4PHFA

Crystal structure of ypt7 covalently modified with gdp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
163
Chain Sequence
NILKVIILGDSGVGKTSLMHRYVNDKYSCTIGADFLTKEVTVDGDKVATMQVWDTGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis,exocytosis
molecule keywords GTP-binding protein YPT7
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 163
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phfA00
3UK6A 3ND9A 4JT4A 4A8JC 2FZ4A 3LX8A 1LNZA 2GCNA 4PZYA 1KNXA 3LVRE 4PANA 1WE2A 2ZRIA 1Q21A 1XEXB 4WBSA 3L8ZA 1E2KA 1SVIA 4PZZA 2ZVPX 3AV0B 2E9SA 4TYQA 2XB2A 4ZCIA 3TQCA 3ZYCA 4DSNA 2I1VB 2YKGA 4C0QC 1H8HD 1CRQA 1NL3A 1AZTA 1NJFA 3EA0A 5ELXA 3D7MA 2OBMA 2IS2A 2IW3A 1D2NA 2ODWA 1CR2A 4POAA 2ZIAA 2O8BB 4ZDIA 1NY6A 4JLAA 4RZUA 4OQXA 3VU9B 4AC9A 3CONA 2R8RA 3LY5A 4OQMA 1DAEA 3AVPA 2WKRA 2G9NA 5CB8A 2IL1A 2WOOA 3VHXA 3AF3A 3THWB 2QGZA 3W6OA 3R7WB 2X19A 5FPYA 2VSXA 1KDRA 2WIBA 3IO3A 5G53C 1H65A 3LBNA 2H8KA 1XMVA 1GZSA 1JXMA 1M1YE 5HKKD 2Z83A 1LY1A 1E9SA 3MMPA 2RMKA 3K0AB 3DZ8A 1A82A 2FPLA 3ZDQA 4NMMA 3K9LA 1KKLA 1DAMA 3KFXA 1MOZA 3A37A 4LY6A 2OFXA 5DSZA 2IX3A 2YOHA 2YOGA 4B74A 2EFHB 3BE4A 1NP6A 4A0GA 3C14C 5SZIA 4GT1A 2EFGA 2AK2A 3BS4A 5L3QB 4FMBB 1BYUA 3BIFA 3TUZC 5L3RA 1DAKA 3NDBB 2FPKA 1JR3D 4PXAA 1DG1G 1VCOA 4D25A 2NIPA 4F93B 1E0AA 1UADA 3GFPA 2YC4C 2JAQA 2ZSDA 3MJHA 1P7CA 4P33A 2IYQA 4TLCA 3LXXA 3SJAA 1Q57A 3DKVA 3PEVA 5HCIA 2IC5A 1NKTA 3NHAA 5SZKB 1OFIA 4CEIA 3LLMA 1CJMA 4R2HA 3CX6A 1AA9A 3CRMA 4I1SA 1GKUB 1II0A 3MAAC 4OHVA 1CR4A 2ZYVX 3KKPA 4JVNA 1FZQA 2UZ3A 1NMXA 4QGHA 1NBME 4LSGA 1PUIA 3QKSA 1IXZA 1AQYA 4TYNA 3ZZUA 3P20A 3SQWA 3SFVA 3CM0A 3T5GA 4NH0A 1WP9A 1AIPA 3SJCA 4ASUD 5KPDA 2Q9BA 4L15A 2EYQA 5JMTA 4QOSA 1IBRA 1CKEA 2YV5A 3OZXA 4LJ8A 1DARA 1BH2A 2MSCB 1J7KA 4O0MA 2O8DA 1FQKA 3LW7A 5DISB 1FNMA 4TTQA 5HE9A 3ZS9A 2GZDA 1QHHA 2X1VA 3JZAA 3TK1A 3I5XA 2JLWA 1CBUA 1YZKA 4JJZA 2RHMA 3QPVA 2GZHA 1II8A 4WIAA 1KJWA 3RSLA 1G64A 4BPBA 1CS4C 1P61B 3GLFB 2ONJA 2V9PA 4YXWD 1QHYA 4IRUB 1PLLA 3NHBA 4NCJA 3V9PA 1D2EA 1GFIA 4HAZA 4KU4A 2D74A 2JATA 2ZUCA 1N0UA 4P4SB 3R9WA 4JYBA 1VCIA 4E09A 4CDGA 1VIAA 3KXKA 4IOKA 2AL7A 1VPLA 1T0JB 1YZLA 2GVDC 1D9ZA 1XPRA 4EPTA 4HEJA 5E7JA 1KYIA 5LBIA 1J8YF 2OM2A 3QPUA 3WNDA 4BFXA 3N70A 1U0LA 3DMNA 4M1OA 4W7SA 2BIFA 5BQ5A 3TAUA 2F9LA 4Q00A 5FTLA 3EC1A 4A8JA 3TBKA 4BWYA 2OG2A 3BWDD 3UWKA 4MRNA 3B60A 3SI7A 2F3RA 2P6UA 3GQBA 3AGPA 4KO8A 4V0LA 4RJLA 2ZAOA 5H1YA 1M7GA 4HAWA 2IYLD 1W36B 2W2VA 2F3TA 2PX0A 4DSUA 4HAYA 1M8PA 4DUGA 2P6NA 4UQOA 4ZO4A 3QF4B 2J59A 5FUVA 4MYHA 4MGIR 4DVGA 4I1UA 4PHFA 2AK3A 1KI3A 4IDPA 1E0SA 1YKSA 4Q7MB 4JL8A 2B21A 8OHMA 1G20E 1O3YA 5HZHA 4QC2A 3SR0A 5DYIA 1J8MF 2ZROA 3EIHA 4O2RA 4RD3A 3NBZC 3KQKA 1TNDA 1Z29A 2H92A 2ZI4A 4PC3A 5CYOA 1GITA 4I81A 1NRJB 2GAAA 4M53A 1E2PA 2P5SA 1Q20A 2GWHA 2QE7A 3CWQA 3KQUA 2EU8A 1Z06A 1W36D 2A5YB 3T06B 2IYWA 3A4LA 2BBOA 1FTNA 2QMUA 2C78A 3ND8A 4XVQA 1U8YA 5G3YA 2ZSFA 3PUYA 4IDNA 5CIWA 3L8YA 2REOA 2V4ZA 5GJCA 4DJTA 1FNNA 2ZEJA 3BJIC 4HB2A 4BZPA 1G6OA 2O8CB 4J0QA 2CJWB 1OXXK 3B5JA 1GRQA 1GUAA 2WIAA 5FPSA 3T61A 3O8CA 1US8A 3CNLA 4X8LA 3ADDA 4I1VA 4O25A 2OFOA 1YZTA 1T3LA 1NN3A 3RLFA 1S4QA 4GL2A 4TYPA 4Q03A 2ODNA 3T1TA 4LYJA 4AKGA 3B2EA 2QRZA 5FUWA 1CR0A 4CEJA 4ERNA 5IK2D 1FPMA 1SVWA 2X2EA 4AKIA 1SXJE 3U4QA 1HQCA 4PHTA 2QZ4A 3LVQE 4L5BA 2BBWA 4OHXA 1OIXA 4LYHA 4O2LA 2KJQA 1YE8A 2I3BA 3X2SA 5KNDA 4IDOA 4K46A 4EAQA 2G1JA 1JEDA 4PAOA 3IIJA 3K0EA 2L0XA 4X8MA 4NZYA 2GXQA 4HSEA 2I4IA 1RYFA 4P3YA 4OHYA 1E9BA 2B7CA 1JPNA 2ZE8A 4F4JA 2IUTA 4B32A 4TYYA 1J2JA 2N1BA 3NEJA 1LFDB 1JR6A 1MO3A 1E32A 3GLHE 2A78A 4LOAA 4JKYA 4RD4A 1XPOA 4RFVA 1D8TA 1TQ2A 2AD5A 2ZRHA 3KKNA 2AR7A 3ZGXA 1IY0A 1U9IC 4B3CA 1E2DA 1XJ0A 2OEPA 1W2HA 4LZZA 1AKEA 3TSWA 3B1YA 221PA 1Z0AA 3FMFA 1EG7A 1SVLA 2F43B 3ZQJA 3K9HA 2XTMA 3ADCA 3TGPA 2IXEA 4W5WA 4BFVA 3M1IA 1OXVA 1R5BA 3ZJYA 2MMCA 4LHZA 3THXA 2ZUBA 3B1VA 2OLKA 5KDDA 3EZ6A 2O0KA 1C4OA 3THYA 1N0VC 2F1JA 3AEZA 3MLEA 1E69A 4KSBA 5A0FA 4B33A 3K70B 3SE0A 2ZRGA 3MG9A 4IVPA 3KDSE 4QNRA 3ZS8A 5FOTA 3E2IA 2ATVA 2DHRA 2IYXA 4A0RA 5J4HA 4MRSA 4XWOA 5AJVB 3UPUA 3H4MA 3QENA 2Z43A 1OF1A 4XD7D 3BXZA 4JVLA 1M6NA 4D4MA 1R8SA 4MGKR 1XFAA 4M0LA 1A5TA 5FOSA 1OB5A 3HJNA 2NPIA 2AN9A 4TN1A 4DXAA 3F5FA 2R9VA 2P5TB 1KMHB 2ZI5A 4UNPA 3GD7A 2QTHA 2FGJA 3PVSA 4B2LA 2OCBA 4YMTA 2OBNA 4OI0A 2IS4A 2EFDB 4NONA 2YC2C 4MKGA 4M9QA 2WAXA 4EPVA 3K70D 3Q9LA 3KTAB 1PLKA 2QN6A 3C8UA 1XRJA 4PPNA 1GWNA 3KJEA 4Q9IA 3VNUA 2ZRFA 2RCNA 4ILEA 4F91B 2Z4RA 1XWIA 5FI1B 2NO9A 3SHWA 1ZRHA 3FDIA 3UANA 4X8OA 3TR0A 3MCAA 3CNOA 4OL0A 4BRWA 2WWYA 1G3UA 2FU5C 3QBVA 3HU2A 4R9UC 3VMFA 2IYTA 4OJQA 5EP2A 1SULA 5FR2A 2XGJA 2D7CA 1ZBDA 3K0CC 3CR8A 2WAYA 2BEJA 4UXIA 1R0WA 4EPYA 2QAJA 1W44A 2V1UA 4LHYA 4KFSA 3TW4A 4OK6A 3BK7A 1QHGA 4XTRA 2QEQA 2IYUA 2CE2X 4BLPA 1W0JD 1Z6XA 2G88A 3IPXA 1F5NA 2P67A 2DWQA 1Q1ZA 1IM2A 3K0FB 3AKDA 2XSZD 1KZGB 1G8FA 1QG4A 4FMCB 4Q4HA 1Z0IA 1AGPA 5JJKA 3QY0A 5HE8A 3A1TA 5LDDC 4PC7A 1J99A 5JJIA 4RFSB 1TUEA 2PLFA 1BKDR 1CU1A 2ZQ5A 4M1TA 2HDNB 4KHZA 4TQ9A 4BLTA 3T15A 3KJHA 3EXAA 3SS8A 5C4GB 3QKRB 5TMPA 1NY5A 2J3EA 1WMSA 2VP6A 3D8BA 5KPJA 3G5UA 1I2DA 2RHDA 4ZV4A 5AWFC 2WWWA 4NL4H 1AM4D 2ORWA 4A82A 4DLYA 2CNWD 1G9XA 2NTYC 5J5CA 821PA 2LKDA 4QKQA 4DSOA 1SXJC 1JR3E 4HUTA 3LBHA 2G6BA 3L43A 2CBZA 2EWWA 2HUPA 3ZIAD 3GP8A 5KSZA 1KAGA 1S9DA 4NP6A 2J0SA 1G7SA 1TU4A 2GXAA 2B7BA 5JSZA 1SKYB 4DLRA 3LX5A 5B2ZA 4UXHA 1UF9A 1JPJA 2Z6VA 3C5HA 2YOFA 1GL9B 3QXSA 1NBMA 5H70A 1ZVQA 1E1RA 1KK1A 3EW9A 4V02A 4CVNA 4D4KA 4ZDJA 1N5LA 2ASEA 3PITA 4R7ZA 3UG7A 4LPKA 4TZ6A 1E2NA 4DCNA 1RJ9B 1OH5A 2VHTA 3B78A 1GOTA 5F9HA 4OYHA 4HLUC 2ORIA 3SYNA 4GOKA 2EVWX 4EKDA 1OHHA 1U9IA 4WVFA 3W5JA 3LV8A 4C0AC 5B64A 1Z83A 1VG1A 1MABB 5KOYA 2PJRA 1KDOA 4G5RA 2H5EA 1T5LA 4JSYA 2ZJAA 4CF7A 1E9CA 2Q21A 2ECKA 5BYKA 1W4BA 1UKYA 4JBWA 4DSTA 3L0IB 4WZAE 1IY2A 2AKAB 3Q5EA 3IBGA 1OXSC 1ZP6A 1VHTA 2I1QA 3QEJA 1KDPA 3QUSA 3W90A 2ZRPA 5IHPA 4MUBA 4LBZA 2V7QD 4WZ6A 2BJVA 1IN7A 4GI7A 4PC2A 1TQ4A 1K8RA 5JS7A 4D0LB 3FMIA 1CJKC 2A2ZA 5DI9A 4DZZA 4PQYA 1GDDA 3AP1A 3FB4A 3TUJC 1UDWA 4XIGS 4JLJA 3WNCA 2WPDA 5KYKA 3LNCA 5KSPA 4FWIB 2JLQA 3P4XA 3AVUA 5ANRB 5FI0B 1GNRA 1OXUA 4L9WA 4A2QA 2GNOA 2OLJA 2FNAA 2ZRMA 1Z0JA 3KKOA 4RZXA 2DB3A 4JBXA 4IOMA 5FTNA 4EIWA 2DFNA 4M21A 1E1QD 4RD6A 4A6PA 1MH1A 4GDFA 2KWIA 1KI7A 5JI3E 4IXMA 1OKKD 4RKFA 4F38A 1IXSB 4PC6A 3G0HA 2BWJA 2C9CA 3I4LA 4JMPA 4NCHA 5JFGA 2NZJA 2V55B 2O8FB 2O8EB 5DN6A 2JGNA 2QA5A 4YONB 2PH1A 4KFTA 4ZIRA 4A0FA 4TL8A 2Q9AA 3RANA 3U6BA 1EESA 1ANKA 1L7VC 3PUZA 4DWJA 5E7IA 2RH5A 2PMDA 3DL0A 3WBKA 3GLIA 2H18A 3X1YA 2J9RA 5HZKA 2XXAB 5L3VA 1S3SA 3ECCA 4PC1A 1WF3A 1HEIA 4HDQB 1EFRD 2X2FA 3K0CA 1XTJA 3B6EA 5D3MA 3FE2A 4Z8XA 4ITRC 2X77A 2BVNA 3ZLJA 1YVDA 2N46A 3RRYA 4G5OA 2GESA 2R6GA 1G1MA 4Q1EA 2FDCA 1E79A 4OI2A 2YHSA 2OCPA 4DEYA 4KBFA 3EPKA 4C3ZA 2YWGA 3GEEA 1WCV1 4D4LA 1COWD 2QTFA 2QM7A 4WAUA 1XCGB 4HAVA 4HLDA 3K9GA 4PX9A 1P2UA 2GF9A 3QOFA 2ZRNA 3SBEA 2CMKA 2OFWA 621PA 1JAHA 5JLJA 3ZVMA 4LJ9A 1UAAA 5TY0A 1UKVY 1AN0A 4MH0R 3SDZA 3VAAA 4DC9A 4DIDA 3A1VA 1U0JA 2W6JA 1ZM2A 2HCJB 2OXCA 4M9SA 2ZANA 1YQTA 3RS4A 4Q19A 1RE0A 2C95A 3U61B 5CLLA 1UFQA 3SNHA 5J4YA 3IQXA 5CK4A 3LO5A 3ICEA 4A2WA 4KLZA 3DPUA 2FEMA 4AKEA 4Q4JA 3A1WA 2ZVQX 5FL7D 3BGWA 4ESVA 3NC1C 4XSGA 4IW3B 2D62A 1NKSA 1OKKA 2QMEA 4TL7A 1T9HA 2XOKA 1XTQA 2WJVA 3NWJA 1P5ZB 3I8SA 3TKLA 4EQ6B 5J4VA 3KXIA 3ZVRA 2XTNA 3RABA 5DLQC 4CT4B 2NMVA 3I32A 4Q4AB 1VHLA 4AD8A 4BFWA 2Q9CA 2ZETA 4OQFA 2ZS7A 2CL6X 3NG1A 2GCOA 2HXYA 4FMDB 1G8HA 3M0EA 1UKEA 1Z28A 2BCGY 2OHFA 2JA1A 2JLVA 3TRFA 4S2EA 2OCYC 1XXHA 3FMPB 3GLHA 4Q7LA 2QSYA 3AP3A 4QBGB 3AVOA 2R6FA 3GCGA 2AD1A 3QIAA 2DBYA 1Z63A 4D0GA 1RRCA 2FOLA 1DAGA 5EZ5A 2JIZD 4NTZA 4TMWA 4H9GA 4HLUA 5KTYA 5KDLA 4LJAA 4UNNA 4CGZA 1NVWQ 5IRCD 4OHZA 2ZYUX 1E9DA 1JJ7A 3OFND 4PPQA 3GFOA 4Q9JA 2OAP1 3ASYA 3OEED 3DMDA 1NIJA 1LB1B 3M6AA 4C7OB 4A2PA 1SHZA 4LV5B 3QI2A 1HH4A 2D4HA 5HR5A 1Q1QA 2ZJOA 1XEWY 1FL9A 1YR9A 2A5GA 4HI0E 4RVCA 2FJUA 4NU0A 1KO7A 3CRVA 1KK0A 4HUQA 3U7GA 1V5WA 1FX0A 2AFIE 4BLRA 5LD2B 1A7JA 2FZLA 1D2MA 1R4AA 1Z8FA 1KI8A 1T0HB 3IEUA 3PR1A 5HCNA 3FTQA 1ODFA 5FL7A 2D2FA 2QTVB 4LBYA 5P21A 1E2IA 4IOJA 2AKYA 3OEHA 3TH5A 3PFIA 3L0OA 4ZKDA 2ZRKA 2JDID 2WHXA 2IWHA 2R2AA 4JBYA 4EPXA 5J4KA 4BRUA 1U2RA 4KITB 4QJ3A 2VSFA 2WV9A 3EX7C 4RD1A 3DDCA 2WM9B 3SOPA 3TQFA 5EJEA 1L8QA 2J0QA 1W5TA 1T91A 2GTPA 2HCBA 2W6ID 2DR3A 4M1SA 4P4UA 4L4UA 1KK2A 5F2EA 5EXTA 1YZUA 2WTUA 3I1FA 1MV5A 1H8HA 3QNUA 4NE2A 4PQFA 3TAHA 2W83A 1BYIA 2BBSA 2YVUA 3JVUA 3LBIA 3W34A 1OH7A 2VHQA 1DVRA 4E5UA 4X8HA 5DHFA 3S1AA 5JWOA 1CRPA 1G3MA 1TX4B 2E87A 4NBSA 3IPYA 1Y3AA 5C1BA 1T5IA 4I99A 4LRWA 4Q01A 1G8GA 2HJGA 3IBYA 2RAPA 4LC0A 4URWR 5FL3A 3SN6A 3U44B 3PENA 1T8TA 3BC1A 1HT1E 1XEXA 4Q7KA 3U2QA 5G40A 2VF8A 1DE0A 4PHGA 1C1YA 1DBSA 1T3HA 4PQRA 5HKKA 3U7FB 3AKYA 2OXRA 3WHKA 1Z2CA 3N2IA 1VKJA 1XMJA 4W5HA 1T3SA 2QP4A 1N6LA 4MITA 1UKZA 2XJ9A 5JCPA 2QBYB 3AVVA 1Y63A 3BOSA 2IEZA 2ERXA 4CW7A 2O8BA 4DLZA 2O0JA 3OIVA 2RGXA 1R0XA 2JLSA 4DDWA 3RVBA 1OFUX 2EFCB 3VU9A 1N6OA 3C16C 3H84A 2H17A 2FFQA 4U00A 1VECA 4IVQA 4BEBA 1E99A 1ZNZA 1LS6A 1AGRA 2IYZA 2P2LA 5FTMA 4AYXA 3THWA 4JLNA 5JZVA 3DOEA 3R7WA 1FFHA 1Z22A 3B85A 4JVSB 5TVKA 4F7WA 4AI6A 5J47A 4ACBA 2V8OA 1IN4A 1JR3A 2GK7A 4FD2A 5CITA 1VYTA 4L16A 1P3JA 1DAIA 2CLDX 3K0AA 2ZYTX 4FW9A 2CCKA 5A5GA 1JQJC 1ZNXA 4XVUA 4PAMA 4US1R 3QBTA 4LJ5A 2VBCA 5TDHA 4NCKA 4HLCA 1XCMA 4XWKA 3GEIA 5M04A 4FMDF 4B76A 3OE7D 1E2QA 4DBLC 4DIEA 5E4FA 1NG1A 1XJQA 4QM6A 4Q1AA 5L3QA 1IHUA 1F2UB 1G21E 2WWHA 2D2EA 3RYTC 3PUVA 4OI4A 5BYJA 1OV4A 3VKGA 3GPLA 1A2KC 5KDOA 1GL7A 4B3FX 3GJ8A 2WSSD 1P60A 3GLGB 4II7A 4ASUA 3GLIE 1XZPA 3FYHA 3ETLA 1U99A 1S3GA 3JVVA 2RB4A 1ZM9A 4GNKA 4QRHA 1WB9A 1X1SA 5LB2A 2A3RA 1R10A 2VQSA 4JS0A 5AUNB 1W2GA 1NLZA 1R8QA 2FX3A 1JALA 2PZGA 4Q5IA 2V6JA 2A9KA 4FINA 4OK5A 5DH9A 3AF0A 5DI3B 3W9YA 1PZNA 3AVWA 3GMTA 1KY3A 2XITA 4PO9A 5KO2A 3EZ9A 3FFAA 3QEOA 4B34A 2VLIA 5JBQA 4DDVA 2WMOB 4Y0AA 1KKMA 1PJRA 1SKYE 4Q48A 4BFUA 2VHCA 1DO0A 2NG1A 3FKSD 4LV8B 1KI6B 1VG8A 1X86B 2B92A 3IQWA 2FFHA 4D6PA 2A5JA 2F55A 4YXWA 1BOFA 2ANCA 5EZ6B 5TARA 3VR6A 2WMNB 3ADBA 3H1TA 2QT0A 4EPWA 1YZQA 5EE3A 2UZIR 3EASA 4C0BA 3TVDA 1ZYUA 4BFTA 4ZCMA 3ICQB 3QE0A 2DYKA 4JLVA 4Y0VA 2PCLA 3GJ4A 2R6DA 1ESMA 1KAOA 3MWKA 4OQNA 4LYFA 2HF9A 2WKPA 2C2HA 4TLBA 4BECA 3SYKA 1II9A 4IKEA 4URXR 1ZM3A 4IHQA 2XZOA 4RD2A 4QJ4A 4TL9A 3EIQA 3NTUA 1X3SA 2VYFA 1NMZA 2QY9A 5IDVA 3O8DA 4KCGA 3NXSA 4GZMA 1TEVA 3THOA 1IJEA 3FHOA 1YR8A 1OYWA 2H1LA 1G19A 3ZH9B 1YU9A 1Q3HA 2C03A 1E94E 1EXMA 3K70C 3GLFA 5KNBA 3P27A 2NO1A 2NQ2C 2Z0MA 3AUXA 2QPAA 3QXHA 5EXXA 4TYWA 1NSFA 1W0KD 1PVOA 3TLXA 4Z51A 3KKMA 4P4SA 2OCAA 3PQCA 3W8RA 1JI0A 1S1CA 4KVAA 1R0YA 2KBEA 3N2EA 1ETUA 1KO5A 2J5XA 2Q6TA 4UKDA 4JLPA 1N25A 3AVXA 3F8TA 5CLQA 1QVAA 3KUCA 3EPJA 2JJ1D 4O3MA 5GADl 1KNQA 2GDJA 1ZD1A 1SVOA 1N5KA 2VHJA 2DPXA 3WP1B 3V00A 1W48A 1SQ5A 1XXHE 1Q44A 3NEYA 2WZQA 2ZAMA 4PSAA 3MFYA 1TAGA 1YZGA 4PFSA 3WP0A 4H1VA 5L8VA 2RGCA 4MDEA 2IUUA 5FUXA 4OJKA 2GXSA 2ZR0A 4U5XA 3HR7A 3T1QA 2GVZC 1KZ7B 1QHXA 1Q0UA 4Q1BA 1XCPA 2V1XA 4TQUS 3QF4A 4TQAA 2QROA 4IEIA 5GJVC 3A58B 1YHNA 2H7VA 1U94A 2ZUDA 1MRNA 1Z07A 1SVSA 1SKQA 4M1YA 1TF7A 4RZ3A 1OIVA 1GM5A 3WY9A 1I2MA 4YDHB 3WYAA 1L4UA 5AUPB 3NH6A 1EWQA 4MYTA 4AYWA 4LX0A 4DT1B 3IHLA 1TEXA 4V0OA 1P4SA 4C0SA 3A6PC 1U90A 1OLOA 1CLUA 1XMSA 4N3NA 4Q1CA 5AJZA 1CEEA 1IOZA 2IK8A 4IDQA 4PPGA 1G8YA 4ZPXA 2FEOA 4URYR 4BFZA 1N0WA 2ZYWX 4B6FA 2C9YA 3BFVA 4CZ2A 4YMUA 4D80A 3FPAA 1Q1BA 5FR1A 2GHIA 5JI2E 2F9MA 4PHHA 1LV7A 5JJLA 1BO6A 1QHSA 5BN3A 5BW8A 2C5LA 2QSZA 4EFMA 2QG6A 4OBEA 5JECA 2MMGA 2BHRA 5IK2A 5AUOB 2CVFA 1EK0A 2QU8A 2VEDA 2O5VA 3W3ZB 4TZ0A 1ZIPA 3U6KA 2G83A 5FBLB 1E98A 3NH9A 1Z0DA 3FOZA 2WSMA 2Q0HA 1E9AA 3I3SR 3TR5A 1GNPA 1X6VA 5EQTA 4AURA 1R6BX 1ZCAA 4Z1MD 5L3SB 3KQLA 2VO1A 2O8CA 2JJ1A 2GJ8A 4B3XA 2CJWA 4PAQA 4BZQA 5DIFA 3VR5A 1NN1A 1G16A 3VNVA 1ZD9A 2AFHE 1FP7A 4ZDKA 2VPPA 2FSIA 3FMOB 5K8LA 4BGDA 3H2YA 1VIYA 3AF2A 3I62A 3ZD7A 2FF7A 3CX8A 1IXRC 1DAFA 1P9WA 2CHGA 2GJKA 3TUIC 2HJVA 1HY3A 1JXOA 3TIFA 4A6XA 1G6HA 2VL7A 1QDEA 2OSBA 4G0NA 2VSOA 2ORVA 1S0UA 1FMLA 2A5FA 1FMJA 3BFXA 4RZ2A 2CDNA 1GRRA 1LF0A 2EQBA 2VP9A 3KQNA 4URUR 3HP1A 4MKIA 1DADA 2J0UB 1RC8A 4ARZB 3TJZA 4NDZA 521PA 1J90A 3KB2A 3OF5A 3D31A 4K8OA 3VR1A 2HF8A 4Q9LA 4QM7A 5CDFE 4A36A 3SFZA 2BCJQ 4DB4A 3F0TA 4G3XA 4CEHB 2JCSA 4L8GA 1G7TA 2VP2A 4GOJA 5CM8B 5EE1A 1MR3F 3HWSA 2UKDA 4XD7A 4EFNA 1G3IA 2CL7X 4KJZA 3WYFA 5TV2A 3H0KA 3DZDA 2HLDD 4KFUA 1ONBA 1IJFA 1W47A 1KGDA 4DHEA 2F43A 4M4SA 1ZNYA 3DOFA 1OH6A 3C15C 1E4VA 3L0SA 1XD9A 4QGFA 1HE1C 1E2MA 1FOEB 2F7SA 4M8NE 2IS6A 4MUAA 4QBFA 3UXMA 4KXFB 4XTCS 3EZFA 5FPHA 2ODEA 3A1UA 1FP6A 5DO9A 4LYAA 2QMOA 4EJSB 1Z3IX 4FWTA 2OAQ1 5KSOA 4HZUB 3MWLA 4OI1A 4WZBE 4B48A 3KFVA 4UJ3A 3QVVA 3BD9A 3GEHA 5FPTA 4PTLA 1I4TD 1F2TB 3RWOA 2PLRA 3KL4A 1C9KA 5TXGA 4ESHA 2C98A 3CLVA 3DVLA 1SHKA 2QAGB 3IIKA 1X8KA 4RD0A 5FUYA 4A4DA 5LB4A 4C4PA 2WWXA 1KMHA 2YINC 1T8UA 1ZC3A 4KYIB 4V0ME 2FSFA 2CK3D 1XD2B 3GFTA 1ZM7A 1ZM4A 1AS3A 4QFMA 4LHWA 1TMKA 3CW2A 2ZRDA 3W3AA 4PSKA 3PIRA 4NHOA 5AK0A 1GVNB 1W0JA 4JKIA 4D82A 2BKEA 1B23P 4FCWA 4RSGA 1Z47A 3KTAA 4TSFD 4C0KA 3AUYA 1U81A 4TTRA 2JJ2D 1T4GA 5KUTA 3I61A 2HV8A 3EWSA 2XSZA 2FWRA 1F48A 2XB4A 2CL0X 2W58A 3R20A 4FN5A 1G4UR 4DCUA 2AXNA 3CPJB 1KJYA 5CIQA 4DLXA 1VDZA 1H8ED 1N6HA 2OE2A 1PV4A 1AS2A 4YMSA 3UIEA 3RRZA 4JLDA 5K8IA 2EYUA 2YWEA 4NKRA 5FOVA 3T5DA 1M34E 4GP7A 1P75A 2R44A 3EG5A 4XOIA 1M2OB 1WBBA 4ON9A 2J7KA 2YJTD 4TT3D 3KX2A 4B47A 5FOUA 4GZLA 3KXLA 3QJYA 4B2IA 2XNDD 3B9PA 4HB4A 4DLVA 2QNRA 3RWMB 3PJRA 3SJZA 3VKHA 1EFCA 3FHCB 2NO7A 1A2BA 4DLUA 3CH5A 2GAOA 5DNYB 1K5DA 5GJWC 4S35A 3K0FA 1Z2AA 2CNWA 1E9EA 2XTZA 4GMDA 4QNMA 2ZR7A 1WBDA 4PO8A 3CR7A 1SXJB 1XEFA 1IN5A 5J40A 3U7EB 1MO6A 5C18A 1JB1A 3BORA 3K0SA 3ZIAA 3OAAD 1XZQA 3UG6A 3CF2A 4ZCLA 4RFSA 2Z4SA 3TNFA 3J81k 2BDTA 3WMFA 2VP5A 4C30A 4MA4A 1U8AA 2IEYA 2KSQA 5G3ZA 3RC3A 3F3YA 1OB2A 3ZD6A 1IONA 3JZMA 2Q3HA 1RPZA 3GLFE 2IXFA 5GVRA 4A15A 1E2GA 1ZU4A 2IF0A 4XH9B 3W8NA 3IKJA 1D6JA 1CJTC 1OT3A 4Q18A 1EX7A 1UM8A 1ZCBA 3VTKA 1DO2A 3SEAA 4ZI3A 2YNMA 1QBKC 1ZUIA 4ZDWA 3W6PA 4TMZA 2F1HA 4WA7A 3KUDA 3T1OA 1E2LA 1EGAA 3ASZA 2UVQA 3EC2A 3L82B 2FPMA 2W0MA 3U3KA 1VYUA 3HU1A 5JHGB 4YMVA 3AP2A 3LA6A 1W46A 1RYHA 4JJKA 3FGNA 4LJ4A 2FE4A 4UNSA 1HYQA 1E0JA 1KJZA 1OFTA 1WDTA 4FCVA 3WXMA 2YWHA 3GJ5A 3K09C 3CZQA 4JZKA 2J41A 3OIWA 4AYTA 1QZXA 2D7DA 1QRAA 2G3YA 2IA5A 4LBVA 1GG2A 4ZKEA 3DKPA 3LWNA 2CHQA 1CULC 3Q8XB 4RCYA 3OESA 1RRGA 4N1AA 2ZU0C 1RJ9A 2V7QA 2VTKA 1TTTA 4A9AA 2HEIA 3QKUA 4DCSA 3C41J 1OE0A 1LF5A 1P2VA 2NO6A 2O0HA 2ZJ5A 5JCZA 5GJBA 2E1RA 1VYVA 1TPZA 2ZI7A 3KZ1E 4JVMA 3RS5A 3GLGE 2J46A 3HYRA 3W6NA 3U3RA 2FSGA 3OIYA 4QBIA 1G3RA 4HYYA 4Z8YA 1MABA 2K5UA 3R9XA 1ZJ6A 2KB0A 3HR8A 2XX3A 2CEAA 1E1QA 4Q4LA 2RKOA 5FTJA 3WHLA 1W49A 4B44A 5C46F 3P32A 1AQUA 3CRQA 4B3BA 1G17A 2DFKB 2DFTA 2IHYA 1ZC4A 1F6BA 2ZREA 3PEYA 3Q7PA 4L9SA 1PLJA 5LD2C 1P9NA 2V54A 2IBMA 2B8WA 3CNNA 4MRRA 4CYMA 2PZFA 1IAQA 1SZPA 5C2JB 1OH8A 3VR3A 4CEIB 5J4LA 4MQBA 3HYTA 4B75A 1KO1A 3QVUA 1G4AE 2HYIC 2WJJA 3N5CA 4B3GA 4IXNA 1FW6A 1XJCA 2FFBA 2C04A 5EXPA 4DLWA 5JEEA 5AUQA 3QKSB 5H8WA 1NSTA 1EFRA 4EPRA 2JASA 1NNEA 4DRZA 1XX6A 5HPYB 4M9ZA 4JSTA 4UJ5A 1Q22A 4B3DA 2ZR9A 3QXJA 4Q7JB 2ZE5A 3B1ZA 1COWA 2BBTA 5BXQC 2O8DB 2O8FA 2O8EA 2P6RA 2G0TA 4URVR 3VR2A 3MWYW 1QHHB 4A92A 3UMFA 4G5GA 4LUCA 5AR1A 5BN4A 1SVMA 3RC8A 3CRRA 1X8JA 2BJWA 4F4IA 4TMVA 1II8B 5AJWA 2QM8A 3MSXA 2XXAA 2BMDA 3AB3A 4TL6A 4W5JA 5CJPA 2GBLC 4GRAA 4YC7A 2IS1A 1E0KA 1UPTA 1V43A 4BLSA 2CCGA 5CB6A 1DAHA 2PT7A 1DTSA 3VX3A 1I4LD 1EFTA 3REGA 3SZRA 5HTKA 3AKCA 2IWRA 4QBHA 1DOAA 3AGQA 4HAUA 2EFEB 4LBWA 3QG5A 2J87A 3A4MA 4NCIA 3NBFA 1OJLA 4DLSA 5TB5A 1D9XA 2AX4A 2WICA 4C9BA 3IO5A 2ZJBA 3CX7A 3HPRA 1NLFA 3Q72A 1XD8A 3VHLB 4Q47A 2WWFA 4FXPA 5FPKA 1KK3A 2PX3A 2ZS8A 1JEEA 1VG0B 4LHXA 3O8RA 4A8JB 5CK5A 1P2TA 4Q66C 4OKSA 2AWNA 2REBA 1QF9A 4I1OA 1ZU5A 2RGAA 4XWAA 4NYMR 4OHWA 4WOPA 2NO0A 3LH5A 2GA8A 4BLOA 1R7RA 1G5TA 3QSYA 1A4RA 3NC0C 1CR1A 1HURA 2ZSBA 4M22A 1YRBA 2ZXUA 3EARA 2OBLA 2IXGA 1KOFA 3QQ5A 4LK2A 2O52A 3LDAA 4IJMA 2BMFA 3ADKA 2KE5A 1KSGA 4AKHA 1ZNWA 4DDUA 3LLUA 1NN5A 4G5SA 2JIZA 5DGXA 3ZZ0A 4DKXA 5FH9A 4P4TA 1E3MA 1U8ZA 5GVSA 1G291 3BBPA 3FFBA 1SGWA 3LFUA 2ZJ2A 2GF0A 3O8BA 4EQ6A 1RW4A 1KMQA 1RZ3A 3OIUA 3QG1A 1P62B 5AJXA 3T1VA 4C0HA 4TMXA 3KJIA 2BEKA 3A1SA 3OFNA 3DM9B 3SYLA 3O47A 1RRFA 3FHTA 1TUIA 3D3QA 4Q4AA 3OEEA 1Z6AA 4CIDA 5EP4A 1DELA 3FKQA 3MJRA 1G5RA 2G77B 4XSHA 3NDPA 4R71A 3BFKA 2CCJA 4MGZR 4OQLA 4ABYA 1W36C 1VCMA 3ZQ6A 3PUXA 1SVKA 3K09A 3UWOA 4DUGD 5CDFA 2BKUA 1X1RA 1ZUNB 2C99A 3TSZA 3B13B 2TMKA 1CP2A 4US2R 2C8VA 2HT1A 4MRPA 1LW7A 2Q3FA 5F9FA 3LQRA 4TLEA 3LXRA 2YZ2A 1Z08A 4D2IA 1GSIA 1GTVA 4U7DA 4C2UA 5FBVB 5FBWB 2NOAA 4NYJR 3RS2A 3LD9A 1NF3A 1TADA 3E70C 4KVGA 3CBQA 3CRW1 3A8TA 4YMWA 3WMEA 5FBQB 4B35A 1Z5ZA 1XTKA 3C5CA 2ZRJA 2PCJA 2WBLC 2JDIA 2NGRA 3V4RA 3UATA 4C7OA 3RRMA 2QE7D 1US8B 1KSHA 2PT5A 2BMJA 3CO5A 4IOLA 5F3WB 1Q12A 4W9MC 1PUJA 3BH7A 3TMKA 3E5HA 4E22A 1N2CE 1G41A 1NN0A 1TQDA 4HB0A 4Q1FA 1XB2A 1MO4A 2OO7A 4K81B 3SBDA 3WYGA 1CF4A 1N6PA 2DY1A 1IN8A 1GNQA 5DHAA 1VMAA 5JWRA 3CUEF 1HA3A 1JBKA 1OIWA 2A5DA 2PEZA 2RGEA 2W6IA 4CEJB 2REXB 121PA 1JECA 4NYIR 1ELOA 4Q1DA 1GAJA 2GKSA 3CPEA 4GFDA 4JYCA 3U4QB 5FTKA 3U3OA 2Q3MA 4JL5A 3SJBA 1JJVA 421PA 2PJZA 2CXXA 2DWPA 1NVVR 4AG5A 5JS8A 1E2HA 1U98A 3GJ3A 4GPTA 2C77A 3EWAA 4MKHA 3HDTA 4BEJA 1YR7A 3T35A 4LDJA 5B58C 1E9FA 2BMEA 1G3QA 2FSHA 3IILA 1T6NA 4LJYA 2QRNA 1MRSA 4V0MA 6Q21A 1NI3A 4DDTA 2IHBA 1KI1A 1HE8B 2FA9A 3EAQA 1MT0A 4TMKA 2CLCX 3BB3A 1E4YA 4GMXA 4IFEA 4KYUA 1OFHA 2YYZA 5UKDA 4BE7B 1UBGA 2IYSA 5KSYA 3Q7QA 4DLTA 4V0NA 3PUWA 5EE5B 1U0HC 2OZEA 4PZLA 4ACAA 1UBEA 2ZU6A 4KAXA 5CYPA 1YJ5A 3PCRB 1IQPA 2VF7A 5G41A 5JRJA 5K8UA 3B8HA 2HYDA 5LPNA 5EXSA 3W5IA 1UBFA 4D26A 2WJHA 3M4YA 1JNYA 1YR6A 2ZJZA 4MKFA 2ZI3A 4HAXA 1GILA 3MGCA 4US0R 5IT5A 3THXB 3AF1A 1I4DD 3THYB 3AVTA 1TL7C 2OESA 4AIIA 3CWZA 3VR4A 2G0NA 2GBLA 4B71A 2LWIA 3AQ4A 5FOXA 1KSJA 2DCUA 3B1XA 4JT2A 3U44A 1E2JA 1Q3TA 1KHTA 1RFLA 2R65A 3TE6A 4RY2A 2C96A 1O87A 1Z0KA 2FFAA 4TMTA 3EA5A 4DB2A 1S96A 2QP3A 1XBTA 2ZM5A 2CLSA 4HDOB 1E96A 3WNBA 3Q5DA 1W4AA 3VKWA 3AM1A 2AWOA 2H16A 2VHUA 1X8LA 3NKVA 2QGNA 3IHWA 3Q85A 4E07A 1LTQA 4UNRA 2VH5R 4QG7A 1EX6A 2GEUA 2ATXA 4URZR 3LQQA 4BUJA 2QBYA 3B9QA 4G1UC 5SZJA 2JLUA 4CT5A 2F1IA 3MD0A 3AKEA 2W0SA 4NPHA 4WXRA 4P0TA 5DYGA 1DEKA 2AHOA 2HT6A 2GILA 4XVRA 5F98A 4PR0A 3TVTA 2P0EA 3OE7A 1P72A 1GL6A 4FI3C 1F3OA 5FOWA 1KY2A 1UDXA 1G7RA 2GEDA 4GBMA 3BAFA 3MRSA 5D3QA 1QVRA 1EFUA 1ZW6A 4OK3A 3CB4A 1WRBA 2PZEA 1R2QA 1J70A 1QG2A 3D6TB 4GSYA 3B1WA 3IEVA 2WSSA 1N6KA 2R6CA 3K53A 5FFMA 1B0UA 1CIPA 4BASA 4R98A 2VP0A 3CF0A 2PEYA 2WKQA 2FGKA 4YDSA 5JWHA 1TU3A 2NZ8A 4HDCA 2EW1A 2WVJA 2ZRAA 3SHFA 4D4JA 4JLMA 1UEIA 1P2SA 1TF5A 5H68A 4UNQA 3P26A 2H57A 3REFA 1OPXA 4PO1A 2QPTA 3K9NA 2QMHA 4TTPA 5EP1A 3FKSA 2R6AA 1F2UA 3BB1A 4Q4HB 4IDHA 4QHTA 3KQHA 2W2TA 1RRPA 3QPWA 2HXSA 2P3SA 5A4JA 1S1MA 2EWVA 3GLGA 1N5JA 1AKYA 4B73A 1NVUQ 2F6RA 2Z5FA 4LJ6A 3G82C 3GJ6A 4LCBA 3WMGA 2WJGA 1DG3A 1TQ6A 2ZITA 4WXPA 1TF2A 2FH5B 2NPFA 2OV2A 5DI3A 4KSCA 1D5CA 1CXZA 5E3HA 3ONWA 1JAIA 2FMXA 2ZRBA 3DM5A 1Z6YA 3AVYA 4A0HA 4RCZA 4LWZA 3KB1A 2QENA 2SHKA 3DO6A 3L2OB 3RNLA 4MDFA 4IFBA 1KI6A 2R62A 3K1JA 1YZNA 3E1SA 4LI0A 3OHMA 2QORA 3EIEA 1W0KA 2XEXA 1ZIOA 4QL3A 1MO5A 3IIMA 4KV9A 4HB3A 3ZZTA 5JSZB 3U7HB 2FN4A 4QXAA 5AJYA 1AJEA 1YRAA 2ZJYA 1AZSC 2Y8EA 5C4MA 2VRWA 2DFLA 1W7AA 2F1RA 2BC9A 5B57C 4BFYA 3TW8B 3ZVLA 1R0ZA 2ANBA 2XZLA 1R5NA 1E6CA 2CVHA 5E7MA 3RAPR 3P1JA 1XMIA 4NYMQ 3P4YA 1FQJA 4TLAA 1RVDA 1Z6GA 2GJAA 4JLBA 4U02A 4YLGA 3WBJA 1JQLB 2RGDA 2OT3B 1N6NA 4E03A 4TLDA 1KI4A 4EJSC 5EE9A 1LVGA 4JLKA 3IUYA 2ZS9A 4CRWB 2ONKA 4BLQA 3PEUA 1WA5A 4B6EA 3CH4B 1VTKA 1NMYA 1QHNA 5K8TA 4P31A 1E2EA 2J45A 1N6RA 1NBMD 2IYRA 1NJGA 3C4JA 3VX4A 1E1RD 2QAGC 4Q9KA 2JLRA 2JLYA 1ESNA 2B6HA 2IUSA 4ZI2A 2BM1A 4M1KA 3AH8A 3X1DA 3A36A 3I72A 3T34A 1E2FA 2RGNC 1S9HA 3MWJA 4LGMA 2QL6A 4Z54A 1OHHD 3GJXC 3GJ7A 2BM0A 4Q02A 1AK2A 1KTVA 1G5PA 2W2XA 2WOJA 1BMFD 5KNCA 4JL6A 4V0KA 3RS7A 3DHWC 3HU3A 1XEWX 2ZJ8A 1OW3B 4LC1A 2VIIA 2V3CC 5SZHB 4BQSA 4F4CA 4NYJQ 4A1FA 1CTQA 3ZVNA 1KIMA 4QHSA 2JEOA 2GRJA 1M74A 1S2MA 3QXCA 4WW0A 3X1ZA 4HATA 4C0LA 1XDBA 4MRVA 4AWXA 2WWGA 4DT1A 1FTSA 3EPHA 2BOVA 1OXTA 3RSOA 4Z1MA 2GZAA 2QQ0A 2YWFA 3BH6A 2CE7A 4ZIRB 4HLQB 1M7HA 2DWOA 2ZRCA 1IN6A 5EE0A 1EWRA 2WPDD 3GLIB 4B2PA 2QT1A 3NBXX 4MGYR 3FVQA 3K8YA 2XNSA 4NYIQ 3CPHA 3EPLA 4M9XA 4GOXA 1KDTA 5D3MB 3I8XA 1NG9A 1XTRA 3RHFA 4PPFA 1NVVQ 2GJ9A 2ZSAA 1K6MA 5CJ2A 1HQYE 2JLXA 1KI2A 1KO4A 3LRPA 4H1UA 2IYVA 3RS3A 1HUQA 2J1LA 1GP2A 2C9OA 3VQTA 1ZAKA 1N6IA 1F60A 2WJYA 4N0EA 5DN6D 5L3SA 4DEXA 2QI9C 4NCNA 3R8FA 4KODA 2MSEB 1AS0A 3Q3JB 3QKTA 3RRNA 3EZ7A 4LPSA 4MYCA 1G18A 3NBYC 1CJUC 4C2TA 3BRWD 2J7PD 3UMSA 2FV8A 3R9IA 4EDHA 1XF9A 1VG9B 4PSVA 1VCNA 2QUZA 2RGBA 1R5OA 4BFSA 4KI0A 2GK6A 1BIFA 2W00A 2PL3A 4KLNA 1EFHA 4QGAA 2HLDA 1KO8A 1DPFA 3U3JA 3C7KA 3FWYA 3QXXA 4Q21A 2IYYA 1BMFA 1E79D 2J0VA 3SQXA 3LAWA 4M2LA 4Q4JB 1QHIA 1XNJA 2PBRA 1E9RA 4M1WA 2G1KA 1Z0FA 2KI5A 5CM9C 4Q9HA 1UBCA 4N0DA 1N3BA 1WXQA 2J0UA 2P65A 4FCTA 4ARZA 3MUFA 5JEDA 1GIAA 4G5QA 3CF6R 3PXGA 4R2IA 5JRZA 2QP9X 721PA 4CEHA 2QQEA 1ZMXA 4AY2A 1Z6TA 4C0JA 2LKCA 3EZ2A 2W6JD 3LW8A 3U5ZB 3V4FA 3RS0A 4GP6A 1W4CA 2FG5A 4FIDA 1P73A 4MYUA 1XTSA 2XJ4A 3QKRA 2GCOB 4G01B 2GCPA 2A30A 2ZI9A 2D3WA 3TSOA 3HPQA 2ZE6A 3PG5A 4LJ7A 1XXHB 1S8FA 3GLHB 3IDQA 4QGGA 4AK9A 3R8CA 2XZPA 4RKEA 5E95A 1XP8A 2GXUA 4D0NA 1P9RA 1KSFX 2CK3A 1W5SA 3VFDA 4EFLA 2OUKA 2XOKD 5KU1A 4JIMA 3BERA 1NIPA 4M1MA 1SXJD 2A7QA 3KKQA 5BN5A 2CHVA 1RKBA 3B82A 4KBGA 1MKYA 2BV3A 3IGFA 3T12A 2GEVA 3NIBA 4TSFA 5EUQB 2LCFA 4EJSA 3DEFA 2JJ2A 1NLYA 1L2TA 1W4RA 3NVAA 4HZUA 3I5YA 2ZRLA 1G7CA 1HT2E 5DE3A 1ZINA 2VA8A 3I73A 5EUMA 2KBFA 3SC3A 2X8AA 1IY1A 3QF7A 3WRXC 1H8EA 2MSDB 1F2TA 1RIFA 1XTIA 2GJSA 2J7PA 3CKLA 4V03A 1WQ1R 4TWZA 4HZIA 3KJGA 3U60B 2QAGA 4IVRA 1UJ2A 4HUQB 3L0PA 4KFRA 1FX0B 4TT3A 1ZUHA 2WJIA 1CJVC 3UKDA 3X1WA 2RGGA 2B8TA 4B43A 1XU4A 4EUNA 5KHOC 3BB4A 2JJ8A 1GKIA 5EP3A 2XNDA 4JLOA 1Q1EA 1XD2A 2PMKA 2XAUA 3UMRA 4UXJA 2RGNA 2JLZA 3X1XA 2IF2A 3PEWA 1GRNA 4I4LA 2VP4A 1N5IA 1OYYA 3CIOA 1UEJA 4QJ5A 1GKYA 3BH0A 3RDPA 2ZE7A 4FMCF 1W1WA 5B30A 1L4YA 4DCVA 4F92B 1FUUA 3H86A 3AVQA 2D06A 2ZTSA 3OAAA 5JHHB 2ZSEA 1LS1A 2GETA 1K5GA 2AXPA 2ZPTX 3U3MA 4BZXA 5IF9A 5BWMA 4LHVA 1P6XA 1XPUA 2IT1A 1HV8A 4DCTA 1ZD8A 1NVXQ 3WRYC 3GJ0A 3B7GA 2N42A 2WWIA 2ERYA 1G8PA 3AF4A 1BS1A 3CZPA 1M7BA 1FUKA 2ZI6A 4D81A 4LV6A 2OILA 3SU8A 4YQFA 1A1VA 4P32A 3A4NA 1HTWA 4XJXA 1OSNA 3OEHD 3I92A 3S1AB 2QPOA 4QHYA 1KI9A 2V6IA 2ODBA 3PV0A 4AG6A 1SXJA 5FBRB 1DS6A 4IEEA
chains in the Genus database with same CATH superfamily
4P92A 4Y9DA 1KEEA 3QE9Y 1VBFA 2FQQA 2EFJA 4ECEA 1LDEA 2IODA 4KG7A 4M60A 3OOYA 4DQVA 3LVRE 2DFVA 2JI8A 2H48A 1TA0A 1Z45A 2OOSA 3ELBA 3HV2A 4PANA 2B4AA 4YJGB 5ALQA 5BSWA 5J3JA 4WBSA 3L8ZA 2XVZA 5CLIA 3GJSA 4BKPA 4EG1A 3W5DA 4TYQA 3RREA 1RKQA 3W4KA 5LZ2A 3BSWA 4EI9A 3ZYCA 2ILVA 2Q5OA 4F6CA 2VJMB 5FFNA 2IHNA 4DLAA 5CAEA 3F3MA 2IBTA 3FYUC 1AZTA 2ZCUA 3OJXA 4R1LA 3WGGA 3A1NA 3E81A 3D7MA 3LVBA 2A9QA 4MKXA 3NRBA 4DNPA 1CR2A 3DZKA 4DG5A 2O8BB 4MW4A 2I6GA 3IV9A 1JIXA 4RZUA 3E2MA 2WK1A 2BF7A 1GGFA 1T13A 3AV3A 3CE9A 4AC9A 6YASA 3CONA 3HCOA 4Y7CA 3NR2A 1DAEA 3AVPA 3ETCA 3L84A 2WKRA 4KRYA 3JRXA 1VPTA 3DDHA 4B7ZA 5BR8B 1JILA 2CZGA 5AKEA 3RGWS 2AW5A 1LQ2A 1KDRA 1VJCA 2WABA 4KUHA 5LZ5A 1OX4B 2P8JA 3K9BA 2IELA 4C3VA 3LBNA 2H8KA 1MW8X 2Q50A 1EAYA 3T7TA 1LY1A 3ASUA 3HB0A 3R7BA 3TIIA 4C76A 3A2KA 1B42A 1PKXA 3F71A 1XLVA 5DOZA 3SVTA 4ECAA 3DLIA 2JJYA 3ZDQA 1IB6A 2NZ2A 4BO1A 4NMMA 3OQPA 3FY4A 3JR3A 1OOEA 4L78A 4BC0A 1KKLA 1Q14A 1M9NA 4WZBB 1DAMA 1HPLA 2B9EA 2M2IA 4FFBA 1X9HA 2JI4A 3VA7A 2YOGA 2Y1FA 1OVMA 3HXMA 5AI6A 5DCWA 5F4BA 4Z53A 4G09A 4BTEA 3PF8A 4KGVA 1E66A 4DCOA 3DC7A 3LPMA 2DTEA 3U40A 4C29A 1MIOB 5K2OA 3E3OA 3BS4A 4QG3A 1O8BA 4CL2A 1T5OA 4IHJB 5THXA 1YIDA 3OWXA 1JR3D 4R05A 4L75A 1DL5A 1C0IA 4ENVA 3CUYA 3FPFA 1DG1G 1X7YA 5C5EA 1VCOA 4D25A 3MK31 2K2QB 4QDZA 2NIPA 3HO8A 3WV5A 4RL4A 4AVYA 1GEGA 1UADA 4GOOD 1B74A 3HXPA 3KLOA 3LUDA 2ZSDA 2FZ5A 3CCBA 3MJHA 1COZA 2EEZA 2J85A 3O03A 4FC6A 4UASA 3ABSB 3LQKA 4GXTA 1NE7A 1AF4A 4OVKA 3W1WA 5TF0A 1I10A 3JX9A 3FJYA 3PEVA 1NKTA 3D8UA 2Z2YA 3GFBA 4RIEA 3FWKA 4C4SA 1MX9A 5IULC 4CEIA 3ZEIA 4R2HA 4RH3A 4WZAB 1AA9A 1M34B 3AY0A 1QO7A 1WB6A 3CRMA 4MWTA 4RHFA 5LU9A 2HDHA 4NMWA 1II0A 1UK7A 4S24A 2PGJA 4REOA 3F78A 5CXQA 3KKPA 4I9UA 3HN6A 3MMXA 3FNHA 3QOWA 5J2TA 3ZZUA 3P20A 3SFVA 3AZOA 1X42A 3WJ2A 3NB0A 2WTMA 1WP9A 4NBVA 3SJCA 3E15A 5JQGA 2Q9BA 1XLTA 4L15A 4UDXX 2W2OA 2ZWAA 3TD9A 1CKEA 4LTDA 4AP5A 2VJLA 4BO4A 4Z9YA 1N0IA 1SELA 3RVRA 4B40A 2P78A 4R1TA 1Q7RA 1Y42X 1OZHA 2R751 1FQKA 4GZ5A 4J4TA 3LW7A 1P7ZA 4O0MA 3M4XA 4E2XA 2IZ6A 3OVMA 1VIMA 2B1JA 2I3DA 5I7VA 4TTQA 2GRUA 1QHHA 4QWMA 4XA8A 2JLWA 3B48A 4GKJB 1GQQA 4EO9A 5F7OA 3HSSA 1FZTA 3HA3A 1Z25A 2NTEA 2PX2A 4C7XA 3LCJA 2GZHA 2YZKA 4EL5A 4WIAA 2M6LA 5CCDA 3JALB 4XDYA 4KO3S 2Q4RA 4QSHA 4EHFA 4KR3A 4IRXA 2X13A 3HA7A 1G64A 2C92A 3RSLA 4DZRA 4EA7A 4BPBA 1C7EA 1WSDA 4L5CA 3BT7A 1GPAA 4Q3AA 2B78A 5AI0A 4HD8A 1QHYA 3VR6D 1PLLA 2XRYA 1BEZA 1GFIA 3HP4A 1P33A 2W98A 2JATA 2ZUCA 3DZJA 3KDAA 3N0XA 4MQ5A 2DBRA 4BNDA 4E09A 2H08A 1T6ZA 2QVZX 2NLOA 1ZN2A 2R8EA 3T3HA 2PPVA 2AL7A 1VPLA 1T0JB 3NOXA 4TWIA 4Y2YA 1RYNA 1S89A 1XWWA 1IK4A 1HWYA 1YQQA 2NUPA 1VSVA 3AQIA 3JQ6A 2GO7A 1XPRA 3M5PA 3U4DA 1KYIA 5LBIA 2OM2A 2YJGA 4RL6A 3UV7A 1PNOA 2O3QA 5JXGA 1B6RA 4W7SA 1N3LA 2WAAA 3LBYA 3TAUA 5FTLA 1JIQA 5ALUA 1X80A 4A8JA 4BWYA 4Z4GA 1CUYA 4HFMA 1YH3A 3MCUA 4F85A 4RY0A 3CA8A 4MW2A 4Y6GB 1FXUA 1TRHA 4LCJA 1B00A 3AGPA 1QRDA 2IEIA 4QDJA 4EH1A 1TIPA 2QUIA 2ZAOA 1M7GA 2GTIA 2R6ZA 2IYLD 4HGPA 1T24A 1C9MA 3AEKB 4N5DA 3WLOA 3WXBA 2LIPA 4MWOA 3SC6A 1W94A 1ECCA 3PC2A 4H6XA 4K3VA 5FI5A 2J59A 3BGVA 4Q34A 2J09A 5DBEX 1DC8A 3GBSA 1FTWA 1AHIA 3F7MA 4PHFA 4YAOA 5GWXA 1GYRA 1UXJA 4BMNA 4RDIA 1GPJA 1E0SA 1YKSA 3DUFB 4RXMA 3FJOA 2IBSA 2B21A 1G20E 1O3YA 3RC7A 1P4AA 3EIHA 1PAUA 1I3MA 1ZH0A 3IOCA 3R7NA 3EXG1 1QE3A 3GYGA 4HUJA 4RD3A 2BFDA 1T1GA 1P2FA 2DCMA 2H7YA 2H92A 2RCYA 2V7TA 1P19A 2JKYA 4K0RA 4OUKX 4PC3A 5ALKA 4ES6A 1UOQA 1GXSB 4CV3A 2YRWA 4PNZA 5E4TA 4YJ3F 4CMIA 4D4HA 1TAHA 2QE7A 4JBGA 2B8NA 4TKLA 5ALDA 1NTOA 1YFKA 3U1BA 2DH5A 1CVIA 2GBCA 2MTBA 1WKVA 3PWTA 3S27A 3T06B 1C50A 1A3CA 3EFEA 4G5HA 2IYWA 4DUPA 2XA2A 3A4LA 1Q0TA 5EJ2A 3RIHA 1Y4SA 1E59A 2DUNA 3KZKA 1DQRA 4EF6A 1AQ6A 4R0MA 1H93A 2F2TA 2DLCX 3MAJA 3ND8A 1JHRA 1XCJA 4GGMX 1JZTA 2EAUA 5B1SA 5TGTA 4MUFA 3IT1A 5CIWA 1U65A 1MXHA 2REOA 3PHIA 5GJCA 4AZ3A 3PFBA 1OROA 1DNPA 1I01A 2ZEJA 4MTLA 3C1OA 3K3PA 4Q82A 1UUFA 2VF5X 3A6ZA 3CZMA 3RB8A 1F20A 5AVSA 2RBEA 5L7YA 3V8RA 1KTIA 2CJWB 4XFKA 3H3JA 4LRUA 1VJRA 2OHVA 2WIAA 4OLJA 1US8A 3TB4A 1HKHA 5BMVA 1R74A 5B53A 3ADDA 1KYXA 2XGJA 3NTQA 4Q3DA 3TXAA 2OFOA 4D45A 1W52X 2HADA 5DM60 1IE3A 1T3LA 4ZEMA 1XQ9A 1EDBA 4J29A 3MELA 5DZSA 2QLMA 3OZAA 3HBJA 5COQA 3NTXA 3HUEA 4XQ0A 3T1TA 2G4CA 2QRZA 4AKGA 2AFVA 4AZVA 4JROA 1K7YA 2LTAA 4DQ0A 5L4NA 1CW2B 4NFLA 5ES4B 3VR5H 3AYXB 3SEQA 1NAHA 2AJCA 2BBWA 2ZIVB 4OHXA 5ES3A 1WAMA 1HDGO 1OIXA 1PSWA 1WPRA 3UM9A 1H69A 5KKNB 2C3OA 4K8RB 3I8OA 2I3BA 3QFTA 4KWHA 3X2SA 4E08A 4DCJA 1A7AA 1LLUA 2V7BA 2PWPA 5I9MA 5H83A 1PL0A 3LIPA 3LHKA 4HSEA 3DLAA 1RYFA 2M9MA 4P3YA 1E9BA 1JDPA 2ZE8A 1UJNA 2IUTA 3QU7A 1RI2A 4J3FA 4M37A 3N7TA 3NEJA 1LFDB 3T9DA 1JR6A 1DBPA 2Y2UA 2WHEA 4HLNA 2WC1A 4CUJA 5CLFA 2XQKA 3WIDA 1OXKB 3BHMA 1XPOA 2CSUA 1D8TA 1TQ2A 3KR0A 2JGMA 2AR7A 1V5EA 1T4CB 3HLTA 1D7OA 3DS8A 3ETNA 1MAVA 2H1RA 1J2TA 5DM0A 3TSWA 2BZSA 1VP9A 3ADOA 4QU0A 4XZ3A 1SQGA 3R5JA 4FT4A 5CLHA 4DNXA 5EJ8A 2F43B 5A9SB 4TVKA 1YF3A 1JG4A 2QD5A 4C05A 4FJ0A 1KH3A 1ZQ1A 4W5WA 1CY8A 4DFDA 3OF2A 4M1QA 3HYCA 5JNRA 1R5BA 4P1ZA 1BS2A 3N74A 3ZJYA 5CEFA 1GA1A 1PFVA 2FLKA 1IIBA 1D09A 2H1IA 2H5LA 2JHCA 2NUBA 2WD7B 2ZUBA 1C7RA 1QIMA 4IMIB 2O0KA 3ZU2A 3THYA 1P3Y1 3E58A 2F1JA 5E1MA 2AT1A 4CKBA 3K70B 2ZRGA 2Y1KA 5K2MA 2UXDB 5TIIA 2OK7A 4MVJE 1NWCA 4ZT3A 3KDSE 4QNRA 4CG1A 3E2IA 2IYXA 4A0RA 5F2OA 3OKFA 4D0SA 2DHQA 3TL2A 2GFIA 4XD7D 4AQ7A 4IMRA 4TM8A 3IT3A 3Q7TA 1R8SA 4ZK6A 2H2AA 3HDGA 5FULA 5I9NA 5CRIA 3TTTA 1QFSA 5DHSA 5KC8A 1KVTA 1M8GA 3BTUA 1Z4QA 3EA4A 3HYLA 3IDFA 3ILXA 1XHLA 4HDNB 1JW9B 1KMHB 4IKPA 4DXAA 2HZBA 5EWLA 4DRXB 2ZI5A 1VPWA 1RRMA 3N8DA 2WILA 3DEYX 3GD7A 1CQPA 2QTHA 5DLEA 1AB5A 2OCBA 4R9NA 1CF9A 2OBNA 4G1MB 1NR5A 5LN1A 3FNGA 3LGAA 2YC2C 2RARA 1G2QA 2PU7A 3QQPA 4OCZA 4CIXA 2OGSA 1ZOOA 3R1IA 4IILA 7MDHA 4Z0PA 3KJEA 2ZRFA 3LNTA 1NE2A 2Z4RA 3SHWA 3BWMA 4AJHA 3H2GA 3FF4A 4OGKA 1MD9A 4W4TA 2AFRA 1MNQA 2EBHX 3TNLA 4OL0A 4Q3OA 1KL7A 1Q92A 1YB5A 2FU5C 2H1CA 3QJ5A 2YMPA 3W3AH 3DKKA 4UU0A 3CT4A 3K4HA 3RROA 1X1TA 1JDUA 1SULA 3PXXA 4Z7OB 2QAIA 4KQWA 3NBKA 4CR7A 3K0CC 5IM4A 3CR8A 4W5NA 1XO1A 2WAYA 1W6RA 5B1DA 4Y9UA 3KO8A 3LYAA 4UXIA 1TIKA 3DFZA 4EPYA 2CLFB 3PGXA 1W44A 4CKWB 1A04A 4LHYA 5IKOA 3TW4A 2V1UA 1CV2A 5A9RA 1NQVA 1Y9JA 1SUPA 1YJAA 3BK7A 4C07A 4DWWA 1QHGA 4XTRA 4FE3A 2QEQA 2IYUA 3V6MA 4BLPA 4CV0A 4LHSA 3W2HA 1H4QA 1DJQA 4WESA 5KJCA 3ZNPA 4NBRA 1P1JA 4C1BA 1ND6A 5JS6A 3K0FB 1Z8NA 1KAEA 5CFQA 1CUHA 3NP7A 3UAXA 2W2KA 3EOZA 4Z3DA 1UXKA 2XSZD 4GPEA 2I66A 4RVGA 5LNK1 4W5QA 2JFUA 4FR0A 4B7XA 5HM8A 4WY8A 1GGNA 1A4IA 3CUVA 1J99A 1EUDB 1GO2A 2VXOA 4WUVA 4Y2JA 3SIPA 2DXIA 3S0JA 1TUEA 2O2XA 1E3IA 1BXGB 2JCYA 1BKDR 3OF3A 2X6TA 4YP6A 5B6JA 2HDNB 1J5PA 5IJAA 1FRZA 2AA3A 5EMKA 4BLTA 2AHRA 2G6TA 2XT6A 3KJHA 3EDOA 1EIZA 3I23A 3MMNA 4X85A 4OY3A 3DP7A 5IJ9B 2HHHB 1NY5A 1ZJ5A 2HBQA 2J3EA 2ONCA 2XXBA 1DRJA 2ZJFA 5K03A 2D5BA 3NPAA 4I66A 3IELA 3NT5A 1I2DA 3R3VA 4AXXA 5KIAA 5EIHA 3V1NA 4Z49A 5B3KA 5JXWA 2GAIA 4ZQBA 1N5RA 3KQMA 1USKA 4JY7A 4A82A 5DV9A 1YUNA 4YJ2B 3B1FA 5J5CA 4B3IA 2WT9A 2XQFA 5BT8A 4N6NA 2B1IA 2LKDA 4DSOA 2QX9A 1P6QA 4HUTA 2R79A 3JYPA 3KZNA 2XV1A 4MB0A 2QIOA 2KM1A 4NXMB 1EQ2A 5F4ZA 2JIQA 4F2HA 3W4JA 2HUPA 1RVV1 4QPDA 3WK6A 1UC5B 5CA0F 4C6SA 4II2A 4KR2A 2BFCB 4YRQA 3D02A 1ZLYA 1Q15A 5AVQA 5A3RA 3KYCA 4YUXA 3V8QA 4UXHA 1EFVB 2ZQYA 1JPJA 2Z6VA 3A2LA 1WNTA 3D4BA 2AZ4A 2QJTA 2X9NA 3QXSA 4N7JA 4BJ1A 1R9NA 4BZZA 4Y2PA 4V02A 1Y4UA 4D4KA 3FYCA 1FSZA 1UOOA 4IIFA 2D1SA 3PITA 4R7ZA 1A8UA 3CEAA 4NDNE 1E2NA 2QZSA 3B78A 4NAVA 1WDWB 3D8RA 5F5NA 5DNDA 4ZOLB 3DVAB 4N82A 5KOHA 3O3OB 1LNQA 4OYHA 3DD1A 3WDSA 2QL7A 2CDRA 2X3UA 1O95D 4EKDA 1OHHA 4WVFA 2E82A 2IUYA 2EGUA 3FFWA 4IKOA 3ANMA 1R0BA 2PZKA 1A8PA 1S2IA 5JCOC 2QTBA 1KDOA 3R9XB 1APBA 3OLYA 1XYVA 1C3JA 2W11A 2QRUA 5HQTA 1K7SN 1W4LA 2Y0BA 3KSZO 1L5QA 1E9CA 1GARA 1O5OA 2DQSA 1B6TA 2ECKA 2FWNA 1JEQB 5IZCC 3TLEA 2ZSJA 5HM6A 3L0IB 3B12A 3IBGA 3QEJA 3KSMA 2I1QA 4MHOA 3WWDA 1FNBA 1KDPA 4HWTA 1LVUA 2ZRPA 4LZWA 3WNQA 5IHPA 1WPGA 1JL3A 5EI5A 5JS7A 1T9CA 3FMIA 1CJKC 3P2YA 2A2ZA 1DCTA 1XV5A 1BDBA 3HCAA 1GDDA 1YB4A 1PWZA 3FB4A 5CPBA 2O57A 3KYIB 2J3DA 4F1KA 1NLMA 4JLJA 2RJ3A 3V8PA 2WPDA 4PEVA 1ZHFA 5KYKA 4DUYB 3JQGB 4QTXA 3WQBA 1ZSNA 5BUSA 4M38A 1ZCFA 2W2LD 3KAJA 3L07A 1GU7A 4L9WA 3DAFA 2F3SA 4R7GA 3TSCA 2EZUA 1NJ2A 3K1AA 4A6PA 4FX2A 1MH1A 4PBSA 2GB4A 2KWIA 3QP9A 5JI3E 3EGVA 3V9AA 1OKKD 4MIEA 3UA3A 1IXSB 4F3NA 2P9ZA 4MS3B 2BTQB 3C98A 4QE3A 2JFGA 4WRRA 4HVLA 5CEJA 2BWJA 2C9CA 3O4RA 3JYNA 3FVVA 5JFGA 4IINA 1IOVA 4CMEA 2O8EB 3MTEA 1OX6A 2HY7A 4A10A 4WCFB 4R16A 3EB9A 2JGNA 2QA5A 2WG1A 2PH1A 4KFTA 4ZIRA 5LIRA 3NVMB 2W2NA 3U6BA 3TL6A 1Q5PA 2H54A 3MT8A 1BJTA 3BRWA 4X24A 3WBKA 2IKQA 3X1YA 2HJSA 1JKIA 1IIRA 1UJBA 1M2FA 3Q10A 4RYDA 4P4NA 3E35A 4YALA 3CEHA 1HEIA 1B1AA 2OP1A 3QEMA 2BN4A 4HDQB 2XUKA 3S2ZA 2Z8YA 4G85A 1RXSA 4ITRC 2J9GA 3A26A 4WKCA 2G5CA 2XB6A 1S7GA 2GN8A 3PD7A 4J0JA 4PLZA 1ZL2A 3RRYA 2GESA 1R64A 2OSVA 4B7CA 3MUEA 1E79A 2FDCA 4NAUA 4OI2A 5E9WA 2OKGA 5HQ3A 2FRDA 1RZRA 4D4LA 4YRBA 1SHJA 1T8PA 4KXMA 3M2PA 4XQEA 1A76A 2QTFA 5FUQA 2P2DA 2O3SA 3K9GA 2F8LA 2Y66A 3IMFA 2CKMA 2GF9A 1PGJA 2VRNA 3QOFA 1ZX1A 2ZDGA 3KV1A 4CLRB 5LQNA 3RQSA 3SM3A 5JLJA 2RHTA 2WNIA 3SICE 5AVXA 1UAAA 2WNSA 1J7JA 4K03A 3AY7A 5IBQA 2X6RA 5HIAA 4ESOA 4LF5B 1Z38A 4QOEA 4UBJA 1JIIA 4U0KA 3A1VA 4DIDA 2W6JA 1R6TA 4N6OA 2A4MA 1BFDA 1QCCA 2OXCA 1NULA 2QGFA 1O94A 3DCJA 3HJRA 1RYZA 3LG2A 3EGIA 3OFKA 5KX5B 2Z6AA 1UXGA 4Q19A 4F12A 3C5WP 1RE0A 2C95A 4MQEB 1UFQA 2D1QA 4X20A 1OZGA 1QOZA 1VYHA 3IQXA 4FE7A 4GWLA 4JJ8A 5CK4A 5CW1A 3PNQA 5FQNA 3D4PA 2OENG 3DPUA 2AFHB 4NU6A 3D7LA 1HI9A 2YIDA 3DE2X 2ZVQX 3QWBA 5FLYA 5FL7D 5I7SA 1EJ0A 2P68A 4ESVA 3WNVA 1SOUA 2PJDA 4XSGA 3FCYA 3HXOA 2AGVA 2JVJA 3IKLA 1IDOA 3IAM1 1T9HA 3R3JA 1XTQA 4NU8X 1RQGA 1U3CA 4ROSA 4U3JB 1Y80A 1AKMA 3Q3EA 2QRPA 4DNQA 1FU8A 2Q6KA 3D6FA 3ZVRA 4QPNA 2XTNA 5DLQC 4W9NA 3ULKA 3I32A 1P0MA 2C9MA 3E18A 3RYIA 5G0TA 2JGRA 1CJSA 2Q9CA 3BXPA 3R5XA 5K20A 4OQFA 2XF8A 3MXTA 3NG1A 2HXYA 3PHHA 1G8HA 1Z28A 4UOZA 2QTLA 2BCGY 5TMBA 1HLPA 3IQEA 2JLVA 4WPGA 3TRFA 4JI8B 2AI1A 3L4SO 3HUTA 3L8FA 3ILVA 3JQBA 2JH8A 3NHPA 4S2EA 3CLTC 3MA0A 5IJXA 4NV0A 3CLRC 1E5LA 3RRJA 1ZZGA 4OXYA 3SQLA 2R6FA 1NBIA 1QTNA 4WOKA 4IIBA 4ETMA 1DAGA 4Z1OA 4CM5A 3VM6A 3K0HA 5JO9A 3UZUA 2JIZD 1EGHA 4OQPA 1NI5A 4EF5A 2FQWA 3JYOA 4J0FA 1YZ3A 3W9UA 4CGZA 4DYDA 2ZYUX 3RE1A 1IB0A 3OFND 1JJ7A 4JX8A 4PPQA 1RACA 2ZP1A 3GFOA 2OAP1 3ASYA 3BJMA 4IPTA 4JP5A 1VLZA 2MHCA 2PN1A 3ZY4A 4PLFA 5AYVA 4C7OB 2WKSA 3WIBA 3KOXA 4ZJZA 5I4CA 2FMTA 3U3ZA 2RE8A 4O4HA 3VYRB 5DNCA 4ZYXA 1SU8A 2IQ5A 3MJTA 2D4HA 5HR5A 1YMUA 4IWYA 4HI0E 4UEWA 2AG0A 2IYNA 3IR5A 3OOHA 3QZUA 4MVJA 4BMCA 1KO7A 2X9VA 4E5UA 2HH9A 1OI3A 1KK0A 2A86A 5A06A 5JANA 1QRSA 2IHVA 1GNLA 1V5WA 3A9CA 4E15A 1R4AA 3K20A 2ENWA 4FSXA 4LG1A 5FP0A 1JVNA 3UGJA 3FSRA 4QOGA 1B3RA 2JKVA 1T0HB 2Q29A 4DMGA 5I7EA 5HF9A 1G8SA 1W35A 1BDMA 1Z6QA 1MU0A 2D2FA 1BWSA 4TOIA 2JD1A 3BMNB 4RVNA 3U4GA 2QYTA 2ZPAA 5P21A 1E2IA 1XSEA 2QV0A 3F2VA 4WLUA 5JQWA 3TH5A 3PFIA 1VXOA 4KXQA 2IWHA 2XE7A 1CWUA 1J0BA 4JBYA 1XMXA 3PRHA 4EPXA 3UCXA 2KQUA 3I34X 5DDIP 4YN3A 4BRUA 4KITB 3BUSA 1TO6A 4RD1A 1N5MA 4XYLA 3A6LA 3Q0TA 1AXRA 1KE2A 1CQZA 1CZRA 4KL8S 4PLHA 4NI5A 4D8WA 1Y6FA 3SE7A 2EZ4A 2VSNA 4L73A 2NV2B 5CB4A 5L40A 1T91A 1SUSA 1AB6A 4MARA 4P4UA 4OHPA 4L4UA 3E7XA 5GP1A 3R0XA 3UB4A 2WIDA 1NF9A 2HK8A 4R1SA 4RSRA 4UVDA 5B1YA 4PQFA 1H9BA 1RQLA 1JR2A 2C4MA 4RZSA 5F9MA 4OSOA 3TVYA 2DP4E 1BYIA 2BBSA 2YVUA 3W34A 2ISQA 1K8ZB 2DULA 4L0CA 3UJCA 3PICA 4CFYA 4EI8A 1THMA 1U2DA 2CHFA 2BFBB 3INRA 4X8HA 5DHFA 5IC5A 3ZU4A 1G3MA 1TX4B 1YE3A 3B6IA 2QUJA 4UTXA 1WHTA 1W0CA 4I99A 4L76A 5LFAA 4L4YA 1G60A 1YVPA 1Q83A 3OZTA 1Q77A 3HBNA 3P2OA 4LC0A 4URWR 4HQOA 4ZT5A 4E14A 3U44B 1A9ZA 4G4JA 3OCZA 4IX1A 3PXBA 1HT1E 2J8ZA 1X9IA 4FNMA 3E1GA 4YMLA 1E8MA 1F9EA 2NUAA 3PLNA 3TCXB 1SQ6A 1BXKA 2HIAA 2VF8A 3EFOB 4PYKA 2B30A 4PHGA 4Q7KA 3U2QA 1T3HA 1DMSA 3U7FB 1L1FA 3DZCA 5AW2A 1ENOA 1G0NA 3AKYA 3VR4H 2FZWA 3ID6C 3WHKA 2XXJA 3JZFA 5ICEA 3N2IA 5JAMA 3F73A 3WIUA 1IU9A 3KOOA 5BPFA 1UM9A 4PVDA 5K3SA 2ID9A 2VHWA 1N6LA 3L18A 5JCPA 2QBYB 3SX0A 4HWPA 1R15A 3HNOA 4DSZA 4ZGWA 2VRCD 4NZMA 3GT4A 2JLSA 5ENVA 2F4VB 2EFCB 3FUXA 3NDRA 4PS1A 3VU9A 3WGNA 3C16C 3O8LA 5HMLA 1CQIA 1VL0A 2P3LA 1VECA 4TVOA 1IATA 3ZGOA 2MSWA 1ZNZA 3ISJA 2IYZA 4JK3A 3L6EA 1MB2A 5JZVA 2PKCA 1ZJWA 3W5HA 2J9XB 3LP5A 2HMWA 2V7PA 3W7VA 1JHAA 1T2CA 4JVSB 3WMWA 2GS9A 2A0KA 5J47A 5K0JA 3TIXB 4OM8A 1I1NA 1O1YA 3NGLA 4Q6WA 3SK0A 2NT4A 1VYTA 3CO0S 1RWNA 5T6MA 3ZDEA 4DA9A 5ISMA 1POWA 3K0AA 5DHUA 1AT1A 2IZOA 2OTCA 2ZYTX 3IUJA 1AU9A 3P97A 3NU1A 4FW9A 4XYEA 5A5GA 2R5NA 3FPSA 1OLUA 2CEKA 5AKJA 2YUTA 2QLNA 1YL5A 3IUSA 1ZIXA 4C04A 3RJMA 4NCKA 4COOA 2FSVA 2W71A 2P75A 1VCHA 2XT0A 2ZAGA 2C4HA 3G7NA 3UCFA 3V1UA 2QNBA 2Q3EA 4G9EA 4YVFA 1R4MA 4FMDF 5AM0A 5CTAA 3UAOA 1E2QA 4DIEA 4HAIA 4O08A 1NG1A 4RADA 1WXXA 1AQIA 1JI3A 3L8DA 1IHUA 5FLXA 3DBLA 1G21E 2FY8A 1C3LA 5BUCA 3JYLA 3A6KA 3OZBA 5CT6A 4FGKA 2NACA 3FCSB 4WACA 5J2TF 2G5PA 5JDCC 2OWDA 4NF2A 2RGWA 4A1OA 2J4CA 1A2KC 5JISA 1UAYA 2Q6VA 1SC3A 3FWZA 5JQGF 4RANA 4KO4S 3OICA 2Y92A 4CQLB 3SXUB 1SWWA 2VN8A 1AUPA 1XZPA 3GFFA 2NU9B 3TM4A 3FYHA 1S6YA 2GFQA 1S3GA 3JVVA 2Z04A 5JG7A 3E05A 4GNKA 4QRHA 3ZV5A 1WB9A 1X1SA 1FLNA 2FOIA 5IARA 2A3RA 3JWEA 1R10A 1UJCA 2C5SA 4X0EA 5AUNB 1UBSB 3IVGA 4O63O 4O4JF 1D2RA 2FX3A 5DH9A 2QYHA 5FXMA 2A9KA 3W9YA 1QS0A 3ONEA 3AVWA 2DBQA 4LOLA 3GMTA 4XM1A 3GZNA 1QFZA 1TYAE 5IW8A 1NXVA 1IUOA 2PRSA 2VJDA 3QEOA 2ZSHA 4IGEA 4B34A 4GI2A 5JBQA 1DHTA 2PVCA 2EBFX 4JH0A 1KKMA 4MLCA 4Y0AA 1SKYE 2B37A 4BFUA 2VHCA 2V9ZA 3E5RA 4RTOA 1KI6B 2GYYA 2GEBA 2YJ3A 3FDZA 4GLBA 3SLGA 5C35A 4R69A 1V4VA 2F55A 1BOFA 4Q9NA 5ITSA 2QJFA 1Y34E 2X5NA 5A7HA 5EE3A 1NJ5A 3T4PA 3CSUA 4UD6A 1ZYUA 2ZDHA 3A7EA 4KGXA 3TVDA 3QE0A 4JLVA 2NSJA 4URHA 4AF6A 2VDOB 1SKBA 4Z7NB 5A0TA 5FO0A 2W48A 5CM2Z 1ZPDA 1OAOC 1H2HA 2EJBA 1E63A 4OQNA 4LYFA 1S7CA 1MJ5A 1V5FA 2R7NA 3QH4A 4BECA 2C2HA 3HY6A 4YCDA 3WZMA 5EJ9A 1II9A 4L9RA 4G0PA 4IHQA 4URXR 3QE2A 4RD2A 4U2DA 1FRNA 1X3SA 4IIEA 3G88A 1SXQA 1NMZA 2QY9A 2XMCA 4X1KB 4BNIA 1HSOA 3OA2A 5A6SA 1VGQA 3FVWA 3JAWA 4BWFB 1IJEA 4QOJA 3FHOA 4EEXA 1YR8A 4QRIA 3ZH9B 2Z1DA 1UFKA 3NM6B 1NFRA 2YRXA 4PX2A 5AVYA 3KNZA 3MT0A 1T43A 5DSXA 1E7RA 1U8EA 3AJRA 4GX1A 5E1DA 5KNBA 3ANXA 2X6QA 3AUXA 5GTDA 3LT4A 3M5CA 2BFPA 3CX3A 2DPHA 1L5MA 2ZBDA 1XAJA 1W0KD 1MF7A 4DJDC 1SCIA 1RWOA 2XEDA 3L4EA 3RLIA 1B15A 3N3BC 4P4SA 4NEHB 3Q0EA 3W8RA 2I8AA 3CINA 4TXJA 3D64A 2KBEA 5JJCA 1DQSA 1TU0A 1JTEA 3NHKA 4JLPA 3UT0A 2J9FA 4UHJA 5ERGB 2PDAA 1SN7A 4TKZA 1V7PC 1FUEA 5CLQA 3VZPA 4JB2A 3RTDA 3NVKI 3MTJA 4MI1A 3A6FA 4P7KA 1TVKA 1SVOA 3HEBA 2FPGA 1N5KA 1ZI8A 4PG5A 4TM7A 5ERXA 1YVRA 4R41A 5HSGA 1W48A 4EJFA 2X2OA 5JCJA 1CUCA 3WP0A 4CG0A 2D4AA 4I5FA 1QUFA 3T5MA 5FUXA 1M1YB 4RJ2A 3GAMA 4NPCA 4OQQA 4RTSA 2QMZA 3JYHA 5BYBA 2M1ZA 3OSZA 3GVPA 3LC2O 4UEQA 2AJ8A 4FYYA 4D9HA 2D0DA 2FWJA 1KXJA 1LI4A 1PZHA 3F6BX 3ET5A 4TQUS 1EVJA 4BEWA 2VQFB 4TQAA 2QROA 3AHGA 4G0OA 4IEIA 5L6MB 1TI7A 3I9KA 1YHNA 2ZUDA 4X90A 3S29A 1N92A 3PE3A 1SKQA 4LXYA 1TAQA 4RPJA 5IBCA 1H3NA 1TF7A 5JMWA 1V9CA 5D8DA 1GM5A 4S1OA 3GWGA 3R7LA 1JHYA 4BO3A 3DMHA 3NUZA 1HO3A 4NQZA 2PQ0A 3G2JA 3IA7A 3E9QA 1FNSA 4Y1RB 4DT1B 4FU0A 1TEXA 3S2SA 1NX9A 3ZHCA 2HRRA 5CURA 2E4XA 4N3NA 3KG2A 2J07A 3COZA 1IOZA 4TRMA 5J43A 4PPGA 4ZPXA 1O6FA 2FN7A 1QV6A 4EDHA 1QIHA 2XTJA 1FFCA 2B5WA 3OO0A 2FETA 1Q1BA 3MPUA 2C7RA 3DQZA 1WIWA 4PLPA 2GHIA 3BZBA 4BV2A 5KNCD 1V11A 4BIMA 4E5DA 1P74A 1PBNA 5C9ZA 1QHSA 3TQIA 4YRFA 2HFJA 4GF5A 4B9AA 2JRCA 1FP1D 2QSZA 4D6YA 4EFMA 2BEUB 3BXOA 3HADA 4OBEA 5DKFA 3ZK8A 4J16C 3O9ZA 5IK2A 3CURA 5AUOB 4OHOA 5L6LB 1WOMA 4D9MA 1FTYA 2VEDA 1ZIPA 2YVQA 4LDNA 3AOEA 1THZA 1CHNA 4OFXA 3RW9A 2WB2A 4C7JA 3VRHA 2BZGA 4NZOA 4L8FA 2WSMA 1X87A 3SWWA 1H22A 2WD9A 1IHYA 3TR5A 1B6GA 1GNPA 4AURA 3H9QA 4Z1MD 3VYWA 1V9SA 3IVXA 5BP7A 2O8CA 2RI6A 4B3XA 3BGDA 3CUTA 1X1EA 2PIDA 4PAQA 5E4JA 1FW8A 1EP3B 4EYKA 2K87A 1A50B 5DIFA 3X44A 1REQB 1E64A 3ZKAA 2C7GA 2CV0A 2BGKA 4KQ9A 3H5WA 4DC0A 1FP7A 1SOVA 1ZZEA 2WFAA 3NNSA 4GYJA 2VPPA 1MB0A 1Z35A 3FMOB 2WVAA 4ZDKA 3K72B 4HSGA 1U28A 2I22A 2PX5A 3MN1A 3ZHZA 1VIYA 3N0VA 3PNYA 4NFHA 1XZCA 3ZD7A 3P0JA 3JYQA 5JD6A 1OYVA 1OGJA 4BJ6A 1R5JA 3GEMA 4GPIB 2WIJA 3G8BA 2WM3A 4AJKA 2HJVA 3L6OO 1MT3A 2Y1CA 4K05A 2Z09A 4G0NA 4Z6KA 1J2RA 1WCIB 1DHRA 3NQ41 5EHIA 2ORVA 2QLFA 4P80A 4RA6A 1J49A 3D1VA 3H9GA 4LKRA 4RPLA 3BFXA 3WIEA 4D8VA 5HS4A 3QE4A 5BUZA 1CR6A 3GAAA 2J0UB 2O9JA 5C8XA 4NDZA 3D3EA 4QUIA 3ILHA 1XXLA 2CLHB 3OF5A 4EELA 5KTRA 1C14A 5LQRA 3K94A 2JGDA 4A36A 3SFZA 2BCJQ 2YW2A 3F0TA 1U7DA 1DIOB 3JATB 3FGOA 4X7BA 1SMKA 2JGLA 3D7SA 1JBEA 3GPIA 5EE1A 5JXIA 2WTAA 1PZMA 1MR3F 2PAFA 3HWSA 1RHRA 3D7NA 1G3IA 2XGOA 3SZ3A 2D13A 1FJXA 1RJWA 3O6VA 4KK4A 4MS4A 4ITVA 4KFUA 1MA0A 1YDWA 1IJFA 1K3UB 3RTAA 4DHEA 3TLBA 2PMCA 4M4SA 4AJPA 3M6XA 4K40A 4MLZA 1PWHA 2HCFA 1ORWA 3BJRA 4K5QA 2HAEA 5DBIA 3LL4A 1KOLA 3I45A 5G2OA 4EEKA 1FOEB 1FU4A 1P1KA 3GA0A 4W8GA 3P52A 4PINA 3DUWA 3CFYA 3OPNA 3UXMA 3IE2A 4HDRA 4K9RA 4XTCS 4DYHA 4YJFA 1V26A 5CNKA 3WBBA 4MW7A 3QVTA 1J1IA 3V8VA 5K4AA 4D9BA 4ETNA 4KE8A 3T4UA 2QMOA 4EJSB 1Z3IX 3E7WA 1DIHA 1KMIY 3ZCSA 1OFVA 4IAOA 4RELA 3C87A 4N41A 2J3IA 5KSOA 2ZIXA 3QHAA 3PRKE 4RS3A 4WZBE 4B48A 1DU4A 2C0QA 3GR6A 3KFVA 3L79A 3BD9A 4N9WA 5B3JC 3KT0A 4GLJA 1F2TB 4RVOA 5HRCA 5LQDA 1G8MA 1EWVA 1TB4A 1DPGA 4ESHA 4IEFB 3DVLA 3CLVA 5FUYA 1SHKA 3IIKA 1X8KA 2JARA 3DNFA 1IAVA 3WGOA 1DG9A 3DE1X 4R9SA 4KYIB 4MQMA 2JBAA 3PPYA 1SBIA 2AZTA 2ZRDA 3NHWA 5JY6A 3IMEA 4H6VA 2BT4A 1W0JA 2ZR8A 3OFVA 2BKEA 1ZSYA 1BWPA 1Z47A 4C0KA 1T2FA 1V1RB 3PUIA 1Z39A 1JSCA 4JELA 4RK7A 4ZARA 2D5LA 2FWRA 1F48A 2XB4A 2W58A 2K2WA 3R20A 3E3LA 3KWFA 4V3BA 2OQRA 1M0WA 2BHTA 3DKRA 3E9NA 4DCUA 4EGCB 1CK4A 1V39A 2AXNA 2E2WA 5EEHA 5CIQA 1WW3A 1VDZA 2PLAA 4R2KA 1LSSA 3FPJA