2C5LA

Structure of plc epsilon ras association domain with hras
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c5lA00
2ZRLA 3KKPA 4NDZA 2OXRA 4C0BA 2YKGA 2ZSAA 5KO2A 4OKSA 2RAPA 4C7OB 1OV4A 2DPXA 4HSEA 3TGPA 1KSFX 2ANBA 1E2IA 2QM7A 3ZH9B 1MR3F 3GLIB 2WAYA 3BB3A 1KO5A 3A1VA 4KYIB 3LX5A 4NBSA 3ND9A 3NBYC 2PBRA 4NTZA 4OJKA 3CKLA 2BDTA 3ZVLA 3L43A 1OT3A 1ONBA 3VU9A 1RRCA 1E98A 3EZ6A 5JZVA 3KUCA 2HJGA 2OUKA 3ZYCA 5AUOB 3TUJC 3IPYA 2WBLC 2FFQA 4RFSA 1XPUA 3OIUA 4G5RA 4PO9A 3KQHA 1G3QA 4IDNA 4JBWA 4DC9A 2ATXA 4FI3C 4HUQA 4Z1MA 5FPYA 3VX3A 4B74A 4L9WA 5AUPB 5TVKA 1E2LA 3TRFA 4URVR 2J59A 3ZIAA 4A2PA 2CL7X 3VHLB 1Q44A 4M21A 4XSHA 1IJFA 1Q3HA 1LNZA 3T1QA 3UMSA 5BYJA 1GNQA 4K81B 1ANKA 3AP3A 4ZCIA 2VHTA 1E9BA 1Q21A 1KY2A 1E2EA 4W5JA 4BLPA 4YQFA 1OHHA 1GIAA 3FFAA 3MWYW 1VMAA 5J47A 3OEHA 1ZRHA 621PA 3IBGA 3ND8A 4IDQA 1JXMA 4QHSA 2VP6A 5IDVA 3SJZA 1P3JA 3IO3A 3G82C 3H1TA 4GZLA 2QN6A 5EP3A 2QTHA 3S1AA 1A1VA 1XEFA 3LA6A 4FMCF 4Q1DA 3FGNA 4PO1A 5KOYA 3DHWC 2A5FA 2R9VA 2D62A 5IF9A 1S2MA 1CJTC 1YR9A 3B2EA 1FW6A 4LJYA 3QKTA 2GAOA 1Z22A 4TTRA 1MV5A 2GXQA 2XSZA 4OBEA 3GFPA 2PH1A 3TVTA 4J0QA 3AVVA 4P4SA 1W0JA 4XVQA 3WRYC 1E2QA 2AHOA 4KBGA 2OAP1 3MSXA 4F92B 1DOAA 1QZXA 3QBTA 2WSSA 4L4UA 4JS0A 2QP4A 5EP2A 2F9MA 1JAHA 2PX0A 1KI6A 1O3YA 3W6OA 2WWHA 2WKRA 3Q85A 5AJZA 1SULA 4TLDA 4YMWA 1HQYE 4BRUA 1K5DA 2RGNA 1JR3D 2P67A 2QUZA 1XEWX 2J5XA 2VHUA 3RYTC 4UXJA 1KK3A 1TQDA 1ZIOA 1H8ED 1QBKC 2HV8A 2ERXA 1UEJA 1CLUA 4GRAA 4PC1A 1E2PA 2R2AA 2ZRMA 4B6EA 3NH6A 1W4RA 4IW3B 1II0A 5CB6A 3CH4B 4WAUA 5HKKA 2C9CA 4PXAA 4F91B 4XOIA 4B2IA 3U4QA 3RWOA 1W4BA 1XNJA 2PEZA 1E9SA 5EXSA 2NZ8A 2O8CB 1FQJA 1U8ZA 3TSZA 1N0VC 1GTVA 1Z2AA 3P1JA 3KJGA 2GZDA 5H70A 4PZZA 2FEOA 3RABA 1M7BA 4IVPA 1V5WA 1PLJA 4RD3A 5JBQA 5EZ6B 4KYUA 1KI2A 3BB1A 4RSGA 1UBEA 1CF4A 2EYUA 3OIWA 1SZPA 4TTPA 4LX0A 4Q1FA 2VSXA 4V0KA 4ACBA 4DCSA 2W6JD 4CEIA 5SZKB 2XX3A 1Z0AA 1W36C 3EPKA 4NYJR 1G4AE 3P32A 2D7DA 1EFRA 4R71A 1YU9A 5CDFE 3N70A 2Q3FA 3QF7A 4LWZA 2IYLD 5DHAA 1W4AA 4MKFA 3S1AB 5LDDC 5EE1A 3TR5A 2ZI3A 1GNRA 2WWGA 2GF0A 4B75A 4TT3D 2GHIA 4XIGS 1Q20A 1NVVR 5FUXA 4PSAA 1GILA 3CW2A 3QKRB 4IXMA 3PR1A 2FF7A 2J1LA 2CK3D 4OK5A 3FHCB 3CRQA 4S35A 5UKDA 4D0GA 4AWXA 5BW8A 4NYIQ 3SDZA 3ZS9A 1SKQA 4HI0E 4MH0R 1CR0A 4EPTA 1G7TA 2R6FA 4MKGA 5B64A 3B1VA 4C2UA 4JJKA 2VO1A 1OIXA 4W9MC 2GA8A 1LF0A 4A6XA 1XD8A 4EIWA 3GLGA 1U9IC 1R0XA 3NHAA 1E9EA 2J0QA 2I4IA 3IO5A 1FNNA 1VYTA 2BOVA 3I8XA 4R7ZA 3PENA 4TLAA 1G3MA 2E9SA 3WRXC 4ZI3A 5CIQA 4Q48A 3KQNA 3KB1A 2IS4A 2QY9A 3DL0A 1X1RA 3AUXA 2EFGA 2GCOA 4JVSB 1XTJA 1JAIA 1NIJA 3TIFA 4HDQB 4EDHA 3F3YA 3MAAC 3IQWA 3K0AA 1P61B 1AN0A 4DZZA 4NZYA 2JEOA 4D80A 5A0FA 1YVDA 4M1WA 3ICQB 5C4MA 1IBRA 1N6RA 3CNLA 2IEZA 5K8LA 3K9HA 1UAAA 3TLXA 1XXHB 2AXNA 2J0UA 5A5GA 2WJVA 3QPVA 3MRSA 2QQEA 1KO1A 5TDHA 1P4SA 1R10A 4C9BA 1I2MA 3VAAA 4IRUB 1ZUHA 4LUCA 2OCPA 2FH5B 3C41J 4Q1AA 4YLGA 4BLTA 3IQXA 4DWJA 421PA 5CK5A 1DARA 4CEHB 1XBTA 3JZMA 4Q19A 1MOZA 2MSEB 1QHXA 2D74A 2IYRA 3NG1A 1T0HB 3U3KA 2GJKA 1PUIA 3CR8A 2ZRHA 2W0MA 2SHKA 4IVRA 4M1KA 4HB2A 1TNDA 3C16C 5EXTA 4RKEA 4OQLA 3W5JA 4DLZA 2VEDA 4OI2A 4XTCS 2QGNA 1CBUA 2CCJA 2RB4A 3NTUA 2ZAOA 2CE7A 1E2NA 3QUSA 4BFYA 4FMBB 2OLKA 4U7DA 5F9FA 4B35A 4BPBA 1CKEA 1JR3A 2FPLA 2ODEA 2JJ2D 2I1VB 2ODWA 1P9NA 1JALA 4CT5A 2VLIA 4S2EA 2O8FA 1E4VA 1H8EA 4ZDJA 3ZVRA 1R5NA 5SZIA 2ZM5A 3ZVMA 2EU8A 1SQ5A 4M1SA 1QG2A 4OHXA 2WOOA 1N0UA 2WIAA 4QRHA 3IUYA 3L0IB 1JQLB 4TWZA 5DSZA 4PC7A 4YMTA 5JJIA 3BB4A 5HE8A 1IN5A 4RD0A 1SKYE 4AKEA 2QPOA 1U98A 5CB8A 4QHTA 3GMTA 4CZ2A 1TQ2A 3W3ZB 2NPFA 1TEVA 2IF0A 4IOJA 5J4HA 1Q1QA 1Q1BA 3CNOA 4FWIB 2QSYA 1DPFA 1VYVA 3CRMA 5LD2B 4B44A 4TL8A 2R6DA 3LQQA 1FZQA 2VPPA 2GJ8A 2ZI5A 1KOFA 3AF3A 1G5TA 2JASA 2AXPA 2GCOB 4EUNA 2BC9A 2W2VA 1WBDA 1E96A 2CHQA 3IIKA 2VBCA 2W6JA 4MYHA 1SVWA 4FXPA 4LHYA 3A8TA 4UNQA 4TSFD 3P27A 2OEPA 4IFEA 2IUUA 3DM5A 2KB0A 4OL0A 4N1AA 1DAHA 4QJ4A 1N0WA 2QG6A 4JLNA 2H16A 2J0UB 2ZRGA 1G64A 1X1SA 1RYHA 1HV8A 5FPTA 4TT3A 3WYFA 2CCKA 4ESHA 4AKIA 2O8DB 4ZIRA 2IS6A 4OHZA 2QT0A 2QAGA 3CO5A 4FN5A 2QBYB 4HB0A 1MH1A 2F9LA 4TMVA 1XEXB 2CK3A 4N3NA 5DH9A 5HE9A 2WJJA 1ZC4A 4LSGA 5EE3A 5C18A 1KTVA 4PR0A 2WHXA 4MDEA 1HH4A 1WDTA 4FIDA 1G17A 1KK2A 1RJ9A 3THWA 4JMPA 1W4CA 4I99A 4AYXA 1ZM7A 1KSGA 3WBJA 4RD4A 3ZS8A 1H8HD 1H65A 1KMHA 3LRPA 1GFIA 3LQRA 4BLRA 3KKMA 3KTAA 5FH9A 4KXFB 1GVNB 1S4QA 4DJTA 5DGXA 1XJQA 1MO3A 1Z0DA 3TUIC 1NMZA 4GOJA 2WKQA 4Y0AA 1OB2A 3AF0A 3GLFB 2O8FB 1OXTA 3RRYA 4UNPA 2RGNC 3AKCA 1AZTA 3CPJB 4FMDF 4IDHA 2XB4A 4F93B 3GPLA 4MGZR 1SXJB 4DLVA 1EESA 1L2TA 4LI0A 4NCJA 3GJ3A 3O8BA 3K9NA 4Z54A 2W83A 1XF9A 1GRRA 1YKSA 1P9WA 1DO2A 2V8OA 1I4TD 3ZVNA 5FUVA 3B85A 3EG5A 2QM8A 4CGZA 2DB3A 3PJRA 5FTNA 3A4LA 2XJ9A 1G7RA 1GG2A 4DT1A 1QHHB 3MJHA 2A3RA 3WNCA 1F5NA 3DVLA 2QMHA 1GNPA 1RRFA 4YMVA 4L5BA 2FX3A 2HCJB 2H17A 2JLUA 3U44A 4G5OA 3BGWA 2FU5C 4LRWA 3TE6A 1KHTA 2ZRAA 2BV3A 4Q1EA 1DAMA 4F4JA 2PZGA 5BXQC 4MGIR 3PITA 1EK0A 1RFLA 3C14C 3FWYA 1R2QA 2IF2A 4OJQA 3UG6A 2EW1A 1Z0FA 1G3IA 2QQ0A 3TW8B 2C2HA 2QMEA 3SN6A 1CXZA 3LVQE 3Q7QA 4DCTA 4Q4JA 2G0TA 3THXB 1E32A 2Z4SA 2D2FA 1NN3A 3CX7A 1P2UA 2ZITA 4TYNA 4MKHA 4MRRA 1ODFA 2AFHE 5EUQB 3K8YA 3AF1A 4M9XA 4D6PA 1CP2A 3CRVA 2D2EA 4W5WA 1ZCAA 4R2HA 5DN6D 2JJ2A 5FOTA 2X1VA 4TN1A 3KJIA 3X1YA 5L8VA 3SJAA 4QG7A 4DIEA 2EFEB 2BJVA 1CRQA 2REXB 1RRPA 2OESA 3K1JA 3DM9B 1G3UA 2ORIA 2C5LA 4A0GA 4HDOB 221PA 2ZSFA 4C0LA 4A4DA 4F7WA 3PEYA 1AS0A 3K70B 2C9YA 3THYB 4Q01A 5EP1A 3FKSD 2V55B 4LHZA 5E7MA 1DTSA 1K6MA 1RJ9B 3CR7A 1CULC 4JZKA 1GP2A 4GOKA 1IM2A 4A0RA 3HU1A 3A4MA 3CPHA 2CXXA 2ZS8A 4TL7A 2ERYA 4EJSA 2OCYC 3ECCA 4YDHB 2GJSA 2DWQA 2WIBA 1U0JA 1PLLA 1BOFA 1W44A 1FUUA 2GVDC 4AI6A 3TKLA 2Z4RA 1Z28A 2B92A 4JVMA 1Z63A 3KX2A 1R8SA 2IWHA 1S1CA 3K0FA 1T8TA 4EQ6B 4QNMA 3L0OA 3BD9A 4A82A 1U99A 3QIAA 4TYQA 2BBSA 4XWAA 2RH5A 3BERA 4Q03A 1TU4A 1LVGA 1KI9A 2V4ZA 4I1VA 3I62A 4HUTA 3TW4A 3A1WA 4LC0A 1N6HA 1X8JA 3CBQA 1UPTA 4TSFA 4DLSA 1Z6AA 3NBZC 4D0NA 3SHWA 4Q4HA 4R98A 3R8CA 3TQFA 1II8B 1U9IA 3RS2A 2OSBA 2Q21A 1Z06A 3MWJA 1JEDA 1VPLA 1G41A 2PL3A 3C15C 1YZQA 1T8UA 2NO9A 1N6LA 1Z6XA 4LV5B 2BKUA 4P31A 5BN3A 1N5KA 2V6JA 1UBCA 1U90A 1D6JA 2WAXA 3T34A 1OXXK 2PLRA 2VP5A 4C0SA 4QNRA 3QNUA 5KUTA 1DAGA 5FBWB 2QI9C 2VHCA 4NYMR 5FI1B 2IHYA 2XXAA 2FMXA 2OAQ1 2ORWA 4QC2A 1EFCA 4WZAE 1JR6A 3LDAA 4A0HA 3ZJYA 4KHZA 4A6PA 2J7PD 2FG5A 3EPLA 3WYAA 1JB1A 3FVQA 4Q4JB 1GRNA 1NY5A 4CT4B 2YC4C 2ZROA 4C0KA 4EFNA 4LYJA 2AD1A 3NEJA 3EZ2A 2E1RA 1H8HA 2F43A 2VP2A 3Q3JB 1VDZA 3SNHA 4JLMA 2UZ3A 1IN8A 2NZJA 5HZKA 3K0CC 1D9ZA 5BWMA 2PX3A 1QVAA 2J9RA 4MGKR 5JHGB 2WOJA 3Q5EA 2HEIA 5AUNB 4AC9A 2WMNB 4HATA 3T15A 3SBEA 1XFAA 4F4CA 1FPMA 1D2MA 3WBKA 1IXSB 1E3MA 2BKEA 1W36B 1GKYA 1ESMA 4RZ3A 1P75A 3LH5A 1KDRA 1KMQA 1P2TA 2IL1A 2RCNA 4PPQA 3KXLA 4PTLA 4URWR 2IYWA 3P4YA 1L4UA 2BBWA 5KNBA 1VG8A 1KAGA 2CVFA 3AM1A 5L3QA 4JL8A 2E87A 4ABYA 2AWOA 1DG1G 1E2JA 1S9HA 1NN5A 2ZE8A 3RS7A 1L7VC 4A8JB 5EJEA 2EYQA 4O25A 1FTNA 4QGAA 2OCAA 5EXPA 1AGPA 3NHBA 4LHXA 3TJZA 3WHLA 4BEJA 1JECA 3IIJA 4MYUA 5KHOC 3ADBA 3W6NA 4HB4A 1UADA 2HDNB 4L8GA 4D82A 2QEQA 3SJCA 2JLXA 4IFBA 2OT3B 4MRSA 2I1QA 2X2EA 1M6NA 2L0XA 2HXSA 4WA7A 3UXMA 5DYIA 4XTRA 4RD2A 3W3AA 3QEOA 4JT4A 4Q4HB 2ZRJA 1QHIA 1OF1A 1XTRA 2H57A 1E1RD 4OI1A 1GZSA 3DPUA 2G0NA 4B3CA 1Y3AA 4BZQA 2ONJA 2D3WA 3TSOA 1X6VA 2XNSA 4G5QA 4KAXA 5EZ5A 5DN6A 3BS4A 2GJAA 1ZD8A 3K9GA 5CM8B 4ZKEA 3MUFA 1Q12A 1YZLA 3QVVA 4LBYA 4PAOA 1LS1A 2BMDA 1ZU5A 3TH5A 5CYPA 2ZYVX 5JI3E 3QE0A 2Q6TA 3TAUA 1FX0A 2ZJYA 5CYOA 2FFHA 1W1WA 5KDOA 2AFIE 4BFXA 1CR4A 2QAGC 1R7RA 4ZO4A 1T5IA 4EPYA 1F48A 4ERNA 4BQSA 2ZR9A 2XXAB 5DNYB 2CJWA 3FKSA 2P2LA 1TQ4A 3GLIE 4WZ6A 5CDFA 1G5RA 1OSNA 3AGPA 3SEAA 5C46F 1XTQA 1QRAA 3DZDA 5B30A 3VFDA 1R8QA 4BASA 2G3YA 4JLDA 4LK2A 3EA5A 4ON9A 2CNWD 1C4OA 4B48A 1W46A 1C1YA 2KWIA 4US1R 3KDSE 1G7CA 1Z6TA 2FEMA 2D7CA 3CH5A 1XB2A 4Q02A 3OE7D 1U8AA 2O8BA 2W00A 2B21A 2V54A 3HU3A 4IEIA 4AIIA 5KPJA 4LJ4A 4EPXA 4JT2A 1RC8A 4C2TA 2C03A 2ZE7A 3MJRA 1Z6GA 1RKBA 1LV7A 1ZP6A 3KJHA 1TU3A 3LBNA 4C3ZA 3GP8A 4TL6A 1KKLA 2VRWA 3VMFA 4KBFA 3VTKA 3HR7A 4URYR 3C8UA 4Q4LA 1TADA 1NMXA 4HLUC 2QT1A 2ZR0A 1NLYA 1VTKA 3EWAA 5B57C 1TMKA 2IXFA 3PCRB 2XZOA 3UPUA 3GEEA 4ZPXA 1TTTA 1IN4A 2G1JA 5FR2A 3Q8XB 2ZANA 3TAHA 4BFVA 1E2GA 1MO5A 1Z07A 4PFSA 4Q66C 1FQKA 3LBIA 4CEJB 3TVDA 3EA0A 3KKNA 4B2PA 4LBZA 3PEUA 4LY6A 1KDOA 4CYMA 1CTQA 1N2CE 3TK1A 1NIPA 1CU1A 2RGXA 1FMJA 4M1YA 5CK4A 4HLDA 1VG0B 3IGFA 2K5UA 3RDPA 3SYLA 1CJMA 3H86A 4Y0VA 1P62B 4A2QA 4X8MA 4TLEA 5JEDA 2IXEA 4IKEA 2H8KA 3B5JA 3GJXC 3EZ9A 3U3MA 4M1TA 5HTKA 2AK3A 2J7PA 2UZIR 5AK0A 3BH6A 2IUTA 2GF9A 2V7QD 5JCZA 3LW8A 2ZRDA 3KB2A 1LW7A 3OFND 4Q7JB 3VU9B 2CE2X 3R7WA 1RIFA 1ZM4A 2BHRA 3AKDA 3QJYA 4I1UA 4NYJQ 4M8NE 3UATA 5AJVB 1R6BX 3EIQA 1NBME 3RS0A 1ZYUA 2CBZA 5H68A 2G9NA 4UXIA 4RFSB 1GKUB 2GEDA 3SZRA 4HUQB 1E99A 2HF8A 1MO6A 4JKYA 4M1MA 4DLYA 1BYIA 4QGHA 2BBOA 4JLBA 4DVGA 2JAQA 1BS1A 1NVVQ 2XTNA 5JJKA 1Z8FA 2LWIA 4PQRA 5TY0A 2ZVPX 1KO4A 3MG9A 3CB4A 4URZR 4QXAA 1CJUC 3QI2A 5GJCA 2Z6VA 4LV6A 4TQ9A 5AJWA 3RANA 4AD8A 1NSTA 3PUVA 4BLSA 1IJEA 3AGQA 3I1FA 4L16A 1G8PA 1O87A 1OPXA 2OFOA 4PHFA 3BFKA 2GEVA 3A37A 4UJ3A 4G1UC 4KFUA 3AKYA 3ONWA 3P26A 4V02A 4X8HA 4KVGA 3O8RA 1QF9A 1CJKC 2IXGA 1YZUA 1NKSA 1X3SA 2FJUA 4EJSC 1R0ZA 3B1YA 3W6PA 2QAJA 1E9AA 1HUQA 4B3DA 2DFKB 3VKWA 1KI4A 1P60A 3REFA 4II7A 4RD6A 4DCUA 1VHLA 1JBKA 1M34E 2AKYA 1XD2A 2GZAA 4D4JA 1IXRC 1E0KA 521PA 4P4SB 3VNUA 1YR8A 3KQLA 1E2HA 1E1RA 3FTQA 1IY1A 4BFWA 4DLTA 4M9SA 1OYWA 2CLCX 1XP8A 4Q1BA 4DUGD 3QKSA 2J7KA 2G83A 2GCPA 3IEUA 1OE0A 1KI6B 5KYKA 4O2LA 4LYAA 2IYTA 5L3SA 2PJZA 1Z0JA 2NQ2C 4F4IA 4OQFA 4E07A 2GCNA 2D06A 4HAUA 4GI7A 1W47A 4NU0A 2ZE6A 2GBLC 5JS8A 1KDPA 3U2QA 1SVOA 4CIDA 1I2DA 4A15A 1KK0A 4FCVA 1PV4A 1S3GA 2V3CC 1XTSA 2JATA 2J0SA 1ELOA 2GESA 2NIPA 3LY5A 2NG1A 3X2SA 3A4NA 4CW7A 4GP6A 1QHGA 2X8AA 3HJNA 1EX7A 1NRJB 1F3OA 1GRQA 1IY2A 4Q9IA 1WE2A 1Z83A 3EZ7A 3B1XA 2WWIA 4WBSA 1IXZA 2CNWA 4Z8XA 4Q9LA 3LBHA 3GFOA 2FPMA 4ARZA 1UKZA 4NHOA 4RJLA 2O0JA 1XTIA 4WZBE 3NC0C 3U4QB 1SHKA 3GLHA 2FZ4A 3UANA 5B58C 3OE7A 3RAPR 4DRZA 1HEIA 4LZZA 1XD9A 1QDEA 5JCPA 3X1WA 4NYIR 2P3SA 2HT6A 4GOXA 3K0SA 3R8FA 3PUXA 3L2OB 2QTFA 4MYCA 5KSYA 1EFTA 4PSVA 4MGYR 2WJIA 4QKQA 4B43A 1UFQA 1N6NA 4BFSA 121PA 2ZJ2A 2EWVA 4TL9A 3U7EB 5J40A 3EARA 5DHFA 4HAYA 2IWRA 3VHXA 2VSFA 3MGCA 1Y63A 2RGEA 1G8FA 1JNYA 2AR7A 4BUJA 4CEIB 1ZMXA 2A5GA 2YWEA 3QXCA 4PHGA 3NWJA 2V6IA 3AVTA 3OHMA 1UKYA 1SHZA 2P5SA 2LKCA 2RGDA 3TNFA 2F3TA 3K0CA 4B3FX 4D0LB 1T9HA 2EQBA 1XXHE 1A5TA 5C2JB 5LB4A 3IEVA 2FV8A 3T12A 1G1MA 1MABA 5CIWA 1AKEA 3DOFA 3NC1C 3N2EA 2IS2A 1B23P 3X1XA 1G16A 4O2RA 4KV9A 1IN6A 1FUKA 4NKRA 2VF8A 2WMOB 5IHPA 1DADA 1SKYB 2QMOA 3AKEA 3NH9A 5FBRB 2GTPA 4ZDWA 5KSOA 4H9GA 4D25A 3FPAA 1OYYA 4DLWA 2ZUDA 4KO8A 2V7QA 5KNCA 5E4FA 3QENA 3OFNA 5F3WB 1EWQA 3I92A 2BM0A 4AYWA 4DLXA 1XJCA 3SYKA 3GLGB 1NN1A 4DB4A 2G6BA 3C7KA 4AK9A 1G291 5L3SB 2O5VA 4DIDA 5FTLA 4K46A 1CR2A 1SVMA 1XCPA 4RKFA 1KKMA 1IN7A 3QKUA 4LHVA 4RZ2A 1KNQA 1E9DA 3WY9A 4QBFA 1Z3IX 2GEUA 4Q4AA 5FR1A 2B7BA 4Q7KA 3TQCA 2A5DA 5J4VA 2IS1A 1J7KA 1XX6A 2XTMA 4JLKA 3D8BA 4MKIA 2GDJA 3QF4A 1IONA 2BBTA 1DAFA 5AR1A 1XWIA 4EPRA 1OB5A 2UKDA 3EC2A 1FMLA 3K0AB 4NE2A 3MFYA 2W2XA 4PSKA 2WM9B 4V0ME 3FMFA 2J41A 5DI9A 5JS7A 2DR3A 2RKOA 2YHSA 4KFSA 1KZ7B 3T1OA 2DCUA 1US8A 4XD7D 1T5LA 3GLHB 3QXJA 2XB2A 2OZEA 3M4YA 4YDSA 3HYRA 3RC3A 4B32A 1L4YA 1FTSA 4DBLC 1PUJA 2R8RA 4D4KA 3AF4A 2OILA 1NVXQ 3J81k 3A1TA 4HLCA 4TLCA 3B1ZA 1G8YA 5KPDA 3SJBA 1E4YA 2YNMA 1N25A 1P5ZB 1ZD1A 1OXSC 4IJMA 1P9RA 2FDCA 2QENA 3PFIA 1CIPA 3EIHA 5DI3A 1J2JA 3BK7A 1YRBA 4OK3A 4DDUA 3IHLA 3W8NA 2JLZA 4DUGA 4CDGA 3RS4A 5K8TA 2W6ID 2RGGA 4HZUA 1RW4A 2DFNA 2BEKA 2CLSA 3RVBA 3EWSA 2QP3A 1XCMA 2V1XA 2P6RA 2VTKA 3PV0A 3EC1A 1IHUA 2BVNA 1ZJ6A 1ZINA 1FL9A 3H84A 3VR3A 1NLFA 3AB3A 1ZM2A 4U02A 3SFZA 3ADCA 4EFMA 5GVSA 2VIIA 4GMXA 4KSBA 3U3JA 1NJGA 4KFRA 4PZLA 2V1UA 5JLJA 3EXAA 4HLUA 1FP7A 5BQ5A 2OBLA 3I61A 3PEVA 4WVFA 1KAOA 4QFMA 1VCIA 3FHOA 4V0LA 4JLOA 3C5HA 3BC1A 3TBKA 4H1UA 4I4LA 4HDCA 5BN4A 2REOA 2Q9BA 1W7AA 3QY0A 4JLPA 5FOUA 3H4MA 1KY3A 2IYSA 1YQTA 4JLAA 5GVRA 1MT0A 5CJPA 4BEBA 1DG3A 1NN0A 2C99A 2KJQA 3PXGA 4B76A 4LYFA 2CEAA 1JR3E 1II9A 3W5IA 3SBDA 4DSTA 1E2MA 2NOAA 2HLDD 3FFBA 1PJRA 3K9LA 3L82B 4LGMA 4MDFA 1HE1C 4OK6A 3W90A 3GLFE 4FWTA 5JJLA 2BM1A 2ZYWX 4M2LA 1J90A 1HT2E 2HYDA 3QG5A 1LFDB 5JSZA 1D5CA 2HCBA 1AIPA 1SXJE 1OJLA 2FGJA 2NTYC 4GFDA 2HYIC 2ZRFA 1E2DA 1Z6YA 5EQTA 4GSYA 4R9UC 1P2SA 3CUEF 4AG6A 4EPWA 4BGDA 4TZ0A 1NBMD 2Y8EA 1A4RA 2F6RA 3A58B 2V9PA 2F55A 4UJ5A 3IHWA 1VIAA 2EFHB 4PHTA 2R6GA 2FSFA 3FMOB 3I3SR 3I5YA 1T3SA 4C0QC 2G77B 4MQBA 3OESA 2DHRA 5FTJA 2ZUCA 4Q47A 1KI8A 4BFTA 3T06B 1YE8A 3BFVA 4ZIRB 3RRNA 1KYIA 4P0TA 2QAGB 2NO6A 1M2OB 2C8VA 4GMDA 4TZ6A 2F1IA 4NONA 3I73A 1GKIA 5L3VA 3BFXA 2ZSDA 3UMFA 1OXVA 3HPQA 2J87A 1C9KA 2JJ1D 4LV8B 3NKVA 4UXHA 4NCNA 3F8TA 5KDDA 1F6BA 4XVUA 2ZPTX 3CNNA 3CX8A 2XOKD 1AS2A 4PPNA 3B82A 4JL6A 3U60B 3THWB 4A2WA 5JWHA 1D9XA 5FPKA 4IDPA 2RHDA 5DE3A 1XJ0A 3QVUA 3U7FB 2NPIA 1F2TA 3NBFA 4U5XA 3GJ4A 3VR4A 1F2UA 2IA5A 1KMHB 2ASEA 4QJ5A 2GK7A 4LPSA 3KTAB 2W58A 1N6IA 1UDWA 2O52A 4ZDIA 1EFHA 2CHGA 1S0UA 3TMKA 1YRAA 4POAA 2ECKA 2VSOA 3SS8A 2WWFA 3KUDA 1R0YA 5D3MA 4Z51A 4CF7A 3GD7A 5EP4A 3A36A 4D26A 3U7GA 2QNRA 3B78A 1ZM3A 3QBVA 2ZJOA 1Z5ZA 5ANRB 2F7SA 5FBLB 2GXAA 2ODBA 2IEYA 2H92A 2C9OA 1T4GA 1E94E 1ZU4A 3R9WA 2FPKA 3W8RA 4I1SA 4XD7A 3U6KA 3HDTA 3REGA 3EAQA 2YOGA 1G8HA 1D2EA 1W2HA 1T0JB 1R5OA 4DT1B 3I4LA 3FDIA 2QZ4A 1WXQA 1D2NA 2YJTD 3MD0A 4PC2A 3AVPA 2GBLA 4D4LA 4C7OA 1K5GA 3HPRA 3JZAA 3AVWA 2OBNA 3O8DA 3U44B 2GILA 2VF7A 1JI0A 5D3QA 3GLIA 4IDOA 2YZ2A 4HAWA 2H18A 1UBGA 3O47A 4LYHA 1Q1ZA 5HR5A 3D31A 1CRPA 1TL7C 3BAFA 3WP1B 1DELA 4GP7A 2JLRA 1OKKD 4M1OA 2WVJA 1EGAA 2W6IA 2A30A 4MRVA 5K8UA 2Z5FA 3EW9A 3ASZA 1XCGB 3AVUA 2QL6A 1CS4C 4TMWA 3N2IA 1KO8A 2QRZA 4RCYA 2ZJ8A 4XWKA 3GJ5A 4IEEA 4WXRA 2OM2A 3RS5A 1XU4A 1RVDA 2IX3A 3WMFA 4DXAA 3KJEA 2GWHA 3E70C 4LJ7A 4QGGA 2FFBA 5FPSA 1E9RA 2GXSA 5EE5B 2ZRNA 5JRJA 5M04A 1KIMA 1UKEA 1WA5A 2ZRCA 3R20A 5E7IA 1S8FA 3VR1A 3B9PA 1ZBDA 4E03A 4MRPA 3QQ5A 1EFUA 4BWYA 2VA8A 3KFVA 4JIMA 5CITA 2QE7D 3MWLA 3X1ZA 1YZTA 3WP0A 2CHVA 2QP9X 4AKGA 4V03A 3D3QA 3VKGA 1VECA 1F2TB 4GT1A 4EJSB 4B33A 1TAGA 4ZKDA 1OFHA 1XRJA 4QBIA 2VP0A 5FL3A 1AGRA 5P21A 2HLDA 3K0FB 3SQWA 2IHBA 5HPYB 4D4MA 2Q0HA 2Z83A 5LB2A 1UKVY 3L8ZA 3UKDA 3EX7C 2OFXA 5TV2A 1OFTA 2WWWA 2GXUA 3WXMA 3CF2A 4PAQA 1YR7A 4V0NA 3NIBA 1NBMA 1U94A 4WXPA 2C95A 2CDNA 1YZGA 1E0AA 4NCIA 2FFAA 1ZAKA 4DLUA 2JLWA 1M7GA 2QPTA 2F3RA 1NY6A 4BLOA 2WTUA 1N5IA 1DE0A 3QEJA 2ZRBA 4AY2A 2NO1A 3T1TA 3IIMA 1CJVC 3AV0B 3ETLA 5B2ZA 2NGRA 4FW9A 3CPEA 4YMUA 1GSIA 2OCBA 2VP4A 2ZTSA 3LLUA 1I4LD 4DEYA 1DAIA 3B6EA 4FCWA 4D81A 3VNVA 3DZ8A 4W7SA 2ZRIA 4H1VA 5CLLA 5BYKA 3G5UA 5KNDA 4GDFA 5FOXA 2ZS9A 1TQ6A 4DSNA 3ZGXA 5GADl 2JJ1A 2WJGA 1UF9A 4E5UA 4RVCA 4GBMA 2XOKA 4OI4A 4EPVA 2O8CA 1XZPA 1JPJA 5JECA 5DISB 4KU4A 1QG4A 1A7JA 3FYHA 4JJZA 5FTMA 2F43B 1N5JA 3FMPB 1U0HC 4JYBA 4IHQA 2RGCA 3HYTA 3T5GA 1EWRA 2MMGA 3R9XA 1P2VA 4PANA 4OI0A 1ZM9A 1LY1A 5J5CA 2CL6X 4PZYA 1KZGB 2EFDB 4M22A 2FSGA 4PX9A 2NMVA 3TUZC 1HT1E 3B13B 3ZZUA 1Z0IA 3LLMA 3SQXA 4GPTA 4OQNA 5G40A 4BECA 1ZIPA 2B6HA 3P4XA 2VP9A 3LXXA 1HE8B 3JVVA 3KFXA 3L0PA 4NP6A 4TMXA 1ZNZA 1DAKA 3K70C 2JCSA 3HWSA 2OG2A 4KI0A 2CL0X 3IILA 2H1LA 1TX4B 4KITB 4LJ5A 1M74A 1P6XA 4LJ9A 3RNLA 3GJ0A 1OH7A 4A36A 1DVRA 1BMFD 1KJYA 4DCNA 5EXXA 2ZVQX 4JBXA 3RHFA 1P7CA 2VHJA 4OYHA 2AL7A 4JVLA 3AQ4A 1VCNA 1HTWA 4B73A 2A2ZA 3QKRA 5L3QB 4FINA 2IYVA 5FI0B 2YVUA 1W2GA 1W49A 1XMJA 2VH5R 1HURA 4TMKA 2C77A 2QGZA 2ZE5A 1GOTA 1LTQA 3THOA 4KLZA 3U5ZB 1NLZA 2H5EA 4HAZA 2EVWX 1OKKA 3PQCA 2ZYUX 5DIFA 2QRNA 4WW0A 2ANCA 2FE4A 2RGAA 4BE7B 4FMDB 3ZQJA 2BJWA 3A1UA 4C0AC 4JYCA 2N42A 2QMUA 3V9PA 4EFLA 1XDBA 5DLQC 2WPDD 3FMIA 1YHNA 3NVAA 4JSTA 2J46A 2ZRKA 2Q9CA 2YWFA 2B8TA 3LWNA 1P73A 4ACAA 2R6CA 4ITRC 2XGJA 3KZ1E 1SVLA 1NNEA 1WCV1 3I32A 4FD2A 2YWHA 1SXJD 1XMSA 2AKAB 3CWQA 3SHFA 1FX0B 1OW3B 4UNNA 2JGNA 1DEKA 3HR8A 1ZUIA 2XNDD 1TF5A 1HYQA 1G19A 5AJYA 2BMFA 1G6HA 2P6NA 1G7SA 1NG1A 2CJWB 2FZLA 4V0OA 5FPHA 4PAMA 2QE7A 2PJRA 2DBYA 3NXSA 4HB3A 1G6OA 1NVWQ 1XXHA 3SOPA 1N6PA 4N0EA 4Q21A 3FB4A 3H2YA 3LFUA 4LPKA 3PUZA 3U7HB 1R5BA 721PA 1ESNA 3VR5A 3EPJA 3VKHA 1SVSA 1Z08A 5AWFC 2B7CA 4ZI2A 4CEHA 3G0HA 4PQYA 2O8BB 3K09C 1NF3A 2C78A 3SFVA 3AUYA 2RGBA 1YZKA 4X8OA 4BZXA 3VR2A 5JWOA 2YINC 3B9QA 4M9QA 4L15A 1VHTA 1R0WA 2BCJQ 3D7MA 4KCGA 4RFVA 5EUMA 1UDXA 4LC1A 5JWRA 3ASYA 5GJBA 3U61B 5CLQA 3SYNA 5GJWC 2DWPA 1D8TA 3LW7A 1XZQA 1Z29A 4EAQA 1GL7A 3F5FA 2R6AA 2ZYTX 2FN4A 4PHHA 4NCHA 3SU8A 3ZD6A 4YC7A 2G88A 3PVSA 2ZEJA 5GJVC 4C30A 4BFZA 2O0HA 1EXMA 3EZFA 2J3EA 2ZJZA 3QXXA 1TUIA 4PPGA 4IOKA 4TYPA 4A8JC 4B6FA 1XTKA 1OH8A 1XEWY 3MCAA 3IKJA 1TUEA 3OZXA 4DDWA 2ZAMA 4MYTA 3V4FA 1X86B 1BH2A 1KGDA 4Q9KA 3I8SA 3IDQA 4G01B 3K70D 1OLOA 4V0MA 1XPRA 5SZJA 4URUR 3NDPA 4OQMA 1G21E 5EE0A 4UNSA 4QM6A 4PC3A 1ZD9A 2EWWA 3QOFA 1WMSA 1UJ2A 5FL7D 1FP6A 1QHSA 2DWOA 4Q7MB 3MMPA 4XWOA 3V4RA 2N1BA 5E3HA 3OIYA 5KTYA 5F98A 1ZCBA 2ZJBA 1GUAA 1XMIA 1SVKA 3LV8A 3R7WB 4A9AA 1NKTA 3UG7A 1E2FA 1G18A 1LS6A 4UQOA 4P33A 5FUYA 2ZETA 1G20E 3BORA 3CONA 3CZQA 3K53A 2BIFA 1AS3A 3DDCA 2OE2A 3EASA 4OHVA 3RSLA 4ZV4A 1Z47A 1T3LA 2PT5A 3Q9LA 1ZNWA 2ZIAA 1OH5A 4M9ZA 1ZVQA 1T91A 5LBIA 1ZW6A 4Q5IA 4E09A 2QPAA 1J99A 2WWXA 2A9KA 1EG7A 1RE0A 3LAWA 1HY3A 4HZIA 3ICEA 1E9CA 1OFUX 1BMFA 3KXIA 1NMYA 3U6BA 4I1OA 3RC8A 2PMKA 3BRWD 4G0NA 4NPHA 3IPXA 1Q3TA 1SGWA 1NP6A 1BO6A 2O8DA 1TF2A 1UEIA 5HZHA 4YMSA 1NVUQ 2QBYA 5KSZA 2WSMA 4ZDKA 1KI1A 1XEXA 1L8QA 1KNXA 4Q1CA 3NEYA 2BMEA 3RSOA 1J8YF 2X77A 4B3GA 1M7HA 1TPZA 3ZLJA 1JXOA 4Z8YA 1AM4D 3DKPA 3WNDA 2GNOA 1X8KA 3SI7A 4HAXA 1J8MF 3KQUA 2ZI4A 1IY0A 4DSUA 2YOFA 4X8LA 2X2FA 5G41A 5FBVB 1E2KA 2IBMA 4GNKA 3BH0A 4MUBA 4NMMA 4CVNA 1KJWA 1DS6A 4RY2A 4WIAA 1W5SA 1XD2B 2QROA 4PC6A 1NSFA 2QU8A 1W0KD 2TMKA 1FFHA 2ZXUA 1VCOA 2X19A 1N6KA 1S9DA 3PG5A 2GAAA 5K8IA 3M1IA 2HUPA 2WPDA 4OHYA 1OXUA 2IYYA 2ODNA 2JLSA 1BIFA 3QKSB 5JMTA 4BLQA 1Q22A 4B47A 3ZQ6A 4IOMA 2YC2C 3DKVA 4BRWA 3GLFA 1OIVA 2ZJ5A 4A0FA 2DY1A 2VYFA 3DO6A 4P32A 4TTQA 5CM9C 5AUQA 4KFTA 1Z2CA 2J0VA 1SXJA 3PIRA 1VG1A 3OIVA 1G9XA 3Q5DA 1Z0KA 3FKQA 1W36D 4LDJA 2XNDA 1S3SA 2WV9A 1E1QD 1N6OA 2QA5A 1PVOA 2O0KA 3GEHA 4M53A 1COWD 2C98A 5J4KA 3OAAD 5IK2D 4XJXA 2QORA 2FSIA 1DBSA 1QHHA 1RRGA 2PCJA 2ZU0C 1KDTA 2WJYA 3M0EA 5L3RA 4ZCLA 3VX4A 4LCBA 5DO9A 3WMEA 4ARZB 3T61A 5G3YA 3CWZA 4QOSA 5IT5A 4EKDA 1S96A 3C4JA 4A1FA 1J70A 4TQAA 3GLGE 1S1MA 4P4UA 2R62A 2PEYA 2ORVA 1CR1A 4AYTA 2PMDA 3UWOA 1U0LA 3GQBA 5KSPA 3WNBA 3F0TA 3KQKA 2KE5A 3BBPA 2ZU6A 5H1YA 1G5PA 2GVZC 2C96A 1WBBA 1Q0UA 2OO7A 1XPOA 3GFTA 3THXA 2DYKA 2VHQA 2Q9AA 2Z43A 2P0EA 2BMJA 4JKIA 4OHWA 5C4GB 4JBYA 2JA1A 1JJVA 5FOVA 2MMCA 1QHYA 2IW3A 5TB5A 4TYWA 2PZEA 2W2TA 4YXWD 3TR0A 4RD1A 4MA4A 3TSWA 1YJ5A 4P4TA 4KSCA 4MITA 2Q3HA 5HCNA 3BXZA 5LPNA 1AJEA 1G4UR 2JLQA 3BJIC 5SZHB 2PT7A 1Q1EA 5JRZA 5F9HA 3LX8A 4DB2A 3VR6A 3W9YA 2DFLA 3GLHE 1BYUA 5J4YA 1VYUA 2CVHA 3CZPA 3AF2A 3UWKA 1MABB 4LJ8A 5FOWA 2IC5A 1T6NA 2KI5A 1ETUA 5IRCD 1X8LA 1JEEA 4FMCB 2D4HA 2JIZD 2ZI9A 4JL5A 1PLKA 2R65A 2ZI6A 2KBFA 1KSJA 1QVRA 3HU2A 1OIWA 4GZMA 3THYA 4TYYA 4A92A 1WP9A 3UIEA 1NJFA 3U3RA 4C0JA 3HP1A 4Q00A 1A2BA 2XZLA 2ZS7A 5FL7A 3UK6A 4DHEA 4ASUD 2AX4A 2GKSA 4O0MA 3T35A 2JDID 2UVQA 2XEXA 3WMGA 1EX6A 3GJ8A 4K8OA 2FGKA 4HLQB 3DOEA 4QBGB 3KKQA 4N0DA 2ZI7A 2F1RA 2GJ9A 3GCGA 3V00A 2GK6A 2W0SA 3I72A 3CM0A 4ILEA 3K0EA 4MUAA 4EQ6A 2OFWA 1E0JA 4IOLA 3NDBB 1AK2A 4U00A 2F1HA 5G3ZA 4LHWA 1VG9B 2OHFA 1E79D 5FFMA 1SVIA 2BWJA 1U2RA 2AD5A 3PEWA 1E69A 4HAVA 1E0SA 3EIEA 1KI3A 4Q4AB 5HCIA 4W5HA 4M4SA 3EPHA 2J45A 3H0KA 4KVAA 1II8A 3QF4B 2OXCA 1AQUA 1KO7A 3OEED 4TMZA 2HJVA 5ELXA 4QGFA 4DCVA 4Q9JA 5J4LA 5DYGA 1YR6A 3E1SA 3UMRA 2ZJAA 4RZUA 3LXRA 4Q18A 2FOLA 2BEJA 1GWNA 1FOEB 1G3RA 1QHNA 4US0R 1RPZA 5JFGA 4GL2A 3GEIA 4QL3A 4JLVA 1E9FA 2WKPA 1US8B 3Q7PA 4TQUS 2HF9A 2ATVA 1GL9B 2MSCB 1CEEA 1MRNA 3A6PC 2C04A 2IUSA 3ZZTA 1W48A 2XZPA 4DDVA 3AP1A 2LCFA 1P72A 3LNCA 3B1WA 2WWYA 3AVYA 1G8GA 1RYFA 4JVNA 2O8EA 4RCZA 4DDTA 4QM7A 2REBA 2KBEA 4G5GA 4Q9HA 4WOPA 1U8YA 2FNAA 4JSYA 4AURA 3BH7A 3PUYA 3T1VA 1W0KA 5DI3B 4FCTA 4PQFA 1YZNA 2GZHA 2NO7A 1NI3A 3B60A 3GJ6A 1AZSC 4G3XA 4F38A 2JLVA 2YYZA 3Q72A 4L9SA 2QSZA 2ZRPA 4DLRA 2A7QA 4HZUB 2FA9A 3R9IA 2HT1A 5KDLA 2YV5A 3BIFA 3L0SA 4Z1MD 4US2R 5TMPA 1TEXA 3JVUA 1V43A 3K09A 4IXNA 1F60A 1NG9A 4TLBA 4BZPA 4NCKA 5E95A 2IT1A 3ZIAD 2OV2A 2I3BA 3KXKA 5F2EA 3X1DA 2FSHA 3DMDA 1GM5A 1HQCA 2YWGA 2P6UA 1VKJA 1E1QA 1IAQA 3E5HA 4IVQA 2P5TB 5C1BA 3AVXA 1GAJA 2AWNA 2QTVB 1T3HA 3B7GA 1COWA 4LBVA 4XVRA 3ZDQA 2DFTA 1OHHD 3CLVA 3OAAA 1N5LA 3OF5A 4KODA 2CCGA 1AQYA 4NYMQ 5IK2A 5A4JA 3OEHD 3QPWA 3KKOA 1FNMA 2WZQA 4MRNA 4XH9B 5JHHB 3FE2A 1TF7A 4QJ3A 2R44A 1GITA 2A78A 4JLJA 2WICA 1UBFA 2IYUA 1DAEA 6Q21A 3DMNA 2GETA 5FBQB 3U3OA 4A8JA 3AVOA 3SC3A 1OFIA 1PZNA 3MLEA 2P65A 3CF0A 1WF3A 8OHMA 1K8RA 4Q7LA 1I4DD 3LVRE 2G1KA 5LD2C 3AVQA 4XSGA 5KU1A 4R2IA 4ZCMA 2AK2A 4B34A 2EFCB 4D2IA 2KSQA 2XSZD 1JPNA 3ADKA 3DEFA 3P20A 4HEJA 2IYQA 1MRSA 2NO0A 4PO8A 5TXGA 3SE0A 1W0JD 3QG1A 3BOSA 5JSZB 4CRWB 2GRJA 2XAUA 4BFUA 4UNRA 2WSSD 1RZ3A 1ZNYA 4E22A 2JLYA 1JJ7A 1N3BA 2A5YB 1UM8A 5EE9A 4AG5A 2HXYA 2RMKA 2ZREA 4YXWA 1AKYA 1A2KC 1DO0A 2ZSBA 4O3MA 1M1YE 3PUWA 4TMTA 5BN5A 3W34A 1WRBA 1A82A 2PZFA 1KI7A 3AEZA 2IYZA 1W5TA 3T5DA 2CLDX 2IK8A 3CF6R 2ONKA 1U81A 4LOAA 3GJ7A 3RLFA 4KLNA 4P3YA 4OQXA 4B3XA 1IOZA 2VQSA 2JIZA 2ZSEA 5G53C 2OLJA 2Q3MA 2JJ8A 3AH8A 2O8EB 5FUWA 4DKXA 1IQPA 1B0UA 1GDDA 4QBHA 2ZR7A 3RS3A 3QSYA 1KK1A 3BE4A 3SR0A 4C0HA 2B8WA 3B8HA 4RZXA 4G5SA 3O8CA 1VIYA 5JI2E 2MSDB 4NL4H 3KL4A 4ASUA 2AN9A 2F1JA 3FHTA 1MKYA 1WQ1R 3ADDA 5HKKD 2JDIA 3C5CA 4B3BA 2RHMA 2PCLA 3CRW1 1KJZA 2XJ4A 3RWMB 4PPFA 1JQJC 1WB9A 4I81A 2IYXA 3QPUA 1LB1B 3RRZA 2Z0MA 1LF5A 1ZNXA 3CRRA 3RRMA 3BWDD 3IBYA 4UKDA 1XMVA 3ZZ0A 2BCGY 3CX6A 2FWRA 2YOHA 2N46A 1F2UB 4LJ6A 1E79A 1KSHA 1Q57A 1MO4A 3NBXX 5CJ2A 3L8YA 4ESVA 1ZC3A 3QXHA 4C4PA 2A5JA 4B2LA 3VQTA 4QHYA 5E7JA 5FTKA 3WYGA 3WHKA 3ZD7A 3A1SA 3AP2A 1R4AA 3M6AA 4HYYA 1SXJC 3CIOA 3N5CA 5D3MB 3D6TB 1OH6A 2CMKA 3OEEA 3FOZA 5H8WA 2WJHA 5AJXA 3LO5A 4KJZA 4DEXA 1NL3A 2PLFA 821PA 4URXR 4LJAA 1M8PA 5JEEA 2LKDA 4LBWA 3QXSA 4AKHA 1BKDR 1AA9A 1VCMA 2VL7A 4M0LA 3E2IA 1GL6A 2XITA 3MWKA 4YONB 5TARA 1E6CA 4CEJA 1HA3A 3I5XA 2H7VA 1EFRD 4NH0A 2OBMA 5FOSA 2XTZA 2ZQ5A 4B71A 3LD9A 4DSOA 1ZUNB 2ZUBA
chains in the Genus database with same CATH superfamily
5LA6B 1X7XA 3F7MA 4NDZA 4CFZA 5LYJB 1Z16A 4I8DA 4JP8A 3GJZA 5F5LA 3PICA 4B17A 2PT9A 2ZSAA 4BBJA 4ROSA 5JQGB 4OKSA 1PV4A 4D9MA 4C7OB 3CINA 3D0OA 4HSEA 2OO5A 1AMUA 1OROA 2ANBA 3ABOB 3K6SA 2QM7A 1XQVA 1OC4A 3KXPA 4LOIA 1HGXA 1V3QE 1MR3F 3OKFA 4QDUA 2IXDA 1KO5A 4UQPA 1FMTA 3TZBA 3RJZA 3L6BA 1KORA 3NBYC 3U09A 1PQUA 1O95D 2VZ8A 4Z3KA 3ZJTA 3CKLA 3L43A 3P4UA 3D2AA 3VU9A 1JE1A 2IIVA 4C5BA 1Y5LA 5JZVA 2IYEA 3GCDA 2X9QA 2Z57A 2HJGA 2OUKA 3ZYCA 3WWDA 3TUJC 4AZ0B 4D6YA 1Z7BA 4G6ZA 2CUKA 4I5IA 4L50A 5HKBA 4EA9A 2WF8A 5GGYA 1EK1A 5JNRA 4G5RA 5GOTA 1NMQA 4JBWA 5T4HA 2ZB8A 4TSRA 1CS0B 3G2MA 3AEKA 2LP4Y 5JSKA 2JA2A 4D9KA 5TVKA 2E5WA 1NPYA 5MGNA 3PA8A 3M9XA 4QTXA 4A2PA 1OTYA 4CLXA 4D42A 1CZUA 4FGLA 4NJMA 5JJ5A 1W29A 3U13A 4EYOA 3H6GA 3T1QA 4YT5A 1M34A 1PN3A 3TJRA 4IIEA 3W4JA 3A31A 3RRXA 4ZI7B 1QYCA 3OCJA 1GO2A 3IUMA 4ZYTA 5BUQA 2FYTA 1ANKA 1T6XA 1U8XX 1C7JA 2AA3A 2PTHA 2HU7A 1IPFA 1FFWA 4ND8A 1ZK0A 1UJBA 4P98A 5BSRA 1BGWA 4Z3DA 3ZKAA 5DSXA 4MVJD 5FV7A 2H6EA 1PK8A 3MWYW 1LSJA 5CA1F 2O7RA 2BEUB 5I9IA 5JH7F 1GCUA 1JU3A 2HD4A 3AFHA 3I37X 3JR3A 2J32A 4ZVVA 2VP6A 4UDNA 2IYFA 3SJZA 1KR2A 3G82C 2HJRA 4GZLA 4PG4A 5EP3A 1A1VA 1W52X 2VLBA 1XEFA 2D5BA 4FMCF 4IR7A 3FGNA 3O2NA 4PO1A 3TG2A 4UBLA 1V45E 5BYBA 3DHWC 1J0AA 2NZ2A 5D5QA 3HFGA 2AJBA 1PTJC 1IQUA 1NR1A 2D62A 3PFCA 4HAIA 4PNZA 1W88A 5AI8A 5I7WA 1FW6A 3QKTA 1H5NA 3KVYA 1Z22A 4TTRA 3BFPA 2FMFA 2EX4A 1SUEA 4JJAA 4RDHA 1SQSA 4ALIA 2XY4A 2LXNA 2VQ3A 4F4DA 3AVVA 1W0JA 3PJEA 3IALA 3EYWA 4XVQA 2AHOA 3WRYC 5CA0B 3LIIA 2OAP1 3MSXA 4QQRA 2Q7DA 2C4NA 3C7AA 4JS0A 1LU9A 1XZMA 2F9MA 3QUCA 4FFOA 1IWPB 2WLTA 4QSHA 2NUTB 1EJ6A 1SK9A 2Q6IA 3QPAA 3W6OA 1BC5A 4OGFA 1G8JA 1RWXA 1UXIA 5EQFA 3Q85A 3OMXA 4IIJA 2JFUA 4YMWA 3SMVA 1R6UA 2GLXA 5REQA 4RTLA 1WR8A 2X3FA 4BRUA 1ZO8A 2P30A 2WD7B 1K5DA 2H9YA 4XOUA 4JV5B 1DP4A 3FPJA 5CM2Z 5ALMA 1X7WB 2V4UA 2H9AA 1XEWX 2FHSA 2J5XA 3KZXA 2XMCA 2CHFA 4JQZA 2QQ5A 3RYTC 4Q3LA 3DS8A 2EZ4A 3ER9A 2O2CA 1QBKC 1QHEA 2JVJA 1PQYA 2ID8A 1L5FA 2R8BA 3DT9A 2J09A 1XAJA 4PC1A 5IC4A 1E2PA 3FWHA 4XIYA 2PGXA 2KW5A 2HPVA 3DCIA 1L4FA 2HU8A 4IW3B 4CQMD 3EPLA 2QUHA 4WHMA 1NBEA 2HTFA 4FBMA 5HW0A 2C0QA 5GM1A 1QS0B 3OJXA 4K9RA 1P9LA 1ZOOA 1YRQA 3E7DA 5CLLA 4B2IA 4F91B 1J5EB 3U4QA 4GPAA 1W4BA 1TMGE 2PEZA 3FBGA 4DR3B 3GU3A 5TPWA 2O8CB 2QRGA 3DL2A 4B9AA 2RE8A 4O2AB 2NSYA 5J23A 1U8ZA 4OATA 5KOJB 1N0VC 1HDEA 1Z2AA 2ZWIA 4JLUA 2OP0A 1YR2A 4NENB 3UJAA 1O8CA 4IUYA 2FEOA 3HRHA 5A3SA 2DPMA 5KVCA 2Q50A 1BA3A 4E4RA 1EVIA 3N2ZB 4IVPA 3CUSA 1V5WA 4IHKA 5TR9A 5HTOA 2XUFA 2NSJA 4W1PA 4Y7CA 1ZH8A 4RSGA 2VK8A 4YK7A 2HMAA 1CF4A 5BT8A 1GLGA 1O9GA 1POWA 1WSWA 1E9VA 4A26A 3QVJA 4R83A 4M1ZA 5J5VA 3C3WA 1TKBA 3ENQA 2JFPA 3KSUA 3M9WA 3N0WA 2BUBA 4LX0A 1AQ6A 5L4LA 2W6JD 4CEIA 5SZKB 3PJFA 4D97A 1P74A 4DIFA 3INRA 3H2SA 4CE6A 5KYWA 3DFKA 5HZMA 3EPKA 1CY0A 3GVIA 4HLNA 1T9BA 4HK4A 2J6CA 4IJUA 4QUHA 2PRZA 3DZKA 3DBIA 3KO8A 1EUCA 3P32A 3DTVB 4JT8A 3VPBA 3WOHA 3ZE0B 1YU9A 4BOYA 4BP1A 2IYLD 1W4AA 5IT9A 5LDDC 2FY8A 4KIUA 4ZMBA 1ZGAA 3TR5A 5CCXA 3R7NA 3N2YA 3DNFA 4D43A 2XMDA 1VE9A 2UU9B 3FPEA 4EK9A 3R09A 5K9ZA 5LVAA 1EIWA 3L77A 4KN8A 3BHNA 4C89A 2GUWA 5KQMA 4F3TA 2HBZA 1N57A 1Z0UA 1J06A 1T6BY 2XDAA 4KXQA 3Q3EA 1RJFA 2AOWA 4IXMA 3PR1A 4DMGA 4UHDA 3PNLA 4U0KA 4DQUA 3HKEA 4BY9E 2QIOA 3AESB 5AM4A 5BW8A 3SGLA 4NYIQ 1NOKA 2Y6VA 4JGBA 4FUQA 2ZIUB 4P5EA 1R0CA 1DDIA 5FF9A 4NZZA 3BRQA 4RVUA 1LDNA 3W2EA 4GC9A 4B3MB 2UYGA 2R6FA 5B64A 3F71A 5LMUB 3I2GA 3VO9A 3E35A 1E20A 4W9MC 2GA8A 3TOVA 5IAEA 1FJGB 3MMXA 1JXQA 4C03A 4Z99A 5DXAA 2BUAA 2HTEA 4G8JA 4I7EA 3EDMA 4MCIA 1RM5A 4MI1A 4PYOA 5DDIP 4J49A 1RMTA 2AR0A 2RAVA 2G1UA 2LPMA 2ZYDA 2ZWPA 2I4IA 2AG8A 4RH3A 1FDIA 1FFYA 4Y6RA 1ZL2A 5KTPA 2WIFA 3OZCA 2PSEA 4MB0A 1YMQA 2FX5A 2OMKA 1P17A 1PUXA 2NUPA 1WXDA 2QN1A 4D8YA 4JLSA 3KQNA 2AI3A 4AB1A 2IP2A 2Q0SA 4E2XA 1PHPA 3KLMX 3SVLA 1LUAA 3H6HA 1RXWA 5EJ6A 2GN0A 4URHA 3DEIA 1Y9AA 4DDMA 4YMLA 2WSYB 3PRJA 3F3YA 3HYSA 3C98A 1V3UA 3JAWB 2A1UA 3MAAC 4KO4S 5HEKA 1P61B 2OHGA 2GEFA 4JN6B 4LVUA 1AN0A 5JMPA 1R74A 1TZJA 3OEYA 1EWYA 2JEOA 5K3FA 4QLAA 2VBIA 3B70A 5DOVA 1IBRA 3A6EA 1K3FA 1O6GA 3KC2A 3KV1A 5K8LA 3H65A 2GERA 3JRXA 1B4DA 4LXTA 2AXNA 4S0XA 5IBRA 3ZXSA 2HXGA 4D98A 1OXBB 2A9PA 1P4SA 3MWEA 4C9BA 1QUFA 1UP4A 3Q8WA 1I2MA 3W0LB 4Z1OA 4IRUB 4U2BA 2OCPA 3CX4A 1WUYA 4UOEA 1UFOA 1ZNQO 4B87A 1NPTO 1DARA 2K7ZA 5JDIC 1X9IA 1F6WA 3DMRA 5A5DA 3IHKA 4DM7A 7ABPA 5DLEA 4PW0A 1Y81A 2OQRA 1UFRA 1NTRA 2PPLA 3EG9B 1U2DA 1PUIA 3CR8A 1RAFA 3L1UA 1PVVA 4OA5A 5T57A 4QYSA 4TROA 4HEQA 2C1EA 5EXTA 3ZGLA 2RFLA 3I9LA 2PBLA 5CA1A 1X8XA 3M5CA 5DLYA 2K87A 2A9QA 3HH8A 3N3BC 4XTCS 2JEZA 5JH7A 3NTUA 2CE7A 1E2NA 2JIMA 3PXAA 1M2WA 3MMZA 4UVGA 4ATNA 1XPJA 1DGQA 2ECQA 5F9FA 1HFWA 2CNNA 4KR6A 1W87A 3UAGA 2VNKA 5CP8A 1JR3A 2FPLA 5TVGA 1QP0A 2JJ2D 2D1SA 2XT9A 2JI6A 2I2AA 2YBDA 2ODWA 2WJAA 4AF6A 2ZZMA 3I83A 1MORA 4G86A 1N4AA 1V4BA 4LVCA 4FGZA 5ADHA 1VE6A 1R5NA 4QQFA 4N6OA 4Q82A 2RGRA 3HLYA 2DJ5A 1SQ5A 3DUWA 1QG2A 4OHXA 2WOOA 1N0UA 4R9SA 3O2SB 1S8AA 1MEEA 3BHJA 3GNQA 3L0IB 3GI1A 4I66A 4J3JA 4PC7A 4EMSA 5EHNA 3F5SA 4K9NA 4OHKA 1IVYA 4QTUB 5ECYA 4O4IF 1SH7A 4RD0A 4K2HA 5HE8A 2C9ZA 1U98A 2QPOA 5CB8A 1EJ0A 1I2ZA 4DA0A 4BQEA 2VR1A 4JLWA 3GFVA 3GMTA 3Q8LA 5JY6A 1DXOA 4WXHA 3FSJX 1U2SA 2NPFA 1BX3A 2Q3LA 1CHDA 3DCNA 3OJCA 4IOJA 4FLEA 4XAQA 1JAYA 2BFFA 2VSNA 5AK5A 4HPJB 5L3ZA 5JARA 1H5QA 2RBEA 1T43A 1VYVA 1WNFA 1Y3BE 3A3NA 4BMSA 3GT7A 4B44A 1AD2A 2PSJA 2QLFA 3WO0A 4YXFA 1VMIA 3ODPA 4MLPA 3CISA 2Z5GA 2R4QA 3OUZA 5CCDA 2ZI5A 3V8QA 3AF3A 3KLPX 2Y1FA 4OP3A 3PP8A 4BV9A 3X43A 3DLAA 4H7FA 3SDBA 3OTIA 3TTUA 3DQPA 3HY4A 3V5NA 4CF6A 2AZ4A 5F23A 2BC9A 3MT8A 2IPLA 3ITNA 3IIKA 2D00A 1RMQA 3S2YA 1T5SA 4BRSA 2YV4A 4D74A 3IMCA 3A8TA 3P27A 5AH0A 4MQMA 3L18A 2WJ6A 4N8SA 4IHJA 2IUUA 2GM5A 3UT0A 2VJKA 2KB0A 4OL0A 2DXIA 5EVJA 4ZAXA 4DWOA 3K6KA 2FQQA 5HIJA 1EWVA 4JLNA 4BNMA 3IV7A 1JWBB 4OX9Y 3QPCA 1EPUA 1G64A 1XTZA 3I2YX 3LY8A 2MR5A 1JFFB 1YBMA 4N0QA 1VXRA 1K8ZB 2CCKA 4JHLA 4AKIA 2O8DB 3PD7A 4D3FA 3CO5A 5AXAA 2J5BA 5I47A 4HB0A 4DZTA 1Y3CE 4FDAA 1NLUA 2CK3A 3EGDA 4ZYLA 5DH9A 1E2UA 4LXHA 4G0XA 2X5OA 4FNGA 5TMDA 3QX7A 1ZC4A 4NDNE 2V8BA 4I9FA 3A9UA 4WXMA 4L0MA 4O33A 4CKEA 4QTTB 1HH4A 1CUDA 5JFOA 1HRDA 1JA0A 1LK5A 3OSUA 1V6SA 3EZGA 3TL2A 3THWA 3G2PA 3HLKA 1XP5A 3L8EA 4AYXA 2JEYA 2GM9A 3PKZA 1VL5A 4J9VA 5AVUA 2O1WA 2YY5A 4Z2YA 4RD4A 1PR1A 1H65A 1SU6A 1E1YA 1LJLA 4QYTA 4UUPA 2JGDB 3ZCRA 4BLRA 3HBFA 5EIWA 3VPAA 4QEZA 3L0ZA 4L6IA 4BDTA 3TUIC 1EQAA 1XJQA 4EECA 4HNTA 4L8LA 1D4OA 1GGVA 3ISVA 4GOJA 4DLPA 2H29A 2Q3CA 3AF0A 4Z9FA 4D8XA 5KEIA 3RRYA 4UNPA 3AKCA 1AZTA 2I4OA 4QLOA 2FPGA 2XB4A 5C5EA 3NHUA 4BCDA 5G0VA 3GCXA 2O23A 3QEKA 2C3PA 3JSAA 4NCJA 3C3EA 3DP9A 1GJRA 2C8LA 2QUKA 2QW0X 4FR2A 4ARCA 5HUQA 4ZYYA 4Z0TA 1XF9A 1SZCA 1M1YA 1ZX1A 3A6GA 3IAHA 1DO2A 4FKBA 1JTVA 1YGPA 4IXTA 3NLLA 4DILA 2DB3A 3FOBA 4HNRA 1CNEA 4I50F 1RHUA 1UR5A 3VPGA 2NNWB 1Z2OX 4DRXA 1GG2A 3E9YA 1IHDA 3HVIA 2D2IA 2QAIA 2A3RA 4ZP1A 5A9SB 3LPCA 1YRLA 3QA3E 1HDCA 2QMHA 1GNPA 1N2ZA 3NBQA 3LPNA 1KZHA 3M4JA 4DRYA 3DFIA 4G5OA 3ETJA 4DQKA 2HH9A 3V1YA 4NFSA 1A9SA 3D6HA 4U3JA 2H5LA 4OUDA 1ZGJA 3IQHX 2W71A 2C2XA 5KNLA 1WB5A 5LOVA 1EI9A 1AH2A 4BC0A 1SIOA 3GL9A 2CF6A 1V8FA 1M6VA 3GARA 4I1RA 5AFSA 1KU6A 5KVQA 3I0NA 5ICMA 1AV7A 1CXZA 4OFZA 3Q7QA 1DRJA 4Q4JA 4YBZA 4RK5A 2Q27A 4YJ2B 2Z4SA 2D2FA 3FJYA 3OPQA 4HKTA 4DMCA 5TIIA 3HYLA 3L4KA 2QTRA 1QIEA 2WF5A 2Z1NA 4TYNA 4OMUA 1I01A 1A9ZA 3E15A 3ICOA 4W5WA 2QL5A 1K0FA 4LHEA 2X1VA 4BXOB 4H7HA 1BFUA 2W37A 3KJIA 4O8CA 4OEHA 4TN1A 1YUMA 3WMXA 3MGAA 2O1SA 4DIEA 2EFEB 2J5RA 3GDFA 2REXB 2FK7A 4AJIA 1HL3A 4CV3A 4R8VA 1RTTA 4LI3X 1RXSA 4TTVA 3T5BA 4CQJA 4A0GA 2EGUA 2D0IA 2I2FA 4G85A 2P0AA 4RM3A 4C0LA 2C9MA 1GLNA 1BHO1 1E7YA 3DMGA 5J2TF 3PEYA 2G82A 2X6QA 1X38A 1PSWA 2C9YA 3FPSA 1KAQA 4L4ZA 4UAVA 3THYB 3K70B 4KRXA 1DZ3A 1UPAA 2ZTUA 1UANA 4OBBA 1DTSA 3OO1A 3LNTA 3CR7A 3LKVA 1I5EA 3IDOA 3A4MA 3ETEA 3MCZA 5FAXA 3WWZA 4JC4A 5BURA 2OCYC 4EO9A 1U80A 2DWQA 4H7JA 1U02A 5JDIA 1PLLA 1A5ZA 1IDOA 1D2GA 4IS3A 1FUUA 2GVDC 1XKTA 4PYQA 3STTA 1WD5A 3TKLA 2B92A 1F12A 1S1CA 2CLKB 4FN4A 1FP4B 2HF2A 1PGNA 2H4HA 3E9CA 1OX4B 4TYQA 5FWYB 4EQ6B 2EC5A 4YMIA 4LMBA 1LVGA 1GNSA 4FX5A 5ISMA 1CLEA 1C9MA 1QF7A 1XCBA 1MA0A 2ZXFA 1T9AA 1TAQA 3TW4A 4EM6A 3VDMA 5LMZA 3E3AA 1H2RS 3CBQA 3EQ9A 1RAIA 1EJ2A 3I04M 4QPDA 4GLBA 5E9WA 1Z6AA 3GBPA 3LFTA 3SHWA 1L7BA 2MJLA 4R98A 3L6CA 4JJIA 3H5IA 3LRXA 2GBIA 4MJ3A 1HDZA 4LQCA 4PNHA 2NU7B 1WUTA 1VE3A 4O4IA 1UXJA 1G41A 5A7HA 3IVMA 3UKJA 1O94D 1OV6A 3WRXA 1V7CA 4IIHA 4OMCA 4ADSG 2QW1A 1D4ZA 3C4VA 1L3BA 1N5KA 1UBCA 1ECJA 1Q95A 4N03A 4QIHA 3WLTA 3MJ4A 5CURA 4LGCA 2HLPA 4G37A 2PXCA 3V1MA 3QNUA 2JFZA 4NH4A 4CIBA 2ZWVA 1C1DB 5KUTA 3WFZA 2H1OA 3I58A 4K1XA 3B6JA 3GGOA 4DNQA 1P7WA 2FMXA 1HEUA 2OAQ1 3B6MA 4EF6A 1UKCA 4QC2A 1EFCA 4WZAE 4YN3A 5HQ3B 3S55A 3ED1A 5HRCA 2C7OA 1NDHA 4KC0A 5KKNB 4F3KA 2QVLA 4KHZA 1YB4A 3U1TA 4A6PA 3MTJA 1I2BA 3FVQA 3WL5A 4C0XA 5DP2A 5C7YA 1GV0A 4NVRA 4DG9A 2PSDA 4EFNA 4EHHA 1SAYA 3NEJA 2J4FA 3EZ2A 1RS0A 2D1RA 1H8HA 2F43A 2PXAA 4J76A 4L08A 5JANA 2BKXA 3Q3JB 1VDZA 4Z4IA 5HM6A 3TIIA 3SNHA 4BNKA 2FPWA 1QYDA 5HZKA 4W5TA 2DH6A 3E9QA 3K0CC 4FZ3A 3AHDA 4GOLD 4G24A 1FJXA 2J9RA 4MGKR 4KACA 3QIVA 2EBHX 2IZ7A 1M2FA 2VXYA 3RC1A 1XFAA 3FG9A 1YB6A 4GZ3A 1JIXA 4P3PA 1QIFA 3JAKA 3LOPA 3S2GA 3W5SA 4F4CA 2EARA 3QU7A 3DHYA 3WBKA 5KC8A 3RVNA 3LVBA 1GR1A 3VH4A 1TCCA 5JIBA 1M8JA 2EJVA 1EVKA 4OXIA 1MJFA 1PFVA 2CC2A 4BP3A 3NXKA 2YIDA 4EJMA 1ESMA 4CLEA 1QYXA 1G66A 1YOBA 3EJ6A 3RKUA 1M1UA 4URWR 5FLEX 3HGTA 4TTTS 4HH0A 2POCA 2JGRA 1SG6A 4IP0A 4X54A 2HSJA 4WPGA 2BBWA 1O4WA 1G0NA 2FUG1 3GP5A 3NMUF 4OBWA 2IUFA 4HDKB 4S1OA 3VC1A 2O3QA 4IYJA 1VG8A 5CT6A 3TRKA 2CVFA 2VK1A 3UT5A 3DLIA 3FYUC 4JL8A 3WB9A 1ODKA 1U3WA 1OWOA 1TUBB 5DP1A 3IMEA 1DDGA 1DG1G 2HJWA 3TTXA 2PMEA 2ZYRA 1SWVA 4O25A 2YJNA 3T4XA 1FTNA 2JD2A 1PZHA 2OCAA 1JDSA 3JY6A 4QGAA 4NBWA 1AGPA 5DBEX 3TJZA 4M0PA 4GF5A 2ADFA 3EF3A 1QYWA 2BFBA 5M2QA 4HTFB 2VWGA 1JPUA 1DC3A 2OT3B 2Q2QA 2ZBGA 2WP0A 4REQB 1Y4UA 1GGNA 3V1TC 4XB6B 4XKJA 1HLFA 3DE7X 4P7BA 1LPSA 1E1RD 3A6KA 3COZA 1EXDA 3DPUA 1DT3A 1Y9DA 3J7TA 3D5QA 4CTKA 3UA3A 4UHJA 3RI3A 1CE8A 1X6VA 1OZGA 3AWIA 4G5QA 1C7IA 1E18A 1N1MA 3DDWA 4OMDA 1GZVA 5LM3A 4CV1A 2QZ9A 1V8BA 2ASVA 1EEHA 1QV6A 1V5GA 3GZJA 1E1LA 5EKTA 2DU8A 2QI9F 2VJDA 3MUFA 3PXXA 4ZKEA 4B6JA 5J58A 3QVVA 3TQRA 2RH8A 4FYMA 5B3JC 2B1JA 1YACA 2BMDA 4IGIA 1P1KA 5LWHA 3AERB 3UC9A 2RK4A 3QE0A 4ND1A 1YBVA 3HO8A 1WSAA 4FZVA 4LJLA 3ZCTA 5MF6A 2ZJYA 4ENSA 3D3JA 3HDQA 4YJFB 2XVMA 5FWXA 1GXSA 1KEWA 1YCDA 1BJTA 3DWEX 4H35A 4LZAA 2QAGC 3SZOA 3ZY6A 2IEBA 4ZODA 5C8ZA 3QHPA 1J20A 1UZUA 2PBFA 2P2LA 3OZTA 4JOCA 3CVXA 3GLIE 5CDFA 1JVBA 1U7UA 3K73O 4B3HA 3SEAA 3DZDA 4RX1A 2H7CA 3RGWS 1JR4A 3PUKA 3VFDA 2VA9A 3ZTYA 1HE5A 4KE6A 4B48A 4GM1A 2NSHA 4ITVA 1C41A 4R2WA 2DBVO 1G7CA 2PPVA 1DJLA 3O1IC 3C3AA 1QLHA 1UDAA 2X0JA 3OBIA 3R77A 1NRXA 3BMQB 4Q02A 3UNXA 2ZOSA 4RACA 1NONA 2G67A 1ISJA 2V54A 3NQ41 1O2DA 5AKKA 2FX2A 2C3MA 3VPSA 4AIIA 1JP7A 3AFOA 4MR9A 3IAAA 1VL2A 4DWWA 1VBKA 1ZK4A 5HQTA 2EP8A 4K6CA 1CEQA 3KQQA 1OFVA 3GH1A 5CLJA 1ADFA 1D0IA 3KJHA 1ZP6A 4JYZA 1HYEA 3GP8A 2H1IA 4WBNF 3G0OA 4N7JA 1GPNA 3BSFA 1I6LA 1K3TA 1SZDA 3EBOA 3OLXA 4S2UA 4PCAA 5EPUA 4NAHA 2P5UA 3VMFA 1TJ3A 3VTKA 3BE6A 1ZJYA 3DP7A 1TADA 1TT5B 1T3GA 1NMXA 2INGX 2ZR0A 3ZDAA 1Z7GA 5TMEA 3PCRB 3FCEA 5AOVA 2ZANA 1DC8A 2L17A 2XMRA 1Z07A 5ECWA 4B6RA 1FQKA 3LBIA 5FNZA 5KYUA 3WK6A 4MQFB 4LBZA 2YHIB 4LY6A 5LMNB 5LSAA 1CTQA 5EMNA 3WGKA 1XCJA 2OPHA 1CU1A 1SHUX 5C7LO 3IAS6 3DCYA 1RYMA 1GPMA 2TMGA 1DSSG 5CK4A 1ZH0A 1VG0B 2JF0A 2K5UA 3IGFA 1USIA 4ZVOA 2YXPX 3H86A 1FS5A 2HWWA 3D6VA 2VDRB 4TVOA 3B5IA 4IKEA 1Y6ZA 1J56A 4QUIA 3O3OB 1O58A 3INYA 1NUSA 3H1EA 5HTKA 4F8EA 3LQFA 2AK3A 5EJ5A 3E4CA 5FNVA 1LRKA 3ZHXA 3W05A 1P1RA 1P77A 5EMHA 5CFOA 4PNPA 3DOCA 2GF9A 1PNVA 1NUQA 3L0CA 3KB2A 1MBZA 2H63A 3C8HA 4U2DA 4ERXA 2HFJA 1DXHA 2YMQA 1QKJA 2CE2X 2R25B 4NX2A 4UCQA 3ZNPA 2O3RA 4EB0A 4NYJQ 3FTPA 5JVDB 4L72A 4DR4B 1NATA 1HOTA 4UXIA 4RFSB 2X0RA 2GEDA 3NS7A 4LMRA 1VI2A 5YASA 2HF8A 2O2SA 1BYIA 4QGHA 3QFFA 4JLBA 2AG0A 4UTRA 1BS1A 2PWZA 3V2UA 1QFJA 1UWCA 1ID1A 2QW8A 4F4HA 3CJRA 3QI2A 5GJCA 4TQ9A 5AJWA 4J0GA 3ZLBA 3Q7EA 5BWNA 2VWHA 2P9GA 3BJRA 1P7ZA 3ZI0A 2FQYA 2JGEA 5CCBA 3AGQA 3H0EA 1RP7A 1QGED 1O87A 1I1HA 1MIOB 1OPXA 1XRMA 2CZQA 2OFOA 4L16A 4MS1A 5EHIA 3KR9A 4AJ4A 1RWWA 3Q0TA 3UUGA 2G5PA 5I6DA 4UJ3A 4G1UC 3UJ8A 1C7QA 1D0VA 4JUCA 2JCYA 1EAMA 3P26A 4IUCS 1E7RA 4ZU6X 3V2GA 1LD3A 1X1AA 1YI1A 4MVJI 2AMLA 1XNHA 2IXGA 3NVMB 1NKSA 2Q41A 4QTYA 1R0ZA 1WU7A 1OLSB 3PKIA 1BVRA 4F84A 3QA9A 5L53A 4DV2B 4KPUA 4RY8A 2M6KA 4N5DA 1DX6A 2WZDA 4QZVA 4WNAB 1QAOA 3GLSA 4MUEA 4YCMA 3E53A 4DCUA 1VHLA 2L69A 1X2EA 3GZ4A 4DV7B 1QM5A 3V8VA 3DLHA 4NMLA 2AKYA 5IABA 4FEAA 4EIWA 5F3DA 2GZAA 3LQYA 1QONA 5C37A 5ITVA 4UZSA 1OVGA 3NHLA 3RODA 3OX1A 4E13A 4BFWA 3TW0A 2CVPA 3CTPA 1BDIA 2B4RO 1YSCA 2CLCX 2YFKA 4MEBA 2GCGA 2MINB 5LZ2A 2J7KA 3PL5A 1OE0A 1KI6B 3ETHA 1E7SA 4LYAA 5KHAA 2IYTA 4MHOA 4CODB 1VMKA 4BYGA 1R0KA 3AW8A 4P81A 4E07A 3DL4A 4MLCA 2D06A 3H42B 2VHEA 3IT3A 3MCWA 1XR3A 3TB6A 5JS8A 3LY7A 4DL9A 3U2QA 3CEHA 1GY8A 4IL5A 1KK0A 2FWNA 3F46A 4XJVA 4WOJA 3STUA 1XTSA 2JATA 3ZHSA 1FA9A 3TQSA 2E82A 2GESA 4EG8A 2NG1A 5T5QA 2GPWA 3ZW9A 3QVGA 4R4JA 1KFJB 3IQDB 4HQLA 3DR5A 2HA2A 3MINA 5EHXA 1EFPB 4E31A 2XMPA 4WOCA 3QVXA 2CNDA 3IELA 1F3OA 1PF7E 3HACA 3MMSA 1WE2A 4NDAA 3HY6A 4OSEA 1RHQA 4OVKA 4UHHA 1VP9A 2CT8A 2A9FA 2WWIA 2CNWA 1T9GS 2O50A 1JLRA 2R47A 3LBHA 2NXNA 1X19A 1XMXA 4KBYA 4YCBA 2O0JA 1XTIA 1YHZA 3NC0C 5FB3A 1SHKA 1M67A 3KJFA 3THRA 4G0UA 1KH1A 1HEIA 1XD9A 4UUOA 4FSDA 4RXTA 2JBAB 1WV1A 4UCWA 4NYIR 3X1WA 1YAJA 2HT6A 3G6WA 3MJEA 4FFSA 4D8VA 1EFVA 3HB4X 3PUXA 2EZUA 1NX6A 1GPBA 3ROTA 3TLGB 3HMQA 1KR5A 1SO8A 2BMAA 5JD6A 3MUOA 4RPIA 4NQRA 4H6XA 3AR8A 4EB3A 2ZJ2A 3S8EA 1AZWA 2NU8A 5J40A 1P1HA 4BQOA 4HAYA 1XRQA 2W6ZA 5LFAA 4DR5B 4FLFA 3MGCA 4ZC8A 1Q6ZA 3KLBA 3HQ4O 4KX3A 3V6MA 1HZZA 5FBZA 1JNYA 2UXDB 2R4TA 4BUJA 1ZMXA 2A5GA 4KN6A 3NWJA 2XDQA 4R1NA 4MXDA 1BDBA 4MVXA 3CLSC 3CC8A 5DTRA 5H02A 4ZT4A 1JIIA 1YCFA 4L2IB 1X15A 4Y9UA 4B6OA 2F3TA 5L6LB 1V2GA 3NHZA 1T9HA 1GQRA 2EATA 1D6NA 1QQTA 1XXHE 2GD6A 1XAIA 5CVJA 1HYGA 5C2JB 2FV8A 5CIWA 3E6AA 4B2YA 2PSFA 1FXUA 2W8BA 1CEXA 3I9V1 3WHIA 4FUTA 2OZLA 3NC1C 4KH1A 3OJ0A 3MAJA 4H6WA 4U9HS 5D2CA 1LKZA 4LK3A 3RREA 4RKRA 5JADA 4MQEB 4QO7A 1IN6A 3AO0B 1I6KA 2PZMA 3C97A 3BRSA 1DADA 3AKEA 1ZN9A 1WJGA 3DE6X 2GTPA 5KJ6A 5L4NA 1XVTA 4B1FA 4GX1A 3W7AA 1YDMA 1KJQA 1KEUA 4J1TC 3TI9A 3NTLA 3ORYA 3QMMA 3OFNA 2IY7A 5F3WB 4PTYA 1ZXXA 1FFXA 2A94A 2BM0A 2Q3DA 2YJ3A 5LA6F 2YR0A 5LYJF 4AYWA 1DC7A 5JQGF 4BX3A 3AUKA 1Z33A 2P2GA 4DB4A 3ZUGA 1NHWA 2B1RA 2HSWA 3AOEA 5CW1A 3U4MA 3T4PA 5L3SB 3RAFC 2VHZA 4RKWA 2F8TA 1E1DA 1IDN1 4DIDA 1CR2A 3G6KA 2AYYA 5LJLA 2PZBA 4YAFA 3SDSA 1LSSA 5LQRA 5EIXA 4YAIA 3DOIA 2MYUA 3S7TA 2WA1A 3H04A 1P5JA 4L95C 4EHNA 4IBOA 1J7KA 1XX6A 3ZC3A 5B3LA 1WDMA 1EUZA 2CDCA 2GOYA 3DC2A 4MKIA 3SKYA 1Y7IA 3DV9A 3DBVO 2HK7A 4YO8A 4B6QA 4KFCA 3GN1A 1GG9A 2BBTA 2AGVA 3O83A 1YZFA 2REQA 4EPRA 4ZEVA 1M73E 2DFPA 3EC2A 3A7DA 4KUGA 4PGAA 1OI3A 4CMBA 3OC6A 3VO1A 4KFSA 5KTMA 1KZ7B 2FTKE 1U7TA 2Y99A 1XRSB 3OQOA 1K88A 1G8AA 3GLHB 3MGGA 4CLDA 3WSTA 5JASA 1WKBA 1TTHA 2OZEA 1Q2UA 1T0PA 3QEMA 1L4YA 1NSYA 4ZI7F 3HNRA 1PUJA 2RJ3A 4OREX 2XE6A 3KWFA 3J81k 4ZQFA 2YW9A 3F67A 2D59A 1LRJA 2OC4A 3O0DA 3EQ8A 3IMGA 5C8DA 1R9NA 5L7YA 1KYWA 1E4YA 5ADUS 4UBOA 1NVGA 3GXBA 4GX0A 1N25A 1U0SY 2B2CA 1VIDA 3ZWQA 3L84A 3NP7A 1ZD1A 3INTA 3PYMA 3OE4A 3UAXA 2N47A 4C1NA 5AW2A 1L4HA 2QJRA 2WWTA 4CFSA 4RPCA 2QENA 4E5DA 1M0WA 2Y4OA 2JFHA 5BSTA 1DIBA 2Q28A 3AETB 5B6JA 1YCHA 1ZGZA 2WHRA 3BK7A 1MG5A 1YRBA 2GCIA 3AI3A 2PL1A 3UUFA 4OK3A 3LLCA 2QUAA 1B6TA 5JCJA 2YVLA 3T3GA 3ZDFA 1UMBA 3W8NA 4UBKA 4DUGA 2JLZA 5K8TA 2J85A 1ZD5A 2RGGA 3EWNA 5G02A 3VYUB 2CLSA 1RYZA 3RVBA 5ALEA 1B16A 1I80A 1XCMA 2G9VA 3DXYA 3IB3A 3K92A 2VTKA 3ABSB 4IV5A 3ROQA 2IEGA 1BX1A 4J16A 1L7XA 2W22A 1CZRA 5HUHA 3GY0A 4OAOA 4F21A 5IF3A 1TM4E 1Y7LA 1ZJ6A 4BO1A 1ZOLA 3E58A 3IQGX 1I3NA 4UE2A 4ETIA 5C53B 4PSCA 3AB3A 4UDXX 3VR3A 3T5AA 5KTKA 1VLMA 3GEPA 5CA0F 2Q9UA 3B3FA 3QLJA 2VIIA 4GMXA 1E63A 1BCSA 3NV9A 4RLSA 1K9SA 1FTWA 4CDMA 3L8FA 1MHTA 4RPGA 3SG0A 1VJ5A 4WLVA 3KOMA 4ZT2A 1L5MA 3ZZ1A 3ANXA 3I61A 4CQMB 4D41A 2ZTHA 4V0LA 3C5HA 2FK8A 2H1WA 1JX6A 3MOGA 4V1CB 3TBKA 1A96A 4N18A 1GADO 2G04A 3R3YA 2JFWA 3EVTA 3IV6A 2Q9BA 2YUTA 1W7AA 2PY6A 4JBIA 5FOUA 1KY3A 3ZE6A 2O2ZA 1SJ9A 2Q6LA 4F72A 2O2XA 1U7WA 3U7JA 2OYRA 5F1OA 1QRUA 2C99A 4FC6A 3IKMB 5EIHA 2KJQA 2OXTA 4LYFA 2CEAA 1R8YA 1DKLA 1NTOA 1T2FA 2YIVX 3D3EA 3W5IA 1E2MA 2OCKA 3P9NA 1K7SN 2OV8A 3AXTA 4ML3A 4MTCA 4B3SB 1PJRA 1BMQA 5E1MA 4YTEA 4OK6A 3W90A 4FWTA 4G25A 2ZYWX 5JPDA 3E3OA 2HYDA 2I7XA 1SUDA 4P82A 5AHRA 4DXHA 3RU9A 1SBIA 5JSZA 2PRIA 2HCBA 2A14A 5I7UA 5KYGA 5EYPA 4P36A 5KOHA 2ZRFA 3QW4B 4YT4A 5EQTA 2B0CA 3GZNA 4GSYA 4BMXA 4O2AF 5DF1A 3BF7A 3TNYA 2V6MA 1H6AA 1RD4A 1ZRNA 3N75A 4FSXA 2Y8EA 3LUKA 4BGDA 1C8LA 4IIBA 2SCUA 1DLIA 2F55A 4UJ5A 3IHWA 5EJ2A 2EFHB 3ZE2B 2R6GA 2FSFA 2PL9A 3I3SR 4WFIA 4C43A 4C0QC 2HHAA 1SPXA 3HEMA 3IP7A 2G77B 2C4KA 2BGIA 3SVZA 4YRMA 1XKLA 1A1SA 2VT2A 2DHRA 4RIIA 4BKRA 4X62B 2ZUCA 4Q47A 1G60A 4XQGA 1JJFA 3HL0A 4RE6A 2W2NA 1YE8A 3NBKA 4F2PA 4ZIRB 1JVSA 2BRUC 2QAGB 4FTWA 4CLRA 2NO6A 9ATCA 3VOBA 2NADA 3T3EA 5KQPA 4GKVA 3ZR4B 3MB5A 5KAPA 3BPSA 4FHGA 5LP6C 3L7CA 2YCLA 3RIEA 3GAAA 3L04A 1WEKA 4NONA 4FK8A 5L9AA 3PHGA 3I9OA 5KNDD 1P4HA 3S2FA 3EGEA 2FKAA 4NARA 3W9BA 1FNBA 2Y9MB 2JAHA 3IMFA 3UMFA 4CI0B 3MTAA 3DMYA 3KDPA 4LV8B 4EABA 1F2VA 2QT9A 3F8TA 3BGVA 1BXKA 3HKCA 2AMVA 5B4UA 3DE4X 4W1SA 3UAVA 3B82A 3AR7A 3KUXA 1X87A 3U60B 3QVUA 4IJ5A 4BGEA 1O0BA 2NPIA 3BL5A 4NPAA 4NICA 2ISQA 3NBFA 2J30A 4O4HB 2FWMX 2GFIA 3C39A 4JR0A 4K26A 3T38A 1Z18A 2IA5A 4WMLA 2ASEA 1HETA 4BX2A 1FSSA 2F1KA