5B 1PLKA 4AYWA 1X8KA 1T3LA 3UMFA 4BASA 1E9SA 4B43A 1J2JA 3AF3A 1LTQA 3QBVA 4MYHA 1GRQA 2X77A 4HYYA 3QOFA 1MH1A 2V7QD 4A8JC 3QI2A 4IOLA 2DBYA 4OHXA 1R5BA 3LVQE 4QBHA 2ZSEA 3U7EB 5AWFC 4B74A 3CBQA 2XZLA 1T3HA 1TPZA 2H92A 1FUUA 5SZJA 5SZHB 3HJNA 5JEDA 2Q0HA 2EFEB 2OUKA 4NTZA 5E7IA 2P0EA 3SJBA 4ERNA 5IHPA 2FEMA 2IYRA 4C7OA 1C4OA 1OXUA 2H7VA 3DM5A 4J0QA 4KU4A 1FP7A 4M1SA 2P3SA 4MQBA 4A8JB 1SHZA 3VR3A 2N1BA 4M21A 2CBZA 1IN5A 1SKYE 4YQFA 4IEIA 1FOEB 4US2R 3EW9A 4R2IA 1WB9A 4TZ6A 4D25A 4Q7JB 1OFTA 1DTSA 2H16A 3CH5A 1LV7A 3B8HA 4AKGA 4KI0A 2ZJBA 2I3BA 4LCBA 4OI0A 2J59A 1E2JA 1N0WA 5BN3A 1DVRA 3AM1A 4O25A 1AZTA 2RB4A 3OHMA 421PA 3U6BA 3R9XA 5TMPA 1IN8A 1UBGA 2FEOA 3AGQA 3P27A 4W5WA 4DLWA 4W9MC 4LYAA 3LAWA 3HPRA 4KAXA 3B6EA 2CK3A 1W49A 3FMFA 1FUKA 2XEXA 1ZNZA 3R7WB 3QQ5A 3IO5A 3ZZ0A 1EX6A 4ACAA 2AHOA 3DEFA 3R20A 3X1WA 2YV5A 3UIEA 3IHLA 1J7KA 1OPXA 2XXAA 5C2JB 3KKQA 4EIWA 3B85A 3I62A 4JS0A 5DYGA 3OEED 3B2EA 4BFTA 3VX3A 4Q66C 1F5NA 3T15A 1NVVR 2Q3HA 4XIGS 2QRNA 3WHLA 4B3DA 3K9GA 4CT4B 2GZAA 3GPLA 2W6ID 3W5IA 2Q6TA 4BLOA 4PAQA 3ZVNA 2OFWA 2JGNA 2YVUA 4X8MA 4FXPA 3U4QB 1II8B 2B8TA 3AKCA 1RKBA 4LJ8A 3TQCA 3OAAA 2ZRBA 2GBLA 3SU8A 3IEUA 1ONBA 1XRJA 1JPJA 3E5HA 1DELA 3LH5A 5AUPB 2LCFA 3TBKA 4HAXA 4V0LA 1FZQA 2ZRJA 3TR5A 3EARA 2IYVA 4WZ6A 2YZ2A 1G8YA 1Z6AA 2CL0X 3SR0A 1KK1A 1XF9A 2D2EA 3AV0B 4MDFA 2DWOA 1A5TA 4D4LA 1I4TD 1SZPA 1SXJC 2AR7A 1LB1B 2P2LA 5BQ5A 4Q7MB 1TQ6A 1XEFA 2JLVA 1RIFA 4IFEA 2Z83A 1S1CA 1W36D 4YXWD 5L3SA 4D2IA 2YOHA 1DBSA 2Z0MA 2ZS7A 3DL0A 1G17A 1Q1QA 4HAUA 1E2MA 2OFOA 3QF7A 5CK5A 1CIPA 1EFCA 1SXJB 4LYFA 4B75A 1GRNA 1S96A 1CS4C 1ZCBA 1FX0B 1T6NA 2HDNB 4V02A 1RE0A 3MWJA 1CJUC 1QDEA 2BKEA 1YR6A 2QSZA 1ZAKA 3CRVA 3BD9A 5FOXA 2R6FA 3G5UA 3RC8A 2BBTA 1AA9A 2CL7X 121PA 4K46A 2BM0A 4JLBA 2DFNA 1KI8A 3I1FA 2WWFA 4GRAA 5HE8A 3HDTA 3GLFE 2W0MA 3LO5A 4BEJA 3ADBA 3EPJA 4QFMA 2O8CB 2ZRAA 3THOA 3W6PA 2FMXA 1YU9A 4I4LA 1VCOA 3IPXA 2B6HA 5DN6D 2PCLA 3GMTA 4TQAA 1EX7A 4OJQA 2IK8A 4URVR 5FPYA 4XTRA 3X1ZA 3TUIC 2EYQA 2ZI7A 1N6PA 1X86B 4A8JA 2JLUA 4QOSA 4DZZA 2WICA 1K5GA 4M8NE 3U44A 3KQUA 1UAAA 1SKQA 5CYPA 4LC0A 2IEZA 2OAP1 3KB1A 4U5XA 2IEYA 1NLZA 1D2NA 2FPMA 1KJYA 2EFHB 2PX3A 4C0KA 3I5XA 3X1XA 3RAPR 2XJ9A 4KFUA 1XCPA 3N2EA 1BS1A 4BUJA 2VP9A 5CM9C 5JI3E 5KPJA 3THWB 4D0LB 5HCNA 1A2KC 4CEJB 2D4HA 3A37A 1GL7A 4B32A 1NBME 1EFUA 4HEJA 3V4RA 1XPRA 2V7QA 1Z47A 2GCNA 4NDZA 1Q12A 2GAOA 2WOJA 5EP1A 4BPBA 3BAFA 5H8WA 2VP2A 4XOIA 2BBSA 5L8VA 1AZSC 3W8NA 2JAQA 5FTJA 3U3OA 1E0JA 1JECA 2ZANA 4O3MA 2XXAB 3PUZA 4WIAA 2KI5A 4KO8A 2EFCB 4CT5A 3I3SR 4P4UA 3CPHA 3LLMA 1P6XA 1E1RD 2QL6A 3TE6A 4HUTA 2XB2A 3Q7QA 1MABB 1MABA 3RDPA 3WXMA 2F6RA 4EQ6A 1EFHA 3O47A 5LD2B 2Q3MA 3MWKA 4TQ9A 1A1VA 2JDIA 4TYPA 5EE1A 4L9WA 1KDPA 3KKPA 3BFXA 1NVVQ 4A36A 1OIWA 3CRQA 1HURA 2BMFA 4ZCLA 1Q1ZA 1Z0DA 2V3CC 3C15C 2HV8A 2XTMA 4GPTA 2Z6VA 1N6LA 5LD2C 4Q7LA 1XTJA 1ZIOA 4HDOB 1EFTA 1HEIA 2N42A 2ZAOA 3CNOA 4G5OA 2IYYA 4GOJA 4BFXA 1P9NA 1X8LA 3NHAA 3HP1A 4Z8XA 1CR2A 1WDTA 2VO1A 2WIBA 3K0EA 4ABYA 4C0SA 1OH7A 5KYKA 1KKLA 4I1VA 2C99A 1NN0A 2GESA 3THYB 4MYTA 2HCJB 1LF0A 3I4LA 3CONA 3NVAA 5A4JA 821PA 2G83A 3TW8B 1GWNA 2QAGB 2QEQA 3CRMA 3GEIA 5J47A 4AG5A 3MLEA 2GEUA 1CBUA 2V1UA 2DWQA 3AEZA 2HJGA 5K8LA 1DE0A 3W3AA 3TAUA 2ZRPA 1KMQA 2NOAA 4PSAA 1N5JA 3HPQA 1R5OA 2ZYTX 1ZU4A 3CF0A 3H2YA 4GOKA 4LHZA 4CEIB 1TQDA 5GJVC 2WWWA 4TQUS 1I4LD 1XEWY 2GVDC 1KI6A 4FCTA 2X2FA 3H4MA 4GSYA 2G6BA 4DEYA 3KKOA 2J87A 4LY6A 4EAQA 4KITB 1UKYA 4A2WA 2W2XA 3KKNA 3HYTA 4LYHA 3THXA 1G5RA 2FA9A 2FZ4A 2B7BA 2Q9AA 1LF5A 1OXVA 1MO6A 3Q7PA 1DAFA 1Q0UA 2PH1A 1RRGA 3PENA 2J46A 2OBLA 3EZ6A 1D2EA 2FF7A 2F7SA 3KDSE 3PIRA 1O87A 3S1AB 3TGPA 1TEXA 3SI7A 1OE0A 3KUDA 2JLYA 3B5JA 4B2IA 2JEOA 3BERA 4GBMA 4XVQA 4YC7A 4WXRA 2JLRA 1X1SA 1KO1A 5LB2A 3TUJC 2D7DA 4LI0A 3AVOA 2C8VA 1JI0A 2G0TA 4OHWA 1S9DA 5AJWA 3A58B 2QSYA 4XWKA 4BZQA 2OBMA 3JZMA 4FINA 5F98A 1XXHA 4N3NA 1N0UA 4DLXA 1TL7C 4RD6A 4U7DA 1NP6A 4PZZA 4UNSA 1AN0A 3AKDA 5BYKA 4B3BA 3U60B 2WJGA 1IQPA 4IDOA 2HT1A 3F5FA 4OI2A 1N5KA 3OE7A 4KBGA 5GJWC 3KL4A 3ND9A 4LSGA 4DC9A 3VKGA 1GKYA 1OYWA 2GXQA 5FUXA 1GVNB 3CRRA 4AK9A 2CLCX 1UDXA 2XNSA 5E3HA 2BBOA 2EWVA 2OBNA 1CRQA 2WJYA 3UXMA 3PJRA 3W8RA 3TQFA 2WMOB 2QE7A 1U81A 3LX8A 3T61A 2QT1A 1GOTA 2QZ4A 2OT3B 3FOZA 3KXLA 4M2LA 3E2IA 1OXTA 3B1XA 4R98A 4TLAA 5UKDA 4D4KA 2ANBA 2FG5A 1UBEA 4JZKA 3NH9A 4L5BA 2EFGA 2Z4SA 1BYUA 4DSTA 4N1AA 3EWAA 2BEJA 2YYZA 4DLYA 3E70C 4Q02A 1UEIA 5J4VA 3ZS9A 4PHTA 3LY5A 5AK0A 2GDJA 2FZLA 2QP9X 4JLOA 5A5GA 2OV2A 1N5IA 3SBEA 4TL9A 1KZ7B 3TVTA 4XVUA 2IW3A 2FNAA 5KU1A 3VKHA 1QHGA 2CK3D 4JKIA 3ASYA 4A2QA 4TMXA 1W4AA 1R0WA 2IC5A 2FWRA 4MYCA 1XCMA 2R6DA 1W5TA 1CJTC 2F9MA 4TTQA 4ZDIA 1ZNXA 4BFVA 2GA8A 2J45A 4LRWA 2JJ1D 2XTZA 3I8SA 4II7A 4QBGB 1XD2A 3K09C 2RMKA 2IXFA 1OW3B 2VHUA 4I1OA 1KSHA 3ZYCA 3FKSD 3RRNA 3A1VA 1KI2A 1KI6B 4OHYA 1XDBA 2QGZA 1NVWQ 3BB3A 3B1YA 3B60A 1OFIA 2REOA 1ZW6A 3ZQJA 2BEKA 5AUOB 1E94E 4EPRA 1R8QA 1M7HA 4C0AC 1KMHB 3Q85A 4BFZA 3OEHA 4IKEA 4DCNA 1W46A 2C9YA 1SVKA 1TNDA 1U98A 4MITA 1TF2A 3NKVA 2RCNA 5HKKA 2XNDD 1ZINA 5KNDA 2XTNA 3QSYA 1MKYA 4W5HA 4DT1A 4PO8A 2ZIAA 1E9BA 1FNMA 1P2UA 2FFAA 3A4NA 5JWHA 2A5FA 3RWOA 1NSTA 3CX7A 4GI7A 1Z06A 4D0GA 5CB8A 1WMSA 5L3QB 3GLGA 2C04A 1W0JD 1KSGA 2OAQ1 4FI3C 3SC3A 3KKMA 2J0SA 1Z07A 1XZPA 4DVGA 3BXZA 5JLJA 1H65A 1JEDA 2DYKA 2VL7A 3NDPA 3PG5A 3SEAA 8OHMA 2FSIA 4JVMA 5JHGB 1GRRA 5G40A 4B35A 4OQLA 2GF0A 3ZIAA 2QROA 1GL9B 2GWHA 2IT1A 1F2UB 4Q03A 3DZDA 4WBSA 3TAHA 4NE2A 1T8TA 1R8SA 4L9SA 2O8DB 2QRZA 3MD0A 2QPAA 1G3QA 2AK3A 1OV4A 2O52A 1B23P 1CEEA 1VIAA 1BYIA 5DN6A 2RGNC 4ZDKA 3M4YA 3HU3A 4JBYA 3IO3A 4UJ3A 2FSHA 4Q1BA 2ONKA 2VTKA 3QKRA 1GIAA 5G3YA 1QG4A 1S9HA 3WMGA 2GXUA 1TF5A 2F3TA 1Z29A 2OILA 1Q1BA 5EE9A 1YR7A 5FPHA 4CIDA 2VPPA 4QGGA 2FSFA 3L2OB 5GJCA 1P2VA 1Q20A 2G9NA 5A0FA 5FBRB 4RD1A 1VCMA 3A1SA 2KSQA 2UZ3A 3LQQA 1N6RA 3LVRE 1PLLA 4OK6A 2ZVPX 4YXWA 2Z4RA 2ZU0C 2C96A 1U0HC 4FMCF 1KI4A 1JJVA 4EFMA 3GD7A 3L0OA 4R7ZA 3HR8A 2D7CA 2ODBA 4US1R 1YKSA 3U61B 4KLNA 1FNNA 3C5CA 1KYIA 3KFVA 1ZC3A 3I61A 4JSYA 5IT5A 1AKYA 2ODEA 3MJRA 5JRJA 4AKHA 2PMKA 1T4GA 2MMGA 4FN5A 3AVWA 2X8AA 4JVLA 4V0NA 3X1DA 5B30A 1N2CE 3LW7A 1NI3A 4K81B 1C9KA 3P20A 1ETUA 1XXHB 3JVVA 2ZPTX 2EQBA 5DIFA 2WJVA 4JYCA 2AWNA 2CDNA 2UKDA 3KXKA 5JJLA 3UKDA 2KWIA 2QY9A 4YDHB 1Z0FA 1NF3A 1QG2A 2AXPA 1MV5A 4G01B 4P31A 3CX8A 1SHKA 5G3ZA 1ZJ6A 4B33A 1NNEA 5KPDA 3CRW1 5B2ZA 4ZDWA 4DDTA 1QHXA 3EC1A 4MGKR 1E9DA 4Q1EA 1T9HA 3JZAA 5CK4A 1BO6A 1Z6XA 1EWRA 5KSOA 2R2AA 1IY0A 1DG1G 2JATA 4M1MA 3VQTA 1D9XA 1AQYA 2VIIA 3K0SA 2LKCA 2QT0A 2VHJA 4AURA 4MGYR 1CTQA 3Q5DA 1SVLA 3MRSA 2F1RA 4CEHB 2V55B 4LOAA 1N6KA 1OLOA 3VMFA 5JSZB 2ZRLA 4P0TA 1NRJB 2WWIA 2NO7A 4OQMA 4TYWA 2HT6A 1ZUIA 4B47A 5EXSA 1VMAA 1IY1A 2LKDA 3FPAA 2QMOA 1G7SA 3IUYA 1KNXA 1F60A 3M6AA 1KK0A 2WKRA 5FBLB 4PFSA 1IJFA 4MRVA 4RD3A 2GEDA 3EIQA 1EG7A 1I2DA 4WZBE 5FL3A 1DG3A 3RANA 4YMTA 2PZGA 5DYIA 1Z6GA 2C5LA 2RGEA 4F7WA 4G5RA 1YZGA 3NBYC 3BGWA 3KFXA 1TADA 4GZMA 4S2EA 2O8BA 1G64A 1E4VA 3WP1B 4TMWA 4E5UA 1XEXB 1D9ZA 1XEXA 3BBPA 3L0PA 2GXAA 4XJXA 1G5TA 3HYRA 2PX0A 4LYJA 4Q19A 2AD1A 1Y63A 5JWOA 1XMJA 2GBLC 3KJIA 3DOFA 3U44B 3K53A 4NCNA 4C0BA 1NMXA 3EX7C 4EPXA 1G4UR 2VF8A 2BMDA 2QMHA 3VR5A 4DLVA 2IYTA 2V1XA 3EZ9A 2ZI4A 5KO2A 2EW1A 2ZU6A 4URYR 3B82A 2ZR9A 5BWMA 3W9YA 1SVMA 3MWLA 3GFPA 3K9HA 4IVPA 2AK2A 3KJHA 3DMNA 3E1SA 1RJ9A 4BFWA 1M7BA 1YRBA 5JRZA 3ZD6A 1KGDA 3K1JA 3PEUA 2Q9CA 2IWHA 3AP2A 2W2TA 4F4CA 3BORA 2HEIA 3GJ3A 4Y0AA 4QBFA 3RNLA 3WNBA 4PZLA 4CW7A 2IL1A 2PZFA 3LX5A 1TF7A 2VA8A 4M9XA 1LY1A 2QA5A 3K0FA 4URZR 1NIPA 2Z43A 4MYUA 4GP7A 5C1BA 3K70D 2W00A 4JSTA 1QRAA 3U2QA 3B78A 4LHYA 1HY3A 3K0CA 2J3EA 1P2SA 1E9EA 2O0HA 3GEEA 3A1UA 1RW4A 3QVVA 1SGWA 2WJHA 2P65A 1ZBDA 1WXQA 521PA 3B1ZA 4KFTA 1VPLA 4F4IA 1XTIA 3KTAB 5C4GB 3AF2A 1XFAA 3ECCA 1JAHA 3C14C 4KV9A 2XITA 1KI9A 3FE2A 2FGKA 2GCOB 2VLIA 4QJ4A 4U00A 3U3KA 2PT7A 1KO5A 1DAGA 3C16C 4C4PA 2G3YA 1VDZA 4EFLA 2PLFA 4BLRA 4MGZR 4JL8A 1VTKA 5CYOA 5KOYA 1TTTA 5FPKA 4ZIRB 2ZETA 3EA0A 1OXSC 3JVUA 2PJZA 2ZJ5A 2HXYA 1IN6A 3AVQA 1N6NA 4ARZA 1HYQA 2Y8EA 3W3ZB 2PCJA 4Q9LA 1W0KD 3O8BA 2YINC 5EUQB 5FUVA 2A2ZA 2XSZD 2WJJA 1KTVA 2QU8A 1G291 4OK5A 2QG6A 3CO5A 2OCBA 4F93B 4JIMA 3I5YA 4RCYA 2ERYA 2E9SA 2NZJA 4KVAA 4QNRA 3RS7A 2CNWD 1VHLA 1L8QA 2DFKB 3RYTC 5KDDA 1CF4A 3CWQA 2VSFA 2A5YB 4B3GA 4V0KA 1HE1C 3CNNA 3D6TB 3ZVRA 3MG9A 1FL9A 3NC1C 3PFIA 1FMJA 4AC9A 1F2UA 2G1JA 3MUFA 2HLDD 3NG1A 5DGXA 2ZROA 1JNYA 2Q9BA 3SYNA 3GJXC 4PPNA 4C9BA 1KDTA 3LFUA 4H1VA 4OQXA 3BH6A 2ZRDA 2EWWA 2RGGA 1T5LA 4QGFA 2GVZC 2P67A 2ZRHA 3VU9A 4LHXA 1G8FA 4PANA 5HZHA 1EWQA 2VQSA 3TR0A 1Z63A 1TEVA 4LJ6A 2WTUA 2JLWA 1R5NA 1E2LA 1P9WA 5FI0B 3QPWA 4H9GA 3ICQB 2J41A 3ND8A 1OFUX 1P72A 4MUBA 2IYLD 2J1LA 4Q9JA 4BLSA 2ZUCA 5AJZA 1QHHA 4OI4A 3ZZUA 1MRNA 1YR8A 4DT1B 3MFYA 3P4XA 4R71A 1JQJC 5EZ5A 4UNRA 4OI1A 1P73A 3TJZA 3NDBB 4D4MA 3D8BA 4DUGA 4HLQB 3TLXA 3N2IA 2VH5R 1DO0A 1ZNWA 2UVQA 2NIPA 1GNPA 2QTHA 3PUWA 4HB4A 4RKFA 1NY6A 4DCUA 4LJ7A 1CJVC 2CCJA 4ZV4A 2ZITA 4NP6A 3QUSA 4RFSB 5FTMA 4F92B 3UMSA 4GP6A 1U90A 2C03A 2H17A 3FYHA 1OJLA 4LDJA 1QHSA 4M1KA 5DH9A 4ITRC 4V03A 1UM8A 4IXMA 1TQ4A 4EPTA 4C30A 2Q21A 1H8HD 3U7FB 4HUQA 1JPNA 5KTYA 1H8HA 4OK3A 5JI2E 5KSPA 1OHHA 1CP2A 1Z6YA 4POAA 1JALA 4TMZA 1VG9B 2VP0A 1M8PA 3VU9B 3NEJA 3VNUA 4LJAA 1F2TA 1T91A 2VEDA 1G3MA 2ZRFA 4LV5B 4MDEA 2V9PA 3GJ7A 4FW9A 4P32A 4CEIA 2IYQA 3QPUA 4A6PA 4DUGD 3LXXA 2JLZA 2YC2C 2QP4A 3IBYA 1YJ5A 3R8CA 4Z51A 5K8UA 4FMDF 3ZDQA 1KI3A 2AX4A 1XD2B 2ODNA 5L3RA 1T5IA 2F43A 1XTSA 1NSFA 4FIDA 4RD2A 3ZVLA 4DEXA 3U6KA 1P61B 4N0DA 1VYVA 3LNCA 5HCIA 3L0IB 3D7MA 4NCIA 4LBVA 1IOZA 5EXPA 4EJSA 4JVSB 3EIEA 1WBBA 4QG7A 4BGDA 4Q9KA 5E95A 4DKXA 5FR1A 5F9HA 3UG6A 3NTUA 221PA 5D3QA 2YOFA 2H5EA 2CEAA 2IUUA 5TVKA 3SBDA 4A0RA 4DBLC 4JYBA 2VHQA 4M1YA 3NC0C 2RKOA 2V6JA 5HTKA 2V6IA 2QTFA 2WOOA 2O0KA 5M04A 1AM4D 2REBA 2ZYWX 4H1UA 2B92A 1Z22A 3SYLA 3L82B 3UWKA 3WHKA 1PV4A 4P4SA 1W4BA 4RKEA 3T35A 2YJTD 2BVNA 4UNNA 1E2DA 1OIVA 4YMVA 3WYFA 1NN5A 2GEVA 3WP0A 1FTSA 2QM8A 3DDCA 5LB4A 3ADDA 3K0AB 1P75A 2ZI3A 1NBMA 2WSSA 4DCTA 1GKIA 4HB3A 2REXB 5EXXA 3GJ4A 2WPDD 2EVWX 5AJVB 4IJMA 4Q21A 1XPUA 3QENA 4DLRA 4DSOA 1X3SA 2UZIR 2AL7A 1IN4A 4BRWA 2DFLA 3GFTA 4MKIA 4JLPA 2GETA 5FH9A 4NYJQ 4QGHA 4LGMA 3RS0A 3BH7A 4LJYA 1GKUB 2XGJA 1J8YF 4PR0A 4URUR 3EPKA 1G5PA 1W1WA 2KE5A 1GP2A 3B13B 4CRWB 3VR1A 1SVWA 2VP5A 2WWHA 5JWRA 4UXIA 1IN7A 4QXAA 4Q9IA 5EE3A 1W48A 1AQUA 5FPSA 4HSEA 2ODWA 4JJZA 2V4ZA 3HU1A 4JBXA 1JJ7A 4WAUA 3T5GA 3TSZA 1ZM2A 1E9RA 5P21A 1G20E 2E87A 2ZJYA 4LJ4A 1EK0A 1G19A 1Z3IX 3G0HA 4AKEA 3AVVA 5EUMA 1JBKA 2NGRA 4R2HA 4BZPA 2QENA 5K8IA 4QBIA 5JBQA 1M6NA 3RRMA 1ZUHA 4HATA 4HB2A 4WVFA 1OFHA 1KDRA 2CMKA 4DLUA 2G0NA 4B3XA 1YZUA 4IDNA 4AG6A 3AB3A 2NMVA 1R10A 4BLTA 3ETLA 4OHZA 2D3WA 4PSKA 4CDGA 4JLAA 2FJUA 3M1IA 4DB4A 5BW8A 1YHNA 1QHHB 1G8GA 1Z5ZA 4ON9A 2GAAA 1H8EA 3RC3A 1OKKD 2ZSDA 2ZTSA 2DFTA 3PITA 2DCUA 1XP8A 5KSYA 5DLQC 3OIUA 2AKAB 2ZJ2A 1ANKA 2TMKA 1P7CA 2CHGA 4RVCA 5EZ6B 4IVQA 1SKYB 3OFND 2OFXA 2F55A 1E1RA 2J0UB 2P5TB 3CX6A 2IS6A 3CR8A 4IXNA 4TTPA 4RFSA 1Z0KA 2ATVA 2I4IA 4B34A 4HZIA 3AP1A 1JR3E 4MRSA 5AJYA 5B64A 3K9NA 2I1QA 2P6RA 1WF3A 4ESVA 4QHSA 4XWOA 2D06A 2NO0A 4JL6A 4G5GA 4XWAA 3BIFA 3EZFA 4IDQA 1G41A 4IHQA 4NYIR 1N0VC 2NQ2C 2JCSA 2OE2A 3W6OA 3RLFA 2AFHE 3QKUA 1V43A 1T0HB 1XCGB 2YWEA 3Q5EA 1RPZA 1ELOA 4Q18A 1KAOA 1V5WA 4Q1FA 3EG5A 1RYHA 3BK7A 5CLQA 1BIFA 3FMIA 3FMPB 1SXJA 5KHOC 4BLPA 4TYNA 1CRPA 2CE7A 4D0NA 1E96A 1K8RA 2BIFA 2ZYUX 1PJRA 4PPQA 2QE7D 5J4HA 1DAKA 3OIYA 4OQFA 2C2HA 1E1QD 3LXRA 3F0TA 5C46F 1XZQA 2QQ0A 3FB4A 1X1RA 3B9QA 3R9WA 2FE4A 4FMDB 3RS3A 5E4FA 1LFDB 3WNDA 3CWZA 1VKJA 5EE0A 2YKGA 1NVXQ 2WWYA 1VIYA 4QNMA 1VG0B 1NMZA 3NXSA 3DMDA 2BJWA 1J70A 1E2KA 3AUYA 1M74A 1WP9A 1DAMA 2AXNA 1J99A 2C9OA 2C9CA 3TRFA 4CEHA 2D62A 4W7SA 1Z0AA 1II8A 2JJ2D 4G3XA 1WCV1 3B1VA 1OH8A 2IS4A 2R6AA 3FFAA 4IFBA 1AJEA 3T1TA 4LC1A 4AY2A 3BWDD 1OB2A 1GM5A 1U8ZA 4C0HA 4A1FA 4PQRA 5JEEA 2FFHA 2ZSBA 4Q1AA 2FN4A 4KHZA 2MSEB 4EPWA 5CDFE 4HLCA 1TAGA 3X1YA 2GK6A 1M2OB 2FV8A 2H8KA 1GITA 1KDOA 5EJEA 2IS1A 4QGAA 1BMFD 1DS6A 3QXSA 4AYTA 2V8OA 4OJKA 2IF2A 4FD2A 3FTQA 1DEKA 1S3SA 2J7PA 4TT3D 1G8HA 3MJHA 3QKSB 2NO6A 4X8LA 4E03A 3CW2A 1NKTA 4EQ6B 2CXXA 5IF9A 5SZKB 4C0QC 4LK2A 5FR2A 1YZTA 2ZRNA 3RS5A 1AK2A 3MGCA 4I81A 1E4YA 3OAAD 4JKYA 5D3MA 5D3MB 2GRJA 4XSGA 4MKFA 5EP2A 5CDFA 1G6OA 1BMFA 3LD9A 6Q21A 4KBFA 5ELXA 1UBCA 2IYZA 1JB1A 1PUJA 2CCGA 3EZ2A 1S8FA 1EFRD 3K9LA 2BCGY 2BHRA 4NL4H 3T5DA 4KCGA 2XZPA 4NCKA 1W36C 5LPNA 1FFHA 5DE3A 1TUIA 2ZR0A 2QMEA 2WKPA 5CJ2A 5EQTA 3H86A 3LBHA 4TL8A 4BFUA 4URXR 1E2PA 2QTVB 1E69A 2JASA 2KB0A 3FWYA 3REFA 1RRFA 4D26A 1A82A 5FUYA 5F9FA 1VCNA 4QC2A 4P4TA 1OF1A 1E98A 4DDWA 4M1OA 3U4QA 2ZS8A 2VRWA 2XZOA 1E0SA 1WRBA 1P62B 2AKYA 3CZQA 4ESHA 1Q22A 1F3OA 1VECA 2VBCA 1B0UA 1SQ5A 4HLUC 1DAEA 4Q47A 5DNYB 3CIOA 1DARA 2ZUBA 1UEJA 2H1LA 1OT3A 3CM0A 2IYXA 3GLIE 1E2HA 3P26A 2YWHA 2QAGC 4GFDA 2IYWA 3K0AA 4DHEA 2PT5A 5TV2A 4LWZA 1Z2CA 2WIAA 2BBWA 1RVDA 1TMKA 1N25A 1U99A 3O8CA 1NN1A 1M34E 3ICEA 1OYYA 3I92A 1AS3A 3NBFA 1E79A 1ZCAA 3ZLJA 3GJ8A 2ZI6A 4AIIA 2C78A 4B76A 5G53C 1TU4A 4JT2A 3P1JA 3IIKA 4PPFA 4OBEA 5DISB 1D6JA 1OIXA 2PZEA 4GT1A 2ATXA 3LWNA 2NZ8A 3SOPA 3WBJA 5JHHB 3GLHB 3F8TA 2D74A 3TSWA 4GMXA 5FFMA 3ZQ6A 2IYUA 4GOXA 2HUPA 2O8CA 3AP3A 2ECKA 2J0UA 1OSNA 1RZ3A 1W2GA 1ZD8A 4EJSB 3GEHA 5BN4A 1W2HA 2ORVA 2WHXA 3A1TA 3ZS8A 4JL5A 5FBVB 4A92A 2CLSA 4ACBA 1JAIA 3EA5A 3CPJB 4FWIB 4Q4LA 3BRWD 4Q9HA 1CR1A 2R44A 3K8YA 4IRUB 4U02A 4PQYA 4L15A 2A7QA 5KSZA 5CLLA 2MSDB 2QM7A 1YQTA 5FOTA 2PL3A 1Z83A 4YMUA 3EASA 5IDVA 1E9FA 4NPHA 2HXSA 4KODA 1QBKC 1N6OA 3K70C 3U7GA 2IWRA 3SFVA 4I99A 4MRNA 2BWJA 4RZXA 5FUWA 4MKHA 1KHTA 2ZJOA 2WV9A 5EXTA 4HAZA 4XSHA 4MGIR 4QM7A 4TL7A 4ZPXA 4YLGA 4Q4AA 1SVIA 2KBEA 3KQHA 1YVDA 4R9UC 2V54A 3I72A 1FPMA 2R65A 4PC6A 2ZM5A 4ZDJA 2BMJA 1E2QA 1TU3A 1G8PA 3B1WA 1Q3HA 5JCZA 1ODFA 5HE9A 1XWIA 3EXAA 3LLUA 1DAIA 1NN3A 3AVTA 1NJGA 1SULA 2NG1A 3PEVA 1EFRA 4PX9A 1K6MA 1G7RA 1F2TB 1OB5A 2VP4A 2E1RA 1Z08A 3LA6A 2ZE5A 1E79D 2D2FA 1VCIA 2C77A 3THYA 4TMKA 1U2RA 2A5GA 5TDHA 1NLFA 4X8OA 4WOPA 2CHQA 5JECA 2FDCA 2A78A 3OESA 3VAAA 4PPGA 4QM6A 3A4MA 5GADl 4NHOA 3C5HA 2VSOA 2IHYA 4CF7A 1QVAA 3DZ8A 4A0HA 1ZRHA 2FPKA 3SS8A 1G7CA 3TSOA 1XTQA 2R6CA 5C4MA 1KZGB 4HLUA 4EPVA 2J7PD 1KMHA 3IKJA 1L2TA 4BRUA 1K5DA 1W36B 2OM2A 2ZREA 2QAGA 5CIQA 3QG5A 1NL3A 3WRYC 1KI1A 2A5DA 4HAVA 3S1AA 4GZLA 3PXGA 4RZUA 2PLRA 3ZZTA 2X2EA 2AD5A 4JLDA 4XVRA 1KJWA 1HQYE 5GVSA 4G0NA 1GDDA 4HAWA 4DSUA 2AWOA 2RGXA 4RZ2A 1ZP6A 2Q3FA 1VHTA 1Z0IA 1ZM4A 4JLJA 2ZI9A 1HA3A 1ZM7A 2JJ2A 2ASEA 2HF8A 3L0SA 4EDHA 5CB6A 1Q57A 1YZNA 1Z6TA 2WBLC 1X6VA 2ZJ8A 3MAAC 3NEYA 2GILA 2ZUDA 5AJXA 4DDUA 1N5LA 4TYQA 1KAGA 2OXRA 4B6EA 2FGJA 3H0KA 1XX6A 3NIBA 4V0ME 1W5SA 1VYUA 2VP6A 4UXJA 1NVUQ 4PC3A 721PA 2BKUA 1UKVY 4TLCA 3SZRA 1W4RA 4M9ZA 1E1QA 1CULC 3HU2A 2OO7A 1KO8A 2DWPA 3REGA 1Q44A 3BH0A 3W34A 2FFQA 3QF4B 1DAHA 4W5JA 3RWMB 5JS7A 2GNOA 4AD8A 3GCGA 1YR9A 2WAYA 2PBRA 4GNKA 5AR1A 1NJFA 3UK6A 2W6IA 3AVPA 2ZE6A 2QPOA 4PSVA 1G3UA 4IOKA 2HF9A 3SN6A 1XPOA 3FHTA 2R9VA 1XD9A 4NKRA 3C7KA 3OEEA 3OIVA 1KK2A 4V0MA 4EUNA 2X1VA 4C3ZA 2GTPA 3PR1A 4DB2A 5ANRB 4C0LA 2YHSA 1MO4A 3RS2A 2XB4A 4FCVA 2QORA 1P9RA 4LBWA 5JS8A 4Z1MA 3VX4A 2BCJQ 5IRCD 3PQCA 1NLYA 2ERXA 4QHYA 1E2EA 1HTWA 2A3RA 2G88A 3QF4A 5G41A 3WMFA 5L3QA 4O2LA 5JZVA 1AIPA 2RGCA 1IJEA 4HZUB 2OSBA 1HUQA 3QXCA 3ZJYA 1AS0A 4F4JA 4A2PA 2R62A 1OKKA 2P6UA 3ONWA 2RGNA 2HCBA 2IHBA 5TY0A 1J90A 1R2QA 3SYKA 1EXMA 2PMDA 3AKEA 1XD8A 2WKQA 4KXFB 4CZ2A 4PAOA 1XJQA 3GLGE 4F91B 4ZIRA 4TMTA 4IOJA 4UKDA 1Q1EA 3RVBA 1Y3AA 2I1VB 4I1UA 4Q5IA 1BOFA 1G21E 3LBNA 3DKPA 2J0VA 3ZGXA 1W44A 4OYHA 4Q4AB 3RABA 4B73A 2FFBA 3CZPA 1X8JA 2O8FA 3GLIA 3M0EA 2ZRCA 4TN1A 1AGPA 1U94A 2FSGA 3QKSA 4WXPA 2FPLA 1OH6A 3L43A 5FOUA 5E7MA 3CB4A 3GLHA 2ORWA 2OCAA 3X2SA 1G9XA 3DKVA 3U3JA 2IS2A 2CNWA 3QG1A 2VYFA 3A1WA 4Q00A 4Q7KA 4KFRA 5DI9A 3PV0A 3QXHA 2PJRA 4D82A 4URWR 1DADA 1UF9A 4ASUA 4BECA 2BV3A 4KFSA 5GVRA 5J4KA 4CEJA 1KKMA 3VFDA 2JA1A 4PC1A 2BOVA 2J0QA 2AFIE 3N70A 2Z5FA 1KO4A 3GJ5A 4Q1DA 2GZHA 1OH5A 4AI6A 1L4UA 1XXHE 2O8FB 4IDPA 1BH2A 3ZD7A 2WSSD 5K8TA 2YC4C 1I2MA 1C1YA 1XNJA 2IYSA 4DJTA 2O5VA 3UMRA 3A4LA 3K0FB 2NO1A 1XTKA 1P2TA 3KTAA 4ZO4A 1RYFA 3V9PA 1FMLA 2ZI5A 1NIJA 1U0JA 4D4JA 4L16A 4LJ5A 3T1QA 4UJ5A 5JJIA 4RFVA 1ZU5A 4E07A 1XBTA 2WMNB 2ZE7A 5FOWA 4NU0A 1D8TA 1CKEA 3I32A 1M7GA 3NWJA 4NYMQ 2ZR7A 3QVUA 3VTKA 1II9A 3ASZA 3TW4A 4G5SA 2F1JA 1NG1A 5DI3A 3UPUA 4L4UA 4AKIA 5DI3B 4QRHA 1IAQA 3DM9B 1YE8A 1Z2AA 3GJ6A 4NYMR 1UJ2A 5BXQC 4ZCIA 5FOSA 1ZD9A 1NMYA 3NBXX 3MMPA 4S35A 3LBIA 5HPYB 2J9RA 3FHOA 4M9SA 1Z8FA 2GF9A 2WAXA 1IHUA 1JQLB 3BS4A 4KJZA 4PXAA 1ZM3A 3VHLB 2JLQA 3IILA 1LW7A 4Q48A 3TNFA 3OIWA 4CVNA 1RJ9B 3T34A 2ZRIA 1CJKC 1DO2A 2KBFA 1JXMA 2RHDA 2B21A 1LNZA 2IXGA 3A8TA
chains in the Genus database with same CATH superfamily
1J2TA 1SELA 2XOKD 3DUFA 2YV3A 3RSLA 4EUEA 2G82A 1VFPA 1Q95A 5K3DA 4AJNA 5JFGA 1XLTC 2CCKA 1H66A 4A6XA 4BE9A 3VC7A 2XUOA 2P62A 5K2MA 5CA0B 3MB5A 3SMQA 3GP8A 1DC4A 4IXWA 3D0KA 1HQDA 4H3KB 3OA0A 5FCDA 2Z2YA 3IQIX 4MK4A 4YCLA 1PVOA 3ZE2B 5DEOA 8LDHA 2D1SA 2HSDA 3DHVA 4NMMA 3VR5D 5JNVA 5ECGC 1NYLA 3O7WA 4JR2A 1PLJA 4BV2A 2HCTA 3WC4A 3EOAI 1HT2E 2FRDC 4U0KA 2XV1A 2BGLA 1EHCA 3LMKA 4FSDA 1LPAB 5C8YF 3TPFA 5FBWB 4M0MA 3LK7A 4Z53A 3C6QA 2ZRKA 3MOIA 4R0MA 1P2BA 4HEHA 4AQYB 1CU1A 1CXZA 621PA 2PSSA 3QOXA 3AM3A 1KNQA 5CFNA 3CW8X 2QTTA 1UM9A 1T8UA 4EYKA 4DDVA 1EJ0A 1PR6A 2P2ZA 3UXHA 1E9VA 3P7MA 2XUPA 2Z9DA 1GT6A 3B51X 5A5VA 1YQUA 2BFFA 3SJCA 2YNMD 4TVBA 1XROA 2VKTA 3FJYA 1FA9A 3AYZB 3OVMA 5K6AC 2D1YA 3KQKA 3A1DA 4R1LA 3WKDA 4GP9A 1RI4A 5BSKA 5HQTA 1UK8A 3U3RA 1SQGA 1CUSA 2ZM6B 2QTAA 4KYIB 1K2WA 2BEWA 4JJ8A 1L5WA 1U2DA 3B2NA 1WB5A 1CP3A 1IONA 1QO9A 1ZGBA 2F9FA 2EFDB 2PG3A 4L2IA 4LK3A 4YONB 4L95C 2YX1A 4RPHA 2X5OA 3K0CC 4IJWA 5LMNB 1GNTA 3ZE8A 3TX6A 2PXCA 2DSTA 2C5GA 4IZIA 2BFFB 5HJEA 4TZ0A 3D3NA 3QEOA 3RUAA 3AF4A 1PRYA 2RK3A 2VHEA 4FJ1A 2K2WA 4D8VA 1SXJD 2VCHA 3OZTA 4OBXA 4YGYA 3AJRA 2OD2A 4RLFA 2Z8XA 3KXIA 5HFAA 2OZLB 1MB2A 4RY0A 4K2AA 1UPCA 1V71A 2JGRA 4Q4HA 4F5YA 1F12A 7MDHA 1AZWA 5L6MB 4LY9A 5I7AA 5BP7A 1YB4A 3PE4A 1SVNA 1HTTA 1Z34A 3WBKA 3AIMA 3QP9A 2YY7A 5FO0A 4GBJA 4P54A 3UT6A 4A4DA 3AG6A 3RASA 5I4KA 4RTQA 1OHHD 2NO9A 3H0EA 1AKEA 2V4MA 3L49A 1BE8A 3CR7A 4EGQA 4D79A 2Y1CA 2H18A 1GAJA 1L7VC 1QF9A 2OMEA 5F76A 5GV7A 2OXCA 3WICA 2I7DA 3AINA 1SCUB 2RONA 1K89A 1QGDA 4NU8X 1QAOA 4P82A 4ZKEA 2ZWVA 4Q3DA 1FFBA 2EW8A 5T3UA 1QCZA 3L46A 3UWSA 4P4SB 4AN4A 4GLOA 2JFNA 1GPKA 4EHAA 2VHZA 4HDCA 4G86A 3OFNA 1P1RA 1YFJA 1S1MA 3F47A 4FGKA 5CIWA 2C98A 1Y37A 2H57A 3I4CA 3PFFA 5TXGA 4QJ3A 5EIBD 4B87A 1MRSA 1V6AA 2HA4A 2BEVB 4X62B 4DR1B 1I4DD 3S2IA 2ORIA 3WMXA 4LPSA 4AMYA 2O8EB 3GAAA 1AS2A 1C80A 1YZKA 2YCLA 5KDOA 2DHRA 3ZWXA 1O94D 4FEAA 4MVCA 4HVAA 4MZXA 4KDEA 5CXSA 3D5QA 2BI8A 3Q11A 5FL7D 5SY4A 3DZIA 4CCYA 2QRMA 3WB0A 1JG4A 1GU1A 1HDEA 1Y82A 1VRVA 2C82A 2H4XA 1IPFA 2VDPB 2ZWOA 4MZDA 4ZJUA 4ZQEA 5TQVA 2C7VA 3KJGA 9LDTA 3WLLA 1M2KA 5HR5A 4B44A 2YJ3A 3FZQA 3VTFA 5JYCA 2VPXA 3TKLA 3EH1A 5KHAA 4B4WA 1SKAA 2F00A 1LRJA 1NW8A 4HRXA 5LLTA 1XCBA 4IUDS 2W48A 4EQZA 1JPUA 1ZIPA 2QZPA 2A9JA 3OJEA 3QVGB 2IXEA 3MVEA 1UADA 1UMDA 4GI1A 4B80A 2BFBA 3M6MD 5F9MA 2O20A 4AJ9A 2G25A 3ISJA 3KQOA 4CQMB 3A6PC 1FRNA 1IE3A 2Q1TA 3R7LA 3WWEA 2H2WA 1Z6ZA 4ARZB 4IY1A 4Y2TA 3PHCA 1ESNA 2ISQA 4UNQA 3RCBA 1I3NA 4MRRA 4RELA 3NHSA 5FTKA 3RS4A 5FEUA 4TT8A 4M0CA 1KGSA 3V8QA 4AMUA 4L8GA 4C20A 3TDMA 2JJ8A 3T5BA 1PS8A 4LHWA 3BQNB 5LKRA 4F45A 2Q6IA 3GFGA 4Z7QB 5JSZA 3OKFA 4WLFA 3ZCRA 2X0DA 5ERGB 5KYTA 1JR3A 5A4AA 3H84A 3HBMA 5HZGA 4GXQA 2EEPA 1V95A 3AB7A 5FA6A 3A6EA 3DEIA 2BFCA 2I99A 5H82A 2MMCA 4OXRA 4B46A 2X3UA 2PKYX 2JIZA 3PUVA 4XDZA 2QJOA 5AT1A 4BVAA 2FWPA 3EQZA 3T06B 3OF5A 3A7EA 2G40A 2GZ1A 4FYPA 2HLNA 4CIWA 2BLNA 4YJDA 3AETA 3ICVA 2FR1A 3G8CA 1A69A 3H1TA 3HWSA 3MMSA 4FEYA 3ED5A 2Q0XA 3GJ0A 5DT9A 3BFVA 2IA5A 3QBTA 3QPBA 3A6LA 2ZPAA 1MX5A 1PR0A 5EJ2A 5K6TA 1U0BB 1Z4IA 3CTMA 1EJBA 1TUGA 3BGSA 1W0JA 2VNKA 1I51A 1Z28A 4M4SA 4QL3A 5LQJA 3FHCB 3A1CA 4FNGA 4PCUA 5KUTA 2NU9A 1UFQA 1VGVA 4PG5A 3AUAA 5IK2A 3K9FC 3O3NB 4BZXA 1QMGA 2GERA 4FMBB 3SBXA 4YRKA 5IZ4A 4E12A 5ED4A 1RAAA 1XVUA 2BC9A 1AKQA 4R9SA 1NT4A 2AG8A 4DYVA 1IQUA 5ALJA 4QPDA 5HKKD 1ONSA 1MAAA 1B76A 2FTKE 5EP3A 4PYNA 3UM9A 4CFSA 3IUPA 3TZ6A 2SECE 1S3GA 3I5AA 1M6VB 2Q27A 2XPCA 2QNRA 2VYCA 3V2IA 3L8YA 3F9RA 1P8JA 1JIUA 2C31A 4M0PA 4ZI2A 4OLAA 3IDQA 4M0UA 4R8KA 1IPHA 2D4AA 4HI0E 5E1MA 5COAA 2MHCA 3ER9A 3PQDA 2YOGA 3BE4A 4OGGA 1XMXA 5ARDA 5IVHA 3IUJA 1D1TA 1NQUA 5C0OE 1U8AA 1V7QA 2Y1DA 3MSXA 4XKJA 3VKWA 4BMOB 5CEEA 1XDWA 4LV6A 2E21A 5IKMA 4IIFA 2JCGA 3IJRA 2HUNA 1SIBE 4YJ3A 5IMSA 1LRLA 2MOKA 2YQ5A 2YV4A 4QYSA 4FCWA 4B48A 1JSXA 3JALA 4B2IA 3I53A 1FS6A 2GZDA 1XRLA 2VCEA 2YIJA 2UXBB 1T8SA 2H1CA 3IUMA 5B1IA 2HTFA 4PO1A 1K3FA 4MPDA 3TSAA 1XDSA 1C7JA 3KXPA 1Z88A 5EWMB 1F48A 3LV8A 3SHFA 3EB9A 1NSYA 1W88A 2O2XA 2BISA 2FPIA 4X1KB 4KWIA 3EGXB 3AONB 1MQ8B 5E6RA 2NV6A 4FFRA 2ABWA 4IW3B 3N28A 3H1BA 2CBXA 4OKIA 3ZN2A 3ZUPA 1TM4E 5C4IA 5CT6A 3UMGA 2EXXA 3DC7A 4GPIB 4K87A 2PUTA 3RVDA 2GCIA 1XC7A 2AEJA 3T12A 3EGOA 2GM5A 2X0KA 3AESA 5CHYA 4P4LA 1V47A 1ZC4A 3A2KA 2YFKA 1MJNA 3HO8A 4LN1A 1TA0A 2DY0A 4Q9HA 2X5KO 4KQXA 1GPLA 2P6NA 4J0EA 3PUYA 3AH8A 1JKXA 3TBFA 3UT0A 4C06A 1OZGA 1BGWA 1WO8A 1LLCA 3ZHTA 1XKQA 1BJTA 4FFDA 4HKTA 3H5RA 2FU5C 4GPD1 4HPWA 4MVJM 4TGLA 4TLDA 2FMHA 4RE6A 3SZGA 1W4CA 2B8WA 2Y4NA 4H3HB 2AQIA 3ILVA 3QVKA 4PN7A 2XADA 4DLTA 4CKCB 3IS3A 1KO7A 2FP4B 2RBEA 1YJQA 1SA0A 3P9NA 5CFLA 1F7UA 1BVHA 2HLPA 3DDUA 3UUGA 4AG3A 1L7XA 3KZ1E 4S05A 3QEKA 4CLEA 1UXHA 3IHWA 1KARA 4JUAA 2MSKA 4C4ZA 4I0WB 1X87A 1C7IA 2HQBA 4L57A 2F43B 3PEWA 4O4JB 4EKDA 2WM9B 4RTJA 1RWKA 3E81A 1Z68A 3BHJA 2ZEJA 1J0DA 2MSWA 2YMLA 3OOYA 1E3EA 3Q9LA 4XTCS 5FTNA 1U5BB 3L4KA 1KI7A 2QPTA 4M9CA 2C57A 1RAGA 4MO2A 5EIWA 5ICGA 5KU7A 3WLQA 3ME5A 1PYGA 5BV0A 1MB3A 1IZZA 4ITVA 4UBOA 1CS0A 4BN0A 4KQ2A 3NO4A 4BV8A 1SXGA 4JITA 2YNMA 4XYBA 1IPEA 2QUZA 3OCZA 1M0SA 1ZN2A 2RGDA 1ZUNB 3KM0A 1DWPA 5EINA 3W6NA 3NRJA 2GDZA 3RGWS 1E7QA 1GUAA 1PBTA 3KPYA 2B4YA 4IVNA 5EJ4A 4I5IA 2Q0QA 4LTNA 5FAXA 1FK8A 1S8AA 2X76A 4Y6QA 5IYZA 4R1TA 4C7BA 3GQBA 1A8QA 3VISA 3DE4X 4G4SO 1GAXA 1RFLA 4BVKA 4P6VF 2FN3A 4E22A 1E2IA 1M1YA 2OV3A 3LKVA 1K6IA 1F8XA 3DMTA 3WMWA 1J8MF 1QC5B 1R4NB 4JT8A 1KP3A 4PHHA 3TB4A 4Z4QA 2EERA 2QN6A 2O3SA 4OL0A 5B36A 3RTEA 1V9CA 2DULA 2IEIA 3D4BA 3KVNA 4QLOA 3S27A 3SKYA 3NBAA 4UTOA 3TPZA 3LWBA 3BB4A 4V1CA 4B6OA 1IOLA 1KK3A 2C2YA 3I8XA 2OZVA 1H9BA 1JE0A 1YIAA 5KJEA 3ZGNA 4BP9A 2HU7A 2ZBUA 3EBLA 2G1KA 1A4XA 1K68A 2LZ0A 3B70A 4IR7A 4JLMA 4MUAA 1WLSA 2RKBA 3AZPA 4PONA 3ANTA 3S68A 4JP8A 4JK3A 5D3ZA 2OEPA 2P9BA 1H0KA 1R6BX 4O4HA 3VNAA 3KUKA 4CJXA 2C7OA 3AYXB 1AK9A 2BFBB 3IJEB 3E0QA 3W4KA 6YASA 2YJ6A 1KIAA 1M0EA 2V6GA 3LO8A 3KUUA 5BNFA 1Z0JA 3O83A 3EQ9A 1GQSA 2OVFA 4MVJG 1VSTA 5T6MA 1Z18A 2Y1LA 4IEEA 1XZJA 5BV8A 4QUBA 1DJPA 4NSNA 4GEKA 2IY7A 2O2YA 3QKTA 4P80A 4ASUD 1QTRA 4QQFA 1LK7A 5AESA 1PVDA 1SQ0A 3S81A 3FGNA 1UK6A 3T3EA 1UXIA 2NN3C 1O0SA 4MA4A 3TM5A 4UXHA 3E8MA 3UK1A 4FGJA 1GTSA 1DZ3A 2W4MA 1Z37A 2QRKA 3KUXA 4M88A 5HFNA 1JIXA 3ACBA 3EDCA 4BE7B 1PG0A 1ZJJA 1VHJA 2AOTA 2GHIA 3GIWA 3N0RA 4H7JA 4K9DA 4KWTA 5JVDB 1OBFO 4M7OA 1OU0A 4FWTA 1R0KA 1LPMA 1RQ7A 1YD7A 3UYKA 3I04M 4RANA 4ATNA 4HH4A 4Z8YA 3HMKA 4A5OA 4E4YA 1AXGA 1MVNA 1US8B 2BM1A 3PVSA 3GRVA 3HA3A 3LY9A 4KQ6A 4NBSA 3LHSA 4OSOA 5KDLA 2MR6A 2J5XA 3USZA 4ETNA 5HIKA 6GPBA 3ZE7A 4ZREA 5K0LA 2R2GA 2WRZA 4WUVA 3F6PA 4DMKA 5F3RA 1LNQA 2JW5A 1GD1O 2XQKA 5CJPA 5A0TA 1XMPA 2ZS9A 4HYTA 4YREA 1BWRA 4GICA 1ZD1A 3K70B 4YX9A 4L6AA 1E32A 3EFHA 4JI4B 3ZE6A 1H1TA 1TQHA 4JFRA 2EYUA 3OOEA 1D4ZA 2UZ0A 5KZMB 3QIAA 1SUCA 1MT3A 3RE1A 4BFSA 3FBTA 1A8PA 2OPBA 4PR3A 4FKBA 4KVGA 5EVJA 4M22A 4PX2A 3TQIA 4EATA 3QPVA 5H81A 3OLYA 5IG2A 2C7QA 1S3IA 3T99A 1J06A 3OPMA 3HVJA 3AERA 1VZ3A 4I4CA 2WIDA 1T0UA 2QR3A 3MNFA 5E9JA 3GVCA 4LBYA 4LZOA 3WOHA 4Z1OA 5DGTA 4DQXA 1RD4A 3FFBA 4ZYLA 2WFLA 4R81A 5DNVA 3WWCA 3B3AA 4KKVA 5JQWA 2PUWA 1XKTA 2E49A 3C3YA 2L18A 5IH7A 4ICIA 1C3OA 1U0LA 1E7WA 2QUJA 3FF1A 5TVGA 2XBUA 3W5JA 3WLOA 3U5TA 3FSGA 3LQRA 2IV2X 3A36A 2ZJ1A 4FS8A 2ZBDA 3IAS1 3UH1A 2NVBA 4MVJI 5I9SA 4BIMA 5DHAA 2JCXA 3A1NA 3L4BA 3KTOA 1RTTA 3M83A 1JG7A 2D7JA 1T3LA 3BM5A 3FLBA 3IYLW 1J2JA 3QBVA 1EB9A 4MYHA 3B1JA 4IZHA 2C94A 2XGSA 4EJ2A 1L4EA 4CHTA 2PYDA 5C46F 4A8JC 4C6HA 2PGNA 1CUIA 2YFHA 1R5BA 4H3SA 1XHFA 4K6HA 4QBHA 4QFCA 3U7EB 5AVUA 2XZLA 5DXAA 5SZJA 3KQPA 2AE2A 3R0IA 1K7YA 1KYZA 2Q0HA 4EF4A 1SPXA 5JY1A 4R69A 2P0EA 2ETXA 3KOOA 2IYRA 3SIXA 3CZ4A 3DM5A 3RVLA 4BB6A 2HQSA 1Z15A 4A36A 2P3SA 3CX3A 4AFNA 4Y2UA 2C5SA 3JWIA 2L17A 5HKOA 1KYTA 4IPTA 4M8SA 4M7PA 1ULHA 1PGNA 2AOWA 4LJSA 3JTMA 2CYBA 1XQXA 3KOUA 4MEJA 3VKFA 1SKYE 1I94B 3T9CA 2QGFA 4MQLA 4P3OA 3L7OA 3C5EA 3TTUA 2RGUA 3TMAA 4US2R 4H0FA 5DJ5A 1IB0A 4DRYA 4L5AA 4UMFA 4D25A 3ON5A 2K87A 4FHGA 4R6XA 1DTSA 1HE2A 2G9VA 3CH5A 4J1TC 4X1YA 5K0TA 2A0WA 4KI0A 2ZJBA 2I3BA 4O8ZA 4OI0A 2XYRA 5BSMA 3B1FA 3AM1A 3R9XA 2RB4A 421PA 4ZHSA 1VJ0A 4YV1A 4KXYA 1TZBA 1UBGA 4JQSA 4FBLA 3V4LA 2CK3A 3FMFA 4NEQA 4L5JA 4FW8A 3R7WB 3SF8A 3IO5A 4C4RA 1EX6A 4J0GA 4RS4A 1T2DA 3R20A 1JKMA 2CLMB 3ZXSA 1YULA 1A8SA 1TGYA 1PIWA 5C2JB 2BTQB 4EIWA 3WLJA 1FVOA 3I62A 1WCIA 5DYGA 3OEED 1WW3A 2NTVA 5JXWA 3OJLA 1WF6A 1EDEA 2YW2A 3HB0A 1QYVA 4DBLE 1IVSA 2QRNA 2YQZA 5KYXB 1KY5A 1N2IA 1TCCA 2VQEB 3ZKWB 2BGTA 3NM6B 3EMVA 4UM9D 3ZVNA 4ZO9A 5LLSA 4BZZA 5ALDA 4KDFA 2JGNA 1QH8B 5E1OA 1B73A 3TQQA 4YXFA 1RKBA 4JI3B 1HETA 1YS1X 3ASVA 1TCAA 2GBLA 2AC7A 5ALUA 3RSSA 1ONBA 2G5GX 3E5HA 4B17A 2PUAA 2IZZA 3WGQA 5IT0A 4HAXA 1JDTA 4TV9F 3L41A 3JX9A 1JHDA 1TJYA 1YASA 3DDOA 4YV0A 1G55A 3QFCA 2CDBA 3EOBI 2YZ2A 3NHZA 4KOAA 4QRIA 5CGQB 2H51A 5JBIA 2AZXA 4MDFA 1A5TA 4ZOEA 5IWCA 3ZY5A 1I4TD 1KDZA 1SXJC 5EZSA 1XVAA 1ESEA 1CZKA 1KVTA 3BYZA 4P81A 3CCFA 4GVXA 1U7XA 1HDOA 3PJGA 4PGGA 4PQEA 2WSYB 1EYZA 3NV7A 3OQIA 1RIFA 1KH1A 2ES4A 3C0KA 3DAGA 4JX8A 3C7CB 3HXOA 3TZBA 1X42A 5JALA 2PD3A 2ZUVA 2CVZA 4D2IA 2Z0MA 4D8XA 4LF6B 4HAUA 1Q1QA 1IN1A 3V5NA 1M8GA 2OFOA 3PRHA 1EFCA 1GRNA 2LIPA 3O38A 3RW9A 1ZCBA 1BCRB 1OA1A 2F3PA 4O59O 4Q82A 5FI5A 1TRKA 4BAGA 2A86A 4YP0A 4JXZA 1PR5A 2ECOA 3MWJA 2FWMX 3K6SA 3TFOA 1GGNA 2QSZA 3CRVA 3G9UA 2XUFA 2YVAA 3QJ5A 2NVWA 4EYSA 5EJ7A 3QGMA 4CODB 5HQ3B 4MUJA 4KR0A 2ZJFA 3AL3A 121PA 2BM0A 1CYEA 1THTA 2I62A 2OQVA 2DFNA 5E1DA 3DAPA 2ZWIA 1D4AA 1QMPA 2Y1KA 3LUGA 3OCCA 3WYDA 5MN6A 3EFBA 1WEKA 4QOIA 5HE8A 3HDTA 3HDVA 4TMFA 3ZZ1A 2J0EA 3DBRA 3LQKA 4L78A 4WXEA 1DBVO 2ZRAA 3KT0A 1DDOA 3THOA 5D01A 3W6PA 5AK6A 3UJCA 1VCOA 4JODA 3ZHZA 5DN6D 5E6RB 2Y0BA 4MOWA 4Z9AA 3ROQA 1KBOA 4S12A 5FPYA 2FN9A 4Z4IA 2Y4OA 2EYQA 1O4VA 2R751 1X86B 3K1AA 3TXYA 3UV3A 4E5MA 5DNCA 4A16A 3LE8A 2JLUA 2WICA 1X77A 3TD9A 1E62A 1M1NB 1PJLA 2NYUA 3QFRA 4K9PA 1YOBA 3KQUA 1ICIA 2NUBA 1RADA 2P9FA 4LC0A 4ZOBA 1WU8A 2IEZA 4ZT5A 2X0NA 3CVYA 4MGHA 2YRXA 2XA9A 4ZQFA 2PRYA 4CQLA 1P5RA 3MGKA 2FPMA 2VRCD 1Z35A 3NIWA 3ORYA 3RC7A 4Q05A 1B4DA 3B6JA 1FXUA 4AKTA 3X1XA 2JL1A 1NQVA 4LTDA 1BS1A 4BUJA 5CM9C 3D8UA 3LM8A 1ZH2A 3THWB 5HCNA 3WZMA 4CEJB 2D4HA 4LXQA 4B32A 4HEJA 3KSDO 4NJMA 3V4RA 5PGMA 2GCNA 4KNVA 4NDZA 2GT1A 4LISA 1U4SA 1IG0A 3PEEA 5EP1A 4C43A 1DXQA 1T2CA 2YFQA 2VP2A 4J7CA 4XOIA 4QD3A 4RSHA 5TSDA 4NXNB 2GTIA 3U4DA 5ABPA 3RIHA 2QV0A 1P19A 1Z4PX 3PUZA 3RYIB 5LUAA 4KO8A 3SBOA 2EFCB 4HC4A 4CT5A 1QTNA 4HPJB 1AOXA 3QU7A 4R4JA 3NJRA 2B98A 4P35A 2I29A 2QL6A 2VBGA 4S3MA 4HUTA 4ZI7B 2XB2A 1XLVA 3Q7QA 1J0AA 2DZDA 3WXMA 4NE9A 4IJ6A 5G2OA 1L7QA 1BKSB 3LY7A 3PUHA 4LF9B 3UKJA 4AL4A 3VO2A 2OXTA 4FUTA 2JDIA 4R1PA 1YE5A 5IARA 3UK7A 4ALIA 4P2BA 1T36A 4HH1A 4ZT4A 5I7HA 3AX6A 3OI7A 1OIWA 1B0PA 1ZIXA 4KW7A 4EG0A 1YCDA 3EXFA 1Z0DA 3BF7A 3V3KA 3C15C 2V3CC 3FFTA 4I6JA 2A8YA 1NYQA 4F3YA 1WHTB 3P52A 4HGQA 4JEMA 4F9EA 5LD2C 4GOMD 2XUHA 4CTOA 5C32A 3Q3IA 4AQ7A 1EFTA 1NC3A 4MW6A 3VO9A 3JD1A 3MLBA 2IYYA 3VPAA 1T3GA 1HORA 1X8LA 1LU9A 3NHAA 1L7PA 3HP1A 4K9LA 4Z8XA 5JCXA 1WDTA 2VO1A 2V3VA 3K0EA 3M33A 1X1EA 2PGLA 4IEFB 5FAKA 5F73A 5K51A 1E63A 4KXQA 5KYKA 1QIFA 2VWPA 2XGOA 3HFRA 4HL6A 4LSZA 5CTJA 1KQPA 4EJ6A 4LF4B 1WUIS 1MCZA 2HCJB 3MWFA 4X93A 1DHTA 3GUVA 3E27A 3SYTA 4W9RA 1WD5A 2II6A 1BHQ1 1ZWKA 3Q9SA 5FT9A 1DCTA 3NWPA 2RGRA 821PA 3R7AA 2TS1A 3DZCA 2E4VA 1RHKA 4IL5A 2MTBA 1TIBA 4LZAA 2YHBA 4PU0A 5GY7A 3N2NA 2W93A 4F85A 4P22A 3W5VA 1EM8A 4WXMA 1CBUA 5GM2A 2V1UA 3ENZA 1XCOA 2O7NA 2QRLA 1P17A 3ODPA 4NWIA 1P9LA 2Q5IA 4DV6B 1APBA 2NOAA 2C7BA 4G8DA 1N5JA 1R5OA 2XMZA 3CF0A 4UHFA 4Q3CA 4PNEA 4YRMA 5I7FA 3BILA 2O48X 3Q87B 1XEWY 1VL0A 4JWTA 5HUHA 4EHBA 1KI6A 4FCTA 4DEYA 4GSYA 4EAQA 2J87A 2OCIA 4AS3A 1MW8X 1UKYA 3CLKA 5HYVA 4XQ0A 3Q3GE 4YAEA 13PKA 2E4WA 1PK9A 4A2WA 3F5SA 3FJ1A 2W2XA 3KKNA 4GZ3A 4DHWA 3HYTA 4LYHA 5DCUA 2ZAIA 4D4JA 2B7BA 1GPDG 5D7NA 1QE0A 1LF5A 1LDBA 1MO6A 3Q7PA 1T4BA 3M2TA 4Q3EA 4XLZA 2XVMA 4D44A 5ADHA 3PENA 1C3VA 1FE8A 2PZAA 3BWVA 3EZ6A 3Q3HA 4LGVA 5AVOA 2FF7A 3FW1A 3JQ7A 4ZZ2A 1YAJA 3SHOA 4A03A 4EJFA 3AHGA 4MUHA 3KDSE 4CNQA 1O87A 3OQVA 1KYQA 4MV5A 4UHKA 4J29A 1TEXA 2IOFA 3NP9A 4RS3A 4U63A 3SI7A 1XALA 4HMPA 2PGAA 4E1BA 3FCXA 2LDXA 1I5RA 2ZK7A 3AHHA 1E3WB 3NTXA 4YC7A 1V1MB 2H2FA 4WXRA 5DT2A 5AFSA 2EQ5A 4IQ8A 2D7DA 1ZMOA 3CY6A 3INRA 2C8VA 5JO0A 1JI0A 1YVEI 2ZB2A 2V96A 1S9DA 3OJ0A 1DQZA 3A58B 2QSYA 4QYTA 4WI1A 1L4LA 1JWAB 2R6R1 4BZQA 1HDYA 3IVMA 4FINA 4LDAA 4TKVA 5LVAA 2A4MA 2C3OA 4DLXA 1N0UA 1IH8A 2HMVA 3N2KB 1BKYA 4J94A 1RDFA 1Z7WA 1XN4A 4N5HX 4O33A 4RD6A 4GECA 1NP6A 1XELA 2VK1A 1KFKB 4UHDA 3UNXA 1QFYA 4C4TA 3I2IA 4XQCA 1ZKDA 4UNSA 1AN0A 3AKDA 4UAVA 2WVHA 1VRCA 3KEOA 4RXUA 4Y6SA 5FBKA 1IQPA 3ZJUA 2JLBA 3F5FA 4AS2A 1SUEA 3PQ6A 1PG5A 5ICSA 2ZUFA 2AFIB 2P9CA 1MAVA 3KL4A 3ND9A 4HTFA 5FUXA 4XIFA 3CRRA 3QMWA 2CLCX 1UDXA 5ALVA 1JBQA 2A1TS 3OJWA 2OV8A 3BG5A 2DBVO 1CRQA 2FUCA 3QKWA 3RAJA 3PJRA 2H8GA 5ER9A 3MBKA 3W8RA 1D2GA 1JYSA 3OT1B 3I64A 3LX8A 2OQIA 1SXHA 3T61A 3COPA 5IT9A 3UICA 2QT1A 1GOTA 3ZGOA 3VR3D 1GA4A 4F5WA 2HREA 4L8WB 2OT3B 3UOAB 4HNVA 4M2LA 4CTMA 3QJGA 3D4LA 3WLIA 1JSLA 4RMHA 5ECYA 2AE1A 1H9CA 2VN8A 2A0FA 2FG5A 2CFIA 5T7BA 3NPMA 2E48A 1UBEA 2VJQA 2BEUA 4RIGA 1KZ9A 1JEOA 1HDCA 2RIRA 2YV1A 4GLBA 4QVKA 2P3OA 4EHKA 4MQ5A 5AVKA 3RK4A 1DQPA 4N1AA 1F6WA 4J1SA 4DLYA 3D7KA 2W6NA 3L7YA 4DA7A 4EGCB 3SC4A 5G0SA 3KR0A 5ES3A 3DULA 1X19A 1E20A 2QP9X 2QMZA 3K2IA 3RK0A 3L4EA 5BNTA 1ACLA 4EW2A 5C7LO 1SWWA 1V3VA 4A27A 2CXRA 5FOQA 3SSAA 1KZ7B 5AHOA 2L2QA 2VC2B 2EIHA 2FNAA 5KU1A 1GZUA 1ZRNA 3PF9A 4YCDA 3JARB 3E3NA 3PD1A 5JJCA 2YWJA 3CZCA 1QJ4A 4JKIA 3QVLA 4EYQA 4YJGB 2IC5A 1VYHA 2FWRA 5KAMA 4Q12A 3NT5A 4FFVA 4FLFA 3MCZA 4G0XA 1M75A 1EVEA 4TTQA 4ZDIA 4QULA 4BFVA 1ZHOA 5F2OA 1HTBA 2JJ1D 3GROA 3I8SA 3I1YA 2REQA 4KO3S 5FXMA 4DM3A 2GBCA 1XD2A 5KYVA 5B6JA 2RMKA 3H5LA 2IXFA 1F4PA 3I5MA 3IRVA 3LF1A 1J97A 4I1OA 4PF1A 1KSHA 3DW3X 4LX8A 1FNCA 4U9UA 1KI6B 2FKNA 2Q8PA 5SYAA 2QGZA 5FIUA 2I9PA 1N2SA 3WLRA 3SYRA 2REOA 1EHYA 3NDIA 4BN4A 4JJEA 4I50F 3FDJA 2BEKA 1P6QA 2GGSA 3G0DA 4C0AC 1QHEA 1Y9JA 1HLDA 4MVJA 2BF4A 4IKEA 4YP5A 2Q2NA 5CCDA 3Q8KA 2CD9A 1DLIA 5DBEX 4E32A 2Q7OE 3OZEA 2PAFA 3H5TA 5IT4A 1EIWA 4W7IA 2CFTA 1YRQA 3IVRA 4IWYA 1Y5RA 2P79A 3M6WA 1PV1A 3GZ4A 2RCNA 5HKKA 3OY7A 2XNDD 4GH5A 1GG9A 3EBPA 3QSYA 1Z17A 2DHQA 1QZ3A 2PIAA 2F17A 1LD3A 1DQSA 1FNMA 1UKAA 2ZIAA 3BWYA 3JAWB 2EL9A 4N03A 1NSTA 2PR2A 2YZNA 4XXHA 2YUTA 2CV0A 4GI7A 1OFVA 1GUFA 1WMSA 4Q24A 3TD6A 5H0IA 3ZHSA 1ADFA 1W0JD 2I6UA 2X9NA 4IG4A 3NDRA 1XZPA 3PNVA 4AJHA 3TNYA 4F56A 1A04A 3N6XA 5I7RA 3TZQA 4UREA 2KX7A 3GEBA 3LSTA 5IM4A 2DYKA 5AI4A 3Q98A 4YRLA 3B9RA 2D6FA 2FSIA 1YK1A 2HDWA 4F6RA 1QNLA 2GN6A 3ZDYB 1GRRA 2OHXA 3OZIA 3GGCA 1U1IA 2GZSA 1JI3A 3EXEB 1Z7EA 4F11A 2XMQA 5BMVF 1NI4B 2GF0A 4XEUA 4MUFA 1GL9B 4H18A 4KIJA 3DZDA 3QW2A 5ESRA 1X1QA 4NE2A 1H9AA 2I2BA 3D1LA 4OHPA 1BHO1 1SEPA 5EERA 1YBVA 2I8LA 1ISFA 3WGTA 1B23P 1CEEA 1VIAA 3RVMA 5DN6A 4QATA 3K6KA 1KQGA 1A9RA 1NXPA 3KQSA 2XEDA 4AO8A 2PWAA 2V7XA 3GLQA 3T7DA 3DQQA 5A02A 3UHAA 4MWDA 1HYGA 4LF7B 4F46A 4EA8A 4G24A 4H3VA 2V45A 2X5JO 3GOHA 4GVLA 1TF5A 2NXCA 1OI3A 1Z29A 3CMMA 3OBIA 2LBPA 4Q4DA 4YAGA 1RAHA 1T4CA 5KOJA 5D3KA 1Q20A 3LHDA 1FFGA 1RQNA 4FYJA 2O6LA 4N5NA 3USES 4RD1A 1VI5A 3VU3A 5TGDA 1H2ZA 2NZXA 2BR5A 5CPFA 3RRBA 3HRKA 2ID7A 1NVKA 1PNRA 1YO6A 3KRTA 3E18A 4KUGA 4F8JA 3QV2A 4BJHB 2WD7B 3AEXA 4QICA 4YRNA 5BNIA 1Q14A 1K6EA 1WCYA 4OK6A 4WBXC 4B83A 1KL7A 3FOEC 3U3ZA 1U0HC 5BWLA 1OZHA 2X2PA 3ZXUB 4EFMA 5KREA 1PAUA 2PVSA 5CT9A 4ZC8A 4AP5A 4MIEA 4QFDA 1HGXA 3OQ1A 3U9TA 2D7CA 3UQYS 2ODBA 4D8UA 5DLYA 1YU6A 4DE5A 3V2GA 2B4RO 1WSAA 2P30A 3GNQA 5HIAA 3U61B 1FNNA 4CL2A 5CH3A 3JQ6A 3RJ9A 3C5CA 2O1SA 1HT3A 2I6TA 3KFVA 2H5JA 4YUWA 1K7CA 2ZIGA 2JKYA 3MBOA 1X7XA 4NVRA 3JVDA 5ITWA 1XTUA 3MJRA 4K9QA 4TRMA 5J2TB 2PMKA 1GZDA 1Y3BE 2QN7A 2X8AA 3PU6A 4BO9A 3LW7A 3GZJA 2ZUTA 2XDWA 4XUEA 2ZPTX 3ZDBA 2EQBA 3VMMA 1ID1A 1AQLA 2WJVA 2CDNA 3KXKA 2H29A 3NB0A 3O6VA 3O4IA 4JYCA 1Z7BA 3UQZA 4ZZ0A 5JJLA 2YJNA 3UKDA 2XLBA 1PWYE 3CN7A 1Z0FA 3FGZA 3RVSA 3H97A 1H2WA 4P31A 4LVNA 2AN3A 3A6HA 2PT9A 1K06A 5J2TF 4HDRB 1KRHA 4JGGA 5CX1B 1SHKA 1XVVA 2NU8B 4B33A 4EB6B 2FY8A 1WU7A 3CRW1 2DOKA 4J1QA 4ZAXA 5B2ZA 3U62A 1U8FO 4IUYA 4Q1EA 5K01A 3CLSD 4CQMA 3QRWA 1FBTA 4U6SA 5CK4A 4DREA 5K0ZA 2QYTA 5K0JA 2O6HA 5T41A 4KRXA 1J9ZA 4M1MA 4JJIA 3ZD9A 4WKCA 3R5SA 3X0DA 2D3TA 4R8RA 2VIIA 2O1WA 4RGQA 4RU1A 4YRTA 2VHJA 1YUMA 4BEWA 3D3JA 4AURA 7REQB 3UENA 1DBWA 4HWPA 5LUBA 4EVQA 1N6KA 1OLOA 5JSZB 1L5GB 1EQUA 1NZJA 2WWIA 2J3QA 2VT6A 3OJCA 5JVDA 2ZPUA 1XVTA 4FBGA 2BM8A 5EXSA 3W4JA 3VJLA 1VMAA 1H6BA 1VP3A 5JCJD 6AT1A 3FPAA 3D6FA 4LRQA 1WMEA 1KNXA 3WDSA 1EK1A 1F60A 4R8SA 4MRVA 4Y2YA 2NYVA 1LJ8A 1MA3A 1QIJA 1S89A 2F8MA 3IP9A 3QOYA 4RD3A 3QH4A 3V8BA 2GEDA 2DVMA 4ZT7A 2XRZA 4EZIA 1AH2A 3DLTA 3RU7A 1RCFA 1EBUA 2NUAA 2Y93A 3C1UA 4QODA 2EBUA 1PKEA 1TIKA 3NJ4A 4BYGA 5ESDA 2ZB3A 4YCNA 5JLAA 5F5LA 1JAYA 5T4HA 1EXDA 4F3CA 1AMUA 2C2BA 3AV3A 1MBZA 1FNSA 1K98A 3EQ7A 2GF2A 3QUQA 4FE4A 3U09A 3NBYC 1N3LA 3BGWA 2O8BA 3KTFA 3AEKB 1W1UA 4K9OA 4E5UA 1XEXB 5KNCD 1D9ZA 3L8HA 4O2AB 3L7LA 4WNIA 1JL3A 3IPRA 4Y2QA 4DARA 1NHWA 2LD4A 1M34A 4KLAA 4LYJA 5DM70 1OYOA 5ADVA 3BL8A 5KNLA 4E5YA 4YJ3F 2XT0A 1Z16A 1DIBA 4Z9XA 3K1ZA 3Q0TA 4NCNA 4C0BA 1GGJA 1U2ZA 1W94A 3R0VA 4EPXA 5LR6A 4QYXA 3T7SA 5F2NA 4L9RA 4IIBA 1RP1A 1YGYA 3CE9A 1W6RA 3QUAA 3Q8MA 4MAAA 4IZOA 4MAFA 3TQSA 2V1XA 3EZ9A 3LQYA 4Q15A 5JQGF 3Q3EA 4HWKA 4URYR 4J0IA 2ZR9A 2JJMA 2GN8A 4EVSA 1NQWA 1SVMA 1U7HA 3MWLA 3D2AA 3GFPA 3K9HA 3LT1A 1B7GO 4TUYA 4F7DA 1OZ0A 2AK2A 2OZLA 4CXMA 1JSRA 5JRZA 1WP4A 1KGDA 3ILYA 3K5IA 2PMEA 5BRAA 3C6YA 2JS7A 3K1JA 5AI9A 3E3OA 1P7YA 2GLTA 3AP2A 2IWHA 3OZWA 3ADPA 3ZY4A 2QTGA 2EAUA 1UQUA 3F6RA 4Y0AA 4BO3A 2JC3A 3RNLA 4PZLA 1BS2A 4CW7A 2C54A