4PHFA

Crystal structure of ypt7 covalently modified with gdp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
163
Chain Sequence
NILKVIILGDSGVGKTSLMHRYVNDKYSCTIGADFLTKEVTVDGDKVATMQVWDTGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YPT7
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis,exocytosis
total genus 46
structure length 163
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phfA00
1GL7A 2ECKA 4I99A 1W4BA 1L8QA 2OFXA 3B7GA 2KBEA 3U7FB 2H18A 3TK1A 3CH5A 3U44B 4L9SA 4LYAA 3C14C 4GT1A 1S3GA 3UG6A 2EU8A 2DWPA 4BFYA 4CF7A 1I4DD 1KOFA 1H8HA 2G77B 2H57A 3UWOA 4EJSC 1W36B 2J3EA 4TTRA 2OT3B 1DAHA 3N2EA 5DIFA 3WRXC 2GAAA 2ZE6A 2Q9AA 3I72A 3LO5A 2BKUA 4G5SA 4IDHA 4OI1A 2RH5A 1AZSC 1QZXA 1UKZA 4B6EA 2BWJA 2ZRDA 3AGPA 3VTKA 3Q7PA 3UXMA 4K8OA 3FFAA 1Z0KA 4IXMA 1R5BA 2PCJA 4DUGD 2DY1A 1WA5A 2NO1A 2IYTA 1P2VA 2ZAMA 3SJCA 5J4YA 1HV8A 1CJTC 4DDUA 3RDPA 4K46A 2ZRKA 1T4GA 4HB4A 4Q1FA 4F93B 3I62A 3AF0A 1ZAKA 4KFSA 2J45A 3QNUA 2ZI6A 2QP4A 4QG7A 4XTCS 4ZDJA 1MABA 3CF6R 4NCNA 4HAUA 4A2WA 4B2LA 4EKDA 2QT1A 3IIKA 4IVRA 2R62A 4NYMR 1GRNA 4LHYA 4MA4A 1G7RA 4N0EA 4OQFA 2BBTA 2HT1A 1KZGB 3BB4A 1BMFA 1NY5A 1SHKA 2B8WA 4GDFA 4TL9A 3VU9A 2QRNA 2QUZA 3K53A 3KTAB 2Q3FA 2BM0A 4EPVA 1S0UA 2GVZC 4B48A 1A5TA 3WMFA 1XD8A 3EX7C 3LFUA 1DE0A 5LD2C 5DH9A 4YMVA 2O0HA 4RY2A 1Q3TA 1UPTA 5FR2A 1GP2A 2WWIA 4TYQA 4TYWA 4Q7JB 1OHHA 3R7WB 2FWRA 3B2EA 5EP1A 2ZE7A 1GAJA 3HYTA 3PV0A 4IW3B 4NYJR 4O2LA 1E2HA 4NYIQ 4WXRA 4X8OA 4LI0A 2V7QD 2KE5A 1GWNA 1ZNXA 4I4LA 2BJVA 1DAIA 3SN6A 3FYHA 2ZRBA 3TIFA 3L0PA 2QENA 1P60A 4BQSA 1IM2A 4EPXA 2ZJ2A 3GJXC 1G8GA 4UNSA 4QHTA 3K8YA 4BUJA 3CX6A 3GCGA 5FBLB 3V9PA 2VSFA 3FB4A 4ACBA 1WBBA 4QJ3A 3CBQA 3OE7A 4JL5A 3PIRA 1VG0B 1DS6A 3PVSA 3REFA 2NO6A 3LD9A 3PG5A 4B33A 5DYGA 2XSZD 2DWOA 3W5JA 1NNEA 4D26A 5JMTA 4S35A 4Q02A 4BFSA 4DCVA 3OF5A 4JLDA 4BLTA 3NBXX 4YXWA 2ZRPA 1AKYA 2AHOA 3KKPA 2GXSA 3AP1A 3CM0A 1W36C 4YMSA 2F3RA 3L0OA 3EZ2A 2QP3A 4OI2A 1G18A 3JZMA 2GBLA 5JWOA 1AQYA 1RJ9B 4ARZB 2FJUA 1VG1A 4M53A 3LVQE 2ZSDA 3W6OA 3DL0A 4A82A 2ZJBA 4FWTA 1Q1QA 2WWGA 3WNCA 4IFEA 3A1WA 3B85A 3EPJA 5HKKD 1UJ2A 2VQSA 3QF4A 4IFBA 3AH8A 1RKBA 1P3JA 3GPLA 4LPSA 3TRFA 2CLDX 1K8RA 5LBIA 1E79D 3GLFE 2QI9C 5LPNA 1KNQA 2CK3D 2HLDD 4NYIR 4F4CA 2ZR9A 1CTQA 4QBFA 3CR7A 3GEIA 1R4AA 2FSIA 1YR7A 2WSMA 5FTJA 3CO5A 5CDFA 1E96A 4O0MA 2OCAA 2ODWA 3Q9LA 1NVWQ 2CE2X 1M7HA 1QHYA 1JBKA 2UZIR 3QKSB 4KU4A 4URUR 5BW8A 4O3MA 2OFWA 5SZJA 3ZS8A 3ADKA 1ZM7A 1G20E 1M8PA 2CLCX 1G3QA 3W90A 3MCAA 2GZHA 1ZU4A 2B7BA 2QY9A 1E1RA 3LXXA 2FA9A 1RYFA 3N2IA 4WAUA 5IDVA 4MGKR 4HUQA 4A9AA 3A4NA 1G6HA 3UKDA 2CNWD 1EFHA 3LQRA 3WMEA 5JI2E 1U8ZA 3KXLA 3NWJA 5CYPA 1OT3A 3B6EA 3HJNA 3NBFA 3CLVA 5TARA 1SULA 4E03A 1G17A 1XTJA 3GP8A 4Q7KA 1ZD1A 1OW3B 4M2LA 2ZRIA 4KI0A 1G1MA 3SI7A 1F2TB 4B2PA 4MDEA 4ABYA 1QBKC 3CRRA 3FHTA 4KSBA 1LFDB 5M04A 2QMEA 5KDLA 3WYGA 2ZIAA 1RVDA 2FG5A 2AR7A 3PEYA 2G0TA 1P62B 1KO1A 1G4AE 2OCYC 2YINC 4DLYA 1XPUA 4J0QA 2RGBA 5AK0A 4CEIA 4GOXA 2HDNB 4QHSA 2VL7A 2FPLA 4BFUA 4AIIA 1G8FA 5FPKA 5DI3B 2W0SA 1N6IA 1ZUNB 2IEYA 1E9CA 2BMEA 1II8A 5E7JA 1OYYA 1KI2A 5JECA 1NSFA 1T3SA 5FBWB 2O8DB 2IUSA 4HZUB 2J7PA 2Y8EA 2VBCA 3QPUA 3FKQA 1Z08A 1NLZA 2OILA 2EFHB 2W00A 4NKRA 1Q21A 2WM9B 5IF9A 1KMHA 3W34A 1VPLA 3FWYA 3IPXA 4G5RA 3GLIB 4QBHA 3U61B 2AXNA 4CT4B 3OESA 2WIBA 3AUYA 2JLXA 1E2LA 1ZM9A 4XSHA 2F9MA 3SYKA 1VCNA 1YZNA 4Q4AB 1P6XA 3LBIA 1NVXQ 2VPPA 2CL7X 4D4LA 2CJWB 3I5XA 4C0HA 2ZE8A 1HT1E 1MO6A 1U0LA 1XXHA 4Y0AA 3RWMB 4HATA 1O3YA 1JAIA 1A4RA 1FP7A 4IDNA 3T5DA 3THXA 4HB3A 3JZAA 4GPTA 1E9RA 1W48A 4NCHA 4RVCA 2QPTA 5LB2A 1KJZA 2ZI4A 4LBWA 2QPOA 3LH5A 2UVQA 3AB3A 4MYUA 1W49A 5G3YA 3WBJA 1Y3AA 3B60A 1F6BA 1N2CE 3RS5A 3A1VA 5GJBA 2JASA 4V0LA 2XAUA 1ZD8A 2OFOA 1MO4A 4U7DA 1GSIA 2G6BA 2C03A 2VF8A 2O8FA 3HPQA 1N0VC 4XJXA 4PANA 3PXGA 3VKHA 1DAGA 1W47A 3CRVA 3AVPA 2YWEA 3QG5A 4KLZA 5EE9A 2NZ8A 3R9WA 1NRJB 3I8SA 2IXGA 4M1SA 4LYJA 3S1AA 1XBTA 3WY9A 3K0CA 1OH8A 3FGNA 4HB0A 1BYUA 1NKSA 1UKVY 2R2AA 2REOA 1SVWA 5E95A 1XPRA 5EP2A 1XTSA 4ZI3A 4R7ZA 4PO9A 4G1UC 4AURA 4FMCB 5IRCD 3OAAD 4B71A 1XU4A 3NVAA 4CT5A 2GCPA 2IS2A 4BECA 1UFQA 3I1FA 4URWR 4PFSA 3DMDA 2ZETA 4FCVA 1OFIA 5FUXA 2GA8A 2QG6A 3EC2A 1BS1A 3LWNA 5ANRB 3SOPA 3DOEA 4FI3C 4MUAA 4URXR 3DO6A 4GFDA 1PVOA 1JECA 1ZNYA 1P2UA 3ASYA 1COWA 5AJYA 4A4DA 1OFUX 4JLOA 1N0WA 4G5GA 4CGZA 2G1JA 4YDHB 1YU9A 2GWHA 4N1AA 4OQMA 5D3MA 5ELXA 2OLKA 1KIMA 1I2MA 1U8AA 2FMXA 4TL7A 1H8EA 4EFMA 1IXZA 1XDBA 1R0WA 1V43A 2REBA 1XCGB 2JLSA 3QI2A 4W7SA 5KNBA 4MYHA 1U0JA 1G6OA 2FEOA 4NTZA 3U4QB 2AD5A 4BLSA 3FPAA 5B30A 5DNYB 2QTHA 3U7HB 4HLCA 1JALA 2WKPA 4C7OA 2N42A 4PHHA 2SHKA 2C95A 3Q5DA 4ZCLA 1LB1B 1AJEA 1P9RA 4L9WA 2D2EA 3IQXA 3VNUA 3M0EA 1TTTA 4N3NA 3GLHE 3R9IA 2YZ2A 1T3LA 4TZ6A 4UNPA 4A92A 5FOWA 3EZ7A 3D31A 4TWZA 1WDTA 2V54A 1F5NA 4MKHA 2QMUA 3Q72A 3KQLA 4US2R 2JLZA 1QHIA 1EFRD 1S9HA 1Z6XA 4TQUS 3BFXA 3AF4A 1ZP6A 4YMTA 2XNDA 4URVR 5KDDA 4XSGA 1FTSA 5J5CA 5L3SB 3KL4A 2H16A 4KYUA 1DVRA 3I3SR 4Q66C 2ZRAA 1U8YA 2WSSD 2PZGA 3T61A 1Q57A 4OYHA 4M0LA 3A6PC 4A6PA 1UKYA 5AUNB 4LHWA 4LUCA 2PX3A 2J46A 3N70A 4MYTA 3V4FA 2PLRA 1Y63A 4QHYA 5GVRA 1DADA 1HE8B 4CYMA 3VKGA 4KFRA 3RC8A 4B76A 2QEQA 1ZCAA 1QHXA 2HUPA 4JYCA 3X1WA 4EQ6B 3UPUA 4DC9A 2DFLA 3MJRA 4WZBE 2FGJA 4Q1CA 1VYTA 3EIHA 2ZU0C 2D4HA 1E2DA 2QTVB 2W6JD 1NLYA 1G291 1GRQA 2NOAA 4UNNA 2IYUA 2QM8A 4HAXA 2NG1A 2IWRA 2J0SA 2ASEA 3KTAA 1QHGA 2JLRA 3HDTA 2GVDC 2RKOA 1KK0A 3WP1B 1CR4A 2GF0A 5FTKA 2GCNA 4IVPA 1VTKA 3ZIAA 3ZGXA 1PV4A 5C46F 3QXHA 3DVLA 3O8DA 1SQ5A 4DB2A 4WZ6A 3F5FA 1AM4D 5JSZA 1OXVA 4R2HA 4YLGA 1RE0A 1WP9A 3C41J 3T1VA 1QDEA 2ODBA 4P4SB 3R7WA 4AKIA 5FUVA 2QBYB 4LJYA 1W7AA 3AF2A 3NBZC 3QPVA 2JJ2A 1GKYA 2Q6TA 2WKRA 5JJLA 1P72A 2VP9A 4BPBA 2B8TA 2GJKA 3BE4A 3KQUA 4NE2A 1MH1A 1FFHA 3ZZ0A 4NZYA 1ETUA 1IY2A 1NG1A 1YZGA 2ZREA 4TLCA 4KJZA 3LVRE 3FKSA 3EXAA 5JS8A 4FW9A 3CF2A 4I81A 2F55A 3OFNA 3TLXA 2JDID 1OB2A 4AD8A 2ZRHA 2K5UA 1VMAA 4MQBA 4O2RA 4QGAA 2PJRA 2C8VA 3SHWA 3T1QA 1L4YA 2F1IA 2REXB 3GEHA 4IOKA 5CLQA 3UMFA 3C7KA 3HU3A 4CIDA 4Q1EA 2JA1A 1DELA 1JAHA 1Z3IX 1G3RA 3VR1A 2EFGA 5BXQC 4PC2A 4Q9IA 3HYRA 5JHHB 3W6NA 5EXXA 5IHPA 3W9YA 5BN3A 5G41A 2QGNA 2YVUA 3A58B 2FZLA 4XTRA 3LLUA 3QVUA 4DBLC 1CEEA 4ZV4A 4G0NA 3OEED 2RCNA 2YKGA 4FWIB 5J40A 1S2MA 2Q9BA 3GMTA 1GVNB 3JVVA 3QY0A 4I1VA 1XMSA 2JJ8A 4JJZA 4DUGA 4A8JB 1RJ9A 3HPRA 5EP4A 4ARZA 4PHGA 3A4LA 2FN4A 1E69A 2BMDA 1BKDR 4PSVA 1U94A 5H68A 1CJMA 4BZXA 2LKDA 2RGCA 2ATVA 1KSFX 4P31A 1SXJB 4HAWA 4Q4HB 1TU3A 3GLGB 3SHFA 5C2JB 5IK2D 3ZS9A 2EFEB 1N0UA 2IXFA 3NH9A 4W5JA 3EPLA 2QE7D 3SQXA 1XEFA 5D3QA 1E4VA 3LAWA 1JB1A 2ZI7A 2C5LA 4TTQA 2R44A 1DAMA 3DKPA 4HDQB 3RS4A 1R0XA 1ZUHA 4JJKA 4LJ6A 3F3YA 3BFKA 3BH0A 4TL6A 3B78A 4ESVA 4UNRA 1KMQA 1LVGA 2QMHA 5HTKA 5BN4A 4V0OA 2X8AA 3RS7A 1UEIA 1ZJ6A 4M22A 1A82A 1W5TA 2J1LA 1II0A 4DCUA 1IJEA 2MMGA 4LYFA 1J90A 3WNBA 4LBVA 2AN9A 1TQDA 1Q1BA 5FL3A 1VCMA 4PHFA 2P6UA 3KXIA 2BDTA 1OJLA 4QC2A 2QZ4A 3MG9A 2UKDA 3FMPB 3QXJA 1M6NA 4KFUA 5KSPA 4G5QA 3IEUA 4Q19A 4I1SA 2V7QA 3WHKA 5K8UA 1HT2E 2WZQA 2XX3A 1Z8FA 4JVNA 1S9DA 1G5PA 2BKEA 1KY3A 2OSBA 4FMCF 1RFLA 1CXZA 3PCRB 1TQ6A 4P32A 1N6RA 4US0R 3PEUA 1O87A 1QHHA 2DFKB 4ZI2A 2CCGA 1W36D 4MKGA 2C9CA 2ZUDA 2JEOA 2VP2A 1SHZA 2AD1A 3K9GA 3KQKA 4DLVA 5HE9A 4JS0A 1RRFA 2XSZA 2GK7A 4LCBA 4Q21A 3BRWD 2O5VA 2P5SA 4C4PA 3X1DA 3LQQA 4LYHA 3QVVA 2FFHA 3EAQA 4II7A 4B3BA 3AGQA 3MSXA 4FIDA 4RZXA 1TAGA 3T12A 1KK3A 4QFMA 1DAKA 1JI0A 1HY3A 3UMSA 3U3RA 5DI3A 5EE5B 5AWFC 4DLUA 1CP2A 2QTFA 2X2EA 3BGWA 4Q00A 4XIGS 2O8DA 6Q21A 1XCMA 2CVHA 2J59A 2V9PA 3K0SA 4CRWB 1W4AA 1OF1A 2HT6A 4RCYA 4BFXA 2GAOA 4YONB 3HU1A 3SNHA 1L7VC 1X1SA 4QM7A 3OEHD 1NN0A 5FTMA 3GLIA 2B6HA 4A8JC 3QSYA 3DZDA 3MLEA 3NDPA 1GFIA 2WKQA 1AGRA 1X3SA 4F4IA 5HKKA 4PC7A 3FMOB 4D4MA 1M74A 3SC3A 4OI4A 4TT3D 3T1TA 1SXJC 1G5RA 2HF9A 4OHXA 3X1YA 1UBGA 1E79A 2CJWA 1AGPA 2CK3A 2XOKD 1R6BX 2HLDA 3CZPA 4FMDB 2FFBA 3CRMA 2I1VB 2J7KA 2F9LA 1NVUQ 1P7CA 121PA 3M1IA 4JVMA 4NHOA 5F2EA 5EQTA 4AYXA 5JRZA 4OK3A 4F7WA 2JGNA 2ZYVX 2IT1A 2YHSA 2JJ1D 4Q4JB 4DB4A 1F2UB 1GITA 2ZRMA 2IYVA 3OIYA 4B75A 1KAOA 4AYTA 1G7SA 3IHWA 4XWOA 3IO5A 1TX4B 1U81A 4PQRA 1NP6A 3C8UA 4DDWA 1JQLB 2OZEA 3GJ8A 2XB4A 1ESNA 2VP5A 3ZVNA 1IBRA 4PZLA 4NP6A 1KI4A 2QQEA 2CNWA 3GJ4A 2ONKA 2ERXA 1XZPA 2LCFA 2RGNC 3W3AA 3Q85A 4RFVA 1QF9A 2P5TB 4JLBA 2ATXA 4UXIA 2Z4RA 3KX2A 1OE0A 4GP7A 4IKEA 4CEHA 3IIMA 3C5CA 2C96A 1DAFA 3L8YA 4WZAE 5DN6D 1ZIPA 2P6NA 2GXUA 2RAPA 4TMZA 2JIZD 1OIWA 4PO8A 1P9NA 4JL6A 2EFCB 2HJGA 4B43A 2QORA 3EZ9A 5BYJA 1UADA 1E2MA 4KLNA 4A2QA 4MGZR 4P3YA 1A1VA 5AR1A 3ETLA 4F92B 3GLFB 1FP6A 4PQFA 4PPQA 1R10A 4TSFD 5SZHB 3H84A 2J87A 1W4RA 2GK6A 2GZDA 2AXPA 3EIEA 3K09C 1FX0B 1IN4A 1TQ4A 1YJ5A 3WNDA 1N6OA 1N25A 2IL1A 3AKDA 2GXAA 3P27A 2ZI9A 2F43A 4QL3A 1UBCA 4BFTA 2W2VA 4JVSB 2XB2A 4QRHA 1LF5A 1N5LA 3T15A 4IXNA 3RRZA 4L5BA 1HTWA 3UG7A 4M1MA 4PAOA 1E9DA 3R8CA 4NCJA 4BWYA 4XVUA 1JPJA 2NGRA 3VNVA 1Z6TA 2WJHA 2IK8A 2FSFA 3SQWA 3AKEA 4GSYA 4U02A 1XEXB 5EP3A 2ZJ8A 1T0HB 4JLVA 1EK0A 4QM6A 2ZRGA 4OQLA 1EFCA 1XMVA 1I4LD 2F7SA 1E3MA 1IN5A 1AKEA 2I4IA 2FEMA 1GKUB 1MT0A 2QL6A 1NMZA 3PENA 5FBRB 4OHYA 3UK6A 2QPAA 2NPFA 4E22A 2ONJA 3LBNA 4LC0A 4B3FX 3MJHA 1H65A 2KBFA 1Z06A 4G01B 4KXFB 3RS2A 2F1RA 4A0FA 4D4JA 4HAYA 1N6PA 2PZFA 5KPDA 3EZ6A 4DT1B 2IYYA 3LLMA 4LPKA 2YWGA 3BERA 3ADCA 1GZSA 1WBDA 2RMKA 2FNAA 3TQCA 2XZOA 2CL6X 3K9NA 4QOSA 2IF0A 3BJIC 2XITA 4AY2A 1F3OA 1XJCA 3OIVA 5FOXA 2ZU6A 4OHZA 1NJGA 2VHUA 4RKEA 5FPHA 1K5DA 4B2IA 2P2LA 5DISB 5K8IA 4L16A 1XD2B 3TNFA 3OAAA 1KDPA 3FMIA 2VLIA 3VR5A 3EPKA 2O8CB 4A0GA 4OBEA 2H17A 1E9FA 4NONA 5E3HA 5C18A 2FDCA 3CR8A 1E0JA 2ZSFA 4Y0VA 5FBVB 3KFXA 1ZIOA 1G3IA 4BLRA 3B8HA 4WVFA 4P4TA 4EFNA 1T9HA 4EPRA 3KKOA 1R7RA 2A30A 2ODNA 2WWFA 3THWB 1D2NA 3C16C 1G16A 4P4SA 4A36A 4XVQA 2QBYA 3I4LA 3K0AB 1OH7A 3NTUA 1IY1A 2Q0HA 4B3DA 3MD0A 4Q18A 1E99A 4PC6A 5HR5A 5EZ6B 1KO4A 2H92A 4YMWA 5TV2A 4QBIA 2C98A 2IYWA 3QPWA 2D74A 2CEAA 2PL3A 5HE8A 4AG6A 3O8CA 2OHFA 1M7BA 2CVFA 2D2FA 1VECA 1Q1ZA 3H1TA 1IN7A 2QROA 3PQCA 1YR9A 3DPUA 5DLQC 5B57C 2X19A 5FOVA 5GADl 3E70C 2QAJA 2GDJA 2XJ4A 1GNQA 3ADBA 2HXYA 3LRPA 4FCTA 3NC1C 2GF9A 2IX3A 4WXPA 1NBMD 4GOKA 1G8PA 2IS1A 2CXXA 3B82A 4X8MA 5TMPA 5JJIA 4LJ8A 3Q7QA 1CLUA 3CIOA 5AJVB 3KXKA 1Z0DA 2BCGY 2QNRA 3K70B 4TMWA 5KHOC 2Z43A 2A5GA 2PMDA 1EFRA 2VIIA 5CM8B 2PEZA 3WYAA 2WJIA 2XXAB 5DGXA 2J5XA 4DSNA 2ODEA 1YRBA 4CVNA 1KI6B 1PLJA 4BLPA 4YMUA 2D7CA 2JLYA 1IXRC 2IYQA 1OFTA 4A8JA 2RHDA 3KFVA 4DEYA 3ICEA 2C99A 1XP8A 1SVSA 2WSSA 4KO8A 4LJ7A 3BK7A 2OAP1 3RSOA 4B32A 4EDHA 4MRPA 4FMDF 5L3QB 3GLGA 3NXSA 3SJZA 3BBPA 5KOYA 1KHTA 1U99A 2OESA 4KSCA 1W44A 4M1YA 4JT2A 4D81A 2EFDB 1MO3A 1ZU5A 2PJZA 5H70A 5JEDA 1JR6A 3R9XA 5B64A 1ZBDA 1KDTA 3RS3A 2D06A 2W6JA 1PJRA 1XJQA 2IXEA 1NLFA 1VG9B 2VA8A 2ZRCA 1OXXK 4LDJA 2W58A 4HDCA 3GJ5A 1EXMA 3P26A 3J81k 2AWOA 5E7IA 1P2TA 4NCIA 3KZ1E 4OJQA 1G4UR 2X1VA 3LW8A 3GLHB 4AKEA 4XH9B 2GJAA 2R6FA 3DM9B 4KV9A 4Q9LA 3CPJB 1GG2A 2YOGA 3MFYA 5UKDA 1EGAA 4TQAA 3WRYC 1F48A 3ZJYA 4RD2A 4XWKA 3NDBB 1X8JA 1G9XA 4IDPA 1J7KA 3RVBA 4BLOA 1FQJA 4QJ4A 2PLFA 4EJSA 1ZNZA 3KB1A 2WWHA 5EE3A 3TUIC 2V1UA 1R5NA 4DRZA 4ZDWA 4BGDA 5EE0A 2Q9CA 2D62A 2BBWA 2GJ9A 2WV9A 4DJTA 3LBHA 1HE1C 1NMYA 4RD4A 3EA5A 3GJ6A 2R65A 5KNCA 2HEIA 1WE2A 2JDIA 3A8TA 2WICA 3QOFA 1NKTA 1LY1A 4ZDKA 1WF3A 3F8TA 1C9KA 4FCWA 4ZPXA 3L0IB 1GIAA 1X86B 3AV0B 1YZTA 3MAAC 1PLLA 1TEVA 3ADDA 2VP6A 4CEJB 2OEPA 5A4JA 1XD9A 1Z5ZA 4QGGA 1FTNA 2I3BA 3EIQA 1AN0A 2GHIA 1A2BA 5CLLA 1EX6A 4RD6A 2A5FA 2H5EA 2WJGA 3EARA 3I5YA 1E9AA 1S4QA 3REGA 3U3KA 521PA 5A0FA 4DLXA 3ZD6A 3TUZC 3OEEA 3VR4A 2NO7A 4MUBA 4Q48A 4DLZA 5CIWA 1US8A 4PZYA 5EXTA 2EVWX 5KPJA 3K70C 5GVSA 5CK4A 3I32A 3FE2A 3BORA 2NMVA 1HQYE 2BEJA 4NBSA 1YVDA 3QF7A 5JI3E 1EWQA 4DXAA 3TSZA 1OPXA 1KDOA 1ZINA 5DHFA 3ZD7A 2WMOB 4PC1A 3IPYA 5FL7D 1N6KA 2BBSA 3IKJA 2EWWA 5IK2A 4M8NE 3SS8A 3U3JA 2CHVA 4X8LA 1Z6AA 2VEDA 2QE7A 1VIAA 2RGAA 1GILA 1CRPA 4A0RA 1KO8A 1KSJA 1QVRA 4XD7A 3TQFA 4JBYA 2VTKA 4TYNA 1F60A 4DDTA 4I1UA 5JFGA 2GRJA 2R6AA 5F3WB 4DHEA 4A15A 2F1HA 3N5CA 4A0HA 2AFIE 1HYQA 3SYLA 1DAEA 3B1XA 4M1TA 1TPZA 3GFTA 3U6BA 4OHWA 3D7MA 4NL4H 4HI0E 4A1FA 3SDZA 2H7VA 4C0LA 1CJKC 4Q4JA 1WB9A 2YWFA 1F2UA 5EE1A 3KUCA 4TMXA 2IWHA 4DLWA 2VSXA 2WJJA 5EUQB 4NCKA 2DFNA 1TF7A 2V4ZA 3T5GA 1IAQA 3RANA 2YC2C 1FMLA 4HLQB 1OYWA 3QBVA 4ZIRA 1NSTA 2VRWA 4QKQA 3AQ4A 1IXSB 1DO2A 2RGXA 2Q3MA 4LY6A 1D6JA 2ZEJA 1XRJA 2A2ZA 3U44A 2OV2A 1Z22A 2VSOA 5BYKA 3G82C 4Q03A 2Z83A 2AK3A 3PUVA 1KKMA 1ZM4A 4V02A 1W0JD 1YZKA 1E2QA 3VX4A 1E2JA 2GCOB 2GZAA 3DDCA 4TLDA 1OXTA 1OIVA 3SFZA 1LW7A 1SVOA 1A2KC 3VR3A 1DEKA 2O0JA 4KAXA 3E2IA 1SGWA 5L3RA 4LBYA 1D5CA 1Q22A 2ZRNA 4B47A 4LJ9A 3EW9A 1E2KA 5HCNA 4MYCA 5FOUA 1CR0A 2CL0X 3W8NA 4L4UA 3SYNA 1KZ7B 3I73A 1KDRA 2IBMA 1JR3D 3U2QA 1PLKA 1Z0FA 4Q1DA 4E09A 4N0DA 3SBDA 4TLBA 3D6TB 3BWDD 1FX0A 1NN3A 1VDZA 4PPNA 3CNOA 1SXJD 2OO7A 3LXRA 2GETA 5EUMA 3TVDA 4B44A 1J70A 4B73A 3WP0A 3THOA 4FN5A 1CKEA 2PT5A 4JSTA 3K9HA 4EPYA 1CS4C 3QXCA 5FUYA 2R6CA 2FOLA 5K8LA 821PA 2CHGA 1Z29A 3OEHA 4V03A 4JL8A 3AVTA 1QG2A 2JAQA 1VG8A 1VYUA 4TLEA 1P9WA 2E87A 1A7JA 4NU0A 4PXAA 2KJQA 1AK2A 1N6HA 5AJWA 2GJ8A 4TT3A 1E9EA 4FD2A 1DOAA 1LNZA 3PEVA 5JWHA 3WYFA 2EYUA 1G8HA 2I1QA 4HLDA 2XOKA 1G7TA 4B35A 3LX5A 4PSAA 2QMOA 1XEWX 1AZTA 2BMJA 2HYIC 5CITA 2FE4A 4FMBB 4I1OA 3B5JA 3ONWA 2JJ1A 3H4MA 1Z28A 2QGZA 3CF0A 3ZVLA 2C2HA 2FF7A 4M21A 3FTQA 3SBEA 1XTQA 4B3XA 1WXQA 2QSZA 1KJWA 2A5DA 3FFBA 3QQ5A 4AKHA 2ZJOA 3RS0A 4DT1A 1QRAA 4RJLA 1KI3A 2N46A 1ODFA 1Q3HA 3MMPA 4JVLA 3TSOA 3JVUA 2WIAA 1W46A 4F4JA 1R5OA 4D82A 4Z8XA 3IIJA 3EC1A 5JEEA 4Q7MB 1KI1A 2OM2A 2OCPA 5DN6A 4AG5A 2QQ0A 2JIZA 4Z54A 2MMCA 3RAPR 1XB2A 2QT0A 2BV3A 5FTLA 1G5TA 1VKJA 4JT4A 1XD2A 2OUKA 1GNPA 1DARA 4BFVA 5CB6A 3R8FA 1WCV1 3Q5EA 4TMTA 4M1WA 3CX7A 2ZYUX 3MWJA 4JKIA 4WOPA 1B0UA 3RLFA 1E0KA 2KSQA 2OE2A 1JJVA 4KHZA 2RHMA 5J4LA 3PEWA 3B1YA 2DWQA 4QGHA 1Z47A 2OXRA 3UWKA 4Z1MD 1GNRA 5JHGB 3ZVRA 1YRAA 5CB8A 3U60B 2GXQA 2VP0A 1GM5A 2IF2A 5JLJA 3THWA 1FPMA 4QGFA 1TUIA 1R8QA 2GTPA 2W0MA 1OKKD 2PT7A 4JYBA 4RD0A 1CR1A 1N3BA 3RYTC 3CH4B 4DCTA 1N6LA 1P61B 2XTZA 3DHWC 1LS6A 4MKFA 2ZVPX 5DO9A 1Q0UA 2DR3A 2IA5A 3K0AA 4IRUB 1EESA 2ZR7A 3B1VA 4C2TA 2B21A 2E1RA 4IOMA 4DVGA 3TH5A 4CEIB 1G8YA 3BXZA 3K0FB 1IONA 5BN5A 1E1QD 3KKQA 3L8ZA 1YR8A 3QKSA 3TAHA 3SU8A 4MH0R 4RZUA 1OH6A 2GNOA 4RD3A 4JLPA 5LDDC 4M1KA 1P75A 3NG1A 2BJWA 2VP4A 2ORVA 2IS4A 3QJYA 2ZS9A 1Z2AA 3LY5A 3A36A 4PC3A 2OBNA 2ANBA 3ND9A 5GJVC 4F38A 5SZIA 3GJ3A 1ZC3A 2VF7A 1W4CA 1QVAA 4POAA 2P3SA 5KNDA 1I2DA 2YWHA 2BM1A 2D3WA 1U9IC 1UM8A 2A5JA 2HCBA 1F2TA 2V6IA 2XXAA 3W5IA 1T0JB 1IN6A 4NPHA 3CB4A 2O8BB 1RZ3A 1GOTA 1E98A 2P6RA 1KI6A 4AI6A 1GKIA 4Q01A 3PITA 1XMJA 1D2EA 3F0TA 1I4TD 2YV5A 4OQXA 5EJEA 2TMKA 4IOLA 4Z51A 5JWRA 2WOOA 4HYYA 1Q44A 5KU1A 2ZXUA 3WHLA 4Q9JA 3TAUA 1C4OA 5FPSA 2Q21A 4JBWA 4UXJA 1II9A 3IDQA 4GZLA 2OCBA 2CMKA 2A5YB 4MRSA 3IO3A 4BRUA 1CULC 2WHXA 4HZUA 2QP9X 2IYLD 1VHTA 2AKAB 1IY0A 3CWQA 3L82B 4G5OA 2ZM5A 3U3MA 3ZH9B 5CDFE 4PHTA 2XNDD 2BMFA 5SZKB 4KVAA 2IEZA 1NF3A 5DHAA 1CJVC 3EZFA 3G5UA 1BIFA 3GLHA 2HYDA 3S1AB 1LTQA 3MWLA 4BZQA 4BZPA 3B1WA 1Z83A 2KWIA 3T1OA 1TEXA 3CKLA 1EWRA 2IHYA 4UKDA 4Q4AA 4B74A 1E94E 1K6MA 3U7EB 3P32A 1Z0AA 4LJAA 2CE7A 2CLSA 3TR5A 1IHUA 1TF5A 3TSWA 1FUKA 4ZKDA 1MO5A 3QEOA 3PR1A 4D2IA 2ZRJA 1NMXA 2WJYA 4EIWA 2V3CC 2HV8A 4DLRA 4QXAA 3QE0A 2ZAOA 4Q4LA 4RZ3A 2AKYA 1VIYA 1K5GA 4C30A 2DBYA 2BC9A 2CDNA 3CPHA 4OQNA 1XX6A 2PCLA 2V55B 3HR8A 1TADA 2ZJ5A 3KJHA 4TMKA 1Z0JA 1FOEB 1OIXA 1NBMA 4BASA 2ORWA 2J0QA 3BAFA 4LC1A 4KBGA 3C15C 3DOFA 5KYKA 1R0YA 1E0AA 1HQCA 2FSGA 3X1ZA 3O47A 2OBMA 3AKYA 4GNKA 4C0KA 4Q1AA 3VKWA 1E9BA 2WPDD 3ECCA 1SKQA 5K8TA 5FBQB 4IEIA 4M9ZA 4GL2A 2RB4A 1CJUC 3KJGA 4W5HA 4NYJQ 1TU4A 4JKYA 4P0TA 3TW4A 1ZM3A 4FINA 1RRPA 2IUTA 3FHOA 1KGDA 3BC1A 5FOTA 3RABA 5CJ2A 1G41A 4ASUD 4IOJA 4D0NA 1V5WA 3PUXA 2X77A 3NEYA 1ESMA 3PJRA 1VYVA 4C2UA 3QUSA 4EAQA 621PA 1XXHE 3DEFA 3TVTA 2WTUA 1NIJA 3PFIA 2Z4SA 5JRJA 3UIEA 1J8MF 3KJIA 1GUAA 1W0KD 1AA9A 2NTYC 2W6ID 3NEJA 4OK5A 3IHLA 1OLOA 2LWIA 1EX7A 3HP1A 4P33A 4RZ2A 2CBZA 4AWXA 3FOZA 3CZQA 3RWOA 5HPYB 1Z07A 3K0CC 4BE7B 3SZRA 3U4QA 1C1YA 3GQBA 2YOFA 2MSCB 1NL3A 5TY0A 3ZDQA 1SKYE 2BOVA 4MRNA 5HZKA 3LX8A 4IEEA 4L8GA 2O52A 1TL7C 4Q9KA 4M9SA 3A1SA 1T8TA 2J0VA 4UNQA 3RNLA 2GCOA 2D7DA 5A5GA 2F6RA 2J0UB 1CRQA 2IC5A 2HF8A 4B34A 5FI1B 1XPOA 2FH5B 1FQKA 1LF0A 3K70D 4JZKA 4ILEA 3VMFA 1G19A 5JSZB 4PO1A 3TJZA 1S96A 3M4YA 2GEDA 2ZSEA 1SVLA 3CONA 1KK1A 4IJMA 8OHMA 5FH9A 5L3SA 2BIFA 1VCIA 2NPIA 4KFTA 3TW8B 1NY6A 5G3ZA 4IVQA 2DFTA 3BOSA 3DMNA 2HXSA 2NIPA 1AS0A 3A4MA 3W6PA 1IQPA 5HZHA 2PH1A 2O8EA 2E9SA 3AVOA 4H1VA 4TMVA 3C4JA 1IJFA 2Z0MA 4EQ6A 1R2QA 3MWKA 2R6DA 2FU5C 1X6VA 3OIUA 4MITA 3U3OA 3L2OB 3TKLA 1MKYA 3THYB 2ZJZA 4LHVA 4LJ4A 4R2IA 5FL7A 5G40A 3T35A 4EPWA 1KNXA 4TTPA 1E32A 4PPFA 2ZVQX 1ZRHA 4LBZA 3KJEA 2ZYWX 4MDFA 2C77A 3SR0A 4P4UA 5KSOA 3T34A 2AWNA 1XTIA 5F9HA 3NC0C 4RFSB 2JCSA 5TB5A 3CNNA 4E07A 2ZITA 5FPTA 2CHQA 5C4MA 2ZJAA 1CF4A 3LV8A 1ZNWA 5TVKA 1HH4A 1OFHA 1U9IA 2B92A 4LV8B 4TZ0A 3P20A 3FMFA 3IUYA 3VHXA 1J2JA 1PUJA 2QU8A 1HEIA 4JLJA 1HA3A 4EPTA 4DCSA 2IYZA 1Z2CA 3P1JA 3PUWA 5DI9A 1PZNA 2OLJA 2XNSA 5BQ5A 3ZQJA 5FR1A 3VHLB 1AIPA 3SFVA 1YR6A 2QAGB 1W5SA 2MSEB 3U5ZB 5FI0B 1T3HA 4TYYA 5J4HA 1D9ZA 1KYIA 1Z63A 4V0MA 1VCOA 1E2NA 2ZYTX 1W0JA 2VYFA 4MGYR 3TUJC 3AVQA 1SZPA 2DPXA 3FHCB 3TE6A 3BFVA 3FDIA 5GJWC 1FNMA 1NVVQ 2ZR0A 2FPMA 3AP3A 4QNRA 1Q20A 4HAZA 4DEXA 1JQJC 2WOJA 4HUTA 3CRQA 5J4KA 3IILA 4QNMA 1RPZA 4A2PA 1GDDA 3CW2A 5DSZA 1CU1A 1JR3A 1XNJA 3QEJA 1UAAA 3LNCA 2HCJB 1M1YE 3E5HA 5AJXA 3O8BA 3BB3A 2NQ2C 2ORIA 1L2TA 2ZRFA 1NIPA 4ZCMA 1SXJA 4Q4HA 5KSZA 3PUZA 1Q12A 4TYPA 3VR6A 2XZPA 1QHHB 4ERNA 3W8RA 1H8HD 1YZUA 3GFPA 5FOSA 1N5KA 2G9NA 2G88A 1S3SA 2OG2A 4C0SA 3CWZA 1CBUA 4YC7A 2YYZA 1UEJA 3QKRB 4AC9A 3DZ8A 4BRWA 2KB0A 1IN8A 1KSGA 3ZZUA 3RHFA 3K0FA 5H1YA 4DIEA 1RRCA 4CDGA 3MGCA 3NBYC 2PEYA 2DB3A 3OZXA 3RSLA 1E6CA 1U2RA 2RGGA 1E2IA 1E2EA 5EZ5A 3B9QA 1UDWA 1XTRA 2RGNA 2WAYA 2BVNA 2XTMA 3AVUA 4H9GA 1CR2A 2ZI3A 4JBXA 1E2FA 2JLWA 1XJ0A 4ZO4A 3E1SA 2BCJQ 4TLAA 1BMFD 3EG5A 2IHBA 3X2SA 1NVVR 5BWMA 3G0HA 1XEWY 1T91A 2FZ4A 1KO5A 1DG3A 2O0KA 4GI7A 4JMPA 2FX3A 4ACAA 3L0SA 1AS3A 2XJ9A 2O8BA 1XZQA 2A7QA 3GFOA 2ZI5A 1FZQA 1OHHD 1UF9A 1N6NA 3UMRA 3IQWA 2XEXA 2G3YA 2QAGC 1G3MA 5EXSA 1FUUA 3K09A 3HR7A 2C04A 4HLUC 3LW7A 4PQYA 1P73A 4Z8YA 2IYRA 1TNDA 4TQ9A 2EW1A 3WXMA 1RIFA 2ZRLA 4ITRC 1PUIA 5HCIA 5TXGA 4DKXA 2YOHA 1X8LA 2XGJA 4UJ5A 4C0QC 3QIAA 2ZE5A 3NH6A 5FPYA 3AM1A 1QHNA 3OE7D 1U90A 1DPFA 3A1TA 4OK6A 4Z1MA 2ZUCA 4HZIA 4IHQA 5B2ZA 3FVQA 4CEHB 3WMGA 1D8TA 1TQ2A 1E9SA 5IT5A 3TGPA 2LKCA 4WIAA 5B58C 1OKKA 1HUQA 3QKTA 3MRSA 1G7CA 3WBKA 4YXWD 2Z5FA 3K9LA 4M9XA 221PA 4MRVA 1FL9A 3IGFA 1JXMA 3DKVA 4BEBA 4C0BA 2PBRA 3QBTA 5DE3A 3SJBA 2WAXA 3NHBA 3IEVA 5FFMA 4R9UC 1DTSA 1YHNA 2WWYA 3H0KA 2FPKA 2A3RA 1E1QA 4C3ZA 1MRSA 2ZPTX 1SVIA 4DDVA 2AX4A 4S2EA 4U5XA 1KI9A 5FTNA 1BYIA 3ZZTA 4E5UA 1KAGA 1ZCBA 4AKGA 4L15A 4PAQA 3TR0A 4XOIA 3HU2A 4XVRA 3L43A 5CK5A 3R20A 2RGEA 4M9QA 1HURA 2F43B 1MABB 1Z0IA 4D6PA 1GL6A 3EPHA 3I61A 4JIMA 4LHXA 1JNYA 4LWZA 1L4UA 1T6NA 2ZSAA 2W83A 5CM9C 4D0LB 5GJCA 3AEZA 3VU9B 3VQTA 4TN1A 4F91B 1G3UA 2UZ3A 4HB2A 5E7MA 3U6KA 2W2XA 5JBQA 3UATA 2ERYA 4D4KA 2H8KA 4V0KA 3AP2A 4V0NA 2VH5R 1MRNA 1E4YA 4GP6A 3O8RA 1ELOA 1XF9A 2WWWA 4OJKA 2IYXA 4BEJA 3D8BA 1ZW6A 1E1RD 5C4GB 4ZDIA 1OH5A 1WQ1R 3GLFA 5P21A 1S1CA 1YZQA 2BEKA 2C78A 3CPEA 1SVMA 3M6AA 3SEAA 4EUNA 1P5ZB 3GLIE 3A37A 2EWVA 3KUDA 4LK2A 5KDOA 1ZYUA 1OSNA 2R6GA 4ESHA 1ZM2A 1W2HA 2IS6A 5KO2A 2BBOA 2NZJA 3H86A 4WBSA 1T5IA 1JJ7A 2ZROA 4PTLA 2OXCA 1YKSA 3KB2A 1TUEA 1E2GA 1W2GA 2EYQA 5J47A 2PZEA 1BO6A 4GBMA 1OXSC 4Q1BA 2PMKA 3AF3A 4LHZA 4LJ5A 2A9KA 1T5LA 2ZS8A 1D2MA 1ZUIA 4U00A 4YDSA 2A78A 1RRGA 3NHAA 2R8RA 3SJAA 4W9MC 1N5IA 1XEXA 5G53C 1MOZA 1LV7A 3C5HA 2WVJA 4JLMA 4RCZA 1AQUA 1NBME 1JEEA 1J8YF 2JATA 3KKNA 3UANA 1WMSA 4KCGA 1MV5A 4WW0A 2JLQA 2J7PD 5C1BA 4DIDA 3D3QA 4DWJA 1U0HC 3I8XA 4US1R 1UBFA 4WA7A 2J0UA 4EFLA 2WWXA 1ONBA 4M1OA 5LB4A 5TDHA 1FMJA 1W1WA 3AVVA 1E0SA 4JLNA 2AFHE 4NMMA 4Q9HA 1M2OB 4JSYA 2G1KA 3BB1A 3V4RA 4JLAA 4UQOA 3QF4B 5L8VA 3U7GA 2IUUA 4KVGA 4DLTA 1KK2A 5E4FA 2MSDB 2VHCA 5FUWA 3QG1A 2XTNA 4O25A 4B6FA 5AUOB 4ON9A 3QENA 4HAVA 5H8WA 1FNNA 3HWSA 4FXPA 2YNMA 1ZMXA 1R0ZA 2V6JA 1UBEA 2FGKA 4HDOB 2F1JA 3MUFA 421PA 3AVYA 2N1BA 1OB5A 2VO1A 2ZJYA 2WPDA 3ICQB 3BIFA 3AF1A 4ZKEA 3TBKA 5AUPB 2NO9A 2O8CA 2F3TA 2ZSBA 2PX0A 5F98A 2IW3A 4DLSA 1TMKA 3THYA 1J99A 5CIQA 1G21E 3B1ZA 2G83A 4HUQB 4TSFA 4RKFA 4D0GA 2ZQ5A 3BS4A 1NN1A 1KY2A 3A1UA 3EASA 3KDSE 4PAMA 3QXSA 2Q3HA 2GESA 1EFTA 4ASUA 3RC3A 4ZCIA 1NI3A 1M7GA 1S8FA 721PA 3W3ZB 4B3CA 1NN5A 4GZMA 4A6XA 3PUYA 3Q3JB 1KJYA 2GILA 1MR3F 3X1XA 4B3GA 4UXHA 4RFSA 3GD7A 2OBLA 3RRMA 2GJSA 3AKCA 4HEJA 1N5JA 2HJVA 3ZYCA 1FW6A 1W0KA 1DG1G 3GEEA 3ZVMA 2QM7A 4PZZA 4NH0A 2RGDA 2W6IA 4URZR 5CJPA 2WJVA 1YZLA 4DZZA 4DSUA 1JEDA 1KI8A 4KYIB 1JPNA 2ZANA 5AUQA 3KQNA 4QJ5A 4DCNA 4OI0A 4Q7LA 3AUXA 3P4YA 2AK2A 2QSYA 3RRNA 1KI7A 2QRZA 3EWAA 3K0EA 3OHMA 4DSOA 2GEUA 4R71A 1II8B 2CCKA 4OL0A 1WRBA 2QAGA 1E2PA 4H1UA 4XD7D 1LS1A 1COWD 2J41A 5JS7A 1KTVA 4MRRA 1BH2A 1RW4A 4HLUA 3EWSA 1U98A 2EQBA 5JCZA 1ZD9A 1Z6YA 2V1XA 2GBLC 3T06B 2AL7A 1KMHB 1M34E 1CIPA 1H8ED 1XMIA 2KI5A 1KO7A 1G64A 4QBGB 4URYR 3Q8XB 3CNLA 4C9BA 4D80A 4LSGA 2H1LA 2VHQA 3B9PA 4KITB 1QHSA 1D9XA 2DYKA 3ZLJA 3TMKA 1BOFA 5JCPA 3CRW1 4W5WA 4GRAA 4CW7A 1GRRA 1XXHB 4LZZA 4BLQA 3THXB 1YQTA 4R98A 2DCUA 4EJSB 4UJ3A 1GTVA 1UKEA 1ANKA 2JLVA 4LV6A 4X8HA 1XFAA 4XWAA 2QA5A 5KSYA 5L3QA 4LV5B 4KODA 2V8OA 4PX9A 1EG7A 1OXUA 3VX3A 2NO0A 4K81B 3I92A 3NIBA 1EFUA 4IDQA 4KBFA 4OHVA 1P4SA 2W2TA 2X2FA 3K1JA 1B23P 2G0NA 2WMNB 4AK9A 2O8FB 4PR0A 4GMXA 3ND8A 2ZTSA 3VFDA 2VHTA 3QKRA 1R8SA 2C9OA 1SKYB 3IBYA 1S1MA 4G3XA 3KKMA 1OV4A 1RYHA 2ZS7A 2R9VA 3RRYA 5L3VA 4LX0A 2P0EA 4RD1A 5JZVA 3CX8A 2O8EB 1XCPA 3LDAA 5F9FA 4HSEA 4YQFA 2B7CA 1Z6GA 2C9YA 5EXPA 5KTYA 2JLUA 2ANCA 4RSGA 5JJKA 2FV8A 3NKVA 2FFAA 2BHRA 2IYSA 4LOAA 4Q5IA 1GL9B 1US8B 3LA6A 4CZ2A 3AVWA 1XWIA 2J9RA 3CUEF 4V0ME 4PSKA 4OKSA 1ZC4A 2QN6A 1T8UA 4AYWA 1Q1EA 4BFZA 1KSHA 1SVKA 1ZVQA 4BFWA 4M4SA 3DM5A 4NDZA 3BH7A 4LGMA 2WBLC 3P4XA 2Z6VA 5LD2B 3AVXA 1JXOA 2FSHA 4IDOA 3V00A 1QG4A 3KQHA 2L0XA 3ZIAD 4D25A 2GKSA 1XTKA 1DBSA 2DHRA 2FFQA 3SE0A 1KKLA 2YJTD 2YC4C 3BD9A 4MGIR 1JR3E 4NYMQ 5KUTA 4CEJA 1YE8A 5DYIA 5D3MB 2GEVA 1X1RA 1VHLA 2JJ2D 1P2SA 3H2YA 3BH6A 4MKIA 3OIWA 4PPGA 3QKUA 4DSTA 3ASZA 4C0JA 3MWYW 1SXJE 1NJFA 2ZUBA 4TL8A 2OAQ1 3GLGE 4LRWA 4GOJA 3VR2A 4Q47A 2P67A 1X8KA 3B13B 3GJ0A 4GMDA 5AJZA 1TF2A 3GJ7A 5CYOA 1AS2A 1DO0A 3IBGA 1IOZA 3EA0A 4JLKA 1UDXA 3VAAA 3FKSD 3QXXA 4ZIRB 3ZQ6A 4C0AC 2P65A 5J4VA 2CCJA 1RC8A 2XZLA 3OFND 4C7OB 2VHJA 1NG9A
chains in the Genus database with same CATH superfamily
2ECKA 2WJ6A 1W4BA 2OFXA 3K7EA 5AVKA 5IT4A 5ALPA 1YDMA 3DLIA 5KCZA 1HFJA 1MB3A 2H2HA 2UZ1A 4ADSG 3IP3A 1B8UA 3C14C 1FYDA 4GT1A 1S3GA 3ORRA 2EU8A 2YN4A 4CF7A 3DEYX 1DEHA 3GNQA 1Z5UA 1BFKA 2AQKA 2MSKA 2V7EA 2JD2A 2J48A 1FFCA 2OT3B 4IIGA 5DIFA 5HDQA 2Q9AA 1LJLA 2AE1A 2ZBDA 3BXHA 3LIPA 5FO1A 2ZXFA 2OLEA 3DHEA 2RH5A 1UKZA 2Z1MA 5EEGA 2RJ3A 3EXIB 4B6EA 1RQPA 1DIBA 4OJNA 4EHIA 3K31A 5K6AC 3Q8MA 3MHPA 4K05A 3Q41A 2ADMA 3VI4B 1JU4A 1QGAA 2PCJA 5IARA 1ZH4A 1UUFA 2DY1A 1Q7GA 2IYTA 3SJCA 4CM9D 4W1PA 1YZHA 4CMKA 1CJTC 3DMRA 3QV2A 3NWPA 4ZFNA 4HNVA 4PYKA 4EY6A 1PTJC 2BZ0A 3KEQA 3TZLA 4Q1FA 3EIXA 1P5JA 1ZAKA 2J45A 3GFGA 1U6KA 1TYBE 1JU9A 3GFSA 3N3BC 2G8LA 3QNUA 4GYWA 4JJ4A 3R24A 2FP4B 4BJ5A 2ZSJA 4ZDJA 4B2LA 3TM4A 1EHIA 1X1QA 1Z63A 3JYNA 1H2HA 2R62A 4TYYA 1PR2A 4MA4A 2UYCA 3ZV7A 3FHLA 3BB4A 1BMFA 1VZ2A 1Q84A 3UAVA 3NYWA 2OGSA 1BCSB 2N3ZA 2QZZA 3KO8A 1FYXA 3Q87B 4H4CA 2QRNA 4KACA 3NLLA 1ESZA 1GG9A 4DRYA 3CUSA 4KC0A 3KYDB 1H3FA 2M6RA 4WXEA 1OZHA 4EPVA 2YJ5A 4UDNA 2E55A 3O3NB 4KIGA 3H65A 4EA6A 5I4BA 4DPLA 1NURA 4N49A 1CB7A 4PF1A 3WMFA 5IM4A 3LFUA 1N2GA 1DE0A 1YKGA 2ZKIA 2J3JA 3BZUA 4ZICA 5DH9A 2O0HA 1Q3TA 3L7OA 2FKAA 1GP2A 1K9SA 1SXHA 2XY4A 1A2QA 4N8EA 4RMJA 3R7WB 2BEWA 2FMHA 2QMQA 1QHFA 2AJTA 4WXRA 4NYIQ 1C9YA 3EHEA 2CUKA 3IE2A 4RLSA 4LI0A 1QZZA 5COQA 4EKIA 1L5LA 2BJVA 1DAIA 2HJHA 5CBKA 1N3LA 1P1CA 2NZUG 2Q0SA 2W6OA 1NVTA 1JW9B 4EPXA 4LTNA 1V5FA 2HWXA 2ISQA 3Q8WA 1C30A 3JRWA 4R3WA 4A1OA 5ITZB 3W0LB 3GCGA 2OCXA 1WBBA 3FB4A 5K09A 3OD5A 1Y37A 3OE7A 4OXIA 2KLBA 2Q28A 4PLTA 2EP8A 2DH6A 1H4QA 5LLTA 4Z4FA 3LD9A 4B33A 5BQFA 2XSZD 3HN6A 4AUKA 4KRGA 5LMUB 4BNWA 1RQXA 4P4GA 1R0CA 5JMTA 1LLQA 3V8RA 3NBUA 2OZLB 4W1QA 1DRWA 1Y1PA 3FUXA 4P3NA 3FTEA 3TYXA 3FOAA 4KXMA 3C24A 5L4LA 4P4LA 4BLTA 2P4QA 2BFCA 1G60A 3I9MA 2AHOA 4L75A 4AFNA 1BRTA 3CC8A 5IDWA 2PYIA 2B6NA 3C5EA 1ISMA 3DL7A 4BVLA 3CEPB 4X1IB 2ZBVA 4J3FA 3UWPA 2GH1A 2GBLA 4HQ6A 2GYUA 1REQB 4K6GA 2OOSA 4FOPA 4ARZB 1TXGA 1N8SA 1QTNA 1PHRA 2AOWA 3BE5A 4OGGA 3AIIA 3DL0A 1OTYA 4P36A 2Y0EA 2P7IA 1VHDA 3QOXA 5CAEA 2WWGA 3IE0A 3WNCA 3ZLBA 4AY6A 1TGVA 4M8SA 4RWEA 1FTYA 2XRYA 3V8QA 3A1WA 2CBGA 2J6CA 4YMHA 1UJ2A 1Y8CA 4NABA 3QF4A 1JDUA 1QB8A 4KBYA 3HYNA 3EOBI 4J16A 5BVGB 4FUTA 2R5NA 3TNDA 1P3JA 3GFRA 4LPSA 1T5TA 4D7AA 3PVCA 2GPWA 3GLFE 4PZ0A 5BXYA 5ENZA 1P81A 2WTMA 3K2EA 5C52B 3G6KA 3CSDA 2DOKA 4ZOEA 7MHTA 4DLNA 5FWYB 5IUNC 5K03A 3UJ8A 1FJGB 1K7CA 2ZSHA 1H3NA 5BW8A 2UZIR 1ISFA 3QKSB 4KU4A 2NU8B 4U8HA 2PFSA 2FCRA 2NU7A 5SZJA 3M3DA 3SYRA 1NQWA 4ZJUA 4IJ6A 1AF4A 1ZDMA 1OZ0A 3GYBA 1EJBA 3W90A 5AXAA 2GZHA 4C6HA 2B7BA 2QY9A 2DHEA 4X1KB 1WOYA 2LGJA 2FA9A 3D5EA 3F71A 4QU5A 1RXVA 3ZV4A 4A9AA 3LQRA 5BT8A 1U8ZA 2B3DA 4JBGA 4W9NA 2IYFA 2FJ0A 4U2DA 1ZSNA 1O6FA 1IZYA 2CNBA 3FPLA 5DV9A 2C42A 3CLVA 4BX8A 4E03A 3HUEA 1EINA 1OW3B 3H2IA 4FYJA 1VLZA 4L0CA 3G7NA 4L72A 3RNOA 4KI0A 1KIAA 2AE2A 4N39A 2WA2A 1DXYA 2XYRA 5DOZA 4WKOA 1BN7A 1TJNA 2P90A 3KAQA 2M1ZA 4IG4A 4BDTA 5J1SB 2AR0A 3EXFA 4PLWA 2FETA 2H0QA 4HN2A 2QMEA 3WYGA 4C6TA 2ZIAA 1RVDA 2JIRA 2AR7A 5EUQB 2G0TA 1IPFA 1KO1A 1G4AE 1CQPA 1KYQA 1ZEMA 3ASVA 4L5IA 3ZG6A 2J9GA 4N5IX 3YASA 3HDJA 2PIAA 4CEIA 1WY7A 4FX2A 2AGVA 3LF2A 4IEFB 4LE2A 4EUFA 1YB6A 2AH5A 4BFUA 4FKBA 2B1RA 1P0FA 4AS2A 2CHUA 2I78A 3E6AA 3N8GA 1G8FA 4WZAA 3QWHA 4LI3X 5FPKA 5JPDA 4MPDA 4GKVA 1I01A 1PNOA 4CLOB 3I6BA 3H2JA 3THSA 1FDUA 1TJ3A 5IKMA 3GPCA 3AXSA 4WXHA 3T0IA 1GZHB 3FKQA 3PIDA 1MQ8B 2OILA 3DVSX 2I34A 2EFHB 1Z6PA 4LKOA 4V0SA 3EUWA 2BKAA 3DVQX 4ZI7B 3SX0A 3ESCA 4HS9A 5JXHA 1ODSA 3F7NA 3W34A 1VI6A 2XF8A 3FDXA 4QBHA 2ZTLA 5GONF 4DUZB 3U61B 3DHVA 4KDRA 5LZ9A 1TA4A 4CT4B 2ZBGA 3FPCA 2WIBA 4GS5A 4M0DA 5EHXA 5KWVA 2O7NA 2PUJA 1ZM9A 3D02A 3D6MA 3BEOA 2XMCA 4R8KA 4Q4AB 4EH1A 1ZGJA 4W5TA 4AN0A 4D4LA 2CJWB 1WCYA 2GVNA 1TTQB 2RI0A 1BW9B 4MI9A 4Y0AA 1HDGO 4PYQA 3SQOA 2PMCA 1JAIA 1JIVA 1UPUA 3IBFA 1CQWA 4GPTA 1O5TA 2WAAA 4M89A 1CX9B 4PZDA 1XDZA 4AWBA 2QPTA 4FHDA 3BJEA 4KL8S 2PQMA 3CEHA 5LB2A 1EK6A 3LI2A 3PR2B 3LH5A 3AB3A 3V1LA 1H2AS 4MYUA 5FNVB 5G3YA 3T3EA 2O6HA 1HNZB 2P77A 1N2CE 1FTWA 4P86A 4ZJPA 1SH7A 4CKYA 3IQIX 1BFUA 3O4FA 4MB0A 4NFLA 4QECA 1YCGA 2B2NA 2FQYA 2IOYA 5EUBA 1MO4A 4QYXA 3TNLA 3EEFA 3DL2A 2VF8A 4YJDA 1ZHHA 3OU7A 4HQKA 4YY3B 4JJAA 2XQVA 4KN6A 4NU8X 1VE1A 3PXGA 1JG7A 3VKHA 5ALUA 5EE9A 2NZ8A 4HGQA 4HXYA 4TV8B 1NRJB 3I8SA 3QPAA 4PYOA 3HWRA 4ARUA 4WY8A 1VLQA 2HSJA 2C7QA 4HB0A 3QOWA 2YXNA 3C3KA 1BYUA 4YI3A 2WNIA 4KEAA 1UOQA 2C5FA 4J49A 1F17A 3PL1A 4P5DA 1MV8A 3HKCB 3EEYA 4Y6RA 4PO9A 3ELUA 5HJ2A 2AFHB 4ENQA 5CDHA 5ENDA 3G9UA 3Q15C 1YZVA 4X84A 5K01A 2CLMB 2OUIA 3NTLA 1Q2XA 4BVBA 1ZN7A 4J2TA 2BFEB 2GCPA 4I2NA 4R7GA 1BZYA 7ADHA 3BSYA 1D5WA 1PWHA 2W8BB 2Y2UA 4URWR 2EGUA 2FPGA 3QFCA 2GSWA 4C7XA 3OJCA 4PFSA 3B38A 3MTBA 5G0TA 4FCVA 3STYA 4AU1A 2Z3WA 3RC2A 2GA8A 1M1UA 1YQ9A 4XIYA 2QG6A 3HXOA 2X2PA 1GA4A 1MLDA 5ANRB 4KREA 4MUAA 3SR4A 3DFZA 3AZPA 5JVDB 1VBFA 2G28A 4Z0TA 1PVOA 2G9ZA 3MINB 2KM1A 5AJYA 4A4DA 4CEJB 5IMSA 1OFUX 3LPAA 2EXXA 1GQRA 1NX6A 1THMA 1KDZA 1U2GA 3RBZA 3EGXB 4HDNA 3WBFA 3ND6A 2PUHA 2FDXA 2GWHA 2ZULA 1T2UA 4N1AA 4QLOA 5ELXA 3R0VA 2BFNA 4O4JB 2HTEA 2JFHA 3WFJA 2XA2A 1HFKA 1JPUA 2IPMA 3I1JA 1EA5A 4K7JA 1R0WA 3E3OA 3QK7A 4XARA 4CCSA 4W7SA 4RTOA 3D6JA 4FYHA 4LHSA 4YB8A 5DP2A 2G0AA 3CY6A 3M6VA 2W5UA 2R4UA 4X7BA 2VAMA 4CKBA 1I4EB 1DEOA 1QORA 2AD5A 1XRLA 4DC0A 3U4QB 2WKPA 3OFJA 4XIIA 2DVMA 3E03A 5IJXA 1M8GA 1HPLA 1O5OA 3Q5DA 4PHHA 3ABRB 1RCTE 1DC7A 1AQLA 1P9RA 2YMMA 3H19A 1Y4DE 3K6KA 1W73A 1WB5A 2D2EA 3L05A 4L9WA 3M0EA 5DBIA 1QAQA 4GGMX 3KC2A 1YR1A 3HUTA 2YZ2A 1E9VA 5ER9A 3R76A 4TZ6A 4UNPA 4A92A 1EDDA 4W63A 1QDUA 5H9VA 1U9CA 2Q3CA 2XRZA 1G38A 1SKUA 4MUHA 3FLAA 1UJ5A 1L5OA 1SBYA 1XZBA 1OFGA 1R27A 3Q72A 2QNBA 4US2R 3R7BA 1S9HA 2X1LA 3KQLA 1QR6A 1H22A 2LIPA 4H3VA 1JKXA 1Y3FE 2GARA 5PNTA 4DA7A 1ZJJA 1ZP6A 2GO7A 3E3MA 2RKBA 2B78A 4EGSA 4EHBA 4EMTA 4XSGA 4EI2A 1M5TA 1RDFA 3H2SA 1NOJA 3PIIA 3VYWA 2IGBA 3ONVA 5F5LA 5HOEA 4DQUA 4QICA 2PQ6A 3ZTWA 3JAWA 3T61A 3ZY2A 5LQNA 3NJRA 1NGSA 4C06A 4LUCA 4XASA 2PX3A 3N70A 4XUDA 1EP3B 4GXRA 1DOHA 1Y63A 4QHYA 5GVRA 3ZHTA 5JSFA 4OYYA 4UEOA 4B76A 1EXDA 3GZTB 1ZCAA 2PDAA 2HUPA 3EEBA 4EQ6B 2ZZMA 2B9EA 2DFLA 3MJRA 4WZBE 1VYTA 3HXLA 1QVZA 2W6JD 3PICA 4FFSA 3H9EO 4DILA 4F8EA 3EIOA 4NAUA 4Y9SA 2IWRA 5DLYA 1KR5A 8ATCA 2J0SA 4GSLA 4AN1A 4FJ1A 1M2GA 3I64A 2RKOA 3SYMA 3R7LA 1KK0A 5B4VA 2G17A 1ZLYA 3BWCA 2F4VB 3DCJA 1B7GO 3IAAA 4GPD1 4IVPA 2PR7A 4JUAA 1VTKA 1XXLA 1VJGA 2WR8A 4N0PA 4WY2A 3ZGXA 3ZIAA 5C46F 3UMMA 1IVNA 2AUNA 3O8DA 1SQ5A 2O50A 4OL9A 4YLGA 3VZDA 5KNDA 2G40A 1WP9A 4AROA 4QTXA 4AKIA 5AOVA 2V7WA 3IVRA 5FUVA 5BVHA 1AQJA 2QBYB 1L4BA 3RJTA 1M2KA 1CRLA 3KQYA 2FR8C 2HX1A 4G0QA 2AOVA 3TW8A 3S2GA 3BE4A 5F7ZA 3CGWA 1P91A 2M1XA 3GDWA 4FLFA 4QYSA 3VM6A 5L40A 3VPBA 3NT2A 2ZAIA 2XCTB 3TOVA 1Y48E 2JF0A 2ZREA 1ATIA 4UATA 4KJZA 4EWLA 1PS8A 4I7EA 4RU1A 3H1AA 3JYPA 5JS8A 1CB0A 2BF4A 2O9JA 3R3XA 4O2AA 4ZU3A 4Y2RA 3BN3A 3PI7A 4KO4S 4DG9A 1VL6A 2PJRA 1PTKA 2NXCA 1TCCA 3PQ5A 4O2RA 3UGKA 4C03A 2GAIA 3L1JA 1MEEA 1EUQA 4Q37A 4AM8A 3PX2A 3UMFA 2R1ZA 4ZGWA 5BRJA 5JASA 2Z04A 4HX9A 4A0SA 2PIDA 5FPQA 2A33A 2ZJ3A 2EDAA 1AMNA 4JQYA 1CQXA 5ICSA 2NP6A 3KTFA 1BE0A 4I4CA 5BN3A 1DHTA 2QGNA 2YVUA 3BD6A 1QKIA 3A58B 1O9BA 3L01A 4XTRA 1ZMBA 3LLUA 1CEEA 4UTOA 4IH4A 2FWAA 2WLSA 4INZA 4G0NA 2X8LA 1ODCA 1T1GA 4MV4A 4Z99A 2X40A 3Q98A 5ICFA 2BKLA 2H85A 4TS9A 3GMTA 1GVNB 3JVVA 4DUGA 4Y1EA 4JJZA 4A8JB 1RJ9A 3UM9A 4PHGA 3IEKA 3A4LA 1E69A 3H11B 1IBCA 1TC2A 1U94A 2BD0A 4EW6A 2X7HA 1MA0A 2RGCA 1SKAA 2YHBA 3N2KB 2GGSA 3A6ZA 1SXJB 4HAWA 4Q4HB 4CUZA 4A6EA 1NW3A 4UTNA 3EEIA 4H6VA 3ZS9A 3FNHA 1N0UA 1IJKA 4W5JA 3CFYA 3RSFA 2PX2A 3DTVA 3ZQ4A 2QE7D 2FAXA 4EABA 5T7BA 4Q93A 2ODPA 3NHUA 1FJXA 2ZI7A 3RS4A 4UPEA 3ZHQA 1WPXA 1R0XA 1ZUHA 3C4VA 3QM1A 5DP1A 4ZV7A 3S2SA 4CMEC 4LJ6A 2YCLA 4G1FA 1K08A 1PWEA 2VAVA 3BFKA 3LOPA 3PFNA 4ESVA 3ZU3A 4UNRA 3B5EA 2QMHA 4ZYYA 3FSGA 1Z38A 5BN4A 2XADA 8LDHA 3R40A 1LA2A 1VJ1A 3LL4A 4HGPA 5EJ9A 4HNHA 5ULLA 2ZPAA 1NWHA 4M22A 5JE8A 4IZHA 1L7AA 1UQUA 1XZCA 4LYFA 4Y6QA 4LBVA 3PNQA 1TQDA 3UWMA 1B1CA 1Q1BA 3K2IA 4FT4A 5FL3A 3OQIB 4OYLA 5DLDA 4DLAA 3CLSC 1QCZA 2DJIA 3L0CA 1NYTA 4NJOA 1FVXA 4J9UE 1N2BA 4NXMB 1Y33E 1OJLA 4M87A 4QC2A 3T3OA 2QZ4A 4YRQA 3O4GA 3KLOA 5KSPA 2JB9A 6NULA 2Z2YA 1NBOA 2Y9MB 4RANA 3AESB 4WNAB 1DIHA 1KC3A 2V7QA 5EHZA 3FOFC 3WHKA 1AQNA 4RETA 1O77A 2IPAB 1AB5A 2FN7A 2ZWMA 3TXAA 2I87A 4Y2PA 5IAJA 2X8JB 4F56A 1G5PA 1S2NA 1W9MA 1Z34A 2BKEA 2GZRA 2OSBA 3UJAA 1GU7A 2YV3A 4DCPA 1OVGA 4US0R 3PEUA 3RJ5A 1XNQB 4EF4A 3PQ3A 4WLEA 4ZI2A 4R7TA 1LPBB 2H1CA 1MNAA 1RQ7A 2CBXA 2XRFA 3VR3D 2Q3EA 4LZAA 3KQKA 3LTEA 3F7OA 3K9GA 3T4EA 2UYYA 3KD3A 1EXWA 1X1EA 4L74A 1QGOA 2BONA 2OGWA 2VNJA 3BDVA 4LCBA 5K4GA 1EXVA 2CNLA 3O90A 1V3UA 4LYHA 1S2LA 2QRMA 4II7A 1RYYA 3GVCA 4B3BA 1C3LA 5U4XA 1F0PA 2CLKB 2PSHA 3FAKA 3UK0A 4EVIA 5G0WA 5HHTA 4QFMA 1ZRSA 1AK1A 2P6OA 1Z5VA 4ZP1A 1HY3A 2X6QA 4TKLA 1XOIA 3ANMA 4DADA 4M0FA 1JUDA 1CP2A 5EMMA 2R8PA 1A71A 2EGHA 4B87A 1WSBA 3KQQA 3KE9A 6REQB 1MQSA 1MB9A 2QSJA 3QX7A 1YRHA 3NM5A 3AFIA 3IAHA 2V9PA 4BMZA 4GR9A 1FVFA 1W4AA 3AJEA 3O21A 1GZUA 4DCCA 5C81A 4COKA 3SE7A 5TQ0A 1I7LA 3LP8A 2YHAA 1SCUB 3PU6A 3HU1A 4L78A 1L7VC 1X1SA 4CV0A 4S05A 1WS6A 5FTMA 1UXHA 5IT0A 3A4YA 1J8DA 3MLEA 4GAEA 4PZUA 4U7JA 5BN1A 1GFIA 4HWKA 2IZOA 1J33A 3ED1A 1JR2A 5CIYA 2DQYA 2WRZA 2YXPX 5HKKA 2MINA 3REOA 1X9IA 1HSOA 1XU9A 4D4MA 1HE3A 3HB0A 3C2QA 3G9TA 1I1QB 2IHVA 1FSFA 4Y6LA 3DB2A 5COAA 4QO8A 3X1YA 1M0EA 4IMPA 3BDAA 3IP7A 1N2EA 3OLXA 1VQ1A 5GM1A 1HLDA 3CZPA 1R6BX 2O1WA 2PKQO 5DNVA 1N9KA 4UHJA 1Y6FA 1SELA 4UD2A 5AKHA 4G07A 2J3DA 2F9LA 1E2BA 4C7KA 3M1IA 3QKIA 4GP9A 5D01A 5E1DA 5CD1A 1JKFA 2JHAA 2ZYVX 2IT1A 4DG5A 2WF6A 5IH7A 5C8YB 1F2UB 6GPBA 4XXHA 1IUNA 1YRYE 2IYVA 1KAOA 3OIYA 5JXGA 5BMOA 3IHWA 4Y67A 1LQUA 1DWUA 4XWOA 1GTZA 3CE9A 5SYMA 2VK8A 1IVYA 1VJDA 4DDWA 1J23A 1GUYA 1JQLB 5AXDA 1SKBA 4LRYA 1WEKA 2X22A 1IBRA 5EJMA 4D9FA 1TTPB 5JY6A 4NP6A 1NVAA 2QQEA 3GJ4A 2ONKA 1KHHA 1XZPA 2RGNC 3AUAA 1AUVA 2EQAA 4RFVA 3FYTA 4ED9A 4IZ6A 5DYTA 4O4IA 1KRXA 3KSRA 3KX2A 3M1YA 1OE0A 2PSJA 4IKEA 1ZR4A 1HDZA 3CSUA 1SMKA 2C96A 3WLNA 4F1WA 4V38A 3L8YA 4V3CA 5A5DA 2CXQA 1ZIPA 2P6NA 3GFQA 3WL8A 1GPNA 2JIZD 5JXIA 5I7HA 4BNNA 2OXFA 3KWMA 3TNJA 1EFPB 3IJ5A 1XK7A 3Q12A 4L2IA 4W6QA 1XU7A 1E2MA 2C5AA 2QRKA 3AK4A 4MGZR 4A2QA 3GAZA 5A5EA 2DHDA 4YP0A 2CSUA 3ETLA 4BB0A 5KOIA 4B3HA 3GLFB 1PHPA 3EDOA 4FSDA 3UWDA 5TIIA 4NEGA 1Y80A 4CV1A 3I8OA 4P54A 5DLEA 1IK4A 1JGTA 1TJ5A 2JAWA 4RDCA 2AXPA 3QBJA 2NXEA 4RGBA 2ZUTA 5B1YA 3TTXA 2HU2A 4J7XA 3K16A 4JBHA 4E5PA 1LBSA 2AC7A 2ZI9A 3M49A 3FF4A 1UBCA 1PP4A 3S28A 4BFTA 4E1AA 3GUCA 4JVSB 4DIKA 4MAMA 1LF5A 1N5LA 2Y3IA 3NX4A 3T15A 4IXNA 4JR1A 3ELDA 1NONA 2Z30A 2GN4A 4L5BA 1HTWA 1OXKB 5KVQA 2WWVD 1SZCA 1VSQA 3DD5A 1VM6A 1E9DA 1G21A 1KF0A 3X44A 4EY3A 3FCOA 1FJHA 2QXYA 4YAEA 2I29A 2HSDA 4NIMA 3CUYA 1YZFA 4MYSA 3ROGA 1JPJA 2M32A 4C1NA 1Y9DA 2JI4A 2WJHA 2IK8A 4WN9B 5F35A 4ZU1X 5EP3A 2ZJ8A 3GGGA 4JUIA 5I51A 1EK0A 5KJFA 3PLAE 1GNTA 4OQLA 3MHTA 1K4MA 3FETA 5F3DA 1WLYA 5HIJA 2TSYB 1Y1LA 5TS2A 2F7SA 3DC7A 4XJTA 1QP4A 4E3ZA 3KQMA 4AZ0B 4EB6B 1KWGA 4OU5A 4YJGA 1X7XB 4AMVA 3D9QX 1XSEA 2RH9B 2ZBFA 1GKUB 1MT0A 3MWFA 1NMZA 4JU8A 5FBRB 3KNZA 4GE0A 4ANFA 5DCYA 4X45A 4AW9A 4B3FX 3EGEA 4DNXA 1N1EA 1H65A 1JHZA 3FY4A 1ND6A 1WD5A 4UE6A 5CH5A 5KI6A 2J9YB 2QTLA 4WTOA 3TZQA 4D4JA 1UEXC 3NUZA 1HE4A 4TKVB 3ZLTA 3QMMA 1JILA 2PX4A 1CY8A 1KBQA 1NXVA 2GTHA 4DT1B 3A2LA 1UWKA 3A6LA 3JQFC 4CIVA 1CZUA 2QN2A 3BERA 3GL9A 4ZO9A 3AEQB 2YJZA 1ULZA 2RMKA 3TQCA 4BO2A 4JIGA 3FB1A 4OKIA 4XYMA 3K9NA 4E6PA 1T5BA 5JROA 4JYAB 4NSNA 3OE5A 4GC9A 2VUIB 2QN8A 1LDGA 1Q7RA 1ULSA 3IPCA 1FU7A 2ZU6A 1NVFA 1A72A 3O4IA 4IKPA 5KYVA 4DNFA 1J7JA 1J2EA 4R31A 3RQIA 5I01A 3SK0A 4Z9FA 5JAHA 2P0YA 4PVCA 1GNVA 2FW8A 2EZ4A 3OAAA 4RL4A 4CMEA 3TD6A 1U1DA 1BE8A 2VLIA 1U8FO 3MMNA 3SC2B 4BTVA 1O08A 2J3IA 3D8HA 2H17A 4DBZA 5LXTA 5BY2A 2BE9A 1XL0A 3LLVA 1ZQ9A 2ZJ4A 3SSMA 5F9MA 1GCUA 4JOSA 5C5CA 1L5KA 2RD2A 4UHHA 5KQLA 5HM8A 2OHHA 4CGYA 1U0OC 2D3TA 1G3IA 1NC1A 3D3WA 4BLRA 4G5XA 1CUXA 1GXSB 3WLAA 3F49S 4CMIB 4NFYA 1CYEA 1R6TA 1T9HA 1EFDN 5AHKA 5IJZA 4FNGA 2B9VA 3LFHA 3OQ6A 4TV9A 4EPRA 3ZE8A 1WHSB 1N2CB 4RLHA 1MNQA 1M2OA 2ODNA 1R12A 1T9GR 4LZOA 3T1NA 4K9DA 3C16C 3CUTA 3QFTA 2K7FA 1G16A 1ISPA 1I7DA 3H5TA 2ORED 3MTIA 4X92A 4JDUA 3GJRA 3I4LA 1OZGA 3K0AB 4DW8A 3NTUA 3MUNA 4YR7A 2AF3C 4B3DA 5LNK1 1U04A 1E99A 3KU4A 4PC6A 1LTHR 1KO4A 5EZ6B 4P0QB 4UCXA 3MT0A 4XPZA 3UUFA 2BGTA 2CEAA 3MYRA 4YPVA 1WB6A 3O8CA 1DX6A 2CVFA 3PKZA 4LWQA 2QROA 1RFGE 4K9MA 5B57C 5DLQC 2X19A 1GPWB 1OI4A 1LLUA 3F3KA 2QAJA 3WK5A 3C3BA 4U3JA 2GEFA 1GNQA 3LRPA 4FCTA 4FE4A 4WX2B 3WK6A 1ZOPA 2XUHA 4BO8A 3DNMA 1QOPB 5DBEX 2A0KA 3H1FA 1OX6A 4I1PA 1OUMA 3B82A 3IQDB 5JCXA 2A0WA 1W93A 2PRJA 3BGDA 4UPVA 3UUEA 2H29A 4KQKA 3RUDA 1K5PA 1OMOA 1LCIA 3DUWA 3LHSA 1CZKA 1Z0DA 2BGJA 3C3AA 2QNRA 2QY6A 4A03A 3KD2A 3OTHA 1E3EA 4MQ5A 1ZKMA 4E5YA 2A5GA 3K9FC 2CV1A 1EFRA 2GPBA 3DPIA 1PVDA 4R6WA 3QE2A 4E12A 5CM8B 3WYAA 3EFHA 4CTMA 4OTZA 4Q3CA 4PIMA 4IAOA 5AXBA 4BV3A 1YRBA 5CX1B 4C20A 5AM2A 1DFHA 2LDXA 3Q9SA 4BLPA 2JBAA 3PD1A 2D7CA 1IXRC 1QIFA 4KMOA 4QFCA 2J6HA 5CVVA 1LBTA 3ICEA 3NNNA 4UBLA 1NE7A 1P44A 2I7XA 1D6SA 2XUIA 4LN1A 2IXAA 4FMPA 1H0RA 1MGPA 1QJCA 4NEQA 4AUEA 1ADYA 1YE3A 2P2DA 4UUMA 5AW5A 4B32A 3V8BA 3KYCA 1YFKA 4FMDF 3DE4X 3SJZA 2X42A 4ZAXA 3BHIA 2ZTVA 3TSCA 1KEPA 2JFGA 4MW5A 1ZU5A 1J22A 2K4MA 1UZMA 2PJZA 2QVBA 5CURA 3R9XA 2DJ5A 1T2NA 4L4YA 3S68A 4KFCA 4NLLA 1E61A 3HCEA 1AGXA 2D06A 1I10A 1W35A 3NJ8A 5DMXA 5ECGC 4F3TA 1V1MB 3BZWA 5DSTA 2DLNA 2W58A 4HDCA 4QQFA 4DZTA 3CIFA 3UC9A 1CY0A 3TF5A 2VG8A 3TZHA 2RI6A 5CBPB 3IA7A 2CVZA 4NCIA 1MUUA 3HLTA 3V3TA 1QIJA 4F9FA 4H1WA 4FDLA 1CE8A 4XH9B 1KVRA 3IMCA 3PL5A 4B3GA 3DM9B 3UPTA 1EZZA 4LYDA 3V7UA 4EMBA 4FGZA 3ZBUA 4QPDA 2CZQA 4WLOA 3Q88A 4L3WA 1EGAA 2H1RA 4RD2A 1O9HA 1X8JA 3W4IA 3FNQA 2QNIA 1QP0A 5K4AA 3P94A 3RVBA 4CQNA 3GX1A 4EI9A 1NFQA 4QJ4A 3LUKA 4MPRA 1J4AA 4ZRNA 1W85A 3DMPA 3E5MA 1QAMA 3JYHA 3S5JA 3TUIC 4K1XA 4ZTUB 2V1UA 1IN1A 4DRZA 2BMVA 3VGJA 5EE0A 4E32A 1Z6QA 2D62A 2GJ9A 1A8IA 4IRXA 3LBHA 4W8OA 4YGYA 4YAOA 5DHUA 3EA5A 4LCEA 4YGXB 1RPAA 2C3YA 2JDIA 2AZXA 2PXHA 1KZ9A 1XTZA 1TDJA 2NWQA 2WICA 3F1KA 2V98A 3QOFA 4M0PA 4NPCA 4FCWA 3ESYA 1C9KA 4BGUA 4BQEA 4YRMA 4ZDKA 3L0IB 3ZDRA 2VCHA 1X86B 3TRIA 1YZTA 4ND3A 2P9JA 2VP6A 5IN4A 1BROA 4WZBB 1XD9A 5CX4A 4OXQA 1WUKS 3EIQA 1AN0A 4IGIA 3G9XA 1IYZA 1EX6A 1WL8A 4Z0PA 3SKYA 3U3KA 4DTIA 4YCLA 4BQRA 4KP7A 5A0FA 1CWUA 1ULAA 3ZD6A 3TLEA 3OX2A 4G85A 3VR4A 2FUCA 2MIIA 4MUBA 3DONA 3QMVA 3RV3A 4DLZA 3NBKA 2EVWX 2GEJA 4HNAB 1CF2O 3I32A 1LK5A 3BORA 3K1YA 4X6LA 1V6AA 2BEJA 4NBSA 3AERB 3L4JA 3QF7A 3BTOA 2Y71A 1EWQA 4IKOA 4ENUA 3E7PA 5KWEA 1R74A 1FRFS 5LOVB 4JI4B 3ZD7A 3D7KA 1V96A 3U1BA 2E5LB 4E2YA 3IPYA 4HO1X 1WV0A 2BBSA 2EWWA 2QL7A 3U3JA 4ZYUA 4NICA 1KJIA 1TKRA 3ESDA 4OATA 4YMGA 1UMCB 4RA9A 1VIAA 2RGAA 5I5EA 3H4IA 2VBGA 4GO1A 4H77A 4X65B 1WXGA 2DGDA 5AK4A 2VTKA 1SG6A 1F60A 4DDTA 3TG8A 4I1UA 5LNK6 2NVWA 4FN4A 1WV1A 1L4LA 4DHEA 1CUCA 4A15A 4XDGA 4RY8A 3B1XA 1T0BA 1VHQA 2JNWA 2JGAA 2M6LA 3D7MA 3H8JA 5CHYA 3HDHA 3FMVA 4Q4JA 1M0TA 1E3DA 4QXOA 2VSXA 3VZRA 3M6FA 1MIOA 1JSZA 3OSZA 1TF7A 4NJMA 5IYZA 3T5GA 1U6JA 3FRJA 1ONNA 5C80A 4AS1A 1JH8A 2YC2C 1FMLA 4HLQB 3LNTA 2CDCA 3QBVA 1PGPA 2JGRA 3OH8A 1ZH2A 2VRWA 3KALA 1R8XA 8MHTA 5CLIA 2G1AA 3MYYA 3P2YA 1A5SB 1IXSB 3PDHA 4J4BA 5AW2A 3VZCA 1YDFA 4LY6A 4I4TA 2A2ZA 3G0BA 3VYSB 1Z22A 1BU8A 5BYKA 3GJYA 4IR7A 4YECA 1PVVA 5EWLB 1E2QA 4ZCTA 5KOHA 1GR1A 3JZIA 2O4CA 3LQKA 1S3FA 1GZ5A 4MVWA 1Q0RA 4TKUB 5PGMA 1MJ5A 3DOJA 4KNVA 3R41A 1DEKA 4B6OA 1PJBA 5E6SB 1QCDA 4P93A 1W1UA 3RODA 2ZTUA 2IUYA 3EXIA 3K96A 3BRWA 4GOOD 4LJ9A 3UMJA 2PQ2A 2P8JA 2VAXA 1ML4A 2VF5X 1Z5OA 2CL0X 3W8NA 1WW2A 4HVAA 3PFHA 3R0IA 5EJAA 1E5VA 3MCUA 4E09A 4REMA 1JHQA 3DBVO 2DQSA 4TLBA 4IGEA 3ADOA 4MS3A 3D6TB 1GQQA 1NN3A 3I2KA 4YA6A 3UNXA 2QGFA 3KS9A 3LXRA 2CFIA 4RUKA 3RHZA 5I7UA 1OWLA 2Y92A 3FZNA 3GRVA 4X00A 3NCHA 2FP4A 1U1GA 4JUCA 4M8KA 4EVQA 3E8XA 4N5HX 3THOA 1CKEA 5SICE 1JTVA 2GMWA 4L0QA 2RHLA 1LQ2A 3W7BA 2SKEA 1XHLA 2XD9A 5ED4A 5M7EA 2R6CA 2FOLA 4HNGA 3NVKI 3AVTA 1BCSA 5K51A 4M9UA 1CIJA 1QG2A 1P6QA 1WU8A 2FSVA 3NUGA 2WHQA 1VYUA 2RHBA 3CLRD 3G0DA 4OFBA 4C4ZA 3LPMA 3IV9A 5KTMA 2FEAA 3NHRA 4A26A 2OAGA 2KJQA 3VR5H 3H5WA 4TT3A 1E9EA 1JDZA 1RAEA 3GNSA 4FD2A 4WADA 3SHTA 7YASA 2OB2A 4R4JA 1YDGA 2I1QA 2P0AA 2DP4E 3JQAD 2CY0A 4FPXA 2WFMA 3KVYA 4ZVQA 3SBXA 2BMJA 2JI8A 2O3TA 1K8YB 4MNTA 4OGWA 2JJ1A 3H4MA 3R2JA 4MOWA 3CF0A 4I66A 3ZVLA 1GTL1 3NTQA 5JQWA 4LF4B 1DTWB 1YH3A 4O63O 4N18A 2VEOA 3SBEA 1QWOA 1XTQA 5JAMA 1R9MA 1Z4NA 1OU4A 1WXQA 4O3MA 5LYJA 4KQ1A 4ND7A 3IPLA 4DA0A 4TTJA 3H9QA 3IP1A 4S0XA 5ITZA 1RI2A 1TZJA 1UH5A 1PFKA 2WK1A 2N46A 3EOAI 3RRXA 5HEKA 3HBAA 1JLMA 1Q3HA 1ZQ1A 3P52A 2EEZA 4JJ8A 4JVLA 3B53X 5AM3A 5LKAA 1AKWA 3LDUA 2APJA 2D5AA 3IMKA 4FB4A 3L9XA 5L3ZA 4FUQA 3SSOA 3F73A 4MW1A 1UK8A 2OZLA 1KI1A 1Y4SA 4QULA 5DIZA 5K0NA 4EY7A 3RUAA 1NVEA 2OHGA 2JH3A 3MS7A 3PFKA 5MFZA 4RSHA 1VMIA 1R16A 1JQBA 2MMCA 5FULA 1UDAA 3WYCA 3HN7A 3H5NA 1XYYA 2NQTA 3PJGA 1L8LA 1VKJA 2JFXA 4QGBA 3OZTA 3GXOA 2BFPA 3LGAA 4MEAA 5CU7A 3QLTA 4BFVA 1JXQA 2OO3A 2TMDA 4IDFA 4KNWA 4YACA 5G0SA 4M1WA 3BXOA 1P8AA 2ZYUX 3MWJA 1REQA 3VOSA 4JKIA 2UXDB 1VRCA 1JSCA 3RLFA 3L6OO 5C7LO 3JQ9C 4NBRA 1KH3A 4RSMA 2TYSB 4IHJA 2MYUA 2BKVA 2RHMA 4RVGA 5HF5A 4BVEA 5J4LA 5BR8B 4QGHA 3RAEC 2IYEA 3UWKA 4Z1MD 1GNRA 5TEWA 5JHGB 4X71A 4PGGA 3ZI7A 4R2WA 3L46A 5FKJA 1MAHA 2B98A 3IUBA 5FBHA 2VP0A 4NCBA 2DECA 5ES3A 4LW8A 4EYSA 1TYCA 1UT5A 2Z2XA 2E4YA 1CUYA 4BYMA 1TUIA 3ORFA 4RD0A 3RYTC 1C4WA 1XKXA 2FW9A 4ZD6A 4DCTA 1USIA 3FF1A 3KFLA 2ZVPX 3A9WA 1EEHA 1XRNA 2IEIA 4PAWA 4IRUB 5TMDA 1THGA 2ZR7A 4B82A 2W4IA 4IXTA 3OZEA 4C2TA 3G8YA 2B21A 3DR5A 2FTKE 4B7XA 5BRAA 4NNOA 5EMLA 1ZXXA 4RM2A 3BXZA 5FWYA 4OHUA 2IDJA 3GZ4