4R8MA

Human sirt2 crystal structure in complex with bhjh-tm1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
301
structure length
286
Chain Sequence
b'KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Efficient Demyristoylase Activity of SIRT2 Revealed by Kinetic and Structural Studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 286
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4r8mA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4r8mA01
2WVAA 5EJ6A 3EY9A 2PGOA 1T9CA 2OORC 3GLSA 4JD5A 2IHUA 3F6BX 1UPAA 3CLUD 2QQGA 3U31A 4RMJA 2BRUC 4BVEA 4I5IA 4GM4A 3K35A 3CLSD 4UTNA 4Y6QA 3CLTD 3EA4A 4X3OA 4K9PA 4V1CA 1T9AA 1O97D 2V3WA 2EZ8A 1S7GA 1YHYA 4BV2A 1U31A 4BVBA 3CF4G 1Y9DA 2Q5LA 2JIBA 1Q6ZA 4GM1A 2WVHA 4FZ3A 1M2KA 3GLUA 3U3DA 2OD9A 4C78A 4GM0A 1T9DA 3RIGA 2FR8C 2VBGA 1YI0A 2OD7A 4RJIA 2A1UA 5DGDA 4BN4A 5EJMA 4K9KA 4UUAA 3OE1A 4JT8A 4UU8A 4R8MA 1M2GA 1XLTC 2W93A 1NM5C 5FEMA 1E3TA 3D81A 2VBFA 2NYRA 4C7BA 1JSCA 4F4UA 1YI1A 1PT9A 4K9OA 2UZ1A 2JI7A 4KPUA 1M2NA 4Y6OA 2H2DA 3EYAA 2VK8A 5D7NA 5BWOA 4UTVA 5MF6A 2JI8A 4J1TC 4UUBA 1S5PA 4UTRA 1YC5A 5DGTA 1MA3A 5BWNA 5K3SA 1POWA 1O96B 2Q5JA 4G1CA 1Q1AA 2Q29A 1POXA 2JI9A 1ICIA 4QELA 3PDHA 1PI3A 1M2JA 4F56A 4D5EA 1PO7A 5EJ8A 1BFDA 4IF6A 4ZZIA 4K9QA 2H4HA 2Q28A 1PVDA 2VK4A 2QQFA 1U2GC 1YNOA 1OVMA 3D7KA 4QQ8A 2OD2A 3PKIA 4BV3A 2A1TR 4BVFA 4Y6LA 5EJ4A 4FVTA 4L3OA 5EJ7A 2DJIA 3ZG6A 4K9MA 1Z8NA 1PNOA 1T9BA 3ZGVA 1YBHA 4JT9A 1EFVA 1HZZC 4RMIA 5FYQA 4HDAA 3FZNA 4RMHA 4MQ5A 2Q27A 2X7JA 2B4YA 2VK1A 5AHKA 3FLMA 1Q14A 3ZGOA 2VJYA 4TWIA 4X3PA 2H2IA 4V1CB 4GP9A 5EJ5A 2H4JA 4MPPA 2H59A 2EZUA 4FEEA 4JUAA 1EFPA 2H2HA 2WVGA 4QPZA 3RIYA 4UTXA 4GPEA 4KXQA 2FRDC 3F6EX 3FSJX 4MPJA 1YC2A 1QPBA 4IAOA 1DJLA 4BN5A 4J16C 1M2HA 2FWNA 5BWLA 4BUZA 1PTJC 4IG9A 2OO5C 5EJAA 5K6RA 1SZCA 4V1CI 2EZ9A 2H2GA 1UPBA 5K6TA 3JWPA 5DEIA 1UPCA 4K9NA 2FSVC 4KGDA 2H4FA 4MPRA 3IAEA 2C31A 1V5EA 3D4BA 1J8FA 4HD8A 3HWX1 2H2FA 3CLRD 4RJJA 1V5FA 2JLAA 1U2DC 2UZ1B 4JUCA 2FN3A 2Q5QA 4MZXA 1SZDA 2JLCA 1PNQA 4FEGA 4D5GA 2VBIA 5MGNA 2EZTA 5K2OA 1Q17A 4L2IA 2Q5OA 1N0HA 4O8ZA 2AG0A 1V5GA 4GG1A 4Q9DA 4UU7A 4UTZA 1PYDA 5IMSA 2NXWA 3PKJA 4K9LA 3IAFA 4ZP1A 4TWJA 3HWWA 4JUBA 1OZHA 4RJKA 4JUDX 5MFZA 4RMGA 2HJHA 2AG1A 4COKA 4BVHA 2PANA 1D4OA 2IHTA 1ZPDA 2IHVA 1YHZA 3JR3A 2EZ4A 4JUFA 1YTLA 4JU8A 1MCZA 1OZGA 2PGNA 3GLTA 4JU9A 3E9YA 4BVGA 5MFPA 3GLRA 1U28C 5EJ9A 4JSRA 2JI6A 1OZFA 3LQ1A
chains in the Genus database with same CATH superfamily
1XYGA 2DUNA 2O8DB 4LGVA 4Q3DA 4AJKA 4RVNA 3RFXA 3EGVA 2K2WA 5LP6F 3H17A 5B7NA 3LM8A 5L4LA 3QVGA 3WLTA 1BDBA 1T9GR 2CHEA 1NOJA 4Y9SA 1UXIA 3SNKA 1CEEA 2HPVA 2QLBA 3C0KA 4TS9A 1Z74A 3Q0TA 2EEPA 2JIMA 1KDPA 3L6UA 3LD9A 3N8NA 3S1AA 4Y2PA 5U4XA 1S2LA 2VDPB 4DIEA 4ZN6A 2J30A 1EDDA 5JQGF 2H63A 4E4TA 3KVOA 1M6EX 1G19A 3K32A 1W47A 5A7GA 5TGTA 3I58A 4JFAA 3TPFA 4QXAA 1GFSA 1N2SA 1ML3A 3AW9A 3LX4A 5DPMA 4FFNA 2BJWA 1UKBA 3ED1A 4WAUA 4ZHQF 2HQRA 2V3CC 5K0EA 1QORA 3D2AA 4RQUA 2QRVB 3LFUA 3MERA 4Y1EA 1KP3A 1HTTA 3SX2A 3T3EA 3JQGA 2CCKA 4OQNA 3LBHA 2GPJA 1J24A 1N2EA 2WYOA 3B1VA 2YNMA 3U44B 1S2IA 2I67A 2ERCA 3OPVA 5C31A 3ER6A 1OI4A 1P61B 5FORA 3T5CA 2J48A 4BCDA 3AZQA 3NC1C 4RF5A 1CVIA 3DEJA 3AR3A 2X23A 5JADA 4DM3A 1X7GA 3DFMA 4P54A 1R6XA 2GTHA 3EAFA 5AVYA 3KXKA 3CZ9A 4M9SA 1CE8B 1AUOA 3K8ZA 2Q6LA 2QGNA 4I5FA 4BJHB 3CS3A 1AX9A 3IS3A 4PX9A 2WA2A 1B8OA 4WXPA 5FRDA 1XFDA 2O2JA 5EHGA 5HYVA 4RETA 5F2NA 5M2QA 4FFPA 2PYIA 1OV4A 3BHJA 4FR2A 3G7SA 4IUYA 4Z1MA 5IBPA 4AY4A 5AR1A 4HXFB 4X64B 1R0YA 5DT9A 4HNUA 3PFNA 4FFOA 4DR7B 3Q72A 3ORHA 1Q0LA 2G04A 4H59A 5A2QA 2MSCB 3E7PA 3C3KA 4FD3A 4QOEA 4BYMA 3SQDA 4RYDA 4DMGA 2QS9A 3AEKB 4OYHA 2O0LA 2ON6A 5LDGA 1WDWB 3K9BA 4AJHA 3PYLA 2JLYA 1MQ9A 2H08A 2Y4NA 4DLKA 1LDEA 1K68A 3BGDA 2VIIA 4JJ7A 4YV2A 1XU7A 3VH1A 1PBNA 4JYBA 3MZ0A 5EP3A 3QK7A 1IQPA 4HUQA 4FYIA 1O03A 1SG6A 4FMCB 1ZUHA 2VP5A 4BNWA 1XMVA 1YAJA 1Z2DA 1K4KA 1TT7A 1CPYA 3DOFA 3EHEA 2QNIA 2H5IA 1WY5A 3KB1A 3MTQA 2DOKA 5AXDA 5HF8A 5LQSA 5ALZA 2JGDB 3SPXA 7ABPA 4M1OA 4OVKA 3CX4A 1Z28A 3GW8A 2NN3C 2N42A 1O6FA 2B8EA 2VJAA 3BMCB 2CWWA 1PEKE 5LIRA 2H48A 3P2JA 1QGOA 3FWZA 5J4LA 2JAPA 4FFSA 2CLMB 5CYOA 1H8HA 1I2CA 2RGAA 4IGFA 2FSPA 3UW1A 3ZWNA 4DHEA 2Q4OA 4EB0A 5C18A 3T5TA 2VTVA 1OH8A 5FEMA 2AEEA 3QPUA 3V3KA 3OM0A 1P45A 1UOOA 1MG5A 2G9VA 3HUTA 5I9MA 2WWWA 4YCDA 3Q3HA 5F64A 1W8IA 2J9GA 5FJIA 1BXZA 1EXMA 5J3JA 1J1IA 5FTLA 3AG6A 1QYXA 4PFQA 3NEAA 4U7JA 4PHHA 3V42A 4U2FA 5AD1A 2ZIXB 3AHGA 2XZLA 2GSDA 2UZ1A 1K98A 3B9PA 5CT4A 4F12A 2ZJFA 3TYXA 5GZ3A 2A35A 1E9DA 1U9ZA 1KHTA 2QL6A 1K7XB 2X41A 3FNFA 3V80A 1X74A 2UUCB 4XVQA 2GVZC 3GPDG 4YUXA 5EE0A 2OORA 2PE5A 1W30A 1Z8DA 3OUUA 5ICFA 2W11A 3TRHA 2I6XA 4D6PA 1P9WA 3FKSA 4Q5IA 5EKTA 3RM3A 1A4RA 1L9XA 2R8XA 3IX7A 5L3ZA 4HO1X 4NQZA 5JYDA 1JXMA 1ULUA 2IOFA 1DUIA 3KT3A 4CLXA 3DT9A 1JHXA 1JS1X 2E4AA 3AL3A 1ZJYA 4BLPA 1Z8FA 1RCFA 3N2KA 1I3NA 2ZVJA 1Z7GA 1ZMOA 4WWHA 1W48A 3VUFA 2ZYAA 1OA0A 3E9QA 3I9LA 4JR1A 3LTEA 4WESB 2FSVA 3WYCA 1AKEA 5B4UA 3C45A 5JO0A 2VQ3A 4DWJA 4DSOA 3AF2A 1M34E 1X70A 2VRCD 5BWNA 3L8EA 4RHTA 2C82A 3V33A 3FGPA 4FYMA 3P7MA 3MJRA 3WBKA 5HZMA 1J8MF 3CRW1 4DG5A 2P4EA 1Q1BA 2YXPX 3G82C 4I9FA 3ZKWB 3M6IA 1K2VN 1DIAA 1POXA 2GEKA 3AVOA 4CKEB 2J7KA 4M2LA 4CCSA 4QUKA 3K9QO 2QN7A 4IR7A 3RSGA 4BEBA 2PMFA 5ALQA 4C1BA 2WJHA 3W1VA 3OQIA 2CNNA 3BMQB 2GAJA 3R0XA 3D7RA 4W6QA 4D5EA 1A76A 3TI7A 1MC1A 2GEJA 4EG4A 2QTHA 1JB9A 2EG5A 3AUUA 5TQJA 4JEMA 2BGGA 3MJSA 1B1AA 1A2BA 2F8LA 4FIZA 4KXMA 4CTNA 1ODSA 1W0CA 3K9FC 3I23A 1NNLA 2PCLA 3A6GA 3PC3A 1NYLA 4A0SA 1SA0B 1ADCA 1SUSA 1MO2A 2PZ8A 3PC2A 5FBHA 4DEYA 3OAAA 1FNSA 2F1IA 2YJGA 2DFLA 3L01A 4Y6RA 2QX9A 3THXA 1AQYA 4MQFA 5HF5A 2IKQA 1PYOA 4KHZA 1QOZA 2BMWA 4CMKA 3O31A 2WEKA 1HTBA 4FINA 2XDWA 5B7GA 1QF6A 1RJDA 1T5LA 4NU0A 1Z47A 4NBRA 3G8YA 4WKNA 2PUEA 1Y4AE 5HIKA 1BFKA 2VZEA 3BIWA 5DYWA 3TW4A 4BMPB 4ZI7A 4NMHA 4A0RA 4HQKA 2H57A 1FMFA 4DSUA 4EGSA 4HNRA 4QYXA 3IBCA 4YJ2A 1DJNA 4EHNA 3LXMA 1YNSA 3PFBA 3WJ7A 2IXBA 4YVFA 4CNBA 3F0TA 2DJIA 4ZQCB 5FL3A 4ES6A 5SYAA 3JSAA 1FX0A 3E4DA 3VR0A 4FGUA 3ILYA 3WWEA 1JWBB 3N7UA 4BWYA 5IHXA 1H5QA 2C5FA 2C8JA 2O7VA 3PF9A 3ZG6A 2GM4A 1E1KA 3D3WB 5J2TB 5HIIA 2ZB3A 4OXKA 2MINA 4RKEA 5KTOA 1CYEA 4QD3A 5A4DA 1ODIA 4Q9IA 1PNOA 1Q0PA 3D0KA 4X7RA 4HR7A 1WXDA 1SU7A 2IYOA 1UJ6A 4DRYA 1MH1A 3VJMA 4IZHA 1YKFA 1T10A 2OPBA 3GG2A 3HGQA 2PG3A 4D92A 5FAKA 3I4FA 3GFGA 1DCKA 1DWUA 1IXKA 1Q95A 1R18A 1XLTA 4PRKA 4QYMA 5CLQA 3L0PA 2BMJA 3M4YA 1LV7A 4FYPA 4J90A 1LSOA 4YWJA 3FLAA 1SCJA 2QMQA 4LMRA 2UYCA 5DXFA 3LGXA 4QAJA 3FZEA 3PQ5A 2RGNA 3FNRA 1HMYA 3D7SA 2RAUA 3OC0A 3L8DA 2H06A 2LBPA 2HSZA 3PDWA 5CA1B 4G5FA 3VPAA 1Q6YA 1L7NA 1WETA 1U7PA 4KFUA 4UUQA 3HJGA 3TTXA 3OG9A 4Z3OA 1DCTA 2OV1A 4QFBA 4N7BA 3ZJUA 5DHFA 2DFDA 4M7PA 4K46A 3IAAA 5FBQB 2OXIA 2J9FB 3V1KA 2O20A 5BPFA 3Q3CA 1GL9B 4TSFA 3EC7A 1SAYA 4LDJA 3HWRA 4BLWA 4UHHA 3GN1A 4MYSA 1N6KA 2H1VA 4JOCA 4PLWA 2LW7A 2IXEA 1L6IA 2P78A 3K16A 3LDHA 4GMXA 4E03A 1FUIA 1PDOA 1GPMA 4I4TA 4CEJA 3UKJA 3IMEA 1YBFA 4HNQA 2OAQ1 5EGSA 2R4UA 1X94A 4LDAA 1IHXA 4FZJA 4QUJA 3H1AA 1FRVA 1XPUA 4XJVA 4JODA 4N6OA 1C9DB 2QM3A 1L1FA 4X1YA 2PBFA 2HHCA 2CUKA 4B3TB 2ZVQX 2GCIA 1W4LA 4CEIA 1U90A 3PX3A 3LE8A 4GXNA 4EEXA 1SCBA 4O4IA 4B3SB 5HSGA 3LYLA 1IN6A 2EARA 4JLWA 2DY1A 5SICE 3O2QB 4Y2SA 2RGRA 1KJIA 2HFKA 3CZAA 2WJJA 1XTQA 1A5ZA 2RHDA 2RJOA 4MZDA 5CB4F 1TCBA 4CKZA 1HA3A 4EZIA 1NMXA 4UBJA 4HGPA 4B0PA 2W6JA 2OT3B 2XD9A 3R5KA 2QYHA 5DBFA 3AEQA 4L8VA 3B60A 3OPNA 2QAIA 1LF0A 2Q49A 4BN5A 4MIEA 4YK7A 5C34B 1KL7A 2BELA 2PKEA 2SCUA 3K8QA 1OIWA 1Z0SA 1HNXB 3OLXA 4AX4A 4LSMA 4NI5A 1PTJC 3T1VA 2Y93A 1L7DA 1E3SA 1RLOA 4K5QA 1UBUS 3CZRA 4E11A 4FDVA 5KJ6A 1F9EA 2PZKA 5EY5B 2QV7A 2FK7A 2KQUA 3KV3O 3NEJA 5C53B 3EWNA 1O58A 1YDWA 5JSYA 5AJUA 4ARCA 1FB5A 1J00A 3OY7A 1D1QA 5F5XA 3P2IA 4BCCA 3IPXA 1A9XA 3H86A 3PYMA 3DEIA 4HNHA 4NRDA 2EJUA 1L2TA 5DE3A 2FCRA 3TQFA 3YASA 2IF0A 3P9YA 4LOJA 1A82A 4UVIA 1K63A 3C1UA 4HAIA 2UYOA 1YRWA 3EHDA 4KR7A 1ISMA 2OP0A 4CJXA 3CN9A 3DH0A 2B8WA 4OHRA 2WTBA 2PSSA 3NIGB 1NV9A 4QTYA 4TV9B 2LIVA 2OBBA 1Z82A 4Z2AA 2C5EA 3ENQA 4NYJQ 2DGDA 3OFVA 3NXSA 2HMAA 2YRWA 5G0SA 1UBJS 2PLAA 1QRTA 3BDVA 5JRZA 1IY8A 2ZW9A 1X3SA 4CU2A 3PLAE 1V4BA 2RKOA 2IDKA 2P9TA 4Q9AA 2VTKA 2F7SA 1J97A 3I2FA 4UQOA 5ENVA 3VHRA 4CV2A 1V5EA 3RIMA 4OU5A 1F48A 3Q5GA 3UWDA 3GRRA 4L0CA 2XMGA 3ZHQA 4N48A 5LIPA 3LY9A 3QKWA 4D45A 2UUBB 2WA1A 3DBOB 3C3BA 3FVTA 2PQMA 5CEEA 1VE5A 3THOA 4Y6SA 4WKCA 3SR3A 1E9EA 2PKXA 4E5VA 5F7JA 4GOMD 2QTZA 2RG7A 1LA2A 4GKAA 1EUCB 3GUVA 3HNOA 3T54A 3EEOA 2WAYA 4BLOA 3LX6A 4RABA 1KYQA 4K28A 1FXSA 3ZE9A 5KVSA 3NFYA 4CR7A 2G83A 1KWKA 4Q1EA 3SEZA 3NDBB 2AX4A 5I7OA 4MZXA 4PYJA 1RKVA 4MV6A 1G5TA 1Y63A 1DPGA 1JHRA 1TVEA 1JEOA 4O4HB 3SX4A 5DBIA 5CFRA 3QNWA 5LBUA 2W4QA 3FPLA 2B0JA 1UAGA 3ZLTA 2ODPA 1QDEA 2VF8A 3AVXA 3HUEA 5LB2A 3ICEA 4KQFA 5J40A 4IIJA 2JKYA 1FDSA 4FX5A 1E2KA 2HA4A 4RELA 4W1SA 3TZEA 2NZJA 1PHRA 3DVAA 2XQVA 3GX1A 3Q1LA 2NVBA 1L8LA 2IDZA 3C6MA 1V5GA 3CW8X 5FNVA 5K0JA 1VLZA 4E5MA 1M8JA 4X65B 4N3NA 3ND8A 4CQMB 621PA 5HK9A 1QP7A 2ZVPX 3VKHA 1JF8A 4MICA 5D3KA 2JPDA 4INAA 4M1EA 4D82A 1GA1A 4JFRA 1DS6A 1II9A 3C1TA 1G2QA 1GT6A 2D5LA 2FEWB 4LYYA 2VDKB 5LA6F 2RE8A 3IAFA 4ZRDA 1VE9A 4PZ0A 3WYEA 4UVEA 4EPVA 3ZDEA 4TTTS 1JBQA 3NETA 2FR1A 2QF7A 5A4KA 2XRZA 4JUBA 4RCVA 1BN7A 2WILA 1SB8A 2DUWA 3RTEA 1PYGA 1UC4B 3IVGA 3C6ZA 3WK8A 4AZ3A 1G55A 5JNWA 2X9QA 4Z4FA 4JUDX 1T3ZA 4RMGA 4BXOB 4EO7A 1UJNA 4Z0TA 3IIIA 2AG1A 3E27A 3MW8A 5C2JB 1MO3A 2H65A 4IVPA 4YNBA 5LLDA 2IHVA 3Q9SA 1E89A 3IQWA 1QMGA 1QK4A 4DLVA 2NM0A 4KL8S 1YTLA 1SHTX 4D9CA 1MCZA 5JHHB 1WXIA 2BDUA 2HWKA 5FBWB 5HF6A 3H5TA 4DM4A 5FUWA 5DHPA 3GLIA 1OIVA 3L7LA 3P9SA 1Y89A 1I7PA 1E1QD 3QNUA 2NACA 2JH8A 1Y5MA 1R27A 5GY7A 3F1KA 3RTGA 3T7KA 3V3TA 4AVYA 1AMNA 3QSYA 4RK7A 2OB2A 13PKA 2D0IA 2OP1A 4P31A 4C3OB 3NNSA 4C88A 2I8CA 5CDGA 4BPBA 1XZNA 2ZRBA 3TS1A 3P9ZA 2Y05A 1ZUIA 2JFUA 4DJTA 3ANSA 3HS3A 4MRPA 4WNAB 5E7QA 2Q5FA 5EG5A 1E4OA 1M1UA 3D3EA 1ZXLA 2CXRA 3PFIA 3P9IA 4N0PA 1VOTA 3TOSA 2FWAA 4E07A 4DLPA 4JLNA 2PRSA 1QHSA 3ZVKA 4OLJA 1E61A 4KO8A 2ZSDA 3FGOA 4QYIB 4JK3A 4KACA 2HSWA 5KNCH 3QHPA 5TQ0B 5A5VA 2F9FA 2XMBA 3DKIA 4PG5A 1VYTA 5HZHA 1ZD8A 3P9QA 3TFOA 2COEA 2J08A 3H4MA 4DUGD 4DUZB 1UXKA 3VKFA 3DVQX 2O2XA 3C3CA 3VX4A 2CZQA 5JXIA 1JRLA 5AK6A 5J9FA 5TJHA 6ABPA 2QQGA 1IPFA 1VLHA 1ZL2A 2YJZA 2WLTA 3P2KA 1YR1A 4YJGA 2V96A 2IYTA 3UGKA 3JX9A 3F7OA 3DOHA 2XI4A 4MDHA 3WHKA 3CWCA 4LYFA 4KEAA 3KQKA 4FBMA 2FXIA 3GZNA 3TLXA 5ARBA 5CITA 2WD9A 3CLTD 4QOIA 2WM9B 1GJRA 2C96A 4X3OA 2ECQA 3AXSA 1PTKA 2QYTA 5D00A 5FA6A 3IUPA 3KLPX 1LW6E 4TLCA 4F85A 1P75A 1R5JA 1ZNWA 1YE3A 4L9RA 1VECA 3WSTA 3ZU5A 1HDEA 1T9AA 2ZRMA 2Q3MA 3M6WA 3N2LA 2G77B 4JBWA 3IESA 1WMEA 1WV1A 4V3BA 3ZZ0A 4EYOA 2JFBA 4O1IA 2ZWAA 3A2LA 2ZTUA 1ZHOA 1E4EB 1KJ9A 3E35A 1UJ4A 2IU6A 4DL9A 4F5YA 1L5WA 1UFVA 4EVRA 3KQPA 5CLLA 2VHYA 3DFIA 3MJDA 4MMYB 4Q1CA 3NBYC 3GLHB 3RF6A 4ZVOA 1KNXA 2DWPA 3TZCA 2JFHA 2FDCA 2Q3LA 2H4XA 4W1PA 2ZIAA 1T0HB 4NS1A 1NRJB 3HKEB 1TW3A 2ZGVA 3HU5A 3R3ZA 3MTDA 3HDQA 2Q6IA 2HMSA 5DTEA 1JA9A 2O5VA 2P2CA 2WVHA 2X2OA 4YGYA 1NVTA 3F7NA 4KGZA 1EK1A 1E8MA 5JNVA 4L6CA 1SPBS 1XYVA 1MTZA 3DZCA 5G1NA 1VCMA 1QVWA 1ZI8A 2OQRA 2W00A 4W7SA 4Z4EA 3NM4A 2PNFA 2P27A 4TMKA 3WDKA 1JFSA 1MJGM 1E3DA 1T2EA 1WY7A 2X6QA 2YH2A 1AK9A 5DCUA 3WI7A 2BGIA 1N3LA 4JEHA 2QJRA 2KB0A 3ZWDA 5L53A 4KKXB 2CMKA 2XNDA 1M5TA 3PWTA 4YMHA 1RYHA 1NPYA 1BE1A 4Q37A 2I3ZA 2AI2A 4R1OA 2PT5A 1DKUA 3ECSA 2VDJA 1OX4A 1SJ9A 2B5VA 1ZLYA 1N3YA 1SVUA 2H1WA 3QH4A 1WXWA 1GQQA 3X1WA 3PXAA 3O4VA 3ZS8A 1PQWA 3JAKB 5LUBA 2VSQA 4LTMA 1SM4A 4PYQA 4DA6A 3CO5A 3BB3A 1NLMA 2FX2A 1XZ8A 3P0IA 3KTAA 1EBUA 3NJ8A 4RXUA 2IUFA 1CUDA 4PYKA 4UUAA 3L43A 1Z0FA 5I7WA 1GTRA 1IOVA 3OESA 4M1ZA 1VFPA 2FLWA 1N5OX 4OMDA 2CVHA 5AI8A 3IQDB 4IFBA 4S2UA 1NY6A 1TZBA 4MA4A 4NLLA 1Q21A 4Q3LA 4UMVA 1QQAA 1T4DA 1Z56C 2QMOA 4DCJA 3DF9A 2ID7A 3JTEA 2J4DA 4HDOB 4DRZA 1KFCB 1QGUB 2C88A 1Z5OA 2M9MA 2O8EA 1EPUA 3PRJA 3PEVA 4XB6B 1BW9B 1J0AA 1EIWA 4LYHA 3RGWS 3K1ZA 2IHJA 3BHNA 5B4VA 2Z3ZA 3BM5A 1YAHA 3JWGA 3DE1X 4BX0A 2HM7A 3F6CA 4Q3EA 3KWJA 5TGDA 1A72A 2VDMB 2VPXA 3FCUB 4F4UA 2OG1A 1LZKA 2VSOA 1XP8A 1N0IA 2B1JA 2YJ3A 2YW9A 3NGLA 4WD3A 5CIWA 4EKEA 4EHJA 3I9V6 3CX7A 2ZB7A 4XXHA 1YZFA 3UJDA 4E6PA 1XVTA 5JBQA 4M89A 2QL7A 4YCAA 4MQEB 2PMKA 5DM4A 4U2EA 5C1OA 1OCEA 4PZDA 3DHNA 4AJJA 2WWIA 2B94A 4I19A 1H4TA 3KFLA 5E1MA 4X60A 4Q9JA 3I05A 1W0KD 3X1JA 2A0YA 1GKUB 3VZSA 2AN9A 3WGTA 2I2AA 5E6SA 4P58A 3OPXA 1E2DA 3E15A 5JC8A 5IRCD 2ZUTA 1TLFA 4AP6A 4B3MB 2XBUA 2OGTA 3GJYA 2E48A 2O48X 3LXUX 3E1GA 3U4IA 5DGTA 5EXXA 3T4XA 2LDBA 4A10A 1N0UA 3AIMA 4J7AA 5CH3A 2NSYA 3TLGA 1Y7PA 3NFRA 3WLFA 3L0IB 3HM9A 1Y7IA 1PK9A 4ARZB 4D0GA 1XC7A 1GTSA 5EP4A 4R5MA 5TQVA 4BO8A 1OXTA 3MF4A 3NBQA 1TYAE 2MSWA 3QV1A 2EGGA 5B55A 1GGHA 1U6IA 2ZWVA 2NO5A 4DWVA 5BT9A 1JILA 2AV6A 2EYQA 3T3DA 2AR7A 5BT8A 4ER7A 2BISA 1RC8A 4YLEA 3NKFA 1MX3A 4WVFA 2GBLC 1PO7A 3QX7A 2I55A 4JYZA 2OCBA 5DMHA 4S24A 2SKEA 3RUIA 1NZDA 1TO6A 3SX0A 3EBLA 1B73A 1CP3A 4EBFA 4LTDA 3RRNA 3KU1A 3PE4A 4W7HA 5DDIP 1A8QA 3I2IA 3O4RA 1I80A 3HO1A 3C3EA 4MVJE 5IYZA 2P5SA 5BUZA 1UPXA 4BBJA 1TJ5A 4UOZA 5ICSA 1QIEA 4HQ0A 4INZA 5AOVA 5CT8A 2A0UA 1R5OA 2ZG6A 1DUVG 4PNZA 3K70B 1WOMA 1NJ8A 4WCFB 1XB2A 2DH5A 2P7HA 3T1OA 2ERYA 2PL3A 5FULA 1K5DA 1E3QA 4CI9A 4Y6LA 3K2IA 3OQBA 3SS8A 5ABPA 3E5MA 2J3HA 3NWBA 4WZAB 3A0RB 3H9BA 4P5EA 4G24A 4DMRA 2QEQA 5IAAA 1FP6A 1Q57A 3LHFA 5TNXA 3W5VA 1RNLA 4A8JB 1FRQA 3SE0A 2VNJA 3AKZA 2AJLI 3JQCA 5LJLA 3WQHA 2AA3A 4HLCA 5TS2A 2EFDB 1MOPA 3D0OA 5BWBA 5JDIA 3DO8A 3SSNA 5AXCA 2DZDA 4RY0A 5BV7A 4OB7A 5JH7F 1HWYA 2DE0X 2FE4A 4NCBA 1F0PA 1CD5A 3IKTA 1CRZA 2YVUA 2KM1A 2OECA 3HU1A 5FEUA 5F1PA 3PJGA 4HBGA 2J5XA 3GLHE 3VKWA 4DMLA 1FFDA 3FI0A 3HYRA 3PVSA 2OM2A 3QP9A 4MITA 3VSEA 1MAUA 1EFUA 2VP6A 3T4PA 4CM6A 4PPNA 2JLUA 3U3XA 3IAS1 1RYFA 4Q7JB 3HKCA 1DBQA 2CXPA 2XDAA 2C8VA 3NHZA 2Q0QA 3B82A 4GZ3A 3T0FA 2BHNA 5TT0A 5LZ7A 4PEVA 2R25B 2DHRA 3LCUA 3SJAA 2NO7A 3V1YA 4KH0A 5D6OA 4QLBA 3ER9A 1WD5A 1ZAKA 2H0AA 2AZMA 4Q1DA 2GAAA 3PJRA 4YYEA 2AJTA 2O3TA 4BX3A 2EL9A 2P9ZA 2JG3A 3EG9B 4AKHA 2YZMA 3X43A 3A27A 2PJRA 4KUGA 2BBSA 2PRIA 3G89A 3HYTA 4BRZA 2DHCA 4EYEA 3I61A 1MJHA 4MJ3A 1NAIA 4L07A 5CVEA 2KW5A 2XTMA 3RHZA 1DRKA 3LWZA 3OZXA 4BMYA 4UPEA 4ZTUB 4AY6A 1H8HD 1AS2A 2HCJB 3D1LA 4DTIA 4M0MA 1LJLA 4UARA 5FV7A 4EHDA 3KSAC 3JYHA 2DECA 2QRNA 1F17A 4ZV9A 4UATA 2NXCA 1BYUA 1QK3A 2I65A 2QG6A 4HX2A 1OXBB 2YIJA 3PNOA 3NVAA 2DBRA 2Z9BA 3DBLB 2EQAA 4ZT4A 2VSXA 2BFCA 3EVGA 1I2ZA 1DX9A 1SPXA 3U4CA 1J42A 1E1CB 1P80A 1B6RA 2WW8A 3ESXA 4GP9A 3N53A 2ATXA 4Q47A 3KUUA 2AOXA 5EP1A 4FFLA 2I2DA 1NXOA 3TOZA 1H05A 1ZP6A 4IXTA 3RRMA 3TW8A 1YZVA 2H59A 4BUCA 2DFNA 2A4MA 2VS1A 4YR9A 3C7AA 5BW8A 2VHVA 2DHDA 1DOAA 2JJ8A 4B1FA 4CLOA 2CNWA 2RKWA 2ZM5A 5E7MA 1RXEA 3PUJA 2G1UA 3BULA 4NULA 5H83A 2WM3A 2QXYA 3DCJA 1QV9A 5FDFA 5HOEA 4BU0A 3S7ZA 3PPXA 2WVGA 3M5PA 1IJBA 3RIYA 2AJDA 2PRJA 4G23A 4O4JB 4NKRA 1BH6A 1KSFX 1NBAA 3K20A 3FDIA 3HJCA 4OB6A 4UFOA 3STHA 2GCGA 2YXBA 3IA7A 2FPIB 3X1ZA 1ND5A 4EKYA 4LI0A 4MPJA 1YC2A 1D9ZA 4NEHB 4D42A 3BXHA 1DTWB 2AN5A 3QW2A 5EHIA 4DBLC 1Z88A 4EB6A 2IK8A 4PX3A 2JJQA 2AWOA 5LYJB 3W2EA 3T5AA 2WIBA 2EU8A 1VJ5A 5BWLA 1HFKA 1SQ0A 2Q9CA 4A1FA 1H3EA 1FZTA 4XPIA 5BQ3A 5DYYA 3BZWA 3TIXB 4KPFC 1E3WB 1P4GA 4O6VA 3F9RA 3ORRA 3SXJA 1KY3A 1SZCA 1LI4A 1R6BX 3AETA 3LO8A 4G5GA 1U2GA 3BRSA 4V1CI 3JQ7A 2XOKA 1KYVA 4NBKA 4XVHA 1JXAA 3TMYA 4ZOLA 1RRFA 2EZ9A 5ITZB 1GRCA 4TLMB 4X1IB 1QCZA 4IF4A 1S2MA 1QE3A 3E6AA 4HFRA 5HRUA 1COWD 2OESA 2WLSA 3OCVA 5DNCA 3UJ6A 2W2LD 2R0QC 3QWBA 2P1RA 5HA5A 4AZ0B 2H2GA 4KBYA 3SCZA 5D8DA 5CEJA 2R1VB 3OKPA 2MSKA 3JWPA 3EBOA 5HM8A 4GI1A 3MB8A 4BAZA 3KKKA 1JR6A 2HU7A 2EGUA 5CDUA 1XZLA 1AQ6A 4WA8A 5FPTA 3GLGA 1Q1ZA 1KZ6A 1E79A 2VPTA 3IVCA 3PEUA 4WGGA 4N5MA 2D13A 4TS4A 1KXJA 4EFLA 2GN0A 4QUHA 4JL8A 2WUEA 2FZWA 4MLZA 4Y1FA 3M0EA 5TE9A 2CD9A 2HU5A 2ZE8A 3IAEA 5LZ9A 2GWRA 2CL0X 1WKVA 3WKDA 2WTAA 5T4EA 1KK2A 2XXBA 2QZZA 2ZAIA 1O08A 1Z36A 4CNQA 1AGXA 3DQQA 2OB1A 3K09C 4RHEA 1J25A 4Z49A 1P19A 1UEJA 4QPJC 2X0FA 3ZWWA 3I6YA 3AKDA 3NOXA 2XB2A 4ZT7A 5FNZA 5TRTA 1VSUA 2ACEA 1U3UA 1EGQA 3M4XA 5BORA 4CTOA 5LPNA 2VJPA 2GPAA 2J9YB 1GNRA 5GJWC 1EFLA 2ZDQA 4EW2A 4A0GA 4NH4A 2C92A 1K4MA 1NX9A 2I1LA 3CRNA 4PLVA 3G88A 1JLLA 3FMGA 3IQIX 3WLHA 4RENA 5FOQA 3AONB 2D3TA 1IUNA 3NHRA 4EG8A 4LMPA 4I1VA 4QDUA 3UMYA 2AN4A 2CXSA 2G6TA 2QHXA 4RYLA 5CXSA 5A4IS 2J5RA 3U4MA 3B9QA 5K01A 5K0TA 3SBEA 4U4AA 4ENWA 2XIJA 3DBHA 4OL9A 1IBMB 3Q7QA 3EGXA 3PXEA 4U2CA 16PKA 4YREA 5L95A 3CLVA 1M1YB 4KN9S 1NQOA 4LG1A 1NUTA 1P7YA 1DIGA 5CLIA 3W06A 4CIXA 2YN4A 4GXQA 1LY1A 3HCAA 1KZ7B 1STOA 3RGGA 5C1DA 4CMAA 1QO0A 2GKGA 2HXSA 4FGJA 4RGBA 4UASA 1NQ5A 2OBYA 4KH1A 5BYBA 3DHYA 3JYPA 1ONSA 3A58B 2NVUA 4HLNA 1SC3A 1AJEA 1UDRA 3IMFA 1XL1A 1PR9A 2VT6A 4P0PB 2UXDB 1DFGA 3L4BC 1ZJ5A 2XWSA 3RIEA 1ETHA 1SKAA 2CJPA 1YZGA 1CJKC 2OYSA 1X2BA 1Q0QA 1QFSA 3CONA 4HL6A 4AO7A 4BQOA 3T38A 1BC5A 1KSJA 1Z0JA 2EDCA 4FMBB 4R8KA 3E2MA 5TVKA 4N7JA 1K8QA 2B0CA 3UMSA 1F8UA 2JANA 4GGMX 4CLEA 3KDPA 4LY0A 4L4XA 5IP5A 3HZRA 1R3DA 1F20A 3ENKA 2H7CA 4MYUA 4MV1A 1P1JA 2E5WA 1D4OA 3PWKA 4G4IA 1T4CB 4XDGA 3RI3A 3OUTA 3TZHA 1ADYA 2ISSD 3E22A 5C8VA 1YHZA 4X8HA 1M2OA 4OP3A 4EM6A 1GGKA 2C5AA 1FS4A 3HBFA 2IDJA 5BW5A 8AT1A 5IUKC 1TJ4A 5JVDB 4UKDA 4ZCLA 1GYRA 4WIAA 4KTVE 3I9OA 4JX9A 1E64A 3WJAA 2Y2VA 3H16A 4XUDA 5BN4B 5KYUA 5JCPA 1NG9A 1UMCA 2XQFA 1X0XA 2ARKA 3DO5A 4DYHA 3K31A 3HCBA 2CNOA 3FOFC 1T6BY 1V5IA 5H59A 1ND6A 4Z54A 1W52X 2HO4A 5KIAA 4B5LA 1IB0A 3AUKA 1CNEA 5D1NA 2ZBFA 3WTCA 5CFPA 4BWGA 3GLRA 2AN1A 3K05A 1QQ7A 4WZBB 5IWCA 4X63A 1QSGA 4M9UA 2JRCA 2AG5A 4B4UA 3JD0A 1I0LA 3LQ1A 1G5IA 3B3AA 4IOMA 1AMOA 3FRJA 2RHHA 1A8UA 1UH5A 3GLSA 3PWZA 4HQ6A 2QAGC 3L7YA 4L72A 5C5EA 4F92B 1H66A 3OA0A 1VDZA 2DT5A 1WHSB 3PB3A 5KTYA 4LUCA 4KGXA 1C3VA 4RLFA 5F52A 1ODKA 1SBTA 1SUFA 1TVMA 2P79A 4FNAA 5FI0B 2AE1A 4JBHA 1XQWA 1W2WB 1FJXA 3OZDA 2WD7A 1H42A 2C4MA 4KJZA 4MRMA 4O2BF 3OKAA 3CNLA 2ZUUA 3GJSA 4JSYA 1NZFA 1SRQA 3QOYA 3U31A 4Y9UA 1C9NA 4L9AA 1ATZA 5AH0A 4LF8B 3FTEA 4K88A 4GDMA 4D3ZA 1V9CA 4RNDB 1G6KA 1L5HB 3N8IA 2RHTA 4GF5A 4PLCA 4MR8A 4Y6QA 5AKHA 4CV1A 4DSTA 3I5YA 3E1SA 4Q6WA 4IJQA 2ZUCA 3Q1KA 2V7PA 4LZZA 3T5MA 2FAXA 1CEQA 3ICQB 2DMRA 5IABA 1W5TA 4I1YA 4KMRA 1ZFNA 3LT5A 4G41A 2WD8A 3IR7A 2VKQA 4H15A 4ENQA 4P7GA 1CWUA 1NVMB 4Q4JA 2J0VA 4RPLA 1IWPB 3KOUA 1PZMA 2B6HA 1AV7A 2PH5A 1IBSA 1P17A 2NW6A 3NS7A 3ZE6A 1Y1TA 1WCIA 1YHYA 3B2EA 4OGGA 1U31A 1UMDA 1SBCA 3FHTA 1OTXA 5JASA 3AUYA 4GZ5A 2PQ6A 4JC5A 3ZDFA 5LUAA 4QM6A 2V4ZA 4S1VA 1UODA 3SSMA 1QZXA 1LKZA 3RYTC 5JU6A 2WU3A 3NBZC 2ZBDA 5HIAA 1FYDA 2WSLA 5B3KA 2OQ2A 2R00A 1DBWA 2XCUA 1T36A 1PL0A 1F8XA 4REOA 3CLTC 2EHDA 1KETA 4C2TA 2ZRLA 3LLVA 1TIPA 3UHFA 4WLOA 2VDQB 3T7SA 3NAZA 4OREX 4AWXA 2PMWB 2JJ1A 4R68A 4OSEA 3WYDA 1D04A 1KWGA 1KR5A 3EPKA 4I14A 5DHAA 1M1NA 2M1XA 1O6GA 4PAOA 1MABB 3GDFA 3MRXA 4IV0A 3OU7A 1OBCA 2PN1A 3RC9A 1C7QA 1TU3A 4JBXA 1JL3A 4C78A 1EGAA 3CBGA 3GAAA 3IIMA 4BFTA 3T5PA 4KQWA 3LUAA 4WN9A 3V55A 3VFDA 1EDOA 3QVTA 3GGGA 1VGQA 5DK4A 4ZT5A 1QFMA 3VO2A 1H5NA 3LUBA 4EAAA 2IOQA 3HKBA 4QBGB 4NCIA 1QCYA 2P9FA 2JIZD 3NXKA 3RSZA 4N0QA 3O93A 1IAVA 2EX1A 3L1UA 1C29B 4U7WA 2ZVDA 3IDAA 1CJCA 3STYA 3EDYA 3OCXA 1AHPA 1TNDA 1JDJA 2Z5LA 1ZNXA 1DADA 4V0MA 2J6CA 2Q41A 4CHGA 1MEOA 1FUEA 2WWHA 1SOUA 3PFCA 1V0JA 3UC5A 3BKXA 1T26A 2ATCA 2ZJYA 1O3YA 1XZDA 2PYDA 3EA0A 3K0EA 2CMDA 2V59A 3OOHA 4IXMA 1KY5A 2HMUA 3GDGA 4MP3A 3VAYA 4BB9A 2JC3A 4QRHA 3BKWA 3A7DA 4FOLA 2AOUB 2VCEA 4L4YA 3UMVA 2B35A 1DV1A 1X8LA 1M1YE 3KYDB 3PXCX 4A0QA 5BUCA 2A2ZA 5AVUA 1KPHA 1O94A 3MGAA 1Z5VA 4ZV7A 5I5GA 2AK3A 4DR4B 1DRJA 5D87A 2FUG1 3UT6A 4LVCA 3WB2A 2FQQA 3I6MA 3MJHA 4BBAA 3R9XB 2ZSHA 4XLTA 1LTHR 2B8JA 3KKNA 1WBJB 4NEQA 1GXSA 1Z0AA 1JSCA 2RHCA 3GJTA 1JHOA 2FPOA 1T25A 3CLKA 4JVNA 4TLEA 4UQPA 3OJLA 2BGUA 1R9JA 2G36A 1VIYA 4RD1A 1W4CA 4G0VA 4HN9A 2BGWA 3KOWA 4K6CA 1PT9A 1XUOA 1YZYA 3DMGA 1ISRA 1B8NA 2HIMA 1R6UA 3AFGA 3F96A 3G59A 3LC1O 3SMQA 3SS9X 1HT0A 1T2VA 3D9QX 2D0DA 3HUDA 2POQX 3DTNA 1Q0TA 5HE8A 5FUYA 1CUWA 1A2QA 1DAMA 3KE9A 3HBAA 5C37A 1ZM7A 2GBIA 2VOJA 2IBSA 1FVOA 1KIMA 2ZIVB 3D54D 1MC4A 4PIVA 4UJ3A 1QP8A 2NU6A 1KQFA 1FS6A 1H23A 2FK8A 3AGQA 4Q7MB 3WQQA 4LE2A 1QYCA 1L5VA 4ICIA 2Q0HA 3D2BA 3DM5A 3ZJYA 5GZ6A 1U3FA 5K0SA 5AOAA 4ZCQA 4DSAA 4KWIA 4CQNA 5C8DA 1R37A 2D4AA 3DMRA 3TQSA 1KEWA 3AM5A 5BYKA 1POWA 3EPRA 3IBSA 5KDLA 3U19A 4OLBA 5MN5A 1S8NA 2Q46A 3GT3A 1CSEE 1ZEMA 2BMEA 3NTQA 1I2BA 3HXPA 2VHZA 3C3DA 1OU4A 4G5RA 4M1TA 4TKUB 1FMLA 5IJ0B 3QE3A 5DBEX 4A0FA 5GV8A 4OBEA 2P7IA 1SUBA 5GGXA 5K3DA 4WZBE 3HFJA 1QB7A 1XXHB 2YX1A 5I7VA 5ARCA 3IUJA 4PAGA 1UK6A 1MEEA 4LOAA 3ODPA 4BBZA 3H1TA 3G2KA 4MKHA 4DT1B 3G9ZA 1IPHA 5T3YA 4K9QA 5AMXA 5FA8A 2HSDA 5DASA 3DE3X 3R0VA 4NJMA 3K53A 3Q87B 1DI0A 1U1IA 1KRHA 2JHCA 1ENYA 3O8QB 1FFYA 1EKXA 5JZMA 3M6UA 2DTDA 2V4MA 2P2LA 4HZGA 5G0WA 4Q3BA 4QQKA 1PZXA 1T0JB 2CKMA 2QTCA 2A9KA 2ZFUA 3CPJB 3A6EA 2NADA 3T7EA 1DSSG 3IXMA 3SG0A 2WAXA 1BRMA 1XTBA 4ZV4A 1O87A 2IVFA 3LQKA 4W9RA 4YMSA 5T41A 4FE4A 2VL7A 1H4VB 5EJ7A 3H4TA 1IEQA 1RI4A 4LRUA 2OG2A 5BUQA 4CETA 5JWHA 3LOPA 1NVWQ 1UC5B 2GLTA 4ND2A 1N92A 3R7SA 4DQ0A 2O0MA 3WNBA 1E0SA 3QVWA 1VE7A 2XODA 3SJBA 5CFLA 3NJRA 4TL8A 3W1WA 1ZXXA 1YFLA 3ZIAD 1CB0A 4BO9A 2JCSA 1OXSC 3AESB 2I7CA 3PDJA 4B7UA 3L84A 4WINA 2QTWB 3NHSA 3NYWA 1GNLA 4MVYA 5CVCA 5FO1A 5BSUA 2Y6UA 2JF0A 3DB1A 5CHEA 2IZZA 4QDXA 4DIMA 1ESDA 5K8JB 2GHIA 1DG9A 4IDPA 4A1OA 3FAZA 4ETNA 3KQLA 3KR0A 1I3MA 1FQWA 1MIHA 1ZRNA 1A4UA 2VDVE 1F2TB 1FLAA 1JXOA 3GVCA 4FFBB 4IFIA 2B30A 1HZZC 3EXHC 4NNOA 4URZR 2XNDD 4YRBA 5HRCA 2A5DA 4RMIA 3E58A 3OHPA 5FYQA 3TPCA 4ZO9A 1WAMA 3IMKA 4YJFA 4YN3A 4EHAA 5EHNA 3GH1A 1XVAA 4HFMA 4YRLA 1Z7EA 1AGYA 1AM4D 3QVVA 2BZ1A 3BK7A 3C4VA 1ZGHA 3RC3A 3VR4H 1UCFA 1XCGB 3C7KA 5AW7A 2HA6A 2C7QA 2Y1GA 3WG9A 3NWOA 1A9PA 4DCVA 3MVEA 3PE6A 4IZIA 1VIAA 3BPSA 4E22A 4RTNA 3Q98A 1L7MA 4B3HA 3QXSA 1OX5A 5TQ2B 1CQWA 2H4ZA 3IQZA 1TUEA 2VR1A 1HE3A 1ULAA 3TIFA 3OQ1A 5ED4A 2XGJA 4P2BA 4J0IA 2ORVA 5JAIA 3TL6A 1X7ZA 4NYIQ 3HR7A 4FB4A 4LS3A 1WWKA 5T4BA 1MC5A 3SJUA 2CYCA 5JZBA 1T5DX 5K6AA 5F9MA 5H7XA 2YDXA 2JH3A 5AKGA 2CNKA 3Q11A 4KZKA 4OOFA 3L1JA 1OBOA 3E5RA 2LXNA 2WU1A 1YMQA 2ORYA 2VHQA 4CIBA 2CNBA 4ZQGA 2JFWA 4L0MA 1KDYA 5JEDA 3L5KA 3WRYA 1AF7A 1TPZA 3TAXA 3WNCA 2OC4A 3P4UA 2QTFA 2XADA 1NW7A 1R00A 1Z06A 2BLLA 3LK6A 4K0RA 4QFCA 3NC0C 4Z9FA 2WYUA 3AY3A 4R5HA 1XCOA 1J33A 3X2EA 4Q39A 4HNAA 3UW3A 4K8RB 3ZOKA 3QUAA 1GQYA 2F48A 3P9KA 4MV4A 4TS3A 1V2GA 2NVWA 4QEKA 5BQFA 5CNJA 5ANRB 4OHMA 5F73A 1V3TA 3OETA 2HU2A 3OFSA 3FCOA 4Q3OA 4LK2A 2WHPB 3A2KA 1YZTA 4LOLA 3PXBA 2IJGX 2YWJA 4C5BA 4GWGA 3N2EA 1VE1A 1SK8A 1IE3A 3D31A 2BRUA 3O91A 4EHKA 5ICCA 4G81A 5KNBA 1SR8A 3LNTA 4YRSA 1NLZA 1W88A 2RAVA 4D4MA 3NVDA 1RYDA 1DJLA 1UFOA 4ROSA 1TM4E 1W85A 3QF4B 3EGOA 4KQKA 5TX7A 3VPBA 2GAIA 2XF8A 4M9CA 3RFUA 2TRSB 4I8XA 3T7IA 3F6PA 1IQUA 1NW9B 3DLCA 3LPDA 4ENPA 3DPSA 3M6VA 3IVXA 3R0JA 1KVQA 3IB3A 2O6LA 3MUOA 4NH0A 1P62B 4OK5A 4CKBB 2BBTA 1I01A 2WHXA 1LBSA 5H3CA 3C7DB 2QD2A 5EXDA 1C5KA 5T8KA 4CKCB 1N0WA 3DCNA 1UP7A 4HDRB 4HRVA 4PSKA 4WZZA 4HWKA 4UD6A 5JDCC 3T1YB 2IYXA 3R4VA 1RWPA 2ZOSA 3U16A 4DCUA 4ZI7F 1VKOA 1YZQA 3B3GA 5K6TA 5IAGA 4WUTA 1CUCA 2ZPUA 3PWSA 1Q19A 2PJZA 3LVRE 3TL3A 4B76A 4NYMR 3MTIA 5DEIA 2PMEA 3SLRA 1AV6A 4DLUA 1WSBA 2VNIA 5CLJA 2FSVC 2ZROA 1R5BA 4WXMA 1G3MA 4K7JA 3UG7A 4DOMA 1QS0A 3ESZA 2YJTD 1OFTA 4NZYA 3OCUA 1WCV1 2HLPA 4KN6A 1Q3KA 4AWAA 2C7OA 1KBZA 3O83A 4ZCTA 4OQFA 1W7AA 4JR2A 4K2AA 1EZZA 4OQ4A 5G4LA 4AS1A 1P0FA 1XMOB 4XJTA 5T7BA 3IB6A 1DU4A 3N8DA 5K45A 4LGCA 2OQVA 2R8ZA 5K2MA 4M9XA 4B2YA 4C20A 4GZMA 3LDAA 1OB2A 1ZMBA 4UBNA 1XXHE 2IIPA 1S3SA 3PUWA 4PCLA 3DHEA 4N4AA 1Q7TA 1T24A 3AF6A 1BWPA 2ZBEA 2C4NA 3Q7IA 4A5OA 3GYGA 3VTZA 2O8DA 4JBIA 1P18A 3I83A 1A7KA 3B1YA 4L51A 3H5NA 3KX2A 1J56A 3JVVA 1DP4A 1K06A 3NIFB 4F38A 1UKEA 2D8AA 4J9VA 1UK8A 4GWKA 2AHRA 1BA2A 2H85A 1H6DA 2ZBGA 2QD3A 3IE0A 3P9XA 4TXNA 5KU7A 2V0NA 2VUTA 2MR6A 2P2YA 3RK0A 4J6FA 4B7CA 1FVXA 2Y66A 1PG2A 3I64A 3TSCA 4YC7A 1GPBA 1KJNA 3MAGA 2R7KA 3N2ZB 5DM60 5ENZA 1FFCA 2XUKA 1NDUA 3E05A 3CR7A 4KXUA 4B2LA 2GN1A 5HRAA 4R7ZA 1U2SA 1ESMA 1OTYA 3HA2A 1MW8X 2HU8A 2A9QA 4U7FA 3EAQA 2BLNA 3GLKA 4I4TF 2GRJA 2PUDA 4Z4CA 3DYIA 3WL8A 1ID1A 4EKIA 1UWCA 1RE0A 5GGYA 2WG0A 3ESRA 3CY6A 4E14A 1O0BA 4H1VA 3THWB 3AFMA 1TX4B 1VL1A 2NZYA 3MINB 4M49A 1ETUA 1FU4A 2QRVA 4I1PA 3NHPA 5A3VA 1N5KA 4JKOA 2Z4SA 1P6QA 4DA4A 2FFAA 1GPDG 1NVVQ 1IZZA 2C95A 1S8FA 1EZ1A 4NBUA 1K8ZB 1CNFA 5FBKA 3ZHVA 4C7MA 3P71T 3WRWA 4PZ9A 1DPFA 1P7CA 2DHQA 5B3LA 1WQ3A 1GR1A 4TYMA 4WDQA 3ZNOA 4O4IF 1OBVA 2GAFA 3ZTTA 3D8SA 4COKA 4A6EA 1XAIA 3TW0A 2IYEA 1CE8A 3AFNA 3C7CB 3F6RA 4GAEA 5HFAA 3W8EA 1RJEA 1WG8A 5BQPA 4C21A 2NTNA 2YIVX 2OGZA 3DV2A 3MMPA 3PDUA 3D5QA 4Q9HA 2ZJ8A 1HUQA 3G2MA 4FIDA 4EGFA 2WT4A 1C4OA 4GSKA 2B2CA 3L05A 4G4SP 4A6XA 1I6MA 3FVRA 4R69A 2WYIA 3HB4X 3NTRA 3JCZA 1G17A 4FD2A 3RU2A 4CMHA 5IM4A 4DR2B 4OK3A 2GM5A 4LYEA 3OIDA 3JYLA 5TPZD 4CKXA 3BWCA 2X76A 1E3JA 3GEMA 2CNWD 3SE7A 3W9BA 2K6GA 2ID4A 4HV4A 3GNTA 4WCDA 3KM0A 3RYIB 1SUEA 1XTPA 4C7JA 5EJ2A 2GJAA 3BERA 4AJ1A 5JUWA 3AEKA 2YWEA 4WVLA 1ABFA 2A7QA 2VPIA 2F1OA 2PU7A 3A11A 5D2CA 3UJ8A 5GJVC 1KDTA 1B0PA 4MCIA 1D5WA 2BJHA 4M53A 1DEAA 2J5QA 1FMJA 2OL4A 5TPWB 2PLNA 2PL5A 3I2HA 2OHGA 5EJ9A 2O7SA 4GYYA 4WY8A 3HLTA 1L7OA 5CFOA 1QG0A 4C89A 1THMA 2BKLA 1XZJA 2GARA 2JGEA 1V39A 3TNFA 1EEHA 2L42A 1VP3A 1VXRA 4KPYA 1T9CA 3FFXA 1HH4A 4ZPXA 3W8DA 1IHDA 5BNWA 1WPRA 1RQXA 1H3FA 4LNAA 1U8CB 2PEZA 4PN7A 1EFVB 1YRHA 1BAPA 4E5SA 5DHUA 5FUVA 3AL0C 3EDRA 2XOKD 1N8NA 2Z2XA 3IQXA 1MQAA 4P4TA 3STUA 3UATA 4R6WA 4C06A 1ZGGA 4PCVA 5IN5A 3V8PA 1ONOA 1WDLA 1OXMA 1GO2A 1EINA 2J07A 1MC8A 2EIHA 4UU0A 3RUHA 1T2FA 2HC9A 1GPWB 4B6OA 3ASZA 3TE6A 2WDZA 4RSRA 3DFFA 3FYHA 2DFPA 3FRHA 5P8WA 5B37A 4AXBA 1ODJA 2UAGA 2OWDA 5IH7A 4P32A 1MDFA 4GP6A 4WEOA 3UTCA 2ZIXA 4QGHA 1LCIA 3I34X 1M9NA 3FFWA 4BFLA 1T43A 5JNRA 1G8FA 1F38A 4MK4A 2Y76A 3EGIA 2N0SA 1CZUA 2ZJ7A 2FPSA 2IIBA 1SXJE 3SMVA 3DYBA 2VT7A 1ZM3A 3KPVA 3REOA 3OT4A 3KTFA 4FN5A 4RTKA 2PDAA 2X0RA 4GH5A 2DQ4A 1Y9DA 2V7UA 2CLHB 3ADPA 1AKTA 4ND6A 3EBPA 4RIHA 4JLJA 5JATA 2IH4A 2RGXA 5AIBA 3ZHOA 3R9WA 2IYNA 1IJEA 3SHFA 3VDQA 1SCIA 2VQFB 1I8TA 3WYFA 1F60A 4ZVQA 4CM3A 1SG0A 1T13A 4E15A 4IIJF 5IZCC 2ZSBA 4CI0B 4C6TB 3NI2A 3VA7A 2ZUBA 2QRMA 1SHJA 3PQ6A 4WESA 4WUVA 4YCJA 2C4WA 3OZEA 4HOYA 5FNVF 3S27A 4D9JA 3HR4A 1ISGA 4GVPA 2AMYA 4GMFA 2DHEA 4RC9A 2C4VA 1T8PA 3CX6A 2B7LA 2O3JA 4EMSA 2EC5A 3FHLA 1V1MA 1ZSVA 2C2OA 3ZKWA 4B3JA 4RK4A 1H6BA 4NZ9A 4ALMA 2BV3A 2AC4A 4JA0A 4DNFA 3TKAA 1QH8B 3VAAA 2N75A 1YK1A 2EERA 5EJGA 1RQPA 3BMQA 4PYLA 2N1MA 5K0FA 3RLIA 3L0YA 4D9MA 3CF6R 3IP6A 3A2NA 3U40A 4NECA 2QW8A 4BS9A 1PJAA 4K6FA 2OZVA 4X66B 4BN4A 5CAEB 4ENVA 1G8YA 2CUTA 1R4MA 1SA0A 4MJLA 2V6GA 5JD4A 1FOEB 3DVSX 4BMVA 1YR3A 2P0AA 3NGXA 1D2GA 2HT1A 2QDXA 1X14A 1ILWA 2HHJA 3KQHA 4O3MA 2YHSA 3V8RA 4Q7LA 2YINC 3INGA 1OREA 4R8MA 4YY3B 4JL6A 3O7WA 1KTIA 4UJ5A 1R15A 4BGEA 3B6IA 2W93A 1XDBA 3GXOA 1E9BA 4AW9A 3AB7A 1N33B 4O5AA 4P3KA 2DBVO 3WQBA 1BEUB 3MWYW 3R6TA 1M7HA 1HDIA 1KH3A 1DFIA 3O38A 3W4JA 1UMKA 1Z12A 3HCPA 5DB4A 4DADA 4PTYA 2VBFA 1JYFA 2ZTHA 1P2FA 3DMNA 3E7WA 3FTDA 4ND7A 1UZAA 4RGYA 5KTKA 2FJUA 1OC2A 2W2TA 2OHJA 4AZSA 4XD7A 1LRJA 3OZIA 2PCJA 3D3WA 4BE7B 1ECCA 3COPA 4GR4A 2ONKA 1C8VB 1E5XA 3HYCA 1MO6A 1V96A 2JI7A 4UEWA 4UCFA 5COBA 3WIDA 1NBMD 3LQRA 4DLYA 4QU8A 1Q1NA 5PNTA 1EWTA 4WXHA 4ZXPA 4D96A 1Q20A 1RRMA 2XKAA 5DHSA 1LLCA 4AG5A 1HYEA 2I22A 2OK8A 3VYTB 3WA6A 2V1UA 3KG2A 1DAKA 3AFIA 1IM2A 3IPAA 3TM5A 1SHKA 5K7SA 1U8AA 1TK2A 3H2HA 4GBJA 2W70A 3S2IA 5BR8B 4JXXA 1PD0A 1DTEA 3ZPXA 2HWXA 3MXTA 5FUBA 9ATCA 5CT9A 4OQQA 1GTZA 4E70A 4Z9XA 4UTRA 3NCHA 3U17A 2BZ0A 2GYUA 3WS7A 3RYCA 1SVWA 2P9JA 3OI7A 1LSJA 3SSOA 2CHGA 4BNFA 2AXNA 3IKVA 3IQEA 1JWAB 3LVFO 4RV9A 2IY8A 1CR2A 1NR1A 2JFYA 1RR6A 2J9FA 2UYYA 2PSEA 4NZNA 4S1WA 3H2JA 5E95A 5I7AA 1KQNA 3S28A 4QUIA 3W3ZB 3A7EA 3TECE 2MYNA 2PXAA 3RROA 1FXWA 2ASEA 2O6HA 4FFWA 4IIFA 2C3YA 3M9XA 4UNQA 2V1XA 3EK2A 3OIVA 1CY8A 2GYVA 4TLLB 4P7FA 4B8ZA 5I8ZA 2VAVA 1DOHA 1J1UA 4HAZA 2H8GA 1SU4A 3R3VA 1ES9A 4PC7A 1PEAA 2JVKA 2WG1A 5K51A 1A1SA 1IM8A 1THGA 1Z5ZA 1H2YA 2XR1A 1FTYA 4LHSA 4TTRA 4TT3A 4L4SA 1PR6A 1VJ1A 5TMDA 3ZHSA 4BE9A 3DEZA 2JD2A 2A9JA 5JYBA 5KNLA 1YNOA 3PTZA 1WB4A 4D8YA 3IDOA 3T0GA 2XT0A 1KYIA 5EJFA 3AOGA 3N05A 2K4MA 4FCVA 3U9LA 3ZY6A 4MOWA 2BMDA 1Z62A 4TWZA 4FGZA 5ADWA 4PPFA 1KI1A 3VOSA 1X1EA 1IXRC 1RZ3A 2CNLA 2ZSKA 1HC7A 3BXEA 3LUHA 4JT2A 3KYCB 5ALDA 2HQSA 3VMMA 3ZLJA 2PHZA 1HEYA 2UZ3A 5ESRA 3F8SA 1G6HA 4LMBA 3IOBA 2LKCA 3E9RA 5AQ1A 3GAMA 2GN6A 3WHIA 4OA5A 3BFXA 2CXNA 3D2CA 3N58A 1JJAA 1G3QA 5CTAA 2YHAA 3HVUA 4RHXA 3CEPB 3H6GA 3MSCA 1F7VA 1IB6A 2A8YA 2ECPA 2R8RA 3FI9A 1T9BA 4B5KA 3VNSA 4EF4A 4LSWA 2J46A 3IJ5A 5AM2A 1DE0A 3G79A 2ZYHA 4NU8X 3TZQA 1YMVA 4XCXA 3JRWA 3UQZA 3DV0B 2IV3A 5E6RB 5B7QA 2V4UA 2I2CA 1LNSA 4HH3C 4ZTZB 4HB3A 2OHIA 4QQRA 2EW8A 3DD5A 3ZHXA 1TFRA 4XVRA 2MIIA 1F1JA 4P3XA 3NT4A 4QOHA 5AK3A 5ALOA 1E8NA 1U5AA 4TKVA 5LQCA 2X9NA 3DGEC 2I33A 3DOIA 2Z58A 5CB8A 2IPAB 4F4IA 3NLLA 2X5NA 4CEHB 2BGMA 2ECOA 4QTUB 1ADBA 4TV9A 4Z51A 1DWQA 3MQ4A 3ZOZA 1EGHA 3FWPA 1RWKA 3R3UA 1EM6A 4MPTA 3T7CA 3ZHYA 1XMQB 3HJHA 3CVWA 1L1EA 2AVNA 3QEOA 3G7UA 5AM1A 5A3SA 4RPIA 2O8FB 5JAMA 5LJIA 4DLRA 4EY6A 3MOIA 4GPIB 1SH7A 1KVTA 1Z2NX 2EP7A 1H5UA 2O1SA 3I01A 3NC4A 3CUYA 1Y1PA 4I6GA 4N5DA 4CL8A 5I9IA 1F8YA 1JDVA 1P8JA 2AZTA 1YOVB 2VHUA 1O94D 5AKZA 4OHYA 4PQGA 2A9RA 4KIUA 3VHXB 1EFRA 3KBOA 1LLFA 2H2IA 3QOFA 1L5LA 3TLKA 2BH2A 3GMDA 4KV9A 1SQSA 3KQTA 1ZVKA 3O7MA 4FU0A 4YPFA 3SAJA 1EUCA 1T6NA 2X86A 3WFJA 4A2CA 5DLEA 5AVSA 3PPIA 3QG1A 3ZD7A 3L4SO 4DNQA 2IEIA 3ZDCA 2PBRA 4DDKA 5KJ1A 1DNPA 4C0KA 5KWJA 2OKGA 2AQ8A 2GZMA 4K8OA 4DILA 4DNPA 3FD8A 5KX5B 3FTNA 1JQAA 1O0SA 4PX5A 2RH8A 1G4UR 4AULA 3DONA 1LTQA 2R1UA 2Q2VA 4MKFA 4E7PA 1N0VC 2QX6A 3W6UA 5J4KA 4ARSA 1BX0A 2P67A 2W71A 4TM7A 1ID8A 1PZGA 3JR7A 1Z37A 2I7XA 2IU4A 3QVLA 3IVAA 1M67A 1Q0ZA 1T4MA 1T8UA 1CFZA 2I8AA 4KX3A 3AHFA 3PYXA 4AKTA 4W6ZA 4DANA 2AC7A 2QY9A 3IOYA 4Z5XA 3UGJA 2PLFA 3JTMA 3LKDA 3QUCA 2O0HA 4M21A 2JB9A 5KO2A 3G8BA 4WNIA 1HQDA 3VVLA 1JDUA 4CQMA 2L2QA 5EJIA 2Y6VA 1CK4A 3SFZA 4E2YA 2OHVA 1XBTA 5JHGB 1FDOA 1UBGA 4UTOA 4I1SA 2JK1A 3DR5A 4TRMA 5BQOA 3HZHA 4Y0NA 3QM1A 4GGPA 1XRRA 1BX3A 2AXPA 4JXJA 5GM1A 5TR9A 3VUEA 4D0LB 4CTMA 5K6RA 4H27A 1QANA 1ULBA 2WZCA 5L4SA 1SUIA 4KAFA 1FP4B 2ZANA 2WICA 2BZSA 3BYZA 3F3KA 5ERYA 4E0BA 2J4CA 2Q21A 5C4IA 3WNVA 4AFNA 4E12A 2GCPA 1E2GA 3WK7A 2G5TA 2FW9A 2QNRA 1AGNA 3IODA 4P84A 4RW0A 4XYEA 2JHPA 1ZI6A 2C4HA 3IUBA 5TJ9A 1QWSA 2H8KA 2YASA 3H84A 4R31A 5JMWA 3BD8A 3FYUC 4X00A 4N76A 3UPUA 2ENUA 2WP0A 3Q4GA 4DIDA 5AUPB 5IAJA 2AFRA 3MLBA 3TNYA 2RK6A 4JYPA 3GRVA 4PYRA 2IIVA 2GZ2A 5DTJA 3ROQA 1WPXA 1GG5A 2WNIA 3RS5A 4AYTA 3QWHA 4EUEA 4B7XA 4BLUA 1XTJA 3KYBA 3WNDA 1WNTA 5E2IA 3SFTA 3UO8B 1D0IA 4KXYA 1JIVA 2QTLA 3Q3JB 4GL2A 5DEOA 1GZ6A 2JGNA 3ZQ4A 1JAYA 2XYRA 4ONEA 1OAKA 2F1JA 4F91B 1J8FA 4PNPA 5J2UB 1S2DA 3KCNA 4WNAA 4LGYA 4XIGS 4PQFA 2FFHA 2AQHA 3EZXA 1W76A 2WKPA 1ZAYA 2JJYA 1KMCA 1C1YA 2Y0DA 4ZYZA 2VDUE 1X2EA 2P4HX 1MMFB 4UW9A 4AJIA 1NATA 1X7YA 3W6OA 1KQOA 3U4DA 1QRUA 1U0FA 2YXDA 4QYIA 6YASA 3QVMA 3KQOA 1JG6A 4JUCA 3UWPA 5TQ0A 2CV1A 1KBOA 2PL9A 1XVVA 2VWPA 5BYJA 4B8WA 1HLGA 5IG2A 1HLPA 2W0SA 5AHRA 5JCZA 1F2UB 1T1GA 3FWHA 4MVJA 5B64A 1N25A 4ITRC 4FFDA 1V4NA 1H94A 4GD3Q 1PNQA 4Q1BA 4ITUA 3SYLA 2BEVB 4TTJA 1UKCA 2GNAA 2QTNA 2UVPB 3VR1A 5CK5A 3TGWA 4CYMA 3CV3A 3GGPA 3ADKA 3QJYA 1QIDA 4ER6A 1GSAA 4L2IA 1JEEA 1OVGA 4PAWA 1GDDA 5IC5A 4J49A 4BO6A 4QEDA 1WHTB 4YAIA 4AYXA 2AXQA 4P93A 5ALHA 3NH9A 3KSDO 1P2SA 1JX6A 3FPHA 5AKIA 3CPHA 4LVUA 1VRVA 1XF9A 3SXUB 3WGOA 1MT0A 4ALLA 1P2UA 1YDGA 5JZVA 3VZDA 2FPWA 2RJ3A 2ZDHA 4MWSA 2WUWE 2PUJA 5C32A 4XWTA 2P5UA 2F4NA 1FPMA 4IGKA 1KZYC 3VNRA 1E4EA 2A67A 1Q7BA 1SGWA 4J1NA 4WOPA 1A04A 1SHUX 3NKLA 1A8PA 1NP3A 3SHOA 2WAAA 5I4IA 3DAGA 5CNIA 5BQXA 5DF1A 1B00A 1FTGA 2FGKA 2OV6A 3GLHA 1AHIA 4XM1A 4O8CA 5KVAA 5E2BA 4O0MA 3LSTA 1AOXA 1JJIA 3SEAA 3HKEA 4MO2A 5M29A 5DIFA 4XDYA 4FDLA 2Z8YA 1N7IA 1SG9A 5GP1A 4ZK6A 1H2WA 1QCCA 2PS3A 2G5PA 3QSGA 2B20A 4NX2A 3ZHTA 3PE3A 1VQ1A 1Z4LA 1HE8B 2J67A 2XXJA 3S99A 5LU9A 3NVKI 4OI4A 2OM6A 3P27A 3W2FA 3RKSA 2PXXA 4PHCA 4JHLA 1BHSA 1GU0A 2Z9DA 3BD7A 3OSZA 3B3FA 3PS9A 1GAJA 3PA8A 4TUYB 4ZYYA 3DNMA 3ANXA 4DPKA 2FA9A 4RIGA 2G9NA 4FWTA 1W5SA 3BORA 3OQVA 3OO0A 1DLIA 1Z8HA 2R48A 4ZOLF 5KSZA 4GMDA 1R8JA 1G7TA 3AV3A 5F2OA 4F9GA 1L7BA 3BB4A 2ONZA 3JSXA 1R9GA 3CUWA 4QG7A 3TCXB 3TFWA 3H5AA 4CODB 5MFPA 1RLJA 1ULSA 3KZVA 5ECDA 2H1OA 4DC0A 1DEKA 2XTAA 1L4NA 2CLOB 3KJIA 4ZQHA 3EXHB 4KLNA 3JAKA 1QGYA 3ROXA 4GECA 4LQCA 1Z4KA 1GSOA 2AX3A 1YDFA 2O3QA 3JQFA 3ZQUA 4OYYA 5U4QA 1BWRA 2HBYA 4TL6A 4EMTA 4Y2XA 2H1RA 4D74A 2X3UA 3FUTA 4S12A 2QQEA 4XIFA 3ROEA 4TKZA 3C8DA 1MV8A 2GBCA 3VV3A 5T67A 2OXCA 3VO1A 3D8BA 2ZR9A 3CLUD 1QGUA 5ARDA 5C5DA 1RPTA 4YACA 1JDNA 4LE0A 1JAHA 2ZRAA 4CDMA 3C6XA 1BW9A 4RMJA 5DSXA 5SYNA 3GYBA 3AUJB 4R83A 3BZBA 1FNNA 1UIRA 3LQFA 3MTBA 4YALA 3RVRA 1WUIS 1NONA 1UZLA 3TG2A 3DAOA 5AKKA 4XGIA 3UUFA 3DDOA 3GD5A 1NQVA 3QI7A 3EA4A 3A6DA 4R1LA 3ZIDA 1QRRA 2RI1A 1GTMA 1C4WA 3D3KA 4IGIA 3WB0A 1SUCA 4D97A 5ALXA 4UTPA 2PR2A 4V1CA 2ZJ6A 1LUAA 3V7FA 3V4LA 4BRUA 1O97D 1B2RA 2X8BA 4MH0R 2C98A 3WIVA 3C1AA 1ZU4A 3PGXA 4AURA 4EJSA 4JI0B 3EPPA 3J80A 3E8SA 2AE2A 4PPYA 2D5AA 2QMHA 4BV2A 4O2LA 4LRTB 1RM4A 3MHTA 1PKEA 2F1RA 5AVWA 1TM7E 2GI4A 1Q0HA 4XE5A 1HEUA 1RHUA 2GKSA 2QYOA 1A9SA 2WM2A 3PNVA 5TT1A 2HUPA 3VU3A 1U0OC 5FQNA 1A1VA 3FXAA 5DX8A 3ISJA 3W2IA 2IUYA 4C0LA 1BEZA 2FHPA 3KKOA 4TZKA 4DV4B 1N2XA 2GMWA 5KJCA 5AW3A 2Y1LA 1KI2A 2P3OA 1RWBA 2ERXA 3A2MA 3AH8A 3IBTA 3MAJA 1TOAA 4MIYA 3ZBUA 3ZR4B 5A4MS 4X71A 3ZHUA 2JFFA 3EYWA 4EI8A 1PJZA 4ARZA 2H2AA 3COJA 4PR0A 2H1LA 1GQ2A 5DM70 2V7WA 3B70A 1E2NA 4MI3A 3RG8A 4ASUA 3VO9A 4OP1A 1T9HA 2VPPA 2P3QA 3FB1A 1KH2A 1PFUA 2H51A 3MMNA 2MYPA 4GNRA 1ORRA 1WUJS 2YIMA 2FR8C 2X2FA 3UHAA 3C97A 2YVLA 3H5VA 3VAZA 4YRZA 1K7FB 1SXGA 4BLRA 1X7DA 5A3RA 1FLDA 1T34A 2QRZA 1DKLA 4W5NA 4NPHA 1PNRA 1JEYA 4E13A 3X1DA 4XWOA 5JBIA 3QG5A 4FJ1A 2AN3A 4KC0A 4JWKA 4B74A 1IRXA 4LFBB 2B83A 2IX3A 1JPUA 1S4QA 4E2XA 3FCCA 3I42A 5KTPA 3KQSA 3U7QB 4JT8A 1MQ8B 2HF2A 3BILA 3RPEA 4KPEC 1IHUA 2A84A 4JAVC 4M0KA 4KMOA 2QSYA 1S2GA 1G20B 4WCFA 3TEJA 2FZ4A 4MPDA 1CC1S 1NM5C 3D6TB 1HQKA 3EY4A 4XGRA 3I5MA 1G0NA 2R9VA 1OXKB 1Z4JA 4Q03A 5E1BA 1ODTC 5IK2A 2YZNA 4I55B 4Q3NA 4S35A 1BVYF 4OATA 3GNSA 2R7AA 4WZAA 4G56A 4DF3A 5K8VA 1Q0SA 3UANA 3LIIA 2Z4RA 5COAA 3RVBA 5IVHA 3UOAB 4UOEA 2D62A 4BZZA 3ON5A 2WNSA 4A8JA 4UPVA 2F3RA 2FPUA 1Z25A 2A9FA 2XWJI 4QSMA 3RAPR 1KFKB 1GQRA 1ABBA 2QM0A 2WJAA 3L7DA 2XE7A 4FKBA 4M9QA 2DBYA 2RGBA 1AA6A 2XDQB 4JT4A 3Q88A 1O9HA 4JBLA 4LJ7A 5F77A 3EIQA 1IPEA 1NR5A 3DJYA 4DSZA 2OFWA 1E2HA 2PD4A 4NG4A 3RIXA 1DT5A 3LP6A 4HYEA 1C7EA 2HDHA 1RPJA 1EIZA 4FE7A 4RFVA 5GOTA 1EVYA 3WLAA 1IY1A 1XDUA 2ZRIA 3HFRA 5JMPA 4BIMA 5JIBA 4FGWA 5EUBA 4FMDF 1HDGO 3AUTA 4O4LA 4O0LA 3I9MA 1Z4NA 4RVUA 1XKTA 4V0OA 3KR2A 3KFVA 5JXHA 1YVUA 4URVR 2EFJA 3FRIA 3G6KA 2R6GA 2Q0XA 4LZAA 1EP1B 2OZKA 4M9ZA 5FI3A 3FSRA 2JI8A 3M3DA 4X1KB 1TQ4A 4N5HX 1PHPA 2ZYVX 3P4YA 2P40A 4WV3A 3SBXA 4AMBA 3KR9A 4CMJA 5JECA 3E3AA 3VZQA 4CQJA 4DJFC 1RRCA 3U5TA 1RBQA 3MXOA 3TSYA 1A4XA 2ZULA 3C3JA 3C5VA 1RRKA 5BMVB 3EG9A 1H4SA 2JEOA 3BUSA 1FP7A 2QUJA 3OVMA 1NRXA 4L6AA 1RQLA 3PFWO 4P9NA 1PLJA 4LJLA 4OFBA 1E6WA 1QZTA 1D6SA 4EFMA 4E5KA 1UKZA 3JWEA 3S0JA 3CUTA 2JZNA 4MV7A 4O2AB 5EIFA 3ZWPA 5HUJA 2F90A 3MJTA 4EG3A 1E5QA 3G49A 1PK8A 2Y1FA 1F8FA 2CVPA 2JIRA 4F3NA 2R11A 1DBPA 3KJNA 1I4WA 2IXDA 1J7JA 3KOXA 2CVFA 3AOEC 5L3VA 3PK0A 3DBLA 2HTEA 3G5AA 3AR5A 2E6KA 1USGA 4HY3A 4DB2A 1E1CA 4WFQA 3UJAA 1B6SA 2B4TO 1S96A 1WSAA 4M7RA 4AN1A 1T5SA 1USVA 4FWBA 4RWZA 4IDEA 5EGNA 4CG0A 1NF8A 2HFJA 1P0MA 1DKQA 1H9AA 3PGJA 3WRXC 4G2NA 1OWOA 2ASVA 1D1TA 1ZBQA 4WNCA 3U56A 3R0IA 4DA0A 1NP6A 3E1KA 4DG9A 4OF4A 5GV7A 3S7TA 3CR3C 4NJEA 1MVOA 2IODA 3IEUA 4PRYA 4NC9A 3PKIA 4O4JA 4LJ9A 2WF5A 4LXHA 3NNDA 1PJ8A 3TTWA 1U8XX 1XQYA 1J0BA 1MAWA 2IU3A 5L3SB 5DMXA 4BVFA 1L4GA 2FPIA 5FPQA 2J3QA 2WMYA 2O3SA 3QEKA 4TL7A 4WX2B 1DTWA 5KOYA 3G0IA 2I3DA 4Z0PA 1T2CA 1TM3E 2YY5A 3JWIA 2AR0A 3TGLA 2P9HA 4IEIA 4I81A 5JQGA 2X1VA 4R2LA 4L3VA 1EFDN 1YU9A 3NTLA 4KFTA 2QN3A 1ZSYA 2IHBA 3CZCA 1BQ3A 3PENA 4ND3A 2IZOA 4YFYA 1H6AA 2CL5A 2NU8B 4KU4A 2C0PA 4ALIA 2F8SA 5DM1A 1ELOA 4KO4S 1HF3A 2FN4A 3ZE0B 3B6MA 1JHAA 3I1JA 5MN4A 1J7KA 3QE0A 4KQMA 2ALJA 2O0JA 4PLPA 2H0QA 2K2QB 4NK4A 3GRKA 5L7YA 3SNHA 4GIBA 5EHXA 1H9BA 3FE2A 2W37A 1W34A 1XZMA 4YJDA 1WV0A 5ITZA 4J4HA 3RUPA 1N5MA 4V0RA 3ZS9A 2VQSA 5B53A 4YUWA 3V9PA 3ZDBA 4P0QB 2VP3A 1XDSA 2W43A 4AZ0A 1I5EA 2R00C 5C5CA 2GSWA 3KSZO 1QHXA 1CRQA 3KYJB 3K6SA 4FSDA 5HW0A 2XCQA 2H07A 2HMVA 3E9ZA 1A77A 5AJTA 4NBNA 2W2NA 4DV6B 2QMZA 4MO9A 2VF4X 3WLSA 1TTTA 2YMQA 1TTHA 4PG4A 1UBTS 1ZNQO 2QZSA 4Y3UA 4D26A 4W99A 1BGWA 2CDCA 2AJBA 5K4GA 1WL8A 2RARA 4IWYA 1UP4A 3ILHA 5CVUA 4BNIA 3EXG2 2FMHA 2HJSA 1XRPA 2J32A 4ZEMA 3MQFA 4WFIA 3NMUF 1FXUA 1L4LA 3NAGA 1YH3A 3KETA 1O0CA 1NSFA 2X2PA 3QRWA 1UWKA 3LFHA 4QXMA 2YZ2A 4HAOA 4PINA 4YGXB 3WV4A 1EK0A 2HPHA 2HZ7A 3VRHA 3BFJA 1CX9B 1KI6B 2RGGA 3KSUA 4GX0A 1VL6A 3GGSA 2B69A 4GWLA 1QE5A 4EF6A 3WFIA 4GMGA 2O7QA 2WZQA 1ECBA 2HDOA 3SQNA 4HEQA 1CUEA 2ISCA 3KTOA 1AHHA 5JXWA 4RIIA 1JYSA 3RT9A 4OHCA 3AVYA 1SOWA 1YJQA 4RBNA 2G80A 2IYSA 2ONYA 4P53A 4PLYA 2WSBA 1KE2A 1Y6JA 2I4LA 4H9GA 5ITVA 4N5LA 3OIYA 1VLQA 2WTXA 4F97A 4ZAFA 1IDOA 4BO3A 1TQDA 1GNSA 1G20E 4Y1GA 4PG6A 4CTKA 1PKXA 4A16A 2ZT7A 1EFPA 1MLDA 5LWQA 4B0OA 4E5NA 4NYMQ 5AHWA 1BH2A 2PA3A 2UV8A 3KZCA 1CF2O 1YB7A 2HF8A 2FWPA 1GGJA 1M1YA 3HCEA 4U2BA 5AM5A 1VJCA 2N47A 4DQDA 3SN6A 3KLOA 4NENB 3KZOA 3HCRA 2BKAA 4R7GA 2OCXA 1NUQA 1Z9BA 2OUKA 1Q0RA 3ZGYA 2HCTA 4HQRA 1W94A 4NNJA 4X8MA 3SM9A 3QVSA 2CSXA 1QGDA 2FWNA 4IJUA 2XZDA 3ME5A 3WWCA 3B1XA 3LTNC 3MTAA 3HXMA 1CERA 3QFSA 1KZ4A 5A3JA 1NW4A 1B43A 1JQDA 3L92A 3FKJA 4FCWA 2DULA 5FD8A 2XUAA 5A0VA 1QF9A 1Q77A 3HCCA 3N86A 4BP1A 4Q7EA 4GQAA 4R51A 4RH3A 2CC2A 4BPRA 4Z4QA 1IY0A 1A7JA 3JV7A 3OOYA 3ZH2A 4ZCRA 3RCBA 1LVHA 3TM4A 3GLFB 1G5PA 3D6UA 2QPAA 4Z4GA 1Z5NA 5LP1A 3NATA 2Q9UA 2B1RA 1KJWA 2CUNA 3FR8A 2VZ8A 3MT0A 2XA2A 1M3SA 5AIAA 5SY6A 1NC1A 4LXQA 4NBWA 3EZ6A 1T4CA 4FM9A 4MV3A 4YAJA 3QFCA 3AIKA 2A14A 1MH9A 2I2XB 3DTYA 1BMFA 2DCMA 2IELA 1E9FA 1COZA 2QUIA 3EUFA 3N2IA 5JE8A 4F4HA 1MB9A 4K1LA 4RU1A 3LUPA 4B34A 2VJMB 4ZTBA 1RW4A 2PIAA 4H6XA 5EERA 1GR0A 1KJJA 3F3MA 3DP7A 5BN4A 4D9KA 3OICA 3MNFA 1KU6A 1X92A 4IQFA 5AJZA 3Q7PA 5FOWA 3LSYA 1QYWA 3OQPA 4TTVA 3IVRA 4E1BA 3VNAA 2E4XA 1UBNA 3WLOA 4MV8A 1KDOA 1C4KA 1OLSB 3RS4A 2W98A 3A04A 4TVBA 3TX2A 8ATCA 3NR2A 4ZVMA 3ZY5A 5K3OA 4QJ4A 5H16A 1PFQA 3E18A 1X42A 3GXBA 3ZWYA 5FFMA 3BMOA 3KHTA 4WZBA 3K2EA 4WK6A 4W82A 2QPLA 4WLFA 2YRXA 4P7JA 4A03A 4OHPA 1PJLA 2CDNA 4URFA 4GMHA 4IZOA 2LCIA 2DSNA 1PNVA 2FSHA 4MI9A 1WCXA 1P39A 1L8OA 5IEBA 4YRTA 4QBIA 2QM7A 1DOZA 2CLSA 4TX1A 1UBHS 1OH7A 5LOVF 4IH9A 3ZWVA 4GFDA 1WHSA 1DAIA 4IDQA 3IRUA 1JDTA 3BREA 1RLTA 2HMTA 3V1UA 4AD8A 3PX7A 3EDCA 1WU7A 1BHJA 2O1WA 5K0GA 3AHIA 1ULZA 2R60A 3B6JA 3L0BA 2VH2A 3BA1A 1BS1A 3RVQA 4LQLA 1E6MA 3SEQA 3D3QA 4YXWD 5CDFE 3N3AC 1YT5A 5ECGC 2M98A 2EZTA 2JS7A 4R40A 1XX6A 2R1ZA 1CQPA 2PO5A 1EUQA 3E61A 3OF2A 3TEMA 1L5HA 3QV2A 3QELB 1DEHA 4FCCA 3GVPA 4JOQA 4MCAA 2P9BA 1RRVA 1KKMA 1RI1A 3PHLA 5BWCA 2F9MA 3I01M 2WF8A 3NWPA 1TCAA 2BUCA 2VF5X 3CB2A 2WKQA 3GAZA 4IILA 3CTMA 3EZFA 1GAQA 1TCVA 3PKJA 4ZWNA 5CGZA 4EO9A 4XYMA 2ISQA 3CU5A 5AK0A 2OV4A 4TWJA 2QSJA 3TUZC 4D4JA 2ZUVA 1MW9X 1XEXA 3V34A 1RKXA 1BS9A 4Q01A 4CQLA 3BGOS 4HATA 2NPFA 3ZU4A 4ESVA 3OM8A 3MUFA 2ZXFA 4QXRA 2XGOA 4X8OA 4CKWB 5HZKA 5MFZA 1AA9A 1QTQA 3DZKA 3D43A 3KOOA 2H9YA 1GG9A 1SKUA 2E9SA 3A37A 2V7VA 2IC5A 3R3SA 2F3UA 3S55A 2N46A 2Z3VA 1JALA 2QOEA 2R8PA 1SEVA 3PR2B 3VDMA 3FCSB 3IUEA 1G9TA 1VXOA 3MAAC 4C30A 4DQLA 4PONA 1OZGA 1IXSB 1X38A 2DWQA 1E7QA 1WMSA 2XSZA 1GWNA 4KQ1A 1B42A 4EL5A 1MABA 1V1RB 4IQ0A 5FR2A 2QJFA 1K3FA 2WSYB 2RDMA 2FZVA 3TZ6A 2JJMA 3UJ7A 1PX2A 3E7DA 4BU1A 4EEZA 4EKGA 1U1FA 3WGIA 1TUIA 2ODQA 2ZYRA 2FY8A 4HDNB 4J0JA 2CE2X 4PHFA 5IF3A 5DI3B 1JEAA 5K6AC 4PLHA 5B2EA 4X90A 1YVPA 1XMPA 1YWGO 1TYDE 2JEYA 3P5BA 3WTBA 1Y3CE 5JSZB 2KLHA 4ZVNA 2XNSA 4RAOA 4S0XA 4YQYA 3RT1A 4DJEC 3AVQA 5BPHA 1JIXA 2XQKA 3LRXA 3B1JA 2I76A 1VL5A 4PWYA 1KAQA 5FKJA 2R68A 2LP4Y 2Z98A 5D7BA 3TTSA 5AESA 4OJKA 4IFEA 3FAKA 3JD2A 1D2RA 4CQMD 1SCDA 2PGOA 4E32A 4TYYA 2CZGA 2FWIA 2PM8A 3EIWA 4HB2A 3MT8A 1UBMS 3UJPA 2GA9A 2QLJA 2C2ZA 5BV0A 1WW3A 5CUQA 4F3YA 1XRQA 3UH0A 5I7RA 4FFMA 4H7HA 2PMCA 4C3UA 2AOUA 4F0JA 3ZW8A 3F7TA 4ZAZA 4AK9A 3U5ZB 3KYDA 1LPMA 1JIJA 4N8SA 2FZEA 1O6ZA