2C5LA

Structure of plc epsilon ras association domain with hras
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPASE HRAS
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c5lA00
1C9KA 4A2WA 2ZVPX 2ODBA 1ZM9A 2F3RA 5AJZA 3OEED 3KXIA 1E2IA 4NH0A 2QAGA 2W6JD 1GIAA 4B73A 4URWR 2XTZA 4PZYA 5EXTA 4AKGA 1KAGA 2JLZA 2FFBA 2NO1A 2GTPA 1NP6A 1T5IA 3CPJB 3BD9A 3KUCA 3EIQA 4Z54A 3AB3A 4IOKA 3A4NA 5B58C 4OBEA 3KXLA 1D8TA 1ZMXA 4B2LA 1DAHA 2O8CB 4QHYA 5KSPA 3TR5A 4LDJA 2OLJA 2A9KA 1MR3F 2UKDA 2CEAA 1VG0B 2D06A 2IYSA 2CVHA 2QNRA 1ZYUA 2EFGA 2QTFA 4QG7A 5B57C 1T3SA 2QSZA 2WJGA 4M2LA 1N5IA 1R6BX 3B1WA 2BV3A 2R6DA 3G0HA 1ESNA 3AP1A 2WOOA 4EIWA 1FP6A 4P0TA 4A4DA 4FINA 1AZSC 3GFTA 2C95A 3WRYC 2FFHA 3PUYA 1IN5A 1ZD8A 2ZITA 1CULC 3IBGA 3IO5A 1E2HA 1JBKA 2YOFA 1DADA 3MWYW 3QIAA 3IQXA 5TB5A 3JZAA 4Q1FA 1OLOA 1II8A 3IQWA 4WXPA 4NCHA 2V3CC 1RJ9A 2J0SA 1TL7C 4KCGA 1VHLA 5FUWA 4A6PA 3PUWA 1RYHA 4WVFA 3DM9B 3QG5A 5HPYB 2I1VB 5TDHA 3OE7A 4Q4LA 4QM7A 1J7KA 3UG7A 3L0IB 3TJZA 2NO7A 3K09C 5AJWA 4YMUA 3ICQB 1B0UA 2YWFA 3GCGA 1FL9A 1GL9B 1XF9A 4V0LA 1NI3A 4URYR 4LV6A 5KPJA 2ZRHA 2XTNA 3AP2A 1CU1A 2JLQA 3A58B 3TKLA 2IL1A 2AXPA 3FMOB 1E2EA 2ECKA 4KSBA 2H5EA 1XDBA 4W5HA 4IOLA 1KO5A 4M1SA 1E94E 2L0XA 3WYGA 2CE2X 3GLIB 1RRPA 4KYIB 1Z63A 3R9IA 1P3JA 3BAFA 2NZJA 1OH8A 1ZNZA 2EFDB 3PCRB 1T3LA 1IBRA 1FMJA 3LV8A 1F3OA 3T1VA 3A6PC 1G8YA 3Q5DA 3SBEA 2IYUA 3NBFA 4ZI2A 3G5UA 3L2OB 1EFCA 1II8B 2A3RA 4KFTA 2FNAA 3CRW1 4JLOA 5L3RA 4C0JA 4EPYA 1RJ9B 4M1YA 1GUAA 2OUKA 4XWOA 2ZJ8A 2KB0A 2NO0A 2YZ2A 4B3FX 4TL7A 5KO2A 3RRYA 4Q9KA 2BJVA 4QXAA 2QAJA 5D3QA 2O8FA 4LYFA 1UBEA 5LB4A 1X8LA 4AKEA 2BMFA 3AVTA 5CIQA 1QHNA 3C14C 4RCZA 3N70A 4TQAA 5E7JA 4FWTA 4UJ3A 2FH5B 4QGGA 1UBCA 3AH8A 1US8A 5CJ2A 3ADCA 3U3JA 1JQJC 2AWNA 3GLFE 3FMFA 1G4AE 2CDNA 1P5ZB 1U9IC 1ZC3A 3TK1A 4W9MC 3EX7C 2QPOA 1RW4A 4LHYA 2OBLA 2ZJYA 2R9VA 4WIAA 2VF8A 2G3YA 3K09A 4IHQA 4IXNA 2VRWA 3MLEA 2CLSA 4TZ6A 3GJ7A 1KSHA 5HCIA 2XZLA 2JDIA 1PLKA 4Q66C 5CDFA 3SYNA 4ZO4A 1D6JA 1W7AA 1LV7A 3GLHA 4BFUA 3GPLA 1OXXK 4PSKA 3SOPA 1NBMD 3FE2A 3MD0A 4AG5A 1DELA 4D0LB 5P21A 4JSTA 1QHGA 2FSHA 2B21A 3NG1A 4ASUD 5AUOB 4CEIA 1HY3A 1NSFA 3AVQA 3U6KA 1U0LA 1KZGB 4BRUA 4JKYA 1KKMA 1UADA 2YOHA 4Q7KA 1U8AA 2JLRA 3ASZA 1OFIA 2AFHE 2W0SA 1RE0A 1PV4A 2J59A 2ZE6A 5FBLB 1COWA 2ZI6A 4DCVA 1ZVQA 2BBSA 3ZZUA 2RB4A 3TVDA 4LX0A 3TW4A 2FPKA 3KDSE 2VHUA 5CK4A 1E6CA 2BEKA 5FOWA 2EWWA 4JT2A 3U60B 3KQUA 2I4IA 1XCPA 2VBCA 3QOFA 2B7CA 1N3BA 1P61B 3C41J 3IHWA 4P4UA 4EQ6A 1KDPA 4EFNA 1Q22A 4M1KA 2O8DA 5JSZB 2R65A 5JJIA 4CEHA 3SQXA 2HEIA 4WXRA 1WF3A 2JJ2A 1KO1A 5KU1A 2BKUA 3FMPB 1E9FA 1E9SA 5J4LA 2ZI5A 4Z1MA 5K8UA 2JLWA 4MYUA 1UEJA 4IVRA 2HLDA 1JEEA 2FFQA 1UKYA 1HT1E 1XTIA 4KHZA 4NKRA 3LLMA 4BFSA 3ADDA 1NL3A 2PJZA 2QA5A 2BOVA 1SHZA 2GZHA 1Z6TA 2H16A 5K8IA 2XJ4A 2GHIA 5IRCD 4FMCF 2Q9CA 1H8HA 1G3UA 3GD7A 4DIEA 4I99A 3OEHA 3KQHA 4BLOA 3CH5A 4JLNA 1E2LA 2WMNB 1OV4A 4JS0A 3SBDA 3HDTA 1NN5A 2J87A 2IWHA 1ZC4A 1N0VC 4EQ6B 2Q9AA 3PFIA 5G53C 2GJKA 3CZQA 3SN6A 3SZRA 4AI6A 2YJTD 2XXAA 3QKRA 4GOKA 2P6UA 5GVSA 3KKOA 2WSMA 3TRFA 3FGNA 1PJRA 4RKFA 2IA5A 5D3MB 4LUCA 1ZUIA 3W8RA 1S96A 2ZR7A 4M9SA 1W46A 2QPAA 1M7BA 2IS1A 1N6IA 1CJKC 2RGGA 4V0NA 1X1RA 3UWOA 3MAAC 4Q01A 2BKEA 3F3YA 2OEPA 2ZRMA 2DFTA 4HLCA 1KI4A 2GNOA 4W7SA 3UWKA 3WMGA 3ZQ6A 1G3MA 2QE7A 2ERXA 4S35A 4JVSB 1G8FA 2OT3B 4CT5A 3GJ8A 1IN8A 1G1MA 2ATVA 2D62A 2YYZA 2OZEA 5HTKA 3IGFA 2K5UA 1QVAA 3DL0A 3DMNA 4PHFA 2YINC 3FPAA 1LF0A 4TQ9A 5C46F 3PJRA 3QUSA 5JRJA 4DSNA 4Q9HA 1PLJA 1VIYA 3KUDA 3QXCA 4YMVA 3CWZA 4B3GA 1GL6A 4EPXA 4TSFD 4C0LA 2GXUA 2CVFA 4PAQA 2W6IA 2QROA 4DSTA 4C0BA 2F1IA 3QEJA 1I2MA 2P6NA 3MMPA 3A1SA 5E7MA 1KY2A 3QKRB 4AKHA 1MKYA 4K46A 5AUNB 1BYIA 4HAXA 4MDFA 4GL2A 1Q0UA 2D3WA 1SVKA 2QSYA 2ZVQX 1ONBA 4NYMR 3T12A 1TU3A 3LXXA 1MO6A 5DYIA 4QGAA 5HKKA 1G6HA 1J2JA 1V43A 1OH5A 4UNRA 3MWJA 3L43A 3FHOA 1WRBA 5BQ5A 2OAP1 721PA 1SVSA 1CEEA 1CF4A 1GNRA 1NKTA 4HYYA 5FR2A 3U5ZB 4DZZA 2RGCA 4DRZA 2QG6A 4HAVA 2DFNA 1W47A 1T8TA 3B13B 3TUZC 4GPTA 4IDQA 1SGWA 5EUMA 3GJXC 1IONA 1WA5A 2VL7A 3KQKA 1W2GA 1E2JA 1IXZA 1E2PA 2G1KA 1E1QA 3EA5A 3QKTA 4B71A 3ZS8A 4A6XA 4C7OB 1F48A 1ZJ6A 1KJWA 2CHGA 1W0JD 4FW9A 4HB3A 4DEXA 2WHXA 3EZ9A 1DVRA 1JAIA 1JJ7A 2IS2A 4ZV4A 4PQYA 4ZCLA 5G40A 1H8EA 1EFRD 1KI2A 1JXOA 1OKKA 2KBEA 3MJHA 4XVQA 2CL0X 4A0HA 5KSZA 5G41A 1P2SA 4H1VA 3A36A 3MRSA 3SDZA 4CF7A 3PITA 4RZXA 4QM6A 1N5JA 2VEDA 2ZYWX 3CNOA 2Z4RA 1HE8B 1KDTA 3M6AA 2ERYA 3BIFA 2HV8A 5EP4A 1KAOA 2DWPA 4N0DA 5GVRA 1Y63A 4L16A 3LO5A 3SJBA 3AKDA 3FWYA 3GJ6A 2CHVA 3OIVA 1NMXA 2ZSDA 4C0HA 4BLSA 2DYKA 3TNFA 4A15A 3U3KA 3PIRA 1EWQA 4RD3A 5GJCA 4P4SA 2CLCX 2FPLA 2Z83A 3MCAA 4DUGD 4B2IA 2F43B 4RVCA 4ZDIA 1E96A 1HQYE 4FIDA 1JEDA 1XX6A 1NY6A 2DB3A 4LI0A 3GLIE 5IF9A 2FSFA 5C4GB 3I62A 4HAWA 3F5FA 2JGNA 4JVLA 2KE5A 1VECA 4TTQA 1ZIOA 2IT1A 1VYUA 2ZM5A 3KJGA 3QXJA 3VNVA 2J7PA 4LBWA 1T6NA 2RGXA 5IK2D 2RAPA 1TTTA 3QJYA 3R7WA 3R20A 3B1VA 2BBWA 3K70B 4TT3A 2F7SA 2IC5A 2RGDA 1SVOA 4D25A 4ZDKA 1M7HA 4PR0A 3LFUA 1UEIA 2EU8A 3VAAA 1Z83A 3CF0A 4N1AA 4MKGA 1VCMA 3HYRA 3KX2A 1XEXB 3PEWA 2ZAOA 3CB4A 4ZIRB 2AKYA 4P4SB 4DCSA 3U7GA 1VKJA 2LWIA 3REFA 1OXSC 1M74A 4Q18A 5CK5A 1G8GA 4WAUA 1FOEB 4CIDA 3SHWA 1RVDA 5ANRB 1OXVA 1Z0IA 1TEXA 4E22A 3DKPA 2WMOB 1KI8A 3LWNA 5DO9A 4A0GA 2YVUA 4Q48A 3WP0A 2QBYB 4Q21A 4DXAA 3FYHA 4QRHA 4LBVA 3H2YA 4DJTA 3K0EA 3UMRA 4RCYA 4EPTA 1PUJA 4M4SA 3W6NA 2ORVA 5H68A 2PZGA 1Z08A 4LYJA 4A2QA 3CLVA 4DT1A 2W6JA 5FTMA 3ZVRA 4OQMA 4BFXA 2H17A 2ZSBA 5IDVA 3A37A 1IHUA 4MQBA 2XNDD 3UKDA 4AD8A 3TVTA 3AVYA 5CJPA 4BLTA 3ZD7A 2PEYA 3DMDA 1R2QA 1XTJA 3HR7A 4UJ5A 3B5JA 2D74A 3QF4B 2G1JA 2V55B 2IHBA 2NGRA 4IOMA 2HYIC 1N6NA 3Q5EA 1X6VA 5JMTA 5C18A 1F60A 3SFVA 2PLRA 3CPHA 3CUEF 3I1FA 1UAAA 2VHQA 2FV8A 4RFVA 3WBJA 5HE9A 1OFTA 5JS7A 3T1TA 4Q9IA 3T5DA 3LAWA 4A1FA 3ZD6A 1ZD9A 4D81A 3IDQA 5FOVA 1KI7A 2J0VA 1NRJB 1DG1G 2GCOB 3AF3A 4LPKA 4RD6A 2Z0MA 4D82A 1NLFA 3K0FB 3FKSD 4IFBA 1RFLA 3OAAD 3WHKA 2J1LA 2DFLA 1MO3A 1RPZA 1M8PA 4KBGA 3OZXA 1TF5A 1YR6A 1GILA 2ZRPA 4FMCB 4GOJA 1A2KC 1G18A 1ETUA 1D2EA 3DKVA 1AQUA 4FMDF 1RRFA 4M1OA 3RWOA 3KFVA 1KGDA 2OAQ1 1LVGA 3IBYA 5EE0A 4TL9A 5FBWB 4ZCIA 1G3RA 4L9WA 5DN6A 2WJIA 3KFXA 4O3MA 2AFIE 2A5FA 2IW3A 1ZBDA 2OBMA 2P5TB 2LCFA 3QPUA 4NDZA 3LX5A 2F3TA 2V4ZA 5H8WA 4WBSA 4AURA 3THWB 1QRAA 2ZR0A 5EXPA 2SHKA 3R8FA 3AUYA 3IPYA 4M1MA 5FL3A 4D0GA 2H92A 3BFVA 4WA7A 1WBDA 2VA8A 1YZUA 3LLUA 2ZRBA 3QEOA 4BLPA 1GRNA 2RGEA 1FTNA 4PANA 2PT5A 2GWHA 2B7BA 2W83A 3DHWC 3ND9A 4LJ6A 1IN4A 5JBQA 4QGFA 4BZPA 4LHXA 5CITA 5FI0B 1G4UR 2R62A 3GEIA 2W0MA 1E0KA 2D7DA 1N6RA 2VQSA 2JLSA 4LY6A 221PA 2VYFA 4Q02A 4OHZA 4US2R 3K70D 2P6RA 4W5JA 2CNWD 3AV0B 4D80A 2CK3D 1KSJA 2GK7A 4DLSA 3PQCA 4BZXA 2A2ZA 5FL7A 3AM1A 1W36B 4AYTA 1QHXA 1E1RD 1SKQA 4MRSA 1Z6GA 4GDFA 2C78A 4HZUB 4BECA 2VH5R 1U8ZA 3IO3A 1OHHA 4TLCA 4ESHA 5KHOC 2AL7A 4MYCA 1U0JA 1TUEA 4HAUA 4D4MA 5DISB 4QKQA 3AVOA 5EXXA 1QHHB 2J0UA 3D8BA 4X8OA 3MG9A 1P9RA 4QL3A 1QG4A 3KZ1E 1IY0A 1ZIPA 4XIGS 3THOA 1J70A 1SXJD 2JIZA 2RGAA 1K5GA 4NHOA 2HT6A 4KBFA 2P3SA 2V6JA 3AEZA 4G1UC 3NBXX 2WSSA 4TQUS 2QM8A 4BRWA 1M2OB 2IYXA 2ZYUX 2JJ8A 4DLRA 5CM8B 1W0KD 3Q7PA 4IDPA 1NBMA 3CR8A 1G9XA 1Q57A 2PZFA 2YNMA 1HA3A 3BRWD 3C5HA 1G5PA 3W3ZB 4FCVA 1T0HB 1ZRHA 1YZTA 4Q9LA 5L8VA 5GJWC 2FEMA 1TNDA 2VTKA 3EG5A 1SVWA 4HDCA 1NNEA 1F2UA 3NHBA 4NYIR 4KYUA 2DBYA 5FPYA 4MUAA 4D4KA 1KZ7B 3HU1A 2VP4A 5F9HA 1Z0JA 1GP2A 1KK2A 4L8GA 3SEAA 4A8JC 1E0SA 3W5IA 2O8BA 4OKSA 5B30A 3T5GA 3B1YA 4CEJA 1CR1A 1FPMA 3I32A 3BS4A 2OM2A 3CKLA 4J0QA 4KJZA 3H84A 2WVJA 1TADA 4DCNA 2UVQA 2QTHA 3WY9A 3Q9LA 1GNPA 2G77B 2VP5A 3W6OA 5JEEA 4RFSB 2ODEA 3QY0A 4M9QA 4PZZA 3RS2A 1W2HA 2OILA 3I72A 2YOGA 3TQCA 4CYMA 4MRPA 4DDWA 4U00A 2IX3A 4JYBA 2QRZA 4LPSA 1CR0A 4Q00A 1FZQA 2Q3FA 2IWRA 3TSZA 1GM5A 2BJWA 2CL6X 3QXHA 1FX0A 1ZD1A 3I8XA 4Z8YA 1KO7A 4IKEA 3NTUA 2GXQA 1UKVY 4TL6A 2IUTA 4MGKR 2ZETA 4MRRA 3BK7A 2PCJA 2GKSA 2QAGB 1P60A 2EFCB 2ZI4A 4HZIA 4ERNA 5KDDA 3AVPA 5DYGA 2GXSA 2ZS9A 4AC9A 4ACAA 1JJVA 3MUFA 4XVUA 1E2NA 3RS3A 1J8MF 4POAA 2PCLA 3KKNA 4XOIA 1T91A 1Z2CA 3PG5A 2XB2A 5H1YA 5EJEA 2MMCA 3ADKA 1Z28A 2IF2A 4XD7D 3EPLA 5TXGA 2VSXA 1KDRA 1XXHA 3KQNA 5J47A 1NJGA 3P27A 1EXMA 1JPNA 1C1YA 3U6BA 1DARA 3KJEA 2BMDA 3T34A 1YZNA 2XSZD 3B8HA 2A7QA 1OYWA 3A1TA 1FNMA 4AG6A 2CCKA 2ZRAA 4HDQB 3AKCA 3IUYA 1LTQA 1N5LA 1YRBA 4A8JA 4DLVA 4Q7MB 1W36D 3VR5A 3C7KA 1T0JB 1AKEA 3WBKA 2IXEA 3O8BA 1QZXA 3SC3A 1WXQA 1XZPA 3THXA 1KDOA 2EFHB 2WJVA 4RKEA 3QF7A 5EUQB 3T61A 4PO8A 3PEYA 1YKSA 5DHFA 1G5RA 4M1TA 1AZTA 5KDOA 4GOXA 1VMAA 2Q21A 3ZIAA 4NCKA 5DNYB 2A5JA 1W49A 4PX9A 4C4PA 4URZR 3LW8A 1JR3A 1UPTA 3MGCA 4F92B 4NBSA 1ZNWA 2XOKA 3AKYA 1XTRA 4D4LA 3ZLJA 3E5HA 3GFPA 1BMFA 4NCIA 2ZRDA 1CJMA 2JASA 3DOFA 3HYTA 4FD2A 4C9BA 2OBNA 1ZAKA 5JJLA 4TSFA 1UBGA 4IEEA 1XXHB 4Q4AA 3W8NA 1YZQA 4MGIR 1KNQA 1W4AA 2PLFA 4JLKA 2QMOA 1U2RA 2ZJ2A 2WOJA 1FUKA 2VF7A 4HB2A 1KMHA 4BFWA 2A5GA 2ZXUA 1SXJE 4A8JB 4V0ME 4ITRC 3SHFA 2QGZA 4PSAA 4OI2A 3QQ5A 3NBYC 4LHVA 1W48A 1WCV1 4PHTA 1GKUB 4OI1A 2WPDA 3THXB 4G5OA 1II0A 4X8MA 4DSUA 1G7RA 3E1SA 1X3SA 4ZKDA 2ZRCA 3BFXA 1N25A 8OHMA 3MWLA 2IYYA 3Q3JB 3K0AA 3P32A 1DAMA 1E0JA 2EFEB 2PZEA 2HDNB 5E4FA 1GKIA 2WWXA 3AF0A 3R9XA 2IYRA 2PBRA 2REOA 2QT0A 2D2FA 1EX7A 4TYPA 1MO4A 3CRVA 4QC2A 4B34A 2PEZA 2O8FB 3IPXA 1HE1C 2WWYA 1KOFA 4FMDB 2ZI3A 2AK3A 2IBMA 2FDCA 4ARZA 2JJ1D 4PQRA 5F98A 2CJWA 1RRGA 1Z47A 1ODFA 4IVQA 4BUJA 3GQBA 1FNNA 4PC1A 3BB3A 1YR9A 1FW6A 1US8B 2MSCB 3A1VA 4B47A 2FEOA 5UKDA 4HEJA 2ZROA 2AXNA 2WKPA 4PSVA 3KQLA 1G41A 1D5CA 2Q6TA 4BPBA 1LS1A 3ICEA 2BBTA 3CNLA 3ZVLA 1S3GA 2XGJA 2VHCA 1D9ZA 4F7WA 2C98A 3GJ0A 2Q9BA 2AHOA 1OYYA 3H86A 1BH2A 1D2NA 5SZHB 3IEVA 2HF9A 1XB2A 2HXSA 4ESVA 3GLHB 5CYOA 2ZE7A 3AF1A 2CCJA 2AD1A 4I1OA 1Z6YA 5EE5B 1L4UA 3MWKA 3KB2A 4BEBA 5JWOA 1A82A 1U90A 3A8TA 3RC8A 3WNBA 4Q7JB 4CEIB 1VDZA 2C9OA 1F5NA 1U9IA 3CX8A 2AX4A 2OE2A 3KL4A 4B76A 4L15A 2Q0HA 2BMJA 4XTRA 1E2KA 4TLBA 1WQ1R 3FHCB 1DOAA 3WYFA 3WNDA 4TMTA 1A4RA 3TE6A 1JALA 5JFGA 2IK8A 2IYZA 4UXIA 3VU9A 2C9CA 2ZSEA 1IY1A 2GJSA 3EC2A 1U8YA 1TU4A 2W2TA 5AWFC 2EW1A 2B8WA 5FTLA 2ZQ5A 1NVVR 3VR2A 2PH1A 3BERA 1FQKA 2GEVA 3EIHA 4RY2A 4BZQA 2F1JA 1ZP6A 4GZLA 5DGXA 2GA8A 1AA9A 5CB6A 1Q20A 1LNZA 3P4YA 4C3ZA 5L3QA 5DI3A 2GJ9A 1E9BA 3BGWA 3CBQA 1TX4B 1MO5A 5B64A 3U4QA 2O8DB 4CEHB 4PHGA 5AR1A 2VIIA 1UDXA 2QP9X 1A2BA 3PUXA 1AIPA 2YWHA 2MSDB 2BM1A 1DTSA 1LB1B 1G8PA 4KLZA 3RRMA 4YQFA 1TQDA 4OK6A 5BN4A 4Q1DA 2X77A 3UATA 2O5VA 1G291 4TTRA 4UXHA 4CZ2A 4KI0A 3OE7D 3B1ZA 1F2TA 4XJXA 1DE0A 3OFNA 4Q4HA 4NTZA 1NN0A 2ZJBA 4K81B 1GZSA 3LDAA 3I5XA 5F9FA 1X1SA 3RANA 2XNSA 3UG6A 3IILA 3S1AA 4O0MA 4TMXA 2PT7A 5M04A 4DLYA 1CJVC 1S8FA 821PA 1NY5A 1XJCA 1YVDA 2REXB 4WZ6A 3GLGA 3NIBA 2GRJA 4NYJQ 2HCBA 2ZANA 3HU2A 1E4VA 1MOZA 1QHYA 4JL5A 4HDOB 3SYLA 4KV9A 2P2LA 5DI3B 2J7KA 3KKMA 1Q21A 1M7GA 2WBLC 1CBUA 1T4GA 1N5KA 3TMKA 2C2HA 3U4QB 2XXAB 3VKHA 1U0HC 4PC6A 3RS5A 4DDUA 4YXWA 4UQOA 2IYQA 1ZU5A 1S1MA 2B8TA 1GITA 2GZDA 2C03A 2DFKB 3BE4A 2ONKA 5FBRB 5J5CA 1KKLA 4EPRA 2ZREA 2JLXA 3BXZA 3NXSA 4WZAE 1JR6A 2GJ8A 3CW2A 2ZU6A 2DHRA 2V8OA 1DAIA 1M6NA 1F2TB 2OFXA 4ZI3A 2GAAA 4LK2A 3RDPA 3AF4A 2V7QA 1KSGA 1NVXQ 2VPPA 3A4LA 4C2TA 5SZIA 3O8CA 2FE4A 2OV2A 1E9EA 4LC1A 1EFTA 1QHIA 1CP2A 3BH6A 3PENA 5JHHB 1CS4C 3FB4A 5EE9A 5BWMA 2J41A 2O8EA 3SI7A 4KITB 3K9LA 3B1XA 4IW3B 3GLGB 2CCGA 2WICA 1MV5A 1I4LD 1E9DA 3FKSA 2VO1A 3ECCA 3LXRA 3QXXA 2C8VA 5J4KA 3BJIC 2YWGA 1E0AA 5AJVB 2YV5A 1XCGB 2ZUCA 1ZNYA 2OCYC 2RHDA 3VR4A 5FPKA 1BO6A 4KFRA 1M34E 4PQFA 2JDID 1TMKA 1G16A 3U3MA 4B6FA 4OYHA 2VSOA 1SHKA 3I8SA 3OF5A 3U3OA 3CZPA 2A78A 1NIPA 1N6LA 4YDHB 4BASA 1U98A 4B48A 1MRNA 3O8RA 3AVUA 4G5QA 3QPWA 4OK5A 4C0QC 3KXKA 1E4YA 2WIAA 4UNPA 4Y0VA 3QXSA 3RVBA 3TUJC 4URUR 3NEJA 2XITA 3BC1A 4IEIA 2R6CA 1R0ZA 2GBLC 3EWAA 1OT3A 5DLQC 3AF2A 3EA0A 4B6EA 3Q8XB 4G3XA 1COWD 1KI9A 4ABYA 1I2DA 1X86B 2FA9A 3V4FA 4K8OA 3B82A 2O8EB 1Y3AA 5DIFA 3RS7A 2EQBA 2NG1A 4ILEA 3DZDA 3CPEA 1JI0A 2P67A 2WJYA 4NONA 4BQSA 3GFOA 5J4HA 1G5TA 2CXXA 1U99A 4HLDA 4HSEA 2HJGA 4C0SA 1NF3A 2CK3A 3P1JA 4YC7A 3SE0A 3OIWA 3IIJA 4CT4B 2VP6A 4KSCA 2GXAA 5ELXA 4CVNA 3WYAA 5E3HA 4DLZA 1OFHA 2NPFA 2ZRGA 4H1UA 3WMFA 4E07A 1R5OA 4M0LA 4JIMA 4V0OA 2IYVA 3W34A 1AS0A 3QE0A 5JLJA 4DWJA 4F4JA 5KPDA 2O0JA 1K8RA 2ZJOA 1YZLA 2PJRA 2CBZA 3HJNA 3NHAA 6Q21A 4AK9A 2ZAMA 5JECA 3HP1A 1NJFA 3LH5A 4PXAA 2QUZA 2AN9A 4Q03A 1P9NA 4E5UA 3ETLA 1CXZA 1J8YF 3KJIA 3OIUA 3Q85A 4JKIA 3GLFA 1SVMA 1T9HA 3U2QA 2FWRA 3OEHD 3UK6A 3AVVA 3ONWA 2ZE5A 3A1UA 2QEQA 2IYLD 4JBYA 1G19A 1S1CA 4UNSA 4YDSA 2ZJ5A 2NMVA 2X1VA 4C30A 1IN6A 2R2AA 4JJKA 1G7SA 3K0CC 3QKSA 3HR8A 2BC9A 2GF9A 4PPNA 1XCMA 2NQ2C 3HWSA 3LBNA 4JZKA 4Q9JA 4A0FA 1MT0A 2BWJA 5EP3A 3P26A 1N2CE 5LB2A 5FPSA 4W5WA 1AGRA 1ZM7A 4M9ZA 2GBLA 5E7IA 1KI6A 4US0R 1C4OA 3MFYA 2EVWX 4JLPA 3QVVA 2F9LA 2W2XA 1QBKC 1AK2A 5BN3A 2ODWA 4A82A 1DPFA 3OEEA 4DDTA 1NG9A 4X8LA 3VQTA 4D6PA 3SJCA 1IM2A 1VCOA 2DWQA 1UM8A 1JECA 3AUXA 3R7WB 5BYKA 4H9GA 2XAUA 3T06B 2QE7D 3QVUA 4PC2A 1XP8A 4EUNA 4QJ3A 2VHTA 1GTVA 1E2FA 1P6XA 5IHPA 1EWRA 2WWHA 4X8HA 2FPMA 2Q3HA 4TMKA 2BHRA 4MGYR 3ND8A 1S2MA 1XMVA 2HXYA 4ZKEA 5J4VA 2F6RA 4Q1EA 1W4BA 1NN1A 2PX0A 3FFBA 1TQ4A 3EWSA 4UKDA 3NBZC 5EE1A 1P72A 4JL6A 4HUTA 2KWIA 2YHSA 4F91B 2G0TA 4BWYA 3EC1A 3LQQA 2W6ID 1PZNA 5FPHA 2OFWA 5K8LA 1A1VA 3CWQA 1AJEA 1P7CA 4FMBB 5KTYA 2PX3A 2HUPA 4QFMA 4CRWB 2FU5C 4YLGA 1FQJA 1OH6A 1V5WA 1KI3A 4WZBE 4EJSC 4PHHA 1DAKA 1T3HA 4HLUC 1ZUNB 1WE2A 1QG2A 1KJZA 2J46A 4DT1B 2ASEA 4DLUA 4FCTA 5LD2C 5CDFE 1KI1A 4P31A 2IS4A 3GLHE 4TYNA 3FFAA 1HYQA 2C9YA 3CF2A 4B3BA 1DBSA 3K0CA 1EGAA 3WNCA 3B85A 1QVRA 3RAPR 3ZS9A 3SR0A 4B3XA 3H0KA 3LBHA 5C4MA 2ZJAA 2H8KA 3VX3A 2J5XA 2ZRLA 1N0WA 2C5LA 1K6MA 1N6HA 2H7VA 5FOSA 4WOPA 3ZGXA 1EESA 5G3YA 3SS8A 1RIFA 3L82B 4G01B 3T35A 1ANKA 3ZVNA 4R98A 1L8QA 4PTLA 1Q3TA 2B6HA 1XPOA 2OG2A 1OIWA 1M1YE 2FX3A 1XZQA 3BFKA 2RGBA 1R5NA 4OQXA 2G9NA 3JVUA 2W00A 3VKGA 4RJLA 3W90A 3NWJA 3GP8A 3RC3A 4TLEA 3REGA 4F38A 2I3BA 3I3SR 1XPRA 2ZUBA 4NL4H 2QTVB 4OHVA 4BLQA 1ZM4A 3BB4A 3BOSA 2ZRFA 4AY2A 1P2TA 4P32A 2ZJZA 4OHYA 5KOYA 2X2EA 2Z5FA 3K0SA 3NVAA 4NCJA 3PXGA 5JHGB 4Q1BA 4MKHA 4Q5IA 1PUIA 1JPJA 1N6OA 4U5XA 1U81A 4KXFB 2GK6A 3EASA 5AJYA 1FP7A 4OHXA 4FCWA 1XD2A 3F0TA 1A5TA 4Q1CA 1SZPA 4F4CA 2EWVA 3CIOA 3EIEA 3QBTA 3TR0A 1E9RA 1OIVA 1PLLA 3VHXA 2UZIR 1XD9A 4GRAA 3CR7A 4HAZA 2FSGA 1XU4A 2WTUA 4EJSA 2WAYA 2IS6A 3DDCA 2NTYC 4L5BA 3ZQJA 4LJ5A 3MJRA 1I4TD 3X2SA 2ZYTX 1KHTA 4MH0R 3ZZTA 2X2FA 5F3WB 2QMUA 4DSOA 5FBVB 2W2VA 2FOLA 1GOTA 4HLQB 4KVAA 1MRSA 1E69A 1XMJA 3FTQA 3W9YA 3GEEA 3KKQA 1ZINA 2CHQA 5GJVC 1KO8A 3RWMB 1P75A 1G17A 4I81A 1VYVA 4B44A 1B23P 2WM9B 1CKEA 4D2IA 4NP6A 4A92A 1FUUA 5SZKB 4G5SA 1MABA 1Q12A 1K5DA 2HF8A 2MMGA 1G21E 1WP9A 2QI9C 2ODNA 1CR4A 1GNQA 4M21A 4R9UC 4BFVA 1GG2A 3EZ6A 5A0FA 2OXCA 2NO9A 4XWKA 4Z8XA 5KNBA 3VR3A 1Z06A 1ESMA 1Q1ZA 2E1RA 2VHJA 4B32A 4HI0E 5EQTA 1FTSA 1TQ6A 2ZRJA 4PPFA 1P62B 4ASUA 3V4RA 4A9AA 2ZSFA 1S0UA 2XJ9A 2BCGY 2BM0A 4M9XA 2O8CA 5HE8A 5H70A 1HEIA 4DC9A 4FXPA 2ZR9A 2R44A 1AN0A 3O47A 1YR7A 4DBLC 3EPHA 4LSGA 1YJ5A 1KYIA 4NYMQ 2JJ1A 4NU0A 3EPKA 2R8RA 4BFZA 4LCBA 4BLRA 4KODA 3DZ8A 5HZHA 2BEJA 3UMSA 1E98A 2ZU0C 2QPTA 1Z0AA 4ZCMA 5L3SA 4F93B 4GT1A 1FMLA 1R0XA 1L2TA 2H18A 2Y8EA 2ONJA 3QPVA 1Q1BA 1IXSB 2J0UB 2KJQA 5FTJA 3U44A 2NO6A 3QI2A 2F1HA 3N2IA 2XTMA 3QNUA 4Z51A 3GMTA 2G0NA 3CONA 1TF7A 1MABB 2JLUA 2ZUDA 1S3SA 1U94A 4TYQA 2FGKA 2A5YB 2HT1A 1IN7A 2VP2A 4LOAA 4KLNA 3THYA 3OIYA 3W3AA 2A30A 2WZQA 4TLDA 4BEJA 4PC7A 1ZM3A 4BFYA 1S4QA 1XTKA 4RZUA 4F4IA 1E2MA 1XD8A 3QSYA 1R7RA 1NMYA 2AK2A 2ZRIA 3NEYA 4MYTA 3C4JA 3IHLA 4DHEA 4DEYA 4IDOA 1CR2A 3B9PA 3KB1A 3K53A 4JBXA 521PA 1WMSA 3OESA 2X8AA 3M1IA 3B2EA 4MKIA 1F2UB 1G3QA 4RZ3A 4QJ4A 3UXMA 1BKDR 5L3SB 4A0RA 4IVPA 3CRMA 2XZOA 3UMFA 4EPWA 2O8BB 4PAOA 3U44B 5LDDC 1NMZA 3GLIA 4CEJB 2LKDA 3LRPA 1OB5A 3WMEA 1Z0FA 5KNCA 2R6FA 1RYFA 2H57A 2IEZA 1CRPA 1ELOA 2RKOA 3ASYA 1OB2A 4B33A 3THYB 2N1BA 3LA6A 4DLTA 2C99A 1XWIA 3W5JA 3TIFA 3EARA 4LV8B 1E32A 1Z5ZA 1FX0B 2QORA 1HV8A 1Q1EA 3CM0A 2QU8A 2FN4A 5DN6D 2DPXA 4V0KA 4Q1AA 2V54A 2FJUA 3E2IA 5HR5A 2JEOA 3WRXC 5FTKA 3B78A 4EFLA 4A2PA 2ORWA 2ZS8A 4P3YA 1GRRA 2BMEA 4PZLA 5HZKA 1XMIA 1YQTA 1QHSA 2V1XA 1Q3HA 1R8QA 2WWFA 4Q47A 5FOXA 4C0AC 2WKQA 2WV9A 3IIKA 5FPTA 4BGDA 1KTVA 2P65A 3D7MA 3C8UA 4KFSA 1BS1A 4NPHA 1Z07A 4R2IA 2QP3A 3X1DA 2ZYVX 4AIIA 2ZTSA 3GJ5A 4GP6A 1ZNXA 4ZPXA 2WJJA 2YC4C 4RZ2A 4O2LA 4JLJA 4B43A 4UNQA 4GZMA 4P33A 4QNRA 2WWWA 2GEDA 3M0EA 1S9HA 3O8DA 5JZVA 2D2EA 2KSQA 4TYYA 1WB9A 2OCPA 3IEUA 3U7EB 3PUZA 4LHWA 3RNLA 3L0OA 4MGZR 1E99A 1HTWA 4TTPA 4PO9A 5DI9A 1W44A 121PA 4DCUA 2F55A 4M22A 2GF0A 1UDWA 3C16C 3C15C 4JLBA 5AK0A 2P5SA 4RD4A 4Q19A 3L0PA 5FL7D 4EPVA 1OFUX 1OJLA 4HB0A 3KTAA 1VIAA 1OHHD 1N6KA 5FUXA 2PMDA 3M4YA 4DB4A 1L4YA 5JI3E 1F6BA 4TL8A 1CJUC 4D4JA 5TV2A 1Z29A 5SZJA 4LBZA 5BW8A 1GRQA 3NC1C 3VKWA 1Z3IX 1GDDA 1R8SA 5DSZA 5J40A 1R5BA 3SU8A 5GJBA 4FI3C 1X8JA 3TSWA 3Q7QA 4OQLA 4OJKA 4R2HA 3CX7A 3DVLA 3X1XA 2D4HA 1GSIA 2JIZD 4ACBA 4ZDJA 4TMWA 3E70C 3BH0A 1RRCA 1D9XA 2WSSD 4Q4AB 4U02A 2AD5A 1JAHA 5JSZA 1HT2E 2W58A 4KVGA 1E79D 2J45A 2C04A 1SKYB 1W0JA 2D7CA 4LJ8A 4PAMA 1KMHB 1GL7A 3TLXA 1EFRA 1EK0A 4C2UA 3LNCA 3T1OA 4TYWA 2O52A 2PMKA 1ZU4A 1O3YA 4E03A 2GILA 1NVUQ 3V9PA 4B3CA 5FUVA 5CLLA 3VX4A 2ZI9A 3LQRA 4LWZA 3KTAB 2ZEJA 4QBIA 1A7JA 5BXQC 3ZZ0A 1DO2A 5JRZA 4XSGA 3EZFA 2ANCA 3QBVA 4WW0A 3ADBA 4TMZA 4JL8A 4GFDA 4KAXA 1J90A 3K0AB 3GJ4A 2IF0A 1E2GA 3RS0A 2BCJQ 1YU9A 1JNYA 1NKSA 4IXMA 1E2DA 3GEHA 3BBPA 4DB2A 2QQEA 4LJ9A 3K9NA 4DUGA 2XB4A 5TMPA 4OK3A 4G0NA 2REBA 4JLDA 2JCSA 1EX6A 4I4LA 2FZ4A 2RGNC 4Y0AA 4ARZB 4LYAA 5FBQB 4URVR 2CJWB 1AKYA 5CB8A 3A1WA 2QZ4A 3CX6A 2NPIA 2OCBA 1XFAA 1E9CA 1Z0DA 4HAYA 5D3MA 4I1UA 1HQCA 3OHMA 2IYWA 2QY9A 3BH7A 1YHNA 1AGPA 5IK2A 3Q72A 1P4SA 1JXMA 3B6EA 2CLDX 4KU4A 4GMDA 4IDNA 2FG5A 1XEWY 1YZGA 1Z2AA 3KJHA 4TZ0A 4XVRA 3AQ4A 2DCUA 1RZ3A 2NZ8A 4CDGA 4AKIA 3N2EA 1NLYA 3FKQA 4BFTA 1XEFA 2WWIA 2Q3MA 1G7CA 2TMKA 4IFEA 2IXGA 2OHFA 3JZMA 2VSFA 4QGHA 3SJZA 2QT1A 3I5YA 4IDHA 4BE7B 5EZ5A 2X19A 5EP2A 1RC8A 5DH9A 1YRAA 1AM4D 1Q44A 2QRNA 2NOAA 3T15A 1O87A 4FWIB 3FHTA 2IHYA 2A5DA 1R10A 2GVZC 1DS6A 2IXFA 4N3NA 1VHTA 2E87A 3N5CA 1BOFA 1SQ5A 4PPGA 4R7ZA 3VU9B 1LY1A 1JQLB 4LV5B 1LFDB 2Z43A 5CIWA 1XMSA 1NG1A 1G7TA 1OF1A 1Z6AA 4OI0A 3AKEA 2IUSA 3QG1A 1KSFX 1VG9B 4UNNA 3CRRA 3EZ2A 2UZ3A 4IRUB 4LYHA 1T5LA 1LS6A 2XNDA 1YE8A 4M53A 4Q7LA 1IJEA 1G20E 2QGNA 5L3QB 2GZAA 1OW3B 2RGNA 2WAXA 1D2MA 1YZKA 3HPRA 4RSGA 2FSIA 1N0UA 3ZIAD 4LHZA 4RD2A 4KO8A 2Z6VA 1S9DA 1VTKA 3P4XA 1JR3D 3MSXA 621PA 4DIDA 2XOKD 5FH9A 4UXJA 4Q4HB 1BMFD 2WWGA 4HATA 1TEVA 5HCNA 3TGPA 5KDLA 4OL0A 3K70C 4PPQA 5TVKA 3LW7A 4RD1A 4US1R 5E95A 3RSOA 2O0HA 2JAQA 3F8TA 3TUIC 3S1AB 5JWRA 4C7OA 4NYIQ 3V00A 3FDIA 1TAGA 1XTSA 4JT4A 3B9QA 4M1WA 4YMSA 2O0KA 5EXSA 2N42A 3I92A 4EAQA 5LPNA 3K8YA 3OAAA 3UIEA 1VCNA 1NSTA 4L9SA 4XH9B 3KKPA 4LJYA 1EG7A 4E09A 2J9RA 1CLUA 4EFMA 2WPDD 4AYXA 2VP9A 2XEXA 4LJ7A 1II9A 1NBME 1TF2A 1KIMA 1E9AA 4R71A 3VHLB 2CE7A 1NLZA 4G5GA 2CMKA 2JATA 4O2RA 4JBWA 2OO7A 3AGPA 5TY0A 4JMPA 4NMMA 1SXJC 3PEVA 5JWHA 5FOUA 2Z4SA 2AR7A 2OESA 3H4MA 2V9PA 4CGZA 1G3IA 3FVQA 2QENA 3P20A 3H1TA 2J0QA 1HH4A 4O25A 2JA1A 1DG3A 3RS4A 1KMQA 1X8KA 2F43A 3X1ZA 2GCPA 1XTQA 1ZCBA 4NCNA 3LY5A 2XX3A 4JSYA 3CNNA 2QM7A 3TAHA 1IQPA 2ATXA 1CTQA 2ORIA 3NDBB 3X1YA 3CO5A 4OI4A 3NKVA 2BVNA 1R0WA 2G83A 3PEUA 4PFSA 2OXRA 1GAJA 1I4DD 1SVLA 2OFOA 5A5GA 3RLFA 1Z22A 4QNMA 3X1WA 1VYTA 1W4RA 4LGMA 2FGJA 3L0SA 5B2ZA 2E9SA 3TQFA 2GETA 1HURA 2N46A 3TW8B 5KUTA 3LVQE 2IUUA 3EPJA 3UPUA 5EP1A 5CM9C 5K8TA 3SNHA 2VP0A 1T8UA 3VTKA 4TN1A 3I61A 3NC0C 4XSHA 2CNWA 1G64A 4GI7A 3U7HB 4MDEA 3AGQA 4S2EA 3EAQA 5JJKA 3D3QA 4YONB 2JJ2D 3IKJA 5FTNA 3SQWA 1E1RA 1IOZA 5AUPB 1TPZA 3I4LA 4Z1MD 1CJTC 4FN5A 4LC0A 4IJMA 5TARA 1XEXA 2DY1A 2HLDD 4ZIRA 1HUQA 1NIJA 2LKCA 2F9MA 1IJFA 4DLWA 1XRJA 3SFZA 4MRNA 4QJ5A 4JLMA 4ZDWA 2QL6A 4M8NE 3ZDQA 4AYWA 5JCZA 4JYCA 1QDEA 4A36A 2FF7A 1ZW6A 2QBYA 1KK0A 2CL7X 3LBIA 1EFHA 1H8HD 3NDPA 4HB4A 2EYUA 2ZRNA 1SXJA 3U3RA 4QHSA 2RCNA 1J99A 4KFUA 1XXHE 1OIXA 3WXMA 2JLYA 2ZIAA 2DWOA 4HUQA 4TMVA 4V0MA 2VLIA 3I73A 4LBYA 421PA 1L7VC 1YR8A 3VFDA 3ZJYA 1P2VA 1GVNB 5JI2E 2ZI7A 3NH9A 1W0KA 4Q4JA 5J4YA 4OHWA 1UFQA 5FFMA 2FFAA 2C77A 1XBTA 2BIFA 4MRVA 4GMXA 4JLVA 5DE3A 3BB1A 4D0NA 3CH4B 3QF4A 3IIMA 1GFIA 1TQ2A 3J81k 1UKZA 4B74A 3VNUA 4II7A 3SJAA 3PUVA 1OE0A 4PC3A 3OFND 1CRQA 1DEKA 2EYQA 1KK3A 1P9WA 4V03A 4URXR 3RHFA 3AVWA 4I1SA 4N0EA 1W36C 1JR3E 4MA4A 4EDHA 4MITA 3K9HA 3RYTC 5KNDA 2GCOA 3VR1A 3B7GA 1OXTA 3CF6R 2FMXA 2AWOA 3GLFB 1XJ0A 1XEWX 2HJVA 2OLKA 1SXJB 3K0FA 1P2UA 2BDTA 3VMFA 2BBOA 3JVVA 4U7DA 4HUQB 3B60A 4YMWA 1BYUA 3TAUA 4OQFA 1SKYE 4NE2A 4JLAA 4V02A 3QKSB 4CW7A 1OPXA 1WDTA 4Q4JB 2AKAB 5AUQA 2WIBA 4B3DA 1OXUA 2F1RA 4PO1A 4GBMA 2ANBA 1G6OA 3EZ7A 1XPUA 2OCAA 1KI6B 4YXWD 3DOEA 3BWDD 2JLVA 5KYKA 4LJAA 1UKEA 4C0KA 2ZE8A 3VR6A 3THWA 2R6AA 4JVNA 5HKKD 2IYTA 3HPQA 3RRZA 1KK1A 3L8YA 1LF5A 1UBFA 1XNJA 1AS2A 2GDJA 2V7QD 3GJ3A 5FOTA 1P73A 1OSNA 1DAFA 3QKUA 2RMKA 4OQNA 3BORA 2QMEA 2WJHA 5BYJA 1RKBA 1DO0A 1VG8A 5G3ZA 1Z0KA 1FFHA 2R6GA 4I1VA 3RABA 1NN3A 4XD7A 4MKFA 1KNXA 2RHMA 3EXAA 3QENA 3A4MA 4GNKA 3K9GA 4MYHA 1PVOA 2I1QA 2HYDA 1UF9A 1BIFA 4OJQA 2XSZA 1VPLA 2H1LA 1JB1A 4XWAA 3ZH9B 1DAGA 2GAOA 3AP3A 1E1QD 2IEYA 3ZVMA 1ZM2A 1R0YA 3FMIA 4P4TA 4DDVA 2QP4A 4YMTA 1IY2A 2ZS7A 4TLAA 3RSLA 2GESA 4AWXA 4L4UA 2QMHA 3W6PA 1H8ED 3PV0A 1OKKD 4HZUA 3RRNA 1IXRC 2HCJB 1KY3A 5GADl 1H65A 1IAQA 1W1WA 5F2EA 3DO6A 3WP1B 1NVVQ 1N6PA 3HU3A 2WKRA 3ZYCA 2KBFA 1ZCAA 2GVDC 1CIPA 2GJAA 2ZPTX 4MUBA 3LVRE 4TWZA 5C2JB 5AJXA 1E2QA 1QHHA 1GKYA 2YKGA 3TBKA 1KJYA 3LX8A 3U7FB 3G82C 4DLXA 2NIPA 2QAGC 3PR1A 2XZPA 1EFUA 3L8ZA 1DAEA 4QBFA 5EZ6B 1Z8FA 1MH1A 1VG1A 2FZLA 2J3EA 4HLUA 4LZZA 3T1QA 4D26A 4B75A 2KI5A 3SYKA 2MSEB 3FOZA 3UANA 1GWNA 4GSYA 3EW9A 5CLQA 2P0EA 1R4AA 1Q1QA 4QBHA 1KO4A 1ZUHA 2GEUA 5C1BA 5JS8A 3D6TB 5IT5A 2DR3A 1QF9A 4RD0A 3DPUA 3WHLA 5L3VA 2V6IA 5LBIA 4B2PA 3K1JA 4DCTA 4LRWA 3AVXA 2J7PD 1TUIA 3DEFA 3C5CA 1NVWQ 5FI1B 3R8CA 1VCIA 2C96A 4JVMA 3U61B 1AS3A 3TSOA 2PL3A 3TH5A 4G5RA 4TT3D 2QQ0A 3R9WA 4NYJR 4JJZA 4DKXA 3NH6A 1SVIA 1Z6XA 4QOSA 2ZSAA 4B35A 1XD2B 5DHAA 1W4CA 4XTCS 4QHTA 4GP7A 2B92A 2GCNA 5CYPA 4NZYA 5JCPA 4EKDA 1SULA 2G88A 4LJ4A 5KSYA 4RFSA 3DM5A 5KSOA 2QN6A 5JEDA 4EJSB 5A4JA 3D31A 5FUYA 2G6BA 1LW7A 1XJQA 2OSBA 2YWEA 1E79A 2RH5A 2YC2C 5LD2B 1G8HA 2ZRKA 4QBGB 1E3MA 1WBBA 3GLGE 1W5SA 3CRQA 4ON9A 3PVSA 4IOJA 4DVGA 2V1UA 5FR1A 5BN5A 1UJ2A 3LD9A 5EE3A 1OH7A 1W5TA 1AQYA
chains in the Genus database with same CATH superfamily
2DTDA 1DLIA 2HLNA 4KN8A 2XODA 1C9KA 2DEUA 4OXKA 3SSOA 3B52X 3UUFA 2AH5A 4UDOA 3FD8A 3OEED 2X76A 1E2IA 4B73A 1S3IA 1N3YA 1HMYA 2ZXFA 4UEKA 4PZYA 5EXTA 1OZAA 2JI8A 1RRMA 2P9ZA 1KAGA 2EIHA 3GH1A 4UPVA 3VH2A 5IUNC 1N92A 4Z4CA 3D64A 2YFHA 2FPSA 2DJ5A 2I2CA 1HLPA 1OZ0A 1Z5VA 1GA1A 1X14A 3EIQA 4C2BA 1E7SA 1RQRA 4HNSA 3PC7A 3QITA 5SY9A 5IMSA 1D8TA 3ORQA 3VPSA 2D54A 3H11A 1V3UA 2NUBA 1IK4A 4R81A 1DAHA 5EIFA 1NC1A 2DBVO 4E1BA 1GCAA 4QNNA 4W5NA 4B6QA 3IKLA 3KETA 4R2MA 1EDOA 1MR3F 4G6ZA 4RK6A 2XADA 1U7HA 2HNAA 5CPBA 3TIVA 1U4OA 1V8BA 4R9VA 5B57C 1AG9A 2PU5A 3TE7A 1T3SA 3HUDA 3IIEA 2QSZA 4TRJA 6PFKA 1R6BX 3D5TA 1NAIA 1BKYA 3WRWA 5EQFA 1ESNA 2H8GA 3AT1A 1T15A 3HDGA 2WOOA 4YCDA 4LE2A 3U3XA 5EY5B 2AN1A 4O5AA 4EIWA 1UOOA 3RUDA 1Z18A 3RQIA 2QU7A 2OHOA 1BG6A 1H4TA 3WIBA 5KJ6A 8ADHA 1IN5A 3OT1B 1Z7GA 4P84A 4PN7A 2YOFA 4MQ4A 3F6BX 2N47A 5HS6A 1HNNA 1XEAA 4G23A 4LGCA 4LMRA 4DCOA 3MOIA 1QC5B 4F8YA 4UBNA 3MYRA 1II8A 2IHVA 5LXTF 1YK1A 3L4BA 4RSMA 2XDQA 2CXNA 4KR0A 2KHZA 4HAIA 3IE2A 2C92A 4UM5A 2EXXA 4Y9RA 3K70C 1HWYA 2HA3A 1PQUA 3DMPA 4A6PA 1GPAA 3QHAA 5ALQA 3JQAB 3KOZA 2DR0A 5D5QA 5TDHA 2VUTA 2CWWA 3OQIA 4RWEA 4N9QA 4KWTA 4JY7A 5AJWA 4LZPA 3P96A 3GPDG 3Q15C 1Z5PA 1S01A 4ZC8A 3FPGA 5EKDA 2JFVA 1J5EB 1WMDA 4I4TB 1G8KA 4GZ5A 4QULA 2ZRHA 16PKA 4IFIA 1CU1A 2A9VA 3G0OA 2PGLA 2J3DA 4U5QA 3UFBA 3KSDO 3HA2A 3TRIA 3AHGA 1DV1A 2G8NA 3KSUA 2IL1A 3W06A 5IJ0B 1O5TA 4ZMBA 4IIHA 4DJ5X 1OX4A 1JYEA 2H5EA 1XDBA 2H59A 3BHNA 4PIVA 1U7XA 3FLMA 1JHZA 1YI0A 2IOHA 1EQUA 1V9CA 2CE2X 2L0XA 2MTBA 4HO1X 1QXSA 4KYIB 2UZAA 4RHTA 3SZGA 3R9IA 1RRKA 3C2QA 4RU1A 5KNBH 3EHEA 3PCRB 5CEJA 1ZMRA 3RVPA 1IBRA 3LV8A 3RSSA 1F3OA 5CA1B 3A6PC 1C29B 2IYUA 2VPWA 1YS7A 3OQVA 3L2OB 3UOAB 1UEXC 1FLDA 1N2GA 1PL7A 3SM3A 1MB0A 5GZ6A 1GZ7A 3BGIA 5L3RA 3UMYA 4EPYA 1RJ9B 2FDCA 1JAZA 1NQAO 5LYJF 4R2XA 1GPBA 1DC4A 1SN7A 1W96A 1I0ZA 2RHRA 4C21A 3W2HA 4EZEA 1FSZA 3BMNB 2CYAA 3H97A 2R66A 4JK3A 3R6DA 2BEUA 1FRNA 4CUKA 3E3NA 2HDHA 5I7VA 1LBHA 2HSDA 1X7GA 2B2CA 4Q9KA 5D3QA 3UJNA 1UBEA 2I71A 4OM8A 1BXGB 4DQDA 4AKEA 3V55A 1R0LA 1X80A 5LMUB 2C2MA 5JJCA 2XW6A 4U7TB 1LLDA 3P9YA 1J33A 4TQAA 5E7JA 5IP5A 1GZ4A 4HNTA 4Z53A 3FRJA 2GPBA 3K2EA 5PNTA 1XHFA 2FWAA 8GPBA 3AH8A 1M1NA 2V7XA 2J0EA 4RA6A 2GMWA 2JHAA 2O6LA 3LZCA 1JHXA 3MT9A 1W4ZA 3FMFA 1S2GA 3U3JA 4CNBA 5LNK1 4MPRA 1G4AE 2CDNA 3D6FA 3ZE8A 2X4IA 4JENA 2XUZA 1MJ5A 3V33A 4F4FA 4W9MC 1Y3DE 2QPOA 3CLKA 5JADA 1RW4A 2X2PA 4MTCA 2BDEA 2OBLA 2ZJYA 1ZKDA 2ZUEA 3NRBA 3L0BA 3DKKA 1KJJA 3H5NA 3FFTA 3H83A 1RD4A 1T0IA 1WZCA 2FPGB 2G3YA 3LT5A 3JD4A 4IHQA 4N47A 4TZ6A 3E1KA 2HSZA 3GJ7A 1R4NA 2QIPA 2JDIA 1YHZA 2I54A 4Q66C 3SYNA 2YRWA 5KNBD 1LV7A 4R8KA 4GQBA 3GPLA 1ZRNA 5DW3A 4PSKA 5DYTA 2MYTA 3FE2A 3AHCA 3TLJA 4HRXA 5FLYA 3VVBA 4C01A 4QPNA 1EH5A 4EHAA 1CEXA 4YJGA 5JE8A 5AM2A 4PYJA 3CR3C 4MB0A 2PMWB 4RO0A 3UW3A 3LGAA 2R6ZA 3AVQA 4ZT3A 3T3OA 4WBNB 4UZSA 5FBHA 4DSZA 4GAEA 1JN0A 1NI5A 3MCVA 1USVA 1KFCB 1PV1A 2VDLB 1UADA 4CN8A 1L3BA 3PQ5A 1QIMA 3A1FA 2JLRA 1QIGA 4YMHA 4RTQA 1M1YA 2GS9A 1FTYA 1OFIA 2NUPB 2AFHE 2PS0A 1RE0A 5DJ5A 4M87A 1GD1O 5KNCH 4DV7B 1ECLA 5T3YA 3MJFA 4N5HX 4KN6A 1Y8CA 4TYMA 1AQIA 4ARSA 3TVDA 3LY7A 1UBSB 4JGGA 4X63A 3TW4A 4AJNA 2D1FA 5I4IA 5CK4A 1TD9A 2BEKA 1T9GS 4XZ3A 4DV5B 1YHYA 1PT6A 1OC4A 1XCPA 3GLRA 3HCOA 5EZYF 3HJBA 2B7CA 1AMUA 3P9XA 3TPCA 4QOIA 2GM4A 4I5DA 1M2FA 3EMKA 2CBGA 2CHFA 1QTIA 1UFKA 3VAZA 4BC1A 4Z49A 7YASA 2O8DA 1QH1B 3SQXA 4CLDA 1WF3A 1KO1A 4ZTUB 1WKBA 2C61A 2YMQA 3TTTA 2ZI5A 2BFDB 4Z1MA 4BP9A 4XCVA 1YQDA 2M6SA 4BAUA 1XROA 3NVMB 4J0GA 3A70A 2HLHA 4X7MA 1IH8A 1VGQA 4KHZA 2OHGA 1EHYA 2OZLB 3PGA1 2VTBA 1MQ8B 3GFBA 3ADDA 3QEMB 4XXHA 2GBIA 2QA5A 3PS9A 4RLSA 3BICA 1U02A 1LTHR 4KAAA 1JIVA 4HBZA 4XDGA 1SHZA 4YFYA 4YAKA 1MORA 3SVLA 1B74A 5EZQA 4PVCA 4NZ9A 3RADC 2Y1OA 3K16A 3G2IA 5I7WA 2OCKA 3GFFA 3OZAA 2GF2A 1WUKS 2XB9A 4MLZA 2HCTA 1CQPA 2FX5A 4GIBA 1H8HA 2YS6A 3FUXA 3GD7A 3KQSA 2YFKA 3F4KA 4AM8A 5KMGA 2RI0A 1E3SA 3W04A 5BSVA 1VE5A 4F8JA 3O21A 1E2LA 2NWQA 3D0QA 3FGZA 4JS0A 5L4SA 3FCSB 1DV2A 1WZUA 1JQDA 2WUGA 2CT8A 2QPLA 1DIRA 4MR8A 5DOZA 3RUAA 1EE2A 2AJTA 4R2KA 2D5AA 2Q9AA 4WLEA 1G21A 3PHHA 5KQGA 4I1YA 3SN6A 3NOQA 4J7XA 1E5TA 3JR3A 1RACA 4EI7A 5GVSA 5ULLA 3WGTA 5DEIA 1L7RA 1TK2A 2C8KA 3EGIA 3B53X 1O2DA 3FGNA 4RKFA 4DMFA 5TPZA 4GPIB 3W8RA 3KTOA 3LT2A 1QLHA 4J90A 1G8MA 2V59A 4RAQA 2E4YA 1T6ZA 4RWZA 4V0NA 3TAXA 2P91A 1X1RA 1DBPA 3L01A 4PYMA 4JHXA 3JQBC 4Q01A 3IJ5A 3K9FC 2A4KA 2OEPA 3G88A 1XAGA 1NV8A 1XYVA 4JD5A 4HLCA 2GNOA 1H2RS 4OFXA 4PYIA 5J59A 3UWKA 4NBRA 2ERXA 1DRWA 3P5BA 3Q7EA 4JVSB 4EYGA 1G0OA 1A7UA 1YB7A 4J0JA 2JBWA 2Z5GA 1GYRA 3AB8A 3GJ8A 2AI1A 4QUGA 4CT5A 2D62A 2YYZA 5K99A 2OZEA 2OFPA 2Y99A 2K5UA 2QTRA 3ORFA 3OTWA 4ALMA 3DL0A 3DMNA 2YINC 4W7HA 4QT4A 4QEKA 4TQ9A 5EMKA 3GOHA 3AF5A 4DSNA 2BUAA 4OHRA 5TF4A 3ZE1B 1MA3A 1VIYA 3QXCA 2O5EA 3OLCX 4NQRA 1VPVA 3DCJA 1TO6A 5HHTA 4LE0A 2GXUA 2X0IA 4MW5A 2W6IA 2H0QA 3TTYA 2B0CA 3GUZA 3QEJA 4MWZA 2P9FA 3BAZA 2JIDA 2ZIWB 2FPRA 2A92A 3OETA 3QKRB 5AKXA 3OJXA 1MKYA 1JSRA 2P8JA 3IUPA 1TIKA 4MDFA 3MTJA 2HLPA 2W2PA 1RZVA 5C8YB 2QL9A 2QVBA 3OMLA 3CGGA 3V6LA 2XUHA 5B7NA 1WLSA 1LLUA 3CG0A 1G6HA 1JHDA 1Q0PA 2M9MA 3IBTA 3JAWB 4RIHA 4BDSA 3QOYA 3NHLA 3L43A 4HFJA 5IEJA 3FXAA 5BQ5A 3EIXA 5ILGA 4FFBB 1CEEA 1CF4A 3CSUA 1CSEE 1A95A 2AHRA 2C4VA 2ECOA 1PD0A 1KZ4A 1Y7LA 2GD6A 4B46A 2IZ6A 1X9GA 1M2NA 3I9LA 3DZKA 3A6ZA 5KHAA 3LL4A 1NM5A 3M3DA 1NXSA 4KHPB 1FYFA 5E4YA 1R6DA 2HGSA 3STYA 1WXHA 3B13B 3BPSA 2YJ3A 3NASA 1OA1A 1Z2OX 2JHCA 3IYLW 4MWEA 2JAOA 1SGWA 4S1NA 5F33A 3GJXC 4D42A 2IU3A 3R3XA 3VSBA 1NR5A 1Z82A 3T5AA 3EA5A 2XF2A 3QKTA 4NMHA 4B71A 3AR5A 2P9CA 3I28A 4BX9A 2V6MA 4AT1A 2BN4A 3AI2A 4C7OB 2I4NA 4HB3A 1KJWA 2DBZA 1W0JD 1CQIB 3EY9A 4ZRNA 3T7AA 5HF8A 4RVFA 3CZMA 4HY3A 4DG5A 5JH7B 1ISGA 5EJ4A 1H8EA 1EFRD 4J07A 1JXOA 3FYSA 4LVNA 3SC6A 2KBEA 5EHZA 4H18A 3BXFA 3BD7A 1AGYA 1YFKA 2CL0X 2NAFA 4A0HA 3LQFA 5KSZA 4H1VA 4E5NA 4D6YA 4YWJA 4CF7A 3PITA 5LA6F 5DX0A 5KZMB 2UZ4A 1PGQA 1TB4A 5DGHA 1RXEA 3PK0A 2G17A 2GJ4A 4FYYA 3M6AA 4I0WB 4LY9A 3E7WA 2HV8A 1LNSA 4UU1A 2DWPA 5EP4A 5LUBA 2R87A 1DOZA 1W35A 3BQMB 2GM3A 4OU5A 5IWAB 4IIDA 3AKDA 5JXHA 3GJ6A 1T1JA 2A9FA 4OB6A 4M9RA 4C0HA 4OQYA 2DYKA 5FBKA 4A15A 3GPBA 5CVUA 2H9AA 4X1OA 1J0CA 1ULZA 1XN1A 3BMCB 3O8OB 1GNLA 4B2IA 2NZWA 3GEDA 4CCYA 3B8EA 3Q1LA 4MULA 4PS1A 1OUMA 3HA5A 4QPZA 2W4IA 2DB3A 3BRCA 2CKMA 4EY8A 1P5JA 2BAGA 5IF9A 5IXYA 5K8VA 2FSFA 3I62A 1WMEA 4HAWA 4FX5A 3KVRA 3E9ZA 1VYUA 2FW6A 4QWWA 1FLAA 1CUJA 3N2LA 4MMYB 4UPDA 1B6GA 1TKAA 3TCKA 5HRAA 1SVUA 2VUIB 2X2OA 5I9NA 3HFRA 1IB6A 3QJYA 1VMKA 2PFSA 2KMLA 2ZT5A 3JW8A 3PQDA 1WX1A 3JXEA 3L7NA 3B1VA 4LF6B 4I50A 1SCNE 3M6VA 1LRLA 3QHPA 3CF4A 4J0HA 1SVOA 2O2XA 4ZDKA 2RG1A 4BN0A 1Z4LA 1M7HA 1YD7A 1YMUA 4Q1VA 5TGDA 5CDUA 3G17A 3LFUA 1EVQA 1IQ0A 2PT9A 3CF0A 4Q34A 2PUGA 4F0JA 3N3BC 5KKCA 2FRXA 4EB8A 4H7EA 1R15A 3FOWA 4WK4B 3GRVA 4XLTA 3BX1A 4ES6A 2VNSA 1IM5A 4OEHA 4ROTA 2LWIA 3DAYA 6AT1A 1NYLA 4Q18A 5DEOA 4B83A 4M54A 3N2YA 2R1TB 3SHWA 3TWOA 3C3PA 3KE9A 3E3AA 1QQAA 3AIIA 1K27A 3L6BA 1OXVA 1Z0IA 1TEXA 4HQRA 5A3VA 4W5RA 2R8ZA 1J8VA 1PQ4A 2P2GA 2W2OA 4XGRA 4NPCA 4DLAA 2ZATA 4YJHB 4ZALA 4A0GA 4ZZ3A 3WP0A 2O1XA 4DXAA 3FYHA 2BFBB 3QVXA 3Q87B 2FEXA 3KG2A 4UM7A 3A31A 4EPTA 1HTBA 4YAWA 4LYJA 1UMBA 3RIHA 3FGPA 2XY4A 3WQHA 1KAQA 4K9SA 5FTMA 4OATA 4FZ5A 5K6AA 2X6QA 3ZVRA 1QFZA 1Z8HA 1HDXA 3A2LA 4HDSA 4OQMA 2ZSBA 4QEZA 3U0BA 4BFXA 1CD5A 2SKCA 1OVGA 2BGKA 3A37A 3HVHA 1ZD4A 3V80A 2SBTA 5HSGA 4AD8A 4TS1A 1AUXA 3MS2A 1Y7PA 3MMNA 3RI3A 1VLQA 1J9EA 2EKPA 2WI8A 1AU9A 1P4GA 2X9NA 2ZPUA 4BOYA 1YTLA 4CUZA 3NOVA 5MN5A 1Z2PX 4OGLA 3T5TA 1P0MA 1R2QA 3B5JA 4L6IA 4KMSA 3C43A 2GWRA 3R7DA 4UVGA 2Q27A 2V55B 2X0FA 1N9GB 2IHBA 1O96B 5FAKA 5A06A 1OAOC 5G1PA 4TUYA 3ER6A 4ZCRA 5C18A 4O2AB 3SFVA 3JYHA 3ACDA 2QTLA 3S40A 5A9SB 3CUEF 1UAAA 2HN9A 1P39A 3HBJA 2VQDA 3TB6A 1PWEA 3O1JC 1OXBB 2HHCA 3H9GA 2XB6A 5JS7A 2YX1A 2W6MA 5A4MS 3ZD6A 4A1FA 3BF8A 1AUQA 4D81A 3IDQA 1M0SA 4M88A 2HUNA 3T3GA 3TZHA 2KX7A 1NRJB 1VCHA 2V7BA 2YRFA 4BKUA 3G85A 1Z36A 2DUUA 2GCOB 1EUDB 2OTCA 2YZNA 4LPKA 4N7RA 4Z5XA 2O8FA 1WV1A 4AVYA 3K0FB 1QMGA 1JB9A 5TGZA 4EHLA 1RPZA 1H66A 1L7XA 4KEAA 4KBGA 4QDXA 1C1XB 2VCHA 3BDIA 3RIGA 3WK4A 2ZRPA 4FMCB 4GOJA 4IGAA 5GPBA 2BY4A 2XDAA 1AQUA 1M2EA 1RRFA 5CFZA 4M1OA 3T1HB 2CEKA 1C0PA 2QTTA 3PHCA 3RWOA 1JEYB 1KGDA 2OAQ1 1LVGA 2FVXA 3EEYA 4TL9A 3WJAA 1S2NA 1DAPA 4ZCIA 3ET4A 1K9SA 3PPWA 4A10A 3KYIB 2WJIA 4O3MA 2IPXA 2FZVA 2IW3A 4NDZA 3QPUA 2P5TB 3JTMA 4LMPA 2P40A 1O6BA 1DC6A 5H8WA 4WBSA 3THWB 5EIOA 3PI7A 4M0KA 4D0GA 1ZSVA 1SQSA 3VJLA 3WFIA 2I6TA 2C7BA 5JUWA 1BGXT 2VA8A 2CF6A 3JR7A 4RTKA 3I6YA 2DAPA 1C1DB 5CBPB 1ULHA 2ZRBA 3QEOA 4UD2A 1T9GR 4BLPA 5CR9A 1E62A 4J6EA 1UK6A 2H52A 1B0ZA 2PT5A 2GWHA 1NX9A 4EYSA 2FW8A 5LC1A 4U3JB 2H3HA 1JE0A 1RHRA 3ZZMA 1H6AA 4LWPA 1ZOOA 4QGFA 4Z1OA 4CFZA 4PZDA 2PN1A 1E0KA 3M5PA 1XAIA 3KZXA 2QVYX 2Q0SA 2VQSA 2LCIA 3M6LA 3OU7A 1BFUA 221PA 3TLZA 4US2R 5IBRA 3G89A 4REOA 2OWDA 3AERB 4CG1A 2CNWD 3AV0B 1PN3A 1Z68A 5JCJA 5IXSA 2I8LA 4EOGA 1VMDA 2A2ZA 3ZDCA 1L7PA 4IQ8A 5JNWA 4AYTA 3FPHA 4GDFA 3KO8A 1Z6GA 2RH4A 4WFQA 3TFWA 3ZJVA 1I24A 1IWOA 1XI2A 2C78A 2O5CA 1U8CB 2ZIFA 3B70A 2X7JA 4GMFA 1I7DA 5CLFA 4U2FA 4XM2A 5A04A 5KHOC 1AH2A 1EB8A 2C88A 2ZWAA 5JTUA 1QZZA 2R7AA 2C59A 2P41A 1FMCA 4WFKA 4O4IF 4D4MA 4CMHA 5I48A 2UYOA 3IUNA 5ITZA 5EXXA 5C5IA 5DHTA 1QHHB 2J0UA 2YWJA 4X8OA 3ZY6A 1U8FO 1P9RA 4IBOA 2IITA 2IHNA 2NTEA 1IY0A 5E4TA 3R7SA 5IXJA 5K2OA 4ER6A 1XTUA 3EGDA 3ZHBA 3HKDB 1CUHA 4NHOA 3IQGX 2HFJA 3PNVA 4ND8A 1L5KA 1O6CA 3AEZA 4MWSA 4UARA 5C7YA 2YIMA 3OKFA 2MSWA 4QAQA 1LD3A 2JHPA 5DULA 2ZYUX 4E2YA 4YN3A 4C87A 4Q3KA 2I0FA 5CM8B 1BEEA 3Q7PA 4NECA 1R9MA 5C0OE 1W73A 1T26A 1Y6QA 2IYFA 3CR8A 1Q57A 5IJ9B 2XKJE 1HA3A 1I3LA 3AIKA 3F9IA 1RLJA 2EARA 3VRHA 4WTOA 4B31A 1T0HB 1YZTA 5BUCA 5KVAA 1IHOA 3D8NA 4RL4A 1ZWKA 1H2WA 1QGUB 1XDUA 2DHEA 4JZYA 5G0SA 3U4AA 4KH0A 4D02A 4FGJA 3Q5GA 1NNEA 2PKQP 1PEYA 4BQFA 5AW6A 1O95D 3E84A 4MUAA 4D4KA 4U7FA 1RZRA 1RZUA 1BSVA 4X1KB 4U8HA 3ENQA 3SEAA 1GP2A 1KK2A 1N0IA 4MI9A 3K32A 3W5IA 1JP7A 1QH0A 5A0VA 2O8BA 4TLLB 1I80A 4UHBA 3B1YA 1FPMA 3IS3A 1AGXA 1OFUA 2P2SA 4KJZA 2ZAIA 3VYVA 1FUYB 1A9TA 3PIDA 2P6PA 2WR8A 2O9JA 4HUJA 1GNPA 2G77B 2WSBA 4X64B 4KPFC 3GGCA 1OREA 1EFVA 2XZDA 4ND4A 3D3WB 1PWXA 3NFYA 1P3Y1 3RS2A 4DDHA 2NSJA 2XUQA 2ZCUA 3JQFC 4DDWA 1UMCA 7ABPA 4J1QA 3E3OA 4D4IA 4JYBA 2QRZA 4LPSA 5LBTA 2IWRA 3LCMA 2CL6X 5HJ7A 4MLPA 3REQA 5BSHA 2YUTA 2NUTA 5LQRA 1WABA 3JX9A 5K4GA 2AX3A 3DB1A 2F00A 3RKRA 3W9UA 1PHPA 4WOCA 1ECGA 4MRRA 2DVMA 3R3ZA 4KRGA 3VHQA 2A88A 3LX6A 2GKSA 4Z7OB 1L3IA 3BA1A 5C8DA 4HZIA 2EFCB 3N8KA 3ZCTA 4FS8A 3NIDB 4H27A 5HNKA 1FYVA 4PX2A 2P68A 2ZS9A 4FPXA 3QX9A 4TVBA 4AC9A 4QU8A 3N0RA 4IXDA 4IYRA 4IV5A 4P3NA 1TUBB 2Z3WA 3T7SA 3B3QA 1MTZA 3RS3A 3RRJA 5FT9A 2GSWA 1NV9A 2F3UA 4MJXA 4X20B 4TROA 2VXYA 3S1LA 4BNNA 5ILOA 1VHWA 1JAXA 3ADKA 2QSUA 2BR4A 3DD1A 2IF2A 4HKTA 1Q84A 1XQYA 3D2LA 3TTSA 4C7MA 5T4EA 1FFXA 3EH2A 2R3SA 1K66A 2FUEA 4MDYA 2VSXA 5TXGA 5J47A 2QQ5A 1NJGA 2BEVA 4HD8A 4TGLA 4EY3A 3VJKA 3LYUA 1DARA 3KJEA 5FKJA 5T3UA 3T34A 1ENPA 1KVSA 2PBFA 4X84A 1CZUA 3LSTA 4FOPA 2NU8A 3T3PB 1UOQA 5U4QA 4BB6A 5I7UA 2QYHA 4W99A 1I14A 3IP9A 3SYTA 5DHUA 3WBKA 3BD8A 3UICA 2G9QA 3ETGA 2XBUA 4IGEA 1K89A 4R05A 2M98A 1JPUA 3P2OA 3QF7A 3BMXA 3UHPA 4PO8A 5SYAA 1YKSA 4ENRA 4N49A 3U7QA 2HWUA 3WIVA 2QQFA 5EYPA 5DNYB 1F2VA 1R8YA 4KL8S 3LUPA 2ZP1A 3MGKA 2GLUA 4Y6QA 4PX9A 1ESEA 2FJ0A 3HCEA 4URZR 3ZJ5A 1I4WA 2V7VA 2POQX 3F5DA 4M6WA 4MV6A 4DZTA 3IAAA 3MGCA 4HGOA 5JDIC 3M4NA 2YVAA 3KCQA 4YRMA 1DSSG 1F8FA 3DOFA 2Z8YM 3KEGA 1B16A 1L4NA 2OBNA 2YV1A 1UBGA 4MS1B 1KIFA 1XXHB 2BRUC 1CUWA 1LVUA 1UWKA 2EIXA 3UOWA 3W8NA 1TYZA 3NC4A 1SZCA 3SXPA 4R1LA 5JATA 4JLKA 2GPJA 4HB2A 4ME6A 2VCEA 4MKZA 1D1QA 1MX3A 2J8ZA 4QPPA 4V39A 3RYCA 5JU6A 1BD4A 2PZMA 4E2FA 1V2HE 1XQ9A 2FQXA 3AFIA 5A05A 4WJLA 3OD1A 1FP4B 5DMHA 2BJHA 3GJSA 3GIWA 4YMIA 4HDKB 1W48A 3W2EA 1ZQ9A 3GD5A 2VBIA 3IPAA 2WPDA 3CX4A 3THXB 3UB2A 1EBUA 1II0A 2HC9A 2HMTA 1G7RA 3ZWQA 1X3SA 5AYVA 2YJ4A 3P0EA 3WB2A 4OSEA 2IOYA 2ZRCA 5EN4A 2QNIA 3MWLA 2VK1A 5L51A 2VH2A 1A72A 3LQ2A 1E0JA 1W25A 2EFEB 2V96A 1PG5A 2HDNB 1U7OA 2WWXA 2XUOA 1L5HB 5HQ3B 1DJMA 1LDYA 4MPDA 5AW7A 2Z2XA 2O3SA 4LWOA 3GW8A 4A1OA 5AVYA 2QT0A 5JVDA 1MO2A 4A03A 4LE1A 1KDZA 1C0KA 4BNDA 1S2IA 3W05A 1QV7A 4QC2A 1QNLA 1SHJA 5ESXA 4B34A 4CI0B 3D6HA 2WWYA 1KOFA 4FMDB 4YV0A 5HUHA 3CLUD 3EEOA 2CF5A 3ZDEA 4EYOA 3FNHA 4D3FA 3ENZA 3GQBA 1KAMA 2ARKA 2Z4TA 4XYBA 1PWZA 1US8B 2YS7A 5JDCC 3FA2A 2MSCB 1E1YA 1KOLA 1K4KA 2E2WA 5D5PA 1A5ZA 2AXNA 2WKPA 4PSVA 1C50A 4CLHA 1I4OA 1FS5A 3WO1A 1TYAE 1D5CA 4L75A 3CPSA 1LS1A 4CLOB 3ICEA 3CNLA 3ZVLA 1S3GA 2G9ZA 2VHCA 4W9NC 3EH1A 1AB5A 5K3OA 1CUUA 1TPYA 1XU7A 2AHOA 1KYXA 1UZUA 4AJIA 3GL9A 4P3PA 1PFWA 4LXYA 1IQUA 5IKXA 1MFPA 3DFKA 4ESVA 2FKAA 4EHNA 5EFOA 3CW9A 4HK4A 4QBKA 2CCJA 4JA0A 1R4MB 2C2BA 5I9SA 2Q2OA 2WUWE 3H13A 4BEBA 1U90A 3A8TA 5U1PA 2VTEA 4R2WA 1UP6A 3FCCA 4Q7JB 2WTNA 1XXLA 2HRDA 2CDBA 5AP9A 4B76A 4PYOA 4XIJA 3D4BA 3PDWA 5FB3A 2QKYA 2H2IA 5DCWA 3OP4A 3OCWA 4RS3A 2ZPAA 3ONFA 1WQ1R 4MXDA 3AOGA 3CFYA 3DWIA 3LCCA 4PYKA 5G4KB 3STWA 5BR8B 2A9QA 2K7FA 1JFTA 2J0SA 1IEXA 4JJAA 2IYZA 4KZPA 4RDIA 3VU9A 3Q8LA 4UOQA 1RBMA 1QO9A 2GJSA 5F76A 2P2YA 3OP1A 2XOEA 3TG8A 1MDFA 2V5VA 3FNGA 3FSGA 4WCFC 3T95A 5I9BA 1NVVR 3CLSD 2A0UA 2PH1A 3HN7A 3EXG2 4TOIA 2PWBA 2GEVA 5KTKA 1U3TA 1U0GA 3QX8A 3VZSA 1RWMA 1F2DA 3E03A 4OJMX 4XLZA 3R8XA 5JPCA 2AJ8A 4IIJF 4GXNA 1Q20A 2UV8A 1LNZA 1WXWA 3BREA 1TTPB 3AR4A 4HWSA 3ZWYA 5L3QA 2E37A 3K5IA 4DVJA 3CBQA 1FVXA 1TX4B 5B64A 3V2GA 1QONA 1JMVA 3AUKA 3OLYA 2XT0A 3GLKA 3WZMA 3VVLA 3C4QA 1AIPA 1C9MA 1OXMA 1NVAA 2WIKA 3HWWA 2AG6A 4X1YA 3LOUA 1DTSA 3DO5A 1G8PA 4KLZA 3CT6A 4M8IA 4OK6A 4ZV9A 2X15A 3WK8A 1QVZA 2VJPA 2W43A 2WHYA 1W59A 4EZBA 4CZ2A 4KI0A 3FCAA 3OFNA 4WN9A 1RC1A 1NN0A 4K81B 4XGIA 1GZSA 3LDAA 1VJTA 4PIPA 2F4NA 5D00A 5GIOE 1X1SA 2PGNA 1EGVB 3DXFA 3UG6A 4H7KA 2XQIA 2WFZA 3R0VA 4NENB 1MOSA 2WIFA 2OMEA 4OQPA 4R31A 1EJBA 3HKBB 3WTBA 4AY4A 1BVYF 1CUYA 4GECA 1CJVC 1S8FA 3ELWA 3OVMA 821PA 2CUNA 1USKA 3HY4A 3D3EA 1MVLA 4HDNA 3PR3A 4WZ6A 1XMOB 1Z7BA 4YCMA 4N48A 4AP9A 4NYJQ 1Y1PA 2HCBA 2ZANA 4WHMA 3EXFB 1U4SA 1J8QA 1Q2UA 3HU2A 4ZVSA 4P7KA 5FOQA 1T1EA 4PN3A 4FJ2A 2ORED 1QHYA 4JL5A 3SYLA 1X39A 1TW2A 5DI3B 1PYGA 3KKMA 1Q21A 4ZARA 3U4QB 4KJXA 3TMKA 4BVKA 4RPGA 2H1VA 2C0QA 4GOLD 3UO8B 3IMEA 2OD2A 4OUDB 4R0VA 1M6HA 1S1MA 1ZU5A 1GITA 4RZIA 2C03A 5FBRB 4GGMX 3UK7A 4EPRA 1V95A 1ND6A 3D2BA 5JANA 2X4LA 2JLXA 3NXSA 5BN4B 1Q1NA 1RWOA 4BNMA 1N78A 4M1QA 2QR2A 3ZE7A 1JR6A 2WP8J 3CW2A 3R5FA 4XB1A 5EJFA 3CLRD 2VNIA 5ERYA 4ZI3A 4ZMSA 5GM1A 4BYGA 4P4NA 3OE1A 3WX0A 2VH1A 3WAGA 4UTOA 1OLXB 2Y76A 5SZIA 1GGJA 4P2BA 4ZHQF 4NK5A 4FFRA 3I39X 5LZ5A 5M2QA 3P2EA 4FT4A 1TVKA 1EFTA 1IULA 3MJTA 4N6NA 3AEUA 4N4AA 5J5VA 3TTVA 1SPXA 4FJ1A 4HWOA 4TXHA 4YAUA 3NGXA 3GLGB 1E9DA 1NR7A 1TFRA 3JQGB 4NV1A 2PQ6A 1N33B 3LXRA 2DWUA 3ZLVA 4LZOA 4LFBB 1E0AA 2JRLA 2I78A 3DDSA 2GEKA 2QK4A 4I55A 4QGBA 4WOJA 2AA3A 1SUBA 4HWKA 1BDHA 2N9UA 2AC2A 1JWAB 5HP4A 2HQRA 1U2ZA 2CVOA 5HZGA 1K92A 4HNHA 4OYHA 4GVLA 1HK7A 5EJ5A 2O7RA 1DZIA 3DMGA 2O20A 3PZBA 4GHWA 5ITSA 3LC1O 3OKPA 3AY7A 4ZOLB 4X91A 2A78A 1BCRA 2AZTA 3ELUA 1N6LA 1U8UA 2XMPA 4B48A 2ZFUA 5LQKA 2H06A 3IIIA 4G5QA 4OQQA 4Y30A 1C7QA 1G8JA 1MMFB 2B7LA 2PPVA 4J3JA 4URUR 3SJUA 3TUJC 4I1RA 4IIUA 4JYZA 2XITA 2OKGA 3BC1A 3OQJA 4NIMA 3VXKA 1ZBQA 1AKWA 2R6CA 1SBNE 3S2YA 1J39A 5LP6C 1L7MA 1V25A 3NYRA 1Z26A 2HA2A 3EWAA 5BN1A 4H6XA 2Y3IA 3AF2A 4IIFA 4X93A 2WW8A 1DCFA 4ZO6A 4BQQA 1COWD 1I2DA 1X86B 2YWXA 4O33A 2DSTA 4PX3A 5HGJA 4GX2A 4UASA 5K3BA 4F86A 4LRYA 1D0IA 1ETHA 4P7FA 1E77A 3OTGA 1G1AA 1O95C 1E1KA 2JFHA 2WM3A 3WLLA 1APBA 3AHDA 4BMSA 3PFNA 4J94A 2P0YA 2CXUA 3F7OA 2F8LA 5HVNA 1PR3A 4HSEA 5I3ZA 5AW9A 5H80A 5K01A 4R9SA 4AIIA 4S3MA 3E7FA 3EDRA 3UA3A 2CK3A 3M83A 3VU1A 1HOTA 1VSVA 3N0WA 1CX9B 4OA5A 3GRUA 1YXMA 3E8SA 4GR4A 2GXAA 5ELXA 3ZOKA 4HJRA 1SU6A 2CNNA 3PLNA 2R1VA 1R5OA 3V7FA 3ABIA 1GGFA 3M4JA 5CG1A 1MA0A 5DKFA 4V0OA 5GY7A 4F3NA 4ZO8A 5IHXA 1HE5A 5LQMA 3PA8A 1B0AA 2PJRA 2QV0A 4AJPA 4CPDA 1SC1A 3I01M 1M83A 2OO3A 4AK9A 4F56A 1UK8A 2OORA 3DA8A 3K72B 1TXGA 3ZI0A 3BD6A 1KDVA 5CVDA 4K9RA 1H5NA 3LH5A 1SCUB 3NAGA 5AHWA 3T9BA 1LX6A 4NABA 3K9QO 3O1IC 4FGKA 2QUZA 2AN9A 1AE1A 4K0RA 4TV8B 3H19A 3KJIA 3OIUA 3TQOA 3T5PA 3RSHA 2ZE5A 1U63A 1WEKA 3AY6A 3N5KA 4A2CA 1PDOA 2IYLD 4B3HA 1G19A 4AMGA 2ZJ5A 4YTEA 3E5NA 3GFGA 1PBNA 2R2AA 1TVMA 4JJKA 1NBHA 4JJ8A 3LO8A 3UBMA 2IUFA 3B3AA 1WU8A 1XCMA 1K9VF 1UZAA 1XFDA 2NQ2C 3PGKA 4PPNA 2BWJA 3DE1X 3TVYA 3SNKA 2NU9B 3S4YA 3BHMA 1EUCB 4NJMB 4D1YA 1EYZA 1KI6A 4XFJA 4ZFNA 5LUAA 5TQ0A 1RI5A 3DYVA 3MTBA 4BGEA 1C4OA 1KOGA 4H59A 2C3MA 2OGZA 3E22B 1BWSA 2W2XA 2G40A 4NCXA 2V0GA 1PGNA 4KKVA 1K3UB 1IB0A 1XDZA 2C2OA 2IU6A 4XM1A 3VQTA 1N3LA 4NPAA 1JFFB 1H3FA 4R16A 4GC5A 3QLTA 3R4CA 1BJRE 1SPBS 2CLHB 2O2EA 5BW6B 3PX2A 4B7CA 2B2XA 5BYKA 1UPUA 1KYWA 3HI6A 1NI4A 5PGMA 4XOUA 4G5XA 1WAMA 2XAUA 1HM5A 3IAS1 3QVUA 4EUNA 3L8MA 3JRWA 1GTVA 1VLMA 2CJXA 3JRNA 3D6JA 2I3ZA 3NM4A 4QUHA 1AKRA 1XHLA 2QM3A 2AFHA 2HXYA 1PIWA 4IDBA 5HFNA 5J4VA 4DV3B 1XYGA 1YCGA 2J3QA 3FNIA 5K4AA 4CM6A 2W6QA 3FFBA 1NTOA 4CG3A 2YXDA 2QR3A 2ZWPA 3EWSA 1L8AA 1P72A 4HUTA 2KWIA 2YHSA 4KIUA 4P34A 3H0EA 3COZA 1T9DA 5IS2A 3LQQA 1TC2A 2AXEA 2AYYA 3B7PA 4UVHA 5EJ8A 4PBTA 1KEEA 5FPHA 4GMHA 2OFWA 1OBOA 3S6JA 2VG8A 3UWMA 2J3MA 3CWQA 3QWHA 1M2WA 1P7CA 2QTVA 4URFA 3ZDAA 1K63A 4ZT7A 2PX3A 1L5GB 1KVQA 2A1TS 3CUVA 2HUPA 3O4HA 4QFMA 4YLGA 1OH6A 1V5WA 1QLWA 2XYRA 4WZBE 5E6SA 1DAKA 2AFRA 1TJ5A 1K7XB 2R97A 2V97A 4HLUC 1D6MA 2J46A 4IO1A 3L6EA 4NQZA 1QOZA 3EVBA 4AJJA 4FCTA 5KIAA 5BR4A 3IQHX 5CDFE 3VISA 4D98A 1KI1A 1QB7A 1O58A 2QXUA 1TZ2A 2XVAA 4RXTA 3GLHE 2VDKB 3T3EA 3FFAA 4UAUA 3OQHA 1HYQA 2ZWOA 1A8PA 3ZH2A 1DBSA 4JYMA 4WJZA 4GKJB