3U17A

Structure of base n-terminal domain from acinetobacter baumannii bound to 6-(p-benzoyl)phenyl-1-(pyridin-4-ylmethyl)-1h-pyrazolo[3,4-b]pyridine-4-carboxylic acid
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
435
structure length
433
Chain Sequence
KQLIEFVRWSPERAQHYRNKGYWIDQPLTRILTVGVQSHPHSLAIICGERQLSYIELDRLSTNLATRLAEKGLGKGDTALVQLPNVAEFYIVFFALLKAGVVVLNALYSHRQYELNAFIKQIQPKLLIGSRQHEVFSNNQFIDSLHDVNLSPEIILMLNHQATDFGLLDWIETPAETFVDFSSTPADEVAFFQLSGTGTPKLIPRTHNDYDYSVRASAEICGLNSNTRLLCALPAPHNFMLSSPGALGVLHAGGCVVMAPNPEPLNCFSIIQRHQVNMASLVPSAVIMWLEKAAQYKDQIQSLKLLQVGGASFPESLARQVPEVLNCKLQQVFGMAEGLVNYTRLDDSDEQIFTTQGRPISSDDEIKIVDEQYREVPEGEIGMLATRGPYTFCGYYQSPEHNSQVFDEDNYYYSGDLVQRTPDGNLRVVGRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide arylation enzyme
publication title Structure-Activity Relationship of BasE
rcsb
source organism Acinetobacter baumannii
molecule tags Ligase
total genus 156
structure length 433
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.2.1.-:
pdb deposition date 2011-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u17A00
5BSUA 2WD9A 5GTDA 4D4GA 3FCCA 1V26A 3L8CA 4FUQA 4R1MA 2Y4OA 3E53A 3IERA 3VNSA 4DG9A 4RVOA 5BSMA 5DWVA 4G37A 4RVNA 4ISBA 4M46A 3NI2A 4D57A 4GXQA 4GR4A 5E7QA 5KEIA 3ETCA 4D4IA 3O83A 5D6NA 5BSWA 5BURA 5BUSA 3ITEA 4GS5A 3G7SA 3LGXA 3IESA 3QYAA 3WV4A 4PZPA 3E7XA 3TSYA 3E7WA 2V7BA 3RG2A 2Y27A 3WVNA 3NYQA 3VNRA 3WV5A 4R1LA 4WV3A 4OXIA 4DG8A 3EQ6A 3C5EA 2VZEA 4E5DA 3T5AA 3T5CA 3DHVA 4R0MA 5BSRA 1V25A 4GR5A 3RIXA 3O82A 4IR7A 3T5BA 3PBKA 3NYRA 3IVRA 4FUTA 1ULTA 4GXRA 5BSTA 3O84A 5BSVA 3IEPA 3U16A 3GPCA 3B7WA 3IPLA 2Y4NA 3R44A 4LGCA 3VNQA 3U17A 5BUQA 4IZ6A 3DAYA 3FCEA 4W8OA 4D56A 4D4HA 3A9VA
chains in the Genus database with same CATH superfamily
3QI7A 1G8FA 1SXJE 1SULA 4O08A 4RJKA 1R0RE 5HX7A 2PUWA 4JCCA 2PVPA 2I6XA 5DP1A 4MPTA 1VECA 4IGKA 2O50A 4ZT2A 3R75A 3E3AA 4C03A 1GM5A 1D8AA 1ZCFA 4NU0A 3QWAA 3T6KA 4Y6LA 3NEAA 1JKIA 3O3MB 3F7OA 5AVVA 2VN8A 3EAGA 3UMCA 4EF4A 5ALGA 1BE8A 1TMYA 1X2EA 3MTQA 4WRRA 2NVOA 4EX7A 1UJMA 1P91A 4EHBA 3GEBA 1G21A 2AEFA 2B5VA 2BBTA 3OE7D 4Q4AA 5K8IA 3FKSD 4ZO7A 2W9XA 1IATA 1RWQA 1T1RA 1ZM9A 3RUDA 2MCFA 4CMCA 3IT0A 2QLTA 1N2BA 2GARA 3E9DA 3KJNA 3ITNA 4G9GA 1JAIA 3MELA 4Q15A 1A4RA 3Q3GE 2OXIA 4BUJA 1HDOA 1TYAE 3DJFA 4L0MA 3M4NA 1PFWA 4XDGA 4XOIA 1PQYA 2ZUTA 4FBGA 4M1QA 1XZEA 5T4FA 3UO8B 3GZJA 1QP4A 4JNCA 3DPUA 4PZCA 5EWMB 2II6A 4GUAA 4DLAA 1S2GA 3ZIDA 4DPKA 4BWFB 1JIJA 3MZ0A 1LF5A 3S2GA 4A0RA 2GJSA 4B3BA 4C89A 1VG1A 4IHJF 2NO0A 2APJA 2FJPA 4K2AA 5E8RA 4C07A 4YMVA 3R3WA 2G08A 4JP2A 1M0WA 4IUDS 4N6NA 4QOGA 1YFLA 3HV0A 5BRJA 4O1MA 5E2BA 1GZDA 1RE1A 4HWGA 4FR5A 3GLTA 1SXQA 4FN4A 2R7AA 1RLOA 1ESMA 1NTRA 1OT3A 1R15A 2AMFA 4R1LA 2AUNA 3RM3A 2JJ1D 1P3JA 1RWMA 3OEHD 4J0QA 3R24A 5CX1A 5FRDA 1D6JA 5A02A 1FQOA 4JR0A 1CY0A 1HNZB 4QYXA 3PC8A 3FN4A 1MOPA 3EC7A 4TTPA 2ZUEA 3EJ6A 2CCJA 1J0XO 2WUDA 2XITA 3FX2A 2QRZA 3UKOA 2NG1A 4NBTA 2NLOA 1SD2A 4EYQA 3QLTA 1FFWA 3TKYA 1XNHA 3DVRX 3RK1A 1T25A 4B3CA 1C30A 2HOQA 4PLCA 4DILA 4N5HX 5F2OA 3MLEA 4FZ3A 3GP5A 4QARA 4QJ3A 2ZIWB 3SYNA 3CYFA 3SJBA 4IJUA 3I09A 2IQIA 3LECA 1QNFA 2A1IA 3DO5A 4B0OA 4GKJB 2HL6A 3AESA 3Q11A 5G53C 1GZVA 1Z2PX 2G80A 3SYLA 3G0BA 3W3ZB 4YV1A 1JDBC 5J4LA 4KGZA 2XE7A 1UKAA 4JC0A 5HKBA 2ENUA 4C3ZA 3TR5A 5HBRA 1HE3A 1K92A 3PEYA 4UPDA 3EMVA 4UUQA 1S3SA 5F9MA 4AMVA 4UM9B 1M7BA 5JRDS 3ZD7A 4QTXA 3K5IA 4G24A 3WWCA 1WDKA 3COYA 1HH4A 3QXGA 1HSOA 3D9QX 2FF5A 4JYZA 3IOBA 1NY5A 3PSAA 1U3WA 5DISB 4BC0A 4D8XA 3OPYI 3WP1B 4J1TC 4NEHB 4JLUA 3TQOA 2PYZA 4I99A 5AUNB 4GFDA 1I13A 1EVYA 2E5FA 1Q7TA 3D59A 2HJVA 4HDNA 4V0QA 3RLIA 3L0ZA 5H9VA 2I2CA 2H51A 2Q3JA 1Z83A 1NR5A 3K0CC 2PPVA 3IO3A 3MT9A 4DARA 1MOQA 3FYUB 5DHFA 4EO9A 1ZZGA 1FP1D 3OLQA 3EA5A 1N2OA 4G1FA 4OMCA 3DHEA 1PJ3A 1DS6A 5ITZA 1DBVO 4DG5A 1GTVA 3JWEA 5DDIP 3R3SA 4B45A 4DVJA 4JB0A 2VBCA 1G17A 3IIMA 1N36B 2JLUA 4RE5A 4E7PA 1OI3A 1ZEMA 2BH9A 3NKLA 3UJ7A 1MRNA 4HYYA 4KO4S 4OF4A 3WNQA 5AP9A 3WR5A 4TV8A 4FS8A 3NR2A 5HFNA 1V5WA 5G41A 4BO9A 1CRWG 3DEAA 2FLVA 3GMSA 1UBTS 5EHGA 3E18A 1XZBA 5H0IA 4C2TA 4DMHA 1N5JA 2PZAA 1GQ2A 5GONF 1YK1A 3M0EA 2NUAA 2K7ZA 3CB4A 4RD4A 3W2GA 4AD8A 2IEBA 2JGMA 4BGIA 2FOXA 5E0KB 3GLIA 5THQA 1AM4D 1HA3A 1UJNA 5IXSA 3L77A 4CEJA 2OAEA 2G17A 1YCFA 4WOKA 4X8LA 5JH7B 3UFXB 1IN5A 2JGFA 5FJJA 2HMYB 3VNBA 4M0DA 3UMYA 3SSAA 2B2XA 4PPYA 1Q1QA 3AEUB 4FT2A 1ABFA 4UM5A 4YMWA 3LPNA 1T9GS 4XQGA 1IB6A 4CBVA 2HQOA 4JVNA 4ZGWA 2V03A 2W4IA 4P4SA 1SUSA 1NLMA 4IVNA 3ZLTA 1T8SA 3GHYA 1E2MA 3ZKAA 2CL6X 4K0RA 1ZBDA 4RHCA 4ZIRA 2AFHB 1P0MA 4BCBA 1SG9A 3OOHA 4N7JA 3ZNQA 5A2QA 1WPXA 3LO5A 5D3QA 5TQ0B 2HRRA 4OMUA 5IH3A 3UT5B 2EGGA 5JBNA 4TZ6A 2JS7A 2XB9A 4FS3A 3VPCA 4EFKA 4FOSA 1SQSA 4BFTA 1NYQA 2QDKA 3JQEA 4UAJA 3RE1A 2R6HA 2XUKA 3KOXA 4E08A 2Y0DA 4XYLA 1O5OA 3CUUA 1KNQA 1SA0B 2H2FA 4LRUA 4XFKA 1KJ8A 1WU8A 2B8WA 3N6XA 3SS8A 4ZZIA 1EKXA 1DKUA 1X7YB 3CG4A 3D8SA 2RCNA 3ESDA 3OE4A 4G4SO 5JS1A 4PX2A 4ZU6X 1J07A 4YPFA 2FMFA 2WJZB 3MB5A 4N41A 5KHOC 4K9LA 2WWVD 3TZLA 4TM7A 4B71A 9MHTA 3K9BA 3HY6A 1N33B 4KPYA 2PZBA 3QV1A 2BEWA 2HMAA 2IYPA 2Q99A 2WDZA 3IOEA 1NFFA 1LVUA 3EDYA 3ID6C 4PFQA 4D6YA 3H3JA 1AKTA 2J0EA 3T3IA 1H0HA 2P0YA 4GRAA 5ILGA 2A78A 4CV1A 1DJQA 2IHNA 5C1DA 4RK7A 1WOMA 1XMVA 5IMBA 5J1TB 2AKEA 2CXUA 3PC7A 2XRMA 3DE0X 3MHPA 4FX5A 3MHTA 4BNMA 2IYQA 2VDJA 2YXNA 2A67A 1Z5PA 1GTRA 2I1LA 1K08A 1MP0A 1P2UA 3LA8A 1DKQA 3QKRA 4KTTE 4XVHA 4UPVA 1CBUA 2XYVA 5CJJA 3MCZA 1T6YA 4NYMQ 4O2RA 2HB6A 1QHXA 4J0HA 2YVQA 4DA4A 2C99A 2WLSA 2GBGA 4BNZA 1N6HA 1XJ0A 2NNLD 4MULA 4P98A 5HK8A 3U4QB 4CF3A 3BB4A 4M21A 2P9CA 4I0WB 1OB2A 3QFHA 2IZ6A 1R88A 2FR8C 1XEXB 2MSLA 5HKOA 1ULSA 3NC0C 3WMWA 1ZI6A 2CLMB 1NMQA 1QC5A 3CNNA 4GBMA 2ZUBA 2CFSA 3JQBC 3NIDB 1MJGA 4YPVA 5BOVA 2HADA 3QE4A 1QMGA 3HB0A 4C06A 4CZ2A 1QHYA 3HJNA 4YROA 4I4NA 3VH2A 3O9VA 5D01A 3NTLA 2I33A 1D09A 2VXOA 5HKKD 3R0XA 4OU5A 4CLOB 2EYUA 1TD1A 2KQUA 3Q7SA 1BAPA 1H4SA 2FPPA 2GM9A 1RAGA 3OLZA 2JEZA 1AZSC 3AKEA 4ND8A 3TR6A 2BMFA 1RTTA 1FPQA 2VPXA 2WUFA 3LP5A 4H7HA 3WYCA 1PSDA 3OD5A 4CTKA 4HK4A 3HSSA 4M8IA 4PNPA 3OZFA 2CLOB 4NS4A 4G1VA 3S28A 2YICA 5K3EA 4LYYA 3KJXA 1N7IA 3M70A 4OXXA 3RG8A 4D9BA 4EA9A 5JVDF 4H3KB 3WK4A 2RGNC 4X9XA 1W75A 2H1IA 4H35A 4HP8A 4RTRA 5IAKA 2KHZA 3TH5A 1KMCA 5KJ1A 1EFVB 3B9BA 3K1ZA 4IPTA 1D4FA 3CE6A 3C3CA 4WKBA 5AIBA 4UVIA 3M83A 1NMYA 1EE9A 5EVCA 3RUIA 2NYRA 3QBVA 1QGDA 4JHXA 2YNMA 2QTWB 3VDMA 4A8PA 4B6PA 5I7HA 2KM1A 3EFBA 2UZAA 4UULA 3MJVA 3SKVA 1EYZA 2WM3A 3CUVA 3HZZA 3CXRA 3IP5A 3RGGA 3WY9A 4ZOBA 3PVCA 4MS3A 5KNDH 1F14A 1FCJA 1T9GR 2A5YB 3B1XA 4EJ0A 1PQWA 1YTUA 2Q8QA 3VYWA 4MUHA 1R66A 4LCBA 3VQTA 4AAYA 1QE3A 3HBNA 3WLSA 3ZHCA 2J6IA 5M5BA 2XE8A 2X1LA 5K0NA 1E2HA 3VZRA 1R10A 1CUIA 3SX0A 2Q6VA 2Y0BA 2CBGA 4OM8A 4UDYX 2HU7A 2VK4A 3FE2A 3CVWA 4N3CA 3TQRA 4AWAA 5AQEA 4F2PA 1H2HA 2FN7A 1EUDA 3MINB 4YALA 1G2IA 3IPYA 1KI6B 1PTKA 2JFQA 3D4PA 2HYDA 2GTPA 3K1AB 1CDEA 4LXHA 5BPFA 1VJCA 2W6OA 2QTGA 1L7BA 3OX4A 4FKMA 3L3BA 3Q5DA 2Q4DA 4D46A 4EATA 3F73A 3N0VA 4YYZA 3NYRA 3E2PA 4YRFA 2PKRA 4UJ5A 2CVPA 3TKLA 4A6PA 4BLSA 1EWKA 5L4NA 4RDHA 1LSUA 4OSPA 3KJEA 1O96B 2YY7A 4ZYUA 2YWRA 2GZ3A 3F5FA 1Q3KA 5BQPA 2X5NA 8GPBA 1ZXLA 1C80A 2GSDA 3KK0A 4TYMA 2H4ZA 1SY7A 3DD5A 3P19A 4CR7A 5KOHB 1NUTA 1PJ4A 1THTA 2E4YA 2W6NA 1YIOA 1F0NA 2G5CA 3AVPA 3GJ0A 3X2FA 4B6EA 4M0FA 3T4EA 3SVLA 3ICCA 4KGVA 5I9IA 1H66A 3M1YA 2WVJA 4DBLE 1E0KA 3K8OE 1YR1A 5J43A 3WRVA 5IJ9A 4YK7A 5CFMA 4G01B 4PGMA 4BQIA 5C5IA 1DQZA 5C46F 5IHXA 5JBQA 1QVZA 2ZSHA 4N82A 1FIUA 4MNTA 3IEKA 2IZ7A 4P33A 3FGPA 1J4AA 2QQ0A 1FFBA 4GOOD 3ZVKA 1QRTA 4LVUA 1W5AA 1MPXA 3WL7A 2C88A 1OI2A 2TMDA 4MW6A 4JUBA 4PSCA 2JFFA 2CK3D 3VOSA 2Z1NA 3D7KA 1JVBA 1LNZA 2PZJA 1YUNA 4HZIA 1N2ZA 1OGJA 3RSHA 2GFQA 1JDUA 3CR8A 4II7A 4L28A 1KJ9A 1DGQA 2J6HA 2JI4A 4MW0A 5HK9A 1O97C 4K03A 2NXWA 1YQXA 2FTKE 3ZKWA 1BWPA 2I9PA 5EJ7A 2ASVA 4M0LA 5JZSA 4FDAA 4BEVA 5LLTA 1GZ6A 4HVAA 1B8UA 4D26A 1RLUA 1ODCA 1E1DA 3I2KA 4ND1A 2HWYA 2DWCA 4LF9B 4QUBA 1Y34E 1OWNA 3DFKA 1EM6A 1V43A 3ESAA 2WSIA 2J0UA 4CMJA 4GZLA 1T0BA 3SLRA 4BKUA 1C1DB 4OJKA 5GVSA 1XIVA 2XNHA 1L5OA 1WEHA 2VAWA 1NURA 4PRZA 4NL4H 2W2XA 5D6NA 4QTTB 4YR9A 4POAA 2PJUA 2PUEA 4OQPA 1Y9JA 3OP4A 5G4KB 2RJ3A 2BFNA 1IRIA 3E3LA 2Y3IA 3QVGB 3NGLA 1D0VA 4WERA 4HAUA 2XUJA 2B4KA 1XDBA 2NIPA 2OV2A 2QL6A 3CLSC 3ZZ0A 1IOVA 2VQ3A 5BN5A 1MZPA 4H0FA 4Q39A 3P52A 4PX3A 1CJSA 1OYYA 3FF4A 3IDSA 3KJGA 1KMNA 5CURA 3CISA 3QU2A 4Q3AA 4P7JA 3ZJ5A 1HT3A 4OL0A 5A9SA 4IUCS 2ODAA 2IF0A 4HDSA 1WMDA 2XA2A 3A37A 2FHPA 1AKVA 4YJFA 1OBCA 3LK7A 5DLPA 5LZ5A 3R3JA 3SDSA 1LA2A 4LJAA 4XWOA 4YJ2A 2RD2A 3OIFA 4LJKA 2QYSA 1M1YE 1V1RB 3DQZA 3STUA 4ANFA 2X42A 3LP6A 1IOZA 2HLDA 4LOKA 2QIPA 1C4OA 4BWGA 1SKMA 2AOTA 3ZCTA 1ONBA 1X1SA 1YJQA 3L0BA 2IEIA 2QV7A 4WADA 5F9HA 4ILEA 3OIDA 1IWBB 5KNCD 1V6CA 2ODTX 4TLMB 2ZSUA 2PUFA 4IWNA 1EFPB 2COKA 4AYWA 4B3JA 4YBZA 2EKQA 3QBEA 5K0LA 2W6ZA 2BSQA 3NBYC 3ZU5A 5FWYB 1E1QA 3RVPA 4I1YA 4UXIA 1PD1A 1SKUA 5DEIA 4P58A 3GFTA 1VE1A 1P9NA 4RO0A 1MABB 4ENUA 5BUZA 5JZOA 3MD9A 4IUYA 4JYCA 4RSGA 1I3CA 1U8XX 5HG0A 4DIDA 2AYXA 2JLSA 2O3TA 3IMFA 3EEQA 4O4JF 1ZIPA 1K89A 3LCMA 2PAFA 3DSRA 3UBMA 3LWBA 5KKCA 3F5DA 3I3OA 1UBMS 1NRIA 4BFLA 3LDGA 4D8TA 3QX3A 4XLLA 1Z4IA 4AO7A 4PCLA 2OCPA 1GZ5A 3FMPB 4CETA 3U80A 3IB6A 5C34B 1OLSB 5CFRA 2Q41A 3RTCA 3D1VA 4PNHA 2ZREA 3SXUB 4RZ2A 3TLGB 1L4LA 4MITA 2GRAA 4GX5A 4OA5A 4U5XA 4XQ9A 3AV0B 4FQ5A 1AA6A 1Q0HA 3PHGA 5BN4A 3T61A 1QGUA 3W90A 2YOFA 3THRA 1GG5A 1L7AA 2WPDD 5IC6A 1DRWA 4LN1A 3T9CA 1U0TA 3PWSA 5B4TA 3W9SA 2DUWA 5HKLA 4MWBA 3T9DA 2A5FA 3MFYA 2BM8A 1S01A 4JJ8A 1GU1A 1W5SA 4B0PA 1K7FB 1REQA 2FFBA 4YUXA 3VC3A 1WG8A 5D2CA 5LM3A 2R00A 1Y37A 2YHAA 3M1AA 2DBZA 1XWIA 4NH4A 4QFCA 4UASA 4A10A 4E03A 5JOQA 4DR6B 1OZGA 2OB2A 1E0DA 2QTAA 1JDZA 2BGIA 1J9GA 4YJGB 5IBPA 5H83A 4GQIA 4EJMA 2O2SA 4RCYA 4W5HA 3MERA 2ID4A 3H4TA 3Q7EA 3QTLA 4TVBA 1DRKA 4R1PA 4Z0NA 4ZVKA 3RRMA 5FIUA 4JYBA 4UE3S 3TXAA 1B7GO 4MR8A 5C9ZA 1VP3A 1VBKA 3A58B 2P5SA 3HACA 4DREA 1VJRA 4F8JA 3NUZA 5AQ1A 5JCOC 3E1GA 3X1XA 1G64A 3AONB 4KACA 1NVWQ 2AFVA 2W2NA 3D7MA 3I12A 4JEUA 5AI0A 1GEGA 2P4UA 2OO3A 2XCOA 3FLAA 3R5KA 1VSQA 2P62A 2PX5A 3T5GA 3B1WA 3KOZA 2HGSA 1NYTA 3LC1O 2UDPA 4PHGA 3AF1A 4FDVA 4A8TA 5JXIA 1V8BA 2BE9A 3GC6A 2UZ4A 2FP4B 3B6IA 2A1TS 4BO5A 5FQOA 3LIPA 2H9AA 1OX4B 3L6OO 5TXGA 4EMSA 2Q7DA 3C3JA 2BSAA 3TIGA 2ZBGA 2GJ4A 2X6TA 1ADYA 5I9TA 3KTAB 2POQX 3K1JA 3CGGA 3DHWC 3VTZA 3W2TA 1DSSG 2OCKA 4BZWA 3PHHA 5FAXA 5JTUA 1FFDA 5LP6F 3VU9A 4IUBS 1E3DA 3V4FA 3QPWA 5KNDD 1W88B 3G2HA 3LGAA 4XEUA 1QYRA 3P9CA 2BGGA 3IEXA 4CDRA 3L5KA 3TCNA 4G4JA 1TPZA 2YYZA 2Z4TA 1GSOA 1ZJYA 2XMBA 5JSZA 3TLEA 3H86A 2Z3WA 4BLTA 1XEWX 2DERA 3Q7IA 1QF7A 4E1VA 3P5SA 5K8VA 1JG4A 2IEYA 5A0TA 3ENVA 3ZEIA 1AXEA 2EGHA 4AC9A 13PKA 3STXA 2YWGA 1CUCA 1U0SY 4N03A 1BWRA 4TS9A 4FC6A 1IBLB 2I65A 2WEKA 2O05A 2YHSA 3LL4A 2OHIA 4RA6B 2X7HA 4RQTA 4DLPA 1W4LA 2F9MA 2IOHA 3IQFA 2F3SA 4QBIA 3SHWA 1PVDA 2DE0X 3Q3HA 1F12A 1E3WA 3GPBA 2NGRA 4GWKA 1X7WA 2WICA 1G38A 1N8SA 3WK8A 4FONA 4KQEA 4JC5A 4F1WA 4KO1S 1XZNA 2ABWA 3GK3A 4KWIA 1SBCA 1IN8A 1T36A 4ZO4A 1EJBA 4EGAA 3I2YX 4ZAZA 3MQ2A 4YMUA 3L06A 2GPWA 4NV0A 4TWBA 2EERA 4E14A 4UARA 3VYUB 2C5LA 5H68A 1ESEA 1TVMA 1VXRA 3MMSA 4PRLA 4HN9A 1Y6GA 4J0IA 4ENVA 5K6AC 1KDZA 3PVSA 5G4LA 3VH4A 3EEFA 1V39A 3FDFA 2E2WA 3HDVA 5LMZA 3N75A 3L4KA 1GKUB 1WXEA 3PPIA 5FNVB 1BHJA 1ENPA 3RS5A 1PWEA 5U1PA 1N3IA 1L5SA 2VH5R 2GKSA 4D74A 3T06B 2GXQA 1FSSA 1Y7LA 4AULA 1H9CA 1XRSB 2GILA 2V96A 2ZIUB 4IDFA 4B5LA 5AXCA 4DEYA 3N2LA 1Z06A 3DBIA 1SVOA 2ATEA 3P2OA 4M0CA 2QRKA 1O97D 5EMJA 1F8XA 4I4CA 1VL5A 5JD4A 3ELWA 4UEOA 1ZSNA 1BVRA 4IO1A 4MCHA 5AR1A 3HKBA 3G0HA 2N46A 5A5FA 3V7UA 3SY8A 3ZU3A 4MLPA 4N7BA 2JLWA 3KL4A 4UQLA 5AOAA 1N2JA 2QZSA 2QL9A 2PU7A 3CX7A 3I34X 4ABYA 2HLPA 3N2EA 3RIHA 3QJYA 2HRDA 1F3OA 3HZHA 1DIBA 4TMYA 4L4YA 3L6BA 2HF9A 4L7QA 3RJMA 3PB3A 1GQSA 2X76A 1A7KA 4QTZA 4G86A 4KAAA 4YCAA 3V6MA 3ZCVA 5KOIA 4OFZA 1II0A 1ICEA 2W2KA 3A6ZA 1UFOA 3GV0A 5G0TA 1IIBA 3N5KA 1FYXA 4OB6A 4FMDF 2VP2A 3USES 3WRYA 4CVNA 4E70A 3UGJA 3CLSD 5KBYA 1FRFS 2OAQ1 4OYLA 1JLLA 3PNKA 2J87A 1C29B 2BTQB 1RMYA 2IT1A 4OXYA 3OFSA 4DLYA 1QO7A 3O21A 2AZTA 4QXOA 2A1TR 3C1OA 2XDQB 2R5FA 3LVRE 3DOEA 4JWKA 4CYMA 2WM8A 3U3KA 2DCUA 3IAS1 2AB0A 4MUYA 1M10A 4GMHA 5HFJA 1HYHA 4YRKA 1V9CA 4WN9B 1WPGA 2TS1A 4FEGA 4C3OB 1SQGA 3RFCA 3U40A 3WS7A 2RCYA 4X20A 3RBXA 1JNYA 2OBBA 2D7CA 2V3WA 3SU8A 3PF8A 2YBEA 4LOJA 3HUFA 1Z3CA 3ITKA 3EXHC 2JJ2D 1FVOA 3AIIA 2HNBA 1UBRS 4FLEA 2XRFA 5CT5A 3VM6A 4D8UA 1Q0QA 4OUKX 1Q1NA 2C8VA 3SK0A 1Z36A 3PYLA 1YMQA 2HMTA 3PCTA 2DBRA 2ACWA 4F46A 2SBTA 3FOCA 1D5CA 4BQQA 2P5TB 3OAAD 5JJBA 4XJSA 1LWOA 2AK3A 3F6YA 3WRXC 5FADA 1QKJA 1BG6A 1F8UA 1X74A 3CNLA 2I62A 4D8VA 4EDFA 2BT4A 1SO8A 3QXSA 3ORRA 2DLCX 5JEDA 4G4IA 1G20E 2YFYA 4WFJA 5IU6A 3R7WA 3GMTA 1FF9A 1Q16A 3KZVA 4KQWA 4N8EA 5CXUA 3G88A 5EXDA 1LBQA 4JJ4A 3LZCA 1OI4A 1H6DA 2ZATA 3KE9A 1RBYA 1E9EA 3JVDA 3FPBA 1ORRA 4Q7EA 3GGSA 5KYWB 1KDTA 2B8TA 1YDMA 2QAJA 2VEDA 3O3CA 4PZDA 2ZYIA 4L78A 4XUCA 4UJ3A 5JT1A 2MYNA 1K7XB 4N47A 4LGVA 3M33A 1VB5A 4ZJPA 5HF5A 4J0DA 2FE1A 4XVQA 3LPLA 1N9ZA 1UXJA 3PI7A 5ALVA 3KQLA 3OIVA 5CEJA 3ZGZA 2FN3A 4XCXA 4EAAA 2OHVA 2ZWAA 4I1SA 2RIPA 5ALMA 5C4MA 2PL5A 4BIMA 2XWPA 2RHRA 3FAKA 3TE7A 3LHFA 5BR1A 3N6VA 3NETA 4MICA 3RC9A 3TFOA 1E2IA 1OA0A 3IKMB 4XVCA 2AOVA 2Y1EA 3CW8X 3IQWA 3TX6A 3WC4A 3BMNB 4EB3A 1KI4A 5L3SA 2E4ZA 1PT7A 2X4IA 2OQ2A 2PBFA 2PFSA 1MGPA 3ASUA 3OA2A 5EYPB 1LPBB 2DPMA 2DKNA 2XEDA 5AOVA 4U00A 4BQPA 2ZIXA 1DJOA 4NJMB 3W8RA 2CDNA 4AECA 2PH3A 4L4RA 4RX1A 2RB5A 3NRJA 5IT0A 1A96A 1SK9A 3HN2A 4F72A 4UNRA 5F33A 3G23A 4ICIA 3LO8A 2RAUA 1QG2A 1PWXA 1GLVA 2D2VA 3DH0A 4QNMA 1KETA 1XLTA 4I4TF 1EQ2A 1TM4E 4KPEC 2WTAA 1VIVA 4Z3OA 4QO8A 3O2JA 5EWLA 2XKJE 4IQ4A 1DRVA 4U7DA 1PFKA 3LUGA 1ZUNA 2GASA 2O0MA 1NFRA 1BW9B 4M55A 5FTWA 1U94A 1P5JA 2B3DA 2PO7A 1IK6A 2Y0PA 1Y5LA 5CPFA 4LI3X 4QEKA 2Y77A 1J1IA 1RFGE 1C2TA 3KSZO 4JP1A 4NR0A 4J3NA 2BZGA 4QT4A 3KXLA 3RADC 1JXOA 1QOPB 5KJFA 2HU2A 2ZRDA 6NULA 4OAQA 4M88A 4KBFA 4IICA 1KAGA 5J2TA 5B7NA 3VNRA 1NMXA 3DVAA 3FDIA 1XZAA 4TKVB 2GF0A 4FSHA 4HUQB 4R0NA 1UUFA 2BR5A 1VM6A 2HDOA 3ODGA 3VH3A 1O1YA 1M5UA 4NPAA 1QHHA 5CRIA 5A1TA 5F7XA 4M9SA 3AH8A 3QITA 3KEMA 4MV1A 1P0CA 1KZYC 6AT1A 3ADBA 3PXEA 1JDSA 2G0NA 4KBYA 4CM5A 1R8SA 2OLJA 3W5SA 4D4MA 3H3XA 1P44A 3JRNA 1KI1A 4P86A 2F7SA 2FUEA 4TUYF 5ALXA 3S2UA 4OBEA 3MPUA 3H6KA 3RQIA 4NICA 1RJWA 1QH8A 1T6NA 1GRNA 3HG7A 1SHZA 4L16A 1QCYA 3TQTA 2GLXA 2UU9B 1ZH8A 1FRQA 4B32A 1H3EA 1OASA 1OV4A 1PBNA 1GKYA 4QBGB 2O7QA 4A8JA 4X54A 2XKAA 1F9EA 2HF8A 4EHLA 1CEQA 5ERYA 1CZUA 3W34A 3WRWA 4C5CA 1A9RA 2V6IA 4PYOA 1PP4A 5DNYB 5SYMA 5LXTA 4OV6B 4JKIA 4BUCA 4D0LB 3RWMB 3SJ7A 3FRHA 4RM2A 2EL9A 5IABA 3Q2OA 5ECDA 2VNHA 4MKFA 3EYWA 4L8FA 5AVXA 4KDCA 3JATA 1V8ZA 2DUMA 3IQDB 1BTOA 4HHEA 1VHLA 1M73E 1QFZA 1CY8A 2R3SA 5AHKA 5TMEA 1I94B 3H99A 4MPDA 2H52A 2YV1A 4COKA 4WBNA 2XAUA 3RI3A 2CVZA 3RVRA 1L7MA 4I5IA 4KR9A 4Y1FA 1UKEA 3EBPA 2YYSA 3GNQA 1ZGZA 1JHXA 1U7DA 3HFJA 5EI5A 2JHPA 1XTUA 4ROSA 4F9EA 3DDOA 3L7YA 1Z26A 3MT7A 5LDHA 5LYJF 3T5MA 5KNBA 1ZP6A 1VOTA 4MGHA 3VR3A 3U3RA 4XX0B 4GP7A 3T3GA 1FU7A 3CH4B 2YNMC 5A9RA 3VBCA 3TTUA 5EHIA 1JHOA 1TVEA 2PD3A 4TM8A 4A0QA 4BLVA 3UJAA 2FZLA 3AY0A 3I04M 1XL1A 3LV8A 4YMLA 1Y63A 1U3DA 1OCEA 3KBBA 3TNDA 1GVHA 3O38A 5EMLA 5AKHA 4FHFA 3L02A 2JGDA 4CL0A 1K75A 3OHSX 2PFKA 2ENWA 3AVWA 1QJ4A 2REQA 4PIPA 1IWOA 5E38A 4C7MA 4EG6A 4YNBA 3IIKA 5AJXA 4B80A 5EIBC 2ICAA 3TSCA 3MIIA 1DKNA 3OZSA 1V0JA 5E6RA 3H5RA 1GLGA 1WWKA 1TUBA 3K96A 4BO3A 3S2FA 3L6EA 3C5VA 2CNNA 1KVUA 3RYIB 1PW7A 3QSYA 2WR8A 3TRJA 4C0AC 1K06A 3C24A 4IXNA 1LLQA 4ZKDA 1GU7A 2W83A 3E9CA 1YOVB 2H3HA 3OI7A 5DT9A 4RV5A 5DPMA 1RXVA 3K0AA 3LC7O 1P2GA 1ZUWA 4P5EA 2GR9A 4MV6A 1JGTA 1KDOA 2JFNA 5HW0A 3LWDA 4PRKA 1XAIA 1OREA 4MPRA 5BOSA 1N6KA 2FEXA 3CHYA 3VR6H 4EABA 1XZCA 2GBCA 4YP9A 5ALRA 3RHZA 4B6RA 3ME5A 2K2WA 4V0OA 3ZVLA 1CD5A 1R9JA 1J5EB 2GHQA 1GRVA 3LLCA 3MJ4A 3RR2A 1GZSA 3M3HA 2QZPA 4C20A 4HD8A 1A77A 4LHVA 5AVYA 3B89A 4OX9B 2AW3A 2XZPA 2VQFB 2HHHB 3FMGA 3V6LA 5BWBA 1F6BA 3FDZB 1FP7A 4UEKA 2C4TA 2C7QA 4H3SA 5CA0F 4O2LA 1E6KA 1XTIA 3WHIA 2FN8A 4TQGA 2RBKA 4EG3A 4JJKA 3KOMA 1RKQA 3IEVA 1QDLB 3LWZA 3ZG6A 2ZIFA 1ZS9A 3EPKA 1QH1A 3MEQA 4I9NA 2AT1A 1MTOA 3IOMA 5JYCA 4FJ0A 2FMKA 4KXYA 4ESVA 4REOA 1ZGBA 4W6ZA 2VHZA 1QRDA 2VP6A 2WU3A 2COUA 2IYEA 4UHKA 1D4OA 2DSNA 2JH9A 2V5AA 3Q85A 5DXJA 4KG7A 3U1VA 3V7YA 4E1BA 4EFDA 2XMDA 3L7MA 3QLVA 5HJEA 4RJLA 5L8VA 4KIJA 1LZKA 1ZLXA 1NXPA 1NZFA 4ESEA 2NU6B 4FGUA 1T3GA 5GPBA 5LB2A 3EG9A 5BSVA 3BL6A 1VHDA 2ADOA 1U2SA 3L0OA 1YZTA 5MF6A 1WF3A 3REGA 1KI6A 2D2XA 4OHCA 2QL7A 1UT5A 1C8KA 1GN8A 2G82A 3DVSX 3EQ8A 3TFQA 3V80A 5HUJA 3SQNA 3K3PA 2WQ6A 4PRYA 1FSPA 2CW5A 3AB8A 4MHSA 4FIDA 3E3NA 4QRHA 2BFEB 2ZJ1A 2WAXA 1M8JA 3ILYA 1I1OA 1QQ5A 1OZAA 4AY6A 4KKVA 2QY6A 1SHJA 3QVVA 1U9IA 5FLKA 3UFBA 1UFVA 4L51A 2NMVA 4R9SA 2VK1A 3K9NA 3V3KA 4TXNA 1I7SB 2NACA 2RAFA 4G5GA 5BV2P 1LPPA 2FN4A 1MEOA 2WHQA 4R7ZA 4RPGA 4GDFA 3KB8A 4Q7MB 3S5JA 3UGKA 1SCNE 1E2DA 4J7AA 1S4QA 1IN6A 1M1ZA 2JGLA 4CKBA 2UKDA 1GFSA 3AF5A 3QF7A 3WDSA 4C0BA 2VVTA 3D6JA 2A35A 3VUFA 4I8IA 4KPFC 5HSGA 3Q8MA 1G8HA 2W5UA 2EF1A 2JLBA 3DLIA 3I28A 5EWJB 3D64A 4KO2S 4CWAA 1C7FA 4KQFA 5C31A 2DT8A 3PTLA 3OTQA 4I2VA 4BECA 1M2WA 3ZE6A 2O3UA 4RVSA 1VI6A 4R5MA 4B3RB 1H5QA 2Y0EA 4OSOA 3HO1A 2FA9A 2IHTA 3H2IA 2GLUA 4D3FA 4NBRA 3OIYA 3Q3CA 3LPAA 1VJTA 3BBPA 3RC2A 1SBYA 2C78A 1J33A 1XHFA 2B7BA 2X8JB 4DYDA 2FPXA 4CLEA 3DAFA 1Q1ZA 3CRMA 1M54A 5C7IO 4F4JA 4CKEB 3DDWA 4RPCA 2H5LA 3ELYA 3AU8A 4CU5A 3I3SR 3Q0TA 4UTZA 5ALOA 2OCXA 4EPVA 3OQMA 2BUCA 4RHTA 1N6IA 5CA1A 2ZU6A 2J07A 4X6YA 4P0PB 3BSWA 4DT1A 2IA5A 5ERXA 4GKBA 1PD0A 1BXGB 1Q7BA 2W2MA 3RRNA 4JBLA 3HCOA 2WYWA 3EMKA 4F6LA 4OHRA 2X2EA 4MS4A 2HRBA 5AM1A 3TSWA 1LVGA 4DSZA 3NYQA 1GWNA 2FUKA 2QP9X 1TVKB 3OJ0A 5FOXA 1OLXB 5BQXA 5BN3B 3VZDA 2PSFA 3JZAA 4Q48A 2BI7A 4U7TB 4B8YA 5B2ZA 1NI5A 4O4HF 3GR6A 1PYGA 2IVFA 4DE5A 2FQWA 3WGJA 4AN4A 1L4UA 3BTUA 1QIMA 2WWTA 4JEIA 3QUAA 3V4VB 3FHCB 3WLLA 1A9OA 1RD4A 5FUYA 3HO6A 4ZCPA 4BMCA 2A3RA 4ITRC 4OTZA 3FBGA 4UCFA 2R6DA 4QGSA 3D02A 4OHWA 1T0IA 1VSTA 1MQAA 4HAWA 2DFNA 3AC0A 1YZHA 4AJ4A 4WECA 1P2VA 1CRZA 3HCBA 4DQ0A 3RUCA 3ZZUA 1P2DA 3H7IA 2FPIB 3UXEA 3Q9UA 1L4BA 4M1ZA 5TVGA 5JZMA 2HO5A 2NNWB 1FTYA 4N6GA 1ZRSA 3F7MA 1OVMA 3C6BA 1XVVA 4JJ7A 4YAEA 3FFBA 4H1TA 3R9KA 2FVYA 3U3JA 2H59A 2AFIE 3W4IA 2OUKA 4QXQA 4U4AA 4C0HA 2XPCA 4XVUA 3EIXA 2HUPA 4WXPA 4JI8B 2P67A 2QRPA 1SOWA 4BVFA 1JFTA 4G0UA 1BGXT 2QQEA 4KDEA 2GUWA 1CVRA 2B94A 2HNAA 4RPIA 4C4TA 3TW6A 2GQ0A 3HXTA 3IIEA 4R1OA 5E1BA 5JUWA 4GBJA 1P7ZA 2FR1A 4P7FA 3NLLA 1UWLA 4E2YA 2B21A 3ETHA 5CT6A 4E51A 2VP9A 1FNSA 5FPQA 2JGEA 1SUBA 1IIRA 4AVYA 1S8NA 3QF4A 3RF6A 4IHJB 4CMHA 3K6RA 3HKEA 3EGXA 4OK3A 4JC8A 5I9BA 2X13A 3WGOA 1L8OA 2Y9PB 2Q3LA 2YNMD 3DUFA 2QG6A 3HA5A 3ZH9B 4MVJE 1NXVA 4XOUA 3HE3A 4F71A 2RGWA 1KSJA 3AVXA 4URWR 4WJZA 1ULUA 4LY6A 2WWYA 1DT5A 4BO4A 4D8WA 5FBKA 3F3MA 1OIXA 2D6FA 4QEDA 3O1LA 4GLJA 4XB6B 1UJCA 3M9XA 4NARA 3PVZA 4NG4A 4ZRMA 5EIBD 2CXRA 1EG7A 1WV0A 1PFGA 1XCLA 2NZWA 3CZ5A 3RFFA 1VIAA 1EDOA 4QDJA 3UB2A 4F5ZA 3PC6A 2OM2A 3PC3A 4IJQA 4H4DA 1JDNA 4W5WA 5EESA 4R2JA 2ZITA 1QP8A 1RCTE 2HJGA 3HCNA 1YRHA 4ZYLA 3OLVA 2C2ZA 3ND6A 4MV3A 3B1FA 4BLRA 2PZLA 1WUIS 4Z4FA 3PHCA 4H1VA 3CF6R 5AKKA 2QIOA 1NI4B 5KC9A 4RYLA 1NX6A 3ROTA 1BCSA 4G5SA 4GR4A 5TV2A 2VR1A 3X1JA 1PWZA 3QNUA 1J99A 1QGZA 3R3HA 4OBBA 3VHXA 2C0CA 1DIAA 4HMOA 3TZEA 3QNMA 5ALZA 4AUKA 2GDZA 3NJRA 5AI9A 2C95A 2V4UA 3O9ZA 5G0SA 3H2GA 4MQBA 4W5JA 3CUWA 5EIAA 1RBMA 1LH0A 2J9FA 5J1SB 4DJFC 2DPHA 1HFEL 1MHPA 3PNPA 4RQBA 3HFRA 5AVKA 5F1PA 1JEJA 4GWGA 3W6PA 3MMNA 4WZAB 1KOGA 3KQNA 3IAFA 4UHCA 4KPUB 4DLBA 4M0UA 3LBAA 1RZ3A 2RKBA 3WLPA 3IAHA 2D5CA 4MV4A 4RH1A 1O0SA 3TQIA 4B75A 4HJRA 1SCJA 4ENSA 3CZCA 3O75A 2YYAA 4OIMA 3UXYA 4DIBA 1C0PA 4QUDA 1Z0AA 1E0SA 1G7RA 3M5CA 5ALJA 3E5MA 1E4EB 2WV7A 2O1EA 3F9CA 5HXAA 3V32A 3ZXYA 1DZIA 2OD7A 2V45A 3UMMA 3LUFA 4I4LA 3CONA 3WGHA 4H6WA 3G5UA 5KQLA 1A9ZA 2R0QC 4RWZA 3ZU6A 2X2OA 4AX4A 3G2OA 3HYLA 1B8VA 3NTXA 4E2ZA 4RZ3A 3E05A 1TT7A 1LD3A 3OZCA 1YR9A 1VHJA 5TQ2B 4I19A 1AKRA 3VAZA 1VJ5A 4Q47A 3L0PA 2TSYB 2C84A 3EAFA 3PD0A 2W8BB 5GONB 1D2GA 2L2QA 3CEPB 2QN6A 3RTEA 2OHOA 3GJTA 3K2BA 3KRTA 3N0TA 4MQLA 1EVIA 4FMPA 4O0LA 1YB7A 2OMEA 4PX5A 5EZQA 1F48A 2CVOA 3SKXA 2XF8A 1DXHA 5F1OA 3UK2A 4R71A 3I5MA 3GIDA 5B1SA 2FSGA 3S55A 4RSHA 3IAS6 5EP1A 2PX4A 2OBNA 1PZGA 1S1CA 4QZVA 2ZKIA 5H3HA 1IM8A 3OOJA 4WY5A 5KWEA 2WUGA 2XZTA 3PQ6A 4LF5B 5CB4B 5EIOA 1Q1EA 2OCAA 4HEHA 2HPAA 4V0MA 3BDAA 4MMXB 4R0VA 1E9CA 3L8EA 1DAKA 4IM7A 1LKZA 2WJPA 2BGKA 3HVJA 3FWZA 3NWBA 4K2HA 4ZOCA 3SC2A 4B81A 2IX3A 3GXOA 2DAPA 3IQIX 1NW7A 2HIHA 1KS9A 3AUAA 3CJRA 1JFLA 3DTTA 5EZSA 2OXRA 1BA3A 2GB4A 4PS1A 5EZYF 3WRYC 1TTPB 1B41A 4TXHA 2ZUWA 4MB2A 4N0MA 2QVCA 1PR0A 4BCCA 5BW8A 1XZFA 1OTHA 2CXTA 1HTWA 4UUAA 2A9QA 2IXFA 2RGDA 3K8ZA 4PW0A 2C3OA 2JI7A 1FQWA 1KAEA 1PQUA 4J7XA 3W6ZA 3DDNA 3JVIA 1XDDA 4N7RA 2FKNA 2K7FA 2GM4A 1IL0A 5JDIC 5A5GA 1FNCA 1KVTA 2XNSA 3QWBA 4PTYA 1ZYUA 4E0BA 3UIEA 5HFAA 1COWA 1BKSB 1VYUA 3JARB 2Y6UA 2HLDD 4OKSA 4RQUA 5ES4B 5LZ2A 2O8BB 1FX0B 3CEHA 4EPYA 3EIWA 4XX1A 1JDVA 3A05A 3SVZA 4XXHA 3KB1A 3S2YA 3BD8A 5E7QA 3VPAA 2E21A 2IDMA 2Q6TA 2X1HA 1AQIA 1SRRA 2ODQA 4IFTA 5DX8A 3ETCA 2PGOA 1VKHA 4ZEOA 5E6UA 4M9RA 1M2VA 1YU6A 4RZIA 4NHOA 2UYHA 3Q8KA 4GAEA 1E1QD 2OBXA 3ZCUA 1BDHA 2QXUA 3KUCA 3O9MA 1B0ZA 4J0GA 1P17A 5CG1A 4K28A 4R1UA 2WU0A 2B78A 1KKUA 3HWRA 4N49A 1OF1A 3ZTTA 1HEYA 4IJMA 3AP2A 4G5OA 1W35A 2AJDA 2G67A 3ZX5A 2HN9A 1FL9A 2AG6A 2GZSA 2B1RA 1YQTA 2IP1A 1CE8B 1ES9A 2PO5A 4OQNA 3U7FB 2ZUSA 3BTSA 3ND9A 3OF2A 4EVQA 5BMVF 3H8SA 5DGDA 4FYIA 5EINA 1N6LA 3EEOA 3GW8A 3BH6A 4RJIA 1CHNA 3HU2A 5AH0A 2AE2A 4CG3A 2PXCA 2IZ1A 5KDDA 4CLRA 1BS9A 1DC6A 3KP1A 2HM7A 3UK0A 4GRDA 4IIEA 1LQ2A 1T2FA 1FDUA 5F4ZA 5EE3A 4CM9A 3FMVA 2PRSA 4OXNA 4E5DA 1JAHA 4D3DA 1AQYA 1NN0A 3UYLA 1JJAA 3L7NA 3ZW7A 1BVYF 4DRYA 3UV3A 5BP7A 1XTVA 1R5NA 1V11A 1XXHB 2ALJA 2B0JA 1RYZA 1CUYA 1FMTA 2EG9A 2GJKA 3II6X 5CTAA 5BY2A 5FOWA 3F96A 5D3MB 1T2NA 1KZHA 1P4GA 1CJKC 2OESA 3KAJA 1V1MB 4F0JA 4DCVA 5A7HA 4GI3A 2ZG6A 1GTZA 4QU0A 2O9JA 3G6KA 5JVDB 1GTG1 4B40A 4J2HA 3V1KA 4I3FA 1TZCA 1U2GC 2ZSAA 2D5BA 4RDXA 1YVPA 1QV7A 3K0KA 4DR4B 3EOAI 1Z88A 4GICA 5IN4A 4EQ6B 5DXFA 3ZYZA 4PAWA 4U8HA 1U0LA 3AR3A 4A6DA 3LQ4A 2GO1A 1ZGAA 3F1KA 4MGKR 4R41A 2CF5A 5K3AA 4Y2UA 3W9YA 4BMYA 5JI3E 3WLMA 4BJ5A 4KN9S 3V4ZA 1A4XA 1N0IA 4WGFA 1FB5A 1W2GA 5FP0A 1SGWA 5T4EA 1XMJA 1ZIYA 3LQYA 1LC0A 1KGDA 2Q1SA 2CYBA 2QKYA 1JH9A 1Y4DE 1ZD9A 5FHRA 3DFMA 3IQGX 1QH9A 3MTGA 4AROA 1CUHA 3UOAB 1NNI1 1RJGA 1YS6A 4RMGA 2AEEA 1JEDA 4CIAA 4KE6A 1XPJA 1QQ7A 1JLKA 1WCIA 1I7PA 1XYVA 2AG0A 4MLCA 4RF4A 5A3JA 3CVJA 3FDJA 5CLQA 3W9UA 2ZI6A 4BTLA 5LA6A 1BWSA 2XTJA 3FOWA 2O3RA 1QFXA 1VP9A 1WMFA 1MPTA 1CZHA 2XGMA 2XIJA 4YP0A 4AXXA 3QUQA 5C5EA 4FUQA 4ZAVA 3K16A 2H2IA 2NO9A 2WY2D 3O95A 4G2NA 5DHPA 3SHQA 3VR0A 1VKRA 2PKQP 1YO6A 3Q3VA 4MUIA 3GT3A 5FTNA 4GRIA 2J3MA 4CLHA 3ZJUA 1PJQA 2POCA 4BB6A 3NNDA 1UMCB 2PZEA 4AZSA 4CCYA 2EQAA 3PKJA 2ZUVA 1Q0RA 2Y76A 1T1IA 4JXJA 1E5XA 1WABA 1P31A 2YWCA 4HLCA 4J29A 5E3IA 1K5DA 1LPOA 1U7XA 1OILA 4WXYB 2HY7A 4U9IS 2VTDA 1JKJA 4RGYA 3RPEA 3WZMA 1CDOA 1AHIA 2JGKA 1M6VA 3WLIA 1ZN9A 1PK9A 4KQ9A 2FSVA 4L8VA 4BJ1A 2LD4A 4DEVA 5BSWA 1P4JA 2H1RA 2XCIA 2C5AA 4QLOA 1L3BA 1Z9BA 3NEYA 3U7EB 3SYTA 3NBZC 4JS0A 5T7BA 2GLTA 1YZLA 1YJCA 1A97A 2R44A 2VUIB 3HCDA 1A2OA 5GZ1A 4RY8A 2KJQA 3SXPA 4C7JA 3GUZA 4A8JC 1GG8A 2ZT5A 3MUNA 3HMKA 3VAYA 3ET4A 4X6LA 4UNIA 1P3Y1 4NOMA 2XUQA 2R6AA 5DOVA 4HN4B 2NXCA 5IJXA 5LQMA 1STOA 4Q1CA 3PUJA 3R77A 4TVOA 2R7LA 5DGXA 4DL9A 4K0KB 4XIGS 2H1WA 1BOOA 1YC5A 2OM6A 1ZA1A 3G9ZA 3K72B 5CT4A 4RA9A 2HHLA 1OTYA 1UBSB 2ESRA 1JZQA 1Y8RB 3N86A 3VNAA 5JATA 3OPYB 2IZZA 1F9AA 5BVHB 1ISRA 2RG1A 3BMCB 1BRMA 3CX6A 5FKJA 4FIZA 4ETIA 1ECLA 1OXUA 4QPNA 1VHWA 5D3ZA 2M98A 5BRNA 3CLUC 3AY6A 3K6JA 4C4SA 1I7QB 1GUBA 4YWJA 1CJBA 5CDFA 1Z6ZA 3OESA 4JJEA 4U7PB 2O1WA 4OLFA 3DB1A 2R8XA 3IMEA 4K9KA 1NRXA 821PA 1QRUA 1FBNA 4QYIB 5TY0A 1R18A 3E35A 3K0EA 4CU2A 3UVEA 4EI9A 1IM5A 3F4LA 1BA2A 1RHKA 3SKYA 4MJXA 5IUNC 1N6OA 1C7RA 3AI1A 3PFFA 4NZPA 5ALLA 3QH4A 1Y1KE 3U7QA 4MP3A 1PZHA 4WH0A 4MEAA 4CUJA 1USVA 4TV9F 4DLRA 1NI3A 4JLMA 2HXSA 2QROA 2JFYA 1HKHA 1KJIA 3FTDA 1ZUD1 4AX8A 1X42A 5LJIA 4UCWA 2PKXA 2JCBA 1WBBA 3QNWA 3T4UA 3TX2A 1EPUA 1G5RA 1N5DA 3BIFA 1SZJG 4MP6A 4PYRA 3BB1A 4BP3A 2P3OA 3UICA 3I5XA 4UHHA 1KPGA 5JS8A 4V0LA 3A0RB 4YRSA 1FNMA 5EJ4A 4TL7A 4EBBA 3IMCA 2V55B 1GUDA 1HUQA 4GX2A 1GGMA 2JVJA 4X61A 2HZ7A 3SS7X 4IMIB 3V33A 5K03A 2SKEA 4EI7A 3BCSA 5I51A 1ANKA 1R0ZA 1MC1A 3QPCA 2NO5A 4R2KA 3CMCO 1II8B 2AQ8A 3D0OA 3T9FA 1NJGA 1VCIA 1DO0A 1KYWA 3JYLA 1X38A 4D80A 4M3NA 2ZAMA 3SJUA 4F85A 2E89A 3B3GA 2PEYA 3TEJA 5JO0A 1XRMA 5JS7A 3OQOA 1ISPA 4OU4A 2NPFA 1IHPA 2P77A 4WY2A 1BCRB 2V6MA 2VJOA 3LBFA 2E4XA 4FEEA 2C5FA 4G5FA 5FXMA 4KXQA 4CFZA 2FWNA 3IJRA 4ES6A 5EJMA 4AJLA 2A59A 1UXGA 5D5HA 4EKDA 1JDPA 2YOHA 3EXEA 4UVDA 3I2IA 5BV8A 3ZWDA 1SUIA 4XWWA 1R9GA 5AKXA 5BSMA 5LZ4A 3LX4A 1TX4B 2G6BA 4UUBA 4OAPA 3ZDRA 4KV9A 3BAFA 1G98A 1Y82A 4M98A 5FWXB 2JAXA 7AT1A 2OC4A 2AEMA 2P2ZA 1SHLA 4TLBA 1IG0A 5DI3A 1POWA 3VTKA 2C2WA 4JSYA 4MAAA 3OCCA 4O4JB 1NW9B 1H2EA 2XGOA 3U61B 4MV7A 1DJMA 4I9HA 3ZWPA 4W5NA 1E20A 1H9AA 2BF4A 1XTJA 3C5CA 3GDGA 2XHZA 1M2OA 3ANNA 3ND5A 2XODA 1MVLA 1JHUA 2N0SA 2HT1A 2QUIA 3WK7A 1F2TB 3VKWA 5ER6A 4FBMA 4WN3A 4MYCA 6REQA 3HJHA 1VKJA 3GUVA 5TQJA 4E6EA 1RXIA 2I4MA 4DDVA 2ZJ3A 3NC1C 4IJVA 3PQ8A 1G1AA 5BWNA 3DO8A 2H63A 1UMBA 1SQ5A 3THSA 2XCRB 1NQXA 4Q3NA 3QQPA 5DNAA 3ZS8A 1DKRA 1U1FA 1IY8A 1GN9A 2XRYA 4N54A 4PO1A 4BQOA 4DCJA 4ARCA 2TMKA 1IOLA 4HX2A 2FR0A 2O1SA 1JAXA 1JJBA 3NIGB 5GAJA 1KEZA 2BFWA 3OY7A 3F4BA 3L41A 2ZRKA 3TB4A 3HEAA 3GLGA 2XT6A 1CR2A 2PHZA 3TLYA 4UAVA 4W1PA 3DMGA 3W8NA 4NNJA 2ZUFA 3VU3A 1QCCA 1PGPA 1ZOIA 2B82A 1C3VA 4R1NA 1JXMA 1L8QA 3AFOA 1VBNA 5L6MB 2DULA 4FPXA 1ZN7A 2DR3A 3AIOA 1RAEA 4W9RA 2O8CB 1GO2A 1L3CA 1DAOA 2LE0A 2AF4C 4OYRA 5ICGA 4OP3A 5KVCA 2I7VA 1U9ZA 5ETJA 3UOWA 2XUDA 2HPHA 4TTSA 1RS0A 4Z9FA 3IT2A 2P3QA 3FPAA 4UDNA 4TSFD 1YS7A 1C7EA 4E5SA 4DQDA 1FFSA 3LF2A 3ZU4A 3O73A 1T0HB 5EMHA 4K87A 4PZ9A 4XWGA 4DNPA 1SR8A 3V5NA 4RZQA 3HBMA 4Q82A 2ACEA 2ZRIA 4JUFA 1I2AA 3QMWA 3SMQA 5I9NA 2I4RA 2FUNB 3HL4A 1W5EA 2ZAIA 4MQ4A 1VB3A 1NPDA 3ZDXB 4QBKA 3ONEA 2AOUB 2GEKA 4DR5B 2BFDB 1RNLA 1ZLYA 3O3NB 2GF9A 4ZALA 5I4BA 3DNFA 4JLSA 4H15A 1Y4SA 1W29A 3IB3A 4PTZA 2C98A 2C9MA 4QG3A 4G8BA 4BFXA 4YCMA 1C14A 2Z2YA 3EWNA 3PD7A 1VGRA 1X87A 4TOIA 5LP6B 2PH5A 4ZXPA 3H9JA 2CUTA 1GARA 2OENG 3MMPA 3O8OA 3ROZA 3ZXSA 2H5IA 4XAQA 2IZ5A 1L5LA 3WGMA 4BV2A 3DD1A 1ZK4A 5HQ3B 5BVGB 4ZZ3A 5IC4A 3LFHA 1PJ8A 2BFEA 4JQOA 1ARZA 3S1AB 1BX0A 4I1IA 1W2WB 2HFJA 2HCBA 4LZAA 3QGMA 2JC3A 4GSLA 4N4AA 4P7BA 1MD9A 3RK0A 3ZK9A 1A4UA 4RQAA 1R00A 2JLRA 4TXMA 4TYWA 2P27A 3RBVA 1E69A 1HE2A 4C4XA 1WCWA 5L45A 2JL1A 1H6BA 2WJJA 3QTTA 1AD2A 4PSUA 3TS1A 4CMGA 4EUFA 3KKNA 2JIMA 3UQYS 2EEZA 4FFVA 4XRRA 5BPHA 1OH8A 2H7YA 3ZI4A 1I30A 1H65A 1JQ3A 3QW4B 1WHSB 3UAVA 3C5WP 1E6MA 3T7KA 3WL5A 4JKOA 3G9TA 4MVWA 5H1YA 3KAKA 5TPZA 4TROA 2FDRA 1LJLA 3KYCA 2AFHE 3NEJA 4UCXA 5E4JA 2ZT8A 2EW2A 5BUSA 3ODPA 1O4VA 1Z56C 5BYAA 2VP4A 4RTMA 4MRMB 4Q9AA 3U4GA 3V1NA 3ZLJA 1E1MA 2OZLA 3BZWA 5LCXA 4P9NA 4DDUA 4DCMA 3JQPA 2EKPA 1XJ5A 2CJPA 1TM7E 2PK3A 2E4AA 4PZPA 3I8SA 4IIJA 1UK6A 2CDRA 3A6KA 4R01A 3RU3A 4DV2B 3S44A 2F2TA 2VQSA 1JU4A 2CJYA 3VOTA 1YZQA 5J5VA 3SG0A 5K0EA 4LMAA 4YT4A 3ZHYA 4HF7A 3HP1A 1O03A 2EEPA 4GYYA 4RELA 4F97A 3AK4A 3C85A 4CG0A 1DELA 3TOCA 2FXVA 3KQMA 3DR5A 4NIMA 1HORA 3N5CA 2EZ4A 1Q14A 2IEDA 4V2IA 3QXHA 5E3JA 3TTWA 4PNEA 1MA3A 2R8PA 3OMWA 5ADHA 3M7IA 2HAEA 3CLUD 1ZRHA 2H5EA 3WGQA 4DLTA 3KHTA 3T1QA 3TEFA 3WO1A 1I2BA 4FYKA 3G89A 1RP1A 5DE3A 1FTNA 4LRTB 3UG6A 1EXWA 3CVVA 1J42A 3BVPA 3K05A 4J1NA 4DN6A 1D2AA 5CBPB 4ME6A 3BE4A 3IXQA 4EW6A 1QGED 3W3AH 3KYDB 3LXXA 4BBZA 5MN6A 2PNFA 1RKUA 2UZIR 3IHKA 1N1MA 4LXQA 4AYTA 1TRKA 4DLNA 4EK9A 4WCVA 3AUUA 4F2GA 1SIUA 2DQZA 3HUEA 2BM9A 4MB6A 1H1DA 1Z6XA 3L4JA 4V0NA 3EHEA 3ONFA 4FDUA 4MV9A 4JKYA 5CYGA 3T3HA 2ZZKA 1ORVA 4MZXA 2GK3A 3U3OA 4CEHB 3H9GA 4P2GA 1J22A 1L0BA 1U5CA 2IYZA 3DLAA 1ZQ9A 2N1BA 3I6QA 5DTMA 5IBQA 5LMCA 3N2GA 4FMDB 3TAXA 5AM0A 1T2EA 1HEIA 3ANSA 1DC4A 2PUTA 3OOSA 5DBGA 1GITA 4EDHA 1DAHA 4IH4A 4P3NA 4A4DA 3R3ZA 5ALUA 1LDBA 3K9WA 4PBTA 3PIDA 4HAZA 4K9QA 4UOEA 1U9YA 5C52B 5TGDA 3MJCA 3S40A 4GM0A 4X7PA 4D43A 4LECA 1OFVA 2BW0A 2OKGA 3QTBA 3VO2A 2X14A 2GUGA 1T8YA 1O77A 4EG7A 3H8VA 4YH1A 1NUHA 2B9EA 4ZVRA 5FO0A 2BBSA 1AGPA 1L5WA 2RGXA 4GLBA 4QEZA 1GRCA 1G9XA 1SEPA 2Z5VA 3UAWA 2Q2NA 2J3QA 1O8CA 2YWDA 1TQ2A 3NV7A 4XWAA 2A4KA 3GA0A 1YFJA 2Q1YA 3QYJA 2Z4RA 3LQFA 2KI5A 5AOCA 2PX8A 4B6GA 3SM9A 4TV8F 3RKRA 2I2AA 2C1ZA 4UD6A 3HKCA 2YWFA 3T1VA 2N42A 3D3EA 1W8DA 2OZKA 1RWXA 2HSDA 2M6SA 1FU8A 1U5AA 1WHTA 4WKOA 2FZ4A 4JHLA 3UHPA 4ER0A 3OM0A 1B74A 1CB0A 1LBEA 1GGFA 1QK3A 2IH2A 3WDLA 1A9XA 1XMXA 4J4HA 3UKDA 1OSNA 4GX0A 1IYZA 4X8OA 1DFIA 1W30A 1Y48E 4L2IA 3GUYA 2CL0X 4KLRA 2AOXA 4RFSB 2BFMA 1FFYA 3FMFA 4ETNA 1Y1TA 2VSOA 3CT6A 4BMZA 5CH5A 5D1NA 4YONB 1ISJA 1SD5A 2HI0A 2NX2A 2X15A 3IDFA 3NT2A 3E5HA 3COPA 3K09A 2QYOA 1BMTA 1HLGA 1KR5A 3SVTA 2YXBA 2G0AA 3JQ7B 4CL8A 4MJ7A 4PWZA 4RIHA 5MDHA 4FQ8A 4MYTA 1A0OA 4L75A 3GNSA 4KXXA 2QMHA 3DGFC 5DBFA 5LU9A 4L07A 4H7IA 1E2QA 1BD3A 1GCGA 3GZNA 4MKRA 4UAUA 3F2VA 4A6XA 3DCYA 1Z2CA 2C9OA 5K8CA 4RNCA 5C80A 1VGVA 5EJEA 3C5EA 2OEPA 1VZ3A 4XVRA 3W77A 4A2QA 1LV7A 1V2GA 2WNSA 5EKDA 5JQGA 3NOXA 3PX7A 3EGIA 1UBJS 3ZZTA 4LISA 3WTCA 3DHVA 5K9ZA 2GEBA 1JIVA 1MO4A 1XZJA 1X7GA 5B30A 3JQ8B 2YJ3A 2YN0A 1WMBA 1CP3A 1XAGA 2NVWA 2YINC 3EIFA 3F3KA 1P33A 3FFXA 3HB1A 2FKAA 3BS4A 4PF1A 1W4BA 5HF8A 4AI6A 1IDOA 3QEKA 1SXGA 5FCDA 2ZDGA 4TGLA 1PNRA 3O4FA 4GMGA 3UMGA 3D8BA 2GNAA 2H29A 1IXKA 2BEUA 2ZB8A 3GJYA 2I8LA 2IYVA 1PUIA 1TVCA 1M6WA 1RHUA 5DEOA 1TZJA 2BJHA 4A91A 2L42A 2FZEA 4K9PA 2AR0A 3TW8A 2QRVB 1O57A 2CNWA 2CXPA 4YGXB 2G40A 2WSSA 3BIJA 1T29A 1DCKA 3E2IA 3KT3A 4I4TB 2TECE 1WXFA 2PXAA 3AR9A 1XA4A 1U28A 4O25A 4ZDWA 2A9JA 5BQFA 4CT0A 1PFVA 3MRSA 1X7ZB 2F4NA 2PWBA 1UPXA 4G23A 3AEYA 3MYYA 1UJ4A 1YL6A 1HX7A 1NF2A 1KTIA 5M3BA 2GT1A 5IC5A 1NVGA 1SQ0A 3HDTA 4H7PA 2GTIA 1SQFA 4JLNA 1JR2A 2A0WA 5H16A 5TT0A 4ALNA 4BFSA 3OCVA 3BGWA 4DMKA 4LGYA 4E5YA 1H3NA 1PJSA 4I6GA 3ZGNA 4EMBA 5HZKA 3KTDA 1UBGA 3VSCA 1AXGA 4B17A 3EVAA 2NTYC 1WF6A 4NE7A 5BSUA 3R5XA 1Q5PA 3KCQA 5K8JB 1YDWA 2CXNA 3DXYA 4I9FA 3HO8A 1P0PA 2QN3A 1QHIA 2BGUA 2PDAA 5AW6A 1W85B 4WDRA 1LEHA 3H7AA 4ZQCB 3N70A 4X95A 1KWKA 3KEGA 2ECPA 2JGIA 4RHEA 1E5LA 2IS2A 3ENNA 2RHLA 4TUYB 1GDHA 5EP2A 1SBQA 1VA4A 2HBRA 3U5ZB 3SBOA 1TFUA 3WKBA 4C4OA 5K7SA 1UJ2A 2NT3A 3PL1A 1IPEA 1XFDA 1MTZA 4GLFA 1LJUA 1N2CB 1J0DA 1KFEB 1PS8A 3OCXA 1MAAA 3ZV7A 1MO5A 3ISTA 4NP6A 4PGAA 4TWZA 5H02A 3EUEA 3WLAA 2CLIB 2OMKA 2QG4A 3ES9A 4IV0A 3JRWA 4UVGA 5C8YA 4HNHA 1YVUA 2QM7A 3BGOS 2WKSA 4D3XA 4ZHSA 1G3MA 2F1IA 4I8DA 4LZLA 4OLHA 2BJVA 1Z45A 1A9QA 3MGAA 4WKCA 2IXAA 4P08A 4J1QA 5B5SA 2PGJA 4X3CA 3OF5A 1U2QA 3WV4A 2SCUA 1X80B 3JYOA 2I8CA 1HT0A 2WMOB 1HLDA 3NO4A 4FFBA 3V8VA 3QWHA 5INTA 2F55A 2WV9A 1Z6QA 2R7MA 3UMJA 3ZBPA 1P4SA 4Z5XA 1N4DA 4Y9RA 3CLKA 4Q9HA 3RNLA 1Z15A 1FUKA 1ZZEA 2J3DA 2VSFA 5LYJB 2C4NA 5E9QA 4IIGA 1VBMA 2UV8A 1UZAA 3MAJA 5EKTA 3RUHA 4ZHQA 3W1EA 1BMQA 1K97A 1HNXB 1CB7A 3NTUA 3RV3A 5DCLA 1HDYA 1KZ1A 4QQRA 2XQGA 3LKDA 1ORHA 4GR9A 3VJKA 5H4GA 3DMYA 4HQFA 3ENKA 1RPAA 1PX0A 7REQA 2E7ZA 1GNTA 2FPGA 4LVNA 3NYWA 1APBA 3FNGA 1DQPA 3A10A 3MGBA 3P1JA 2A86A 1ACLA 2WHPA 3PDJA 3O84A 2HWWA 2NWQA 3VYRB 4IQ8A 3PDWA 3L0SA 1KRXA 4COOA 4JWTA 1ADBA 1O6CA 4HSGA 4QICA 2QTZA 3ZHBA 3W3AD 3CG0A 1VRCA 3RS0A 2J0QA 3ACBA 2FK7A 3RF7A 1YBFA 2BR3A 1IY1A 3NV9A 1ESDA 4GE3A 2XW6A 1J90A 3BFPA 1QE5A 5MN5A 3CNBA 4KLCA 3HK2A 2GN4A 5DHQA 5A3VA 2HBZA 2VPQA 4Q19A 3BKWA 3EFHA 3H5NA 4JJGA 3EDCA 2J48A 2XXAB 1XDSA 3CT4A 3KT8A 1VXOA 3A3YA 4GUDA 4GYKA 1ULHA 1DBQA 3T12A 1L5HA 1Y8CA 1GP2A 3KYJB 5BV7A 3E3MA 4CM3A 4C0XA 5IASA 2Y99A 2IELA 1CX9B 4JVMA 1R0KA 3A2NA 1GUYA 1YKFA 3I4FA 1G5TA 4K7JA 1Y33E 2FSVC 4LWPA 5JSKA 1XTTA 4HYQA 4KGXA 3TQFA 5FBHA 1SKBA 3KVYA 4BAZA 5CA0B 2XB2A 4CG1A 4X62B 4DKJA 4H6VA 3ZC3A 1CUGA 4U0KA 4J07A 2WD9A 2GWHA 3MWDA 1GFWA 3RIYA 4IFIA 1PZNA 1S9DA 2IHZA 2QQ5A 1T26A 2ZBEA 4LJYA 1SHKA 2JFOA 3V55A 1L8LA 3ANLA 1F5SA 4ZAYA 2XLCA 1C9NA 1H85A 1U8YA 3AEQB 1XMQB 1NGSA 1VI5A 4Y2PA 3D6UA 4OGGA 4JJFA 2IE8A 4F21A 2J1LA 3I9NA 4MR7B 1C7QA 3AVOA 4H77A 3AV3A 2BF7A 3VC2A 1RM3A 1Y3AA 4E2XA 3UZUA 4PG8A 5CW2A 4BKOA 2ZUCA 3LVFO 3BSYA 3VR5A 3ZWKA 3Q41A 5BT8A 3QUCA 1F60A 4F1KA 2B2CA 5G0VA 2ZYRA 3M6XA 2Z2XA 1DARA 3V3TA 4LW8A 3H8JA 2EHJA 4EA7A 3DEHA 1BQ3A 3N2ZB 2GSWA 3JAMA 1C7IA 4EW2A 1IC6A 1FJHA 3DAOA 1IJEA 4EP1A 4JL5A 3RS3A 1Y6RA 2ZE6A 3A9RA 3KPVA 4KVFA 3GVXA 3ZHRA 2A7XA 1KEUA 2HREA 4LC0A 5FI0B 4AUNA 4D5GA 4BXOA 5MFPA 4F04A 4FSDA 1EFCA 1MG5A 1RPNA 1O94A 2ZCUA 1UBEA 4G4SP 4RK5A 3C8ZA 2NUBA 2NPOA 5JXWA 2ONKA 1IN1A 1B6RA 1ADGA 2JBAB 1B1CA 1DE0A 1AXRA 2ODPA 1CWUA 2I76A 2NV2B 2YW9A 2I3GA 1TA9A 1SU4A 2ZAGA 3EULA 4IDQA 4YJ2F 3UJ6A 4X1KA 2QTFA 3IP8A 2D2EA 5K3FB 4W1SA 1EBBA 1MH9A 3S7TA 3BEDA 5JBIA 4GPBA 3GBPA 1UK7A 5A9TA 3MUFA 1ENOA 1WMEA 2E6UX 3T5AA 1V5IA 2PLAA 3CKYA 3EZ6A 1K6JA 4JY7A 4LG1A 4LBYA 3U7HB 2C4VA 3I58A 3W9BA 4E5MA 1C0EA 4FP9A 2BFOA 5L3QB 1AKYA 1J2YA 2CDBA 2J9RA 2WVHA 1NBME 2WYIA 4HKTA 4JBYA 4BJHB 3BKXA 3TIVA 3WGVA 4BKMA 5THKA 5DYNA 3EIUA 3QW2A 4UZFA 3SLKA 2ZB7A 4BEWA 2VWPA 3PUHA 5JAUA 3IAXA 5JAQA 5J4VA 4RZXA 2VPYA 2Q3FA 2ZFUA 2BFBB 3NBFA 2XECA 4U6SA 2AJLI 4JV5B 2YX1A 1DIRA 1ADFA 1NKSA 4K26A 4Z51A 1OXTA 4B85A 4EY6A 5K6AA 4DEXA 9LDBA 2IYAA 4NJEA 1SPBS 3VDNB 4IXMA 2HWXA 1WQ4A 4LK2A 2BPOA 4DW8A 2E4VA 1N5KA 4RL6A 3RS2A 2QTHA 1RJ9A 4HNVA 2VP0A 2D1RA 3JTEA 2HT6A 5ENVA 5JNVA 2RJNA 2C42A 3CH7A 4MWZA 2NVUB 4YXWA 3HQ4O 1ZKDA 3LFUA 1UXIA 3P32A 1ZHFA 2NXNA 3MVEA 4KDFA 1P61B 2X8BA 4N5LA 2OBFA 4BWYA 3U44B 1E8NA 2YZ2A 2P9YA 2JAUA 3CY6A 3E5RA 3L1UA 4MIEA 4I1RA 4QYTA 5I7SA 1U2EA 2FOIA 2VDOB 4CMIB 4M6WB 4H7FA 5ALNA 3OIGA 4UEWA 1QF9A 3FJYA 1RHRA 3DVQX 4O4HB 4RD2A 1ZNWA 3U4MA 3NKFA 2PWAA 1JYEA 1N3YA 4S0ZA 1JFFB 1GNLA 3OOEA 4LOHA 4ND2A 7ADHA 2C31A 1WB9A 1Z37A 1FYDA 2FWBA 5GQSA 2DHEA 5SZIA 4WUTA 3ESBA 4ZPJA 3FBTA 4XR4A 3BG5A 5DBIA 5K4AA 1WB5A 3CTPA 3KCNA 1E58A 1VIYA 3PUXA 4PS0A 1NLZA 3W6NA 5T3UA 4BLQA 4AKIA 2H3EA 3O5AA 4PLHA 1GPYA 2VHUA 4YCLA 5DWVA 1V16B 4HGOA 3T7CA 2H2HA 4PR3A 4CM9D 1LRKA 2H5JA 3P9QA 4B43A 5FH9A 1TCAA 3QPVA 1TF5A 1M2KA 1GZHB 1RYEA 4N0PA 1N4AA 1FDOA 3PQCA 1AS0A 1IVNA 3RSOA 2NW6A 5CGQB 4M53A 5TT1A 4INAA 4K81B 3MWEA 2FSUA 3G0GA 3SHOA 5BN1A 2E5LB 1NUUA 2W0MA 3ZK7A 4DMGA 3O83A 3KJQA 5LL6P 1H8HD 2XZDA 4DJ5X 4F4FA 3A6JA 4HWRA 2VATA 1X0XA 3S99A 4BMXA 2I03A 1Q0ZA 4GOJA 3KR9A 3AOEA 1M7GA 3I1IA 3IODA 2C7PA 3DE7X 2OT3B 4Q7KA 3MB8A 3OJXA 1YZNA 1ZQ1A 4MVJH 4DPLA 4PYJA 2ZJZA 2Q4RA 4GXTA 4JENA 4DC1A 4EJ6A 4DQXA 3LGSA 4MHTA 2CUNA 3TVYA 4NCAA 3T7EA 2FMTA 1K5HA 5A04A 5IK2A 1MFZA 2W22A 3DFIA 3L4SO 2QD2A 2EJUA 4IL5A 3VU8A 2GFIA 3CRVA 2IIQA 1YIAA 3F97A 5JMWA 3C6XA 1C4KA 4F6RB 1T6ZA 3VNVA 2QZJA 4WOPA 4OXKA 3SR4A 1P7CA 3T1HB 2C29D 3NB0A 1M3SA 2XNKA 2XIQA 3W1VA 1ECBA 4FFNA 4JQZA 1FSFA 4XLZA 3UMFA 1K63A 3F8SA 5JSHA 4D25A 1PUXA 1D7OA 4KGDA 4LZJA 4ZVOA 2FWMX 3V1YA 1JDBB 4LJSA 1Q74A 4LJ9A 1RWPA 2WJIA 2VH2A 1QFMA 1FPMA 1P6UA 3ENZA 1D7AA 2IHBA 5AJVB 3ZDYB 3W6UA 1XP8A 2FZVA 2ZJ2A 4ZU1X 3EF0A 2CFOA 1EGHA 2B92A 1NAHA 2HK8A 2QVXX 3GO4A 3JAKA 3HBAA 3WIVA 3AO0B 2GCOA 4OXRA 1W581 4BNVA 2IY9A 2Q2VA 3T7JA 3F8WA 4G97A 3RYTC 1JSRA 5L7WA 5HMLA 3OT5A 1N5OX 3VR1A 3TI7A 1F1JA 2NAPA 1BYUA 4JN6B 5JARA 4OHMA 4QM7A 3AKDA 4DSUA 1USUA 3K4QA 4JVSB 4Z1MA 3ORQA 1QHFA 5C1BA 1H94A 3VSEA 3LG2A 4X63A 4EQZA 3CINA 4NK4A 4GOND 1Z7EA 5KYXA 1W9MA 2RHHA 4K9DA 4PLFA 4LX0A 5BSFA 4OHFA 3DW3X 1P4HA 4Z8YA 3V2HA 1PJLA 3I6BA 5LSAA 1UJ5A 5EAIA 3H6GA 1LDMA 2OCIA 3BMOB 5BSHA 1G5PA 3A6PC 2V98A 1T91A 4F9GA 6GPBA 3DA8A 2VJMB 3ECAA 2DYKA 1TYCA 1AOXA 2JAPA 1EJ2A 4N3NA 1O95A 4S1TA 3G2PA 2Z2JA 4D9CA 1EVEA 5JIBA 3VPDA 3ZE0B 1R64A 2M6LA 3TLXA 3GVCA 1WU7A 2BHSA 2HWUA 1DJPA 5GM1A 1Z8NA 4R3NA 2PL3A 4IQGA 5JJ5A 5JD6A 4B46A 3PR1A 1G6OA 2OLEA 4JJIA 1HZZC 1WOYA 5JCXA 2R1ZA 4LQLA 5PGMA 2GTHA 3UXHA 1XEWY 2EGUA 1CTQA 1UBFA 4UU8A 4RLHA 2VT7A 3V8QA 4QOEA 4FE7A 5D5QA 4BBAA 1ATIA 2G71A 1JECA 2IW1A 5ESWA 4G56A 2AN1A 5ALQA 4Z2YA 3IJ5A 3NHZA 4L74A 4AMGA 1CZRA 3VU0A 5JY6A 3JVVA 4EGSA 4W5TA 1B73A 2XZOA 4NDNE 3DYBA 4HPWA 1RTKA 2HV8A 4F6CA 3HPRA 1YSCA 3AETB 2ZUDA 1UKBA 4KCGA 4MS1B 3TG2A 2EOAA 3IT1A 1DMSA 3DZKA 5T4BA 4B4DA 2KLHA 3H2JA 4JMLA 5EEHA 1JRLA 1RFLA 1YA4A 1ZESA 5LIRA 1M2GA 5H7XA 5JJLA 3JD1A 2PH1A 3FSGA 4YO7A 3PS9A 3U49A 4OMDA 1XUOA 4CQMA 2FW9A 5B3AA 2MOKA 4JGBA 2OAGA 2VHCA 4FMBB 5FUWA 1GZ3A 1MAWA 2VJCA 2ZPUA 4P3PA 4RDCA 3VJLA 3Q4GA 4AIRA 1Y4AE 2CD7A 1SEVA 5JADA 1ZG3A 3QVUA 1WKCA 2QD5A 4RORA 2O2JA 5KC8A 3RUAA 1T1JA 5EZYB 2FEAA 3PXGA 1QP0A 1CVIA 2NZUG 1GL6A 2JI8A 1NATA 2Y71A 3K8QA 3W06A 2BFCA 4WAUA 2NTEA 1ADCA 2QY9A 4XGQA 2H7XA 1L4MA 4WUVA 1E3SA 1N1EA 1JMKC 3CF0A 1RYFA 2CHUA 2GOYA 1PU2A 1WM1A 2BEVA 2D4AA 2R96A 1AT1A 1BU5A 2PPLA 4LVOA 2X8AA 1ZM7A 1S8AA 1MV5A 1XCBA 3EDQA 4CEIB 1CW2B 3K9CA 2LCFA 2EATA 1BMFA 3UAOA 1U0RA 3MWFA 1PUJA 3DTVB 4L15A 3T1OA 1GGNA 2CBXA 3X0DA 4GP9A 1KF0A 3KUXA 4JNKA 1F8GA 5KPJA 1EFKA 3H18A 4YASA 5J63A 2ZYVX 1KMIY 4TL9A 3ZHTA 1K8RA 2G8LA 3RJ5A 3AHJA 5ED4A 3T4PA 3WO0A 5IDQA 1WQ3A 2IHYA 3CUSA 1E79D 1U31A 4YQYA 5IKMA 4KV7A 5KUTA 1I9GA 3OTGA 4MVJP 3KQQA 2QSYA 2WAAA 5CBPA 1FEZA 3PFNA 5AD1A 3R2JA 4KIFA 1C8BA 3M3PA 3VVMA 1P2BA 4PHTA 4BLWA 1Q91A 4PXSA 2X2FA 1Z39A 1E6WA 4LA4A 2N75A 2RHDA 1XAJA 2NUTA 2VJDA 4QT0A 4Q7JB 5I8PA 4YCBA 4F93B 5LQCA 1Y7TA 1T8RA 1DJLA 1EQAA 4H17A 1E6CA 1I2CA 5CR9A 3ILSA 3R7NA 4BO2A 1BJRE 3AHDA 2H4YA 3QMMA 3DP7A 2PUHA 4I1UA 3ZWNA 4F3YA 5BMVB 3GFQA 3FLMA 3IVXA 3TLMA 5LFAA 4FFOA 1NHWA 3UA4A 2ZU0C 2X6RA 4CQLB 1XROA 4BX3A 2A6PA 3SSOA 3PFIA 4JROA 4OLBA 4NBVA 1D6NA 1LRLA 3IALA 3RH0A 3UUEA 2K4MA 5CVDA 3VHQA 1QXSA 1AUVA 1V26A 3AR6A 1JU3A 1N2GA 2VTBB 5CT9A 2NM0A 2O0JA 1MRSA 3SSNA 3MAGA 5E4FA 1PJRA 1N5MA 5B1YA 1WULS 2FY8A 3PICA 4CODB 3FJOA 4FGLA 4BVEA 4BQRA 1GL9B 2BRUC 3L6UA 4E12A 2QTCA 3ANYB 4JT4A 2RAVA 4D0GA 4G0WA 2BMVA 1XHLA 1YR8A 2I3DA 5CLFA 5I3ZA 1YKGA 4TVSA 3BH7A 5AO9A 3PPYA 4AJOA 1TFRA 1NASA 2PX2A 2VPZA 3JQAB 3PRJA 3EFOA 3UB3A 5BNZA 3O2QB 5TQVA 3ECSA 3ZNPA 5ECWA 1Z6YA 3PXBA 1J20A 1FY2A 2EARA 4LWOA 2EJWA 2BM0A 4CT4B 2JDID 1IVSA 1WCXA 1Z13A 1XQXA 2V97A 3C3YA 5FWDA 5U4QA 1ISIA 5D00A 1O5IA 1FMLA 1QYDA 1PG2A 1DWUA 2O4UX 2WU1A 1T9DA 4YB8A 2V74B 2P9GA 4OGKA 4OJYA 1SK8A 5AHRA 1FJ2A 3WJAA 2B30A 3AJDA 2EJBA 4MQ6A 3SE7A 5C37A 4BQSA 4HNTA 4RTPA 5AKJA 4OHPA 3HDJA 3EPJA 1XDGA 3LI2A 3IYLW 2OTCA 5DW0A 5J2TF 1YCGA 1OROA 4JI4B 3THXA 1SXIA 2OGSA 3KS9A 4RMJA 4RTNA 2CB9A 2O3JA 2WUWE 4P80A 1KIFA 4REMA 3AEXA 4IWYA 1MQ8B 4C4RA 3EQ6A 4FLMA 4AJPA 3RFTA 5JY1A 1NQTA 2YJ5A 4LDPA 1OKKA 1U28C 1HGXA 1M2JA 4B6JA 4RXUA 4C01A 5JALA 1B8NA 1WE2A 5JFOA 1K8XB 1UBLS 4YT8A 1OAKA 2VLIA 1TNDA 3IOYA 5DU2A 4K6HA 3U4HA 1FK8A 3A14A 4WMLA 3V2GA 2Y1LA 3COZA 1SCUA 1MIOB 3MQ4A 1A8IA 1FOEB 4J9VA 4X64B 3ZNOA 1YCHA 1TZ2A 4HRAA 4F5EA 4MVXA 5FUVA 2WYOA 3ORHA 4Z7NB 5FI3A 1ABBA 4Q3LA 4PQEA 3QIVA 1A8UA 1EB8A 2DT5A 3AUSA 3D31A 2OXCA 3KWJA 1E7MA 3PWTA 5B1EA 5A5EA 2WSYB 1XALA 5F3RA 3BILA 1IU9A 1MB0A 1W5FA 3PUKA 5TEVA 4ZCMA 1XCPA 2ATCA 3ZD8A 3H11B 4JQCA 2WZQA 2HA6A 3E84A 3TZCA 4AP9A 4B7UA 4CKWA 3VKHA 2P8JA 4ZC8A 3ZTYA 2C5GA 5LXTF 1Q0LA 2DBYA 2NZYA 2N1MA 3A9UA 4D4KA 3KR2A 5FOQA 3DLHA 2I6QA 2Q0SA 1T3SA 2H4WA 3KXDA 1QLJA 4IZHA 5HYVA 2QMUA 5KREA 4B09A 5CB8A 3EISA 3M5DA 1JPNA 3OU7A 4OP1A 4YV0A 2XCTB 1LX7A 3X2SA 1X7XB 2NU7B 4U3JA 1V4VA 4WBNF 1WV1A 3D3WA 3LBHA 2J3JA 1Q95A 1LPMA 3DR3A 4QBHA 2ORYA 5TPZD 4BBPA 4FHCA 4JLDA 2X4LA 5LMUB 3P9IA 4PY2A 4ZVPA 4UE6A 4AJ9A 4CLOA 4RLSA 1OV6A 1Q2UA 7MHTA 5REQA 4G0VA 4MR9A 4O4IA 2Z3ZA 2BP7B 4NYJQ 4BC1A 1U0GA 4JITA 4W8OA 2JLZA 2XR1A 3DQPA 3GEDA 3OQHA 4PNZA 1R4NB 4TRJA 3OFVA 3THYB 1TEHA 3GEHA 2QUAA 2RHJA 3WFIA 4B31A 1GT6A 1UXOA 2GAJA 2IOYA 3GLHA 3KKPA 2R8EA 1EGQA 3KHUA 3GNTA 5C8XA 3BJZA 2DXIA 2Q28A 5E2IA 2OOSA 4BMOB 2Q0HA 3ESYA 2JGRA 3KUUA 3WX0A 1XJWA 3DLTA 1VL8A 4N18A 5L4LA 4KO8A 4G5YA 3O74A 3E7PA 5F5XA 1SBHA 2VIIA 2C9BA 4X60A 4G37A 5CH8A 1AMOA 2QGNA 1AURA 2GZDA 4XKJA 3AFIA 4F4HA 3KKLA 3U4IA 4LYDA 4FW9A 4RLFA 3WAGA 4L72A 4M9UA 1LTQA 3N3AC 1IHOA 2C8KA 4RXMA 3V4LA 2VAVA 3TLKA 5DBEX 3LX6A 2G36A 4N0EA 5DM0A 2OHGA 1IJKA 3OE7A 3PRKE 4LHYA 4RFLA 4CI0B 3O91A 2OQIA 3FKSA 4DR3B 2ZSBA 1RM4A 3S1SA 4TV9B 4U7JA 3DT9A 4UHDA 2CFIA 1B2LA 1RZVA 2AG1A 1Y3BE 2F3QA 5K45A 1P5ZB 3QVXA 3QM1A 4RV9A 3OQIB 2INGX 4FE4A 2C92A 3TTYA 3GLFB 1KVQA 1E6LA 1X0VA 3ABRB 3P7MA 5AT1A 1TUGA 3C14C 2WSLA 4Y3UA 2EFEB 5ADUS 1WSBA 3HFSA 1HYGA 3FBWA 4URVR 3ACDA 2ZBVA 2O5VA 2PUJA 3DE2X 4X66B 1A5ZA 1TAHA 2GWRA 2WYHA 3I4LA 3Q5EA 1IUPA 4L8GA 3PX3A 4E4TA 3OJFA 4QA9A 1SUPA 2ZI7A 1R50A 3C45A 3ZDZB 1KERA 2F43B 5COBA 1ZW1A 1N2EA 5EXEA 1EA5A 1QR2A 1UL1X 2FI1A 2VNJA 4DWVA 4CM7A 3EAQA 2FUCA 2SECE 4N40A 5B6JA 1ISSA 3L6DA 1PO7A 3DZGA 5T8KA 3A3NA 3H04A 1F1BA 2W58A 3H0EA 3OZVA 3DCIA 4GU5A 4EY7A 5J3JA 3PGJA 1UAAA 1XGKA 1XZKA 1WD7A 2DHRA 1FA9A 2JGJA 1CK4A 2UZ1B 3R5JA 4HZGA 4JDPA 1RXSA 5DTJA 4CMKA 2ZJYA 5CTJA 2AFRA 1VBFA 1FP4B 2R4UA 4NZMA 3K1TA 4DA7A 3LS2A 1P75A 3B9QA 2EP7A 1CUZA 1T1GA 1I6LA 3DAHA 3WYBA 2GRUA 1KBZA 4Z9AA 4EB6A 2HGZA 2GD0A 2P6OA 2VS1A 3ESZA 3F6EX 2XBUA