4PHFA

Crystal structure of ypt7 covalently modified with gdp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
163
Chain Sequence
b'NILKVIILGDSGVGKTSLMHRYVNDKYSCTIGADFLTKEVTVDGDKVATMQVWDTGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YPT7
molecule tags Endocytosis,exocytosis
source organism Saccharomyces cerevisiae
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
total genus 46
structure length 163
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phfA00
3AKCA 3K70B 3B85A 5EXXA 3GEEA 3THXA 4NYMQ 4W5HA 3CKLA 1OFUX 2IX3A 3A1UA 3K8YA 3PUWA 4KLZA 2V7QA 4HAWA 1UM8A 1SGWA 2OSBA 1SQ5A 5DISB 4B3GA 3QXHA 2RGNA 2WKQA 4LHYA 1TX4B 3JZMA 1Z3IX 1PLKA 4I1SA 2FFBA 1Z6XA 4IOKA 1Z8FA 3IIKA 4TYNA 4WVFA 2FEOA 4TN1A 2IUTA 3RS3A 2FPMA 2HYDA 1CBUA 2XTZA 4HB2A 5AJZA 1SXJA 5FOVA 3WNCA 2W6JA 4PQRA 4UXHA 2XB4A 4L15A 2AWNA 5FBWB 1G5PA 3TVTA 2OBNA 4PZZA 5B57C 3G0HA 2BC9A 1YZNA 3THOA 1TL7C 4CEJB 2G88A 2ZYUX 4P33A 5B58C 4GZLA 1GIAA 4QHYA 1W47A 1P3JA 2IHBA 4IDHA 2XB2A 3ICEA 2O8EB 3SJBA 2OAQ1 3ECCA 1ZD9A 1XEXA 5UKDA 4C2UA 3FMFA 2IYZA 1D9XA 3OAAD 2WSMA 1ZMXA 2RHDA 1E69A 1GKIA 5CM9C 1XXHB 1R0YA 3QJYA 1VHLA 4D81A 5C18A 2O0HA 1MH1A 2OFWA 1GITA 1RVDA 1NMXA 2WSSA 5J47A 4GFDA 5EXSA 4MYUA 3R20A 1GRNA 4CEIA 5CDFE 2CNWA 1I2DA 4Q5IA 3QXJA 4QBIA 3GLHA 4UNRA 1T9HA 1OH6A 1ZW6A 3VU9B 4DT1B 1T3HA 4JLNA 3QPWA 2BWJA 5LD2B 2F3RA 5FTLA 2C77A 4I1VA 1GUAA 1YE8A 5JEDA 2FPLA 1OIXA 2J0UA 3QE0A 2AWOA 2JLRA 3EARA 2AXNA 3BFKA 2C04A 2IEZA 2VP6A 3E2IA 3F5FA 1W4AA 2JASA 2CE2X 2QA5A 3GJ6A 3OIWA 5KSYA 2IXFA 1ESNA 4NTZA 3DM5A 2OO7A 5GVRA 2ODNA 4ZDIA 4M1TA 1X1RA 4A6PA 3Q72A 2BV3A 1WRBA 3M4YA 4ARZA 1D6JA 1X6VA 4UNPA 3R9IA 4HZIA 1EWRA 1DE0A 1P9NA 2FJUA 4OJQA 1H8HA 4JMPA 1TQDA 4O2LA 4JBXA 3AP3A 4NHOA 2JDIA 3N2IA 4BLSA 2C99A 4B48A 4AKIA 5CJ2A 1Z6TA 3U7EB 2FMXA 3ND8A 2PBRA 4LJ5A 2J0SA 3PEUA 1SULA 1A82A 4BFXA 3TUZC 2HEIA 2Z6VA 3R7WB 4BFSA 1G4AE 4RSGA 2ATVA 3OEEA 3L0SA 2RGAA 2GXQA 3FDIA 1HT1E 1JXOA 1G8HA 1NF3A 2IYQA 2XX3A 3WBKA 4B2LA 3S1AB 2ZETA 1IXSB 1EX6A 5C4MA 2R44A 3I4LA 4HUTA 3GQBA 2NIPA 1R8QA 5J4HA 2BEKA 4UXJA 1VCOA 3LLMA 3AV0B 3BFXA 1JECA 1S0UA 1G8FA 1YRBA 3QKRB 4AKHA 1R0WA 1TF5A 3KJIA 2LKDA 2VHTA 2REOA 4HSEA 3BB4A 5KNBA 4LK2A 1E2QA 2DY1A 5AR1A 3ZS9A 2IYVA 3TW4A 4NCHA 1EFHA 5K8LA 4D4LA 2ONJA 1XJQA 1KNQA 2D7DA 4P4UA 4YMVA 2NGRA 1OHHD 2C8VA 4IVRA 4KJZA 2OG2A 3OZXA 4DCTA 1D2NA 2GESA 1F6BA 1II8A 2UKDA 3CIOA 2YOHA 1KJZA 3GJ7A 4ZKDA 4MGYR 1XTJA 3SR0A 3EIEA 4G01B 1NVWQ 1XP8A 1U90A 1YR7A 3DZDA 4TSFA 1MABA 2QPOA 4DWJA 4EJSA 3PENA 5BW8A 2XXAA 121PA 2ZRMA 1G3UA 1W7AA 3FMOB 1XJ0A 1IY2A 1E2NA 2ZJYA 4X8HA 4A15A 1E0KA 2MMCA 2CCKA 2FEMA 2W0SA 1ZUNB 3IO5A 5FPHA 1NI3A 2QPTA 4B2PA 4EKDA 5FPYA 1R6BX 4KCGA 1U8YA 1P2VA 4NYJR 4PAOA 3A1VA 4LYJA 3NH9A 2XAUA 4M1WA 3GLGB 2WWXA 4JYCA 1UDXA 1VYUA 2ZYWX 4KV9A 2OT3B 4Q00A 1XMJA 1UEJA 1MV5A 2NPIA 2GF9A 4US0R 4BZPA 4M1KA 5KDOA 3MFYA 4AYXA 1W2GA 3HU1A 4C30A 2DHRA 2R9VA 2WAYA 3FHTA 4HATA 3IIMA 1OPXA 3SHWA 2QP4A 1JAIA 1G3MA 3U4QA 2LCFA 1NLFA 1YQTA 2FZLA 3ZIAA 3RSOA 3DOEA 3GLIE 3SDZA 1QVRA 5JS7A 1ZNXA 3SFVA 4O0MA 2JLSA 2QSYA 3E5HA 1FUUA 3PUVA 4DB2A 1L2TA 1OXXK 2GZHA 2CJWA 1B0UA 3V9PA 4F4JA 4M1SA 5JWOA 4W5WA 1EFCA 3T1QA 1ZINA 3WBJA 4JL8A 2K5UA 4C0LA 5G40A 1GNPA 1U9IC 1ZCAA 3FKSD 2QAGC 3M1IA 1KJWA 2NG1A 3NG1A 3SBDA 1SVIA 4TLBA 2QORA 3G82C 4QXAA 1DOAA 4TT3A 1BYUA 2YV5A 3Q5EA 2F1JA 3TNFA 3FB4A 4Q47A 3NHAA 3QG1A 4K81B 1G4UR 1IY0A 1FPMA 3NWJA 4HLUA 3LH5A 1CR2A 3SFZA 1T8TA 4RY2A 1NNEA 1OKKA 2IYYA 4HI0E 4V03A 4AWXA 4LBWA 1OB5A 2GEUA 4IDNA 1KK2A 1TU4A 3ZVRA 4B3DA 2ZI4A 1XZQA 2O52A 2ZRIA 4B73A 3CX6A 2WICA 1E9RA 2QT0A 2ZEJA 3AF4A 1G64A 2VP0A 2ZRLA 2L0XA 3EIQA 4HAXA 1W44A 3HU3A 1LW7A 4PANA 5E4FA 4QKQA 4JBWA 1T5IA 2H7VA 3UANA 5FPTA 4MUBA 3MCAA 521PA 4CEHB 3OE7D 3L0PA 4BLOA 2XGJA 1YU9A 4M21A 3MAAC 4HEJA 4JVSB 4Q48A 1Z2AA 3UKDA 2FZ4A 4A0HA 3O47A 1OW3B 3U3OA 1M7GA 3QVUA 2QQ0A 2QMHA 3FE2A 3CH5A 1SKYB 2P5TB 3BB3A 1KDRA 4S35A 1U99A 1BMFD 1YZTA 4JLVA 1II8B 4EFNA 1J7KA 1DS6A 1XMVA 5L8VA 1Z0IA 3V4RA 1T6NA 3PVSA 1E1QA 4RD3A 2A5YB 2B6HA 2Q21A 4Z8XA 4B35A 3L8YA 1YR8A 1KI6B 1MRNA 1NJGA 1N0WA 1E9SA 3SE0A 2ODEA 4MRRA 2XNDA 4PQFA 2FSFA 4KSCA 1AN0A 3NBZC 3TE6A 1HE1C 1HUQA 3FOZA 4TLCA 1C4OA 1KTVA 4GP7A 1CEEA 3THXB 2CDNA 4NYIQ 4II7A 1RRCA 2VP2A 3SC3A 1H8ED 4M9XA 3QXSA 2J5XA 4KFSA 2R8RA 4KSBA 5J4YA 3SQXA 2HF8A 1X8JA 4Q1BA 5IK2A 2IC5A 2GTPA 5KPJA 4PSVA 4PPNA 2X2EA 2XSZD 1N6PA 3TW8B 3VU9A 2A30A 2V54A 2ZI6A 2Q9AA 1YR6A 2QT1A 3P20A 1MT0A 3GJ5A 4NONA 5FL7D 4ERNA 5JSZB 4B32A 2G1KA 5HKKD 2EFCB 2IF2A 3CNLA 4R9UC 1LS6A 2CK3A 3ASYA 5TDHA 5M04A 1TADA 2O5VA 1COWD 4RKEA 3BFVA 2QTFA 3C4JA 1IAQA 1QVAA 2ZROA 4GP6A 4RD1A 1OH7A 1OE0A 1N6OA 2VLIA 2X19A 1KO1A 1KKMA 5FFMA 5FI1B 4US1R 3A6PC 4WZAE 4B43A 3HR8A 5GADl 1XEWX 3L0OA 3NXSA 4QBGB 5DN6D 2XZLA 3EAQA 2XOKA 2ZVQX 4LJYA 4V0NA 5EP3A 2D2FA 4TL8A 3KXLA 4G5RA 4PO1A 4Q66C 5K8TA 2JA1A 1R7RA 1QHHA 4ZO4A 3VKWA 1OFIA 3Q3JB 4PPGA 2QY9A 2HT1A 2JGNA 1XMIA 4NKRA 4OHWA 2JAQA 3SYLA 3X1XA 1FFHA 2ONKA 3HDTA 1G3RA 4TLEA 2WIAA 2YWFA 2O0JA 4GI7A 4EQ6A 5DHFA 1I4LD 2DBYA 2OCBA 1X3SA 4H1UA 5J40A 1HQYE 3RRNA 2I1VB 2Z5FA 2QM8A 3WHLA 3RC8A 4LJAA 4ZI2A 4TYWA 2ANBA 3W8RA 3GLHE 1QHIA 4OL0A 3QKRA 4KFTA 4MYTA 4Q4JA 4MRNA 5BQ5A 2RGXA 1XWIA 2ZR0A 4OKSA 2OCYC 1ZUIA 4BEJA 5EP1A 4ZDJA 4TYQA 1E2JA 3QQ5A 3H84A 5HTKA 3DPUA 4A8JC 3X1DA 3BE4A 3AVVA 2N42A 4ZDWA 4DXAA 4XD7A 4L9SA 3NBXX 1EGAA 1OIWA 2ORWA 2QROA 2RB4A 1G19A 3PUYA 4JT4A 2CHGA 4Q9LA 3IO3A 4Q4AA 3KUCA 4Q1EA 5EQTA 3VKGA 4DLUA 4PSKA 3CF2A 4M1OA 3U3JA 3BK7A 3LBIA 621PA 2ZANA 4TMTA 4KI0A 1YZGA 1FTNA 1GNQA 1VG1A 3GCGA 4JLDA 1SVSA 4OK6A 1XZPA 4XJXA 1ZYUA 3TAHA 4MQBA 1H65A 1JALA 3SEAA 4BPBA 3TR5A 1YZQA 1CR0A 4DJTA 5KYKA 4LGMA 3UG7A 2MSCB 2DCUA 3RRYA 4Q03A 4ZIRB 3CWQA 1MOZA 2HJVA 3T1OA 4LHVA 3QI2A 4DSUA 4WBSA 4Q7KA 4M22A 5SZIA 5CITA 2VTKA 1B23P 2QGNA 1G21E 3RSLA 3F8TA 3LDAA 4RD2A 1E98A 3NC1C 3EZ9A 5CIQA 2VRWA 2YKGA 1XBTA 2GAOA 1ZUHA 3CF6R 1Z29A 4GDFA 1QHSA 4H1VA 1MO6A 5EE3A 5DE3A 3K0CC 1S1CA 1SXJB 1AZSC 1MR3F 3B5JA 3IEVA 3VR3A 3T06B 1E0SA 2WZQA 2JIZD 4LCBA 2ERXA 4NCKA 1YR9A 4OQMA 1UADA 4UJ3A 2RHMA 3DL0A 4JBYA 2B7CA 3C14C 1E2EA 1M74A 4OI4A 1TUIA 3KB2A 4JZKA 1KSFX 3GLGA 4NYIR 4MYCA 4QJ3A 4QM6A 5JLJA 1Z83A 2A2ZA 2WAXA 1KO7A 4RZ3A 4CF7A 3K1JA 2DFKB 3DVLA 1HQCA 3D6TB 2WWYA 1GOTA 3LW7A 3GLHB 4HAUA 3SBEA 5FR1A 2VBCA 4QHTA 4GOXA 4HAZA 4Q1AA 2ECKA 2ZS8A 1TPZA 3IKJA 1TEVA 3X1YA 3EPHA 2J45A 3L0IB 4AIIA 3SNHA 1L7VC 4M4SA 4OI2A 4PHTA 2IS6A 3KFVA 4P4SA 2V6IA 5LDDC 1NVXQ 2J7PA 1IHUA 2GILA 1XRJA 1ZNYA 4JKYA 3DZ8A 3I32A 4DUGD 3LBNA 3KQLA 5E3HA 4LC1A 4WZ6A 4F92B 1ZD1A 4FN5A 1FW6A 1E1RD 1JEDA 5FL3A 2EWVA 3C7KA 1C9KA 2JIZA 3GJ4A 5B2ZA 1R5OA 5BYKA 2BOVA 2ZSDA 1P6XA 1ZM2A 4P0TA 1E1QD 2AX4A 1XD2A 2UZ3A 1UF9A 4URXR 4TQUS 4GPTA 4TLAA 2OHFA 2Q6TA 3LQRA 1OV4A 1UEIA 3SS8A 1A5TA 3WP0A 1CS4C 1VHTA 2KJQA 4S2EA 4F4CA 3MJHA 4PO8A 2ZJAA 1XTQA 1JR3D 2B21A 4Q9KA 5B30A 3QXCA 3DKVA 3BRWD 1K5DA 4DKXA 4IDOA 3ICQB 1SVLA 2QU8A 4IDPA 2NPFA 5DH9A 1EG7A 1KOFA 2VP9A 3AVOA 3MGCA 4ZIRA 3O8RA 3TMKA 2C78A 4OHXA 1XCGB 2VHCA 3EW9A 5JWHA 4BFZA 1ZAKA 2PJRA 4PXAA 3CRVA 1KK3A 2IK8A 2GVZC 1VKJA 1W5TA 5DI3A 3DOFA 4MKIA 2RMKA 3IPXA 4GT1A 4HB3A 1TUEA 1OXTA 4FIDA 3LV8A 1P75A 3GPLA 1XD8A 4A36A 3U44B 4HUQB 4ZV4A 5CYOA 4B34A 1D2MA 2A9KA 3ZGXA 3GFTA 4WOPA 3D8BA 3PFIA 3LRPA 1GTVA 1N5LA 1QHGA 2DPXA 1P2UA 3ZVLA 3VAAA 4DLYA 2RGNC 1HTWA 1WA5A 2ZRAA 3VKHA 4UKDA 1R0XA 1GFIA 2QRZA 2A5JA 3U5ZB 3FPAA 1Z6AA 2C9YA 2BDTA 2GEVA 2ZAMA 4GMXA 3CBQA 4Q1DA 3ZQ6A 2G77B 1ODFA 1JB1A 4GMDA 3VX4A 4C4PA 3VNUA 1SXJC 2JLYA 5JI3E 4Q9HA 2BEJA 1DAMA 1Q22A 1FP6A 1T5LA 4Q7MB 5CDFA 2ZTSA 3QKTA 4A82A 2W00A 5CB6A 3KFXA 1SZPA 1PVOA 5CK5A 3SYNA 4A2PA 1IJFA 1DAIA 3KXIA 4OJKA 2JLVA 1CKEA 4HZUA 3FHCB 1VMAA 2IYTA 4TTPA 2V55B 5SZJA 5LB2A 1OXUA 3TAUA 3GLFB 1HT2E 1EX7A 3EC1A 5FTMA 1OFHA 2QI9C 5EJEA 1U2RA 3DKPA 1XD9A 4XWKA 4ESVA 1W5SA 5F9HA 1A4RA 1Z2CA 2HF9A 1HURA 3U61B 2F7SA 1ZM4A 3QEJA 3PR1A 4ZDKA 3K9GA 1YZKA 3PV0A 4LHXA 4OQXA 2NQ2C 4LWZA 3AF1A 2H8KA 3THWB 3W5IA 2RAPA 4C0BA 4IKEA 3HWSA 3K9HA 3HU2A 2V6JA 2IF0A 2N1BA 1VCMA 1OYWA 1W46A 2D74A 2ZSEA 4Z8YA 4B3BA 4US2R 5DN6A 1E9DA 1GL7A 1G17A 1XX6A 3RVBA 4OHYA 2BBSA 2QAGB 4D82A 4Q4HA 4KBFA 1Z0FA 2IYLD 4PHFA 2N46A 2NTYC 2O8CB 5ELXA 4JT2A 2FDCA 4M53A 4QGFA 3FFBA 2GKSA 2ZREA 2P2LA 1UKYA 2HDNB 4I81A 4CRWB 2MSDB 4CT5A 2DWPA 2GXUA 5AJYA 2WPDA 5KPDA 2FFQA 2OM2A 2WV9A 3IBGA 3CWZA 4EIWA 2ORIA 5HKKA 4QJ5A 4G3XA 1NN5A 4LX0A 4OK5A 4Q21A 4Q7LA 4LV5B 1Z0DA 4OQLA 2V1XA 4F7WA 3BH6A 4MKFA 1I2MA 4TWZA 4EJSC 2AKAB 2GDJA 2VHJA 3SHFA 5AUPB 1N6IA 2XSZA 1W36D 1J8MF 4FMBB 1KSHA 1EFUA 3SYKA 5EP2A 1SHZA 3QVVA 2QRNA 4XSHA 5FPKA 3MLEA 1F2UA 4IVQA 2IXEA 3DM9B 1F48A 1YRAA 4GBMA 1PLLA 3NIBA 2G9NA 1P9WA 3IGFA 1DEKA 1DPFA 4ILEA 4PO9A 2PL3A 5KO2A 3WRXC 2ZUCA 4HUQA 2C98A 4O2RA 1UDWA 2BKEA 4FMDF 4G5SA 5EZ6B 2ZJ5A 1LS1A 3L82B 1MO5A 2EYQA 1AS3A 2TMKA 3AF3A 2JLQA 2O8BA 1KO4A 4XWAA 4RFSB 1KI6A 1UKEA 4N3NA 3REGA 1KZGB 2ZM5A 2JDID 3QXXA 4AYWA 3U6BA 1E2KA 1NVVQ 3TSWA 3SOPA 1HEIA 2BVNA 2QP3A 4PZLA 4B6EA 4ACAA 3PEWA 4QFMA 2CBZA 4GOKA 3NHBA 3BOSA 4O25A 4V0OA 3WHKA 5IT5A 1RJ9A 4U02A 2Y8EA 2ERYA 4BEBA 4EPXA 1OB2A 2VA8A 3PUXA 2QBYB 4FWIB 2PZFA 3AVPA 4ASUA 1DADA 1Q12A 3NTUA 3WXMA 4AD8A 1T0HB 1CJMA 1N2CE 3CONA 2GK6A 1DG3A 2GCOB 2JCSA 4IRUB 1JPNA 3T1VA 1UBCA 4F38A 1PJRA 3GLFA 1WXQA 4JLBA 4RZ2A 2QTHA 1XDBA 2ZJOA 4GNKA 3OFNA 4LBZA 4OHZA 3R9XA 1SVKA 4Q18A 3CZQA 2H17A 2J41A 2NOAA 2RH5A 3TJZA 3JVVA 3HP1A 5DIFA 1KNXA 3RHFA 2WSSD 1A7JA 1P72A 5C46F 4ZI3A 2YC2C 3QSYA 1PZNA 2YWEA 4R2HA 3K09A 3Q8XB 4P32A 4AK9A 3KJHA 1PLJA 2ZJ2A 1OJLA 3CX8A 3M6AA 1E2MA 1ZU4A 3ZDQA 2PEYA 5C4GB 4G5OA 3C8UA 4YMUA 4LY6A 3FKSA 4QBHA 4PSAA 2GJKA 4X8LA 2EFEB 3OFND 3QKSA 1YVDA 1U8AA 1S4QA 2R65A 1G18A 3HPRA 3UK6A 4QGHA 2FOLA 2W6JD 1FP7A 2YWHA 4OHVA 4DLVA 1RRGA 3P1JA 1GNRA 3EZFA 3ZIAD 1G3QA 1U9IA 1WE2A 3DEFA 1NN1A 2PEZA 3Q7QA 4RCZA 2VHUA 4C7OA 3IQWA 4LJ8A 1GAJA 2CL0X 1XJCA 1WB9A 3BH7A 3UIEA 3BBPA 3WYAA 4BFYA 2O8FB 3P4YA 4FCWA 3MG9A 1U81A 3U4QB 4IOLA 4HLUC 2V7QD 3QBVA 5LPNA 4TZ0A 3U2QA 4IOMA 4P4SB 4C0AC 3N70A 1N6KA 5JHGB 5EE5B 3WYFA 3LA6A 2PX0A 2AKYA 3Q85A 2VSOA 3KJGA 4GOJA 4AG5A 5KTYA 1UAAA 4Q02A 1ZC3A 2BMFA 3MRSA 5AUNB 1G16A 4NMMA 5DHAA 4JJKA 2C9OA 2VHQA 4MA4A 1RE0A 3A8TA 4M9SA 1VTKA 1LF5A 4MGKR 4M0LA 4DDVA 2DFLA 2RGDA 3OIVA 5TV2A 3N5CA 1YKSA 4EPWA 4EUNA 3ADBA 3FFAA 4DLXA 3KQNA 2CHQA 2C95A 2CLCX 4D80A 1DVRA 1KHTA 1NP6A 1KAGA 1JR3E 1S1MA 4Q4AB 3MMPA 3D7MA 3EA5A 3DO6A 4KU4A 4LV6A 4V0LA 3W90A 3LAWA 1UJ2A 2GJSA 3EIHA 4BECA 3U3KA 1BKDR 4URVR 4D26A 2VP5A 3UATA 1S3GA 4WAUA 3R7WA 4DC9A 2FN4A 4QGGA 4W9MC 3UPUA 1X8LA 3X1WA 2WOOA 2FSHA 2QP9X 3WYGA 1FX0B 4M9ZA 2H1LA 3ASZA 2WPDD 4LJ7A 4XTRA 2ZVPX 1NG9A 4NDZA 4WA7A 2JLZA 3ZS8A 4YQFA 2V4ZA 4AKEA 2D62A 4YDHB 3CPEA 2A5FA 2WJYA 5L3QA 1YHNA 1E9FA 2OV2A 2RGCA 4ZCMA 1O87A 1J70A 1DO0A 2O8DB 3PJRA 2QUZA 4R71A 2FH5B 1NN3A 2DFNA 4ABYA 2GCNA 2P65A 1QHNA 1XF9A 2RGEA 1K8RA 1GRRA 4TMWA 3PEYA 1G8YA 2F1IA 3DHWC 2IWRA 5JJKA 2OLKA 1ZNWA 2F6RA 2ZE6A 2AK3A 2EQBA 2OESA 4U7DA 4A92A 1YZLA 4AURA 1NMZA 4KFRA 3C5HA 1XTSA 4YONB 2CL6X 3U7HB 4TYYA 3FKQA 4NP6A 4KVGA 1F2TB 3KTAB 2ZRNA 4GRAA 2ZRGA 4PC2A 4QNRA 3LQQA 1IN5A 2OUKA 3C5CA 4DSOA 1KI3A 1E9AA 3CH4B 2YOGA 3QKSB 4JLAA 2VP4A 3P26A 4B2IA 2J46A 5C1BA 1JAHA 3KJEA 4BZXA 3G5UA 1CIPA 3I3SR 5AK0A 4Z51A 3B9QA 4RD4A 1L8QA 2Q9CA 2EWWA 2IW3A 3KKNA 4TMZA 4FWTA 5GJBA 2R6GA 1FL9A 3VR6A 1S8FA 5FUWA 1Z22A 5DLQC 2REXB 4LV8B 1Z5ZA 1ONBA 1TAGA 5E7JA 2IA5A 5J4LA 4URWR 1R5BA 3MSXA 3GJ0A 3AVXA 1A2KC 4C9BA 1DELA 4KITB 2HJGA 1TQ6A 1AM4D 4DSNA 5JRJA 2E1RA 4DLWA 4L9WA 3W9YA 1CRPA 4DVGA 3K70C 2NO1A 2WHXA 1Q3TA 3THWA 2DR3A 1KDOA 1ZM3A 4G0NA 3A4NA 3KZ1E 4N1AA 4URZR 1W48A 1NKTA 1KSGA 1GKYA 3RS4A 3B6EA 1AS0A 1ZM9A 1RRPA 1ZIPA 1E32A 5P21A 3VR1A 2FGKA 3LX8A 2WJJA 2E87A 1KY3A 2W2TA 2O8CA 3LNCA 2ZRPA 3RWMB 3W6OA 3GLIA 3ZZTA 1VG8A 3NBYC 4QBFA 4MKHA 3PCRB 2A3RA 2HT6A 5KDDA 2ANCA 1SXJD 3IQXA 4OI1A 1ZRHA 3IDQA 3MWKA 3ADCA 1ZP6A 4HLCA 1IN8A 1SHKA 2QSZA 3A58B 2YYZA 1P5ZB 4MRPA 2ORVA 3OIUA 4NCNA 1GZSA 1R0ZA 2GXSA 4QC2A 4QGAA 5E7IA 1SVMA 3THYA 1KI1A 4JLPA 2HUPA 3QF4B 1G6OA 1NVVR 3WP1B 4TTQA 2ZJZA 5JJIA 1LV7A 5DYIA 2ZI5A 5SZHB 4EPVA 1N3BA 3T12A 1KIMA 4FINA 1I4DD 1TQ4A 3K09C 4D0GA 5EE9A 3AKYA 1UKVY 5BYJA 3T5GA 3AM1A 3BS4A 4PPQA 1G1MA 4DCUA 2ZITA 1CJUC 5E95A 3FMPB 3TGPA 1QRAA 4Q4JB 1DG1G 2X2FA 1W2HA 1BO6A 1ETUA 1G7RA 2HXYA 1DO2A 2CEAA 3CPJB 3B1YA 4FMCB 1E94E 4NYJQ 3IPYA 3RS0A 4CW7A 1XPRA 1CULC 1BIFA 2Z4RA 4Q01A 1JJVA 5L3SA 4QRHA 1WP9A 1JQJC 3LY5A 3U7GA 3FYHA 4JYBA 1OIVA 5B64A 4DEXA 2J0VA 1OLOA 2WWGA 1E2HA 3CO5A 1ZJ6A 3I8SA 2R6AA 3LXRA 5D3MB 5GJWC 2ODBA 3ZZUA 3TKLA 4JSYA 4HAVA 2GEDA 2O8EA 4JLKA 4XSGA 4QL3A 2ZIAA 3QNUA 1KSJA 2IL1A 1IM2A 4RCYA 1VECA 2R6FA 1DAHA 3IEUA 4YC7A 4OBEA 1JQLB 2ZU6A 2PT7A 3AUXA 3U60B 2C2HA 2RGBA 1NJFA 2ZJBA 2W2XA 3DDCA 3UXMA 3WMEA 4CVNA 1N5KA 2Z4SA 4DZZA 4TZ6A 4NH0A 4B74A 1TTTA 2HCBA 2WBLC 1ANKA 1P60A 1E2GA 3TBKA 1K6MA 1SXJE 2OAP1 1NSFA 1FMJA 2GRJA 4BGDA 4HB0A 4FI3C 4V0KA 2JATA 1ZIOA 3MJRA 4D4KA 4EDHA 2O8FA 2FA9A 3IUYA 1PUIA 4HB4A 2F1HA 5HZKA 2GJ9A 3QY0A 2I3BA 2BMDA 2IYSA 2NZJA 3CR7A 3VR5A 1N6RA 3EPJA 3C41J 5A4JA 1RRFA 2NO0A 4TL7A 3QIAA 4FW9A 1RC8A 1EESA 2KWIA 1E9BA 2P6NA 1E2LA 4PZYA 1NMYA 4A0FA 4CZ2A 1M7HA 2IHYA 1AIPA 3P4XA 2G83A 5FOUA 1FUKA 1XU4A 4A1FA 2FGJA 5CM8B 5AUOB 1X8KA 3DMDA 4R98A 4AKGA 1TF7A 1SVOA 3NH6A 1NBMA 4XVRA 2Z83A 3AB3A 1NLYA 3LFUA 2F43A 3RS7A 2QAGA 3SJAA 3I5YA 4MKGA 2WVJA 2AHOA 1G8GA 5G3YA 1Z0KA 4YXWA 1FQJA 5HR5A 1E2PA 3ZD7A 4K46A 4BE7B 4JVLA 1KMQA 3RRMA 3C16C 4TQAA 1NN0A 5DGXA 2V3CC 3SQWA 3T61A 2W58A 2A5GA 8OHMA 1IOZA 3S1AA 1P62B 3CM0A 1Q3HA 3A1TA 4DDUA 3Q9LA 4E5UA 1IXRC 2CXXA 3L2OB 1G5TA 2IYRA 1RPZA 4UNSA 5H68A 3VFDA 4RZXA 4QG7A 4B76A 3TSZA 1WQ1R 5J4VA 1RFLA 1F2UB 5BN4A 3RRZA 3KKPA 2YOFA 4AG6A 1E4YA 2VH5R 3QF7A 3KKOA 3KKQA 4DDWA 1LY1A 3B9PA 4IHQA 3X2SA 1DARA 4KODA 1CJTC 2VO1A 2ZR7A 4RFSA 4YMSA 1NL3A 2ZYTX 1DTSA 2PX3A 3V4FA 2OILA 1Z6GA 1KDTA 5J4KA 1QHXA 3GJXC 1R4AA 3CB4A 2XTMA 2NO6A 4PAQA 1M7BA 5GVSA 1VG0B 4B3FX 5JECA 2WWIA 2IBMA 1W1WA 3H2YA 1M8PA 3LW8A 4OK3A 2BJWA 2JLWA 2XNSA 2CMKA 3W6NA 1Q57A 2J7KA 3TK1A 2QE7D 5FTJA 2C9CA 1JR3A 3WRYC 1FNNA 3U3RA 4DHEA 3KXKA 2BMJA 2PT5A 2IT1A 3WY9A 1KI7A 1QG4A 4ZKEA 4DB4A 3ADKA 4M8NE 2YC4C 4RD0A 1PUJA 5IDVA 1PV4A 4JJZA 1G7TA 4NBSA 2WJHA 5SZKB 4DLZA 1XNJA 3LLUA 3D3QA 3B60A 3LXXA 2LWIA 1E79D 5FBVB 4YLGA 1NSTA 4FCTA 1JXMA 4L16A 5HZHA 4J0QA 1MKYA 2XOKD 1E1RA 3EZ7A 2AFIE 5AJXA 3RWOA 2QGZA 4DUGA 4PC3A 2X77A 1RIFA 1E6CA 3W3ZB 2J7PD 3T35A 4RFVA 3CRQA 3K53A 1COWA 1G41A 1UFQA 4RVCA 4LZZA 4D0NA 3ZVNA 3EPKA 4I99A 5GJCA 2R6CA 4NE2A 1OH8A 1Q1EA 1XFAA 2PCJA 3QPVA 4WW0A 1OYYA 3X1ZA 3RC3A 3KDSE 2VSXA 1OFTA 3B78A 2EFGA 1X86B 4DDTA 4HAYA 4LPSA 4LUCA 3CX7A 1J8YF 3VNVA 4IOJA 3TSOA 2O0KA 3CW2A 1KI8A 1S2MA 5TXGA 2EYUA 4KVAA 4LRWA 5IK2D 4JVMA 4LJ6A 1HV8A 1VIAA 3I72A 2IUUA 2GJ8A 5FOSA 4TTRA 3ONWA 3U6KA 4BASA 3GFOA 1U94A 3R9WA 3VHXA 5FH9A 2ZYVX 4PFSA 4Q9IA 4AC9A 3NKVA 5FUVA 2XZOA 5JRZA 4D6PA 2ZR9A 1K5GA 1OXVA 4HZUB 1E3MA 1LNZA 1V43A 3PIRA 1YZUA 1N6HA 3REFA 3T5DA 5CYPA 2XNDD 3FWYA 2ZUBA 1W0KD 3GLGE 1A2BA 5JSZA 2CCJA 2OFOA 1FOEB 4UJ5A 1RYHA 3NEJA 1EXMA 4QOSA 1Z06A 4P31A 5FTKA 1HYQA 2ODWA 3K0SA 1TU3A 2X1VA 1DAGA 1LTQA 1ZM7A 1BMFA 4NYMR 2NZ8A 3ZLJA 3BIFA 5JBQA 3T1TA 2EFDB 5IRCD 1P7CA 1CR1A 3VR4A 3GLIB 1FZQA 3I5XA 2ZRDA 2OBMA 4G1UC 4N0DA 4WXRA 5KNDA 1Z0AA 2W6ID 2CCGA 1DAKA 5CK4A 5H70A 2UZIR 2AXPA 2DFTA 5FOWA 2GK7A 3B13B 3FMIA 2FSIA 4LPKA 4CT4B 2ZRKA 3U7FB 3ADDA 5BN3A 4PTLA 3UWKA 2A78A 2V1UA 2DYKA 3OE7A 2FSGA 2OCPA 3GMTA 2YVUA 4TMVA 5TVKA 2BM1A 4ESHA 1F3OA 1OT3A 2B8TA 4WZBE 5D3QA 2FFAA 5BXQC 3K70D 1XPOA 1CF4A 3WNBA 1Z6YA 2E9SA 2R2AA 4URYR 4BFVA 2AR7A 4DSTA 4ACBA 3Q7PA 5F98A 2HLDA 2XITA 3H4MA 3RDPA 3ND9A 1S96A 3I61A 4H9GA 421PA 1MRSA 5G41A 1KI4A 3B82A 1FX0A 1OKKD 1BYIA 4JVNA 1FNMA 1P61B 1Z0JA 3V00A 1P4SA 2C5LA 1W36B 4O3MA 3FTQA 4P3YA 2B7BA 2P3SA 4DIEA 3KX2A 3KQKA 4Q7JB 2ATXA 1Q20A 2G0TA 4TT3D 4A4DA 4DLSA 2ZSAA 1JNYA 4DRZA 2XTNA 3CUEF 2PLFA 3AVQA 3CPHA 4TQ9A 4JKIA 1U98A 4HLQB 1IN7A 3VQTA 3FHOA 4IJMA 4JIMA 3IIJA 2ZSBA 2H57A 2IS2A 1F5NA 5JZVA 3MUFA 4ITRC 1C1YA 2PZEA 4CDGA 3EX7C 2WTUA 2GWHA 4NPHA 1Z63A 3W3AA 5FBQB 4BFWA 2FU5C 3AKEA 1ZNZA 1SKYE 4LBVA 2XZPA 2YJTD 1KYIA 3A36A 4LYAA 2FE4A 3I62A 2BBWA 4HDCA 2RGGA 4Q19A 3TQFA 2R62A 4BLRA 3RAPR 2FNAA 4IVPA 3ZD6A 1N5JA 3KB1A 1CXZA 1XEWY 4A9AA 2VSFA 1W36C 1AKYA 1P2TA 2HV8A 5FPSA 1JPJA 2WWHA 3O8CA 2BMEA 4POAA 4QJ4A 1R10A 5DSZA 1GKUB 1WF3A 1W0JA 2QL6A 1EFTA 1E96A 2H92A 4GSYA 4LJ9A 4PX9A 1W0JD 5FTNA 721PA 1DBSA 2W2VA 1S9DA 2Z0MA 2PZGA 1LB1B 2A5DA 4U5XA 1E4VA 3CRRA 2G3YA 3DMNA 1R2QA 4DCVA 5JHHB 5E7MA 4PC6A 2GBLA 3H0KA 6Q21A 1NIPA 3CZPA 1KDPA 3P32A 2CK3D 1M1YE 4B33A 4TLDA 1II0A 1QF9A 4RD6A 5FL7A 3KKMA 4B47A 2DWOA 3P27A 4Y0AA 3IILA 3H86A 4ON9A 5LB4A 3RS2A 3LVRE 5FUYA 1Y3AA 4G5GA 3TRFA 4CIDA 1FTSA 5G3ZA 4MDEA 2JJ8A 3AP2A 1EWQA 2V8OA 2XEXA 2H5EA 4OI0A 2AD1A 2J3EA 2YZ2A 1KJYA 1Q1BA 5KSPA 3J81k 1G291 1NBME 2J59A 1H8EA 2G6BA 3HJNA 1NLZA 3QF4A 3BD9A 4V0ME 1U0LA 3B1XA 1GILA 2FFHA 3CNOA 3PG5A 5K8IA 2CLSA 2ZRCA 3NDPA 5AJVB 2Q3MA 4NCIA 2WWFA 4CEHA 1ESMA 3OEED 5AUQA 4EPYA 3SJCA 2D06A 2ZS7A 3HYRA 1ZVQA 4JL5A 1N5IA 1P73A 1KO5A 4L4UA 2GCPA 3UMFA 1KY2A 3K0AB 1KMHB 2MSEB 2P0EA 3VR2A 2Q9BA 5EZ5A 4E22A 2OEPA 4BLPA 2H18A 3JVUA 4AYTA 3QBTA 4BZQA 3GD7A 3WMFA 3TQCA 4HDOB 4FMDB 4KO8A 4TL9A 4JLOA 3KQHA 5KU1A 3F3YA 4IXMA 3A4MA 4R7ZA 1OF1A 2ZQ5A 2QMUA 3LWNA 2D7CA 3WNDA 1G5RA 4PPFA 3EXAA 4W7SA 4XVQA 5EUQB 1KK0A 2O8BB 1JR6A 1XB2A 5KSZA 1W49A 4UNQA 4IFEA 1I4TD 1QDEA 5D3MA 3W8NA 4OQNA 4EFMA 2OLJA 5EP4A 1W4CA 4BFTA 4GL2A 4NCJA 2ASEA 2IYXA 3TLXA 3O8DA 1M6NA 1XCPA 3BJIC 1J90A 1KKLA 5FR2A 3AVYA 2IS4A 1TF2A 4IW3B 3CR8A 4C0QC 4TMKA 2IEYA 3RANA 4EPTA 4ASUD 1UBFA 2GETA 2ZE7A 4EAQA 2OE2A 2CNWD 2VYFA 1M34E 4A0GA 4R2IA 4C0JA 2ZRJA 3BWDD 4NL4H 1Q0UA 2QBYA 1HA3A 1JBKA 1L4YA 2WM9B 3L43A 1W0KA 2WMNB 1KZ7B 3BGWA 4NU0A 1AK2A 2F3TA 3FVQA 4UQOA 2GF0A 4IDQA 5JMTA 4PAMA 1KI2A 2J1LA 4JLJA 2YINC 3EWSA 4QNMA 2AN9A 1T8UA 2GZAA 1J2JA 3EASA 2ZRFA 4U00A 1GM5A 1N0VC 3A1WA 2BJVA 1YJ5A 1J99A 3K0FA 4BRUA 4D25A 1S9HA 4BQSA 2QM7A 2GVDC 4DCSA 4TL6A 1RKBA 3OIYA 4ZPXA 2ZPTX 1WBDA 4CGZA 1Z08A 2R6DA 4XVUA 5A5GA 5FOTA 3PEVA 1G8PA 2P6RA 2ZRBA 1NG1A 4HYYA 1II9A 4LYHA 4F4IA 1IJEA 1AZTA 1XEXB 5L3VA 4DIDA 1NY6A 3QENA 1U8ZA 3EZ6A 4CEJA 4A6XA 1BS1A 2F43B 2YHSA 1QHHB 4Q4LA 2VQSA 3AVTA 3SU8A 4P4TA 4PC7A 4L5BA 4JS0A 4Q1FA 1IBRA 4XH9B 4KHZA 2XJ9A 2BKUA 2PJZA 2OXCA 4LBYA 4LSGA 1JJ7A 2Z43A 1RZ3A 5KSOA 1GWNA 2OCAA 4XIGS 5L3RA 4D0LB 4C2TA 3B8HA 5A0FA 2GHIA 1XCMA 3MWLA 1US8A 4I4LA 5HE9A 4I1OA 2PLRA 2YNMA 5DYGA 3VMFA 4DT1A 2KE5A 3M0EA 4MGIR 5AJWA 4TSFD 5K8UA 3EPLA 1V5WA 2KI5A 2G1JA 221PA 2QZ4A 1RYFA 2QPAA 4B71A 1LFDB 2OXRA 4X8OA 5HCNA 5LBIA 1L4UA 3H1TA 1OHHA 3IHLA 3ETLA 5IF9A 3O8BA 4QM7A 3QKUA 3RNLA 1XTKA 1KK1A 2QMEA 1QZXA 2D4HA 3U44A 2WOJA 2ZI9A 3I92A 4MGZR 4XTCS 3CLVA 1W4BA 2MMGA 1Q21A 1KAOA 1A1VA 1GDDA 5CB8A 5H1YA 3SI7A 3TIFA 1NVUQ 2DB3A 2BCJQ 3RLFA 3RYTC 2F9LA 5F2EA 1KI9A 3EG5A 4M1YA 2QMOA 4BLTA 2RCNA 2G0NA 5FBRB 1IQPA 4RJLA 2Q0HA 1HY3A 1E0JA 1LF0A 4C3ZA 3AGQA 3GFPA 1XMSA 1BH2A 5JEEA 1VCIA 2QTVB 2KBEA 1MO4A 3PITA 4I1UA 4MYHA 4KAXA 1G20E 2EVWX 1D5CA 1E9CA 2GZDA 1VYTA 4XWOA 3KL4A 1EFRA 4M2LA 1SKQA 1M2OB 4JSTA 3TUJC 4A2QA 2GBLC 2J87A 1HH4A 3OESA 4FXPA 4V0MA 4MRVA 2F55A 2QAJA 3BB1A 5ANRB 2ZXUA 1CRQA 1LVGA 4DBLC 821PA 4PHGA 2GJAA 3TUIC 3EZ2A 2FF7A 2CVHA 2FG5A 1H8HD 2HLDD 5EE0A 3TR0A 4MRSA 1GRQA 1P9RA 3N2EA 4DLTA 4Z1MD 2B92A 4URUR 1T3SA 4XOIA 4IFBA 4JLMA 1Q1QA 3HPQA 3NDBB 1G7SA 1Q1ZA 3NEYA 5CLQA 2IXGA 2GXAA 3RABA 5L3SB 3K0FB 1AJEA 2QNRA 1VPLA 1E99A 5JCPA 3W5JA 2KB0A 2PCLA 2W6IA 3QEOA 3BERA 4D4MA 4TYPA 3D31A 4ZCLA 1NBMD 2PMDA 1UKZA 2HCJB 4D2IA 3UG6A 5DO9A 5F3WB 1GSIA 1ELOA 3MD0A 1F2TA 5FUXA 2DWQA 1MABB 2XXAB 1CP2A 1MO3A 3B7GA 5FOXA 2REBA 4Q4HB 3BORA 1AQYA 3U3MA 5IHPA 1ZBDA 1TMKA 2F9MA 3AUYA 3HYTA 4C0KA 1DAEA 1OSNA 2CL7X 3ZZ0A 1IN6A 3L8ZA 1GL9B 2IUSA 3PQCA 2OBLA 2QN6A 2AL7A 5F9FA 4YDSA 1XXHA 2JJ2D 1T3LA 4YMWA 5TY0A 5FI0B 1R8SA 2A7QA 1WMSA 4FCVA 4E07A 1ZCBA 1FQKA 2WMOB 2J9RA 4KBGA 1US8B 2GCOA 3OAAA 2HYIC 2ZAOA 2YWGA 3EC2A 3UMRA 4A8JB 2WJVA 2JLUA 1S3SA 1T4GA 3UMSA 3WMGA 1T0JB 3GJ8A 3JZAA 1AA9A 1IY1A 2F1RA 5BWMA 2X8AA 2KSQA 1VIYA 3K0EA 2ZSFA 5C2JB 4NZYA 2BIFA 3PUZA 3UWOA 1F60A 2NO7A 2AK2A 3OEHD 3CRW1 2C03A 2WIBA 5CJPA 3I73A 3NBFA 1N6NA 1AQUA 4G5QA 5DI9A 4BFUA 5TMPA 2VPPA 3GLFE 1D2EA 1W4RA 1N6LA 2W83A 4LHZA 4YMTA 2AD5A 1ZU5A 1UPTA 5JS8A 2JLXA 5JWRA 2FWRA 5BN5A 2QQEA 2FX3A 2VF8A 1QG2A 3LBHA 1QHYA 2Q3FA 3PXGA 4DLRA 4OYHA 1IXZA 4F91B 5KNCA 2P5SA 4WXPA 4IEIA 4DEYA 3RS5A 4IXNA 2LKCA 5CLLA 2CHVA 2EW1A 1GL6A 2BBTA 5JI2E 3K9NA 1G7CA 5LD2C 3GJ3A 4X8MA 4MH0R 1AS2A 4MUAA 2ZJ8A 1P2SA 4GZMA 4XD7D 1ZC4A 3BH0A 3LO5A 4OQFA 2BBOA 1Z28A 4AY2A 1VYVA 3THYB 1GP2A 4QHSA 1D8TA 5KOYA 2QG6A 1E79A 4C7OB 1AGRA 5EXTA 3LD9A 4KYIB 2CLDX 1KMHA 1BOFA 3IHWA 4N0EA 5TARA 1U0HC 4BUJA 2ZS9A 4D4JA 4KLNA 5DI3B 2AFHE 2J0UB 2WJGA 3B1WA 3SN6A 4UXIA 1KGDA 4LC0A 1SVWA 1JI0A 1VDZA 5H8WA 5EE1A 3VX3A 4DCNA 2QE7A 3LX5A 2NMVA 3QOFA 5GJVC 1OH5A 1AGPA 1NIJA 1G3IA 2JEOA 4UNNA 2BM0A 2FPKA 1N25A 4M1MA 4EPRA 2W0MA 5TB5A 1WCV1 2GNOA 1N0UA 1WBBA 1Z07A 3OEHA 1VG9B 5JJLA 4FD2A 3I1FA 2JJ1D 1E2IA 2IS1A 4B44A 2EFHB 3B1ZA 3FGNA 3BAFA 4RZUA 1ZD8A 2P67A 2ZRHA 3OHMA 3TH5A 4A0RA 4Y0VA 3B1VA 2WKPA 2ZI3A 3MWJA 2SHKA 4PHHA 2GA8A 1AKEA 2I1QA 3A37A 3HR7A 1NKSA 4B6FA 5HE8A 4MDFA 4LYFA 1E2DA 5DNYB 1E0AA 4LI0A 1NY5A 3ZYCA 2PH1A 4L8GA 3AF0A 3GP8A 5EXPA 2JJ2A 2WJIA 1GVNB 2BCGY 4A8JA 1TNDA 2BHRA 3K9LA 3T34A 3AVUA 3AKDA 2V9PA 4JL6A 5L3QB 2C96A 4C0HA 1G6HA 2OZEA 3AF2A 4RKFA 2J0QA 4A2WA 2ZE8A 5JCZA 3NVAA 4TMXA 3ZH9B 3VHLB 1X1SA 4KYUA 2ZI7A 1G9XA 3W6PA 4K8OA 4LHWA 4B3XA 4BRWA 1UBGA 2IYWA 3SJZA 1FMLA 1HE8B 3EWAA 3VTKA 3ZQJA 1TEXA 1U0JA 4Q1CA 4YXWD 1GG2A 2NO9A 2ZE5A 1CU1A 4M9QA 3CNNA 1VCNA 2XJ4A 4WIAA 4F93B 2CJWB 3IBYA 2ZUDA 1O3YA 1CLUA 4EJSB 5FBLB 5KUTA 3LVQE 1CJVC 4LJ4A 2H16A 3R8CA 4AI6A 1Y63A 1E2FA 3BC1A 4PC1A 4Z1MA 3ZJYA 3EA0A 3MWYW 3AP1A 3AH8A 4E09A 1KO8A 1XD2B 3BXZA 1DAFA 5CIWA 2KBFA 3CRMA 1NRJB 4Z54A 3W34A 4B3CA 5JFGA 1T91A 1R5NA 2I4IA 3SZRA 1EFRD 2VIIA 1CTQA 1IONA 5KDLA 2IWHA 3A4LA 2PMKA 2EU8A 3A1SA 4LDJA 3QPUA 3TVDA 3QG5A 4CEIB 3AVWA 3F0TA 4C0SA 1XXHE 2IYUA 3K0CA 2FV8A 2OFXA 1XTIA 4PQYA 3AQ4A 4EQ6B 3GEIA 1IN4A 3CF0A 2CVFA 2WKRA 3C15C 3E1SA 3R8FA 2D3WA 2JJ1A 2Q3HA 1RW4A 1UBEA 3AEZA 4MITA 4W5JA 5AWFC 4HDQB 3K0AA 4IEEA 2O8DA 5G53C 1JEEA 3AGPA 1D9ZA 4V02A 2VF7A 2HXSA 4KXFB 1TQ2A 2WWWA 4BWYA 1XTRA 3Q5DA 5EUMA 2QENA 2RKOA 4LOAA 2UVQA 4KFUA 5J5CA 4EFLA 4Q9JA 2B8WA 1EK0A 3GEHA 5HPYB 1CJKC 1E9EA 5HCIA 4CYMA 4ARZB 4E03A 1XEFA 2CE7A 1WDTA 3I8XA 3KQUA 1XPUA 3QUSA 2VL7A 3T15A 4FMCF 2GAAA 2P6UA 4BLQA 3B2EA 3KTAA 2QEQA 2VEDA 3KUDA 4HLDA 4ZCIA 3OF5A 4PR0A 1Q44A 1RJ9B 2D2EA 1QBKC 4B75A 5KHOC 3ZVMA 3NC0C 1OXSC 3E70C 1CR4A 2ZU0C 1Z47A
chains in the Genus database with same CATH superfamily
4N01A 4E4YA 4HNVA 5FB3A 4BZZA 5EXXA 3VUEA 5I7WA 2FDCA 2BMAA 2QRKA 3JD2A 2RBEA 3THXA 4NYMQ 4W5HA 2PLNA 1OFUX 4H0CA 1NTOA 1DC7A 2V7QA 1OWLA 1OXBB 4GVXA 1L9KA 1U11A 1ZKMA 2YJ4A 3DWEX 4OBWA 1OILA 3L4BA 1ZOOA 3KAJA 1H2FA 4B3GA 2CMFA 3PRHA 1I24A 2YXNA 3QWIA 4GXNA 1DKQA 3D8SA 4LHYA 1E1YA 1POWA 4OFWA 1KORA 1TX4B 3RVRA 3ZNOA 3G5TA 3L7CA 4AULA 1I10A 2FFBA 2CLFB 3G5MA 1D0IA 4R68A 1KS2A 1J9GA 1OBFO 2W2LA 3KZMA 1J2YA 4PLGA 1H42A 3SZMA 2PD6A 3N39C 5G1PA 5LZ5A 5JZMA 4X7MA 2P91A 3RS3A 2HYDA 1CBUA 2XTZA 3WL3A 3JASA 3EDYA 3JRNA 4PQRA 4MCIA 4W1PA 3ENZA 4EECA 2AWNA 1G5PA 4Y2HA 4K03A 3EXG1 1IM8A 2OBNA 2QLNA 2H1WA 5DLEA 3ZGZA 1L7QA 2BC9A 3ZHTA 1C80A 4MB0A 4JCCA 3T52A 4H4DA 4RESA 1MU0A 1XMXA 2G88A 2ZYUX 2ZIXB 3U9LA 3HH8A 5DMXA 1P3JA 2IHBA 2P11A 2PX4A 2O8EB 1WO8A 1EJ2A 2FW7A 1GZHB 3L6UA 2OAQ1 5DRYA 4YAEA 4ZT7A 1N57A 3ECCA 4R41A 5DOZA 5UKDA 4C2UA 3FMFA 2IYZA 1V45E 3F67A 2WSMA 1E69A 4PX2A 4W9RA 4RY0A 2GLXA 4GKKB 3QJYA 5B6PA 1VHLA 4CDRA 4RIEA 2WIGA 2XYHA 4P5PA 2JCVA 1GITA 1WUIS 2VJAA 1RVDA 2XV1A 1HEUA 2PUGA 3JWPA 3HCEA 3AEQB 3ZDYB 8ABPA 2C3UA 2UYGA 4OMFG 4KXYA 4BMSA 2CYAA 1DBVO 4Q5IA 5AI5A 4D96A 4O4IF 2QM3A 5JJ5A 4QBIA 4R1LA 1IWPB 2EZ9A 4RVDA 1PU2A 1ZW6A 2ZQYA 5EQDA 1QUEA 1MXHA 4GVLA 4JLNA 2ZIEA 5TX7A 1CX9B 5L7YA 3HXQA 1PD1A 1DKRA 5FTLA 4ETIA 2C61A 3BQ9A 4Y2QA 1WHTA 1YE8A 4QOGA 5CMLA 5JEDA 3G9XA 5THKA 2LW7A 3HY4A 4RSHA 2FXIA 3RW9A 1YQWA 4OX9Y 2AXNA 3C0KA 2C04A 2IEZA 1TM7E 2VP6A 4YUZA 1W4AA 1GD1O 1G2IA 2CE2X 3OIWA 4PAGA 5AHXA 2B69A 5CVUA 2FUKA 4NTZA 1BAPA 4PINA 4ZDIA 3OIFA 4C07A 3ZX5A 2I76A 4A6PA 2AJ8A 1XZIA 1IATA 2JH3A 1TQHA 2Z5VA 1X6VA 2HK8A 3R9IA 1DE0A 1G38A 3PI6A 2JGJA 4BTEA 3TI7A 1GQSA 3VO1A 4X6LA 2EQAA 1PK7A 2DQZA 3N6XA 1Y1SA 3R3YA 4QDKA 2OWDA 2GUWA 4JQYA 4W4TA 3UJAA 3GLKA 1UMDB 1U2DA 4M0CA 4F7DA 4AKIA 5CJ2A 3A9WA 4YJFA 1WTAA 3PEUA 5JD5A 1DIAA 3TI9A 1A82A 5GGXA 4BJ5A 3TUZC 4HQFA 1C0EA 3K96A 1A95A 1J5PA 3HUDA 5C1OA 3D2BA 3KEOA 4RSGA 2ATVA 3RTDA 3L0SA 2Z6AA 5FNZA 4MWGA 4PCLA 2I71A 4QFDA 1KDYA 3IQIX 1JXOA 1VL8A 4EY3A 5CFZA 3SXPA 1DEXA 1PR5A 3E9CA 3S1AB 1EX6A 2O07A 1EE9A 2PUVA 5AD1A 5KNBH 1BRMA 2XTAA 4GKJB 2O8VA 3SVZA 4CL3A 4ENTA 3OTIA 2CXHA 1JG7A 3QKWA 1VJGA 3RF7A 1D2RA 2FVYA 3AU8A 4JOQA 3AV0B 1Z5WA 2J9YB 4LDZA 1IUPA 4R84A 1JECA 4JAVC 2DQKA 1YRBA 2D7JA 3DZIA 3FH0A 1QF7A 1TF5A 4EHAA 2D3TA 2LKDA 2VHTA 1P3DA 2REOA 3AM4A 4QD3A 3ERCA 2C59A 4O29A 1VLVA 4B6GA 4PG6A 1VSBA 2P3QA 2P9FA 3ZS9A 4GI5A 4NCHA 4EHFA 2ISQA 4ALMA 2H0AA 1BOOA 1XJWA 2VUIB 3K92A 4G56A 1ZVKA 4L08A 2ONJA 3LK6A 4YMVA 4LOJA 2C8VA 3QZUA 4KR3A 1GZ6A 1NUAA 3WDSA 1CVIA 3CIOA 3TPCA 4ZOQI 4NIMA 2PKQO 2W70A 4EYOA 2PTHA 3BRCA 1P7ZA 1Y6FA 4AZ3A 1ZK1A 3ORYA 3OPYA 1XP8A 1YR7A 1U90A 3BWCA 3DT9A 3O74A 4CMIB 1XRMA 3AWIA 4HWTA 4DWJA 3VSBA 2XXAA 1LNQA 1TYBE 3PFKA 2ZRMA 1DIOB 4Y6QA 1X7XB 1IY2A 3ZY4A 1QVZA 4BUZA 4MWBA 4F3YA 5HJ5A 3LHDA 5CT8A 2G67A 3DE4X 2BFPA 3KSUA 2FEMA 1YZ3A 2GHRA 3B6MA 1NVTA 3HZHA 1FY2A 4ND7A 2FKAA 3SNKA 4Z7OB 5AM3A 4XIIA 3A1VA 4LYJA 1TCBA 4OLJA 4DXDA 4W7IA 3GLGB 1M10A 2WWXA 3P9PA 4DC0A 4YBRA 4EG8A 3AM3A 1KVUA 3P19A 1UOOA 1THTA 1XTUA 2OD2A 1UDXA 1VYUA 2ZYWX 3O1IC 3QRWA 4TUYB 5CCXA 1V5GA 2OT3B 4Q00A 4Z9AA 3SEZA 3U49A 5J2UB 2NPIA 1QYRA 3NIFB 4UQLA 1O77A 3OLXA 2G8LA 4QOHA 3BQNB 2PLWA 4Z86A 5JDIC 1W2GA 4JYZA 1JKFA 1XALA 3GU3A 4K88A 4C30A 4ER0A 2Z8ZA 1AMNA 3WOVA 4TM8A 1LLUA 3VJKA 2V59A 1JAIA 2D2XA 4WCFA 3U4QA 2C42A 3OPQA 3OIDA 1YQTA 4C5CA 2GM5A 4AN0A 3EQ2A 5C32A 5KAPA 5T57A 4PBSA 3BMNA 2JLSA 1UXJA 3L7MA 1RWVA 5DSXA 1FTWA 3F4BA 3L8CA 1Q74A 1LW6E 5JOQA 3DMTA 2BN4A 4DB2A 2GZHA 2B1RA 3MWDA 3PXDA 2GUGA 4I46A 2JKZA 2VRNA 3GBSA 4PXSA 2W9XA 4U9UA 4WUVA 4KXLA 5EEGA 1PX0A 3VDNB 1EFCA 2Y0PA 2A86A 5E9QA 1AUPA 4U2EA 4C0LA 5AQEA 2QAGC 3M1IA 1KJWA 5CG2A 3NG1A 1BHO1 2F3QA 1SVIA 1RAEA 3B1JA 3D2AA 4QXAA 4TLBA 3H2ZA 1AHPA 3KUXA 2ZQZA 3F7MA 4RE5A 4TT3A 5KTTA 4RTKA 5DBFA 3T7IA 5GMOA 3ND7A 3P0HA 4IGAA 3QG1A 4K81B 4Q47A 5DB4A 1PRYA 1FPMA 2NV0A 1X1AA 4AJ9A 1JDJA 1S7GA 4N12A 1JEQB 4C5AA 2I8CA 3PXEA 2IYPA 2BTEA 4G81A 1KK2A 1UPBA 5FKJA 3ZVRA 4B3DA 1E3DA 2O52A 5KVQA 4B73A 5BSVA 1E9RA 2QT0A 4HAXA 1ZLXA 4W5NA 2L0XA 4RHTA 1NUHA 4D9GA 5LU9A 3OUTA 1T5IA 5AHWA 1MQAA 5FPTA 2PPLA 3Q41A 3ST7A 2FW8A 5LP6B 3HVRA 1NUTA 3OE7D 3HLTA 4OAOA 5A4KA 1PJ2A 1YU9A 5KJCA 4XFKA 1KZ4A 4HEJA 2FY8A 1Z2AA 1EBFA 3UKDA 2ZBDA 3FZEA 3NUGA 4QEZA 2B1JA 2ZBVA 4UD2A 1IQUA 1OW3B 4MPRA 1MJ5A 1UZNA 1AGXA 3U3OA 1QIDA 3UB3A 3QVUA 2JBHA 2CXRA 3TLAA 1J9EA 4RMIA 3IESA 4JC5A 4J90A 4KBYA 4JJFA 3FOFC 2A1TS 4Z53A 1RWMA 2X86A 2NVOA 2P5TB 1D03A 1TVKB 3N28A 4XOUA 1GTJ1 3GK3A 4JLVA 5JCJD 3KPYA 3A2MA 2PQ2A 4EFNA 1XMVA 2R84A 2MOKA 1QXSA 1Z0IA 5LC1A 5IWAB 1WY5A 4QQNA 1NC3A 3NEAA 3PVSA 3HJAA 1WPXA 4M0DA 4N6GA 1HETA 2C2BA 2J9FB 2QM0A 3CC8A 3EOAI 3O8DA 1C0KA 5JCOC 1DSSG 1GPH1 2JK0A 2ZT8A 3BCHA 1M1NB 2XNDA 4LN1A 4B45A 1SJ9A 4HBZA 2D0PB 4NZOA 5TQ2A 1KJJA 1NU6A 1UFRA 1L0BA 2Q1WA 2Y92A 1U5CA 4MKXA 4ZV7A 1ODCA 6NULA 3GPBA 3JAWB 2SNIE 4Y7DA 1DU4A 2QZJA 1T9DA 4GP7A 4ZAXA 5KVCA 3THXB 2CDNA 2Y1EA 4II7A 2QVYX 3PICA 2VT7A 4W6QA 1H8ED 4LGYA 3UWSA 2ESRA 2XCUA 5EY5B 4JI0B 1J5XA 2PSFA 2J5XA 3IT0A 1Z9BA 2R8RA 3OSUA 4YMHA 3UXHA 1QIHA 1ECBA 4KSBA 5F1OA 5K0LA 2HF8A 3ESAA 4YJ3A 2DCMA 5IK2A 4BB9A 3QFCA 4QICA 2CT8A 2C3MA 2IC5A 4B4DA 2GTPA 1MB9A 1O0SA 3SMQA 5J2TB 1XTPA 3KB6A 4WN3A 1GHTA 2X2EA 2X76A 1PDOA 2O1WA 5K3CA 3TW8B 4BLUA 2ZI6A 5LA6B 1TJPB 2VJOA 3RRBA 3SIRA 2D5CA 3P20A 3U48A 5CB0A 1EUQA 4HTFA 3UOGA 1N7JA 2QLFA 4FOTA 1XNRB 5HKKD 2I4LA 4YRBA 3MWGA 2JFXA 3CNLA 1FBTA 3CEHA 3Q2IA 4WX2B 5ALQA 4ETNA 5DGHA 3H1FA 1ZH8A 1BC5A 2QVZX 1TADA 4QULA 4ZT3A 5K3FB 5M04A 2O5VA 1ZN8A 1COWD 4CCYB 2GK3A 2WUDA 3M6FA 2AE1A 2VJPA 2GEKA 1KQNA 2X19A 1U6JA 1ZUD1 5JBIA 3EZNA 2O5CA 1PG0A 1VHQA 4RPLA 5FI1B 1YRWA 3MCTA 3OQ1A 4US1R 2VI5A 3MN1A 4N39A 3ZHVA 3HR8A 3VVMA 3A6PC 4UCWA 1WEKA 1NQ5A 4YRNA 3WO0A 4LNUB 2XRZA 1O03A 1CZUA 1NQTA 4YP1A 5EP3A 2OKCA 1JSRA 3RE1A 4EEXA 4RV9A 3ANNA 3FLMA 1E66A 4N5NA 4TL8A 2IYNA 2PM8A 3KXLA 3K1AB 4G5RA 4PO1A 5K8TA 2H31A 4GM0A 2O3TA 3JATB 2OB2A 2IXTA 2X6TA 3DWFA 4XGQA 5AIAA 4DQUA 4AZVA 3LDUA 4NF2A 3Q3JB 5I3CA 1NE2A 4D8TA 2QY9A 4OIFA 2JGNA 1XMIA 2R25B 4KC0A 3HZOA 4OHWA 1USGA 4U3JA 3SYLA 4EZIA 5B7QA 3UT6A 1Y33E 5FORA 1XMQB 1G3RA 3ZXUB 2J9GA 4H27A 2Q3DA 3VUFA 1VCHA 3K31A 4WUTA 4EQ6A 1DP4A 2FUCA 4PLYA 4UZSA 3KV1A 3KEFA 4TXMA 1E7RA 2DBYA 2VHEA 1X3SA 2XMPA 3H18A 4CKBB 3FBGA 2Z5FA 2QM8A 1E7QA 1IHXA 1MRZA 3DD5A 3F6RA 3QHPA 2GJ4A 3KQWA 2H6EA 4J0KA 4LJAA 4YHBA 2BYTA 3OU7A 1BJKA 3G2LA 3KV3O 3AHEA 1QHIA 3K1TA 4OL0A 3WFJA 5BQ3A 4YCJA 4NQRA 4DGSA 1YL7A 1QKJA 2HPAA 4MRNA 1RADA 2RGXA 1CQIB 1USUA 2AHRA 3CSDA 4RKWA 4UHFA 2CLOB 4RH0A 2MU1A 4ZDJA 1OYOA 3KIPA 4I1YA 3C1OA 4IFTA 4O4JB 1AUVA 2HMSA 3UAOA 5ECGC 2LP4Y 3AKZA 4A8JC 3DE0X 3ZKWA 3X1DA 4RMJA 2W6NA 2POCA 1MZVA 2PRSA 3II6X 2O2GA 4TGLA 4WADA 1EGAA 1JR2A 3ZWOA 3TJRA 3FCEA 1SC1A 2RB4A 3PUYA 1QU2A 2CHGA 3TIIA 3CO0S 1UBSB 3V7FA 3WGHA 3NASA 4M86A 5COAA 1QGAA 1SUIA 2ASVA 3P5BA 3WJ7A 4CMJA 8AT1A 1IUOA 1B14A 2Q8NA 4DLUA 1BEUB 3UAXA 2RHRA 5C9ZA 1WQ3A 4MZDA 1VG1A 4H6WA 4JLDA 4QXPA 1SVSA 5FJIA 1GQFA 3FG9A 1KERA 2MDTA 2XT0A 1QH8B 2YCBA 3R3SA 2Q4BA 1T1EA 1H65A 1O2DA 3FN4A 4LMAA 4TMYA 2MSLA 2DG2A 1ADCA 3FOWA 4K5QA 2IDJA 1PZFA 1Y5RA 2ZK7A 4N8SA 4P08A 1CR0A 2CJYA 3QVJA 3AWDA 4NABA 5KYKA 2VQFB 4DJFC 1ENZA 2OFPA 5K99A 1QONA 5TT1A 3G9ZA 1K7EB 1YB2A 3EVGA 1DT3A 5KC8A 1X1TA 4LHVA 2HU2A 1PG2A 2R6R1 2R85A 3EULA 5SZIA 4M22A 1R0CA 4EEZA 1ZVMA 5CITA 1W35A 4HC4A 5HJ2A 1QRUA 2VC2B 2WSLA 4TKVA 3O2NA 3F8TA 3H9BA 3LDAA 1E98A 4RD2A 1GN8A 4WBNA 5CLGA 2YYYA 3EBOA 3NC1C 4EK9A 1QZUA 2QT9A 1XZKA 2GAOA 4AIRA 4MGHA 3NR2A 5CT9A 1F0PA 1MO6A 1O6BA 1JSZA 2RDMA 2QN7A 3BFPA 3F2VA 1EX1A 3HKCB 5B3LA 1DDGA 5BUCA 1R66A 1FDUA 1JU4A 3PXCX 3OPYB 1M67A 1EP2B 4R1PA 3M3HA 2GBCA 3B5JA 1UXGA 3RUCA 3MHPA 1RJDA 4FFMA 1DKOA 3R40A 1U0SY 1HPLA 3A31A 3H4TA 4KAFA 2HQRA 1I7NA 2JIZD 2WWVD 2OMEA 4V2IA 5A5EA 4NCKA 1LTKA 1WZ2A 1DCFA 4OGLA 2I2BA 4AQYB 4HR7A 4RHCA 1MUUA 4YYEA 2GM3A 5EZQA 2GAFA 3X44A 5KJFA 2O4UX 1M74A 4OI4A 2PXXA 4OP1A 1S5PA 4BBAA 3O0TA 4JZKA 4C5BA 4NYIR 1JEQA 3U3XA 3GLGA 3RU9A 2XIQA 1Z83A 2A2ZA 3NQ41 1OT5A 2MSKA 2A6PA 3DBOB 4IDFA 3TQIA 3OCYA 3UK1A 2BFMA 2X8BA 1NQOA 3QNMA 4C1BA 5JC1A 1GZ3A 1PE0A 2P0AA 3DVLA 5CVCA 4Q4DA 1FUIA 3HB7A 2QRVA 5G1OA 3LE8A 5HF5A 2DF8A 3OMWA 1A8SA 1F0KA 3L4KA 3GLHB 2H08A 3OWXA 5FWXA 4S3MA 4MIEA 4QHTA 3B3GA 1JAXA 3ZE8A 4H7KA 4KYVA 1HO3A 4Q1AA 1ZKDA 2G0AA 3K2EA 4MMYB 1QMPA 1I0ZA 5LU8A 2ZS8A 2IHTA 2W5UA 3BHJA 5GTDA 3IKJA 4I55A 1D7OA 1MQ8B 2RK3A 3HCNA 2J45A 3M2TA 4IH4A 1BU5A 5EIFA 4MHSA 1VXRA 5SY6A 1UPXA 6GPBA 1VI2A 1KVTA 4AIIA 2GYWA 1AC5A 3IAM6 2H2IA 3AY7A 3BFJA 4B6SA 4CG2A 1YIAA 2C9DA 1UBMS 2E5FA 2P9JA 3P9YA 4J07A 5DXAA 5B1HA 4ZHQF 1L3BA 3O84A 4XD2A 3ZOKA 1V1JA 2OR3A 3LGXA 1SU8A 1WD5A 2X9LA 1K4YA 1QRTA 1IHUA 2I4TA 1XRJA 3VSEA 1UR5A 2G04A 1ZNYA 2O2JA 5A4DA 2W2MA 1HRKA 3JV7A 4LC1A 5AKGA 2B1IA 1J0EA 4TV9B 4FBGA 1E1RD 1JEDA 3ZV5A 3I0ZA 2V7XA 1O57A 2BSXA 3D7KA 1YTLA 2XNKA 4KO3S 3KSAC 3FTNA 2EL9A 4OUDA 2FP3A 3M7IA 1P6XA 2HCTA 1YMQA 2Q5CA 2CHEA 4QFCA 1KETA 4TQUS 3OEWA 4GPTA 4ZHQB 2O2EA 3FGPA 5F76A 3SHVA 3P9CA 2QV0A 5JSQA 3MTDA 3LQRA 3ZWYA 1A5TA 1CS4C 3MJHA 2X0IA 4ECAA 2RC5A 1JR3D 4R0VA 2AN4A 4WI1A 3V2UA 4PS1A 3QXCA 2R11A 4LC9A 3G8CA 3BRWD 4QVKA 4HGOA 1NXOA 4DYDA 4YCCA 3IR6A 4UQPA 2VQEB 2AA3A 1SBZA 3C87A 3OJXA 4ZIRA 3O8RA 3TMKA 4FD3A 4OHXA 1XCGB 1YCDA 1GQYA 2H07A 4BFZA 1ZAKA 4FE3A 2PJRA 3R24A 4BO8A 3DWGA 3ZH2A 2IS6A 5M34A 1W5TA 3R7AA 4E1BA 1TYCA 4BCDA 2RMKA 2FX5A 4GT1A 4KE7A 2YJ6A 1RYEA 4ZANA 3H2BA 4KQWA 1PSDA 4TSKA 3RVQA 3GPLA 4X3PA 1XD8A 1JE1A 4W1QA 3C8DA 4GX0A 4R69A 5K3FA 3GT0A 4ZV4A 1OR8A 5CYOA 4B34A 1D2MA 1I94B 4C6SA 5EMHA 4BX2A 1ABBA 3GDOA 3PFIA 5CM2Z 3ID6C 3KPWA 3LRPA 4MCJA 4UEJA 3U56A 3BGOS 5KNDH 1AOXA 4YP0A 4Z3OA 2HA0A 3UUFA 4EB3A 4WGGA 1L8XA 5U4QA 2RGNC 4BGDA 1YE3A 2IP2A 1HFWA 1I14A 2J32A 2L69A 3G2QA 4GLJA 4M9RA 4E5MA 1D2AA 2WB4A 3EB9A 3ITDA 4FZ5A 4G4GA 2IKSA 1FP2A 1X13A 1E0DA 3JAWA 3ZJ5A 2A5JA 3SM3A 1I7LA 4TWBA 5H5JA 3GO4A 3FPAA 3FI0A 4ZOLA 2BDTA 2HA5A 1PNTA 2JFBA 3EVEA 1N9GA 5A9TA 3UMJA 2J33A 1P0QA 2A0WA 3CLRD 5HTOA 1DMSA 4EHBA 4EQZA 1V8ZA 1PYGA 1GZ7A 4F06A 4B6RA 2O3RA 5JASA 2ZIZA 2BEJA 1DAMA 1Q22A 1G42A 4OAPA 4U7HA 1MJFA 4WFKA 2WU4A 3KFXA 4KO2S 1JEOA 2G5TA 2VDUE 4XIYA 4OF4A 1A9SA 1IJFA 1IG0A 4WKOA 5CK5A 5F2OA 5C8DA 3WWZA 4HVAA 1CKEA 1ZHHA 2JLVA 3FHCB 2IYTA 2UYCA 4XPZA 2V55B 1VXOA 2C3PA 2JHFA 5SZJA 3TAUA 3GLFB 3OQHA 4KDCA 4KRGA 2XMGA 5AM5A 4MVJE 1RWPA 5FTMA 1G66A 5EJEA 1E58A 1L8LA 3DKPA 1XD9A 4ESVA 1A4RA 1MAAA 4KI7A 4W7HA 2BMWA 1Z0UA 2DUJA 2AFIA 1IUNA 2EHJA 1V37A 1J9ZA 1Z33A 3PR1A 1AKMA 1CY8A 4I8DA 1YZKA 4RMNA 3UK0A 1QX3A 1EGHA 3HDVA 4D9JA 5IF3A 3QVKA 5JZOA 2WIDA 2XQGA 5JSKA 2BKLA 2OCGA 2RAPA 3WLTA 1ZUWA 4WMLA 3IUQA 3V32A 2Y1WA 4TX1A 4RBNA 3RH0A 2YWXA 4AJ4A 4HFRA 3AG5A 1W46A 4J2HA 4US2R 1DOHA 2X42A 1GL7A 3NORA 1G17A 3RC1A 4NU5A 2I22A 3QJGA 2DLCX 4KZPA 1Z16A 4UAGA 2BBSA 5BQPA 3RV3A 4D82A 4KBFA 2QZ9A 1EE1A 1VL5A 5LL6P 1PR0A 2WINI 2X15A 3JWHA 4JT2A 4V39A 1EFVB 2XF8A 4ZT6A 3FFBA 3T9DA 4CPDA 2JF0A 1NMEA 3M2PA 4CKZA 1UKYA 2HDNB 3T99A 3OIGA 3WI7A 4CT5A 4RTSA 2GXUA 1ORRA 1Z82A 4QA9A 2OM2A 1YQQA 4GQBA 3KLOA 4LY0A 3FCOA 4E2WA 3VC2A 4GWKA 1RFGE 1NX9A 4L3VA 4DJEC 5CA1B 1QH8A 4LX0A 4XQEA 1NXQA 2CKDA 2WD8A 1TM5E 4OQLA 3GLTA 4F7WA 4YRCA 3KO8A 1IZZA 1B76A 2PL1A 2AR9A 2XBLA 2VHJA 1M2OA 4R3UC 2XSZA 1UC5B 5D3KA 5BSMA 4FMBB 3H1BA 1KSHA 1EFUA 4WOJA 2XCRB 1D2GA 2YZNA 1SPBS 4U6NA 4JELA 4EELA 4MV3A 3EXEB 1JKMA 4KMOA 4DR1B 4KDFA 1P7PA 3MLEA 1K3UB 4LQ4A 5ALGA 4AFNA 1F2UA 2GPJA 2YL2A 3L1IA 4YTEA 3CQ9A 3DM9B 4YGYA 3A6KA 3BL8A 2WT8A 1U4SA 4CHTA 2PUDA 4QPCA 1P9WA 4XJSA 5PNTA 3TLEA 3VNAA 5M29A 1S2DA 1DPFA 4CV3A 1Y5IA 3IVRA 1ZY2A 3BL5A 4PO9A 3PGLA 4NDAA 3O95A 3R74A 3SS9X 4HUQA 4O2AB 4QOEA 1UC9A 1TTQB 2BKEA 4O2RA 1JKJB 3WGOA 4EGAA 2VNSA 2PG3A 3ASVA 4QO7A 2QN3A 3B6KA 2GYYA 5CPBA 1YHZA 2TMKA 1CRZA 1QQBA 1KO4A 4D9IA 4WD3A 3TTXA 1M1XB 1Y89A 5BYBA 4E6PA 4RFSB 3JR3A 1B00A 1UKEA 2R5WA 2CKMA 4INAA 4N3NA 4UUBA 1U5BA 4F9TA 1AB6A 1M0SA 2V5UA 2NZ2A 3TSWA 1I6WA 2QP3A 3KR2A 4PZLA 1YZFA 5DHTA 1LDBA 4M83A 1ATIA 3V4PB 5HK8A 4B6EA 3HEBA 4V0OA 2DHQA 3ZWWA 2QL7A 4ZHSA 3MMXA 3L02A 1VKNA 2ERYA 2Y1GA 4EPXA 1OB2A 3D8NA 2CVQA 2OHGA 3PUXA 3ROXA 3IEKA 4Z1OA 1W6RA 2PZFA 3MQ2A 2CB9A 4R1SA 4Y3UA 4ZC1A 4ASUA 4BP9A 1X7HA 3S55A 4ZQCB 2D1SA 3EQ7A 4ZYVA 3RUFA 2YIVX 2CV2A 1V4VA 1SHTX 1GEGA 3CONA 1NR1A 4Y2GA 4UU0A 2I6QA 2VOEA 4DV4B 3NUZA 4OKIA 4IRUB 3SZUA 2QZSA 1YS4A 2DUNA 2Z2YA 3JY6A 2XUGA 3NI2A 1M2WA 4PZ9A 1JLKA 1PJRA 4HEHA 2IZ5A 2XVAA 4WTOA 4ZEWA 4EX7A 4DLWA 2PV0A 4JUIA 3B3FA 3AL0C 2FVXA 2ZJ7A 2UXCB 4OHZA 3NDRA 4Q18A 5H9WA 2NOAA 3URKA 1EGVB 3VTAA 4AQDA 4AN4A 3HP1A 1RJFA 3WZMA 3E9QA 2JGIA 4WPGA 2HI0A 3HKCA 1JG4A 3RHFA 4B5LA 4RH3A 1FSGA 4ZI3A 2I29A 2YC2C 1F8YA 1PZNA 1JYEA 3K09A 3Q8XB 1D4ZA 3BXOA 4CUJA 2NQTA 3KJHA 1T13A 2X5OA 4XPIB 4AK9A 1OJLA 4BMOB 3KZCA 4EFKA 2H06A 5ED4A 3IA2A 1ORHA 3HJGA 4YJ2A 3TTVA 3TRJA 2PEYA 2PJUA 3ICVA 1E6WA 3KL2A 4G5OA 3RUDA 4F9EA 2DMRA 5I9NA 1QO9A 2I80A 1U6IA 3G2NA 2HJWA 4K28A 4PFQA 1YVDA 1JAYA 1Y4UA 4ER6A 4YUWA 1S4QA 4Q3DA 1G18A 4DILA 5IS2A 5IP5A 2YIDA 4YASA 3T7RA 1GJRA 2YV4A 1XAIA 5D84A 4K0KB 1FP7A 2ZYSA 5E2AA 4UM7A 3M5WA 4WLNA 2HV9A 3WB2A 3Q8KA 1KJNA 4PLFA 3EZFA 1XLWA 5LZ9A 1G3QA 2PUJA 5A4IS 4M0UA 1CERA 1WE2A 3CFYA 1L5VA 4MYRA 3GH1A 4QGBA 1NTRA 4WXHA 5F33A 1SXIA 2PEZA 4RCZA 2FMKA 2P9QA 3IQWA 4IQ8A 1Q7BA 4EHKA 1SQ0A 2HLPA 1AUXA 2H85A 3BBPA 3WYAA 4BO9A 4UEQA 3F4LA 3DV0A 3GVPA 1CY0A 3HWWA 3P4YA 1CFZA 1R9JA 3R6DA 4LWPA 3WB1A 4L75A 1Y3DE 1HNWB 2WYHA 4IOLA 4FS3A 1LPNA 2EJCA 3QBVA 2ZYGA 4M8IA 4C0AC 2I4RA 3HXPA 1RHQA 1LSUA 3OBBA 3N70A 1N6KA 5JHGB 3NNDA 5CEJA 4Q3BA 4C43A 3Q85A 2ZT6A 5JMPA 3IAEA 5CFLA 4OQZA 4EW3A 5KTYA 3MRSA 3LKVA 1M54A 5E1BA 4ZYLA 1GGFA 5DHAA 3FI9A 2WKWA 4MA4A 5JAHA 1A69A 1FCJA 1HNNA 1RE0A 3A8TA 5HIMA 2X13A 4NE7A 1C0IA 2I6GA 3T95A 4YPVA 3OIVA 2EBFX 3N5CA 3ETGA 3U5TA 4DQVA 4KXMA 2SCUB 3ZCTA 1MEJA 3DJFA 4X93A 5AOCA 4S12A 2YJZA 1SOWA 1JQDA 3PYMA 3JTMA 2C95A 2IDMA 4AB1A 3NHRA 4D80A 1JJFA 5A6SB 2ZUTA 4D44A 4DHWA 4CIBA 2XGSA 3BCSA 4FNAA 1JR3E 5AQ1A 4RDCA 3QE9Y 3QP9A 1ZESA 4Q4AB 3IODA 3EA5A 3ROQA 2F8TA 2UU9B 3UJ7A 4BECA 5BY2A 4LFCB 3U3KA 5HF9A 1IQRA 1JIUA 2VP5A 1RR6A 2CFTA 3UATA 1S3GA 4BKRA 4WAUA 2PUAA 3R7WA 3RVMA 4QGGA 1YKGA 3GP3A 3QW4B 4QEDA 1YQ9A 1RSZA 3SX4A 1SUSA 1W34A 3FXAA 1E0AA 1HC7A 3AERA 3PFFA 2EZTA 3QPDA 4HD8A 5CU7A 3FCCA 3LBFA 3KHUA 1BU8A 3RYFB 4KGVA 3SC2A 1A5SB 2WD9A 2YVKA 3VU0A 3WGZA 3CPEA 4IIXA 1MGOA 4MVJG 4F4FA 1VE6A 3AJEA 1YULA 4ZCMA 4BOYA 5GIOE 1DO0A 1EZZA 2IDKA 2JFUA 2VYNA 4OFBA 4RYLA 1ENPA 2CLLB 1RWQA 4YJHB 4BFLA 3WL5A 1JLLB 1JVBA 1FRQA 1O9GA 3I23A 4R71A 3DAFA 3WYEA 1NN3A 5TPWB 1GNTA 1QHNA 1XF9A 2RGEA 4TMWA 4WFJA 1F06A 2Q6IA 3PFCA 4UFOA 2VXYA 3MJDA 2NM0A 1P5HA 4N7MA 5ENVA 5HBGA 2FMHA 1RCTE 1ZNWA 2CNBA 2OESA 3TOZA 2HF2A 1G6Q1 13PKA 4KFRA 2EP7A 4IIFA 1GUZA 3DWIA 2HA2A 2R1UA 3MZ0A 2FN7A 4GI2A 3FKQA 4GVPA 4UU7A 4XM2A 5BPHA 3CUKA 5KJEA 4KVGA 1Q0TA 3H83A 2ZRGA 4HWSA 3T7JA 3H4IA 3C5CA 2GTHA 1PIWA 3B53X 1AQIA 3F46A 2CXNA 3OH8A 4I8XA 4B17A 1N9GB 3I01M 2R6JA 3CUVA 3PDWA 3I3SR 4OFZA 3W5VA 3F98A 1LV8A 1UWCA 4GPAA 4RNDB 3FTCA 2G9ZA 4DCMA 3B9QA 5LZ4A 2WWRA 2JPDA 2Q9CA 1DXHA 4CM6A 2IW3A 3HA2A 4YS6A 1QZ3A 2I99A 4FP9A 5JSYA 4UFPA 1HNXB 5BSGA 5EJ6A 1MXFA 2FG6C 4R83A 9GPBA 1KWGA 3VR6A 2EEZA 2J9XB 1N33B 1CP3A 1TCUA 1TCCA 3D4PA 2P2CA 3H7AA 5DLQC 3TZCA 1O6FA 3H75A 4B31A 5AVJA 2WNHA 1ONBA 5I8WA 1TAGA 3A3KA 1WXHA 3GMSA 5J4LA 3S44A 1IU9A 1IB6A 1SQ6A 3LIIA 3G6KA 4PV7A 3MSXA 1P2GA 3UH0A 5F7XA 3AVXA 4MI9A 3MWEA 4R2XA 1DELA 1NBHA 5EESA 4OH7A 2QVCA 4BL5A 4CFSA 1TQ6A 2IOHA 2JEZA 4UCFA 4DSNA 1Z7YA 2E1RA 4LF5B 1SB9A 3G2PA 1TOAA 4JOCA 3MIZA 4L9WA 4ZU3A 4QAJA 3W9YA 2NO1A 2PKQP 3WKAA 3ZW8A 4DMMA 1KDOA 1ZM3A 5ITZB 4KRYA 3KZ1E 3O38A 4AP9A 4BE4A 4URZR 1NKTA 1P6QA 1S3FA 1Z45A 3B6EA 5K4AA 1JKJA 3MJ4A 3S8MA 5P21A 1QQTA 3VR1A 2FGKA 3FUXA 3LX8A 2QX6A 2WJJA 3QV1A 4I5IA 5IX8A 5CT6A 4N48A 1H3FA 1KPGA 2W2TA 4CFZA 3MS4A 4N54A 5CLJA 3PNSA 4V1CA 1G59A 1VI6A 2R4QA 4FN4A 3U3ZA 4MUMA 4UUMA 3WV5A 4D46A 3VISA 3ABOB 4QBFA 4J0JA 1O8BA 4MKHA 3KNZA 1ODKA 1NZJA 1V3QE 4KX3A 4AO6A 1ZCFA 3VYRB 5KDDA 1GN9A 1Q84A 1COZA 2HPVA 1QRRA 3EEFA 1HL3A 3I9LA 3ADCA 4YBZA 4HLCA 3BF8A 3A58B 2H54A 3OIUA 1U8TA 1GZSA 1E5TA 1KIFA 1R0ZA 2EBWA 1QAMA 2GXSA 1IB0A 1IEWA 4QC2A 2G08A 4E88A 2FPIB 1XRRA 3QF4B 1BEZA 4X95A 5F4BA 4TTQA 2ZJZA 3NLLA 4G0XA 5DYIA 2BMVA 1LBQA 2HREA 1V8FA 2BFNA 5HKBA 1TQ4A 3M8KA 5EE9A 1C8LA 4JJ4A 4DGQA 2Z56A 1T5DX 5B4TA 1MA0A 3RUHA 2YWCA 4QAQA 5CFPA 1G1MA 3M9XA 4DCUA 3G49A 4LNAA 5AJUA 3ANYB 2WZDA 3RU7A 1Z4MA 1DG1G 1V6AA 3DVQX 1W2HA 1WV1A 4GWLA 4N03A 3W5SA 3WWEA 1MJGA 4YY3B 1GAQA 3CPJB 2QTBA 3COYA 1XRLA 3F7OA 3M4NA 3QTLA 2Z4RA 5L3SA 1B8OA 2Y1LA 3HA7A 3D3EA 5HNKA 3V4LA 2HBQA 5JQWA 1N7IA 4YMIA 3G2JA 1HI9A 3KOOA 3OD1A 7ADHA 1JQJC 3GGOA 1T2NA 5LUBA 3MGGA 4JYBA 1GAXA 2O19A 4DEXA 3R0JA 1Z6PA 4AVYA 1OLOA 2WWGA 3I8SA 4GW3A 1ZJ6A 5D3MB 1DZIA 4ZEMA 5IW8A 4D43A 4JSYA 3QLVC 2UVDA 4DARA 3NVKI 4I3GA 4NAHA 4XGRA 4QL3A 1DNPA 4LDAA 1KSJA 1IM2A 2JAWA 5A5VA 4X92A 2COKA 1TRKA 5BN3B 3ZDCA 3FVVA 1SBIA 1UM9A 5KSWB 4Q3KA 1T1JA 4KXUA 4PYNA 4YC7A 1JQLB 3AUXA 4W6ZA 4NV1A 4RWZA 2VKQA 3U60B 3LUBA 1YS2X 4UW9A 2P30A 5EKTA 2RGBA 1E64A 4COKA 4RDXA 2H2AA 1PQYA 2HMWA 1FUYB 5DKFA 3ZBUA 3G79A 4DZZA 4F85A 4B74A 5JRDS 5KX5A 3WDLA 2HCBA 5T4EA 3VR6H 5KMGA 1NWCA 2CXPA 1VFPA 1P60A 2WYWA 1IPHA 2YHIB 1K6MA 1MW9X 1SXJE 2YW2A 3TBKA 3WLFA 4C6HA 1FMJA 1WM1A 2A3NA 3B8EA 4QO8A 2MR5A 1IY8A 4LY9A 4MR8B 3RK4A 4RETA 3LT5A 4DMFA 5K3EA 2YWDA 1FMFA 4OOFA 2B30A 3IUYA 1H4SA 3AIOA 4QARA 3ZCUA 2F1HA 5HZKA 2OY0A 2AXQA 4QTXA 3HYLA 1GZDA 2JCYA 2IYSA 1MCZA 5MFZA 1EGMB 1ND5A 3VR5A 4LZNA 1MBZA 4YXFA 4HADA 1KXZA 1Y82A 2CDCA 3G2MA 1M5TA 3EPJA 2I6TA 4MX8A 1GUFA 3PHHA 1WKBA 5JMOA 2NO0A 4U9IS 1CG6A 4FQ5A 4KWTA 4MWSA 5IVHA 1E2LA 5EL0A 3BWMA 1GFZA 4A0FA 4DZRA 5A06A