4R8MA

Human sirt2 crystal structure in complex with bhjh-tm1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
301
structure length
286
Chain Sequence
KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Efficient Demyristoylase Activity of SIRT2 Revealed by Kinetic and Structural Studies
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 286
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4r8mA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4r8mA01
4G1CA 2NYRA 2VK8A 4Q9DA 1PVDA 2FWNA 1Q1AA 4Y6QA 5DEIA 4UTRA 2Q5LA 4RJIA 5K6RA 4KPUA 4V1CI 4UU7A 4BV2A 1PTJC 5MFZA 4IF6A 4UTNA 2UZ1B 1PNQA 4K9QA 4MPRA 5EJ9A 1M2NA 4JT8A 1U28C 4RMGA 5MF6A 2UZ1A 1ZPDA 2Q5OA 3D81A 3E9YA 1O96B 4RJJA 2OORC 2EZUA 3FLMA 1M2HA 1YTLA 2JI9A 4BUZA 3JR3A 2H2DA 2IHUA 4UUAA 1S5PA 4GM1A 1UPAA 1V5GA 4K9NA 3EYAA 2EZTA 1OZHA 3FSJX 4RMHA 2V3WA 1D4OA 1XLTC 1Q14A 4BVGA 1OZGA 2JI6A 2PANA 4JU8A 4F4UA 5K6TA 3IAFA 4V1CA 4C78A 4BVFA 2H59A 4L3OA 1SZDA 4TWJA 1O97D 4BVEA 1PI3A 2VBIA 4JUAA 2VJYA 3CLSD 5K3SA 5EJ6A 2W93A 1YHYA 5IMSA 2H2FA 2FRDC 2PGOA 1JSCA 3CLUD 2JIBA 4JUCA 4COKA 2OD9A 1HZZC 2Q28A 4K9LA 1M2KA 1M2GA 1UPBA 4JU9A 5EJ8A 2IHTA 1T9DA 1BFDA 1PT9A 4K9MA 1YNOA 1Z8NA 2AG0A 1YI1A 4JUDX 2Q29A 5BWLA 2EZ9A 1M2JA 5BWNA 2HJHA 1POWA 1NM5C 4RJKA 2VK1A 1S7GA 2DJIA 3U3DA 1POXA 2WVGA 4GP9A 2H2HA 4JSRA 4UTVA 1J8FA 4GM4A 4K9OA 1U2GC 1DJLA 1OZFA 1YHZA 1E3TA 3OE1A 3PKIA 3GLSA 5EJAA 5K2OA 1ICIA 4J1TC 1N0HA 4QQ8A 1EFPA 2VK4A 2H2GA 4K9PA 3F6EX 3U31A 1YC5A 3RIGA 1T9AA 4BVHA 1YC2A 4X3OA 4L2IA 4C7BA 3EY9A 4MPPA 4FEEA 4JD5A 4UU8A 2X7JA 2IHVA 2AG1A 4K9KA 2H4HA 3D4BA 4JT9A 2FN3A 1UPCA 3GLTA 1EFVA 1U2DC 4ZZIA 2VBGA 4BVBA 3JWPA 4MZXA 1MCZA 3CLRD 4HD8A 5EJ4A 2OD2A 3D7KA 4GG1A 2Q5JA 2JLAA 2A1TR 4GM0A 3RIYA 5DGTA 3K35A 2H4JA 3F6BX 4RMIA 5EJMA 4JUFA 4FVTA 3ZG6A 5DGDA 3CLTD 4HDAA 4QELA 4KGDA 4BV3A 4R8MA 1T9CA 2NXWA 4O8ZA 4J16C 4UTXA 5FEMA 5D7NA 1Q6ZA 3GLUA 2Q27A 3ZGVA 1YI0A 5BWOA 5FYQA 4TWIA 2WVAA 2Q5QA 2WVHA 2JI8A 1MA3A 5MGNA 4UUBA 4FZ3A 2FSVC 5EJ7A 1QPBA 4IG9A 3LQ1A 2OD7A 4UTZA 2EZ4A 4IAOA 1Y9DA 3HWX1 4KXQA 4RMJA 1V5FA 1YBHA 2VBFA 4MPJA 4JUBA 2EZ8A 4I5IA 2B4YA 3IAEA 4X3PA 1PNOA 3FZNA 3GLRA 1PO7A 4FEGA 2JLCA 4V1CB 4Y6OA 1V5EA 2A1UA 2FR8C 1PYDA 5AHKA 4GPEA 2BRUC 4Y6LA 3CF4G 4D5EA 2QQFA 2QQGA 3PKJA 4BN4A 2PGNA 1Q17A 2H4FA 1OVMA 5EJ5A 2C31A 2JI7A 4BN5A 4F56A 3EA4A 2H2IA 2OO5C 4MQ5A 3ZGOA 4D5GA 4QPZA 4ZP1A 1SZCA 3PDHA 5MFPA 3HWWA 1U31A 1T9BA
chains in the Genus database with same CATH superfamily
1PDVA 3T95A 3AHGA 4L5JA 4EAQA 2H9AA 5BORA 4PCLA 1O2DA 4KP7A 4QIHA 1F20A 1E79D 2I33A 4DCOA 1INLA 3HM9A 5JW6A 2ID9A 4P3KA 3WYEA 1KA9H 4BPBA 4ETMA 2NSHA 2W8BB 3TOXA 4KR3A 2X4GA 5CHYA 3JSXA 5KINB 4DR7B 1USGA 1TMYA 4AFNA 1YV9A 1ECGA 2H1SA 2W71A 3VSCA 2A5FA 4QYSA 2PSEA 1DU4A 3OU7A 3RS0A 1SXPA 5BSWA 4UASA 4X1IB 4WXPA 3KWLA 1A72A 1N6IA 3ENKA 4P5PA 2RBKA 2I71A 3Q40A 3AJDA 3GX1A 4FD2A 3OOYA 4FLEA 1PG5A 2AW3A 2C5LA 4AY2A 3IULA 1Z25A 3OM9A 2AX4A 5BP7A 3E05A 1NURA 4UTNA 1QLWA 1GQRA 2UZ1B 2X1MA 2XGMA 1R4AA 4E51A 3BH7A 3RYHB 3D6MA 2PLWA 1JVNA 3RS3A 2X9QA 3VU9A 4QU8A 3R77A 1BXRB 3FF1A 4X45A 1XEXB 5C8YB 1E0DA 3MB8A 2R48A 2FUNB 3P9CA 2QUKA 2ZT7A 2C9YA 2Q99A 5ELMA 1OX6A 1RLUA 4C07A 1EK2A 1OYVA 1ULHA 3QX7A 3SJBA 4R2WA 2YXBA 3ZLJA 4M83A 3DTVD 4N0EA 3RKUA 3OZRA 1WY5A 1S3IA 3CUYA 5ITZA 1JAHA 1JHRA 2NSDA 3L07A 5JG7A 1UF9A 2FFQA 4HEQA 2F59A 4FFLA 5JWHA 2JLRA 3PVSA 3TX2A 3WG9A 3RGWS 2QBYB 3VZSA 1JLHA 1BS1A 1WPXA 2BJHA 2HSEA 2VRNA 1WO8A 2XVYA 3AF4A 2VYNA 3CVOA 3GJTA 4JDPA 4RK1A 5A3SA 1TMOA 4ALLA 1CNEA 2H9YA 2Q6KA 2IA5A 5LCXA 2XD9A 1EINA 3K9BA 4XVUA 1ZWKA 2GPJA 5KX5A 4R54A 1C7QA 2O2DA 4QTZA 4RS4A 4B7CA 3GJ7A 1T0HB 4HXEB 2SHKA 3FMIA 1CW2B 3ZDYB 2K7ZA 3LYUA 1YFJA 4LYYA 4EF4A 1S01A 1YB6A 2VSOA 3KT8A 5LSAA 5TF0A 1K27A 1I4TD 2E85A 5JMPA 3SWWA 2QJFA 4X9XA 4LJ6A 1VBNA 4K8OA 3LL4A 1N8SA 4MKGA 3OHMA 1Q0ZA 1E8DA 2B8WA 1ZIYA 5EUMA 4RMHA 4PTZA 2HB6A 4EABA 3DHYA 4NPAA 1S1CA 3VFDA 2BI7A 3F98A 3R1IA 4UAGA 4ZREA 4RUKA 3AONB 1HSZA 4AY6A 1ADBA 1N2ZA 4R1PA 2QMZA 3NHJA 1M76A 1P9WA 3KQVA 3EEIA 3OTGA 1RAAA 1HY3A 2VWGA 3BB4A 1ZIDA 4N1AA 1LH0A 2RONA 4WPGA 1RQLA 3BBLA 3BVPA 3CPJB 3PHLA 1TZMA 1FYFA 3OP4A 5AVKA 4IQ4A 3WTCA 1G41A 4EPRA 4B83A 2ZQYA 3MQFA 3C70A 3ABSB 4TWJA 3JZAA 4TVBA 2GB4A 1L4MA 2V7GA 2LVBA 1QTNA 4KH0A 4NH4A 1Y33E 4TQUS 1WUJS 2G25A 2JFPA 2W43A 4RVFA 5FD8A 1YULA 3T06B 4B09A 3QPCA 3DMHA 2CXQA 3LT0A 4HUTA 5JSUA 2WKPA 2EWVA 5FO1A 2ZIZA 3AIOA 3EPPA 2F1KA 1K7SN 4HFJA 2RHWA 3GH1A 2C61A 2VJCA 1OLXB 1W34A 1LLUA 2WIKA 3FPBA 5ER9A 2R6JA 3LLMA 1VHTA 1E3DA 4LSGA 2QK4A 4P0TA 4WY2A 2IF2A 1C1YA 1NKTA 1U0RA 2G7MC 3L5KA 3GFTA 1O0SA 4NOKA 3U48A 1TEZA 3LECA 4Q9NA 4IDAA 5HOQA 3SZUA 4FNOA 1NI4B 3KQQA 1L7QA 4IS3A 4KK3A 3T1OA 3CTMA 1Z2NX 1R4NA 3ZJVA 2B4KA 4EY6A 1OU0A 1AQIA 1PQPA 4ZDKA 3QLVC 3KELA 3CVWA 2Q6LA 3R8CA 1R18A 5LJLA 1AKUA 2JJ8A 4ACBA 1E2KA 2XKAA 1NPDA 4Q4JA 2OV4A 2HF9A 1LPOA 1II0A 2I2CA 3TVTA 3F1KA 2OEPA 2IHYA 4ZOLA 4ZMRA 2C4KA 2BFDA 2IZ7A 2Z83A 2FN4A 5JCOA 1REQA 1THMA 5JQGA 1SHZA 3OUTA 4DG5A 5D3MA 1R5JA 1KYWA 2GF2A 3CEPB 4GLBA 2X0EA 2LXNA 1YS9A 3EEFA 2G0NA 4U3JB 1G42A 3FJYA 1MN6A 4X63A 3C5VA 4KNVA 4I5FA 5ERGB 3KSAC 1P0QA 2BIFA 4IDQA 1RADA 2QYOA 4O02B 2AHOA 4ZI7B 3L01A 4QEKA 4F8EA 4NR0A 2DFTA 4KVGA 4U5QA 2BYTA 2J3HA 2EBUA 2Q29A 3P97A 4UBLA 1QRTA 5BWLA 2OBBA 3DLIA 1NUPA 4FMPA 3FZEA 4HPJB 4NAUA 1GG2A 1GOTA 3PGMA 4B6JA 1Z6PA 4BNFA 3G0HA 2WABA 2D5IA 2RHRA 4CG0A 2ERCA 2PMDA 4FINA 2VQ3A 3FUWA 3V4LA 4EI2A 2ZAYA 1L8XA 4MRNA 3FIUA 821PA 1COZA 2FZLA 3C2QA 3NWPA 1HTBA 3U7QA 4IIJF 4EFLA 3VU3A 4N3AA 4NE9A 2NU8A 1KGSA 5JU6A 1PR2A 4LS3A 1WXEA 4XAQA 1T6YA 2FX2A 3VQTA 1S8FA 2IBMA 4D0RA 2YFQA 4IDOA 4ETIA 2QKYA 4IJMA 1E2UA 5LDDC 1TRKA 3HA3A 4L7VA 4LVOA 3VUEA 4TSRA 3ANMA 2ACKA 1JFVA 1QYWA 3T9DA 1B42A 3DC7A 1M2VA 7REQB 1BW9B 4KXNA 4WE3A 1SC9A 4M7OA 4GYYA 4EHHA 4HR7A 4M22A 1ZSNA 4OKIA 3JAKB 1L4UA 1NP6A 1NQUA 1ULTA 2NNLD 2WINI 2ZBDA 2Y1FA 4LE0A 3A05A 5CRIA 5D2CA 2YKGA 5LMNB 4WTOA 2G5CA 1YVEI 2QE7A 5I9BA 3F2VA 1SXGA 4ZQIA 5E6SB 1JLLB 1UK8A 4L9RA 3T5BA 4AZSA 5FWXB 4LK3A 5LDGA 2L42A 3AL2A 1OWPA 3MAJA 1E3TA 4I4IA 1PEYA 1HURA 5KQSA 1J24A 3MWEA 4NYMR 3GXBA 1JEAA 5LJIA 2NVUB 3CR3C 1KZYC 1TTQB 1EX1A 3RSZA 2W58A 1P1CA 3LXUX 2JLZA 3IDSA 1BMFA 4O2LA 4PG4A 1Q50A 1I4DD 1ULSA 2VK4A 3K16A 2KQUA 4UHKA 3Q5GA 4YCAA 5HBRA 4OHYA 1GGNA 3SGLA 1NSYA 2G4LA 1GSOA 3RIHA 4IWNA 2IY9A 4CLOB 4WBNB 1UDCA 4GKBA 4YACA 2F48A 3ECCA 3I2IA 2IOQA 2ZE6A 3VO9A 3ANXA 5F5LA 4URVR 1QTRA 3WL8A 5BSKA 2HTEA 1E2FA 1OXSC 1T9AA 2FSSA 4ZVKA 1ZK3A 1JFFA 4WZAB 4C7VA 4I3GA 2W2VA 1G8YA 1S02A 1W48A 1X94A 2PPLA 4C5CA 5KYUB 2HLNA 4O2RA 4GC5A 1I4EB 1M73E 1A4IA 4X3OA 3DTNA 5CG2A 4L2IA 1EWKA 3TBKA 1Z7GA 3DZJA 2YXNA 3BWEA 4H4CA 1U0TA 1UKCA 3LKDA 1GHTA 3LQ2A 3N87A 4OHKA 3EGEA 4TMXA 1QX3A 3KT3A 3OI7A 4PAGA 5C1PA 4NZPA 2XRYA 2HMUA 4JR1A 1JLMA 4XPIB 5KSYA 2HV8A 1RBQA 3K05A 4RA9A 4ZAWA 3V9PA 2QIPA 1QIFA 1WD5A 3EXFB 4ITUA 3PNQA 2ONKA 4KWHA 3KFVA 3VGJA 1R0XA 2R11A 4HX9A 1EFVA 2Z1MA 5K3FB 5AW6A 3OZUA 1E2BA 2O7VA 1YGYA 2VYVD 2X5KO 2ZI7A 3IVAA 4FR2A 1OOEA 2O07A 4EGFA 2BF4A 4HK4A 2QROA 3SYNA 1W85A 3L6DA 4Z9XA 5JS2A 3BAFA 3WLTA 1X19A 2VYFA 3M6LA 3ILHA 5J2UF 4ZZ0A 4HD8A 3QVLA 2VC2B 3GW8A 3B1JA 1ZO8A 4WL0A 4JROA 1SBQA 1S2OA 3FSRA 2DQSA 4K2AA 4L4ZA 4X44A 5ALIA 4L0CA 3TLCA 5EZYF 3WFIA 1I13A 2FZWA 3UWOA 1A1VA 4JBHA 2F3QA 4DQXA 3A32A 5F2OA 4XSHA 1GSHA 4DBLE 2YHIB 4L4XA 3INNA 2OR3A 4J0JA 1JXAA 4RD1A 2OBMA 4F4JA 1T15A 3CN7A 3RVRA 2K2QB 3CT6A 5D87A 4B6PA 2PU7A 3OEED 3SIRA 3EB9A 5IDVA 3H4IA 4LI0A 4IJKA 1HDOA 3JQAD 3NWBA 1C0PA 1QO7A 2C99A 2V7QD 3MWJA 4PX5A 1I9CA 2B4RO 3DULA 3HADA 3EA5A 4X90A 2H2AA 1FP4A 4CL0A 3L0ZA 3AUXA 4YCSA 1FUIA 4TV8F 3UV3A 2QXUA 5EXEA 3V6MA 1TF2A 4HYTA 4EW3A 1LBIA 6Q21A 2BELA 2ZYUX 4QYWA 1L4YA 1LZKA 4JXXA 1SKUA 5B6IA 3KXDA 1LS6A 2AOWA 2NADA 2QTZA 4LHVA 5ALNA 4ECEA 4HDAA 9MHTA 2UUBB 1R12A 3FUTA 4D44A 3EW9A 1XXLA 1FDTA 3DAHA 4M89A 3B48A 4R98A 3LLCA 3P5BA 4AKHA 2PKRA 2IU3A 3K53A 3R6GA 2VUUA 5AM4A 2YCBA 3F3YA 4Z4FA 4ODIA 3ZWPA 3NIWA 3G0BA 3PV0A 2AOTB 2JG3A 5AVWA 3NJ8A 1TCUA 1G17A 4HBZA 4XDGA 3GO4A 3WZ2A 3FHJA 4QUDA 3PHBE 5EOVA 3L04A 3EEYA 2GDJA 2XGJA 3HKEA 1XMVA 3B51X 3B85A 2O7QA 3C14C 2HLHA 3G23A 2PD3A 3ZE7A 4L8YA 4QU5A 3BKXA 2F3PA 2FW8A 2FFJA 3J81k 1Q74A 3UAOA 1AKQA 1QRSA 5A4MS 2PSDA 4UCQA 4J94A 5B1HA 3GPDG 3CGGA 3RKSA 1CEXA 3ISTA 3UGQA 4OX9B 3V4PB 3OE7D 4OM7A 4HWOA 3G17A 4JLAA 3O4RA 2FA9A 1HYQA 1I32A 1JU4A 1U2ZA 2A5DA 1G0NA 3LNCA 4QT4A 1GPLA 2FP4B 2WHXA 3H8WA 1S4QA 1Z37A 2P2ZA 1KDZA 3K70B 4IGFA 4RZSA 4RGBA 2VXCA 4CV3A 3OTWA 1SUSA 4TLLB 4JI6B 5AKZA 5BV0A 3P2OA 3ZLUA 3K4QA 5T67A 4O1MA 5B4UA 2PH5A 4KV7A 3TPFA 2QM3A 1VPEA 4IVPA 2QAGB 3R76A 2PR7A 1K3UB 4J16A 4A2PA 1VSBA 1HRKA 2X23A 5G3ZA 5HZHA 3DLBA 5F7OA 2GA8A 4GC9A 4CT0A 1J9ZA 1QHHA 2C4MA 5B53A 4AN1A 1LBEA 5EHXA 1WHSB 1L1QA 2I2FA 2JFVA 4RHXA 5BRNA 2VBFA 1IQRA 1HMYA 3BZWA 3GFQA 1M6EX 4NK4A 1DC8A 4MR8B 2VP9A 3SVZA 1L9KA 3I73A 2X9VA 3NXSA 3VV3A 1AU9A 3K0AA 3HBAA 4OGGA 3LHFA 2G09A 3TIIA 4AKSA 1EA5A 2QZZA 1MB4A 4PZYA 2ZZMA 3N2KB 5DHFA 4IZIA 3QZUA 2IGBA 3UNXA 3AI3A 3KC2A 1GPMA 2G8LA 1M5TA 2Y05A 1ZD3A 3OM1A 2D7CA 4B35A 5BV7A 3PC8C 2O3SA 2AN1A 5EZQA 5J1TB 5ES4B 3FZNA 4TQ9A 3L8MA 3P0JA 1EP2B 3E5RA 1GAEO 4PRLA 2RJ3A 1KIFA 4K46A 5DNCA 1KF0A 1Y4UA 2Q6IA 5LA6B 3E7XA 1VB3A 2YWXA 4QUBA 1UMCA 4Q9AA 3RVSA 5A4AA 4ZXPA 1IHDA 1WXXA 4ZDJA 1K9VF 2G0TA 2D59A 4Y6OA 1E8NA 1SVWA 1YQXA 5BV1A 3QLTA 4N0PA 1DEKA 4QOHA 1A9PA 5CYPA 5F64A 3VR4D 1FMLA 5DHQA 2YNMD 3W6UA 3DBLB 2I6UA 4AO7A 2VKTA 4Y6LA 3MSCA 4J4HA 3EXEB 1QR6A 1N7GA 3AM1A 1NBHA 4PC3A 1WP9A 3GD5A 1BKSB 3BQMB 1P7YA 3KKNA 5IK2D 3A1NA 1Z5PA 3D0OA 5E6UA 1C29B 3UYLA 3H17A 5T3UA 2ISSD 3VKHA 1MHTA 2V6MA 5K2MA 1Y4DE 1YR3A 2BEWA 5FA5A 2I87A 4IIEA 1SQFA 2D3TA 2NWQA 4J7XA 2R4TA 4LJYA 5ISMA 3W3AD 3OH8A 3RVBA 2OXRA 3L1HA 3D3NA 2R5FA 5FPYA 3WLIA 2IDZA 1PT8A 1ZDMA 4PBSA 5INTA 2DR3A 3C1OA 5B30A 4UNPA 3QOXA 4BAGA 1I4WA 3P2YA 3HBNA 1JYEA 5GONF 1SCKA 2BGGA 1FFAA 5KNCH 2G36A 4OQ4A 5AJXA 2CW5A 1TA9A 4PTYA 2DLDA 4GYJA 1PKXA 4YJFA 4C14A 1T3HA 2WWTA 5GADl 1XN4A 4TM8A 1IHPA 4CEIB 3O4GA 4EY8A 5AVVA 4QGBA 4DY6A 1EBBA 4YV2A 2QP9X 2AXEA 2Z43A 5ALGA 3DMDA 1L4GA 5FULA 3O4JA 4CIDA 1G20A 3NWEA 5KB3A 2CXUA 4BO3A 3GZNB 2LZ0A 3STYA 3TYXA 2NYRA 4ZHQF 1DC4A 3VDQA 4B6GA 1N7JA 4X6XA 1U94A 5BSHA 2AFHE 2HD4A 2P1ZA 3P71T 4GOND 4JVSB 4NBNA 1J1IA 4NYIR 1DB3A 1K89A 5ULLA 4KQIA 1TCBA 2Q5LA 3GT0A 1PT7A 2DLCX 5FOWA 1P3JA 1QTQA 2W2LD 2JCXA 2YINC 1TD9A 2GAOA 3LZDA 4R3NA 4S1WA 1K7YA 2ZDGA 4PVCA 1B0ZA 5D7BA 2DC1A 2FPPB 3MAGA 4I4CA 2ZANA 2PXAA 2E18A 1JU9A 3O8DA 3I92A 4YRNA 3R4CA 4HFMA 3QLVA 2RG7A 1N0WA 2XITA 3EXIB 5KWVA 2O8DA 4F2DA 1T5IA 5CW2A 1NYRA 2IP4A 1Z2CA 1QSGA 3OHPA 4MTLA 5B4TA 1MC8A 1N8NA 3RYCB 3ZDDA 1SXQA 4OX9Y 3BJEA 1ZU4A 2ORYA 4IMPA 3N8KA 4A15A 1EIZA 4U02A 1FSGA 2AEJA 2CCJA 1J33A 3D81A 4RYDA 1SUBA 4INZA 3RV4A 1U90A 3AF5A 3SMVA 4Y1RB 4KPYA 1KH2A 3ID6C 1V9CA 4AWXA 3QTTA 2QTTA 3KUCA 2XZDA 3N6VA 1NQTA 4JC5A 5JNRA 3OCWA 4I6EA 4Q4HA 4Z0NA 4B3RB 3ZV7A 2ZP1A 3EQ8A 2VNKA 3G9UA 4A0SA 5F7ZA 4NJMA 5LM3A 1HE1C 3EF0A 5KQGA 3DOFA 5FYDA 2XIJA 5JIBA 1VKZA 1LX7A 4JA2A 1BFKA 3R7WB 1JRLA 3KVRA 5EHGA 4H7KA 3FB4A 1UAAA 3GEDA 3HKCA 1DMSA 2WJZB 1MVOA 1ZCBA 2FPLA 4RCZA 3ZHSA 3KZ1E 4MLCA 2QN6A 3KZCA 2MSCB 4FMBB 1E98A 3U1VA 5C8ZA 3V6LA 4QVGA 2WHPA 4JJEA 2NO6A 2POCA 4EVSA 4KN5A 4IH4A 4N5NA 5EE0A 1OZHA 4BNLA 1B2RA 4TT3D 1OKKD 5AM0A 4DMMA 4LOAA 3MAAC 4R6WA 1EJ0A 5A3VA 2AOUA 1ENOA 3KKZA 1Q0TA 1Q3KA 4I4NA 3PHCA 2RAVA 2V7WA 5KNBD 4XJXA 2GD6A 5KYVA 1L4BA 1N4AA 4DIKA 4V2IA 1UH5A 4MI6A 4QPPA 1LX6A 4D41A 1YR9A 3PQEA 3FGOA 1ADJA 3GGJA 3N9IA 4AY5A 3MWKA 3RRMA 4ZYZA 2ZB4A 4OYRA 3SYMA 3DF9A 2GCEA 1P2UA 2D4HA 3U0BA 1XRRA 4E5VA 2OBLA 4F3YA 3ESRA 4BNWA 3VRHA 1SCUB 5HSGA 4Y0NA 1RFLA 2XF2A 5CK4A 5F73A 4XRRA 4L3OA 4WD3A 5HQJA 5KOHA 2OCIA 1H3EA 4OJYA 1I5RA 1ZK0A 1EX7A 3ZJUA 4IM7A 4ZOCA 3V46A 1O97D 1P4AA 7YASA 1M0TA 1RVDA 3LFHA 3TOVA 5AVRA 3COPA 4WLVA 1WS6A 3CUKA 2YV4A 5CJJA 4AG5A 1F1JA 3L82B 4RTQA 2EEZA 3DDSA 2UDPA 4QPJC 2H2FA 2ZCJA 3NOVA 5JPIA 2PGOA 3FVVA 3IJRA 3LHDA 4OBEA 1UBSB 1X39A 1GNRA 1IZ9A 3MT0A 3ND7A 4J6FA 4QBFA 5AM5A 3TDKA 1HQYE 4M1YA 2ORED 2BGIA 2YY5A 2HI0A 2BKXA 3L0OA 2VRBA 3QPDA 3I5XA 4JBGA 3HB4X 4D0LB 3WSTA 5CFMA 4PQRA 3H8SA 3T54A 3JVDA 1YCDA 2LRHA 2ACEA 1DADA 4MHOA 4OJQA 1T5OA 3MJ4A 4ZODA 1L4HA 3RK4A 3ZH9B 2DPYA 4NQZA 3WWCA 3UT0A 2WE7A 1P7WA 4AULA 3CVUA 3O73A 3D64A 4OU5A 4NEQA 1PT9A 1EXDA 4ALKA 1OY1A 1USKA 2FPKA 4JLOA 1U7ZA 1KMHA 3BULA 4N01A 1JEJA 1JYFA 1XZGA 4PLVA 4Q16A 5DVZA 4C30A 1R66A 2JAXA 1L4KA 2X8JB 3UG6A 2IH5A 4LFAB 4NDZA 5C3MA 1SH7A 1XL1A 4A9AA 1DAGA 5B37A 4DDTA 4C08A 3IAS1 1LQTA 2JGMA 1NW7A 2NTYC 2I4TA 3EAQA 2VT3A 3GDHA 4FGLA 4HH0A 4UJ5A 3IEIA 1QO0A 2BFBB 4CEJB 1X9GA 1OYWA 1CZOA 1Z12A 3L05A 4L51A 4NECA 2JLWA 6REQB 1TYAE 3IB6A 2HJHA 2OSVA 5DN9A 3SLRA 1TPZA 3LIIA 4GMHA 2X9GA 4MUAA 4BV8A 1M0EA 2DUWA 3SEZA 2DWOA 1LKZA 4HAZA 4CEHA 2F3TA 4HXFB 5AHOA 1RYZA 2J3DA 3BGIA 1NXWA 2I55A 1M8GA 2WUGA 4JCOA 4QYIA 4E2FA 1CCWA 1EB9A 1ZCJA 2DEUA 1RWBA 2RGGA 4FCWA 3W4IA 4Z4EA 1N6HA 3ZCUA 4D9NA 4EJFA 4GM4A 2CNLA 4FE3A 1RLIA 4QXQA 5H70A 4U7GA 3H97A 5K8UA 1CD5A 1QZ3A 3UCXA 3ZQKA 2JLUA 1DXYA 1GLNA 3CW8X 3LC7O 3AF6A 2AOVA 3H1AA 1KAEA 3HCCA 4HB0A 4LI3X 3ZY4A 5AVTA 3M0EA 3CX8A 4X60A 1WU7A 1K8QA 3I12A 2GVDC 2I8LA 2CNWA 4Q1BA 5EJAA 1WQ3A 1K68A 3QITA 2JVJA 2H1FA 2I34A 4TLBA 2QG9A 4XDYA 3RVPA 3M6MD 4EGCB 1Z0IA 2E4ZA 5T64A 1WBDA 3N2LA 1RPZA 1M83A 4L5CA 4K88A 3DKPA 4G97A 2V59A 2YBEA 2XGGA 1DC7A 2ZBGA 4R31A 4DMKA 3AUFA 3V4OA 4RXUA 2B21A 3AUKA 1O77A 1F2UB 2HSJA 2P78A 3E0QA 2VOEA 2XUJA 3BCHA 4J03A 3ELWA 5E9WA 1JIQA 4J49A 5LOVF 1FZTA 1YJBA 3AVOA 1RI4A 1WV1A 2CGEA 3NGXA 3FM9A 1Q0SA 2QVZX 3IPCA 4DDMA 1NI5A 3RVLA 5J1SB 2WIBA 2HNBA 1Y8CA 4DCPA 3NDRA 1GTMA 5KCZA 1YC2A 2DQYA 3AETA 3SM9A 3ZBPA 2FZEA 2OUIA 2ZVPX 4RDXA 2YMLA 2B4AA 1WY7A 1QH9A 1U9JA 1K9SA 3QE3A 5AOAA 3ZD8A 2I3AA 2EBHX 3FAZA 3PJFA 2WQZA 1JR3E 4L5BA 4UU8A 2GO1A 4RZ3A 5DNEA 1Z68A 1FQWA 5AW2A 2W48A 1OBHA 4I4TB 5KAMA 3Q9NA 1FSSA 1NW6A 4S0XA 2FW0A 1PL7A 3GLGA 3T9FA 3ONNA 2C5AA 1EXWA 5I7VA 1N33B 4YO7A 1V6CA 4FK8A 1DDOA 4NG5A 3HJNA 4GI5A 2A1UB 3TB4A 3UM9A 4HQFA 2WWXA 1RWKA 1V47A 4S1TA 4ZZIA 1ZUWA 1T4MA 2NSLA 4N12A 3L0SA 1FNDA 3D1VA 4P5EA 3OQIB 4QJ3A 4UNQA 3R74A 3L77A 4HBGA 4ZT5A 2Z8YA 1DV1A 1ABFA 4BMZA 4QZVA 2Z4SA 1USUA 3NT5A 2WG0A 3CMCO 5KJFA 4PWYA 3U7IA 1CJKC 4LE2A 3AEXA 4YRCA 5ECYA 4MWZA 2PH3A 4W7HA 2IPAB 1L7BA 1GCOA 2YIVX 1S3GA 3UJAA 3SF8B 1L7AA 1DX9A 3K9GA 1KQ3A 4HPWA 1RRCA 4FSXA 3SFZA 5CIQA 4K05A 2WWVD 3DV0A 1M67A 1C9NA 3T5GA 4D02A 4UHJA 5EJMA 2DHRA 4W5NA 5K0SA 1X3SA 4LZZA 1J22A 1H2ZA 2ZU0C 4P2BA 4I5DA 5IVDA 4EGQA 3UJ9A 4JOSA 4EI9A 4YRGA 1VLJA 4WNYA 3KYCA 1A2KC 2B8EA 4DJAA 5JH7F 3F46A 1KH1A 5EA2A 1N9GA 5IN4A 3RAGA 1E61A 3A1DA 2QJRA 4KIWA 2WLTA 4W9MC 3K2IA 1B3RA 3AR8A 2OPHA 1SB9A 3ETHA 4WKGA 2PJZA 4AWAA 3E9ZA 5KTPA 1TTTA 4A26A 3OY7A 4QYTA 4UFNA 2PQ2A 3OQPA 2XGSA 3THSA 1JP7A 3B3QA 3ICVA 2Z8YM 3HCRA 1FTNA 4Q3CA 2XOKD 4RD0A 4IV0A 5ALSA 3WRVA 4YYEA 4ND5A 1P81A 3JVVA 1L8QA 1SXJE 5IHPA 1VRVA 1X6VA 4UTXA 1I2ZA 3QKUA 4CN8A 3DBVO 4JI0B 3G2NA 1GKKA 1CF2O 2P62A 2XYGA 3DO6A 3V8MA 3B12A 4B3BA 1VFPA 5HE8A 5CD9A 2CBXA 5EE1A 4HDKA 4MGZR 2BUBA 4EFDA 2WSMA 3IE1A 1ZJWA 1J97A 3IUJA 5LR6A 4F3TA 5G41A 2HF8A 3HZRA 4EUKA 3TOSA 4RSMA 2DWPA 5EZYB 1S2LA 3UUEA 4EM6A 5DNUA 1SK9A 3W2EA 1U0LA 2PS9A 2Z1DA 5EKXA 5BN4B 2RI6A 3DH0A 5EMKA 5JD6A 3ADPA 1GPYA 1WCWA 2JZCA 5I7SA 1BN6A 4JY7A 4RM2A 2E1PA 1ML4A 4GKJB 2Y93A 1DSSG 1C2YA 4G6ZA 4ZPXA 2FG7C 5B7GA 2K7FA 3VOAA 4DSNA 1E7WA 4NOLA 3G5LA 2JGLA 4XWAA 1PJZA 4DLLA 4CF7A 3F90A 2X6TA 4R69A 3N58A 4RF5A 2XV1A 3HVUA 3L7YA 4KDCA 2H7VA 3C3CA 2KW5A 1PX0A 1P9OA 1XTBA 3LA8A 3U39A 1HTWA 1RBZA 5JWRA 3LK7A 1DQRA 4IIHA 3HM2A 4ZAZA 4TV8B 3SSAA 2BKUA 4GSLA 4MP8A 4OQZA 1H69A 2EJWA 2UYQA 3I9V1 1C41A 1OQAA 5I7HA 1EM8B 2ZTLA 2CT8A 3RR2A 5I7RA 3RFXA 2DULA 5EQTA 5IBCA 1IU9A 2PDAA 3SR0A 2A8YA 2DPMA 4HWTA 1BMDA 1M75A 1OI4A 4JJFA 5LP6F 1V5FA 1XQ1A 4CLEA 4QTYA 1QMGA 2REQA 4TV9F 4NBRA 5E2IA 3MCVA 3UB3A 4P8RA 4A0FA 2XY4A 3L1JA 4EI8A 2ETVA 1X1CA 1KJZA 3BSWA 2ZIGA 3JQ9C 3ZE6A 1Z2OX 4CCAA 1BYIA 1OX5A 5DCYA 2WE8A 1G8AA 2CMFA 1JDUA 1ULZA 2HCJB 1UIMA 2HGZA 2GFHA 3A26A 4IIXA 3N1UA 2JPDA 1SVIA 3LE8A 5F33A 3HR8A 4MMXB 4G01B 1TCCA 3PTZA 3PDJA 1D5WA 2VHJA 4R3WA 4XGNA 1ODCA 3JYLA 3PUKA 2OHXA 2XT9A 3M82A 1Q15A 1VYVA 3NTOA 3AM5A 3K6JA 4A10A 3Q3VA 2IE8A 1JJBA 2O1WA 4DHEA 3ICOA 1DPFA 2OK7A 4L8FA 4NZYA 1HG1A 1Q0HA 2CFOA 2W2PA 3GRPA 1UIRA 3OQVA 3ANYB 4HYEA 3B2EA 4C6TA 1H2RS 2BTEA 1RXIA 3GCXA 4Q93A 4M2LA 3ZXXA 3KCNA 1Z07A 2ZSAA 2ZW9A 5GVRA 4L3WA 3N6XA 2KHZA 4TZKA 1FS4A 1Y9JA 1JSLA 5IBRA 1YBMA 4H2DA 2P9YA 3E1KA 1XVIA 2PT7A 3HRIA 3P8ZA 3TRKA 3EAGA 1KWKA 1JMYA 4D5EA 4L8VA 4MARA 2W2QA 3ZXSA 1UBEA 4ZRDA 1KJNA 5F9FA 3DHWC 3UYKA 4LTNA 2CFCA 1OBCA 2GD1O 1CUHA 5L53A 1CF9A 3QG1A 3FJOA 3M3PA 5CJPA 2Y0BA 4PFJA 4F2GA 5CDFA 2JAPA 3GRFA 1Q17A 2Y71A 3DD1A 3SBOA 1CIJA 1VCOA 4GGPA 4BLVA 4YUYA 1SUFA 1EUDB 1GL3A 1UEJA 1YDHA 2D5CA 3PPXA 4L1KA 4NULA 5TE9A 1QOQB 3UMRA 4YPOA 4TLDA 1LI7A 3RV3A 4HVTA 2C04A 4QOEA 1E7QA 1OX4B 4MVJD 2H6EA 2AB0A 2J9YB 3PEYA 2ANCA 2ZIEA 2AF3C 3ZE8A 1KP3A 4MO9A 1UJ4A 2F7SA 3G3EA 3IEPA 3EYWA 5E4YA 3VHLB 4ETWA 2ZFUA 5TGTA 2AIRA 2NTJA 3TLGB 3WA6A 4DB4A 2VJAA 4IOMA 1RQXA 2C07A 4BGIA 5D00A 1NA5A 4IDDA 1ZJJA 1TF5A 4MRAA 2X5NA 5G4KB 3VYTB 4YRPA 4E11A 3FR7A 3LD9A 5JHGB 2GZ1A 2EIXA 5CEEA 1NJ1A 1OXTA 3QMWA 3HYSA 1IATA 2A3NA 1RBMA 5F5NA 3U81A 3UJNA 2DQZA 4QOSA 3G8YA 3OLCX 1RHJA 4K6CA 2RGNC 2HCRA 2XDWA 3ZY5A 2FE1A 2GN9A 4PU0A 3HEMA 2WMOB 3V3KA 3WV5A 4NENB 4KPUB 1WAMA 5HJ5A 1KMQA 4IH1A 4CHTA 1XUOA 3CNBA 1Q22A 4PV7A 3GLHE 2OHJA 3IBGA 4I08A 1KJYA 1CNMA 2FJ0A 3M2TA 1G2IA 3A1EA 3HJGA 4JVLA 1DBSA 4LYGA 1KVTA 3EIHA 4EHKA 1E60A 1YBFA 2XMCA 1EWRA 1PR5A 1TK2A 1SG0A 2M32A 2HLDD 2C03A 5AH0A 1OA1A 2FZ5A 2YDXA 5REQB 5IT5A 3GQBB 3MTAA 2WF8A 3CG0A 4CKYA 3UKDA 4A7PA 2ZRAA 3U56A 1N77A 3EXHC 4IQFA 2FK7A 2OM6A 5I7FA 3DPSA 3KLNA 1OA0A 1T2CA 3ND9A 2IPXA 4WKPA 3URKA 1UWLA 4ZV9A 2FPRA 1M2NA 3DZGA 4RMGA 3P26A 3UJDA 3BTUA 6PFKA 2VNSA 4IY1A 1E8MA 4LYAA 4PS0A 4IGIA 1RWQA 3P0EA 2P8SA 4TRRA 2ZBFA 3H65A 4IJUA 5GONB 1JXQA 1OLOA 3ROKA 4CIVA 5LWHA 3CMMA 2C2ZA 2YV3A 4Y2VA 3FN4A 5KYGA 1QKKA 1SRRA 1YTLA 1V3VA 1DCFA 4RETA 2JI9A 2N3ZA 1T2VA 2QUZA 3F2IA 4KHPB 4OLBA 1YI8A 3HDHA 1EFCA 1Q0UA 2GXUA 2ODTX 1PSZA 3KNZA 4W5HA 3U3ZA 1C7FA 3VU0A 3QTLA 1XJ0A 2A30A 4JYCA 3WSVA 5KTRA 4CE6A 1CDOA 1YRLA 4XQCA 1MEEA 1D2EA 1KAHA 2FNAA 1TQ2A 2EFCB 1XMXA 2C96A 3ND5A 3CIOA 3CXRA 1NF2A 1MR3F 5EG5A 5BSEA 3IMKA 1ECLA 2FZ4A 3DDCA 3OKFA 3CZCA 2O0KA 4X1KB 4AJ1A 1G9TA 2LNDA 4NFHA 5AIAA 3RW9A 1E3MA 4ZHQB 5HM6A 2AC7A 1OU4A 4F91B 1EA7A 3ZCQA 1O4WA 2XOEA 3FR8A 1L5WA 3WIDA 3CUVA 1HG0A 3RS5A 1ISGA 1TJ4A 4L4UA 1R8YA 3NJ4A 3EZ2A 1ZJ4A 2X0NA 1XD2B 3LPDA 5FTLA 2V7UA 2Q5FA 2RGWA 4F1KA 4RTOA 4P7JA 1DKQA 3H2BA 5D6NA 4JI8B 1KDTA 1G8JA 3AZPA 1XYGA 2A2ZA 1C1HA 3WQQA 5ICSA 1ZA2A 2V65A 3BMOB 3STTA 4YAWA 3OQHA 2ZUVA 3KLOA 4FDTA 3PF9A 4FFBA 1TM2A 3T9BA 1XLTC 5DBEX 3WIUA 9GPBA 1KS9A 1E1YA 1TFRA 2FFBA 3E3MA 5E7QA 5THQA 2ZRLA 4OI4A 2G5PA 4KUHA 3MC1A 3IV6A 1Z56C 1KJIA 3LDAA 4Q3KA 1XTIA 2I62A 5TR9A 3C3DA 3QEKA 4PLGA 4HNTA 2DUNA 4X7PA 1TIBA 1YZ3A 2BTQB 2J3MA 3DUFB 2L18A 2J3QA 4BB6A 1KP2A 1IXRC 1M2EA 3HXKA 4QEZA 5EVCA 1Y5LA 2DKFA 2ZSFA 3TVDA 3NZEA 1R4MB 1NQAO 5GZ6A 2RKWA 4LNUA 3CNHA 4EKIA 1X1EA 3DE0X 5LQKA 2PT5A 2ZRBA 4E3WA 2LBPA 4XW2A 2PV0A 1VHQA 2JLQA 2B4QA 5FOSA 5FPTA 4CLXA 2IE0A 3EMKA 4I50F 4R1SA 3H3FA 2VT2A 4BFWA 4OJKA 4J8PA 4BB5A 3O8OA 1W7AA 4CVNA 3NAGA 3AZQA 1X7GA 3C5CA 1NBME 5BVHB 3W5IA 1OZ0A 1L5SA 2NVBA 4A2WA 1Z47A 5IMSA 4NPCA 5KHAA 2KLHA 2GHIA 2D5BA 3ROQA 5B3JA 2YNMC 8ATCA 3PYLA 3MUFA 2F6RA 2ZJ6A 1FUKA 4WQMA 4JB2A 4G4JA 4W1RA 2R00A 3H3JA 5E1OA 2PZ8A 4XYMA 4EJ0A 2ZIWB 5EWJB 2OC9A 1J0DA 3B3GA 3F3KA 4PLZA 3H9QA 1G4AE 1TU0A 2QTGA 3Q0IA 4WOJA 4L9SA 1QFZA 1WPRA 1DTWA 5FUMA 2OP0A 3UT6A 4BJ1A 1U04A 4Q1VA 3W7VA 3BX1A 1XOIA 5DGXA 4G1UC 1NNLA 5K8LA 3HYCA 4KN9S 4C29A 5PGMA 3GRVA 4MB6A 2PA3A 4FFWA 3NEYA 1DTSA 1R9GA 3ET5A 4BUCA 3BRCA 2BSQA 1K3FA 4PPNA 2PUAA 5C5CA 3T9AA 3UT5B 2J30A 1BHJA 3CWCA 4FEAA 4GEKA 2YZKA 4KB5A 4IIVA 5IJ9A 4IUCS 2WLSA 3ZR4B 2GN1A 2I7XA 2WSSA 2YJ3A 4ZEMA 3PXBA 3R44A 1SD1A 5CPBA 2IH2A 4OIMA 1DAEA 3SNHA 1UAGA 2QD3A 2R8OA 4KOAA 2WILA 4INJA 4O5AA 1GDHA 1U8UA 2NZYA 1R6VA 2PRSA 1FFBA 3C7AA 3NHPA 2Q0HA 1VJCA 3PGJA 4H6XA 1NMZA 2D0PB 2WD7B 1C0EA 2ZB3A 4FWTA 3PI7A 1N2IA 5GJVC 3D54D 3S1AB 2RHOA 2YOGA 3UA4A 3NTLA 3FZGA 4DPMA 1NAHA 1QP7A 5KTYA 3OJOA 1WXQA 3P94A 3D4LA 2FEMA 2JAWA 3TR5A 3L1KA 2BI8A 3FPLA 1UFOA 3NHUA 4J4TA 1E1MA 4NCJA 2CMKA 2W42A 1DAKA 3KV1A 3GJYA 4JB3A 4UCXA 3RBVA 4P36A 1JEQB 4QDOA 5U9CA 1JX6A 2WF5A 3DEJA 4CCYA 2MR6A 3CB2A 3DXYA 3VKFA 2O7RA 5ALYA 3ZDEA 4BEJA 2IFTA 2IZ0A 3NP7A 2FOXA 4X64B 1FJXA 2B4TO 2VWHA 1U8XX 5DYGA 5L51A 1KVQA 1OILA 3E9DA 2R8EA 3TECE 4GYKA 1L7PA 1P0FA 2GM4A 3AYXB 3G79A 5H3CA 5IH3A 2IOHA 2PK3A 1ICIA 1W2GA 3H13A 2B0JA 3HXPA 4BNIA 3QWFA 1XLUA 1QIGA 1M2WA 1E18A 3VTFA 5JJ5A 4QFCA 4ZI2A 2FPIA 1DG1G 2W7TA 2Y0EA 2Z3WA 3TQIA 3LBAA 1SVUA 1FW8A 1Z06A 3WWOA 4RZ2A 4BNNA 4KSBA 9ATCA 1LK7A 4FOOA 2OECA 2ISCA 3OIDA 3V2IA 4DZRA 4GAEA 4C76A 2Z3VA 5A02A 3LVFO 1FFDA 1PS8A 4L7QA 3AIIA 4HNAA 3RIGA 5CA1B 3NP9A 3ZDCA 1Y7PA 2AX3A 4IF4A 2DBYA 3LXXA 1P9RA 3DOIA 3AJ9A 4HAXA 3RVDA 4A6EA 2CLMB 1NRIA 2QEQA 5FOQA 2JJMA 2RB5A 3PIIA 5DNAA 2VH2A 2F2TA 1LPBB 1OPXA 1XRNA 4W8HA 2HW8A 1TPYA 4FP9A 2MMCA 3AEQA 3EGIA 3JS5A 3TFWA 4MPPA 2WSIA 1MQ8B 1B16A 1G21A 1MGOA 1SBNE 3P0FA 1O6BA 2QQ5A 2JAHA 3S3TA 3G88A 1SBYA 3DR5A 1E3EA 3QELB 1AHPA 4Y1FA 2V6GA 4Z99A 4AMUA 2WKSA 1XKQA 1UADA 2OAP1 1B8VA 1YONA 2VR1A 3L6BA 4FYIA 4TS4A 1DJMA 2GKGA 5JHHB 3C87A 4BRWA 2OFOA 5AO9A 5LXTA 1NLFA 2PXCA 3G7NA 3D8BA 2J9XB 2J6BA 4GLLA 1NW4A 4HQ6A 3CO0S 3DVAA 1ZS9A 4OQYA 4RJTA 2DHCA 3DAYA 5IWAB 3DQPA 3I5MA 3PFIA 4R7ZA 4TKVB 3MGBA 5CP8A 5ILQA 5LQDA 1IQPA 2BZSA 3NRJA 3SVTA 4AI6A 3PR2B 5LFAA 3GEPA 4BFCA 3NLLA 4CFSA 4GBMA 1IG3A 3NASA 1H3NA 4XQGA 5U4XA 1TE2A 2Q3DA 3DEAA 3JQ9A 3R6DA 1MP0A 2AHRA 1DFIA 2QIOA 1GDDA 2YJ6A 3HN6A 1COWD 2C8LA 5KSWB 3GUVA 1O97C 2D0DA 1KTIA 1N9ZA 3ISJA 4K6MA 2BLLA 3IHKA 2TS1A 3CNEA 4S1NA 3E81A 2YVKA 2P68A 1U0SY 4MS4B 2G1JA 5LOVB 5FBLB 3MGGA 3IAAA 4DWWA 1BEEA 1YK1A 4YEDA 3LRXA 2JK1A 4Y2TA 1U7UA 2AFHB 2J85A 4F9GA 4PSUA 1Y5NA 5C5EA 1H2HA 1PJLA 4IDHA 4AJ2A 3G0IA 4RMIA 1IJFA 4GE0A 2QTRA 5KEIA 1I14A 3C45A 2VPIA 1KC1A 3DF7A 2VF2A 3ECSA 3GRCA 1MAUA 3ESXA 4FNMA 5GGXA 3N8DA 4ZCSA 3THOA 5HBGA 3NRBA 5FL3A 4Z3DA 3R7BA 3V80A 3WLOA 4I9UA 4UJ3A 2P9JA 3ANLA 1RKQA 4G65A 4JL5A 4MAAA 4OH7A 4KR7A 2IUUA 1LK0A 2E5FA 3OLQA 1VSQA 2BI4A 2GAAA 2RGXA 3K72B 3W9YA 4ALNA 3HEBA 1U1DA 1GUZA 1R88A 1TM1E 2PX5A 3B8HA 4XH9B 2H1OA 1V8OA 1PJ4A 2D1TA 2Q6OA 2WPNA 2FX3A 1Z5OA 1T43A 1RRKA 3HL4A 5JCXA 1YZUA 4M86A 3GRRA 4O4HA 1I5EA 2AG8A 1SIWA 1BN7A 1H94A 1HBJA 1W88B 1YWGO 1LNSA 2E82A 2QL9A 1EZ4A 3DEHA 1P8AA 2GN0A 4TMKA 2IKQA 4I1RA 3RSSA 1I51A 2I1QA 4V0ME 2VYVA 3IO3A 1P74A 4LOLA 3REOA 4BNJA 1R6BX 3PNKA 3OKCA 2VZ8A 5GAJA 3SQOA 2K87A 2ZKLA 3PSHA 4U9IS 4N5IX 3V1MA 4ARZB 3D8HA 3BHIA 3H2GA 1VSVA 2IJGX 3N07A 2Q4TA 2OPBA 5M34A 4H1UA 1GL6A 3RU3A 3WX0A 3K20A 3ZLVA 4E4TA 5FYQA 1C4XA 4KMOA 5EY5B 3OQ6A 1G8SA 2WVJA 2XCIA 5EWMB 2Z30A 3X2FA 3OEEA 1DBPA 4EUNA 4XPZA 2D2EA 4DUGD 5I5GA 3SMQA 1YMUA 3D7LA 1TD1A 3I28A 1TDJA 3HU2A 2D13A 2ZJ5A 3JQAA 4Y2UA 3MOIA 1FLVA 2FZVA 1RRFA 1WX1A 2BHNA 1EP3B 2V7QA 3CQ9A 3NPAA 4NJOA 1NW5A 3R9XB 1LC0A 3WP0A 2YHBA 2X5JO 2HJGA 5ALUA 1RR6A 1K6EA 4BO6A 1WM1A 4BXOB 3AUTA 3CKMA 3UB4A 4AL4A 3ZD6A 5ELLA 4Y2QA 3TF5A 1QWSA 2B1QA 1TMGE 2V6JA 5ALRA 2X8AA 4DV1B 3JQCA 4PANA 1RHUA 2PBZA 4OK3A 3DZKA 4NBVA 2MSKA 5D1NA 4BX0A 2IRWA 2AN4A 2BFCB 4MRMA 3NC1C 4K86A 1T8UA 2J0UB 3NNNA 4ANFA 2VQEB 4MKZA 8ABPA 1JB1A 1QH0A 2LCIA 3ZWMA 4DLRA 3DFUA 4JYMA 3V1TC 4LBYA 1AK1A 4MS1A 5AKHA 4O2BA 1DE0A 1VOTA 1F2VA 1OH8A 2QLTA 4I5IA 2VAPA 4FKMA 1QFXA 3M3DA 3TLYA 2CVZA 4K0RA 3I4FA 1H3FA 1AKVA 5AW7A 4DR3B 3QJ5A 2CJPA 1EK0A 2IX3A 1V25A 4BRZA 1EJ2A 3GGDA 5CYGA 3MHTA 4F92B 1A2OA 1NRXA 2PUBA 4J1NA 2O0HA 1CC1S 3HU3A 3QK7A 1YUBA 3GLKA 3KDSE 4A6DA 1WR8A 1N2EA 4CGYA 3IBCA 4EPWA 2PJUA 2JLSA 3WGNA 5B4VA 4I8XA 3VYVA 1GGHA 1YQDA 4RKWA 4XWWA 1II8B 3WK9A 4D45A 4E3ZA 1C9MA 4V1CB 1ZWLA 5CB6A 1XLVA 4J7CA 4U6SA 3FCSB 3ZOZA 2UXCB 3K1JA 4ZALA 3JQEA 2TMYA 2IYAA 4OB7A 1J2TA 2WZDA 1ACLA 2N1MA 1PYDA 5HGJA 1G3UA 3AXSA 2RH4A 1V71A 2G76A 3FPAA 1JJFA 3G7SA 3H04A 5FI0B 4FT2A 4GOMD 1HDRA 4XB1A 3SXUA 2DVMA 4MTCA 4WHMA 4OYLA 1X0XA 5CIWA 1U8CB 2XNSA 4L50A 3FSGA 5J4LA 1WMBA 1R37A 3NANA 4YIKA 1BQ3A 1WNTA 2GH1A 1OI3A 3BK1A 1TUIA 1BJTA 1PFQA 5C1OA 2NUAB 1K5PA 3AY7A 3RS7A 1DS6A 3L6OO 4J0KA 3JYPA 5AVZA 4CXMA 4WKBA 1NNI1 3U44B 3BHMA 4FBGA 2ZITA 3IB3A 2WZCA 4FU0A 1GNLA 2AF4C 3LBFA 3CO5A 1H2EA 4MX8A 3CSDA 1MNQA 2OO5C 3AK4A 3RC2A 4FZ5A 3ZGOA 1QRUA 1GCAA 5F2KA 3DLAA 2QD4A 4FQ7A 1PK7A 4H7EA 2QGFA 3TKLA 1WWKA 2HXYA 1NVVR 4G5FA 1NVMB 1LW6E 1SOVA 4D3YA 1X38A 4P83A 4TROA 4XGKA 2XAUA 4ZT3A 4QUJA 1XZEA 4EZEA 1R10A 3WGIA 1ESDA 2BGKA 1JEYB 3ZCPA 1C9YA 3THYA 1KPIA 2DE0X 2QZJA 3TTWA 3W6NA 4EVIA 3QWIA 4E03A 3JQBC 4R2JA 2VDRB 3OCYA 3I34X 3VAYA 4WZZA 3BH6A 4EIWA 1T5SA 2EAUA 4TL7A 1FDVA 3PHGA 3PLAE 4M60A 1ZNZA 3DT6A 1JDBC 3WLKX 4RTPA 1B93A 2JBAA 2L2QA 2CC2A 4TLAA 4URWR 1VPVA 4F2PA 5BOSB 4LMAA 5KYWB 5AWFC 3COVA 4I2NA 4M7RA 4UEWA 4L4YA 3WWEA 4M88A 2PHZA 4KR9A 3CONA 3GFRA 5ES3A 5IBQA 1ZGJA 4DR6B 4U6QA 3VNBA 4H59A 2YNMA 1QH8A 2XQKA 1NXSA 1SVLA 4R2LA 4KZKA 4MQMA 5HFJA 3V4VB 1RXCA 1XNHA 2C94A 4OA5A 3P2JA 4V1CI 2I3DA 5DU2A 1JG3A 5BURA 5IZCC 1P1HA 2ANBA 2XHEA 3GEEA 3KEQA 1X8XA 2E21A 3HCFA 4IDFA 4B8WA 3JWGA 4ZJYA 5MFZA 2XMDA 3K9WA 3EJWA 3B89A 5IK2A 3RS2A 4DA9A 3OZSA 4XUGB 1E2GA 1YE5A 3OQBA 3AESA 3O7MA 5E6RB 3TXYA 4EHIA 1L9XA 3GP8A 5DGCA 2QVGA 3K0EA 2BC9A 4MWCA 4O33A 4ZGGA 1PZNA 1RZRD 1W0KD 1PNQA 3W3AA 1Z5NA 3PNPA 4HVLA 4BP1A 2KYRA 2PBFA 3KTOA 5I6DA 3BSFA 4JLVA 1A71A 1FTGA 3TOCA 2YOHA 3IOEA 4UTPA 4TL8A 2ZDQA 1CB7A 4NG4A 5LD2C 5KDOA 2C59A 3UAWA 3G2HA 2G1UA 2PGLA 2PKWA 3S2EA 4ERXA 3JD2A 1A9ZA 4GMKA 5K0CA 1CJTC 2A92A 1KY2A 4ND2A 4DTIA 3C7CB 3Q12A 1XPJA 4ZVUA 4DWOA 3IKMB 4IYJA 1A7AA 1AF7A 1UPAA 5D51S 1DQYA 2VXYA 4ESEA 3GARA 4LHZA 5IT9A 4U6NA 1D4AA 1QGZA 4WESB 1QP0A 2QZPA 2AVNA 2YJNA 2ZZKA 1F8YA 3UPDA 2F62A 2W6MA 3X1DA 4ZYUA 1D6SA 4M1ZA 1EJBA 1S8OA 2I6SA 4M0EA 5JPCA 2C1ZA 2DGDA 3V8QA 1ECBA 5JT1A 1P2GA 3F71A 4XTRA 5HUHA 5ALJA 1S2MA 1SJ9A 3T94A 2ZUWA 4Y3UA 4LXIA 3U2QA 4DW8A 1EUCA 1G5RA 1GGMA 1KEWA 5C37A 2W2LA 3LQRA 1G2OA 2H17A 3G7UA 3FSJX 4GKAA 2A58A 4Z4CA 4YIHA 1W4CA 4EYQA 2ZXUA 2ZTHA 3LTNC 1E69A 2C3PA 3JD4A 3ULKA 4LDRA 4BFXA 4LBWA 1H0HA 1DPGA 4C7JA 3WB2A 4BKQA 1WZ2A 2ZIFA 4Y7DA 2AUMA 2HMTA 1VJ1A 3EDCA 3GLQA 4P34A 4CG1A 1RABA 4BLOA 4TYNA 1J1ZA 1FNCA 3NVAA 4FS3A 4JR2A 2ZI5A 2BLNA 1M0WA 2AZTA 1T3GA 1WZEA 1XTJA 2QNIA 3D6NB 3N70A 4LX8A 4U8HA 5DNDA 4BKRA 1FPQA 3EA0A 1O5TA 2BBSA 2EU8A 4MCIA 3ZWOA 3KTAA 3STUA 4EH1A 1N78A 3DBOB 5P21A 4REMA 2R5WA 4G0YA 4MWGA 4XQ9A 1VE7A 3FDZB 1CR4A 4G8DA 1DJNA 1YDMA 4R7GA 3RJTA 1VBKA 4R2IA 4U5XA 4YP7A 6AT1A 5ICGA 4O25A 5L7WA 5AKYA 4B3XA 1KHTA 4UNNA 2PG3A 4BQOA 3QI7A 1YD7A 2NP7A 1AKMA 4CF3A 4MWDA 1U0OC 1J5EB 1OH5A 5LP1A 4JLSA 3BRQA 4GOJA 2D1SA 4KGXA 4CDRA 4NSNA 4IZOA 2SBTA 3A27A 3OPYB 4KRFA 3HGQA 4JLBA 1OT3A 2CUTA 5HA5A 5FFFA 2WJ6A 1HT2E 3ESAA 1CY4A 4RKEA 5EMMA 4BFVA 5CNMA 4TWRA 3K1YA 4MIKA 4TTAA 4LV6A 3DFZA 4BLSA 5BMVA 1SURA 3LCUA 3QU2A 1J56A 4HH4A 2QRNA 5C0OE 4MH0R 5ESXA 3USES 1K8YB 4OI1A 2PWAA 4RC9A 1VC2A 1WPQA 5CM9C 3V7YA 5K0EA 5L40A 1XQYA 3G59A 2PLAA 1Z83A 4G5RA 1GZ7A 4K9LA 3TDMA 4JJ7A 3GJ0A 3WISA 3JU3A 3FGZA 2JC3A 4RJ2A 2EW2A 2KJQA 1DTEA 1OFIA 4D8TA 3PQ6A 1RC0A 4MUMA 3ITDA 4TT3A 3KQWA 1GZDA 3B6IA 3GVIA 2P4HX 13PKA 4FB5A 3OX2A 2UKDA 2XCOA 2ODAA 5JSQA 1O95A 1Z6ZA 2MSEB 5KNBA 3GT4A 3RS8A 5J2TF 1S3FA 2WFLA 3BE4A 4B9EA 1DFHA 1VE1A 1ZYUA 2ZE5A 4NPHA 1IM5A 5ALMA 1PN3A 3TSYA 3A1FA 1A69A 4FZVA 2VWPA 1UQTA 2IELA 1YI1A 3IUMA 1BOFA 2CYCA 2XDYA 5IC6A 3DMFA 3EVCA 4O0MA 3HDTA 3EXAA 4MR9A 5EQFA 4IP0A 1DKRA 1X1BA 3L7BA 3EBOA 5BSRA 1CF4A 2C7OA 1SVMA 2FMXA 4H7DA 3R0ZA 3MXOA 1DG3A 3RE1A 2I4MA 2BKVA 2W2MA 3IPXA 3FNBA 3QI2A 4GH5A 4Q3BA 4UCWA 1S2GA 1O89A 2J5RA 1K6IA 4JHLA 3ZU3A 1Y3BE 1GYPA 4ENWA 1QFYA 1L8LA 1LLCA 4EMUA 2P75A 3NETA 3BFPA 4YMHA 2V7BA 1C5KA 2AXQA 2D7JA 2GBPA 3CF2A 3IS3A 3PUXA 4WBSA 1R0CA 4YP1A 3PLNA 4Y2SA 4F3CA 2NTNA 1S7GA 3I6MA 1GQOA 2FPGA 3IA7A 5L3QB 3H0CA 3G5AA 5TMBA 3A1TA 5H4HA 2EF1A 2ASEA 4DNQA 3OHSX 4M46A 4HUQA 5I4IA 4J0DA 3W6ZA 1EK5A 2IV2X 1L5NA 3VZQA 3OPYI 5MDHA 1M34E 3HO6A 4FYPA 4K6KA 2XEDA 3ZOKA 1P2SA 1TTHA 1GO2A 2PXHA 2PRJA 1EVYA 3DKKA 3OIVA 3K9NA 4GZLA 4KQMA 1E9BA 3VTAA 5FADA 3EHDA 5SY9A 2PZMA 3D5EA 3NYWA 4M4SA 4R9VA 4B3CA 2NP6A 2ZWOA 1T4CB 1W5EA 1KGDA 2P9TA 2VG8A 2R44A 3GPBA 4PSDA 4QRIA 1HOXA 4FI3C 4EF6A 1HE4A 3REQB 4GQBA 4KGVA 5JTUA 4Z1MA 2L0XA 2QLBA 1AD2A 1C3JA 3GRZA 3VDNB 2CB0A 4Q7KA 5LIPA 1PNRA 1Y0BA 1TJYA 4MK4A 5AQEA 2AMJA 2LGJA 1P2FA 1UAYA 3WLLA 3N7TA 3QFCA 4WADA 4P0QB 4R7TA 5TJ9A 3TK1A 2AJDA 3BFJA 3V8EA 2OHFA 3D3WB 4R01A 1NMEA 3GIDA 5ADHA 2NQTA 3T7EA 3DHEA 4PNPA 4EL5A 2CXHA 3KJZA 3RLFA 5C8XA 4X62B 2FN8A 1JDSA 1Y3HA 4FHEA 1G4HA 3NM4A 1U1IA 2IUYA 2PS3A 2B83A 2WMDA 4AM8A 4KREA 1FFGA 1H2WA 3O7WA 5BPFA 3PEVA 2YJTD 1NSFA 2IS6A 1JLSA 1YIAA 1UMDA 3UHOA 1JS1X 2RHDA 3IPRA 3PA8A 3DXXA 1IXYA 2ZJFA 3PU6A 5K4HA 1O94D 1CTQA 3JQDA 2HEIA 2IEDA 3QYAA 5FRDA 5I7OA 4CM3A 3D4BA 3VR5D 2P2LA 4RLSA 5AJWA 4XB2A 3VSBA 5JYBA 1PJ3A 4DFDA 3E7FA 3E7WA 2A9QA 4BZQA 3ZNNA 1DEXA 1L4NA 2P2GA 1GV0A 1QC5B 3RHZA 3UMFA 4BASA 5C9ZA 2CXRA 3CJTA 3O84A 4FIZA 4XX0A 2G08A 4O4JF 2GCOA 3A3KA 3DBHB 3TMAA 1ZW6A 3KEMA 1A5AB 4K5QA 3GLTA 5DM0A 1P1IA 2XT6A 4CRWB 5IJZA 3L4EA 1QGUA 4QPDA 3IP3A 4DPKA 3AVXA 4WCDA 3ZV6A 1BQ4A 1Q0QA 2BFFA 3F3SA 1Q12A 1V8ZA 3M81A 4LQCA 1TT5B 4I99A 4FC6A 5KKNB 4KBGA 4LOIA 2XUFA 4EJ2A 5F23A 5LQUA 1CS0A 1E9FA 1YMVA 1FL9A 3IAM6 1MVNA 2V6IA 3KXPA 5CB4B 1H6AA 4MW7A 2O8FB 4QWWA 1FXWA 5DK6A 4YRBA 1PZFA 3T6KA 2YQZA 1RI2A 1YFLA 4JJ4A 2CSXA 4OXKA 1V1MA 3HNPA 2A5GA 4GM0A 4F38A 2CCGA 1E3SA 2QGZA 5G1OA 1TJPB 2CJYA 2LR0A 3RIYA 1P18A 4HH3C 4HLQB 2W2OA 2ODWA 3K35A 2ZBVA 1BO6A 1K5DA 2P3SA 2ZUUA 3RODA 3OPQA 2GBCA 2IF0A 3BUSA 1Q3HA 1T2UA 1HLGA 4HDRB 5HKKD 2JKYA 2WOJA 3ZY2A 3N2IA 1NXTA 3GLHB 2CLCX 2DT5A 2SECE 4YT2A 2XMZA 2XECA 1U6JA 4WLFA 1S7CA 1C80A 3AH8A 3DEYX 3CBQA 1XALA 3DOOA 4NONA 4XUEA 3VBCA 4EB0A 3CGWA 4QFDA 1ESNA 3OZXA 5FTNA 2O3QA 1UC5B 5BUCA 1FMFA 5JR3A 1QXSA 1TF7A 4ND6A 5CR9A 1AN0A 4GX2A 4EELA 4Y98A 5HS4A 2J45A 5AYVA 1PEAA 2RD2A 2O50A 3CLHA 1K6MA 3DOUA 3JTEA 3QNMA 3X1YA 4O4LB 3QVGB 1HT1E 2NAPA 3DE7X 3PEWA 1I3MA 3HTXA 2WZQA 4LGMA 3I8OA 2NXWA 1XMJA 4QTUB 4O08A 5SYMA 4X97A 1X70A 4FQ5A 4P81A 4CODB 1BVUA 2QVBA 3W5JA 3DZCA 3JVEA 4O29A 2IUEA 3B9QA 5F76A 2X1LA 3HVJA 2B3DA 5CT4A 1Q20A 4KUEA 1US8A 3BQ9A 2P67A 5EWLB 1ZL2A 2HA0A 1KY3A 2PYZA 3D1JA 3UMCA 1X14A 1TKCA 3HBMA 4CUZA 4MRPA 4DV4B 4ND1A 3BWCA 3R7DA 4C22A 4ZPJA 5KOYA 1A5SB 3OCUA 3ZK8A 2EYUA 4DLTA 3ZXUB 1ADGA 3JQBA 3QVVA 1HDGO 2C5BA 3OAAD 1KO5A 4H17A 4WDQA 3FA2A 3LY7A 1KIMA 3ETNA 2JLXA 1TUBB 4EDHA 1Y1KE 2B78A 4Q4AA 2WC1A 1WIWA 4FZ3A 4H1HA 4I66A 4DVGA 3I4CA 2GK7A 5FBHA 4AAYA 1GPNA 3MRVA 4UXJA 1SBCA 3RVNA 3LUJA 3ROTA 1TO2E 1ODJA 2QV0A 3H5NA 3GELA 4G5YA 3ZHUA 1CQXA 1NG1A 2I65A 1NY6A 4L07A 2XNCA 1MA0A 5LQSA 4HP8A 2DAPA 3WMEA 1Y9DA 3PXAA 4ZXFA 5A03A 3BSSA 1Z4LA 1W73A 5KQRA 3NR2A 2VSXA 3FZYA 4YMIA 2JIPA 2R7LA 3RT7A 2UXDB 1X1SA 1X7XB 4UDNA 2NU9B 4DCMA 5B6JA 1QP4A 5DBIA 2X4DA 4KYIB 3SU8A 1Y9AA 2J7KA 3VPSA 1YVUA 1EE2A 3FPCA 3ZE0B 3FTFA 2GKOA 4OXNA 1Y4AE 1FQJA 1PK8A 2WT9A 3T7DA 2AE2A 5FBZA 4U7FA 1W52X 4KAFA 4ZAXA 3GI1A 2ZIXB 4KTVE 4ZVVA 1HDCA 3MEQA 4Q4DA 4RHCA 4YDHB 1JGTA 4CV1A 5JY1A 2PKCA 2ATXA 4I46A 3Q7IA 1BEUB 4B3MB 1X7ZB 3LPMA 3PICA 1XDDA 1PWZA 5CBPA 3DUWA 3UC5A 1BCRB 3P9XA 2X6QA 4ZN6A 4ZTBA 2IWHA 1WUIS 2CYBA 4WGFA 1ATZA 3HRHA 3IESA 4J0HA 1NTRA 1ATIA 1PLKA 2YTZA 2OZEA 4IGAA 1MW8X 2O23A 2VDNB 5DGHA 4TYQA 1U2RA 7GPBA 3BTVA 4NU8X 3W8FA 3ZCTA 4BQPA 2O8BB 3IPYA 2YYZA 5JALA 1OIWA 1XC7A 2G5TA 2V03A 2JBWA 2VJKA 2AK2A 3LUCA 4OMDA 4Q1CA 3MLBA 5CX1B 5FQOA 3SOZA 3AHHA 2OQRA 3CZ5A 4NYMQ 2P1RA 5DI3B 1SBTA 3FWNA 1JV2B 5FWNA 4R40A 5FWYB 3PXDA 3I37X 3PCTA 2FF7A 5EIHA 3WLRA 1W8IA 5C31A 5K0GA 2R60A 3LPCA 4ME6A 2DX7A 3F4LA 1XGKA 4D8XA 2W0MA 4ETNA 1IXSB 3SSOA 4W9RA 2JI7A 3ILVA 3RO7A 3LCJA 3GUZA 1CWUA 1QIIA 1U65A 3CRNA 4MQ5A 4Y7CA 1JAXA 2OCBA 2HZ7A 4J76A 4OVKA 1QH1B 2KLBA 1ZM4A 4X65B 1WW2A 5LNK6 1A88A 4AXBA 1WB9A 2KSQA 2E87A 1WUYA 1HLFA 3UZUA 3EQ6A 2UZ4A 2IS1A 3P4UA 4B6SA 1KO7A 1IY2A 2IT1A 3DT8A 1GTVA 4C5AA 1WF3A 3HWWA 4YH1A 1E5XA 1FRFS 2FWPA 4PFQA 1L7OA 3AOGA 3M1AA 1R6UA 1XRPA 3I9LA 5KTTA 2JATA 2HM7A 1Y8ZA 1K86A 4J91A 2HK7A 3GFPA 4BO7A 1N6PA 4R16A 4YR7A 3GFGA 5KX5F 2N0SA 3SX0A 1NFQA 4D98A 1R6XA 5H1YA 1LBHA 4H3SA 1FRZA 1E1CB 1PVDA 2OGSA 2VP0A 3CF4A 1E2QA 2XNHA 3Q8MA 1XKLA 2GCIA 4RZUA 3LO8A 3DVSX 2A5LA 2XYVA 2EHDA 2XZLA 4C0QC 1CV2A 3ZHXA 1RWMA 2FI1A 4UU7A 1DWPA 1TKAA 3WNQA 1R16A 4LFCB 4D96A 2Y4OA 3MM4A 2RAFA 1IOZA 1T0JB 2ZAOA 2PMCA 3UQYS 4Q37A 4HB4A 1R64A 3NUZA 3UJCA 1OIXA 4L78A 1FFWA 3I72A 3HFJA 4UZSA 4E30A 4F3KA 1CKEA 1XB2A 4IEIA 2Q7DA 2YWGA 3T9CA 1AV7A 1VG9B 3UAVA 4YFVA 1X8KA 4DQUA 3NM5A 4PF1A 3F78A 2PZLA 3KZNA 1AUXA 3PDCA 2WAOA 1NVWQ 5SY4A 1JBEA 3AFMA 1TGVA 2P7HA 4MVJA 5KCMA 2HYIC 3IJPA 1O96B 3AY6A 2YWHA 4AP6A 4OGFA 4CZ2A 2NXEA 3GLIA 4PYRA 1XF9A 2XUKA 3VC2A 2HRBA 3AJEA 3SEFA 1GAJA 1O54A 3FRJA 4PPQA 4A8TA 4BUZA 5BR4A 1GFZA 1SQSA 4CTJA 4Q02A 4EG7A 5K0TA 1RJGA 3LIPA 3MWDB 2EWMA 4L8GA 2W8ZA 3EUEA 4DY4A 3ADDA 3GNSA 3O93A 1JQ3A 5YASA 4RDCA 2JHCA 3NW9A 4E6PA 2VL7A 2Y0DA 2FMIA 2OK8A 4OFBA 2XF8A 3IE0A 3AZOA 3PYXA 4R05A 5IAAA 4JZKA 4MW6A 2RBGA 3S2ZA 1E6MA 3EDRA 3UWKA 1D0IA 4BMXA 2NACA 5F78A 2BDTA 1UP4A 1QB8A 2Q41A 3NG1A 4WVFA 3TB6A 5K03A 4AKIA 1JHAA 1KYQA 1LDMA 1ULUA 4NZNA 1CEEA 3MINA 4ZDWA 4ZOLF 3D6AA 2VHWA 2YFHA 2XSZD 1EI9A 4BATA 1HE5A 4GWLA 4AP5A 1KOJA 1EJ6A 4WASA 2IYLD 3W7BA 1YE3A 4B3IA 1G9XA 4Q01A 4PYOA 1MO5A 2Z58A 3A6ZA 3HJTA 2V3WA 6YASA 2GVNA 3EUWA 5M3BA 1R0YA 2ZRPA 4MVJM 2ZTVA 2O59A 3GEMA 4HG2A 1SFRA 1FDSA 4BGVA 5HJ7A 3LHSA 4PC2A 1RC1A 5DTIA 3SG0A 3AUJB 4JU8A 5C8VA 2WU4A 3CM0A 1W94A 1LXCA 1NULA 2HA3A 4I5EA 1TQDA 4OSPA 3IQHX 3HO1A 3QYFA 2AQ8A 3C43A 4AS3A 1UT6A 1A4UA 4JJZA 4AN0A 4F21A 4KXVA 1LNZA 1DO8A 4P33A 2ZR8A 2NQ2C 4Y1EA 2DXIA 2SKCA 5TMPA 4M9ZA 4MV9A 4ZVNA 3D2AA 5EJFA 1T0UA 4R81A 4RWEA 1YRHA 2LD4A 2FTKE 3CSUA 4M0CA 4RQUA 3V1UA 1Q0PA 1M74A 4A23A 1SZJG 4P4SB 4PVDA 3EFOB 3KQOA 2J9FB 1PVOA 2W2KB 1V43A 1UFQA 4XLLA 3AM3A 4ED9A 1GPDG 4HO1X 3SC4A 5ED0A 3HVIA 2GAJA 3MWGA 1D8AA 1YDGA 3V1NA 1RLMA 3ENVA 4DANA 4REQB 4O8CA 4FC7A 3K71B 2Y2VA 3O1LA 3LGAA 3PT9A 4DR2B 2PX6A 1YA8A 3EXG1 4RK0A 3VVMA 3KQUA 3ZGZA 3NNDA 2X3FA 1NONA 4DYDA 4DV7B 1P6QA 1P4SA 4BZWA 5KI6A 1QCCA 3DGFC 4WVLA 4OYHA 4QAJA 3D5TA 3AI2A 2Q2NA 2V1XA 3GRKA 1BCSA 4L9WA 5IJAA 2WDPA 2J87A 4KJZA 1NYLA 3QWBA 5A6SA 3ZJYA 1GZHB 4BS9A 1L7VC 1LTHR 2GPBA 4CKBA 5ITSA 2DPHA 3LUPA 3MBOA 4UE2A 1WSAA 3QEMA 3KAKA 1IPHA 3RUIA 3OF3A 4TRMA 3UK2A 2C7GA 2GJAA 4G63A 3R5TA 4BHTA 2YUIA 2QJTA 7ABPA 3EZXA 4KI0A 3EPRA 2HRCA 2DWCA 4M7PA 1V7QA 3DKVA 4MQEA 5AW4A 4EX7A 4V0RA 4Z9AA 3SZLA 4RQTA 2XGOA 1VLMA 1VLZA 4PG5A 5ALZA 3ONWA 1HUQA 4YPVA 1UXGA 3K70C 5BNTA 2Q0XA 3JZFA 4EY4A 4NFYA 2Y0CA 1O9GA 3PF8A 4ZYVA 3GFSA 5AKLA 1I1OA 5L95A 5EIBD 1F0KA 1JSXA 3IODA 3JWIA 1UBGA 3GJ5A 5CVUA 3B78A 3S8MA 3UTCA 4MUXA 1Q83A 2EQAA 3AJAA 4L8LA 1NR1A 3GEGA 1TNDA 4EYOA 1EFKA 4HLNA 5DN6A 4PFSA 3V2HA 5CEJA 2Y6VA 1VI6A 2CEKA 1X1QA 1TM5E 3H84A 4G24A 4H3KB 3OCZA 4OUDB 1D7OA 3KJFA 3I76A 4R3UC 4DC9A 1DAOA 1XCOA 4M6WA 5FH9A 1WZIA 2XIQA 1T1EA 3WSWA 1G20E 2AD1A 2W90A 1E1QD 2GS9A 4U2DA 2IP2A 4Z8XA 2WF6A 4X1IA 4EUHA 4RJKA 1QK5A 4GRDA 3TD2A 5GZ1A 2VK1A 4A0QA 3TPZA 4EBBA 2FWRA 1LY1A 1WW8A 1Y8AA 2P9BA 3DFFA 1CE8B 2VPQA 2F3RA 3QEOA 4MKRA 4RMNA 3RK1A 3UJPA 5LP6B 4CM1A 3O31A 1CJBA 2OFWA 3LT5A 5SZJA 1DIRA 4LFBB 3RYHA 3WVNA 3MF4A 1JJVA 4GR5A 4OREX 3ZLTA 3L0CA 4JYAB 2J0QA 3QF4A 1DC3A 4H27A 3GT7A 1CT9A 1BXRA 4TLCA 1XEXA 3FWZA 1KXJA 4BNDB 3SHWA 4DCNA 4DLZA 1E7YA 2FRXA 3KJXA 2DCUA 2CDCA 3KQNA 2FXIA 5IU6A 4YAFA 1JIXA 4KEAA 1MIHA 4BFUA 1O6CA 3BA6A 3PPYA 3GRAA 2H1HA 5ITWA 5GJWC 5HMMA 4TXMA 3GLSA 3EODA 2GHRA 2AMFA 4POAA 3FHTA 2QVYX 1P44A 1JYSA 4DHWA 3G6WA 3CUTA 3ZQUA 2AUNA 3EPJA 2X14A 2P5TB 1P1RA 1Q1EA 3GBPA 4U2FA 1JA1A 4JI4B 3SDZA 4PBRA 4KE8A 2AG6A 4IDCA 1TIKA 4QBHA 3IQDB 4YAGA 4XB6B 2BR4A 3F6EX 2CUZA 1XX6A 1F6WA 4LKOA 3T5PA 1IHXA 4NMXB 3G0OA 4NYIQ 4Y2YA 3CTPA 3QPVA 4QLAA 4B31A 4QG3A 5LYYA 1DKMA 3KSRA 1NN3A 3MT9A 5BQOA 1HR0B 1E4OA 5IP5A 3UANA 2W37A 2WTEA 3ZDAA 2Y1DA 3N6RA 4UMVA 3SIPA 3KD3A 2JRLA 4AQYB 4A2CA 3T4XA 1Q19A 3IVCA 3T0IA 4B4OA 3LPLA 4DIMA 4BU1A 2CVPA 1J6UA 1ZRMA 3PUIA 4Y30A 3UICA 4H0FA 3ZN2A 1EWTA 2IPLA 4JD5A 5K0FA 4J07A 4Z53A 2CVQA 4L02A 3EZGA 1G6Q1 1LLQA 2PGXA 3X1WA 4JR0A 3OQNA 5GM2A 3SZRA 1Z0UA 3AF1A 2HIAA 5M29A 2GLTA 4WI1A 1NRJB 3IIEA 4RENA 5A4KA 1UPCA 2EFGA 4X6LA 2Q5IA 2YIMA 4XUDA 3D0KA 4MQBA 2FEOA 5CT6A 2GPWA 1ILEA 1H2FA 3MS4A 3AR9A 1PFVA 1E63A 4D3XA 1XTUA 1X80B 1J00A 3JWPA 4G09A 4LGCA 4HXYA 5TVGA 2FRVA 2VIIA 2Z5LA 1OLXA 3QBTA 4WK4B 2G88A 4B4VA 1NR5A 4BFZA 3CLRD 1W44A 4GI3A 1GARA 4FHGA 4EA7A 1T2FA 1EH5A 3DTYA 2O1XA 3RNLA 4F6RB 3P19A 4MVJP 2NZ8A 1AZLA 2IUTA 3VZDA 1MH9A 2QL5A 1PK9A 4QUAA 2B98A 1NI4A 3HUDA 2WU3A 1YH3A 3T5CA 4QUKA 3PVCA 2P6UA 4K9RA 1WTAA 4KXWA 4F7DA 3RC3A 1UPXA 1D2NA 2HIGA 1QM5A 3M8KA 3D02A 3IILA 2FEAA 2ZYIA 5DGTA 4M0UA 5AUNB 2Q3CA 1N0UA 2PUFA 3U80A 3VM6A 5D5QA 2Z2YA 2G9RA 2RMKA 3RYIB 3W9SA 1H1DA 1Z62A 1Z9BA 1C8LA 1N92A 3HCPA 4Q21A 1ZVJA 3M49A 2J48A 4UBIA 5H68A 1LVGA 3ZXIA 3ZW9A 1RYHA 4KLRA 1SAYA 4UATA 4RK5A 1EFLA 1CUDA 1E9DA 1THZA 5ARBA 2P9QA 2EV9A 3CPHA 3BWDD 4U3JA 1AHNA 1ZN8A 1KI6B 4UCFA 3H1BA 4DM4A 5LPNA 3DDUA 3ZG6A 3HJFA 3I9MA 1T4BA 5H4GA 3HBFA 1QMPA 2M2IA 1USWA 3RAEC 4ZI7A 3H2SA 4TT8A 3CLTD 4U7PB 3FETA 2Q0QA 4X6UA 3MYRA 3NBZC 5DSZA 1NX6A 1HGXA 1GUYA 2ZT8A 4YC7A 5JNTA 4KHZA 5TXGA 1CPYA 4WV3A 2ETXA 2Q9UA 1JNYA 1WVMA 4KDRA 4E6EA 4S2UA 1XMQB 2O2JA 4JYZA 5D3QA 4C7OB 1JHQA 2YVUA 1JDPA 4EBFA 4Z4QA 3IIMA 1AMOA 2YFKA 1FLAA 4N18A 3PWZA 1CUXA 3OZWA 4FIDA 2NXNA 1J8DA 1QHYA 4V38A 1JHUA 5EJGA 2JW5A 2BFEB 4KQFA 3TX6A 1G3RA 3NOXA 2QM0A 3OPNA 2QRLA 2PUEA 3AVUA 1VIMA 3ASVA 2WV9A 4DCCA 3S2SA 1BW9A 7REQA 5HKOA 3FPHA 4DG9A 4D4JA 1CUAA 1ETHA 2MOKA 4DBZA 2AZMA 3JAKA 1U98A 3BGOS 3LUBA 4OHWA 5DV9A 5TQ0B 3R8FA 4DXAA 1JSZA 2JFHA 3ZCRA 4EG8A 3VKGA 4KNYA 2GZMA 3D43A 1JLLA 4PO9A 5FWXA 2OY0A 2W00A 1XTRA 3J80A 4WMLA 1JTFA 2XBUA 2TMGA 3ZNOA 2XXAB 4MJ3A 1ZGAA 4NOJA 3UHFA 1JLKA 1A8IA 3EEBA 2HYDA 2Q1XA 4UUBA 4JVMA 5ALKA 5EC8A 2G5GX 1Z2DA 4P7KA 3BDAA 3F1LA 3PKZA 1IWBB 3R09A 2RH5A 3WDKA 2IVZA 4OYYA 1DRWA 10MHA 1BFUA 3C6XA 1WUHS 2UZAA 4D9JA 2HKIA 1UBCA 5GOZA 4E7PA 2YRXA 1IEWA 4BYMA 1UWKA 3TRHA 1WOYA 4BB0A 1O0CA 3T7KA 1YZNA 4WBNA 1LCIA 4QO7A 4CLOA 4AF8A 5IX8A 4RMJA 1D09A 1ZN9A 3IX7A 2OHVA 3QVKA 2R6DA 1UODA 1VCHA 3A3YA 2AC4A 1Y4ZA 4ZOBA 4DRYA 4O59O 3E82A 5FV4A 5J4YA 3JARB 1ZHOA 4YVFA 1EDBA 5LZ7A 4BP3A 1Y1RA 3SJCA 3CX3A 3FVWA 4WXMA 2FPUA 3ZDBA 4WZAA 4FWIB 2JEOA 5H9VA 1VPWA 2H85A 2NYVA 5KYUA 2ACVA 3H87A 4BJ6A 2WWIA 3FKJA 3A36A 4YJ2B 5DYYA 2BKAA 4AJHA 1JDTA 5JZVA 1MLDA 3A31A 3IAEA 4JWTA 3FYTA 1CR0A 2C2XA 3GMTA 4QUGA 3SYKA 3SZGA 3VDRA 4QDXA 2L19A 5JS6A 2HK9A 1ZOLA 3E03A 3U62A 3UKJA 2AFRA 4Q03A 1XWFA 1BQEA 2ODEA 3BXOA 1GIAA 2OYRA 3WDMA 1RYDA 2X1HA 3KQPA 5CVJA 3FXAA 1GA6A 3CCFA 4WKNA 1WKVA 2VDJA 3L7LA 2FUG6 2ZRMA 3K1AB 3LH5A 4II2A 3PCRB 3VPCA 1JEEA 1TECE 3EXFA 4B40A 1Z0SA 1E96A 4BKUA 2ODBA 2Z5GA 3PJEA 2GK6A 4PLWA 3IVXA 5FPQA 4EFNA 1A9XA 4DUGA 5JAZA 3LQYA 2AYZA 1H2XA 4OQXA 5K3FA 2IY7A 2G4CA 3NDPA 5DCUA 4ABYA 1UOOA 1FQOA 4FUTA 1U0BB 2IYXA 1DIGA 3HFSA 3HU5A 1E6CA 3CBGA 3CNQS 2J9RA 3U13A 2GBIA 4CMGA 3GLGE 2ZE8A 5IS2A 1FBNA 1PR1A 1XZCA 1JILA 4GUDA 4RESA 1XYVA 1VL2A 2I7DA 3KXLA 4ZYWA 3I04A 2TRSB 4HDNB 3ZV3A 2V55B 1HNXB 3C6BA 1L5MA 1A50B 3VHXB 4DQ0A 3DZDA 4I9NA 4BWFB 5IAGA 2C31A 1WDLA 1FNMA 2Y1EA 1PJTA 1Q21A 2YHIA 1CVIA 1Z0FA 3UMYA 1IY1A 2I78A 1F8UA 2E5WA 3FCXA 1QGYA 2CLKB 1ZD5A 2GBFA 3MTGA 1WXFA 5AXAA 4OHZA 5IEBA 5BSUA 1ZMRA 1GEEA 4TXNA 3M1IA 1BG6A 1ZNXA 1E0SA 5ALLA 4DAOA 3PC7A 1WNFA 3I5YA 4QU0A 3UOAB 3N2GB 5LYJB 2IHBA 1CR6A 1K1EA 5BWBA 1E92A 4PBTA 4MGKR 2LW7A 2FCRA 2PJRA 4E4YA 3R7NA 1KAGA 2HA4A 2JKZA 1NUHA 3UQZA 2R1VB 3NHBA 1I2CA 1R5NA 2ZRNA 2WZBA 3HFRA 2OFFA 3WBBA 1NWCA 1P4RA 4Z4GA 4G1CA 1W29A 2UV8A 3RVOA 1L5KA 1TAUA 3L92A 4M1SA 4ARBA 1Q1AA 1PDOA 1OI2A 1X7DA 1WZNA 4G23A 1M34B 4B48A 3UMSA 2REOA 3OZEA 4UTRA 1GAQA 1IB0A 4B2LA 4CLDA 5JNSA 3QX3A 1V8PA 4C4AA 3TINA 2M1XA 1T4GA 1PQWA 4CKWB 4TRNA 2NLOA 4C7XA 2AS0A 1PGJA 1HRDA 1CDDA 5CVVA 4HNUA 1IRIA 1JR4A 2B2NA 3EE6A 3RDPA 2CCKA 3QOYA 3ORQA 5FIUA 5A9SA 2ZI6A 2ZYVX 1AF4A 3B9RA 4L6AA 4ZKDA 4PTLA 5IJ0B 1VJRA 1K7FB 2X0JA 1B73A 1RFGE 5K8VA 1EBFA 2F55A 2ZUTA