3U17A

Structure of base n-terminal domain from acinetobacter baumannii bound to 6-(p-benzoyl)phenyl-1-(pyridin-4-ylmethyl)-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
435
structure length
433
Chain Sequence
KQLIEFVRWSPERAQHYRNKGYWIDQPLTRILTVGVQSHPHSLAIICGERQLSYIELDRLSTNLATRLAEKGLGKGDTALVQLPNVAEFYIVFFALLKAGVVVLNALYSHRQYELNAFIKQIQPKLLIGSRQHEVFSNNQFIDSLHDVNLSPEIILMLNHQATDFGLLDWIETPAETFVDFSSTPADEVAFFQLSGTGTPKLIPRTHNDYDYSVRASAEICGLNSNTRLLCALPAPHNFMLSSPGALGVLHAGGCVVMAPNPEPLNCFSIIQRHQVNMASLVPSAVIMWLEKAAQYKDQIQSLKLLQVGGASFPESLARQVPEVLNCKLQQVFGMAEGLVNYTRLDDSDEQIFTTQGRPISSDDEIKIVDEQYREVPEGEIGMLATRGPYTFCGYYQSPEHNSQVFDEDNYYYSGDLVQRTPDGNLRVVGRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Peptide arylation enzyme
publication title Structure-Activity Relationship of BasE
rcsb
source organism Acinetobacter baumannii
total genus 156
structure length 433
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.2.1.-:
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u17A00
3RIXA 3B7WA 3O83A 4D57A 4W8OA 5BSWA 3EQ6A 3C5EA 4LGCA 1V26A 5BUQA 4FUQA 4RVNA 3RG2A 4OXIA 3ETCA 4E5DA 3ITEA 3U16A 4IR7A 5D6NA 3L8CA 4ISBA 5BUSA 3DAYA 3VNSA 4G37A 4M46A 3E7WA 3WVNA 5GTDA 2WD9A 4D4HA 4GR5A 4IZ6A 5BSUA 4FUTA 3FCEA 3IERA 3E53A 5BSRA 3T5CA 3T5AA 3TSYA 4DG8A 3E7XA 5BSVA 1ULTA 3LGXA 4R1LA 4GS5A 3VNRA 3PBKA 5E7QA 2Y4OA 3FCCA 3DHVA 4WV3A 3NYRA 5DWVA 4R0MA 3GPCA 3O84A 4D56A 3IESA 3A9VA 3G7SA 3NYQA 1V25A 5BSTA 4GR4A 3VNQA 3WV5A 4PZPA 5KEIA 4DG9A 2Y4NA 3WV4A 4GXQA 4D4IA 2Y27A 3U17A 3QYAA 3R44A 5BSMA 4D4GA 4GXRA 4RVOA 3IEPA 3T5BA 3IPLA 3NI2A 2V7BA 3O82A 4R1MA 5BURA 2VZEA 3IVRA
chains in the Genus database with same CATH superfamily
2WY2D 2GUGA 1V39A 1E9AA 1JIQA 4IV8A 3N2EA 1OR8A 3B7WA 5KWEA 5FEMA 2XQFA 3ABQB 5F1KA 3MT0A 4PX5A 4R3UC 4P98A 2PT9A 1Z2EA 4MJXA 4HDKB 4TVSA 2X8JA 2TSYB 2OXCA 3WC4A 1JLRA 1E59A 1IY2A 1HLFA 3U37A 1MHPA 3SDZA 4YRMA 2Q4OA 1Y5MA 5HEKA 5A71A 1WB4A 1PJ4A 5LQCA 4EI2A 1FLNA 1T4CA 2WG1A 4L6CA 3D7LA 1BMQA 1D8AA 1SUDA 1JSRA 3BTOA 3ZV4A 1M1NA 5KBYA 1P9NA 4LF4B 3VKVA 3GK3A 5JD3A 3EUEA 5FX2A 1UBTS 4Q4JB 3LDHA 3QJYA 3TMAA 4KN9S 1WY7A 1F06A 4UFOA 4P7KA 3BCUA 1A82A 2GXUA 5E8RA 1JHOA 4NCKA 1S7GA 1US8A 3JV7A 2B30A 2YCBA 5CDGA 1XZAA 2C84A 2V5AA 3VR3D 3BXZA 3NX4A 2CVPA 2OC4A 4PG4A 2KBFA 2AJTA 4D81A 2VPYA 3FVTA 4ZEVA 2VDLB 2DX7A 4O2BB 2QG9A 3FZEA 3ZHUA 2QRLA 1PKEA 1IBKB 4YCNA 3KQYA 3OM1A 5AI0A 5IRCD 3ETDA 1UOOA 1C4OA 5ADUS 3W2HA 2Q21A 1U2EA 3JQQA 5B2ZA 5JI2E 1VBMA 3D5TA 2BISA 4A0RA 4B44A 4Z51A 1EDOA 1JKJA 1L7BA 2IYUA 2PSEA 2X0JA 2X8LA 3VNUA 4QYWA 1H3NA 4YLGA 3I76A 4BZQA 4C4OA 1ZYUA 1AHIA 3AVYA 3HJFA 2GBPA 4KX3A 1DX6A 4IQFA 4HEA1 1E61A 5DN6D 2CSXA 4NBRA 4EHKA 4EPRA 2PLWA 3U80A 4IFTA 4C4AA 2IXGA 2PMWB 4AG3A 2CFOA 1H85A 3CY6A 4AN4A 4OSPA 2B1GA 2P5SA 1W49A 4ZO8A 4KIUA 4KUGA 5K6AC 1DTSA 2J3MA 3CUSA 2WHEA 3AQIA 1KYYA 3Q9NA 4NECA 4E1AA 5JW6A 5JHHB 3N8NA 2V55B 4IHJF 4WPGA 4AJEA 3EK2A 1DLJA 3FVWA 3CRW1 2QBYB 1NJGA 2ZM5A 1MENA 3N87A 3PJDA 3ZXXA 4Z0NA 2IXBA 2CB0A 2XXAA 2Q4EA 1WF3A 2FJUA 5ICSA 1QCZA 2W2LA 2ZUEA 1T9BA 4E1VA 2VBGA 3PQEA 3ZWMA 3D2LA 1NW6A 2AFHA 1PG2A 4PC3A 3CE9A 2CXXA 3O9ZA 5DM4A 2HOQA 4HQKA 3WHLA 1HTTA 1BJKA 2HH9A 4I50A 4DGQA 1QU2A 2GD6A 2NO4A 3F3SA 4AO8A 4FYXA 3KVRA 5IWCA 2ZSDA 1IQ0A 3QV2A 4GL4A 4DWVA 1VIYA 5CDFE 1UP7A 4C5AA 2Y0DA 3KSZO 3UMCA 2ZIUB 1LSSA 3IEXA 1AGRA 1K6MA 4I99A 3M81A 3RKSA 2P6MA 4YALA 1O0CA 5EE3A 3ZY2A 3BWVA 2AS0A 2AUTA 2XBMA 5DX0A 4WXPA 1ZESA 2D1SA 4YRCA 4HTFA 4XQ9A 2FXVA 2ZJ1A 2BKXA 1DAOA 5B36A 3GAAA 3TLAA 2RHWA 3PNMA 2A7XA 5FAXA 3ZXUB 5CA0F 1B26A 5JASA 1J6UA 3QRWA 5KNBA 2Q2OA 2QD5A 4FCTA 3HJTA 2DWCA 4KQMA 2YJGA 1KYQA 2VJBA 4F93B 4Y2UA 5FWYB 3RGWS 2EHDA 4KO4S 4EFMA 1PQ4A 2EFGA 4JOCA 2YMPA 4D5GA 3PWZA 2K4MA 2IP1A 2NZJA 3N3AC 2CMFA 1LQTA 3FM9A 3L9WA 4UUOA 3TLXA 5A02A 1K4YA 4Y6QA 4NMHA 2P4HX 4F4DA 5EMLA 4AIIA 4BFUA 1NJFA 1DVRA 4UTNA 3VR2A 4LTDA 1JKIA 5HFAA 3MJHA 5ALVA 2ZUFA 4DIUA 2JFVA 2PLRA 4HLNA 4LCBA 3BGOS 4AXXA 1M2OB 5IT0A 3F8WA 5C35A 5EZ5A 2P62A 4JP1A 3OFKA 4L16A 2BUCA 3EVDA 1W5BA 3PUKA 3G0DA 2J5BA 4J1SA 4QOSA 3RTGA 3ZWKA 1MAUA 3S68A 3BEOA 1EXDA 3GC6A 4Z7OB 4Z53A 1YR8A 4PRYA 4IHJB 4LJ6A 1G5HA 3OIVA 4RSRA 3BA6A 1XRPA 2WSBA 4GC5A 4JOQA 3IERA 5LD2C 4TZKA 1E6CA 2ODWA 3LDAA 4L51A 5I8PA 4LKRA 4JOBA 3WO1A 5IFLA 3T5AA 1OXTA 2O2GA 3HPRA 1D09A 3A6KA 3L4KA 2YWDA 4K6HA 1CERA 1P73A 2GKGA 4NVRA 1OI2A 2YHSA 1GAEO 3A4YA 3X1WA 3VSCA 2P65A 3ZNQA 2IH5A 3FIUA 4K9MA 5K0FA 4EB6B 4XH9B 3I92A 5LZ7A 4R2HA 3F2VA 1T2VA 2FFBA 4F3KA 3ZE1B 2F17A 5I4KA 1ZA2A 2RGAA 3P5BA 5BQ5A 3RFXA 2AOUB 4TL6A 2FN7A 2QAGA 1GPYA 4GT1A 2W83A 3GZNB 1LDMA 4M1EA 4TLCA 2ZTLA 3RHTA 3RSSA 1X39A 3H97A 4W6ZA 2JLXA 2ZJZA 5ALGA 3WMGA 1IMOA 1IQRA 1RXEA 4CFZA 3KR1A 4DLAA 1EVIA 4ENRA 5ICMA 4Q4LA 1E1RA 4MR9A 5DOVA 2IXDA 4YJ3F 1Q1GA 4IDAA 3J7AC 5J4YA 4E3WA 1R0RE 4FSHA 1LLQA 1T5SA 4GWKA 5EHNA 3MTBA 1PNRA 5CA0B 4L15A 4MB0A 4S0XA 4KWEA 1KVSA 1DQZA 2P8SA 1MFZA 3A6GA 3LBAA 4J4TA 4XASA 3RVBA 1PWYE 2O8DB 2J31A 4URYR 4D6YA 3DOFA 2A0UA 1U8AA 4LMBA 4LCJA 3T5MA 2O20A 5T8KA 1OYVA 2FEWB 3G2OA 3CX7A 5A4IS 5KOJA 3WLMA 3UQZA 4ZP1A 2DFVA 1PZEA 2N0SA 3SYNA 3UT6A 2FSIA 4I66A 1KY3A 1GNVA 1VE7A 1EEHA 2XAUA 3M3HA 4GRIA 4FFOA 2O7QA 1RWXA 1L4FA 2KWIA 3GJ3A 2UYHA 2C5SA 2ZVDA 2D3TA 1PLJA 1JV2B 4UUPA 3LG2A 4UE3S 5IBRA 2BY4A 1NU8A 2PUAA 2HX1A 1WUKS 1W5AA 2XJ9A 4WZ6A 4ZAVA 1USWA 2YBDA 5FUXA 3PI7A 5CX1A 2ZCUA 2QT0A 5DIFA 2PGOA 5LXTB 2BKEA 2J7PA 3SVTA 1MVLA 3AR2A 3GPBA 4KQGA 4M3NA 2QTTA 4IO0A 2HA7A 3AHGA 3CONA 2QX8A 3PUIA 4QGHA 3GJTA 2OHIA 2P0YA 4HFMA 2OV3A 1F60A 3CNLA 3NEJA 5F76A 5AT1A 1CZRA 1EJBA 2YIVX 1T1IA 1XE3A 1T4DA 3OWXA 5JV5A 4XUEA 3RK0A 2C3MA 4QDZA 4LXGA 2G17A 3K53A 3QXGA 1GQRA 3KHKA 3D0RA 1SBQA 2UVPB 4RMJA 2XLBA 3IHTA 2I33A 1Y7HA 4GP7A 3GVHA 3Q15C 1F17A 2GPWA 3NFYA 1LI4A 1QOPB 4EZIA 3EDYA 1VHQA 1KGSA 5EMMA 2AXQA 5G53C 1IAVA 1ZGHA 1ZZEA 2C4NA 2QE6A 3DSRA 3LC2O 2IF2A 1CUJA 1SR8A 2JJ1A 5BN3A 1B15A 2DY0A 4J90A 3SMQA 2PG3A 1IJBA 4DJEC 5CD9A 4N8SA 3L8HA 4KW7A 4YJGB 1SD5A 2IITA 3OZTA 4YLEA 4BV9A 1A1VA 3B1KA 4YJ3B 3RTBA 1NMQA 3EXG2 1Z0IA 2X14A 4PO8A 1HFJA 2NUTA 4DM4A 1D4AA 1ZQ9A 3W7BA 2FEPA 3MUOA 2CFRA 4D8VA 4RF5A 2FW7A 3SS8A 2DUWA 2PUEA 1Z2NX 4B45A 1RYDA 4RK4A 3D3EA 5ALKA 2I3AA 1LRKA 4I4NA 3SM9A 4LJ8A 3DEZA 5ALMA 4JN6B 1UK9A 4LVNA 1XZLA 4DE5A 1OZGA 5SY9A 1YVRA 1CQIA 4RK1A 4ARBA 4ZZ1A 2D00A 4JEHA 3ZPXA 3L07A 4PCLA 3DR5A 4GL2A 4Y1RB 5IMSA 2ZBEA 2C7QA 5CW1A 2XMPA 2GR9A 3RO7A 4RQUA 3SJ7A 1H93A 2Q2QA 3ZLTA 3WLNA 2Q8NA 5M7EA 5F5LA 4FLMA 2PZEA 2WK1A 4RTKA 4E21A 2BIFA 2JHPA 3AERB 4XQEA 3KAQA 4KPUB 4MW1A 1T8UA 2PZKA 2HGSA 5FNVA 1PR2A 4KXUA 2XYPA 4ZKEA 2E5LB 3ZV5A 1PBTA 3E81A 1VOTA 4RC9A 2I3GA 3HU1A 1OKKD 5D6OA 1FJXA 2REOA 3CZQA 5C7IO 3BIWA 4ZYXA 1RC0A 3IP6A 2RAFA 3T8YA 2HF9A 2Q0QA 3AETB 1EDDA 1PW7A 1LS1A 1T8TA 2F1RA 2QV0A 2WT4A 1KSJA 3F5DA 3Q98A 5CNKA 2HIAA 2RGUA 4YAWA 2QVCA 1RT9A 3OCCA 3VNQA 1ZJWA 2XAAA 2V6GA 3LNTA 2A7QA 1Z4MA 5K8LA 1IWBB 3UJNA 2XOKD 4I4IA 3THYB 3DLBA 1VLVA 1H94A 2G4VA 4DJ5X 3KVOA 5C5IA 4HWSA 3T15A 5BSMA 1JS1X 1OIXA 1W5FA 3C5WP 4XIYA 1H2AS 1N9GA 3GLTA 2QLMA 3LUHA 3ZWCA 5A0VA 4YT4A 5DNDA 3T3OA 1GTRA 4G1UC 1P2UA 4BV3A 2XB8A 4E5KA 4PSDA 2YOGA 3ZDEA 2PL3A 1W4AA 4IRXA 3NHPA 4NICA 1SKYB 4DBLC 1K7XB 3MN1A 3U3KA 3CNHA 4YRBA 5IKMA 3QUAA 1KFBB 2Q49A 3KQSA 5JEEA 2QTBA 4KMSA 2IV2X 3DOEA 2XODA 5EE9A 2OZPA 5LDHA 2R1ZA 3A32A 1FDSA 4LYEA 3C8DA 1BN7A 2Y1XA 4B8ZA 4Q6WA 3I01M 1N2GA 2GN8A 1QM5A 1M3SA 2OEPA 1Q0RA 2CJXA 3BJRA 3BOSA 1SAYA 1GZ7A 4HLUA 3WSVA 4OAQA 5IANA 2PANA 5CNMA 4QQKA 5DULA 1E1KA 1AT1A 1WUHS 5CGQB 1XVUA 1PK7A 4D9NA 3WP1B 4ZI7F 1VHDA 2QL5A 1FYXA 3DMTC 3L8CA 3TKYA 3F98A 3K7EA 1C4XA 1UBGA 1D2CA 2QZ4A 2Y1CA 3JZIA 5JZOA 1KAHA 2Y1OA 2BWJA 4G09A 5IVHA 3MOIA 1L7MA 2FP4A 4L9RA 1EJ0A 3JWGA 1GUFA 1JXAA 1KAMA 1SUSA 1ZM2A 3PNYA 3GYBA 4HWKA 2J5QA 3H3JA 4GPAA 4OSOA 1M5RA 2MSLA 2XGOA 1S3IA 5THXA 1SHKA 1WOYA 2XECA 3QA9A 4N7JA 2QTVB 3X1JA 5B58T 1ARZA 1F7VA 2CHFA 4RHEA 3UUWA 1Y82A 5EWMB 3E35A 3L7CA 5HFNA 1BH2A 4ISCA 3RVKA 2D3WA 1DTWA 3ZNPA 3DBRA 3D7RA 2XWSA 4J9UE 1DFHA 4HAWA 1ODCA 2VUSA 4GECA 1XLVA 1BG6A 1SU6A 3UWOA 4D74A 2WTEA 1QAMA 4KPEC 2QA5A 5BORA 5G2OA 1M5TA 5CDTA 2G1UA 3QVTA 4YYEA 3G2KA 5CFOA 2HPHA 1FNBA 4I14A 3P5SA 1XRRA 4GX1A 4EG6A 2XCSB 2HLDD 1TW2A 4TT3A 3KJIA 3RVLA 1VYUA 1KO7A 3EGWA 4B4WA 4WK6A 1N2IA 5LLSA 1Y63A 3I61A 3QP9A 3PKIA 2QUZA 4RQAA 4DYHA 2QUHA 1FRNA 1U3FA 1YJXA 1ZBDA 5D1HA 5TARA 1AQ6A 1HC7A 2ZETA 2OTCA 1Z62A 2HF8A 3NWJA 1RZ3A 4MYSA 2CKDA 2FGKA 3F47A 3KVNA 2ADOA 4YRIA 1BS2A 4QXPA 2PH5A 3KUUA 2E6KA 4Y7CA 4Z1MD 1ETHA 4NOKA 3LGAA 1J5PA 4XEHA 5DFAA 3E3LA 1C3XA 3K0BA 2X5XA 4IWXA 1R9MA 4PZDA 2IOYA 3EIQA 3EN0A 1P75A 3SJCA 2BP7B 2UUOA 4M49A 3WGUA 2GO1A 4DV3B 3VPHA 3KELA 1ZOPA 4CKBA 1VHTA 3K1AA 4Y9DA 2NU9B 3VZPA 5LNK1 3EPJA 1ZMOA 4KXYA 1O3YA 2LE0A 2QRZA 4LXHA 3ZWWA 5CB4B 1VL6A 3EPPA 2V1UA 1L5QA 2WWRA 3HNRA 2CV0A 1I1HA 4R8KA 3KXKA 1XB2A 3W1EA 2NO0A 3HCNA 3WL8A 1KZ9A 3MCTA 1X0XA 3ER9A 1NQTA 1LQ2A 2NXEA 3MRVA 3ODPA 2HQ1A 2QXYA 3CGWA 2GB4A 3MA0A 2MINA 3DMPA 2VFAA 2VEDA 7YASA 2UYGA 3HU5A 4JJEA 2C8JA 2DFDA 1QZ3A 1U3GA 3OIFA 3RKUA 1VL8A 2J6CA 4BVFA 4GNRA 1SKYE 2Q5OA 2CHVA 1IY9A 3NUQA 3P9CA 5EJGA 5GM1A 4KRFA 4NRDA 4B8YA 1SXJB 4M1KA 3NRJA 5J4LA 1BD3A 1U8FO 4G24A 3EIWA 2RK3A 4RENA 1RKUA 2YJ5A 1QE0A 4RY9A 3WMRA 3BFJA 3NHLA 1U5CA 3E4DA 1N57A 3QUTA 2NZ8A 1AGNA 4GKBA 5ERXA 3WGQA 3WLIA 4Z2AA 4JUFA 8AT1A 4FDUA 1RYEA 1G8YA 4D0RA 1LBEA 4X63A 3EPLA 4MB2A 1VL0A 3G0BA 2AI1A 3KYCA 4HGZA 4LWPA 3DMNA 5CM2Z 4ZDJA 5K1ZA 1JDSA 1ISJA 2YHBA 2V74B 3QVLA 5LSAA 1ZMBA 3AB7A 4MCHA 1O1YA 1EJ6A 4DARA 1MO2A 4DDMA 3EF1A 5AVVA 3ROKA 1HA3A 3UXMA 4M1OA 2DP4E 1NIJA 1SUFA 1JRLA 1K0UA 1W6UA 3QKIA 3U13A 1DJQA 4B33A 2DTXA 4NCHA 2ZE8A 1P2BA 3HCEA 3FFAA 4G25A 4LHVA 4XWWA 3EGDB 1YR9A 2EJUA 4JDUA 4LUCA 1I30A 1G17A 3C6XA 4DMFA 2G4LA 3HBJA 1KHHA 4WZAB 2IWRA 3SZ3A 5DLQC 4E2FA 1BCSA 4DQKA 5LP1A 3PDUA 2GEFA 2IQIA 3OOSA 4MQUA 3OPYB 3M9XA 3OT1B 1KMQA 5KDDA 4YNBA 1JQJC 1P0MA 1N3LA 3LLUA 1OB2A 5A7FA 4FFWA 1K4MA 4BTVA 4UE2A 4CKEA 4NR0A 2C4KA 1TEXA 3NUZA 4CQLA 4NQZA 4UDYX 2X9VA 2HXGA 3F7MA 3TPCA 2HYIC 3BC1A 2RBGA 2Q3JA 4PPGA 1ZH4A 4XCVA 1XYYA 1JT2A 2Z9BA 4CMIA 1B7GO 3EVCA 1JJAA 4BFWA 4Z0TA 3IP8A 1UR5A 2NZWA 3CRMA 3N8DA 4JCOA 1M73E 1V5FA 2A94A 3BRQA 3LHIA 4IXTA 2Q7DA 1FMJA 5HF8A 1DAHA 2G8NA 2HJGA 3JD2A 2IP4A 4DF3A 2YMMA 2VPWA 4E2ZA 2Z5GA 2R7LA 1SVUA 1R88A 3STTA 4F4HA 3K70C 2Y1FA 5JQGB 3ENNA 1N34B 2PKXA 4JR2A 2VWQA 1IM5A 4LQDA 4OQNA 1VI6A 2H2DA 3KNZA 4R1TA 4YAFA 3SCZA 3L7YA 5H82A 2A9PA 1Z88A 4ZHQA 2R1VB 1XL0A 1Y89A 1I3NA 2F8TA 2GF2A 4ND3A 1YQUA 3N8GA 1P4JA 1ISMA 4ARIA 1DAFA 1EGVB 2PMCA 1MV5A 1UKZA 1YL7A 4DEYA 1LGYA 3NAMA 2EWVA 2VL7A 2IBMA 3TRDA 5A1TA 3R7DA 3WGLA 3UWMA 4HK4A 2Q5QA 4I55F 4TLEA 5FO0A 3UTCA 1ATIA 2BFDB 3CH4B 1E4EB 3R6TA 5FBKA 4CODB 2D0OB 2WMDA 1PW5A 1G5TA 1DT5A 1IWOA 1X3SA 5ALEA 1QJCA 3IP1A 1RC1A 1KS9A 2R86A 2FZEA 5AI8A 3WOVA 2H52A 2XCIA 4S12A 4ZOLA 4BTLA 4AZWA 5THKA 5IN4A 1SCIA 2P0AA 3RNLA 4EENA 1GFZA 4KAFA 2W6CX 3EG9A 3KTAA 2NTYC 4HUJA 4I5EA 1GLNA 1LI7A 4WKGA 3LY7A 4DQLA 5EZYA 1ZI8A 2LPMA 3HJHA 2Q07A 3OI7A 2D2EA 1D2NA 1VE5A 1T2NA 2BHLA 2J4CA 1JXMA 1L5KA 4BFSA 1JR3E 4JP8A 3FZQA 1CVIA 3O4FA 4A5SA 4HB2A 4MDHA 5CRIA 1O6GA 4OHOA 2JI9A 4BQQA 4R3WA 2WILA 5CH3A 3K1YA 3OOEA 5KNCH 4UEQA 4DANA 1L7EA 4OB6A 1ZNYA 4P82A 3RT9A 3TLBA 1VCNA 1XCLA 2J9GA 3FVRA 3IRVA 2HDHA 4UAJA 5JWOA 1QZZA 1T4MA 1VDZA 2IHJA 3T7JA 5K6TA 4BV8A 2IX3A 3K70D 1V1MB 1XDUA 4C7OB 2ZJBA 2ZJAA 4R71A 4W5RA 1TB4A 1VTKA 3IILA 3IOCA 1BXRA 4YV7A 3AGPA 3CINA 5ESWA 2RB5A 2IHYA 2Z98A 4OXNA 5TQVA 1EH5A 5KHOC 1R74A 2FPUA 1UMDA 5J1SB 1ESZA 2I80A 3GFSA 1PCXA 4FFVA 4M60A 2ZQ5A 3ZHQA 2VF7A 1JU3A 3L0PA 5FBWB 1BA3A 3TAXA 1YRYE 3DL7A 3JARB 4II7A 5LN1A 1MAAA 1P2VA 1EUQA 1F2TB 2L82A 2C8VA 2ZAGA 2EC5A 1KSGA 2PM8A 4PBTA 1MTZA 3NMUF 4OHYA 3C8HA 1EGQA 4CV2A 4BBJA 5LBTA 1O9GA 4G4IA 4UHBA 1KQGA 5KOYA 2V7QD 2EVWX 5DE3A 2J3QA 2QIPA 2REBA 5TF0A 2PX0A 1RM4A 3N59A 3T5CA 5BQOA 3VFDA 5CFMA 2IXTA 5JQGA 2OP0A 4ZQHA 4U8HA 5KSPA 4HDNA 3RAGA 5K0NA 2R79A 4YC7A 3TQRA 1VGVA 1LRJA 4CKWB 1Z15A 2HA0A 1HT2E 1ORRA 2BMVA 2EP5A 3BSFA 1BA2A 1RYZA 5B6IA 1KWGA 2FLWA 3EVZA 1ZINA 4BJ6A 4UVEA 5JOQA 3PIIA 4HDSB 3QHPA 3WLLA 5I7FA 2FEXA 2JLBA 1NGSA 2JB9A 3U44B 2C42A 1NN3A 1QLJA 2O6HA 3KM0A 2Y4OA 1LX7A 3NNDA 3IOEA 1NBMD 1P1RA 1U2SA 3U4IA 1G3RA 5KTOA 3AOGA 4RL4A 2H1CA 2Z6VA 2O1EA 4WLNA 1HF3A 4OHZA 1J99A 4ARZA 4C4PA 4KQ1A 4XM0A 1FMCA 3GPCA 1EQAA 5IH7A 3RF7A 1CE8A 3E9NA 2VA9A 1OIWA 3IOYA 3H5IA 3F6RA 4HGNA 1V9CA 4BVKA 4ZMRA 4MRMB 2O2EA 4UU8A 1ZM4A 4QU0A 2ORED 1N6NA 5D1NA 2O57A 1VI5A 2X9GA 2OCIA 2NZVG 3NTLA 4B0OA 3QVSA 3L4BC 1I4EB 1OFIA 3F71A 3CVXA 1M34A 3BG5A 2G63A 3PQCA 2C29D 2J3KA 4UHFA 4EZBA 1S3SA 3C39A 1GGHA 1HWYA 2W22A 4DCJA 1TM5E 3JPYA 4KOAA 4EEZA 1AKMA 5G1NA 4MULA 3T95A 1ETUA 3LVBA 4A8HA 4MRRA 4ZOAA 2CLCX 3K0HA 1ZH2A 2ERYA 3TO5A 1UIMA 2PUFA 2CZQA 3FBTA 3CQ9A 1L5SA 3FKJA 3QUQA 4AY6A 1H2EA 5EVJA 1UQTA 2P27A 3H9JA 2AZXA 1FDTA 4H18A 4DLVA 4UOQA 4UTOA 1VJTA 1M1YE 1QS0A 4FWIB 4XWKA 4LJSA 2VSYA 1OLUB 3AH8A 3DCNA 3QVGB 1HDYA 1WG8A 2B36A 3RYFB 2WU4A 4ZODA 3FPEA 3HUDA 4JELA 3ZDYB 3TUJC 5FOQA 1W96A 4OLBA 1V26A 3ERCA 1VJ1A 1COWA 3D3JA 2BZ0A 3KYJB 3CRZA 1FNMA 2GVZC 4LYAA 1DQRA 3WL4A 3EIOA 3F74A 2NU7B 1ZRNA 1E2DA 3L3BA 4NH4A 4XARA 4N5DA 5KJFA 5AM4A 1GRCA 1MNQA 3EQ9A 4DV7B 1CC1S 3N6RA 4QYTA 3Q3EA 1XZBA 4WBSA 1M8FA 1XU4A 2OR3A 1B8NA 3DFFA 1ODLA 3FDFA 2QMYA 4IXWA 4K9SA 3VR4H 1R8SA 5AUNB 1KEPA 2R97A 2ZT5A 1SG6A 4IP0A 4Y9TA 1MQSA 2UU9B 1TYZA 2FLKA 1U63A 2C88A 2R4UA 2R8YA 1YRBA 1VLLA 2IHBA 1B8PA 3SEQA 2W2TA 2FVYA 1YHZA 2MWMA 4XM2A 3IE1A 1U0NA 4RJJA 4M9ZA 3QPDA 3KJHA 1I5RA 1GKKA 4F9TA 3PR1A 1P2TA 3JQCA 4JLKA 5SZHB 3BMNB 5HKOA 4HN2A 1HDOA 5JWHA 3NRCA 3LOQA 4A3SA 2NYUA 4E12A 4C7VA 1D7OA 3SFVA 2OVBA 2BF4A 3OEED 1IEQA 2G71A 1KSHA 5BQPA 1GUBA 1FFEA 1ICIA 1L1QA 1FFBA 3TIIA 1PTJA 5FPPA 2VNIA 2P68A 1IYZA 4YRJA 3MWLA 4PTZA 4PZLA 1OZHA 4MDFA 3IEVA 1T9GS 5CPBA 3OLWA 2AG0A 2CEAA 3CUKA 4E70A 3I1FA 1FUUA 3CB4A 3KV3O 4BNKA 4BX3A 3KAPA 2A0XA 2W7TA 1JTFA 2H6EA 3TNYA 1TVKA 4KSCA 2QRKA 1MB2A 1P5JA 5T4BA 3RSCA 3WGNA 2GA9A 2BFAA 2A3NA 1WF6A 2Q9AA 2RJOA 1O8CA 4IQ4A 3TQQA 1U0EA 4R98A 1J9ZA 1QGOA 1XLTC 4KACA 4B46A 2WHPB 1V9LA 1MH1A 3ELUA 2IZ5A 2Q9CA 3B12A 3H0CA 3JQ7B 1PUIA 1VMEA 1Z0JA 2A58A 2OESA 4ZEXA 5FJJA 3V4LA 4S1PA 4JHLA 3BGSA 4HKTA 2ZRLA 1EEXB 2BE9A 5IEBA 2KPOA 5EIBD 1T2AA 2PAFA 4CRWB 3N7AA 4YI5A 3DLTA 2HUPA 3NH6A 3QEJA 3RVSA 4Y0VA 3FNHA 4B9AA 3NKVA 4BVEA 1MQ8B 4PCUA 1XPJA 1ZNWA 3GJQA 4JXJA 2FRXA 4Q47A 1SXIA 2B2CA 3B3JA 2JCSA 2Z3VA 3DMYA 3FVQA 1BAPA 1QH0A 2PWAA 4P80A 2M98A 3DE0X 3B53X 3ZVNA 2AW5A 2BEUB 2E49A 2OCDA 5TF4A 3C3DA 4DIDA 3IBYA 1RXUA 4JWTA 1R0LA 2O06A 3LUFA 4YRNA 3MTGA 4KBFA 1HNXB 3HVHA 1UBSB 1GRNA 2V9PA 1NUPA 4Y0AA 5AO9A 2P4UA 2VQSA 1EWVA 3U7QA 1X8KA 3BMXA 1XNHA 3PHHA 4RAQA 3I6IA 3QVXA 3Q1LA 4M86A 2Z2KA 2Z4SA 3A0RB 2EBHX 4Y18A 3BZUA 5DHFA 5I9MA 4QJ3A 5KTSA 1ISRA 1F5SA 3HRIA 1FS4A 1FFCA 2FSGA 1FSZA 4U0JA 4N8EA 5IDQA 4B8WA 2Q7XA 4N6GA 1DCKA 3L77A 3TQSA 5CB6A 5CIYA 1HQYE 4DBZA 3I45A 1NBAA 1IIBA 1FQJA 3HDVA 5F78A 4Q4JA 1F2DA 3HUUA 4KYVA 4F97A 4EYSA 3HWRA 1V9SA 2Z5FA 2VP6A 3QKSB 2XJ4A 4I9NA 4MKIA 4O4LF 3VOBA 1QORA 1OV4A 1KDPA 1UFQA 3L7IA 5LLTA 1JQEA 1T26A 4UAUA 2FX5A 3OZFA 4JC0A 3NYWA 4B71A 4LX0A 5HUHA 3HP1A 4KKVA 5EP3A 3U1TA 3W5UA 5BUSA 2JLVA 2GTHA 1Q3TA 2VP4A 2C77A 2QLTA 3FF1A 3HZZA 3WGTA 1ZUWA 3DD1A 3GRCA 4G5HA 4I2VA 4O2BA 5HGJA 1KFEB 4GM1A 4YCDA 4EKYA 3T5DA 3ZD9A 4AWXA 3FTPA 2AGVA 5FOXA 3SIXA 4RW0A 1CVLA 1U7HA 1ENOA 3MAGA 4M8NE 3V80A 1GQFA 3P27A 4RGQA 3GUYA 5T64A 5EESA 3K1ZA 3E1GA 1BTOA 1JMKC 3QX8A 3T99A 3DFZA 2FR8A 1WULS 4EPVA 2QT9A 4U2BA 3GUUA 4UU7A 3R9IA 4IQ0A 2VDJA 3EHDA 4FYHA 3CLHA 1FUKA 4NV0A 4TKVB 4A8JC 2H4XA 4FSXA 3ZV7A 4AF7A 1ZHOA 3AUSA 821PA 2AR0A 3MT8A 2LXNA 2I3BA 3DNMA 5JJBA 2Z2YA 1YNSA 4YMGA 2JHGA 2B4YA 3AYZB 4FT4A 3EH2A 3WLSA 2PAAA 3T38A 3DV0B 1N8KA 4Y6GB 2ZQZA 2JIMA 3GT4A 1S1MA 4GOKA 4QGBA 5CVVA 4FNMA 3R9XB 1Q19A 4R1QA 1JIUA 2R1TB 5K8CA 3QENA 2OE2A 1J2EA 4F6RA 5ALZA 2ICAA 5IKXA 3H8SA 4MI6A 5JVDB 2DZDA 1SXGA 1J2YA 3JYHA 4B3RB 4KV9A 1YTLA 1NMYA 4NPAA 2FWAA 4YRKA 1UBMS 3AR3A 3O93A 4L07A 4I4TA 5AJVB 5FLYA 4K05A 3DZIA 1FX0B 1G9TA 1U7TA 3KG2A 1LPNA 2DFTA 2UZAA 1QFYA 3G3EA 4IW3B 4HFJA 3H3XA 2AYYA 4ND7A 3H2ZA 1A96A 5H3LA 1ZR4A 4AJPA 2W98A 1O95D 2W6JA 2AQHA 5ED0A 2I8CA 2WTMA 1YZUA 4FIDA 4LMPA 1NNUA 3A9UA 4MX8A 5DGDA 1KR2A 4JR0A 4N12A 4BN4A 4O4LB 3ACCA 4FR0A 4UHDA 3X3HA 4NSNA 4LRQA 5JXIA 1LBSA 1DDOA 2ZUVA 4ZAFA 4NOLA 1RWPA 4IIFA 1Y33E 2OWEA 3BN3A 4MV6A 5LQAA 3IEPA 3ASYA 1WDWB 1GZVA 1Y9EA 3BB4A 1H9CA 1O5IA 1NLMA 3NVDA 5ERYA 2BKAA 1HEUA 4QM6A 5TB5A 1Z18A 2HNBA 5TGDA 2OKCA 1P44A 2BTOA 1P4RA 2C97A 2VJOA 1TKRA 4TKZA 5F51A 2ZZMA 1N6HA 2D1YA 2V3WA 4I8DA 3FFBA 5FWYA 3WSTA 5I9LA 4D25A 2L0XA 4ZWNA 3BILA 5EEGA 3WQHA 4WQMA 4K6FA 4KO8A 4ZARA 4FEYA 3KFLA 1M66A 4QXQA 2WA2A 1M2VA 3HXLA 2HJ9A 5CFLA 6REQA 1Q1EA 3I2KA 2I6UA 1FU4A 1E32A 4MYHA 3T7EA 4MR8B 4IYJA 1OBFO 4W5WA 1VG0B 1R5BA 3ZU3A 1G7SA 1SBYA 3GQVA 1DC4A 2P67A 4N3AA 4RK0A 1XG5A 1SVKA 3EJ6A 4MAMA 1ZC3A 1M2OA 4EKIA 1NKVA 2H7XA 1BGVA 1YAJA 2YV4A 4RIEA 5E9JA 1MJNA 4X00A 4Z9BA 3QVUA 3WICA 1Y6FA 2H7VA 4GDFA 1GARA 1GU1A 2EJVA 2PD4A 4FFBB 1YBMA 1XNGA 2I8AA 2B4KA 3HGTA 4UNQA 1KZGB 1E79A 1ZRMA 4O4JF 1DU4A 4G37A 4IHJA 2ATEA 1DZIA 3GH3A 2ZPAA 3AKYA 4P34A 5JADA 2HBQA 3WVNA 2F1HA 3M6AA 1LV7A 1VMAA 5GJCA 1Z2AA 3P4UA 1GT91 3VMMA 4E11A 1QTNA 2JJ8A 3EWSA 3RS5A 2VZ8A 3EPRA 4EMUA 1WHSA 2AI3A 4G1FA 2X0DA 2L18A 4DSAA 4B3CA 4CI9A 4CF4A 2Q6LA 3FE2A 2HDOA 4EABA 3UOWA 1L4EA 1EK0A 5I5EA 3BJEA 2QZZA 2NX2A 4WIAA 1SM4A 1Q12A 2B21A 3AJEA 5TMDA 4Y2TA 1SCDA 2AA3A 1XTQA 2I2CA 2O2HA 2AOUA 1IUKA 1J9EA 2QXTA 3GZNA 3HCAA 1JTVA 4KGZA 3WYCA 5LKAA 3RHSA 1VMKA 4LIPD 2AC4A 4G0ZA 3PFFA 5LZ5A 3AESB 3T1NA 1P9RA 5LKRA 4NARA 3WK4A 1GUZA 4XQ0A 5D00A 5BXYA 1RJ9A 5LD2B 4BEWA 3AM3A 3OM0A 1E7QA 1EAYA 2E2WA 4RGYA 2HU8A 3Q3JB 3ZU5A 2CF6A 1L5RA 1J8FA 1VCHA 3LLVA 3KB6A 5DI3B 3HN6A 5CA0A 2H54A 3KKPA 3SZOA 4Q1FA 3RVJA 1CUSA 4HGRA 4M0DA 4Q5IA 3TTXA 2QQ5A 1UJ2A 4B48A 5DYWA 4CKCB 3KOWA 2CWWA 4D92A 5TE9A 3EA0A 4GLLA 3ZIAD 4H08A 2G9QA 1USIA 3ILXA 3M2TA 2G6BA 2OB1A 2YYAA 1VP9A 1NFFA 5K3SA 5C4GB 1ZUIA 1FL9A 1U9IC 1W94A 4KYIB 4J9VA 5A3QA 3W5DA 5G02A 1U0FA 5AVXA 5A1JA 2ES4A 3HACA 2OQ2A 2ZIGA 1U2DA 2Z8YM 5EHQA 3NTVA 1NXQA 3P2EA 1HFEL 4OCZA 1FVFA 5CGZA 2NT3A 1ZK1A 3E05A 4XYLA 1GTZA 1R8YA 4G6ZA 5JUWA 4KBYA 4XD7D 2YN0A 3LO5A 3SHFA 6YASA 2XMQA 5FLXA 4NONA 5LXTA 3DE2X 4PRLA 2IW1A 3D81A 3IVXA 2YJTD 4OSEA 2JAPA 1NUAA 3SQNA 4IGIA 3MERA 4F5WA 4O4JB 1EZZA 1Q0UA 1YB2A 2WT8A 3KE8A 1LK7A 3O8OB 4AJNA 3ZHVA 1LBQA 2D1RA 5KYUB 1JUDA 4P54A 1C80A 4BMOB 3HR7A 3RD5A 3HXKA 4AQYB 1FDUA 5JRJA 1JG2A 1ZR2A 2WUGA 2OG2A 2V3VA 5HRCA 1S6YA 5M34A 3J81k 2XCQA 3CKLA 4DDKA 2J09A 2JA1A 3KTOA 4LNUA 3M1YA 4IBOA 3B20A 2WE7A 3PZRA 4ZAYA 3ZGLA 4B7XA 3OX3A 3JYOA 1JHXA 2PR2A 1Z4PX 2BSXA 4GF5A 4FVTA 2I7TA 1FTSA 2XE4A 1X86B 4WLUA 1QHSA 1AD2A 1EHCA 4NLLA 1TA9A 2NPOA 3IEUA 1JDJA 2A84A 2C3YA 4KN5A 3RK1A 1GYPA 1Y81A 2H08A 3QX9A 5ALFA 3S40A 3AF6A 1Z7BA 4FD3A 4QODA 5IBPA 1DRUA 1AN9A 2JLQA 4JV5B 2C7VA 2B78A 3P0FA 4TL9A 4YJGA 4B40A 3RRXA 2PU7A 3W9BA 1YZLA 4HRAA 1C0PA 3FF4A 1FNCA 3LIPA 3NJRA 4JI1B 2QVZX 2W70A 1JQ5A 3RUIA 3THRA 3WBBA 1MC4A 4IDGA 5DSXA 3HKBB 3GLHE 1T9AA 4YUZA 1PJRA 3C6ZA 5JCPA 3JWHA 3P0JA 5ITWA 3R20A 4RZHA 1G38A 1J2TA 2AG1A 3CEHA 4UUNA 2XKBA 1R3UA 2ZJ6A 1SOAA 1WSAA 1FVOA 1YI1A 1WV1A 3HXPA 3NBZC 2C9BA 5FI5A 5ARDA 4DY4A 5BPHA 1KI2A 1Y1KE 2ZBQA 2O14A 2RAUA 4EHBA 4DUYB 4Y1RA 2QJRA 4HPJB 1PQPA 3NORA 3OE5A 1HZZC 3F78A 4HUQB 1KZ6A 2ZIZA 4IXDA 2J08A 4QYXA 4YRPA 1NU6A 4CM1A 2O54A 2W2PA 1EHIA 5G3ZA 5BQXA 2BVNA 3JALB 3LIIA 3AERA 4EM6A 4KPUA 2O0LA 4YBZA 3K9CA 1HPLA 3STWA 4KXWA 3DAPA 2YICA 2VT3A 3EJWA 2JIPA 3OQ6A 4OTZA 2Q99A 4UC0A 5AKJA 3LLMA 5AQEA 4ADSG 1MA3A 3PD0A 1ZGZA 1EWTA 1A9SA 1ORTA 3OMLA 2AR9A 4FKBA 5F1OA 4D44A 1ISGA 3M5PA 4FB5A 2C9OA 1QMPA 4ZQGA 1UZMA 3V1UA 3R3UA 3ELYA 1SQ6A 1MB9A 1YQDA 2H3EA 2QT1A 2YXBA 4ND2A 5HG0A 8ABPA 3BRWA 1XRQA 3HB4X 2ZOSA 1DEXA 1M76A 2XWJI 2CLOB 4JT2A 4LYJA 3PXDA 1C1YA 2DBRA 3P9XA 4V38A 1DHTA 1KS2A 4YMSA 3THYA 1D5WA 4J7CA 1X2BA 5DU2A 1E8DA 3ANYB 2NT4A 3WS7A 5TIIA 1I3OA 3WZMA 1W7AA 2C3OA 2IDJA 3GP5A 2Q3DA 5DT2A 1EFKA 2P2LA 3FCUB 4F60A 2FFHA 1GZSA 1P17A 2HPAA 5EJAA 5JAHA 4L02A 4H59A 1V6SA 2AT1A 3AWIA 4AO6A 2ABWA 2B6NA 2I6QA 1T5HX 2MSEB 1RWWA 2VTEA 1T6NA 3VDRA 1NI4B 1ZN2A 1S9DA 2JPDA 4N18A 3MWJA 1Y9JA 1EVEA 3SDSA 1OTXA 3G6WA 4CKCA 2B20A 3PIRA 3CTPA 1UM9B 3H3FA 4Y2RA 3KZMA 1TUEA 3GB9A 1B74A 3HBNA 2IPMA 3OJEA 4GU5A 2XUPA 4XQCA 3THOA 4GMKA 4B0PA 2RHDA 4BEBA 3BS4A 2VJAA 3ENZA 5HCIA 4G0PA 1A8QA 5SV2A 4YV0A 1TU3A 5EIAA 1FP4B 2HA3A 4YAGA 2R2AA 4F3NA 2DCUA 1GL7A 1L5ZA 1DIAA 2K7ZA 3KKNA 1B2RA 4BL5A 1VG8A 2CNOA 3ZUPA 1NVDA 5IC4A 3TL2A 4Q3OA 4WCFA 3GWZA 1LBHA 5EZSA 2R25B 1F3LA 1HKUA 2P7IA 4KVGA 4TTSA 4JD5A 1NPDA 2DC1A 4ISBA 1YB1A 4NZPA 2QNBA 2R44A 4QM7A 4WH0A 5DVZA 4WK2B 1IATA 3I2IA 2W6ID 1ZJ4A 4MW0A 5JANA 2CE2X 4IILA 3U3ZA 2Q0XA 5EWMA 4CCAA 1N5LA 1QO0D 3K8OE 4QEDA 2VTBA 4DCCA 2G82A 3FJ1A 4DV1B 4B35A 3IODA 5BPFA 2HBZA 5E1DA 2W2KB 4JU8A 2BJHA 4QSHA 3IC5A 5JSYA 1E5XA 4C2TA 3E5HA 4ZTBA 3GAMA 4NAUA 4XVHA 2HB6A 1W0KD 4AC9A 4FMCF 4EL5A 2QD1A 3F96A 3MBIA 1NX9A 3C48A 1KI6B 5K0LA 2BGLA 3F6PA 4AMGA 4M88A 3QNWA 2A5DA 3N0TA 1BFKA 4G5RA 1ZNXA 4DGSA 2DBYA 3E7XA 4OKSA 3HYTA 4PPQA 3FMFA 1PDWA 4TQ9A 5DXFA 3K5PA 3RQSA 3DHYA 4EMBA 4KFUA 2JJQA 1U8YA 2LIVA 1X9HA 1BJRE 1DOAA 1KFJB 1OJLA 1S89A 2HUNA 3BMCA 3CLRD 1IE3A 3MLEA 3QU4A 4P7JA 3ZV3A 2DSTA 1K4KA 5GZ6A 4IQGA 1CUBA 3O1IC 3PJRA 4JLBA 2FTKE 1MLDA 3IQFA 2C5FA 3TLMA 4RFLA 4AZ3B 4FW8A 1E3TA 1CULC 1VXRA 3UVEA 3NOQA 4M7RA 1DKMA 2JGFA 2V45A 2WYUA 4Q9IA 1KZHA 4AM8A 1CEEA 3LUBA 4EJ2A 1WVGA 2NO5A 1EZ4A 2FOXA 2B7BA 2J3IA 3IALA 4RTJA 4EG0A 3GIWA 1RI5A 4BMSA 1GZDA 2BP7A 1U1DA 1F2UB 1ULAA 2FZKA 4QDTA 4EYGA 3T0FA 3P9KA 3IAAA 3BERA 3EE6A 3QYFA 4UZFA 2BMWA 4WOBA 2WF5A 2NU9A 3CLSD 3O4JA 3N8IA 3OOYA 5HIAA 5CB4A 1QB7A 2YNMC 2CFIA 3GJ7A 3LTNC 5A0FA 4QHYA 3ZI7A 4DCNA 3IBGA 3V55A 3GROA 2P3SA 1NYLA 3Q4GA 3RUFA 1N6KA 1R50A 3MFYA 4MPTA 4I3HA 1PJ8A 4OBWA 6ADHA 3AV3A 2PZFA 3LGSA 4TXJA 2XEXA 4KIFA 4AS3A 5KDOA 3FYHA 1SWWA 1UWVA 3OPNA 2O2ZA 2MHCA 1QX3A 2XBLA 5JC1A 1WU8A 3RDPA 1P60A 4LRUA 4JGGA 4JQCA 1KKLA 4TPKA 3IDQA 1I1OA 5HKKD 3NQ41 1XMOB 1Q7EA 1SXJA 5KWSA 2GCGA 3C4QA 3IQIX 1D0VA 3L04A 4TV8F 2VZLA 3R5KA 1JR3A 3AB3A 5JSQA 2VP3A 1IZZA 4RLSA 5CT8A 4GE0A 2QUAA 3A8TA 3BK2A 2W9XA 3WHIA 4ZPXA 5ARBA 2DLCX 3H87A 2VDNB 4FMCB 4JODA 2POQX 3EQ6A 3ZY5A 1DIGA 5IJZA 1W29A 5IK2A 1WM1A 4RJKA 3V2UA 1AMUA 3I64A 1E6KA 4DNXA 2QYSA 1RD4A 1Z4KA 4XTCS 1OGJA 1S0UA 3U7RA 1V8OA 2GCPA 3ETGA 4G5GA 1LPSA 4UREA 4RVNA 5G40A 2FWNA 4U3JB 4AZ0B 1O94D 1FC0A 1WDTA 3GZ4A 3QLTA 3H4VA 2FV8A 3HC7A 2OLEA 3OZUA 1QNLA 2QDXA 3EGDA 2XEDA 2AJBA 1TCCA 3WBJA 5K51A 4HYYA 3NNSA 1LPOA 1FSGA 3DO8A 4WZAA 3DBHA 3H2GA 3LZCA 4UVIA 1FUIA 4DSZA 1Z4NA 4BZWA 4JQZA 3OT1A 1D1QA 3IUNA 5T4EA 1DG1G 5FORA 1YXMA 1DUIA 2D54A 2FLVA 3L46A 4H0CA 4LCEA 3JZMA 4MQ5A 5J63A 5ALPA 2RH5A 4KE6A 4MWDA 1DBVO 2JEYA 3JYLA 3BH6A 5AKYA 4EVIA 3ZK8A 1VJCA 3H2YA 3INYA 5IF3A 3OQBA 4E31A 3C3MA 4UM5A 4A0HA 2P6PA 4X90A 3SYRA 3UYKA 5HJ7A 1NF8A 5K03A 5LZ2A 3Q7QA 3I23A 3KAKA 3P9RA 1PGJA 4JA0A 1MO4A 2WJWA 4RCVA 4CMEA 4ZRMA 3GY0A 1HURA 1A97A 1Q20A 1GITA 5EIEA 3BL5A 2V7GA 4X7MA 2ZJ7A 1ZK4A 2JRCA 3TLZA 3FFXA 1IULA 3V1MA 2C2YA 3P9QA 3PS9A 4B32A 4OJQA 2EYQA 5EQFA 2FDCA 2HF7A 2P9BA 2XXJA 3KLBA 2ODQA 3QFHA 1CIPA 4IJWA 4BB6A 1NOKA 1GZHB 3OLXA 4P2GA 1H2BA 3HCBA 3PHJA 4HGPA 2CL5A 5JJKA 3HR8A 2BEVB 3L5OA 2PJDA 4OI4A 1RKBA 3EG5A 3MS7A 5UKDA 1IOWA 5B1SA 3L92A 3L4EA 5MF6A 4KQHA 3U3JA 1ZSVA 5C8YB 4DRYA 3WWPA 4PGHA 4U4AA 4B6GA 1D0SA 2FPLA 1XWFA 2A59A 1PZGA 4F06A 1QR6A 3UUEA 2XDWA 3PJEA 3L6OO 4QLBA 3BXHA 1HXHA 3LCUA 1E4EA 4JL5A 1DRWA 4G65A 5TVKA 1GM5A 1J8DA 1FFDA 1T6ZA 3WLFA 4Z4CA 2JLYA 3OZIA 1M2JA 2CNWD 4WN9B 4B6FA 3QU2A 1D4ZA 1Q1QA 3DTVD 3JD0A 3AX6A 2VZ9A 3E3MA 1G6KA 4XPIB 1TIPA 3CKKA 1RADA 3EZ6A 4Q9NA 4QXOA 1KJ9A 4YQEA 1ANKA 3FNQA 1JHYA 4DIMA 1C7RA 2PKQP 2RHOA 3HDQA 4R2IA 4HADA 1L6RA 5ILOA 4ZT3A 1ZG3A 1E8MA 5K0SA 2PZ8A 3OEHD 1DKOA 4RZQA 4NBKA 2GF9A 1M1YA 4QUDA 1P7PA 4EG5A 2QG6A 4OM8A 1OFUA 3JVDA 4ESOA 1V5IA 1ZK2A 2QAIA 4CIYA 2GYYA 1W73A 2ZT8A 4FOOA 2X2EA 2H16A 2OBMA 1QFZA 1WSDA 1QP7A 2ZT7A 2XCOA 3VC2A 1JKXA 3TAHA 5F7OA 2QJOA 2WF8A 2GD1O 3WKDA 3PFWO 3QXJA 1DBWA 4LNAA 4MPDA 3EAQA 2CXQA 5GGYA 5KTRA 1FFHA 5JAPA 4IIDA 3JQ9A 4PC2A 2Q0SA 3NCTA 4QSMA 1V1MA 3C7KA 2YFKA 1E2NA 1G3UA 4K6KA 3UFXB 4C7OA 3P4XA 1E2JA 4J43A 2VT6A 3DLAA 3CZRA 1CJBA 1U2RA 3OMWA 5NLLA 4LTNA 1WXWA 2HIHA 2JGDB 3ROPA 5I7VA 2H4WA 4XRGA 1GFWA 1WEHA 3TN7A 3K6SB 3O8RA 4BIMA 1UL1X 2WYIA 1ECCA 3LAWA 3QFCA 3REQB 4D02A 4AMVA 2BCEA 2IEZA 2P1DA 3TEFA 4MWZA 2OD7A 4IHQA 2EARA 3ECAA 1F2TA 2IEYA 3RYIB 1WS6A 4AY5A 2QRGA 1ZPDA 3ITKA 3VH3A 5DM1A 1S2LA 2O59A 2RHBA 1EJ2A 3GVPA 4UHKA 1Z17A 4F1JA 1FDVA 1OFVA 2KS6A 4P08A 4CF6A 3LUKA 4B7CA 2RGEA 1M7BA 1BQEA 2OVFA 1B2LA 3NVKI 4RD1A 3S8YA 3VNVA 1DAGA 2C1XA 3H6GA 2OWDA 3DVRX 4XGKA 3PXUA 4M53A 3WLQA 3DKVA 5KCMA 4CKWA 2ZITA 4OHFA 5HMMA 3NDRA 3VR4A 4RZ2A 2D74A 3HV0A 2J87A 2JGLA 2JAUA 3LBNA 4Z9FA 3VH4A 2JC3A 2VVTA 3MJCA 5FBHA 1EGMB 5HIJA 4I1PA 1JG6A 2AX3A 4EARA 1MZPA 4FB4A 1Z13A 1G0NA 1Y4SA 4TUYF 3OE1A 1XTTA 4OP3A 3TNJA 2NWQA 1JEAA 5EPEA 5I9BA 3BWDD 5B1HA 3A6HA 2I7DA 2NUBA 2B94A 2ENWA 4TL8A 1JIKA 1QYWA 3HI6A 2J5RA 1Q14A 4R51A 3AUFA 2C0CA 5DNWA 1E6EA 2WC1A 2XNJA 3ELBA 1VG9B 3HKDB 4HC4A 5I7AA 5DK6A 1H42A 2C7GA 2PKRA 4V0RA 4S35A 5E3JA 4ZJZA 3E9CA 3QELB 5FPKA 1GOTA 4ZXFA 3C6QA 3RSOA 3KP1A 1YS6A 4PZAA 4RPGA 2EKPA 4Y6PA 4FKZA 4RD4A 1K68A 3OY2A 4EW3A 2HSWA 3T3HA 1CJTC 1Z36A 2X76A 3BTSA 1U0LA 4BBAA 2XQJA 4W7IA 2PMDA 4YMWA 3ZZMA 1BDJA 1RJDA 5TV2A 2AWOA 2XKKA 1KYXA 1X42A 1MU0A 2OY0A 2O0JA 4L08A 5CT4A 4CKZA 3GLFB 4ZVPA 1P0FA 4R84A 2IS4A 1A2QA 2P5YA 1HT1E 2ACVA 4UBNA 3ZDFA 4CTJA 3REGA 2YN4A 3RFTA 3L1UA 2I6TA 3KDAA 3P1JA 1P2GA 1Z29A 1ZWLA 4QOEA 3M4NA 4U1RA 1L5OA 4UW9A 5GWXA 3EA5A 3P7MA 3ROGA 3QZUA 1OZFA 2WWYA 3GLSA 1G7CA 1MUUA 1RM5A 3EX7C 4ZANA 2ZAMA 3R7SA 1YZVA 4FZ5A 1H2WA 3DTYA 1OI7A 2MSWA 3KR0A 4QHTA 2B8EA 3AW9A 3D7SA 4BE9A 3UICA 1JBQA 5C46F 1E9VA 2M6KA 3TQOA 3W9YA 1GLGA 3M5CA 1DELA 5HDQA 1WMBA 1LTKA 2YJZA 2PGNA 3G2LA 2FWRA 4GOLD 1XKTA 4N4AA 1PK8A 4KXNA 1J39A 5LBUA 3UKJA 1LPPA 3HG7A 4BJHB 4I9GA 1KU6A 1RQ2A 4LWQA 2OFFA 2R7AA 2NU7A 4CG3A 4U7DA 2CDRA 5J2UF 3VAAA 3EEYA 4CI0B 1TMKA 2NYRA 4X66B 4QYSA 1OCEA 2Z9DA 2C96A 5AJZA 3UT5B 1UFVA 1KETA 5K8IA 4IG9A 2VN8A 3VVMA 2ZATA 1JX6A 4CIBA 2G28A 3LFUA 4U5XA 4JX9A 3A6EA 2Y67A 3FCSB 3RABA 1Z7WA 3KPWA 4YUAA 5HCNA 3QLUC 1KJNA 2HADA 3IP5A 3WGJA 2G9RA 3UAYA 2O0KA 2X4GA 4E4RA 1RWVA 3QWFA 3A1UA 3LKZA 4R0NA 2PA3A 1ZW6A 4ZI2A 5JZMA 3DW3X 1NBME 1XEFA 4NFSA 1OI4A 2GUWA 3NM6B 4JBXA 3CJRA 4TWZA 1SEVA 2XZTA 4MK4A 4BFVA 4NBLA 1H6AA 2XTAA 3PE6A 5K4AA 1SZPA 1TMGE 4MWGA 2I4TA 3N2KA 1IWPB 2V7TA 2QTMA 4BEJA 2ANCA 4MI3A 5JFGA 1LSOA 4HEQA 1AQNA 4D26A 5E9AA 1K6XA 4WK4B 4QXMA 4DR2B 2Y0CA 3PHLA 4DYDA 2XVYA 3O2SB 2JDIA 2OAGA 4M8IA 5HXAA 3LL4A 1N32B 4JXKA 1G1MA 5DMXA 5IBQA 4HS4A 1DO8A 2E0IA 2OM6A 2I4NA 4K9DA 1JPVA 4O59O 2G8LA 1QPZA 1XTZA 1RQRA 3JASB 3M5DA 4MYUA 4EAQA 2GK4A 4M0EA 3CX3A 1G8AA 3OESA 4HH3C 3STVA 4RV9A 4KQCA 4ZIRB 2ON6A 1EFCA 3VR6D 4EG1A 2CMHA 2ZWAA 1XK6A 4UXHA 4IRMA 4J76A 4ZQEA 2QEQA 5A4FS 4V0KA 3PEVA 2FUCA 4WXRA 3ITDA 4HQRA 3USCS 4EUNA 3SLGA 3AU9A 4DMRA 1AHPA 2CD7A 1YCDA 3UANA 1SU7A 2FKAA 1KDZA 4ZJUA 4LY6A 3W5VA 3N0RA 4ZAZA 5B1YA 2PMKA 4IMRA 1RWMA 4FMPA 1DKLA 4YDSA 2HQOA 5J2UB 4ENQA 4RVSA 4RJ2A 1RAFA 1M6EX 1UJ5A 2BEUA 3GLIB 1NVKA 2R2GA 3DW1X 4LJYA 2CBXA 5IH3A 2R6HA 1KNXA 4QC2A 1T9KA 2XE8A 2C0QA 4WGFA 3GLFE 3W2EA 1E6WA 1KEVA 2HI0A 1EVQA 2OBBA 4MW9A 3VR3A 1CW2B 2ZJ3A 3TQCA 2WUWE 1MGPA 4ZZ2A 4Q24A 2WDPA 4MA0A 3VPDA 3CVUA 2WWXA 1DOZA 3GX1A 5AICA 1DC8A 2IHUA 2Z56A 2JATA 5CR9A 1EX9A 3N07A 3NEAA 1G21B 3EW9A 3IKVA 5KKNB 5FHRA 2B61A 1UC4B 3F9CA 4JS0A 2PJRA 2HK9A 4R16A 3H9GA 3BGWA 5ESDA 2GARA 4DLKA 2YH2A 4ME6A 4DJJA 2YY5A 5DM0A 3WK9A 4TMXA 2G07A 5LA6A 2N47A 3KDSE 1RAAA 4YRFA 5KYGA 2AQ8A 2ET6A 3IT0A 3LZDA 4I2NA 2IWHA 2A1UB 2B1JA 4UDOA 3TCKA 1WXIA 2RHJA 4AUMA 3QKSA 5L3ZA 1W5EA 3JQ8B 1ZGAA 1MFPA 3OCYA 1JALA 1G2PA 1U2GC 2RH9B 3LV8A 5DN6A 1E5VA 5K05A 2CXSA 1DIOB 2YWHA 3ZW7A 4ZOEA 1XNJA 1D3AA 4TV9A 5BUQA 1YVDA 3GEGA 1R6DA 2FU5C 2FKNA 2YJ3A 3D8BA 1P4HA 2E85A 4FUQA 4PAMA 1NJ1A 1T91A 3G5AA 5FL7D 4GI3A 3CLTC 1W2WB 1JAZA 2C2GA 3LC7O 5A3RA 1TZKA 2FYTA 4LF7B 4FFMA 5TPZD 4X92A 2JCXA 4IDEA 1HL7A 2M9MA 3FWYA 4NABA 1IN7A 1ZUNB 1ML3A 3IT3A 3QPWA 5I7WA 2QAGC 4YRDA 5CNIA 4XFDA 5E8JA 4J2TA 4DBLE 3B1WA 5JS7A 1XTJA 4MYTA 4KWCA 2FN8A 3ZW8A 4EUKA 1D03A 2DT5A 3LQKA 1K2WA 1OOEA 1U28A 2YWJA 3OIUA 4U7FA 1T5IA 1GXSA 3WISA 4TN5A 3IV7A 4X9XA 5TR9A 5JZBA 3N2GB 1Z3CA 2NQ2C 3O0DA 3SSOA 2RD2A 3G9ZA 1PSDA 1SB8A 1C1HA 2J9YB 3V8VA 1K08A 4MW5A 3P0EA 4QDUA 3T4PA 4EFNA 5A4MS 1L7VC 2DUMA 1ZIDA 3G2IA 1Z7YA 2C58A 3MJ4A 4KZPA 3EMKA 1UP6A 5L51A 1HDCA 3TSYA 1NSFA 1C14A 5LYYA 4BP9A 3QUCA 1K8RA 2GXSA 2I7VA 2PZLA 2R1TA 1TC1A 4IDDA 1UDRA 3HP7A 1OX6A 2FW6A 1SKMA 3A1FA 1MEOA 1RACA 2O2IA 4IEFB 3WTBA 5JVDA 1UFKA 2HV9A 2J3HA 4O4IF 2I2BA 1CCWA 2I4IA 2Q46A 2RC6A 4M0KA 5CHEA 3WIDA 1HEIA 1DG3A 1I10A 3L79A 4U9UA 3IUEA 3KZ1E 4FI3F 4YREA 1FX0A 4P36A 1IG3A 5FOSA 4Z3OA 1UT8A 3FYUA 3KSRA 3QVKA 4RS4A 5KC8A 3IR6A 1ZIOA 2I4RA 2VUIB 4IS3A 3QMPA 1G8MA 4EF4A 1Y6RA 5CCDA 2LUOA 1OA1A 3RIMA 3L8EA 1BEEA 2VJDA 2JLCA 5J2TA 1OC4A 4R7TA 1L1EA 3QIAA 3SBXA 5P21A 4A8PA 4C4ZA 1WE2A 4DSNA 3L0ZA 2IGTA 4BNTA 1L3IA 4D8TA 3NTRA 3ZH9B 1NJSA 5JSKA 3UW3A 4YUYA 3IULA 4MIOA 3LCRA 3WV4A 5BY2A 2ZUCA 4BC0A 1CX9B 2QP3A 3C3JA 1P1HA 4RS3A 1Q11A 4BNXA 4EJSC 5ICCA 1J33A 1QHHB 1BIFA 1SVSA 4Q01A 1YJQA 4S1OA 3I2GA 4X3CA 4JT4A 1F8YA 1JP7A 3ICQB 5IAOA 1AXEA 4KITB 2YBEA 1ZFNA 3DEHA 4DC0A 4B3SB 1ESCA 2QTFA 4CM6A 3OETA 4QFMA 3U19A 1G3QA 1C0KA 1TPZA 1Y7PA 1M2FA 3ESAA 4DW8A 4BPBA 2X9LA 2PKQO 2O48X 1PZFA 1SHLA 1M2KA 4RNDB 3RH0A 2JD1A 2ID9A 4YN3A 5BSWA 5EKXA 4RK5A 1J21A 3BWEA 2HHJA 1H8HA 2QRQA 2HSDA 1YAHA 1ZCAA 3ELWA 3JD4A 4FYJA 1GUYA 1QAQA 1RMYA 1FXWF 4LSMA 1HYEA 1WUTA 5G4KB 2ORYA 4DV2B 3A58B 3AIMA 1PT7A 3C14C 1KPGA 1K5GA 3F7OA 4FFBA 4K6OA 2Q3MA 4JFAA 3WRVA 3QU7A 2GJ9A 2YWEA 1N0UA 2HEIA 3DJYA 4LXXA 4H3HB 4YRTA 1KZ7B 3G9QA 4JYMA 4O4IB 4BP1A 1T15A 1PNQA 2IHKA 4JHXA 5BMVF 1USVA 4JBIA 3OIDA 1WL8A 4LECA 4B76A 4X1KB 1V3UA 1U3TA 2V8OA 2J0SA 1QVVA 2O19A 4P5EA 4LAFA 1JPJA 1NV9A 1PT6A 3BD9A 3FY4A 2D2IA 3MMZA 5IULC 4ASUD 1RI4A 2PRIA 2NP6A 1G5QA 3QFSA 4MKFA 5IVPA 5JXGA 2NN3C 5DHAA 4CDRA 3IAS1 1QIKA 1CPYA 1Z82A 2VA8A 3ZX4A 1U7PA 3KQWA 3QXSA 3ZQ4A 1T3HA 4HQOA 1M10A 3RC3A 4JSRA 3UK1A 4ZI3A 2VSFA 2GAOA 5EKTA 3LA8A 3AESA 3OX2A 5E7MA 5T6BA 2DQSA 2ZG6A 2WIKA 4XGRA 3OQ1A 3S2UA 3ZGZA 4DV5B 4KRYA 4MV8A 5ALDA 3U31A 1PL6A 1UC9A 2R7KA 2WIAA 2ZUTA 3LGXA 3U49A 2ZPUA 2AMVA 2I99A 5DI3A 3WLAA 3HNOA 1W75A 4MUBA 4A2CA 5LQMA 3NIWA 4PNPA 4CV1A 1JJBA 4L0DA 1QDLB 3SKXA 2L2QA 4G01B 5AJYA 4ZRNA 4DV4B 2V0GA 4TYQA 1BW9B 1VSBA 1W30A 2EJTA 1T0HB 2MSNA 2XH8A 5E4TA 4CL0A 3H5LA 1PKXA 5A5FA 2OV4A 3BKWA 2EIXA 1T34A 2HFJA 3M1LA 4R6XA 4Q7LA 3BIJA 5AOAA 1ORWA 1U8ZA 4PLPA 5BOSA 1Y3BE 1ESDA 2GFIA 3L0DA 1TTTA 1JEYA 2J4FA 2WWIA 4D4JA 5KCZA 1JR6A 2VF8A 4PYOA 3UV7A 2BELA 4ZICA 4KNWA 2WWFA 5TXGA 2G1KA 1ISSA 4PLVA 2KBEA 3KBBA 3DEIA 2C2XA 5CFZA 1GWNA 1KE1A 1U0HC 3AFOA 3FWNA 3H04A 1NKSA 3O8OA 4ITVA 4RVUA 4N3NA 4YQZA 3V4VB 3ZJ5A 5EJ5A 5JD4A 4DM7A 4KR6A 3KPUA 3OZBA 4LPSA 2PYIA 1JN0A 3N39C 2BBTA 4LA4A 4J0DA 3O3NB 5BRAA 2G70A 5BMVB 1Q15A 3IV9A 4Z4FA 2BW0A 2J5XA 4A15A 3RS8A 3B1XA 1QRUA 3T1VA 2GASA 1YV9A 3FRIA 4QJBA 4D4MA 3UN1A 4DLZA 1AO0A 3IUSA 1A5AB 2ZI9A 1K2VN 2UZ1A 1OXVA 1W6RA 3RSGA 2A0FA 3O9MA 1MXFA 2ZIAA 1YFLA 4F71A 4N65A 1FBNA 1MZVA 2ZBUA 4NI5A 4DZZA 4CHGA 5LIPA 1GT6A 2GK3A 3KFVA 2A33A 1NDHA 1PU2A 2VDWB 1WB5A 1H0SA 4G84A 1E7WA 5BYJA 4B5LA 3EZGA 5IJAA 5BV1A 3U5TA 1JQLB 3D4IA 4CCYA 1L7PA 4RLHA 4A36A 5JS2A 1E3MA 1CUIA 1YO6A 2IE0A 3L0YA 3QBJA 3MUNA 3SZMA 3WKCA 3RIEA 4AX8A 3MWDB 3RG2A 4O0MA 1N2XA 4YCJA 2CT8A 4ENPA 3U7JA 2PS3A 1KEKA 3O6VA 1DMSA 4BNLA 3QY0A 1D04A 3HKBA 5HUQA 3KTDA 2O5CA 4Z0HO 1T2UA 4PQFA 4CTNA 2KI5A 5KQMA 1OKKA 2JCGA 3DEAA 1IHUA 5CB0A 3EFEA 3DDNA 2ZVQX 3B6MA 3SBEA 3BX1A 4YDRA 1IRXA 5AKZA 1A7JA 4C5CA 2XLCA 2X1MA 4RTPA 3FTQA 1GN8A 2J3LA 2GRJA 3AKDA 1U1CA 1Y7IA 4I81A 4XX0B 1G98A 5JALA 2XOKA 4RL6A 3RV3A 5DEOA 3SYTA 5AVOA 3LD9A 2WZBA 1RKQA 3Q2IA 4CEHB 1CR6A 1DDIA 3QW4B 3RLIA 5HR5A 4WY8A 4BGUA 2VT2A 1N1MA 1UKAA 3JALA 1P80A 3UTDA 2F43B 3UG6A 1ZEJA 1OSNA 2LNDA 3BXOA 4OHUA 5HE8A 1YRAA 4BMPB 3ADDA 1L4UA 1HDGO 5EUBA 4MHTA 4IXNA 4TOIA 3SS9X 4MWSA 1C7JA 1DKPA 1Z5WA 4M9RA 2W0MA 1UC8A 1KVRA 4N82A 4TTAA 5DBIA 4G36A 4B3BA 2CJWA 4PSCA 4IMJB 1Y8CA 2HA6A 4O3MA 2NXWA 2I54A 4UEKA 4CM9D 4AI6A 4H60A 1NVAA 1YBFA 1TTPB 1IY1A 3EH1A 1GEGA 1LF5A 1NYTA 3C1TA 5BQ3A 1VMIA 3TF5A 3U3RA 1JEEA 4IMIB 2DPMA 4X84A 1O54A 1FTQA 2GN4A 2QRMA 3QKRB 5FDFA 2K87A 4H6WA 1MRZA 4WX2B 4EL0A 2ZSEA 1IXZA 1W4ZA 2QUIA 3WLEA 1RWQA 4XX1A 3PDWA 4IL5A 4B2PA 1FIUA 2OQRA 3EGOA 3AJAA 2OC9A 2ADFA 3KUKA 3I4CA 5I47A 4YCAA 5HQ3A 4CEIB 4DMGA 2OHXA 3AU8A 1RHJA 3R77A 1TZ2A 1T10A 2PA0A 3RQIA 3ILHA 3MRTA 3D2BA 1EE2A 4DNFA 1GSIA 2IPLA 4QDJA 4URWR 1NI4A 3TSAA 4GXQA 2RGBA 3RI3A 3KJNA 3THWB 2ONJA 1C1DB 1XC7A 1YQEA 2Q4TA 4K9NA 1GTSA 1UM9A 3JRNA 3NHJA 3BH0A 3GPIA 1TJ5A 2CDNA 3KEMA 3M6FA 3B8EA 3ZXSA 1X1QA 2XTMA 1GDHA 3E27A 3SICE 2EZTA 4MUNA 2UXCB 2AFRA 2R8EA 1ZD1A 2O5RA 3HCRA 1H2FA 1GHTA 4INPA 1U4OA 2OHGA 3KSDO 2P9CA 1J20A 2DEUA 2PGJA 3HXTA 1FA9A 1GU0A 2X4DA 4KHZA 4QIHA 5IASA 3MT9A 3IP3A 3RIXA 1Y5NA 4XDYA 4XOUA 3R9KA 4M9XA 1WMDA 4MWTA 5CUQA 4D79A 5FB3A 4R1OA 2BMJA 1ZOLA 3BXGA 4C3ZA 4ZYVA 2HJVA 2HLDA 3B5JA 1N5DA 2RHLA 3DBLB 2WKRA 4XKJA 1QNFA 2DJ5A 5LLDA 3ZCSA 3AVWA 2O2SA 4BVJA 1NVMB 5HM6A 2DG2A 2OG1A 4GW3A 3GEMA 1K6EA 2IBSA 3DUFB 4FGLA 4CMBA 5L95A 3CZ5A 3FPFA 1KAOA 3REFA 1AZSC 1CRLA 1FYVA 1R8QA 2AMLA 4MB6A 1ZIXA 2ZRPA 1HYGA 3MXOA 3FWPA 1TJ3A 1U4SA 3EHEA 3IUBA 4YMLA 4GPIB 2PQ2A 3UPTA 2WJZB 1DEHA 4TYNA 4WOKA 2NACA 4RMNA 3W6NA 3PGMA 4HNAB 3H1FA 2R84A 3A3OA 1XMJA 2E9SA 4KAXA 3P94A 1K8YB 3Q3IA 2PO5A 4FHCA 1EU1A 4HFRA 1KI6A 3LWBA 3SZRA 5JNRA 5CT5A 5JXWA 3ZK7A 3PRYA 2OZVA 1IXRC 3DCJA 3T1TA 4DT1A 4NMMA 1NMSA 2AV6A 1TOAA 2Z2XA 1DNPA 1T3SA 2GBCA 3BMQB 3OLZA 3EZ2A 3AJRA 2IZ1A 2EL9A 3E22B 1M8GA 4GUAA 4XIJA 5DX1A 3RWBA 3TDMA 2D5AA 1QH9A 4AG5A 3AVVA 3ST7A 2XT9A 2VBIA 4RE6A 1XCPA 2F9FA 2YHUA 3NGMA 4KLNA 4QHSA 4B3TB 1CY2A 2JI8A 4BHTA 3CVJA 3K72B 1C9YA 4FEAA 5EFOA 2D59A 5T4FA 4Q1EA 2YL2A 4MS4B 4R8VA 1DKUA 2JFZA 1TLTA 2PH1A 3DZ8A 4CKXA 2DBZA 1VIMA 5JMPA 2PLNA 5L9AA 1LF0A 1IFXA 4DIOA 2FSFA 1TGVA 2W71A 3VNRA 7ADHA 1UJ4A 1HNZB 4FSDA 1DV2A 2ZJ8A 2WFZA 2SCUA 3I6ZA 1DXYA 3ANSA 3ZWPA 1HRDA 3C1OA 2HK8A 5D3ZA 4KQXA 3FRJA 1R6AA 2JJYA 2HR1A 2ZYRA 1RWBA 2R11A 4Y2VA 1FMFA 4OG2A 2BUAA 3NWOA 2FW9A 5CAEB 2G6TA 3NEPX 3DGFC 3LK6A 4UFNA 1E5LA 3CLVA 1E9EA 1KK2A 1DAEA 1RVDA 2NU6B 2O7VA 1E2BA 1AKWA 3I6MA 3KJFA 5IHXA 16PKA 3Q1KA 4PTYA 2YYYA 5IKOA 3E2MA 4UUMA 4ZYUA 4AF6A 1Q3HA 1JDNA 1Z08A 1V7ZA 4FLEA 1CFZA 5EWLB 5LB2A 3STUA 4MRPA 1KXJA 3BJZA 3LQQA 3E5NA 4EHLA 2EDAA 3QYAA 4JBWA 5E2BA 5EXTA 3O74A 4UVGA 5LDDC 4X24A 3R40A 2YJ6A 3TLGB 5CD1A 3LVFO 4BNUA 4Z4EA 3H2SA 2XITA 1NAHA 3GUZA 2H4YA 3WR5A 1KBQA 1UK8A 4MYCA 4QARA 5FUVA 5LP6F 2PJZA 2ZIEA 1PG5A 1RLTA 2I1VB 3QPVA 3ABSB 4YMIA 3VPXA 5IBCA 2IIQA 2Z2JA 3DOIA 3CNNA 5TX7A 3ZE2B 4ZCRA 2Z8XA 2F59A 3SE7A 5TLSA 1XVTA 3NWEA 5GIPE 1KC3A 3RVDA 5AM3A 1FFSA 3NBMA 2W48A 2WKPA 3O83A 2A4KA 2IYYA 3FMPB 2AJ8A 4P0QB 3C6YA 3C5EA 3KD3A 1UXHA 2BLLA 4U3JA 4AZ0A 4ENTA 2A5YB 5CIQA 4KG7A 5ALRA 2HSZA 3WGVA 5BR7A 2GLTA 3COSA 4UARA 3G2NA 3A2KA 2RGRA 3N9IA 4M37A 3GDFA 1MP0A 2DUUA 5TDHA 3TR5A 3SYMA 2YVLA 2A9RA 5COQA 3TZHA 3CWQA 4MUJA 5FFNA 1A9OA 1CNEA 4JBGA 3ITEA 1SKUA 3JVUA 4X3PA 4DQVA 3U16A 1PL0A 2YS7A 3HBAA 4R69A 2V7EA 3IB3A 1I6WA 3GL9A 1XFDA 4MV1A 2OUKA 4RZ3A 3DAYA 3IAM1 2QLJA 5HHTA 1XZKA 1G1AA 1NRIA 2ZKIA 3DEYX 3RIHA 2EAUA 3B78A 5JMOA 3OQMA 3C1UA 4AP6A 3U9TA 1D2GA 3W8FA 4A03A 3RLFA 5TGZA 1EWRA 4BCCA 2R6DA 2WSMA 2QV7A 4Q3EA 5DIZA 3UJCA 2EHJA 5PGMA 3WFIA 5EP2A 5C4MA 5BRJA 1UXJA 1QRRA 1TM3E 1PYGA 2HQBA 4LXUA 4EEKA 2QQFA 5C52B 4WESB 2H1FA 3I28A 4IO1A 3U5ZB 2EV9A 4U2DA 2I62A 2QVLA 4OYRA 4PQEA 3VU0A 3NP7A 5BR8B 4C1NA 1ZGJA 3QNUA 5ICGA 4H16A 1GPMA 1TJNA 3NM4A 1PNOA 5CYFA 5HUJA 1CV2A 1JDVA 3BCHA 1QGED 1T8RA 5E1MA 3TSWA 3PNOA 1ZKDA 3U39A 3VC1A 1WQ1R 1KIMA 2VSXA 1I32A 4ZXPA 4C29A 4DR7B 1TUIA 3C98A 5JT1A 2BEVA 3AEQB 3N70A 2E82A 2DOKA 3JSXA 4MZDA 2VS1A 4UMEA 3SF8A 1DQSA 1XZ8A 4B4OA 2H1SA 3GARA 3O9VA 4Z4GA 3L1KA 4RBNA 1OWPA 1W0JD 3TRFA 1E60A 1TUBB 3COWA 5C8YA 4G0VA 1FX1A 5KAPA 1N2EA 4YX9A 1DPFA 3AWDA 4FBLA 1BKYA 3B85A 4EWLA 1SB9A 3TECE 1VSUA 4B3MB 4QFBA 2BFCB 5A7GA 5KU1A 2FAXA 4BNJA 1N78A 1A9QA 5E1OA 2WIBA 4EDHA 3LHKA 1C3JA 1O77A 1S1CA 4H4CA 3ZQ6A 5DLYA 1EVJA 4OOEA 1PVDA 2GDZA 4GXNA 4HQFA 4B81A 3RS7A 4Q1BA 5D7NA 5DOZA 3NM5A 1QTQA 3WRYC 1GEEA 1MJFA 5KYWB 2XMBA 3SX4A 1ADCA 1CF9A 2FQXA 2I03A 3RFUA 4FN4A 4DKJA 2P90A 3Q87B 2VHCA 4L5CA 4PZ9A 4BE7B 1RP7A 1FDOA 4MVJD 1A9PA 4IOMA 5ARCA 5JTUA 4DS3A 4JVNA 5G0SA 1XPUA 4BMVA 3BE4A 5HPYB 4INJA 2BTQB 4ODIA 3CN9A 4US0R 4B9EA 3VR5D 4P4SB 1GL6A 2IEIA 4F4FA 4FZJA 3OCXA 3HH8A 2X4IA 1XZHA 2QRJA 2ZRGA 2XYHA 5ABPA 2VWHA 2H92A 1F8XA 4B3HA 4RD2A 3UFXA 5FWXB 3B2QA 1T8WA 3FNGA 3EVAA 3IT1A 4AICA 1E9BA 3K1TA 4CUJA 5JPCA 3AG6A 1JQAA 2JGDA 1XGKA 4FOPA 1XAGA 4NG5A 1H1LB 3UA4A 2QP4A 3A1TA 3QYPA 2I2FA 2BEJA 4QYMA 1EDEA 3K6SA 2EJCA 2FPMA 3PLRA 1PTJC 1V8FA 2W58A 2OGUA 3QUBA 2FG6C 4CEJB 3NUGA 2WR8A 3KKOA 3RYIA 2C03A 1KO8A 2MR5A 2WPDD 1IU9A 2IUTA 4K5QA 3GUHA 1NBMA 1WXGA 2HGZA 2Q27A 5TC4A 1QCCA 3A6DA 1OWOA 2GPBA 2PXCA 3M3DA 1AUQA 1BROA 1JKFA 2OFXA 3HDTA 4KU4A 3ZWYA 3ONVA 1VBNA 1CDEA 1GNTA 3GFBA 1SUIA 3K9BA 2DBQA 2JCBA 4Q3AA 2W00A 4UTXA 3WB2A 1VIAA 3E9YA 4EY3A 3DVAB 4IM7A 4F1WA 2V4MA 2RHCA 4CF7A 2XD4A 4GZ6A 2PSDA 3ND6A 2VNJA 5AUQA 3RS2A 3ZIDA 2D0DA 1T8YA 1I80A 1MOSA 2XTNA 2Y77A 3CMCO 3MMSA 5DW3A 5FA8A 2GZAA 5D5HA 5A9RA 1J7JA 1T0BA 3TE7A 2A5GA 3GP8A 3GWGA 1TT7A 2IPAB 1JSLA 3D4LA 3RUPA 2DHDA 1G66A 1TT5B 4DLLA 1W4RA 3ETLA 3BDVA 1EXWA 4CNBA 3FNRA 5BR4A 4J1TA 1I36A 5CFQA 1PLLA 3OY7A 2I55A 2JFQA 4GO1A 1T29A 3FNBA 2A35A 4KJZA 4RMIA 4HPWA 1RBMA 4JKIA 2P2YA 4P3NA 1RLJA 4P2BA 4ZJPA 3FMVA 1GADO 3GHHA 3SQMA 2VCYA 1JHZA 1ZH6A 3HKDA 1DTEA 4UCWA 3RV4A 5IKPA 2OFWA 1P7VA 2PT7A 1FK8A 2ORVA 3QELA 4CTMA 3EPHA 2CUNA 2CK3A 2GSDA 4MRSA 5I01A 1SK9A 1GTL1 1Y8RA 2X86A 4IUCS 5A5GA 1GPLA 2JLZA 1OT3A 1OUMA 2VKTA 3OHMA 4PLCA 3BRSA 3EVBA 4G89A 2OHOA 3G2JA 2J85A 3GEDA 1Y9ZA 2YW9A 4GVPA 1PV4A 5F9HA 1J1UA 2NW6A 4ARSA 4FFPA 2V6FA 4CT5A 4KGDA 2ZI4A 1UPUA 3LDFA 3GLFA 4OVKA 2BMAA 2WNSA 1RYYA 3I04M 4U0KA 4CKYA 2N42A 4QX6A 4CEJA 2AHOA 3BMOB 3LKDA 3ZVKA 3W6PA 4GOOD 4KFRA 4AS2A 1ICEA 2IEGA 1BH6A 3E9QA 3SQXA 2IUSA 5HOQA 3PC8C 1QX4A 1REQB 2ID8A 3A3YA 1X7ZB 3EZFA 3R3WA 5I5GA 1FW6A 2WMYA 4AJKA 2NZYA 2QUKA 2H85A 5DTIA 1J25A 1EP1B 3AFGA 1V2HE 3I05A 3IAUA 1M0WA 3K2BA 1CBUA 2WVHA 4L0MA 4BLRA 1VPTA 3L4BA 2ZB7A 3L0SA 2X5OA 1NYRA 3OFSA 4CQMB 4FX5A 2AZDA 1BWRA 5L4NA 2A14A 2XIJA 4WVLA 4COKA 2CHEA 2GZMA 3HI4A 3IT2A 3LQRA 4P6VF 4Z5XA 5I3ZA 4NENB 1QRSA 4L27A 3E7FA 1C30B 4C3VA 2ECQA 4IGFA 3MNFA 5CLLA 1M1NB 1OZAA 3JU3A 3KXPA 4J4BA 4YONB 3UT5A 4B43A 1YDGA 4RPLA 5K3AA 3SS7X 1U7WA 3WMXA 3EWIA 1VE6A 3ADBA 3FOBA 3SX0A 5E6SB 1UJBA 1QPBA 4G4SP 1YZFA 3I53A 4UD2A 1JFFB 2ZJ2A 3MINB 4WXMA 3BRCA 3OG9A 1US8B 2ZRMA 4RVHA 2HZ7A 4JLAA 3DMRA 1YHNA 1RZRD 2AYXA 1JHRA 2L17A 3M83A 4C20A 4EI9A 3PNKA 3PNBA 4A0QA 1TAQA 1KIFA 1RCTE 2PUGA 2K2QB 1HQCA 1HG0A 2G5CA 3TQFA 4L8YA 3FUXA 3ZW9A 4QFDA 1O03A 4QUAA 4RH0A 2O50A 2Q5LA 2ZI3A 4KE7A 2SBTA 2WD7A 5EERA 2EWMA 3IEMA 5TQJA 1JEDA 3NBUA 3QITA 1CZLA 1CUZA 2IKSA 1K1EA 1RWNA 2X0FA 2Y71A 3S1SA 4CT0A 2ZAIA 3CISA 5T41A 1LTHR 3SHOA 3VO2A 1JKJB 1NJ6A 7ABPA 5AXAA 4F38A 3DQZA 3A6ZA 2R9VA 4QOJA 1QG2A 1G4UR 4XFKA 1R3DA 2C5GA 1JJVA 3T12A 1DXHA 1FFAA 5AFSA 5JQWA 2ZYWX 4OQXA 3IMKA 4LXIA 3D1JA 1AK9A 3N53A 4IJQA 3JAKB 1L5VA 3JASA 3CU5A 4KK3A 1L8XA 5KSYA 1THGA 2O3TA 3C3CA 4Q4DA 5HQJA 4L50A 4ZIRA 3T9BA 1XPRA 2VHZA 4MGHA 4D0GA 3A0UA 1C1XA 2XYVA 3ZI0A 1CUYA 4JLPA 4B6SA 4EBFA 3DLHA 1AJEA 2XQKA 4JBLA 4RH3A 3FOEC 2ZREA 4JYBA 2CLLB 4OF4A 5LMCA 3PLAE 4PYIA 3KKLA 4FQ7A 3ZTYA 5EJMA 4NCJA 1SU4A 1F48A 3S6JA 3L05A 4LZJA 4DDTA 4B3XA 1TF5A 1SBCA 3PE4A 4G4GA 4OBXA 2H2AA 1N6OA 2QYHA 3B36A 4U9HS 5ALOA 2WW8A 4HQLA 3CM0A 3UW1A 3GR6A 1T1RA 3KK0A 3DQQA 3A7DA 4ND8A 1NM5C 3B3FA 1RI1A 2HZBA 1UT6A 3RSLA 5JCJD 4BIIA 3A9CA 4X65B 1L8AA 3PQ8A 3GGCA 3LVQE 4XUCA 5JYEA 4K03A 3IBSA 2JFUA 3SFTA 3C4VA 1YQQA 3DDWA 3I58A 3WIBA 3OC6A 1XDWA 4GIBA 1IB0A 2F1JA 1OX5A 3ZN2A 2IUYA 4J49A 1QQ6A 3F49S 1EFPB 4R31A 3KZKA 1YZNA 2O2DA 4MIYA 5LYJF 2YXPX 3MUEA 1TQ8A 3ISJA 1UDWA 1CJUC 1JVNA 1XTVA 1ABEA 4E2XA 4LYGA 4CV3A 2IHNA 1BE0A 2GVNA 1UJMA 1T3LA 2O5VA 2PKYX 3NHZA 1K66A 1EX1A 3OZCA 3M1AA 3SC2B 4GNKA 2DPXA 2OA0A 1AMNA 3BM5A 3EGEA 4DB2A 3R0XA 1QFSA 2JJMA 4WXYB 2EG5A 3D7MA 4CLRA 4WKOA 2LZ0A 5DRTA 4M8LA 2OLJA 1KY2A 4WASA 4RD6A 5SYMA 2O8CB 2QN3A 2XYGA 4FXOA 2DR3A 3LF1A 3UEOA 1V6CA 3KQVA 2A1UA 1NDUA 3PQ7A 4XYMA 4OEHA 5EY5B 4Z2YA 5C7LO 4IF4A 2FSVC 3IX7A 2X0KA 2WM9B 3DYVA 1N4DA 4LJKA 3A9SA 3JQ8A 3MB5A 3NZEA 1AUOA 2PUWA 4L8WB 3ICEA 4OXRA 1ODFA 4B6OA 4YH1A 3INRA 4BO0A 5ECGC 1VKZA 1SIOA 3LY8A 3CCBA 2XRMA 1MBZA 3DL0A 3IBFA 3KQTA 3QU5A 4NIMA 5NULA 4KR9A 2BLNA 3QE0A 2BRUC 1ZMRA 1WV0A