2C5LA

Structure of plc epsilon ras association domain with hras
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c5lA00
3RRYA 2FPMA 2NGRA 3TUZC 2XSZD 1UAAA 3M1IA 3O8CA 3EX7C 2IYVA 3CZQA 5CB6A 5JHGB 4AKGA 1M7GA 2VHTA 1U0JA 1NLYA 2FSGA 2IXEA 4Q19A 5KNDA 3PITA 1P5ZB 1N5JA 2ERXA 1AN0A 3BFVA 2E9SA 4QJ4A 1CXZA 3RC3A 3WHKA 3J81k 5KOYA 2XJ4A 2FEOA 4AD8A 3ADDA 5H70A 1F2TB 3TVDA 5IHPA 3ZVNA 4X8MA 5KPJA 1NY6A 2KB0A 3T61A 4B3FX 1D2EA 1SVLA 2BCJQ 2BMFA 2ZYWX 2GVDC 1SKYB 4GL2A 3CF6R 3NC1C 3DPUA 1T6NA 4A2PA 2IS1A 4FMBB 1JR6A 3VFDA 1KO8A 2AXPA 1E0SA 4CDGA 2XAUA 4QKQA 3U44A 1G8GA 4NCJA 4Q1BA 1US8B 2ATXA 1NMYA 5GJVC 1N5LA 4II7A 4B2PA 4CIDA 2C2HA 5CK5A 5GVRA 3DDCA 3EPKA 3FDIA 2G0NA 1E9FA 3ND9A 4R2IA 1P73A 3EXAA 1FOEB 1XMSA 2NZJA 4DDVA 4C2UA 4WZAE 2BV3A 4UNNA 3QXJA 2QQEA 4JJZA 3F5FA 4YMUA 1MOZA 2W58A 1P61B 2QM8A 2WJGA 5H68A 4JL5A 1KI4A 2P5SA 2YVUA 1P2VA 4PO8A 3R7WA 4ASUA 2HDNB 1CP2A 1HE8B 1OXXK 4RCYA 2N42A 3Q9LA 2IK8A 4TQUS 1NN0A 4IRUB 1NSTA 3DMDA 4BRUA 1G8YA 4M1YA 3B6EA 3M6AA 4MYCA 4JLDA 2V7QD 1SXJD 1K8RA 2O8FB 1PJRA 3AF1A 3SOPA 4JS0A 4F7WA 4NCKA 3LAWA 2DR3A 5AJWA 1KSGA 4KYIB 2EFDB 2QRNA 3GJ6A 2MMCA 2F43A 2V7QA 1G18A 1SXJA 1T3SA 2YV5A 3ZLJA 4TYNA 1I4LD 1YKSA 4LJ7A 3Q7PA 4MRRA 4ZDWA 3ZVMA 3ETLA 4P4TA 4Q9JA 2WTUA 1RIFA 1XTJA 2QAJA 3BB3A 1RRCA 2NO1A 5DYGA 5DLQC 2PZEA 1G5RA 5DI3A 5E4FA 5L3SA 1VCIA 2YWHA 2VA8A 1D9ZA 3KUDA 2ZRFA 1OYWA 1DVRA 2ODEA 4MA4A 4F38A 3CZPA 4B71A 4LX0A 4Q4AA 1VIYA 3BH6A 2GEDA 3LH5A 4HAWA 4FCVA 3L82B 4QHTA 2VSOA 3RSOA 4Q4HA 4JKYA 1YR7A 2HT1A 4Q7KA 2R2AA 2KBEA 4OI1A 2WM9B 3DZDA 4ZI3A 5FBRB 4TL8A 2W0SA 5EE1A 4G1UC 3A1WA 4Z51A 5FI0B 1ZD1A 2WBLC 3QPWA 3CO5A 1UPTA 4Q18A 4Q1CA 2CEAA 4QOSA 1CF4A 5JS8A 2FSIA 1ESMA 2VRWA 2ZRNA 3KTAA 4MRPA 2ZEJA 2QORA 1AZSC 1SXJE 1HH4A 4QJ5A 4NCIA 2DPXA 2CLDX 2ZRMA 3K53A 2ZI4A 4HAZA 521PA 1JJ7A 3FHTA 4CF7A 4M8NE 5AK0A 2VSXA 3NEYA 4TQAA 2WWHA 5FL3A 1OIWA 3GP8A 4FW9A 1E2NA 4QNRA 4G5GA 3U3MA 3BE4A 3HYTA 4Z1MD 2NOAA 3AVQA 1P72A 2HXYA 2ZI9A 3VX3A 3LLMA 4OQXA 2JDID 1V43A 3SQWA 3MD0A 1NVUQ 3RC8A 1GUAA 3B2EA 4Z1MA 3CX8A 4PC2A 4E5UA 2IYTA 2RB4A 2IHBA 3ND8A 1NF3A 2JDIA 5KSZA 4RVCA 4A2WA 1P60A 4MGKR 1RJ9B 3GFOA 1NL3A 1M2OB 2VP2A 4PQFA 2H57A 1ETUA 2REOA 5G3ZA 5IDVA 4MYTA 3REGA 3VX4A 2GCNA 2ZJOA 2EFGA 1ZRHA 2BDTA 3QVUA 4OJQA 4Z8YA 4EPXA 1PUJA 3IBYA 4IDOA 2DFNA 2ASEA 1T5IA 3UG6A 4AYTA 2IS4A 3VKHA 1D2MA 2UZIR 1ZUHA 3H4MA 1G3RA 2X77A 2WV9A 4LV6A 3T15A 1DO2A 5BN5A 2IS6A 5CYOA 4X8HA 3K0AB 1NIPA 3I1FA 3LLUA 3KKNA 1Q1QA 2W6JD 4B75A 4HDCA 4TZ6A 4GSYA 3TUJC 3OIUA 2OLKA 3BWDD 1FTSA 4D81A 3EC2A 1XTRA 2VF7A 1BH2A 3D3QA 2O8BB 4MKGA 2W6JA 1TMKA 1U98A 3AP2A 3IUYA 2IF2A 5KPDA 4ZKEA 4LUCA 3B85A 4HATA 4IJMA 4A6PA 1IN8A 3U6BA 3GCGA 2AD5A 1EGAA 3W3AA 4M53A 5KHOC 3U7FB 5JS7A 1KDPA 1HYQA 1L2TA 4US1R 1GIAA 2WWYA 3CW2A 1EFUA 2CVFA 1IY2A 2R6CA 5TB5A 1Z6XA 1PLLA 4KFTA 4FN5A 4QBGB 3U3KA 2OCAA 4HB0A 3VHLB 3IBGA 5GJWC 2PX3A 4UJ5A 3THWA 3IDQA 4QRHA 4Q66C 1YHNA 2RGGA 1P3JA 2CCJA 3AVOA 2DFTA 2GCPA 3FMFA 1GITA 1QHXA 3EA5A 2VP4A 1FMLA 2DWQA 5FUXA 2RHDA 3G0HA 1U8ZA 1VKJA 2H18A 3QSYA 2PMKA 3GJXC 3CPHA 4AYXA 4JKIA 1T4GA 3CR8A 4LC1A 2JLWA 4IKEA 3GLFA 2WHXA 1JPNA 4IEEA 3SYKA 2IUSA 4P4SB 2P6NA 2IXFA 4O2RA 3UXMA 2AX4A 2RGDA 4LJ8A 4CVNA 3SDZA 3K0CA 4IFEA 1ZC4A 3KJHA 4P0TA 3FKQA 1CJVC 3KX2A 4V02A 4RJLA 1W0KD 3TJZA 2FSFA 4QGGA 3VR5A 4LPKA 2J46A 4UNPA 1XXHA 2HV8A 3HDTA 4JZKA 3CBQA 4G5OA 4DLZA 1XD9A 3QPVA 3BFKA 2VYFA 1ZW6A 1W0KA 3I4LA 4AURA 1RZ3A 2IYYA 2J9RA 3TUIC 2ODWA 4ESHA 4KBFA 3E2IA 1G7CA 3KJGA 4LHYA 2R9VA 2BIFA 4MGYR 4NKRA 3AF0A 1HT2E 3RWOA 1W49A 1JJVA 1ZNYA 1RRPA 4L16A 5J4YA 5BYJA 3AVXA 1SULA 4BQSA 3E70C 4PPGA 3KQLA 4Q4JB 5FOSA 1Z2CA 2DYKA 2HYDA 2Z43A 3AVYA 2XTZA 1XD2A 1ZM3A 2ZRHA 1Z6GA 1YZLA 4HB2A 4I1SA 4NCNA 5TV2A 4IDHA 1IXSB 1UKZA 2I4IA 4LJ5A 2QGNA 1W44A 4BLSA 2IS2A 3TQCA 1R5OA 3C8UA 2P6UA 4CEIA 3L8YA 4EPYA 2YWGA 5JJKA 1A2KC 2VPPA 2PLRA 3W6PA 2FZ4A 3CIOA 3KJIA 1C1YA 3DO6A 4A8JB 1XEFA 1XXHE 3KFXA 1A7JA 1P62B 3T34A 1N3BA 3IPYA 4RD2A 5EXXA 4TMKA 5JHHB 2CVHA 3VR1A 2QQ0A 3W34A 5CJPA 1E3MA 1Z0IA 4TMVA 2BMEA 4Q48A 1W47A 1SKQA 4DXAA 2YOHA 4ARZA 3ADCA 4IXMA 3SJCA 2UKDA 1SZPA 3QKUA 4BFUA 4PHFA 5A0FA 1CBUA 3D31A 3I73A 4BFYA 4A8JC 1TF7A 2GF9A 4D4MA 3A4LA 121PA 3GLHB 4HB3A 2B7CA 2PCLA 2IYUA 3PVSA 1WB9A 1J8YF 4MUAA 3SU8A 1U9IC 2C5LA 1N6KA 2G77B 3KKQA 3NIBA 3NDBB 2R6AA 3TSOA 3VMFA 2BJWA 1AZTA 1OFUX 2QTVB 1OH6A 1ZVQA 4S2EA 1DBSA 1DOAA 2GRJA 1II8A 1KNXA 3WRYC 2KWIA 1VHTA 3OAAD 4OI2A 4BZXA 5EUQB 5CM9C 4PAOA 1Q22A 1F2UA 4HDOB 2GJ8A 1NI3A 4RFSA 5J4KA 4G5QA 4LRWA 4NYMQ 3OAAA 4BWYA 4HLUC 1FUUA 2X1VA 2ZU0C 2R6GA 4EUNA 2J87A 1MO3A 1ZYUA 3B9PA 2WIBA 1G8HA 5SZIA 1G16A 5E95A 4OHZA 4MKHA 4N3NA 3U7HB 2X2FA 4D4KA 4MUBA 2ZRBA 2HEIA 4DSTA 1X6VA 1XPRA 3ZYCA 1CULC 1IHUA 2ZYVX 2F7SA 4K81B 2EW1A 4DIEA 3PUZA 4MRSA 2ZUCA 5JJIA 2AHOA 2VLIA 4BLOA 2ZRDA 4YONB 1G6OA 2RGBA 2ZAOA 3MWYW 4GT1A 4TTPA 1J90A 6Q21A 2DB3A 1XB2A 1OE0A 2YNMA 4DSUA 3KUCA 2P5TB 3X1YA 1LNZA 2A5DA 2OSBA 2WJJA 5A5GA 4DLXA 2YZ2A 4L15A 5HCNA 4A0RA 4TTRA 4IOLA 1OT3A 4PSKA 1E9CA 3AQ4A 3THYB 1KIMA 2ZI5A 3REFA 5FI1B 3SJZA 3H0KA 1EK0A 1M1YE 3E1SA 4LOAA 4CW7A 4YMWA 4B48A 1XPUA 1X3SA 3FB4A 4XVQA 4QC2A 3JVUA 4ZIRB 1KI3A 1IAQA 2ZJ5A 3BAFA 1Z83A 821PA 2B92A 2QPAA 3KQHA 2F43B 3EIHA 1BYUA 3OHMA 4MRNA 3IQWA 1IQPA 1MRNA 2WWXA 2QMOA 5FPHA 4LI0A 4PC3A 3RYTC 2IT1A 3NWJA 1Z08A 1WA5A 1P9NA 4KBGA 1MRSA 4B74A 1AS0A 1XCMA 4DKXA 1E96A 4US0R 5L3SB 1PVOA 2A2ZA 1ZCAA 1RKBA 5EJEA 2CCGA 2X8AA 4CGZA 2LKDA 5E7MA 3K70B 2FFQA 1UADA 4R71A 3IEUA 4Q01A 721PA 4Q4HB 1T8TA 1H65A 3IHLA 5CDFA 3B8HA 1HE1C 4KJZA 4PZLA 3FVQA 2AKYA 2E87A 5JECA 3RS4A 2GBLA 4C3ZA 1C9KA 1QG2A 1CLUA 4LPSA 2GCOA 4GRAA 1QZXA 1CRPA 4YDSA 3T1TA 2PEYA 1W36D 4IFBA 2EWVA 3B7GA 2JLRA 4HAXA 1O3YA 2IBMA 4HUQA 2AK2A 3K70C 4QGFA 2BVNA 4OL0A 3W5JA 4M4SA 3DOEA 1E2LA 5D3MB 4PPFA 1K5GA 3B78A 4NZYA 1I2MA 421PA 1M6NA 5DGXA 3R20A 5FBWB 3LBIA 2ZS7A 3L0PA 1CR1A 4DUGD 2CL6X 3MJRA 5BXQC 1YJ5A 1GL7A 3K0EA 4TTQA 1KZ7B 2IHYA 1IN5A 4H1VA 1LV7A 4RD1A 1KI6A 1TQDA 3CPJB 2ZR7A 4RKFA 5KYKA 5B2ZA 2ZSDA 4HZIA 4PC1A 2Q3HA 1VCOA 1FQJA 1QF9A 3SS8A 4UXJA 4CEJA 3U60B 1EX6A 1ZU4A 2ZI7A 4EJSA 5FBVB 3NBFA 2VH5R 1LW7A 3E5HA 2B8TA 5TARA 5CDFE 4V0MA 3D6TB 1W1WA 1G5TA 3FGNA 1N5IA 1GG2A 1E2PA 3B1ZA 3DEFA 3OEHD 2J0SA 2QSYA 3X2SA 2WVJA 1S3SA 3MUFA 2F9LA 2J5XA 3P4XA 3C5HA 4KFSA 4M9ZA 3NBXX 4A0HA 1EFRA 4QFMA 1R8SA 4XWKA 2JJ1D 1A4RA 3OEHA 4GMXA 2QENA 3EIQA 3B9QA 1ZNZA 4IDNA 3ZQ6A 1JQLB 4S35A 5BW8A 2W00A 4BEBA 4BE7B 3RWMB 5KSYA 3GEHA 5L3VA 1JI0A 2FZLA 3I3SR 4E07A 4KVAA 1EFTA 4EPTA 3EG5A 2FG5A 4M9SA 2NO9A 5IRCD 2P3SA 2WIAA 3K9GA 3K0SA 2FX3A 5KO2A 5CITA 5HCIA 4JBWA 4PFSA 1R2QA 1DAGA 2JJ2A 1G3UA 1Z3IX 2OAQ1 2PZGA 5KDOA 5ELXA 4FXPA 2H7VA 2HUPA 1DARA 2Q3FA 5EP3A 4P31A 2W6ID 4Q9IA 4GMDA 4I4LA 4CZ2A 1Z06A 1T3LA 2QN6A 3BORA 3CF0A 4OQNA 5FTJA 4EPVA 2FE4A 1WXQA 2D4HA 2ZIAA 2GF0A 1K6MA 3QF4B 1BO6A 4BFVA 2ZR0A 4C7OA 3K0FA 2OESA 3DM5A 3IQXA 2ZI3A 4PQYA 4AY2A 4G5SA 4JSYA 3LBHA 2WAYA 1TQ2A 2VP6A 5C4GB 4D0LB 3GEIA 5SZJA 2VHCA 3MMPA 2GEUA 3THWB 5KNCA 4E09A 2DBYA 3THXA 2GHIA 3GLGA 3TMKA 2NZ8A 4ON9A 4KSCA 1Q3HA 4MYUA 1Z47A 5JEEA 5F3WB 2CHGA 2KI5A 1GZSA 2WMNB 3AGPA 1LF0A 2A5YB 1N6HA 5FPTA 5DHAA 2XZPA 4B44A 5KDLA 4OI0A 4PHGA 4KVGA 1E99A 2ZQ5A 2OE2A 1QBKC 3RS0A 3GLFB 4PAQA 4WW0A 1CJUC 621PA 4JT2A 4JVNA 1E2HA 1IJFA 3TGPA 4ZPXA 3AF2A 3LXXA 4Q4LA 4V0OA 4A36A 1NKTA 4L4UA 5JCZA 3AKDA 1OF1A 3FMIA 3NTUA 3O8DA 3AVUA 2G83A 4MGIR 3UKDA 2ZE5A 1WE2A 4M9XA 1E0JA 1CRQA 1MKYA 1GOTA 2GJAA 1NVVQ 1N6NA 2PMDA 3U7GA 4OHWA 1TUIA 3ECCA 1E2KA 4Y0VA 2IUUA 3EA0A 2R6DA 4ZV4A 1JR3D 2NG1A 4P3YA 3KKMA 3CLVA 1FUKA 3DOFA 2GXAA 3K0CC 4QXAA 3V4FA 2WJVA 3GLGE 4OJKA 2XB2A 1W4BA 3QKSA 1TEVA 2QT1A 2XITA 4TMZA 4Q7JB 5EP1A 2RMKA 2GXUA 4H9GA 1FX0A 1OHHD 4A15A 1E2DA 2HT6A 1E9AA 2Q3MA 1Q21A 3KB1A 3ZVRA 2BEKA 1AQYA 1Q57A 3K9LA 2XSZA 1RYHA 3MRSA 4M1OA 4O0MA 1OHHA 4QGAA 1QHYA 1TQ6A 2O0KA 1ZNWA 1SVSA 1G1MA 2FFBA 1GRRA 2WJHA 3HR8A 4DSNA 1QG4A 1IJEA 3T1OA 5FOWA 1ZINA 4HUTA 5KSOA 4NYJQ 4NTZA 3TNFA 5JSZA 3AUYA 1ANKA 2IYSA 3I8XA 1DADA 2CMKA 4NONA 2W2VA 1BS1A 1E69A 4IVPA 3V9PA 1X8JA 4LZZA 1R0ZA 3R8FA 1RYFA 4RD4A 1R0XA 2FDCA 1JR3E 2GA8A 3K09C 4HZUA 3SC3A 3ADBA 4OHYA 3LWNA 1OFTA 2WICA 3UATA 4DCSA 4W5HA 3F0TA 1GNPA 4W7SA 4KHZA 1WDTA 3QXCA 4EPWA 1XZQA 1W2GA 4GPTA 1O87A 4GI7A 4G5RA 1XTQA 4TL7A 1Z0KA 3MSXA 2F3RA 1LFDB 1S1MA 3OESA 3KXKA 4WAUA 1KGDA 3AB3A 4M1SA 4QNMA 4UNQA 3QVVA 5FOXA 2OFWA 4OQMA 1D9XA 3EZ7A 1F2UB 4ZDIA 2YWEA 1KI1A 2H5EA 2H16A 3HR7A 1CR2A 2O8EA 1IOZA 5EP4A 3RRZA 3T12A 3KZ1E 5LBIA 1S0UA 2N1BA 2J0UA 3MAAC 5L3RA 1GILA 1T0HB 3QEOA 3CH5A 3VHXA 2ERYA 2WWIA 4JIMA 2A30A 1TL7C 4YXWD 4DBLC 3Q5EA 1Y63A 2NO0A 1NLFA 3LW7A 4DB2A 1ZC3A 4IOMA 3PUVA 4DDWA 3G82C 5AUOB 3QKRA 3VNUA 1H8ED 2IC5A 3KQNA 3W8NA 3CX7A 1N6OA 1G7RA 1YZTA 5KUTA 2VL7A 3A58B 3PEVA 1X86B 4Q1DA 4AKHA 4HAYA 1H8EA 2CJWA 3UMRA 3MFYA 4B6EA 4IDPA 2Q9AA 5F98A 1RFLA 4AKIA 2GNOA 2JA1A 1D8TA 1IN6A 2J0QA 1S9DA 2QSZA 5AJZA 2P67A 2ZRJA 4RKEA 1WBDA 5F2EA 5DE3A 3VKGA 2ZUBA 2MMGA 1BYIA 4CEHA 3LXRA 4AK9A 2OFXA 1XDBA 4B3BA 1GRQA 4BFXA 1ZUNB 2P6RA 5AUNB 1ZP6A 1SVWA 1Z29A 3BH0A 3SR0A 5TDHA 2V4ZA 2QMUA 3UG7A 4JLOA 5SZKB 1WBBA 2P2LA 5FUWA 2GKSA 3ASZA 2PBRA 1F5NA 2JAQA 4URYR 2KBFA 1ZIPA 3VR2A 4LYFA 2OG2A 3GD7A 3KJEA 3FE2A 3P26A 1EX7A 1G41A 4IOKA 4YC7A 4OI4A 3WYFA 1EESA 3GQBA 1E32A 4B47A 2GWHA 4I1UA 1E2MA 1N2CE 4LCBA 5DIFA 3RS7A 1COWD 1KDOA 4NDZA 3U61B 3EPLA 1T9HA 2F1RA 1D6JA 2DCUA 1ELOA 3QG5A 3VR3A 3AGQA 3A1TA 3SEAA 1E2GA 1TEXA 2JCSA 1GL6A 2LKCA 4EQ6A 2BBTA 3LRPA 3L0OA 2YJTD 4KCGA 4AG6A 2OO7A 4JL6A 1S9HA 4D4JA 2D06A 3CNNA 4CRWB 1R5BA 1M34E 1Z0AA 2VSFA 3O47A 2C9CA 2D74A 4ABYA 1OH7A 3A4NA 2GJKA 3QJYA 1MO5A 1QHIA 2JATA 1CJTC 2ZSAA 4D2IA 5BWMA 3X1ZA 1XEXB 4BFSA 3NG1A 3OIWA 3WNDA 5HE8A 5EE3A 3U4QA 3TRFA 4ZDKA 1EG7A 1J7KA 3WP0A 1LB1B 4DJTA 1KK1A 3U5ZB 3QUSA 1KOFA 1E9BA 3FOZA 1FFHA 5JWOA 4FWTA 3RHFA 4DSOA 4BUJA 2VHJA 1IY0A 4BLRA 1GM5A 2C9YA 2PEZA 4QBFA 2ZSFA 4FMDF 4KFUA 1G8PA 2QT0A 1KAGA 3PEWA 1VYUA 4WIAA 1P9WA 4IW3B 2VP0A 1MH1A 4ESVA 1UJ2A 1KI6B 1B0UA 3DKPA 4C0JA 1AJEA 3WNBA 3IIKA 2WJIA 2OBLA 1KJYA 3HU1A 1KY3A 4AYWA 4NPHA 4PXAA 4URVR 4CEJB 1H8HD 1VG9B 4MQBA 4R7ZA 4EJSB 4ZCIA 5HR5A 4A82A 4DEXA 2ANBA 3UANA 2Q21A 1VCNA 3SHFA 1RE0A 2QI9C 1PUIA 1VMAA 1NJGA 4WA7A 1H8HA 3B5JA 2C9OA 4RSGA 4B73A 4D25A 1FP7A 1MR3F 5IF9A 1GDDA 4OQFA 4RD6A 2H8KA 1DELA 1KTVA 1XTIA 2QE7D 3C4JA 3AH8A 3CKLA 2QY9A 1XJ0A 4KXFB 4F93B 2O8CA 1E98A 1JQJC 1NY5A 2MSDB 1E9DA 3LVQE 4EJSC 2HF8A 4DT1B 5K8UA 1KSHA 3EZ6A 4DLUA 3FPAA 1AM4D 1IN4A 5EXSA 4L9SA 4BLPA 1U0HC 2UVQA 4JYBA 1N6LA 2PCJA 2BBSA 3GLIE 4FIDA 1W4CA 2BJVA 4ITRC 2D62A 3EAQA 2EFEB 2PLFA 1UBFA 3O8BA 5FPYA 2YINC 1OFHA 3TH5A 3PENA 3C16C 3S1AA 1UM8A 3UMSA 4URXR 2RAPA 3LW8A 3AKYA 2OHFA 1E9SA 3A1UA 1TAGA 2CL0X 3RS3A 4HI0E 3FFAA 3T1VA 3ZZ0A 2OEPA 2QPOA 2IEZA 2OCBA 3LQRA 1VYVA 2ZANA 2DFLA 2JIZD 2EQBA 4PPQA 2W2XA 1XMIA 2AD1A 2FJUA 3BFXA 1JECA 2E1RA 4IDQA 2OM2A 3THXB 2JIZA 2EFCB 3QNUA 2AFHE 1XU4A 1YR9A 4EFLA 3AEZA 3FHOA 3PUYA 1FW6A 1CEEA 1SVOA 5E7JA 1F48A 1U8AA 3QY0A 5CB8A 3HWSA 3IILA 3GJ4A 2O8DA 1X8LA 1KMHB 1MO6A 1Z0DA 1RRGA 2V1XA 3H1TA 4QL3A 1G7SA 4D82A 3LVRE 4AC9A 5C2JB 4B32A 2DFKB 2ODNA 4BASA 4FMCF 4B33A 2ONJA 1P9RA 2JLYA 2NPFA 4DDTA 3B13B 4D26A 1NVWQ 2OILA 3UWOA 2A5GA 2HCJB 2G1JA 4WZ6A 2D2EA 3AVWA 2Z4RA 3TLXA 1Q0UA 5J5CA 1U90A 1XCGB 2IYQA 4U02A 1J70A 4V0KA 4LYJA 1TX4B 2QP9X 3FWYA 2F3TA 1ZMXA 1F2TA 2GVZC 3PR1A 4ZCMA 4EPRA 5FBLB 4MRVA 2WSSD 5KSPA 2ZETA 5M04A 3QIAA 3P20A 2V55B 3RRMA 2D2FA 3D7MA 3SYNA 1U2RA 4KFRA 1DG1G 3AF3A 4QHYA 5B58C 3SQXA 1S2MA 1GNQA 221PA 3AV0B 3FYHA 1US8A 2WSSA 1W4AA 8OHMA 2P0EA 1M7BA 3AM1A 2GESA 4KYUA 1OLOA 2J41A 5TVKA 2JLUA 1YZNA 2ZE6A 1ZUIA 2ODBA 3K1JA 3CPEA 5B30A 1Z0JA 4LK2A 3DZ8A 4RD0A 4ACAA 2GTPA 3LD9A 4TYWA 5GJCA 3FMPB 1AK2A 1CTQA 1S3GA 2EVWX 3TW8B 2ZTSA 1XMVA 1DAIA 2AWNA 4TYPA 3HPQA 2CE2X 4A6XA 1E2EA 3OE7D 1G20E 4CT4B 3ZS9A 4HLCA 2RGNA 5J47A 1VYTA 5JSZB 1JAHA 3OEED 4LJ4A 5HTKA 1GNRA 1U99A 3R9WA 3EW9A 3OE7A 3U44B 2Q9BA 4DLTA 4QGHA 2RGAA 4JVMA 4TYQA 2Z0MA 4LWZA 1RRFA 2XXAA 3LO5A 3N2IA 4UKDA 1DAMA 3OEEA 1NRJB 1SKYE 1UDWA 2REXB 3BJIC 2BBOA 1FPMA 3NH9A 5AWFC 3GJ0A 3RNLA 4EDHA 2ZXUA 2O8FA 5A4JA 1E2FA 4DCTA 1A1VA 1G64A 4GOKA 1DAEA 2B21A 4A4DA 1G9XA 2W83A 3ZGXA 1E94E 1P2UA 3PXGA 1NLZA 4KLZA 1FL9A 4DC9A 1G5PA 4FI3C 3NEJA 3W6OA 1GL9B 1XF9A 5BN4A 2WZQA 2XEXA 4DHEA 1ZIOA 5JCPA 3R7WB 2XTMA 5BYKA 5KDDA 4Q9LA 2ZVPX 2MSCB 1XNJA 1X8KA 1Z0FA 3I92A 2BMDA 2HCBA 3RABA 4LBZA 4BGDA 4BECA 4UNRA 1WF3A 2OT3B 3BB4A 3QE0A 2ORWA 4J0QA 2J0UB 4F4JA 4EIWA 4Z54A 1VDZA 4XTCS 2VBCA 2FGJA 4DLVA 4U7DA 1IBRA 2C96A 4K8OA 1NP6A 2V3CC 4P4UA 4KSBA 3ASYA 1SXJB 1RVDA 4B76A 1LS6A 3ZD6A 4RFVA 3AP1A 1W48A 4HEJA 4V0LA 5JEDA 2R44A 3WHLA 4GOJA 4XVRA 4FCWA 5G41A 2UZ3A 1W4RA 3DKVA 4DCUA 2REBA 2ZITA 5KU1A 2N46A 3OIVA 5DI3B 3BBPA 1RC8A 2ECKA 1YU9A 2Y8EA 4TLEA 5CLLA 2YKGA 1SXJC 4Q4AB 1TTTA 1NMXA 4Q7LA 4JVLA 2ZRPA 3L0SA 1P2SA 1R0YA 1AIPA 3P4YA 4WVFA 3C7KA 1GRNA 1QVRA 1BOFA 1II0A 2F1IA 2BKEA 3EWSA 2OUKA 2ZS9A 3TQFA 2G88A 4TYYA 3WP1B 1DAKA 1YZGA 2MSEB 1E2IA 1KO7A 3W5IA 3PIRA 1UDXA 1YVDA 5CM8B 2VIIA 2FF7A 4P33A 1SHKA 3KTAB 3CRMA 4GFDA 3R9IA 1QHNA 5TY0A 2JLSA 4PHTA 4Y0AA 4M1MA 1RJ9A 2O52A 4JT4A 4UXIA 1S1CA 1WP9A 5IT5A 4NYIR 4PSVA 4POAA 1JALA 2IF0A 4DDUA 3I32A 2XNSA 3U6KA 1E6CA 3B1XA 4LJ9A 3L0IB 1W0JD 4Q1FA 5FTNA 3KFVA 4QG7A 3BD9A 1N0UA 3A6PC 1KO1A 4U00A 1XPOA 2C98A 1EWQA 1K5DA 1YRBA 5DI9A 2GEVA 1VPLA 1W0JA 2OXCA 4UXHA 4PPNA 3GFPA 4DUGA 3MG9A 2IYZA 1VIAA 3RLFA 1XTSA 1KK0A 1KI2A 2WKPA 3K0AA 3QI2A 2CHVA 3CX6A 2ZRKA 4CT5A 4HLQB 1PLJA 2ZRLA 1R7RA 4F4IA 1Z6AA 1TPZA 4UNSA 3PJRA 1OYYA 5JWRA 3HPRA 4MKIA 2O8BA 2IXGA 2Z5FA 1MO4A 3U3RA 4EKDA 5EE0A 2A78A 2XNDD 3EASA 4PC7A 5BQ5A 1Z6TA 2ZJYA 3VNVA 3LQQA 4DLRA 2J3EA 3K9HA 4LJAA 1I4DD 1ODFA 1Q1ZA 3A4MA 3FFBA 3D8BA 1DO0A 3FMOB 4W9MC 2XNDA 3U4QB 3WXMA 3RSLA 3CM0A 4WXRA 5K8LA 1KJWA 2C03A 4P32A 2LWIA 5J40A 2JJ1A 2J7PD 1R4AA 2VHUA 2ZRIA 1YR8A 1OXVA 1SQ5A 3MGCA 2IWRA 1W5SA 1HEIA 1Q1BA 2GAAA 2QBYA 1E9RA 1G3MA 2J7PA 5JJLA 2B6HA 1UEIA 4DRZA 1U8YA 4NU0A 4YQFA 4F92B 2EYUA 3IGFA 2PJRA 4ZO4A 3H2YA 1XWIA 1II9A 2FU5C 4MH0R 3K9NA 5EP2A 1QHSA 1ZU5A 4KV9A 1JEEA 1ZM4A 5TMPA 2CE7A 1EFHA 2RGEA 4ILEA 2W6IA 3B1YA 1RW4A 3HU3A 5B64A 1GTVA 1XCPA 2SHKA 4PX9A 5UKDA 3HYRA 4P4SA 3A36A 1VHLA 1ZD8A 4OHXA 1ZCBA 2FFHA 3ICEA 2Z83A 1XFAA 5J4VA 1N25A 2RH5A 3CUEF 4HDQB 5CYPA 2WWGA 4JL8A 4TT3D 3IO5A 1OB5A 4GZLA 4ZDJA 1N6PA 2HXSA 4IOJA 4ZCLA 3LDAA 2H17A 1Z8FA 4GBMA 3CH4B 4D0GA 3ONWA 3EIEA 2QU8A 1G17A 3F8TA 2O8CB 4R9UC 2XJ9A 2YYZA 5GJBA 2G1KA 3AVPA 3B60A 4GZMA 4C0HA 2WOOA 3LFUA 1JB1A 2BWJA 2AFIE 2FFAA 1QRAA 5CK4A 2IWHA 4JLVA 2C04A 1ZM2A 2QMEA 2DY1A 4LJ6A 1CR4A 3U3JA 3DMNA 1IXZA 4DLSA 2QG6A 4GNKA 3CRRA 1HQYE 1KSFX 4Q7MB 5F9FA 3C5CA 2HYIC 1XXHB 3OIYA 2BM0A 2H1LA 4KU4A 4XJXA 1NBMD 3N70A 3SN6A 4C4PA 2Q9CA 3CF2A 1EWRA 4FCTA 2ZSBA 1V5WA 2ZRCA 3GJ3A 3QOFA 4Q1EA 1KMQA 4GOXA 1E1QD 4WBSA 3C41J 5TXGA 4Q5IA 4A8JA 1ZM7A 1NBMA 3VQTA 2VP9A 1FZQA 1SVMA 2J1LA 3Q3JB 3L2OB 2ZJ2A 1A82A 1JR3A 1CS4C 4I1VA 4KAXA 1Q3TA 4BFTA 1E1QA 3QKTA 1U9IA 4U5XA 3VKWA 1Q44A 3LV8A 2I1VB 1XD2B 2QP4A 2QZ4A 4B3CA 5L3QA 4KITB 3PFIA 3L8ZA 2XZLA 2ZSEA 1CIPA 3UMFA 3WMEA 1YRAA 4D0NA 2ONKA 4CEIB 1WRBA 4NE2A 1IY1A 1GKUB 2O8DB 4RZXA 3GLHA 3GEEA 4E22A 4RZ3A 3UIEA 2FMXA 5JI3E 2F9MA 4RD3A 3NKVA 2F6RA 1DAFA 4NH0A 2XB4A 5FOUA 2F1JA 1ZM9A 1DS6A 3I62A 3R9XA 4LV8B 2H92A 2JJ8A 3Q5DA 4LGMA 3UK6A 2BOVA 2A9KA 4C0AC 2O5VA 1UEJA 2OXRA 4ARZB 2DWOA 4DVGA 3WMFA 4W5JA 1NBME 3N5CA 4B3DA 5HKKD 4OKSA 5EZ6B 4V03A 4C0BA 4LSGA 2OBNA 5JLJA 5AUQA 3ZZTA 2BBWA 2IEYA 3AKEA 1DPFA 5H8WA 1HTWA 4BFZA 5HKKA 5AJVB 4IXNA 4C0SA 3AVVA 3KXLA 1KZGB 2JASA 4DZZA 4N0DA 1XMJA 3SJAA 3T5DA 1T91A 2CLCX 2K5UA 3I8SA 5LB4A 1ZJ6A 4PANA 4BLTA 1UBEA 1II8B 3GLHE 2VF8A 2IW3A 3H84A 4OK6A 3AF4A 3QQ5A 3CR7A 1G3QA 2IUTA 3HU2A 2FSHA 5G40A 3WBKA 2OLJA 4OQLA 3SJBA 1N0WA 4FD2A 2C8VA 5EXPA 1AQUA 4RFSB 2QAGA 2ORIA 3PUXA 4PSAA 1AKEA 3T1QA 1M8PA 2D3WA 1KK3A 4ASUD 3ZD7A 1Z22A 2PT7A 2V9PA 5LDDC 2FV8A 1XD8A 1OPXA 3AUXA 5G53C 2VHQA 2B7BA 1JAIA 1HV8A 1P6XA 1OFIA 3TAUA 3THYA 3P1JA 4YXWA 4PAMA 4A2QA 3BRWD 1NN3A 1S8FA 2XXAB 3ZQJA 2P65A 5LD2B 3EARA 5EXTA 5CIWA 1E4YA 2DWPA 4ZIRA 1FNMA 3B1VA 1Z5ZA 1Z63A 2C99A 2XGJA 3MCAA 4PHHA 1BMFD 2RGNC 1DAHA 1VECA 1OV4A 3MWLA 1OXUA 1U81A 4GP6A 3SFZA 5C18A 3I5YA 4LBVA 1UBGA 1G291 4G0NA 2ZE8A 1BMFA 4L5BA 5J4LA 4JLAA 3X1DA 5LD2C 3K70D 1B23P 4G3XA 1KO4A 5D3QA 1WCV1 5J4HA 4OBEA 4C30A 4CYMA 2G6BA 4A0FA 2ZR9A 3VAAA 3W6NA 3CONA 3W90A 4YMVA 2WKRA 2Q6TA 2IA5A 4XTRA 3NC0C 4QBHA 4AG5A 3V4RA 1MABA 1E4VA 2VP5A 5H1YA 2DHRA 2Z6VA 4D80A 4Z8XA 4XH9B 3KKPA 3IEVA 1HURA 3FTQA 1KDRA 1TADA 2FEMA 2JGNA 3NVAA 1YQTA 3W9YA 1R8QA 4HSEA 2WWWA 3RS2A 4KO8A 3TKLA 3H86A 2QUZA 4WXPA 4Q21A 4C0LA 3QENA 2V54A 3QXSA 4AWXA 4B43A 4JYCA 3JZMA 3NXSA 4JMPA 5D3MA 3QXXA 4NMMA 3BB1A 1COWA 3VR4A 3WRXC 3Q85A 2L0XA 3BOSA 4QM7A 2O0JA 2V6JA 3IIJA 5K8TA 1JXMA 2OCPA 4PR0A 4C2TA 4Q9HA 2QM7A 1FTNA 2G9NA 1XJCA 2PL3A 3P27A 1TF5A 4KODA 5B57C 4URZR 1F60A 2GCOB 4IVQA 2R8RA 5ANRB 1NN5A 1IXRC 2C78A 2W0MA 5SZHB 4EAQA 2WMOB 4HUQB 4YDHB 5C1BA 4DWJA 2PJZA 2GJSA 1P2TA 1U0LA 3NDPA 1W36B 1QHHA 4C9BA 4Q03A 1G21E 3LNCA 2LCFA 3HP1A 2GBLC 2GZHA 1MT0A 1R5NA 4PQRA 5AUPB 2XZOA 5JI2E 3GLIA 1XP8A 4DIDA 2NMVA 4C0QC 3TVTA 3U7EB 2ZROA 1P4SA 1QDEA 2A5JA 4OYHA 4BFWA 2BKUA 1GKYA 2EU8A 5JFGA 4PO9A 1W36C 4MITA 1N6RA 2BCGY 3TIFA 3WBJA 5F9HA 4G01B 1A2BA 3M4YA 3MJHA 1G7TA 3GJ7A 1G19A 4EFMA 1TNDA 2GXQA 1SVKA 2V8OA 1KJZA 3LY5A 3VU9A 4B2LA 1X1SA 1VG1A 4JLJA 3VTKA 1KHTA 5AJYA 2QGZA 1N0VC 4JLBA 5FR2A 1VTKA 2JLVA 1E2QA 2ZJAA 4LDJA 2TMKA 2R6FA 4RY2A 1FNNA 2C77A 3DM9B 4A92A 4ERNA 1PV4A 4HLDA 4O25A 4BRWA 3QF4A 4KLNA 4TLDA 5G3YA 5FH9A 1QHGA 2IYWA 3WY9A 2FPKA 4O2LA 4B3XA 5EE5B 4HAVA 1J8MF 3CB4A 3N2EA 1T5LA 1GAJA 3BC1A 3IO3A 4X8OA 3WYGA 2QE7A 3PQCA 3L43A 5FOTA 3WNCA 3FHCB 2X2EA 3DL0A 1OIXA 2ZU6A 4M0LA 2QBYB 2ZREA 5HPYB 2O0HA 1GSIA 1XEWY 1WMSA 3QF7A 3ZJYA 3JVVA 2ZRAA 3NBYC 4TLCA 5LB2A 5KTYA 1CJKC 5FUYA 4M2LA 3OF5A 5FR1A 1HT1E 5IK2D 5JMTA 4BPBA 4GDFA 1GKIA 2VEDA 2R62A 1UFQA 3C14C 4B6FA 2ANCA 1YZUA 3BIFA 1XX6A 5DH9A 5HE9A 1HUQA 4C7OB 3K0FB 4R98A 5FTMA 2ZS8A 2ZAMA 3ADKA 3CWQA 5IK2A 3GFTA 3T5GA 1P7CA 3I72A 2KJQA 4DLWA 3KQKA 1YR6A 2HLDD 3KQUA 3IPXA 3LX5A 3TBKA 2CNWD 4LYHA 5EQTA 1R10A 4LYAA 1IONA 3SI7A 2AL7A 2VQSA 4LY6A 5FBQB 3GLGB 3EZ2A 2QTFA 1L7VC 2R65A 2HLDA 4NCHA 3P32A 1EXMA 2WAXA 2CNWA 2NIPA 2GK6A 3EZFA 1GP2A 1NSFA 2KSQA 1IM2A 4HB4A 2WKQA 4LBYA 1N5KA 4N0EA 4OHVA 4AIIA 4C0KA 2EFHB 1F3OA 3GJ8A 1IN7A 4LJYA 1X1RA 3RVBA 2JLXA 3SYLA 3MLEA 4PO1A 3BGWA 1I4TD 3T06B 4V0NA 2GJ9A 3ZDQA 5FTKA 2BM1A 4LC0A 3TK1A 3GMTA 3U3OA 4MYHA 1CU1A 3JZAA 4K46A 4Q47A 4A9AA 4JLNA 3EPJA 1G8FA 4JJKA 3GLFE 1CR0A 1KI7A 5P21A 3PEUA 4DLYA 1SVIA 2OCYC 4JSTA 1E9EA 3TR0A 4TLBA 1KNQA 4XD7D 5FUVA 2OAP1 1G6HA 3A37A 1GVNB 3LX8A 5DHFA 1S96A 1NIJA 3Q8XB 5JRZA 4HAUA 3K09A 4LHVA 4W5WA 4URWR 3Q7QA 2FOLA 2IYRA 3QKSB 2VO1A 4NYMR 5HZKA 2CHQA 4LBWA 1VCMA 1KSJA 4XD7A 4YLGA 3EWAA 2IYXA 2CXXA 2XX3A 1ZNXA 3UWKA 1J2JA 1XEWX 1FP6A 4O3MA 3AKCA 2VTKA 1FX0B 2GETA 3W3ZB 5L3QB 2J0VA 1OXTA 1TU4A 5AR1A 1WQ1R 3SBDA 5DISB 4LHWA 1DEKA 1PLKA 4I1OA 4LHZA 1FMJA 1LTQA 1KKLA 2I3BA 2AK3A 3K8YA 1OXSC 1AGPA 5JBQA 3ZVLA 2QTHA 1I2DA 1Q1EA 5FL7D 4IVRA 4ZKDA 2G3YA 1XBTA 5DO9A 4TMWA 1D2NA 1SGWA 3SZRA 1DE0A 1OH8A 5GVSA 2OBMA 2WWFA 2ZRGA 2OV2A 1ESNA 2GZDA 2QMHA 3QPUA 5LPNA 1ZD9A 3X1XA 3MWKA 2AXNA 1YZKA 4BEJA 4M21A 5FL7A 2ZYTX 3EPHA 1W46A 2PT5A 3I61A 1JPJA 2CL7X 2ZE7A 3EC1A 4TSFD 3VR6A 4JVSB 4B35A 2B8WA 2IYLD 4D6PA 4HZUB 3CRVA 4AI6A 2GAOA 1TQ4A 2XOKD 4AKEA 5AJXA 4TSFA 3DHWC 2HF9A 2J59A 5DN6D 1OIVA 4OK3A 1N6IA 1VG0B 5FOVA 4FMDB 1EFCA 1W2HA 4L8GA 2XOKA 2CDNA 1XJQA 1HA3A 1OW3B 2IL1A 1E79D 1XRJA 4MKFA 4QHSA 5DN6A 1OB2A 2QROA 3NHAA 4I99A 4TWZA 1E1RD 4XIGS 2Q0HA 2RHMA 5E7IA 4QJ3A 1E79A 4GP7A 2O8EB 2QAGB 3ICQB 1E1RA 1LVGA 2CBZA 1OJLA 2V6IA 1TUEA 1LY1A 4QM6A 5EE9A 1NVXQ 2CK3D 4M1TA 2QPTA 4XWAA 2ORVA 2FA9A 3U2QA 1NN1A 3AP3A 1AA9A 3A8TA 2F55A 4M22A 4FWIB 4TL9A 3QKRB 4XWOA 2QA5A 2ZM5A 3B82A 2CK3A 1L8QA 4TL6A 1Q12A 4US2R 2PX0A 5JZVA 1KO5A 2JLQA 1XTKA 3QG1A 4YMTA 2QAGC 2AN9A 3GPLA 1KKMA 4ZI2A 1L4YA 3KDSE 2F1HA 2CJWB 2ZVQX 2BMJA 3T35A 2BC9A 2JEOA 2YC2C 5DNYB 3SHWA 3DVLA 1BKDR 4JLMA 4E03A 3LBNA 4TMXA 3UPUA 4WZBE 3B1WA 1NMZA 3BK7A 2WPDD 3ZH9B 4FINA 2NO6A 4D4LA 3KXIA 2FNAA 1Z07A 2D7DA 1VG8A 4NBSA 2BHRA 2CCKA 4CEHB 1KY2A 2RGCA 4OK5A 1J99A 2WPDA 2NTYC 4F4CA 3PEYA 2A5FA 4XSGA 2GZAA 2NQ2C 4TZ0A 3NBZC 3X1WA 2ZUDA 4RZUA 5L8VA 1LF5A 1JXOA 1KDTA 1CKEA 2FGKA 4IHQA 4M1WA 5CIQA 2GXSA 4B2IA 1MABB 1UF9A 3LA6A 3A1VA 1NG9A 1T3HA 5JWHA 5FPKA 1E0AA 1W7AA 2EWWA 2GDJA 1XEXA 3QXHA 2NPIA 1FQKA 1OSNA 1JBKA 4JBYA 3KB2A 4B3GA 4DCNA 1ONBA 3TR5A 4QBIA 4JLPA 1AS2A 3BS4A 2QNRA 4PZZA 1UKVY 4PZYA 1MV5A 4EQ6B 4NP6A 1NNEA 2HJVA 4NL4H 4PTLA 1UKYA 1KI9A 1YE8A 1DTSA 5BN3A 2YOFA 4TMTA 3FKSD 5GADl 2OZEA 3V00A 1JNYA 4EFNA 2ZYUX 2GILA 4UQOA 1AKYA 4FMCB 3CRW1 5FPSA 5JRJA 3Q72A 3CRQA 5EZ5A 2ATVA 3C15C 1P75A 3BERA 3FKSA 1OH5A 3NH6A 4URUR 1G3IA 3KKOA 4F91B 1NKSA 2QL6A 4M9QA 4LHXA 1AS3A 1AGRA 3ZZUA 4A0GA 2IX3A 4N1AA 5C4MA 3TE6A 2J7KA 3ZIAD 2FWRA 1HQCA 4NYIQ 1E0KA 1EFRD 4Q02A 4TQ9A 2JLZA 5KNBA 1OKKD 2YHSA 4H1UA 1QHHB 1GWNA 4X8LA 2A3RA 3AVTA 3ZIAA 5K8IA 1G4UR 2I1QA 3RDPA 3TSZA 4IEIA 4PC6A 4Q1AA 1OKKA 5DYIA 5CJ2A 2Z4SA 1CJMA 3GLIB 5CLQA 1UBCA 4DT1A 3A1SA 4B34A 2JJ2D 3GJ5A 4YMSA 4JBXA 4MGZR 4Q00A 3THOA 3WYAA 2QRZA 1GFIA 5HZHA 3R8CA 4BZPA 3F3YA 1KAOA 4DB4A 4I81A 3SBEA 4DCVA 3VU9B 1ZAKA 4Q9KA 3OFND 3O8RA 1NJFA 2FPLA 5FFMA 4A1FA 4RZ2A 2YC4C 4MDEA 3SE0A 3QEJA 4BLQA 2AR7A 2ZI6A 3SFVA 1ZBDA 1YZQA 3HJNA 1KYIA 4HYYA 3OFNA 3WMGA 2PZFA 4V0ME 4TT3A 3IKJA 4R2HA 4TN1A 2NO7A 2ZPTX 2G0TA 1Z6YA 1NVVR 4WOPA 1Q20A 4M1KA 1QVAA 1LS1A 3SNHA 1S4QA 2HJGA 1U94A 3CNLA 3I5XA 2KE5A 2YOGA 1KK2A 2CLSA 3TAHA 3IIMA 3RANA 1L4UA 1Z28A 1T0JB 4ACBA 4BZQA 3RS5A 5EUMA 4Q4JA 1TU3A 1DG3A 3OZXA 3RRNA 1M74A 3PG5A 1T8UA 3PV0A 1E2JA 4JLKA 1SHZA 3S1AB 2QP3A 1Z2AA 4XSHA 2V1UA 3CNOA 4MDFA 2PH1A 3TSWA 2A7QA 2RGXA 2WSMA 1R6BX 2X19A 1A5TA 2WJYA 3EZ9A 3CWZA 1KMHA 1R0WA 1W5TA 4DEYA 2EYQA 2YWFA 3ZS8A 2QEQA 1Y3AA 1F6BA 1XZPA 3NHBA 1G4AE 2FN4A 2GK7A 5DSZA 5E3HA 3IHWA 1BIFA 4RCZA 4NYJR 4NHOA 3W8RA 4L9WA 1HY3A 5FTLA 3BH7A 3KL4A 5C46F 2FH5B 2BEJA 3PCRB 2J45A 2RCNA 2ZJ8A 3BXZA 1RPZA 3G5UA 3QBTA 3PUWA 2AWOA 1D5CA 3TW4A 4XVUA 1C4OA 3M0EA 1TF2A 1M7HA 1JEDA 2OFOA 4LV5B 1NG1A 1UKEA 2ZJBA 3QBVA 4UJ3A 3RAPR 2RKOA 2AKAB 4TLAA 2D7CA 2C95A 2W2TA 4HLUA 2WOJA 4KI0A 4XOIA 1KI8A 3MWJA 1PZNA 2XTNA 2ZJZA
chains in the Genus database with same CATH superfamily
1VJRA 3RRYA 2PH3A 2CHUA 2FPMA 3EDQA 2H0AA 4G63A 5A03A 5JHGB 1DBWA 4KXLA 1QNFA 1YFLA 1WHSB 2OCDA 1NLYA 1Z5NA 2ECQA 1WDLA 1ZN2A 2B83A 3PITA 1P5ZB 3TN7A 2GZ3A 1QU2A 3L7JA 1Y6RA 2E9SA 2I6GA 4N5LA 3HLTA 2TECE 2G07A 4YAFA 3TQOA 4JYZA 2FEOA 4NV0A 4I8DA 1F2TB 4J2HA 1P6QA 3ZJVA 4X8MA 5EMNA 5CDGA 3ZCRA 1V2HE 2H2GA 4ZTUB 3O4JA 5G0UA 2BMFA 4DNOA 2ZYWX 4HQ6A 4KC0A 2P5YA 1EHYA 3EPPA 3KVNA 2ZJFA 3CKKA 4O59O 4A2PA 3WWEA 4FMBB 2O4CA 3LCJA 4GAEA 4XX0A 3KLOA 2P9BA 5KJ6A 3Q3EA 5TGTA 4EMUA 3GMSA 1Y3DE 5TQ2B 2IZOA 3H6HA 1VJTA 2C2HA 3D0KA 3DDCA 4R8KA 4TZKA 1RYDA 3G9UA 3C6XA 1ODLA 2G0NA 5JFTA 3DLBA 1E9FA 1G98A 2FSVC 4GR9A 4D74A 1UMBB 1OLXA 2C9MA 2E85A 3LBFA 3PT5A 4HQLA 4Z53A 1ONSA 4XKJA 3WWDA 4MV8A 4LF5B 4HGPA 1SNYA 2RG7A 3FDJA 4DIMA 1TOAA 2UXDB 4JJZA 2E5FA 1R9GA 4YMUA 4JJ4A 2W58A 1BWPA 4JJ8A 4BCCA 1ULSA 2EWMA 1H0KA 2V9ZA 3AFIA 3RYIB 2P1DA 3CSDA 2Z2YA 1ACLA 4QOJA 1P2VA 3R7WA 3A6GA 1ADBA 4ASUA 1GUZA 3L7YA 1CP2A 4PZCA 3I6YA 4RCYA 3RYHB 3Q9LA 1TRKA 4L3OA 1RM5A 2DJ5A 2Q27A 2UAGA 3F4BA 4M7RA 2JI9A 1E9VA 1N2EA 3QUBA 5C7LO 2HADA 3ABRB 1NSTA 1JFLA 1U7UA 3OZDA 2HL6A 2FUG6 3H83A 5BURA 5DNUA 4RTPA 1LV8A 3B6EA 4BO6A 1VKRA 1WLSA 2V7QD 3B6ZA 1TAUA 4N0PA 3GZNB 3HB1A 1AV7A 3KUUA 3UJNA 1PJRA 4QTXA 1H42A 2GYVA 4JS0A 4E31A 2H1OA 3E1KA 5KI6A 2DR3A 2EEZA 5DTQA 1R15A 3WKEA 2EJBA 5GONB 2D1QA 3GJ6A 2YV5A 5KREA 1SXJA 4EKEA 3LTNC 2RJNA 1KQ3A 4TYNA 2Q4OA 3CA8A 1GEGA 1YRQA 4C4TA 1B4DA 2H65A 2FPOA 1VCHA 3DXZA 4ZDWA 3OLQA 4P4TA 2DQSA 4Q9JA 5T7BA 1XTJA 1O5OA 2QAJA 2WTUA 2Z8XA 2NO1A 4ZA2A 7YASA 2JIPA 3ZC3A 1GGEA 2PZLA 1PJ3A 2BP7B 3BILA 3D2CA 1NW6A 4XB6B 4F71A 3OC0A 4ROTA 4BQPA 5L3SA 3G3EA 3GA0A 4OFWA 1LPBB 1O9BA 2JAXA 2OCKA 3JPWA 3KUDA 4R05A 2Z1NA 4U5QA 5BY2A 2ODEA 3LIPA 4F38A 4JBGA 2J4FA 1V41E 3DE5X 4B71A 4ESEA 4B0OA 4S3MA 5KWJA 1YQWA 5A4KA 5EWJA 2BKXA 3BH6A 3EZLA 3LH5A 4HAWA 5LIPA 3TOZA 1M73E 3W77A 3WGTA 3ORRA 2WAMA 4JK3A 4FK8A 4H35A 3HADA 2EIHA 1F4VA 5IJ0A 3AU9A 4ZI3A 5FBRB 4HNTA 2E82A 1W25A 2GFIA 3QYJA 1SQSA 1UKBA 4TL8A 2W0SA 4TRNA 5CU7A 4ER3A 1QV6A 1QQTA 4YAUA 1KZ1A 1AOXA 1UQTA 1ULHA 4O2BA 4QOSA 2CEAA 1UZAA 4OVKA 5JS8A 2VRWA 4K9QA 2D2XA 4KUHA 4ZMRA 1RWNA 5KU1A 1C50A 3BUSA 3WYEA 1Y34E 1GCUA 2ZRNA 3MXOA 5F5XA 2AKEA 1X2EA 1RT9A 2ZEJA 2QORA 3BZWA 4GICA 4HX2A 1SXJE 4QJ5A 1VGQA 2GX6A 3FHTA 1UC5B 2AZDA 4YV1A 1UBMS 5KWSA 4KN9S 5AK0A 1P19A 3BDAA 3NEYA 1OV6A 4HKTA 1OIWA 1K3TA 2ZWOA 4YJ2A 3N75A 2X41A 4FW9A 4FJ2A 5JALA 4QNRA 5IDYA 4G5FA 2LXNA 2AZTA 5CX1B 3WYCA 1WUKS 1HDOA 2GB4A 2JAUA 2R3SA 3VX3A 1OC4A 2JDID 2JFZA 3VJKA 1NXVA 4D7AA 3SQWA 1GPMA 3RC8A 5TGDA 3UJPA 5D1NA 2VJKA 3B2EA 4V1CI 2HX1A 4R1UA 1ZQ9A 3CX8A 1ACMA 2X0KA 4PC2A 2RB4A 1CCWA 4TWRA 5EIHA 4E51A 1WIWA 2JCXA 1DMSA 5J58A 1K86A 3EMDA 1AO0A 1P1HA 3GFOA 4RIHA 5HF9A 1R8XA 2VP2A 4PQFA 4EB3A 4CKCA 2ZB8A 3AHHA 3ZHSA 2D5LA 2GMWA 2GCNA 3GGJA 2EFGA 2BDTA 2C5SA 4A73A 3CLUD 3U7QB 1ZKMA 3PDWA 5GPBA 2G71A 1FDRA 4AYTA 2RHBA 1TCVA 2JRCA 2RC5A 4M0MA 1NURA 4Y30A 1BQ4A 4MB0A 1OXKB 4Y6QA 1ZUHA 1XZDA 1TYEB 3H4MA 5F73A 1G3RA 4ADSG 4KP7A 2PIAA 4TS1A 3VH4A 3RUFA 2PMEA 5CURA 5CYOA 3WGLA 1FFEA 2W8BB 1F8GA 2Q2WA 3I1IA 3GFVA 4HDCA 5KNCH 2H4FA 2EKPA 1PO7A 3X2EA 4KKVA 1FVHA 3RC2A 4FS3A 3TUJC 1NMEA 1CG6A 4CLOB 3HU5A 3VUFA 3ZHZA 2H31A 4FXOA 4D81A 2VF7A 2IBSA 1BH2A 1G5FA 1RI4A 1C7RA 4MKGA 1U4OA 1ONOA 1TMKA 2FW6A 4MVWA 3ZK9A 1E7QA 4QU8A 3E7PA 5KPDA 1A76A 4LUCA 3B85A 5IAKA 5CB4A 2P9FA 4E4RA 2BEWA 2GPJA 1IN8A 3U6BA 2QMZA 3K20A 5BVGB 2XIJA 4AZ0B 4LI3X 3P45A 3SBXA 1EXVA 4ZVNA 3ACBA 2UYOA 1H1LA 1EFUA 4ZZ2A 3RSFA 2CVFA 2GVNA 4PNZA 1QIMA 3WK4A 2PLWA 2PGAA 2PZKA 2QRLA 4ZOBA 5DTRA 4KFTA 3WAKA 4P82A 1BCRA 4KWIA 2QRVA 2WB2A 2YX1A 3WGIA 4QRHA 4LRXA 1YHNA 1L7NA 3HVKA 4X44A 3HQ4O 2DFTA 1I01A 1YA8A 1X94A 2GCPA 3FMFA 2LZ0A 3PFCA 4GPAA 4EZEA 3U7JA 1N0IA 2DWQA 1L5LA 5DHSA 5FUXA 3G0HA 1NXWA 3BDVA 3ROKA 1DJQA 3QSYA 2PMKA 5E4YA 2GM5A 4BNZA 1IOWA 3HXPA 1T4GA 3AUAA 4HC4A 1KERA 2SNIE 3O5AA 2D54A 2WHXA 4ECEA 4QPCA 1KXZA 1DKNA 1NP3A 2V45A 4BVLA 3ZK8A 2YXLA 4UHKA 2P9YA 2K2WA 1E3SA 2RGDA 2VJDA 3ANTA 1AU9A 3DWIA 2WPNA 3ETJA 4L9RA 4W82A 5HIIA 3AB7A 3SIPA 5I8ZA 1QP7A 1RQLA 3U13A 3FF4A 4YN3A 5JMPA 3BEDA 2PZJA 4P5PA 2LBPA 4PGAA 4JH0A 3OE4A 3DT9A 2J46A 4GU5A 3QVTA 3R3VA 4OQYA 3WKAA 1A9ZA 3DBIA 3IA2A 2QUKA 1ZW6A 1I94B 1B8VA 4AURA 5E4TA 2J9RA 4LTDA 5EKXA 4ESHA 5C8DA 3GJYA 5ILOA 5HRUA 4MV5A 3DTVA 3E2IA 3V2UA 1CYDA 4HQOA 2BIFA 4W8OA 4YQZA 4H3HB 4MGYR 4MW5A 1FJ2A 3C4VA 4NKRA 5FEMA 4TKVA 5BWLA 1E1LA 2HV9A 5HQ3B 3BHMA 1P33A 1RRPA 1EQAA 2CL5A 1N2IA 4G2NA 2IZ7A 1JKFA 5LQSA 4BFCA 4BQSA 2AA3A 3E70C 3WIBA 2QYSA 1IOVA 4OH7A 4B4DA 1KRHA 4Q4JB 3RD5A 5EA2A 5E6SB 4RY8A 2YV4A 3BGOS 2VATA 1AN9A 2XTZA 3EEIA 3L7NA 3MOGA 3PHJA 1U2GC 1VIVA 3CG4A 1UZNA 1KZYC 4V0QA 5CDHA 4MUIA 4MV1A 1IMJA 1U65A 1YZLA 4BVHA 5JQGF 1GLNA 3PR3A 5BT9A 3LUKA 5AKJA 2QGNA 1W44A 4QDOA 1QGOA 1L4NA 1R5OA 3FCOA 2PX8A 4QJBA 4MQEA 3L8YA 3NALA 4ZOEA 4QTZA 5KYWB 1Y0BA 3C6KA 3VJMA 3CIOA 5TR9A 4O5AA 1C1YA 5EMJA 1XEFA 3KFXA 5IX8A 1P62B 1TTPB 1HRKA 3AM3A 5EXXA 1A8QA 4QDKA 5TQ0A 4YT2A 3Q7EA 4XYGA 5AK4A 3WOVA 1WKCA 4D9CA 3GU3A 3LKDA 1AQLA 2QQ0A 2VBFA 2EZ4A 5HUQA 3N53A 5TJ9A 1T4CB 5CJPA 2BKLA 1E3MA 1Z0IA 2XCIA 1U0FA 1SKQA 3L1JA 3PC7A 3JVEA 4MULA 5I9NA 1DO8A 2BR4A 4YASA 1RAFA 4BGEA 3PGXA 3NBQA 1W1IA 2DSNA 2ZIXA 4L95C 3RANA 1EIWA 4AQ7A 2J09A 1B6SA 1CQIA 1YMQA 3HDQA 1Z73A 4D4MA 2IRWA 2TYSB 1URPA 121PA 2QL7A 2Y93A 3A4LA 4HB3A 2PCLA 5HF6A 2D0PB 3TX6A 2IYUA 4COOA 4R6WA 1T0UA 1TI7A 3FIJA 1U9IC 3FNEA 3GT7A 3KKQA 4N6GA 4ZK6A 1LX7A 4LXGA 2E4WA 1TGVA 1W30A 1OFUX 2XVXA 2HSZA 3REQB 4DCMA 4NAHA 5JS6A 1DOAA 1PBNA 1KNXA 2ZULA 3ECSA 1JDUA 4WFKA 4JVOA 2VK8A 4BZXA 3FYUA 4GGMX 3M81A 5C4IA 3QVGB 6CHYA 4QQKA 5K4GA 1F2UA 4BXOA 4BMNA 2GJ8A 1NW9B 2OK7A 1F0PA 1NI3A 4XDHA 5CB0A 4RFSA 5J4KA 4WY5A 4DPKA 5FV7A 4UHFA 3K4HA 4D9IA 3OAAA 1U0BB 2P30A 2R48A 2R6GA 3TPFA 5K6TA 2J87A 1DSSG 4TTJA 1FDIA 2FMKA 1M1YA 2JL1A 3MCTA 4HNAB 4S12A 1RYYA 4E5DA 1M66A 1TB4A 1H6AA 1QIEA 4N3NA 1DFHA 4O63O 5ADUS 4XYMA 2X2FA 4D4KA 5ILGA 4YRSA 1DEAA 5JDIA 2H1VA 1ZR4A 2AUMA 1HNWB 1JDBB 1LDGA 5H9VA 2FN7A 3W8EA 5CFNA 3KT6A 3NTOA 1SG9A 4MW9A 3SVZA 3QTBA 4I8IA 4K81B 4YPVA 1JKXA 2EW1A 1UWLA 1T5HX 1ZMTA 2ZUCA 3F5QA 5JJIA 2AHOA 1U1DA 3D8TA 4I9NA 1SUCA 2DSTA 1QKIA 1PFKA 4HXYA 1CVIA 4KUGA 2R87A 3BA1A 4L0QA 3TTXA 1ADFA 2G4CA 1BHJA 2FP3A 3HRIA 1QFXA 3IDFA 2QW1A 5ALZA 5K8VA 2YMMA 1J90A 2VTBB 3UJ9A 1J06A 5JD4A 5SV2A 2P5TB 3I4FA 3X1YA 2A5DA 5LQUA 1CY4A 2PVPA 3QFHA 3FJOA 4DMRA 4DLXA 2YZ2A 1PYOA 5HCNA 1QQ7A 4A0RA 1HFWA 1H0HA 4TTRA 5LQKA 1EM8A 1OT3A 3OJXA 5TMBA 3EQZA 2FY8A 3T99A 1IFXA 5D5QA 4COKA 4Z4FA 3THYB 1KIMA 3AERB 2O5EA 3GNTA 3C2QA 1MAVA 2NUBA 1BE8A 4ZANA 5FAXA 3S27A 1WZEA 2A57A 2RC6A 1M1YE 3SPXA 2P68A 4Y3UA 1I3NA 4EG8A 4NCBA 2C4NA 1N7GA 4XVQA 3WVNA 1NJ2A 3GRVA 3AEKA 3VSDA 3JVUA 1KI3A 2HUNA 1P74A 2BFFA 3KNZA 1IAQA 3BAFA 3C3JA 3DZCA 3VPAA 3DFMA 2DBZA 3E7FA 2B92A 4UBLA 3FPCA 5EUCA 3BK2A 4IIDA 1T26A 2RAUA 2G08A 2VRBA 1BYUA 4MRNA 1IQPA 1MRNA 2F3QA 3RQSA 4PFKA 3W4KA 5FPHA 1N8KA 3G5LA 4RKWA 4Q05A 1CD5A 5AW6A 3IRUA 4OHPA 3FYTA 2SECE 1D04A 3NGXA 2RSLA 1MRSA 1J00A 3BGIA 1WPXA 2OY0A 3LM8A 4FOSA 4B74A 5IYZB 1QBGA 2PAAA 3PICA 1BAPA 1XCMA 2I3ZA 3D5QA 4YNBA 1E96A 1PJ2A 5JSKA 1MEOA 2GAFA 4PAWA 5EJEA 2CCGA 4U2CA 5DX1A 2X8AA 3RVNA 1E5DA 4L8VA 1D0SA 2CNDA 2HF7A 4FYKA 2FQQA 1U3TA 2AXEA 2BGTA 4Q01A 4WI1A 721PA 3HL4A 2B99A 2Y1DA 3GDGA 3PSHA 1UJ5A 3GEBA 3FVQA 1CF2O 2E87A 2I2FA 4NRDA 4RPGA 4Z7QB 3NETA 4C3ZA 1C9KA 1QG2A 1CLUA 1U2ZA 2GCOA 4A8HA 3CKMA 3HCOA 1G21B 2ZR8A 4YDSA 3R7BA 4E4YA 1MQ8B 3T7AA 1W36D 4IFBA 3AXSA 1KEKA 3B7GA 5I7UA 1SXPA 5KJFA 1O3YA 1M2NA 5ESDA 4EQZA 2QUIA 4RA9B 4QGFA 1SIUA 1ZITA 4GZ3A 1RWKA 3ESRA 3KCNA 4M4SA 1N1DA 5D3MB 4BYGA 4EI2A 1K5GA 3B78A 4NK4A 4MVXA 4NZYA 4RH0A 3SJUA 4EJ0A 1GTRA 4RGYA 1OGIA 2CNNA 4YREA 3TIGA 2C84A 3W4JA 4MQ6A 1IMOA 5ALWA 3LCRA 5FBWB 2NSLA 3LBIA 1K5HA 2IKQA 3FUXA 3BMCB 1UPAA 2JANA 2WINI 3VU8A 4LZAA 1WXGA 1DGQA 1M5UA 1V16B 2IY8A 3K0EA 4H1VA 1HLGA 3D02A 4AMVA 4RD1A 2BSQA 2J3QA 1TQDA 1HDIA 3ZYZA 3KYDB 4QNNA 4ROSA 4PBSA 1ISIA 1H9BA 3IUSA 3SZ3A 5KYKA 1KJ8A 3P19A 2YCLA 4EY6A 2M1ZA 4HDKB 4N5MA 1KVRA 1FQJA 4FE4A 3SS8A 5KOHA 2PLNA 5JNLA 4KQIA 1R8JA 2C20A 3DV9A 2B8TA 3RODA 3FGNA 4PO3X 3U49A 4WKPA 1E2PA 3OEHD 5ALUA 3AINA 4FFPA 3MS4A 4W7IA 2J0SA 3NVKI 5HJ7A 1S3SA 1R37A 5I5GA 4L3VA 3HY4A 1X87A 2OZVA 3OJOA 4KFSA 5IJWA 5LMNB 3Q8MA 4A0HA 2HMWA 4QFMA 1R8SA 5ERXA 3OOWA 2JJ1D 1A4RA 4BV2A 5KVCA 3U80A 4HRXA 4JWTA 3LKVA 1XJ5A 3N58A 4R40A 1V35A 1Y8CA 3B9QA 3FGPA 1YULA 3EGEA 2C0QA 5DGCA 3HZHA 2W00A 3WIVA 1PT9A 2G8LA 3RVSA 4BE7B 5C5DA 4U3JA 1TYCA 5KSYA 4FDVA 5FO0A 4E07A 2OAEA 1EFTA 1N57A 2HIAA 4GD3Q 1T9AA 2LDXA 2NO9A 2RIPA 2P3SA 3IVXA 1W52X 1KY5A 4W1QA 1LZLA 1F8UA 1EA5A 1IBSA 5KMGA 5AVOA 4YRBA 1LFAA 1PFWA 2GN9A 1R2QA 2OAQ1 3SLKA 1Z3IX 3P97A 3PXAA 5AOCA 3ZW9A 2DQYA 4IGEA 3OFKA 4FXPA 3QU4A 2HUPA 5ELXA 3ZJUA 2Q3FA 1F4PA 1EXDA 5CG1A 5JAPA 1KP2A 1JKJA 4Q9IA 2KLBA 5A3QA 7REQA 5LOVB 4K9PA 2OHJA 5BSMA 3LGXA 5B1SA 1H1TA 5ITVA 1ZVVA 2D4HA 3R3YA 1GNTA 1QKJA 4IDCA 1EVKA 3HNRA 4JR1A 4L78A 3VNAA 2Z6UA 3N2KA 4GWLA 4QYTA 2P4QA 3SZLA 4LF4B 3G0IA 2ZR0A 4M0FA 2ZUUA 5KJCA 3TPZA 1WXWA 3MK31 3Q8LA 2LD4A 4GS5A 3UZUA 4RAQA 4PQYA 2V74B 5FYDA 5TEVA 4QLAA 4YCBA 2OHOA 4KR2A 5F1PA 2JAHA 3F3SA 4EYEA 5C4GB 3RV4A 3Q8KA 2VOJA 1P1FA 1SZDA 4DR6B 3ILVA 4EYSA 2GEUA 4NZNA 3PD1A 5KNCA 3NQ41 3THXA 2IU3A 1ZMBA 1DQPA 1UEXC 3OO1A 5BNIA 1SELA 3MYRA 1EFPA 1QJ4A 1Q3HA 1JQKA 1Z47A 2EBWA 2HQ1A 3N87A 3WK9A 5E6UB 4F85A 5JTTA 1EG2A 3OECA 4FR5A 4G1FA 1HEYA 4NCAA 1GZSA 3CVOA 3AGPA 3EJ6A 1GSHA 4A6EA 1A5ZA 2A5YB 2YJ5A 1ECCA 3DAGA 5FPTA 3MGKA 2HMUA 4U2EA 2O2JA 1OXMA 2HIMA 3OM9A 4KVGA 3R75A 3QVMA 4D44A 2ZQ5A 3V2GA 2OE2A 3RS0A 5K09A 1E7WA 3X0DA 4FSHA 1TPYA 1NT2A 621PA 3HY3A 3QA9A 4R69A 5FAKA 1T13A 4GSLA 1EP2B 3HCCA 2BZ0A 2EP5A 4BGIA 1G4HA 1ND6A 4Q4LA 3MBOA 2GWRA 1VKOA 4TWAA 3WHIA 2PUTA 4AJ1A 1H9CA 3N07A 1QPGA 2QIPA 3ZGOA 4C1NA 3NTUA 3RVQA 3AVUA 2F1KA 5FWYB 3OT1B 2G83A 3MT9A 3MZ0A 4PM4A 1RADA 1IHXA 1UOPA 3LGAA 3QUAA 3OO0A 1WE2A 2PWBA 4EB8A 4YCLA 1HX7A 5K0FA 1CRQA 3WKCA 2DXIA 1N9GB 2OBYA 2GJAA 4D56A 4EHFA 4Y2VA 1I13A 2VDKB 2OL4A 4OHWA 4ZV4A 3TRIA 1JR3D 3R5SA 2P4UA 2NG1A 1MIOA 3DOFA 1OPRA 4QXAA 3QVJA 5HEKA 2O7QA 1Y6JA 2P2NA 3EIXA 5JSYA 1KJQA 2UYCA 3OPQA 3BMQB 1JW9B 4YJKA 2XRZA 5EP1A 4OIFA 2C4VA 5ALHA 2WA2A 5JSUA 2BFEA 1GTZA 4HWKA 4YLEA 4TVSA 4ERXA 2GLXA 3FCEA 3MMZA 2H1WA 2IEAA 4AIRA 1T3ZA 3W2FA 4BO2A 2HT6A 2VTEA 4P8RA 5B55A 2J6IA 2Q3MA 3KB1A 1VJ0A 1YACA 1XCLA 5EVJA 3RH0A 4ZCTA 3PJDA 5A9RA 4M1OA 4JQCA 3MRSA 1Z7GA 3AOEA 2XHZA 2UV8A 1N2ZA 4IH1A 2O0KA 1ZNWA 3ZX4A 1SVSA 1G1MA 3LDUA 4R3NA 4KPEC 4YP6A 3HR8A 2XRYA 5FP0A 3FSEA 1WXFA 3T1OA 1C3JA 1EAYA 1OZFA 5FOWA 1ZINA 3KPYA 3PI7A 1GPNA 4NTZA 2HCRA 1OTYA 2RB5A 3H1BA 4RABA 1XE3A 2MINB 2VHVA 4OMUA 5I7FA 3CEMA 1MB0A 1EUDB 2HBYA 4LN1A 4WVLA 2C5GA 2II6A 3WHPA 2PZ8A 1PNRA 3DZKA 4H16A 4NONA 3HV2A 1UL1X 1T4DA 4WL0A 1T43A 1Y7HA 2IHVA 2W2VA 2ZIWB 5BQPA 4BWGA 5D5HA 1KH2A 2ZDGA 3ACCA 3KEOA 4RD4A 1R0XA 1AZLA 2GA8A 3K09C 1XWWA 4HZUA 3U9LA 3D8RA 4OHYA 4LECA 3LT0A 1ZICA 5HIMA 4V1CA 2FW1A 2ZAIA 3LT2A 4YCCA 3JZFA 3WL4A 3JQDA 1GNPA 3DLPX 3TKAA 3M6XA 4WKGA 1LJ8A 3LP8A 4PCVA 4B8ZA 1PTJC 2V3WA 4G24A 4PZAA 3ETCA 2ATIA 4ZVVA 4UREA 3RIMA 4GI7A 5F3RA 1ORDA 1XTQA 1AKTA 1WMEA 4BQRA 2F3RA 1S1MA 4NENA 1Q91A 2P2DA 3K31A 4GPD1 4IHKA 1KGDA 3AB3A 4M1SA 4NAUA 4UNQA 2XT9A 2OKGA 4HFNA 4ENSA 1KXJA 1GD1O 2JI7A 5D2CA 5ALVA 4OQMA 1D9XA 4ZDIA 2QV7A 1PF7E 2ZQZA 5JSHA 1RM4A 1DJLA 2IHNA 3F6BX 3MAAC 4FC6A 3VJLA 2M6KA 1VKHA 1H2RS 1P1CA 2QUJA 4TM7A 5K0TA 1W75A 2WWIA 5H8WA 3GN1A 5BR7A 3IR6A 4DB2A 1O6CA 4Z3OA 2O4UX 1E89A 3FY4A 4IOMA 5AUOB 3OLXA 3QKRA 3RWBA 3DEHA 3VNUA 2NSYA 3N7UA 2XVMA 4K9LA 1IPFA 4XWWA 3W8NA 2Q0QA 4WZBB 4CKXA 1U2PA 4KH1A 3RADC 1CHNA 3A2NA 2MYTA 2CZCA 3KQVA 3A1EA 3BGSA 4H6XA 5KUTA 1N2CA 1KAQA 2VL7A 3D81A 1VI5A 1USWA 3PEVA 4Q1DA 3DW1X 5TPZA 2VKTA 1ZD3A 3EGXA 3UMRA 2PWAA 4D97A 3RS9A 1Y80A 2D5CA 1YGPA 4BNDA 4OIMA 2J0QA 1YJAA 4Z0TA 3MA0A 4NDAA 4Y9UA 3JSAA 2V0NA 4GC9A 1NWCA 5DE3A 3UJ6A 5DEOA 4BC1A 4I55A 1TRHA 4AK9A 4B3BA 1A7UA 1VJDA 3HUUA 4BFXA 2P6RA 2YZMA 2YV1A 2K7ZA 3U5TA 5TDHA 4YLYA 5SZKB 4LY0A 2P2LA 1QTIA 2P35A 1VLJA 2F3UA 3WSVA 4YT4A 3DQQA 4JEUA 5BWBA 2G7ZA 3QLJA 3HEMA 3HP4A 4AJEA 1ND5A 2DHDA 3M5DA 3GD7A 4DMFA 3KJEA 2NU7B 1H2FA 1GFWA 2YUTA 3I30X 4EZIA 1Y9JA 1IC6A 1G41A 4IOKA 4MR9B 3ZN2A 3QK7A 4MVJD 4XQGA 2Z4TA 3NT2A 1ZVMA 1E32A 2P79A 3JAWA 4P53A 4B17A 4YR7A 1N2CE 2OD7A 4NV1A 1OYOA 4CHGA 5DIFA 2W2KB 3RS7A 1KDOA 3DEKA 3JXEA 1XO1A 3R1IA 3VR4D 1T9HA 3T5PA 1V8PA 4HUJA 4JA0A 3VR3A 3CSUA 3AGQA 3EDOA 3RKUA 3F4KA 1VZ3A 3HCRA 1E2GA 4BLTA 2BBTA 3LRPA 2YJTD 4FR0A 4AG6A 5DWQA 1N7HA 3FCYA 3N2ZB 4D4JA 3PRYA 4BMXA 1ZR2A 2HSEA 1ONNA 3Q7TA 3QOXA 2ADMA 1YJCA 3E3MA 3SC2B 2CFOA 3OFSA 2D74A 1OH7A 1PZMA 2BKVA 2GJKA 2BISA 2VNKA 1V95A 4JWKA 4ZQHA 1QHIA 2JATA 1CJTC 3VTZA 2Q41A 5L3VA 1XEXB 2X4IA 1IHOA 2WABA 2X22A 3NG1A 3VYWA 4C01A 1PAUA 1K3UB 1PD1A 1QZZA 1QIJA 2J9XB 2W22A 1M1UA 3PE3A 1ULUA 1TO6A 1EG7A 3GPIA 4UBMA 3WP0A 4DJTA 4X1YB 5ICGA 2N0SA 4LY3A 4CE6A 2IPLA 1D07A 4WOKA 5IMBA 4HH1A 1VL8A 2X4LA 3IUQA 1QH1A 4YRZA 2P8JA 1IHPA 2BCEA 4QYSA 4X3CA 2VHJA 4BLRA 2ZDQA 1GM5A 5BN3B 1FDTA 2C9YA 2PUGA 2PEZA 1GG5A 2OC9A 3C1AA 1MEEA 4JFRA 2IODA 1BRMA 3OQIA 2ZSFA 4WE3A 5EC8A 5F5NA 1Z0SA 2WZBA 3E5RA 3NPAA 3BF8A 2G67A 3EXIA 2POQX 5ECDA 1KAGA 1T8RA 2CDAA 5LA6A 3SNKA 4AJIA 3GMDA 4IW3B 7GPBA 4DR3B 2A7XA 4FDAA 3RRXA 1QF6A 3OZWA 1E3QA 4L27A 4EEZA 1J39A 4FHCA 4XGNA 3WNBA 3B7WA 4GEGA 2WJIA 4RDXA 2F67A 2OBLA 1KJYA 2YZKA 1KY3A 4QDUA 2YQ4A 4TV9B 4WOCA 4ZZ1A 4CEJB 1H8HD 2BZ1A 2XRFA 4P5EA 3B6KA 9LDTA 2CNKA 2VZ8A 2XCTB 1MJHA 2XUKA 4AX8A 1KOJA 1QFMA 4FZVA 1RPJA 3EF1A 1VCNA 4MLCA 2G36A 2FJ0A 1QPZA 2QF7A 1JILA 2M6SA 4EHDA 2CT8A 3RYCB 1QDLB 3CLSD 2PWYA 4KE6A 4RSGA 2FMTA 1F51E 3LUPA 1MR3F 2TS1A 1VC2A 3M4JA 1FYWA 2W11A 4TOIA 5IF9A 5I7EA 1WD7A 1LK0A 1XTIA 4LG1A 5DOVA 3CC8A 3CKLA 2Y77A 1PEDA 3EOZA 1RKUA 1H5QA 2VPWA 4W5TA 1MFZA 3UJBA 2C0PA 2QG9A 2AG8A 1U7TA 4QLOA 3U31A 1EDEA 1L5QA 1Z37A 4UM7A 2O48X 4IHJA 4OM7A 5EXSA 4L9SA 4EGSA 4JCOA 2UVQA 3BM5A 3CG0A 2O2CA 1N6LA 2FXIA 8MHTA 1KAEA 2WM2A 2BBSA 4IY1A 4BKOA 3ZDXB 4FIDA 2YASA 1XZBA 1GT6A 2AYXA 3I9KA 1ECLA 1JFVA 1TMYA 2YINC 2CV0A 3TH5A 3K6JA 3FN4A 5ENVA 4YRPA 5E38A 3S1AA 3FTDA 4BX0A 5LC1A 4ND3A 5HJ5A 2RAPA 3LW8A 1ZOOA 1KIFA 1O5TA 1BE1A 3AY7A 1DJPA 4ZQGA 3UJCA 3ITDA 2H9AA 1F6WA 3I0ZA 3LQRA 5T5QA 3DLHA 3GCWA 2Q28A 3QPBA 5ECYA 4P9NA 2DFLA 2JIZD 5AW9A 1S2GA 2EQBA 3OX4A 3WI7A 4F8YA 4ZAYA 5FRDA 4Z7JA 4Q3KA 5KJEA 2IPMA 3H2IA 3BF7A 3D6FA 3NDIA 4JJ6A 3M1LA 2C5BA 3BFXA 2E1RA 2R7KA 5EJ4A 4UDXX 3SC4A 5GIPE 2C7OA 1A9XB 1VBFA 3LUJA 3CXRA 2JF0A 1ORIA 1Y1LA 1L5HB 2H8GA 4RU1A 4J0CA 3ZV6A 2XCSB 4IQ0A 1YQEA 2ZVJA 3T6KA 5B7QA 5I6DA 3A04A 4CMKA 1IHDA 1SU8A 4DE5A 3AEZA 3SR4A 1TAHA 4FYPA 2M32A 4HBZA 4RJJA 1XKXA 3M82A 5BP7A 1U8AA 1FDSA 3WJ1A 3VV2A 3B38A 4EY8A 3R44A 4LMBA 1KMMA 3ROFA 1X8LA 4IDEA 1KMHB 3QW4B 3O7MA 1MO6A 4LOJA 3UWPA 3ZHBA 5EKDA 2V1XA 4D82A 5BSFA 1NGSA 3RUPA 4FBGA 3U0VA 3JWHA 2HQRA 5C8YA 5D8DA 2WYOA 3RUIA 4BASA 4B33A 3WGVA 1JEYB 3UAGA 1JHMA 1A7AA 4IZOA 1P9RA 1KYWA 3NHZA 4BN4A 1GGVA 4LSZA 2Z8YA 2NPFA 4BPRA 1AGNA 4DDTA 1FMTA 3BXOA 1QOZA 3C6YA 2A5GA 2HCJB 2QUHA 4CT0A 5C7IO 4BKUA 2V6GA 3AVWA 3H87A 2HB6A 1XA3A 4JP1A 5J5CA 3TLZA 1N3LA 3LHFA 2VPQA 3NRCA 3TRKA 1A9RA 1RQPA 4V0KA 3Q3GE 3TG8A 1D4AA 3FWYA 1H0SA 1TO2E 1V7PC 1ZMXA 1F2TA 3W05A 5LQDA 2AOTB 2GVZC 3F78A 3KVOA 1KC3A 4ZCMA 3B70A 4EPRA 1YWGO 4EUEA 5FBZA 4MRVA 1RMQA 2LCIA 2O8NA 2NUTA 4P80A 1OAOA 1QB7A 6LDHA 5KQPA 5M04A 3IALA 2PRIA 2D2FA 2XMPA 1Z4NA 3SYNA 1SPXA 1SD1A 4KFRA 1P7YA 4WZAB 1DG1G 3AF3A 5J2UB 4M7WA 3BE8A 4F46A 1GNQA 5B58C 3SQXA 3STWA 2L18A 2WSSA 4I4TA 2FZVA 3LWBA 1X7ZB 4S1OA 3ZI4A 2PYDA 3ZTYA 5JOQA 1HE2A 2BZGA 1J2RA 4NMHA 4JI8B 2QQGA 1ZUIA 2ODBA 2OHXA 2PTGA 4BGVA 1I9GA 4RD0A 4TYWA 1UMBA 3W1EA 2FUCA 2EVWX 3DDUA 3TW8B 2ZTSA 1X2BA 3I05A 3GAZA 4TTVA 4JZYA 1L4EA 4Y0NA 2CWDA 3DTYA 4B4UA 4FT4A 2BF4A 2PSHA 3ZS9A 5HTOA 3JD1A 1Z17A 3K2BA 3R2JA 2C2XA 4ZU1X 2P3OA 3AYXB 2Q7XA 4HYEA 1LQUA 3RYHA 3QU2A 1IRXA 1BGXT 3Q6MA 4HP8A 3EW9A 3OE7A 4PQGA 3U62A 2R6JA 2Q9BA 4LNAA 1P7VA 4N3AA 4DLTA 5I48A 4UW9A 4QGHA 2PJUA 4TYQA 3PXEA 2Z0MA 4LWZA 1BMTA 2XXAA 3LO5A 1DBVO 1VPTA 3ZR4B 3GEGA 2CXNA 3DLIA 3JTMA 4W6QA 2TMDA 3NH9A 4UMDA 5DP1A 5SY6A 3GJ0A 3GZNA 4EDHA 2ZXUA 5ALKA 2R1UA 4DCTA 2OBFA 5J59A 3SQDA 1W5FA 1PL0A 1DAEA 4A4DA 4CQNA 1G9XA 4ZV7A 4F2PA 1SUWA 1CY8A 4JYMA 5GONA 3RU9A 4EOGA 3EEQA 3IKLA 4FFVA 5L3ZA 3SHOA 2A9QA 1G5PA 2B5OA 1WUTA 3P2YA 4FI3C 1JDVA 1L5FA 4H18A 4M6WB 1DX9A 4RIFA 4AP6A 2XMBA 4EF5A 3C6QA 4JOQA 4UPDA 2YFHA 4DHEA 1I6LA 1ZIOA 1J8DA 3E8SA 3QLEA 4PFQA 1QVWA 3IX7A 1IZZA 1YL6A 2XTMA 5BYKA 5KDDA 1DQSA 4KBYA 4Q9LA 3VKUA 4AW9A 1JHYA 2BP7A 4A26A 3FMVA 1DXYA 2Q7DA 2I2CA 4JUBA 3HDGA 1HRDA 3NUQA 2Z30A 3FNFA 5CR9A 3FOEC 3UOAB 3O74A 3FD8A 3K0BA 4BECA 4OP1A 4UVHA 1JHVA 2OT3B 2JGFA 4BGDA 2CY0A 4UU1A 1TVEA 2RK6A 2HA6A 2ORWA 4H4EA 2J0UB 2QD1A 2DE0X 2Q4RA 2JAOA 4Y1FA 4CV0A 4Q34A 4KDEA 4K8OA 3N7TA 5ABPA 2HM7A 5EQFA 1XTTA 1N4DA 1OWOA 1RVDA 3G2KA 4JJAA 2ZCVA 4DV7B 1S01A 3VZDA 2BFNA 3NM5A 2GTIA 2XCQA 3AP1A 1W48A 5EHGA 2HSWA 3SVTA 2R44A 4ZJZA 3ILXA 8GPBA 1XYGA 3I5UA 3QNWA 1FC0A 1F17A 2UZ3A 1DEHA 3DZFA 3OCYA 3P9YA 5EIOA 2NXNA 3FAKA 4HY3A 4RGBA 4DCUA 2REBA 4RTLA 4TS4A 2ZITA 1G42A 2J3KA 3H1GA 4M76B 4W9NA 2WMDA 2N46A 3RRFA 3OIVA 5DI3B 3CEPB 1KL7A 3IEPA 3QX9A 3BBPA 1CQPA 2EL7A 5CLLA 2YKGA 3QUQA 1QFSA 5CT8A 3C6BA 1L7BA 3AJRA 4Q4AB 2R1VB 4PYKA 4Q7LA 2VJBA 2ZRPA 5HYVA 2BGRA 1XLVA 1R0YA 1UBKS 4F5ZA 2FRDC 5JDCA 1AIPA 5IVHA 4L74A 1F8FA 1RMYA 1QVRA 2XUZA 3C7KA 3H3XA 3CCFA 3N2NA 1K7YA 3B51X 4GW3A 5CX1A 1WB9A 2BKEA 3FVWA 2ZS9A 3FUWA 1KGSA 1NMSA 4FNMA 4JX8A 1TDJA 4L22A 4RK7A 4LIPD 3R0QA 4WXYB 4PYJA 1AGXA 2MSEB 4XM1A 3RW9A 1KO7A 1GVHA 2WTXA 5CM8B 5ALDA 5L53A 3LGSA 5ADHA 4GFDA 5TY0A 3L1UA 2P4EA 2JLSA 1DDOA 4BIMA