2C5LA

Structure of plc epsilon ras association domain with hras
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPASE HRAS
total genus 58
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c5lA00
5FFMA 2NPFA 4X8OA 1MO6A 4DIEA 2CHGA 4RVCA 5EZ6B 3RRYA 4OK3A 1QHXA 1XD2B 3I73A 1N5LA 4TZ0A 4PC7A 1GRRA 1IAQA 4RZ3A 1CR0A 2A7QA 2WWIA 2ECKA 4YLGA 1VG1A 1UADA 5EE5B 4D4KA 2WWGA 5B30A 1NLZA 1IONA 3V4RA 4G5RA 3CBQA 4JBYA 4PZYA 3GJ6A 4RSGA 4WOPA 3VU9A 4B73A 5JJLA 4ARZB 3CM0A 1ZJ6A 2HF9A 3TNFA 1Z47A 2GJ9A 2H17A 2V7QD 1G3IA 1XD2A 2O8BB 1XZQA 2RGNA 4P3YA 1DPFA 4CIDA 3SHFA 1QRAA 4P4UA 2BKEA 4H1VA 4EQ6A 1XPOA 1ZU4A 3IPXA 1YZUA 2OESA 3C4JA 4RD0A 1FOEB 1RJ9B 3ZS8A 2BWJA 4HB0A 2YOHA 4YMVA 3MJHA 2VSOA 4R98A 2G0NA 1DO0A 1BYUA 1JI0A 2BIFA 4C0BA 4EFMA 1U90A 1YHNA 5AWFC 5FOTA 2ZROA 1E1QA 3JZAA 2QAJA 2O8CB 2VP4A 5E95A 4Z8XA 1AKEA 3A8TA 3TQCA 5HZKA 2JASA 1W4AA 2ZUBA 2G3YA 3NXSA 4EJSC 1E2PA 3B13B 4ZKDA 2B8TA 2W2XA 4HLCA 3PEYA 1OH8A 1FP6A 3A4LA 3QXCA 4A0GA 3EZ9A 4LWZA 1MOZA 4JYCA 4QBIA 3AUXA 1U81A 3W5JA 5JECA 2D06A 4DC9A 1KMQA 4GMXA 5J4KA 2I3BA 1RYFA 4N0EA 3PUXA 1U8AA 2GF9A 3BFXA 2OT3B 3MJRA 2AR7A 3NG1A 4N3NA 3AP2A 4KVAA 3T1OA 4P31A 5EXTA 3EW9A 1RZ3A 3KX2A 3PV0A 3A1WA 4TWZA 3T1QA 1JQLB 1NSTA 2JDIA 2FEOA 2OLJA 4Q4AB 4JLKA 4ZIRB 1SVSA 4LSGA 4DCUA 1C1YA 4FMDB 2GDJA 5KU1A 5B64A 5H70A 2F55A 1V5WA 5CB6A 2PZFA 1GVNB 2FPKA 2QMHA 1JAHA 3PQCA 3SR0A 3I5XA 4GRAA 1PVOA 2Y8EA 2GXQA 4JBXA 3U7HB 3K09A 1GL7A 1NP6A 1SKYE 5CK5A 2ASEA 2C77A 4OQFA 3J81k 1KI6B 1ZM3A 3TW4A 4G0NA 1ANKA 3WYAA 1K8RA 2W6JD 2N42A 3LA6A 2P65A 3IHWA 2D62A 2G83A 4LHZA 4PHTA 2Q3HA 2RKOA 2ORVA 2OEPA 3UATA 1JR3E 1E6CA 2QP9X 3W9YA 1A2KC 2FSIA 2GXAA 1UEJA 3Q7QA 3ZVLA 2GJSA 3LAWA 3T1TA 4A92A 4CEIB 5FBRB 2ZUDA 4L15A 1EFCA 3QQ5A 2GXUA 4J0QA 1Q57A 5C4MA 3FHCB 1P3JA 3TBKA 4JLPA 1OYWA 4HAXA 4IJMA 4NMMA 4WBSA 4DJTA 3AQ4A 1KI1A 1MO4A 2L0XA 2WKQA 3NC1C 4C0SA 4Q01A 5FBLB 4EFLA 1VCOA 4IEIA 3L8YA 5FR1A 3UMSA 3W5IA 1X8KA 1M2OB 2CCKA 5A4JA 2VO1A 3THYA 2PX3A 1ZD9A 2IF2A 1KDPA 1N6NA 4A6PA 4DCVA 1H8ED 2W2TA 1GDDA 1VIYA 2CJWA 4U00A 1E0SA 1PLKA 2J3EA 3WP1B 1VG8A 3ZIAD 1W4RA 3ZQ6A 3HU3A 4JSYA 3FFBA 3P27A 5JWHA 3IKJA 1N6KA 3IBGA 1AIPA 1ZNYA 2HUPA 2R6DA 4LK2A 4EJSA 1E0AA 1DAEA 3IILA 1OXXK 3OESA 2CJWB 2R6FA 3EWSA 3PUZA 1LV7A 4OK5A 6Q21A 4JL6A 3VR3A 4TQUS 2OV2A 1RE0A 1OFIA 4HAVA 4DCNA 3PXGA 3H0KA 3L2OB 5JSZA 1G8HA 1E2QA 2QTFA 3JVUA 4P4SB 4LJ9A 3WBKA 3F0TA 2IYXA 1Z0DA 1LFDB 2AXNA 3EZ6A 4LBWA 4O0MA 4M1MA 5E7IA 1E98A 2OCBA 3GCGA 1HQYE 3DOEA 4GMDA 4KI0A 4M53A 1OKKD 2WAYA 4O2RA 2GA8A 4DHEA 5KSZA 1KJZA 3FKSA 3I8SA 3L82B 2H1LA 4LC1A 4NZYA 2OBNA 2C78A 2FPLA 3MG9A 2ZSBA 4OL0A 2JEOA 2W6JA 4HDQB 5C1BA 4HAZA 2IA5A 2QA5A 2ZPTX 5J4VA 1GG2A 1N6LA 3RS3A 4JYBA 3CX6A 2O0HA 2EWVA 3ZIAA 1W5SA 4ACAA 4RY2A 2OO7A 5GADl 1KIMA 1WBBA 1E32A 3EPJA 4Q4JB 1IY1A 5KOYA 2RCNA 1NN1A 4RCYA 2WWFA 5CJ2A 5BYKA 2CBZA 2F1RA 3K0FB 2WJVA 4C7OA 5K8UA 2WVJA 4PO9A 1NJFA 2XB4A 3MWLA 3GJ3A 2IW3A 4TMVA 4B48A 2VHUA 4A2PA 1NIJA 1TQDA 1Q3TA 1RC8A 4PPQA 1CS4C 4AKGA 4CEHB 2V6IA 2XSZA 4V0LA 4HATA 2B7CA 4Z54A 4ZV4A 3FDIA 4WZ6A 3ICEA 4V0MA 1XCMA 2F1IA 1TEVA 4HAUA 4TTQA 1YVDA 1LF5A 3E5HA 2BM1A 3PR1A 4AYTA 2WWXA 5KSYA 2ANBA 3SJBA 1Q20A 3K1JA 3LNCA 1XP8A 5L8VA 4UQOA 1R8QA 2TMKA 4MRSA 4V0ME 2XOKA 4GZLA 2DR3A 4FXPA 4AI6A 3KKMA 2YWFA 4C4PA 2QU8A 3UWKA 4ZCLA 2OXRA 5DHFA 1GOTA 2CNWD 2YC4C 1ZNWA 3N70A 4OI1A 3NDPA 4X8MA 3HDTA 4HLUA 2R8RA 1N6OA 1Y3AA 3QKSA 3TMKA 1NBMD 4RFVA 4AYXA 2H16A 2RGDA 1WF3A 4OHZA 2O8DB 2ZREA 5EXXA 3THWA 4CEIA 2W0SA 2ZRBA 2PT5A 2HXSA 4BASA 4E03A 3GJ0A 3U44B 5F98A 3AM1A 2W6IA 1PV4A 4LV6A 2QSYA 2ZITA 3P26A 5EE1A 2ZJYA 1VECA 4LHXA 1YKSA 1UFQA 4BEJA 1J8MF 2WM9B 1XJCA 4Q1EA 2W00A 3O47A 4OHVA 1OHHD 3THXB 2N46A 2WIBA 4E09A 2KJQA 3SJAA 3GP8A 3TUJC 2CL7X 4JLJA 4MITA 1VCIA 2P6RA 2BMDA 1EX7A 3U4QB 5L3RA 4DLVA 3RS7A 1P9WA 4EPWA 1E1RD 1W36C 3X1DA 4TSFA 4AYWA 1DS6A 2E9SA 3SZRA 1O87A 1Z63A 2IYYA 1CJKC 4V02A 2QI9C 1YZNA 1T4GA 4JKYA 1E2EA 1R4AA 5FI0B 3V00A 1OH5A 3LVQE 3SEAA 1ZNZA 2UZ3A 2WOOA 1F2TA 2ONJA 3IUYA 3UMFA 3ADDA 2DYKA 4AKHA 2C03A 2VHTA 2XNDD 4MRPA 1IN8A 1P4SA 3DPUA 4MGIR 3ZJYA 2JLXA 1NI3A 3X1WA 4V0KA 4KO8A 4TLDA 4R7ZA 3QEJA 4LUCA 2HJVA 4UNNA 2JJ2D 5E3HA 1TADA 1I4TD 4MKIA 1K5DA 2JJ8A 2ZRMA 4DUGA 3QOFA 2QZ4A 2WZQA 3ICQB 3QENA 4EFNA 4H1UA 1RKBA 1KO1A 3BB3A 2AHOA 4DLSA 1TMKA 5L3QA 3QPUA 3QG5A 4E07A 4PQRA 5LDDC 5TMPA 5DE3A 4ZI3A 5CM8B 3LW7A 3N2EA 4D0GA 2HXYA 3GEIA 4QG7A 2EVWX 4QJ3A 4A9AA 4L8GA 2WPDA 3KFXA 2ZM5A 4LY6A 1ESMA 3DHWC 4LYFA 3K9LA 3L43A 2QEQA 1YE8A 3P1JA 3B85A 5BYJA 3IHLA 2WSSD 1E9DA 5JWRA 2PJZA 2AKAB 5ELXA 4DKXA 1G6HA 2JJ1A 2GAAA 3DVLA 2PCJA 1ELOA 4KV9A 2DY1A 3OIWA 4KU4A 4LC0A 4CW7A 5KHOC 3W3AA 4OQMA 1Z2AA 2F9MA 3B1XA 1Z6XA 3UMRA 5AK0A 2O8FA 4Q4HA 1XX6A 4JIMA 4B76A 4NE2A 3RABA 1OIVA 3I4LA 3RRZA 2NMVA 4QJ4A 1UPTA 4Z1MD 1TX4B 2J0QA 1KI7A 1RRFA 3IEVA 2XXAA 3H4MA 3GLFA 1CR1A 1B0UA 5AJXA 2RGCA 2YKGA 4D81A 2KE5A 4M0LA 4UNRA 4ESVA 5JJIA 1SQ5A 1XD9A 5BN3A 3GJ8A 1G9XA 2IYSA 4M22A 2NPIA 2V9PA 1XPRA 3LX5A 4A0HA 1XTKA 3LQQA 2CCJA 1KK3A 1J7KA 3QSYA 3BC1A 2YYZA 3FPAA 2IX3A 1XTIA 1Q12A 2RMKA 1ZNXA 3FKQA 2UKDA 3AKCA 4LHWA 3FMIA 4RKEA 4MDFA 4HB4A 4TN1A 4XSHA 2O8EA 1E9SA 2C9YA 3QKRA 2OG2A 1W48A 3SYNA 4G3XA 4Q66C 3RWOA 2F1JA 1SHZA 3K70D 1G5TA 1R0ZA 1Z28A 1HH4A 3OF5A 3P20A 1N2CE 1D6JA 4FN5A 1PLLA 3QXSA 4GI7A 4LGMA 2VLIA 2ZU6A 4D4LA 3EIEA 5FOXA 4FIDA 1XXHB 2D7CA 2CNWA 3CONA 4DDTA 5JWOA 1YR6A 2FMXA 4BEBA 1UBGA 121PA 2ZJ2A 4IVRA 4B3DA 5DI3B 3TJZA 1XEWY 1ZMXA 2SHKA 1H8HA 2IS2A 3RNLA 3NTUA 1U8YA 1CP2A 2JLVA 1ZU5A 2J41A 1NVVR 3SYLA 2ODNA 1E1RA 5FUVA 4ACBA 3AP3A 3DDCA 3KQNA 2GEUA 2FE4A 3PENA 4RD4A 3U3OA 4F4CA 2V1XA 2PJRA 1QG2A 4B43A 1KTVA 4JJZA 2JATA 2BV3A 3E2IA 2WOJA 1GUAA 2ZJOA 4BZXA 1FTSA 4YQFA 1R5BA 3PEWA 3CNOA 3P4XA 4DB2A 3I92A 1G3MA 3W6PA 2A3RA 4DLWA 4URWR 1DELA 5F2EA 4TYWA 1FX0B 3S1AA 2NO9A 3KTAB 1N25A 2CVFA 1OLOA 2QT0A 1OF1A 1M1YE 2FSFA 4DLZA 5BQ5A 4Q4HB 3ZVRA 2AFHE 4D4JA 4PSVA 3TSOA 3K9HA 4YMTA 2GJAA 3FKSD 5KSPA 1N0VC 2XB2A 2OFXA 4YXWA 4PQYA 1J70A 3GQBA 1BYIA 4XWKA 4DWJA 1X8LA 2W2VA 3U7FB 2YV5A 4MKGA 5FTMA 3L0PA 3W6NA 2IC5A 1CF4A 1DAIA 2C2HA 3THWB 1ETUA 2QQ0A 4G5GA 2JLZA 5BW8A 1NG9A 3BRWD 3IO3A 4GNKA 4U5XA 3VR2A 3WRYC 2B92A 2WWWA 5FTNA 5JEDA 2KBFA 1UEIA 2DFKB 2IXGA 3OEEA 2GBLA 5DGXA 5KYKA 1G5PA 3T15A 1J99A 1U0LA 2FFHA 4Q9HA 3R20A 4IDQA 4JKIA 4NCHA 3UANA 1MR3F 2E87A 1CJUC 3Q72A 1IN7A 1E2FA 1Q1QA 3SJCA 2XZOA 1TU3A 1DAKA 2J0VA 2WTUA 3G82C 5AUPB 1GSIA 3KZ1E 4PR0A 3O8RA 3FHTA 5F9FA 1I4LD 4EPRA 4BLQA 1NVXQ 2ZSEA 3MWKA 4P4TA 1XJ0A 4Q47A 3ZYCA 1W1WA 3W8RA 2IXEA 2OCYC 2FN4A 3BIFA 1ZP6A 3GEEA 4AIIA 3KJEA 3ZQJA 3IDQA 5CITA 2BMEA 3PVSA 3HPQA 3FYHA 2F9LA 5FPKA 2J7PD 3PEUA 5JI3E 2P6UA 5IHPA 1S8FA 4QHSA 4WXRA 1A1VA 4A8JB 4LPSA 1NN5A 5C4GB 2HYDA 2ZS7A 4MKHA 3VNVA 4GPTA 4HEJA 2WPDD 3FTQA 3I8XA 1R0XA 2QENA 4RCZA 4CZ2A 1NNEA 4QRHA 621PA 4WA7A 4NH0A 2AK2A 3AB3A 3MLEA 3W90A 1NVVQ 2X1VA 821PA 5AJYA 3K70B 2XEXA 4DCSA 2ZYUX 2JLYA 1Z0KA 4IFBA 2JLSA 3DZDA 1E4YA 4PPGA 3PCRB 4WXPA 1FQJA 3QIAA 5DSZA 3R9IA 1AK2A 1X86B 2OFOA 1YR9A 4TL6A 1EGAA 4NYJR 1KK0A 1TQ2A 2ZE8A 3CZQA 3RSOA 1SVWA 3GLHB 3ZZ0A 1XXHE 2JLQA 4B3BA 4LOAA 4NTZA 1OE0A 1SGWA 3KUCA 4CT4B 1U94A 4TTPA 2IBMA 5TV2A 1Q3HA 2ZUCA 2FZLA 2RGBA 3QVVA 2ZRHA 3DMNA 4IDHA 4OI4A 3W6OA 4ERNA 5K8TA 1RPZA 2Q9BA 4ON9A 3B2EA 3V9PA 2ZANA 1TL7C 2JCSA 2IYQA 3UIEA 4U02A 3KXKA 1Y63A 3G5UA 4GP6A 4HYYA 2HJGA 4B2PA 3ASYA 2PEZA 5EUMA 1JJ7A 4K81B 5FUYA 1TPZA 4DIDA 4B3XA 1VPLA 4HB2A 3ASZA 1EWQA 2QORA 3NEYA 4CF7A 2CE2X 1UJ2A 1CRQA 3RYTC 221PA 1G3UA 2DCUA 2EFHB 4NCKA 3RVBA 2ZRGA 5JZVA 4HI0E 2DB3A 3BOSA 4QKQA 1XZPA 3IBYA 3Q85A 2MMGA 5L3SA 1ZYUA 1F48A 2EFDB 4NYIQ 2C04A 3VR4A 4NCNA 4PHFA 3VFDA 1BS1A 1R0YA 2GK6A 2FNAA 5D3MA 3K53A 3FB4A 4HB3A 4GOKA 4EPVA 2BJVA 3SYKA 2ONKA 4YMSA 4TL9A 5TB5A 3CRQA 1QF9A 4FMBB 1VTKA 4BLRA 4CRWB 2FEMA 4KFSA 4F7WA 5JRJA 4XJXA 1IJEA 4NDZA 4B2IA 4EKDA 1NVWQ 2VL7A 4IFEA 4LYAA 3X1ZA 4DBLC 2XTNA 4Q9JA 1KI3A 1NBMA 4HZUA 2FGJA 4LJYA 1YQTA 3CH4B 1RVDA 4QC2A 1XTSA 1Z29A 4JBWA 4TYYA 1ZD8A 4C7OB 1M6NA 3ZH9B 4NYIR 2H7VA 4Q1FA 4XH9B 2A78A 2NG1A 1FNMA 5JFGA 3AKYA 3B60A 3LQRA 4Q18A 2CK3D 5DYIA 3WYFA 4TQAA 3A1VA 1US8B 1DARA 1ZCAA 3ZZTA 1RIFA 1BKDR 3TK1A 1W44A 2J0UB 4F4IA 1EFUA 3U3RA 1W4CA 1R0WA 2F3RA 2ZEJA 4KFTA 3ZD6A 4EJSB 2EFCB 3PG5A 1MV5A 2CXXA 2H18A 1R7RA 4PPFA 5KUTA 2XGJA 5HCNA 2XSZD 4JL5A 5F3WB 4PO8A 3UKDA 1E9EA 2GAOA 1AZTA 5E4FA 1CKEA 4A36A 2QM7A 1KY2A 1U98A 2KBEA 3C15C 2FOLA 3CRMA 4ZCIA 2PMKA 4LV5B 5KNDA 3THYB 1ZM9A 3K0SA 4JLDA 4KLNA 1IJFA 3K9NA 5JSZB 2D7DA 1PJRA 1U9IA 5L3QB 1ZC3A 1D8TA 1F6BA 1SVIA 2B21A 4MYTA 5E7MA 3R7WA 3U3KA 1S3GA 3SS8A 2ZRFA 3RC3A 1KI9A 4XIGS 3T5GA 1TQ6A 2V6JA 3SHWA 3HP1A 1H8EA 3L0OA 5CYOA 3MGCA 3PUWA 5J47A 1TF7A 3CIOA 1XEFA 3KKPA 2Q9CA 1N5KA 3QVUA 4C0QC 1U2RA 1XTQA 4R9UC 3EC2A 4GP7A 3AEZA 1SVLA 2EYUA 1KSFX 4LJ7A 1SZPA 2NZJA 4M1WA 3UWOA 4JLAA 3LBNA 4XD7A 4LJ8A 3TAUA 2OBLA 3VTKA 2YZ2A 4Q7JB 4POAA 4U7DA 4AURA 2FV8A 3VQTA 4C9BA 2N1BA 4XVRA 4RJLA 3KDSE 2QMOA 5DISB 4JVSB 1IXZA 2BKUA 3LY5A 4Q48A 4S35A 4BFVA 1EXMA 4C0AC 4F4JA 1I2DA 4S2EA 4C2TA 1E2KA 3AUYA 1X3SA 3D3QA 1G5RA 4ZDWA 2O8CA 4DSUA 1ZIPA 4E5UA 2QROA 2C98A 1CBUA 4QBGB 2W83A 3LD9A 1QDEA 1IN5A 3WY9A 2NO1A 3LDAA 3B5JA 4TL8A 1OXSC 3WYGA 3THOA 4EQ6B 5FI1B 2R6AA 2KB0A 1YRAA 5IK2D 1KDOA 3A4MA 2KI5A 4G5SA 1DBSA 1QVRA 4JMPA 2CLSA 3AGPA 1TAGA 2XNDA 5JS7A 2ZRIA 4D26A 5DHAA 1W0JD 3D31A 2NOAA 5EQTA 1KSJA 2V4ZA 1IBRA 3HYTA 5FOWA 1X6VA 1KKLA 3KB2A 3O8BA 4PQFA 3B9QA 2C95A 4LDJA 1U8ZA 3AGQA 3DO6A 2XX3A 5CLQA 5BN5A 2ZAMA 1JBKA 3ZZUA 1KSGA 1CJTC 1Z0JA 2GZHA 3F8TA 2MSDB 3WMGA 5J4LA 2XAUA 3GLGA 1CRPA 5EP4A 1KKMA 5SZKB 4DDWA 4DB4A 721PA 5EXPA 3AF2A 1NMZA 2IS1A 3D8BA 4RZ2A 4NCJA 2PH1A 1IY2A 4I1OA 2I1QA 2AD5A 2F43B 1EFTA 2J1LA 3C41J 2PL3A 4G5OA 4TT3D 5FOSA 1CJVC 1D9ZA 2ZS8A 4BZPA 1P2SA 4YXWD 1NF3A 4Q9LA 1FQKA 1YZTA 5FL7A 5EP1A 3C16C 4BRUA 1TNDA 4HAWA 4A6XA 4PC3A 5CDFA 4ZDJA 3H2YA 2QE7A 2UZIR 5B2ZA 1WBDA 2WKPA 1N3BA 4GSYA 4JSTA 3TR5A 4QGHA 3LLMA 4UXJA 1DE0A 1LF0A 4JVNA 1VCNA 2QGZA 4I1VA 1DAHA 4MKFA 4O25A 4C0HA 3BWDD 1AGRA 1YR7A 3BB4A 3OIUA 5KNCA 2B6HA 2XXAB 2IYZA 2WJIA 2GVDC 2RHDA 3BH6A 5SZHB 3CF0A 1S9HA 2BDTA 1XPUA 1KZ7B 5FUWA 1XCGB 4URYR 4HUQA 1KMHA 1MH1A 4A82A 4M4SA 3X1YA 2F43A 4HDCA 3FMFA 3LO5A 5CM9C 3AF0A 1P62B 3F5FA 3LW8A 2QP4A 1BH2A 3NH6A 4C3ZA 1WE2A 3F3YA 3IO5A 3HU1A 5LBIA 1W0KD 1Z08A 1UBEA 2CMKA 2ZRPA 3AVXA 1NY5A 1LNZA 2R9VA 5LPNA 2VIIA 4NYJQ 1XWIA 2AXPA 4V0OA 3UXMA 4TZ6A 4GL2A 4DXAA 4C2UA 1N6RA 4L9SA 2JA1A 4LHYA 2YHSA 2XTZA 4URXR 2RAPA 3EASA 1UF9A 4PAQA 421PA 2O8FB 3NBYC 3QXXA 2Q3FA 1NLFA 1VDZA 1W47A 4IOLA 3K0AA 3LWNA 2R6GA 4BFUA 2VBCA 2YC2C 4XWAA 4IOMA 3WNBA 2BBTA 4ZI2A 1F2UB 1GRNA 1E9FA 1SXJE 1ZW6A 3FE2A 4IOJA 1WDTA 3GLFE 1IXSB 4A2QA 4AG6A 2IS6A 1KI2A 2QMEA 4CDGA 2V3CC 2IUSA 4M2LA 1N6IA 3U2QA 3AVUA 2ZRKA 2IWRA 2ZRLA 1Q22A 5EP2A 1JR3A 3L8ZA 4Q03A 4NP6A 5JLJA 3IQWA 2XTMA 3TVTA 2ZJZA 1Q44A 3GFPA 4DUGD 3H1TA 3R7WB 1W4BA 3U5ZB 1YU9A 2MSEB 1UKZA 3W34A 4A8JC 2P3SA 2QBYB 1AJEA 1OFUX 5C18A 4OI2A 1M74A 3D7MA 1G17A 1CR2A 2EW1A 3PJRA 1P5ZB 1E2DA 1MABA 3ZGXA 5DN6D 3EPLA 4Q1AA 1IM2A 2Q3MA 4BLSA 1Z2CA 5FTLA 5CJPA 1GITA 2ZR7A 5AJVB 1G16A 4Q5IA 2XJ9A 4PC1A 1DO2A 3TVDA 5LD2B 1FUUA 2QAGB 1AS3A 4Q1BA 2BM0A 3C5CA 4URUR 2J0SA 4D82A 4DEXA 4Y0AA 2HEIA 2C9OA 2C5LA 1JALA 5B57C 1KGDA 2C99A 5JS8A 1A7JA 2Z4SA 3RSLA 1KMHB 4TMWA 4TMZA 2RGXA 2AKYA 4D25A 2FU5C 1OFHA 4YONB 1KK2A 2BEKA 4L5BA 5JI2E 4PZZA 3LBIA 3DOFA 4KXFB 3CZPA 4FCWA 4Q4JA 1E1QD 5LD2C 4NKRA 3M1IA 1CU1A 2JJ2A 3Q9LA 4GOXA 5AUQA 5LB4A 4EPXA 2H8KA 2ORIA 1P9NA 2QPOA 3CWQA 2ZYTX 2AX4A 4DSNA 3AF1A 4NYMR 1WMSA 2QGNA 4H9GA 1IN4A 3QXHA 2A2ZA 2V8OA 1LS6A 2LCFA 1OIWA 4W9MC 2ZJ5A 1T8UA 1S4QA 1XU4A 3KKOA 1W2GA 5D3QA 1Z22A 2GCOA 1ZUIA 1FUKA 1GKYA 2HLDA 2QY9A 1YZGA 3NWJA 2QUZA 2V54A 3NVAA 1BMFA 3RRMA 3U7GA 4JLBA 2DWOA 1IHUA 2GVZC 2XOKD 3BB1A 4KHZA 2ZSDA 2V7QA 2OUKA 4MRVA 2ZI7A 1QHIA 1N6PA 4PHGA 4OJQA 2GCNA 5FPSA 2OFWA 4FWIB 2F7SA 1NL3A 5JMTA 4GZMA 1JQJC 4IKEA 2VP5A 2WBLC 3U3MA 3G0HA 2ZETA 1E79D 4P33A 1M8PA 3A1TA 2X8AA 2ERYA 4LBVA 1OIXA 3NDBB 1Z3IX 3RRNA 1P2UA 1W0KA 2WWYA 2JLWA 1J90A 3P32A 4F91B 1E2NA 4RZUA 2A5JA 3RHFA 3IPYA 3VNUA 1D2EA 2OLKA 1II8B 1DAFA 1XEXB 1RJ9A 1XFAA 5G53C 2ZU0C 1H8HD 4G1UC 2Z0MA 1R5OA 1I4DD 3TSZA 4DRZA 2D4HA 1JPJA 1K5GA 3GPLA 1KO8A 2PZEA 2QRZA 4N0DA 4ABYA 1NN0A 2Z43A 3I5YA 2J46A 5J40A 2D2FA 4RD1A 1TF2A 1OPXA 1MO3A 3TIFA 3GLHE 2FF7A 5H8WA 2YJTD 4ESHA 4Z51A 1TUIA 5FPYA 3U7EB 3ZLJA 2G1JA 2PLFA 4FWTA 2OHFA 1MKYA 1II0A 5CIQA 3RS2A 2OILA 4X8HA 4R2HA 4P4SA 1C4OA 1G64A 1WRBA 5TDHA 4KITB 3QY0A 3CO5A 3GLHA 4B2LA 1A4RA 1T5IA 2JAQA 3VKWA 5DIFA 1YJ5A 1AZSC 1Z6GA 4NU0A 4B71A 3OFNA 3AF4A 3B6EA 1OW3B 4HDOB 1VYTA 3KQKA 5TVKA 2R65A 4LJ4A 1Z83A 1QHGA 4F92B 3KQLA 3QNUA 5FPHA 3OIYA 1NG1A 4BFTA 4PAOA 1CTQA 5BXQC 1G41A 1XXHA 5G3ZA 1W7AA 2VP2A 1JECA 2ZR9A 4Q7MB 1LVGA 2O0JA 3UG7A 5J4YA 1E9RA 1OXVA 4OQXA 1XMVA 3CF2A 1VYUA 4M8NE 2OSBA 1DVRA 1D2MA 4OBEA 4Q7LA 4A8JA 5DN6A 1ZUNB 1P2VA 4RD2A 1A2BA 4B3GA 5KPDA 2GZDA 4K46A 4M9XA 5GJVC 2J45A 1ZM4A 2YNMA 4AK9A 1ZM2A 3EXAA 1II8A 2D74A 2FFQA 3I72A 1GKIA 3EPKA 3H86A 2DFNA 2E1RA 2JJ1D 3HR7A 2BC9A 1O3YA 3SFZA 1P60A 4B32A 3KQUA 1TU4A 1GTVA 2JDID 1FTNA 2GJ8A 2R62A 1AN0A 3SFVA 4A0RA 2WSSA 5L3SB 1KJYA 1T91A 1W36B 2VTKA 4O2LA 4UJ5A 4HZIA 1KAOA 4C30A 5EE3A 4TLEA 2F1HA 2VEDA 2GXSA 2IYTA 2FX3A 5CDFE 1EX6A 1E9CA 2ZE7A 5SZJA 2RHMA 2NZ8A 3TRFA 3QXJA 4XWOA 1CIPA 1F5NA 3BS4A 1AQYA 1NY6A 3AP1A 3A37A 3BXZA 1XCPA 2F6RA 5H68A 3X2SA 3X1XA 4URZR 2NO0A 4BFSA 4YDSA 2ODBA 1XEWX 5HTKA 4DDVA 3WNDA 1OFTA 1ZAKA 1JXMA 3BE4A 1NBME 4BFYA 1COWA 1GIAA 2G9NA 2EFGA 1M7BA 3QUSA 4WVFA 3EX7C 3IGFA 2XZPA 1JAIA 3GFOA 2Q0HA 3SJZA 2IYWA 4D6PA 2HLDD 5H1YA 2QTVB 3B78A 1VMAA 4XTCS 2FH5B 3BFKA 4KVGA 4Q4AA 4ZIRA 3W3ZB 2J87A 1XEXA 5FBQB 4ZDIA 2YOGA 1VYVA 3CF6R 2GTPA 4FINA 1HT1E 3PUYA 3NKVA 1NVUQ 1QBKC 2CVHA 3GLIB 1MABB 4ZCMA 3SI7A 4B47A 2P2LA 4Q4LA 3PFIA 3WHKA 4DCTA 2A5FA 4XD7D 3VR1A 1J2JA 3QI2A 2WV9A 2X77A 4PFSA 1G291 1FW6A 3OEHD 3QBVA 2WHXA 5HCIA 4MDEA 2QAGA 1PZNA 1SXJB 1DG1G 5P21A 1UAAA 3GD7A 4KYIB 1G8YA 1E69A 2ZJ8A 5BWMA 4OHWA 4UJ3A 1ZM7A 1SHKA 1G3RA 4KFRA 4WIAA 3OHMA 2ODEA 5IK2A 1NLYA 4PSAA 2ZE6A 4UXIA 3ECCA 4EUNA 4F93B 4BFXA 2WMOB 4QNRA 1KO4A 3QEOA 1LB1B 3NEJA 3QKTA 4DDUA 1F2UA 3B9PA 1SKQA 1G7TA 1HEIA 2BHRA 3C8UA 5DI9A 2WJYA 5KPJA 1Z6AA 2GEVA 3GFTA 2VYFA 2GF0A 2JIZA 1U9IC 2C9CA 1W2HA 1XMIA 1YR8A 1KY3A 2FSHA 4XOIA 1E9AA 1T3HA 3PUVA 3QKRB 2NTYC 2OCPA 4W5JA 5JEEA 2IHBA 2VP9A 4I1SA 4QGFA 5EE0A 3DL0A 5JRZA 2ZTSA 3HJNA 3T1VA 2ZYVX 2FPMA 4KBGA 2JIZD 1XJQA 1T3LA 3DM5A 3MSXA 4A1FA 3U61B 1X1RA 4QJ5A 1DG3A 2IT1A 521PA 1KO7A 3MWJA 2WWHA 2GRJA 3FMPB 5FL7D 5FL3A 1XMSA 4V0NA 4B35A 1US8A 2JLRA 2Q6TA 1NKSA 3DEFA 4ZO4A 4BQSA 1IN6A 2WKRA 2CE7A 2ZI3A 2RH5A 1PLJA 1KHTA 1S1CA 1TUEA 2BMFA 3B7GA 1KI6A 3BFVA 1C9KA 4HSEA 3VR6A 4B3CA 2G88A 2OM2A 4Z8YA 3GMTA 2QMUA 5DNYB 4FMCF 2ZR0A 1TF5A 4AKIA 3B1YA 4QHTA 2B8WA 2FSGA 3RDPA 2YWGA 2ZVPX 1BMFD 4AWXA 4BFWA 3O8DA 4L4UA 4ZDKA 4JJKA 4B6EA 2ZSFA 4BRWA 2HT1A 1ZBDA 4BE7B 3AKEA 4UNQA 5HZHA 2QT1A 1QHSA 4AC9A 1R6BX 2R2AA 3C14C 5JCZA 3L0SA 2ZRAA 4YDHB 4Q02A 5AR1A 3LVRE 3MD0A 1JNYA 4WW0A 1UBFA 1GRQA 4JVLA 5KDOA 2IUTA 4US0R 1TQ4A 4RFSB 4YMUA 1RYHA 2FFBA 4GOJA 1J8YF 2NO6A 3D6TB 2FJUA 2H5EA 4NONA 4TLAA 3TLXA 3GLGE 3IIJA 3NBXX 2GETA 3M0EA 3KUDA 3NBFA 2QNRA 2ZI5A 2FZ4A 2QAGC 3DKVA 4FD2A 5K8IA 2XZLA 4BUJA 1JR3D 4JZKA 3EARA 3JZMA 4IEEA 4IDPA 5BN4A 5M04A 2H92A 1OKKA 4LYHA 1HT2E 2ERXA 1JB1A 3T34A 2HYIC 3SQWA 3ADKA 1P72A 2KWIA 4KFUA 4ARZA 1S1MA 4L9WA 4PHHA 1NIPA 2AN9A 2IUUA 4FCVA 4C0JA 1N0UA 4OI0A 1OXTA 5IRCD 3VAAA 3RS4A 2ZI6A 3L0IB 4IXMA 1FFHA 2AK3A 1E2IA 2BCGY 4DLUA 1QVAA 5FH9A 2VHQA 1PUIA 2ZQ5A 5HE9A 4LI0A 4R2IA 1EESA 1U99A 3FFAA 2AD1A 4W5WA 5SZIA 4CVNA 2HT6A 1QHYA 2FA9A 1XF9A 5FOUA 2V55B 4A0FA 4HUTA 1R2QA 5IDVA 5EUQB 3KB1A 2ZRJA 3IIKA 4TMXA 4N1AA 5HE8A 4URVR 2GWHA 4EPTA 3EWAA 2WIAA 3KL4A 3TKLA 1MRNA 3DKPA 1DOAA 3CPHA 5HKKD 4TYQA 3REGA 1W36D 3CW2A 1S3SA 1G7SA 2WMNB 1QHHB 4LJAA 5GJWC 1FZQA 2AWNA 2VF8A 4TL7A 1PUJA 4GFDA 5DYGA 2K5UA 1DTSA 1GWNA 2PCLA 3MCAA 1G8FA 4TMTA 1E4VA 3N2IA 1XMJA 3EIQA 3Q7PA 5F9HA 4OK6A 2ATXA 2X19A 4CT5A 3R9WA 3TE6A 4B6FA 4M1SA 3VX4A 5KNBA 4A4DA 2WJHA 4ILEA 3AVPA 4TMKA 4WZAE 2OAQ1 3IIMA 1Q21A 1G7CA 2DWPA 3LV8A 3I62A 4RKFA 4PC6A 2G0TA 3WMFA 3BH0A 3I1FA 3UK6A 3U60B 1XBTA 1BO6A 5KSOA 5CIWA 1YZLA 4P32A 5J4HA 4BZQA 2GILA 1SXJA 4YMWA 2EQBA 5GJCA 3RLFA 3U3JA 3AH8A 1JJVA 4LBZA 1HUQA 3GLGB 2R44A 3WRXC 3VMFA 5HKKA 2ZRDA 3FVQA 2FDCA 4QHYA 1WP9A 4LRWA 1UKVY 2P0EA 3SNHA 1XTRA 2GBLC 3EG5A 2QL6A 3KJIA 4M1YA 4MGKR 1L7VC 1WQ1R 2ZSAA 3T06B 1EG7A 3VKGA 3LXRA 1VG9B 3HWSA 4B34A 1W49A 5FOVA 2C8VA 5AUOB 1KSHA 3K0CC 3ND9A 2QRNA 4W7SA 4EAQA 3VKHA 4M21A 4TYNA 1CJMA 2IXFA 2VSFA 3BJIC 4JLOA 3IEUA 3T35A 1Z0IA 3T61A 1A5TA 5K8LA 2AFIE 2VP6A 4LBYA 4MH0R 2VHCA 4Q21A 3SC3A 2EU8A 3EC1A 1SKYB 1KNQA 5FBVB 1ODFA 4E22A 1UKYA 2IYLD 3BH7A 3EZ2A 4D0NA 4BPBA 3AVWA 1NMYA 2EFEB 1ZUHA 4JT2A 1SVMA 3HU2A 4FI3C 1GM5A 2EWWA 1KAGA 3KJHA 1ZRHA 3P4YA 3R9XA 4IHQA 1IXRC 1GL6A 3KTAA 3BD9A 2NGRA 2OAP1 4NHOA 5G41A 2A5YB 1GFIA 1Q1BA 4W5HA 1DADA 3CUEF 5CB8A 1OYYA 5B58C 1KOFA 4DSOA 2ZIAA 4IVPA 1ZVQA 1EFRA 1NJGA 3ZD7A 1Z07A 4QM6A 5EE9A 2D2EA 4B74A 1ZINA 5HPYB 4II7A 4HZUB 3NHAA 4BLOA 4PTLA 2PMDA 4B44A 1P7CA 3AV0B 4D4MA 1AGPA 2J0UA 4QNMA 2PX0A 5JCPA 3Q3JB 5LB2A 1SVKA 2FG5A 3KXLA 4RD6A 3UG6A 3ZVNA 3OFND 2FFAA 1G8GA 1VCMA 2VSXA 3B1ZA 4EDHA 1GL9B 2NO7A 5DH9A 1KNXA 2X2EA 3GJXC 4G5QA 5CK4A 1I2MA 3SBDA 2R6CA 3SU8A 3Q8XB 1GZSA 2VPPA 1G8PA 2VH5R 3QKSB 4RZXA 5A5GA 4WAUA 2JLUA 3WXMA 3EA5A 4MA4A 1G1MA 4D2IA 3R8CA 2GK7A 2QBYA 2A9KA 2GCPA 3AVOA 1N0WA 2CDNA 4KODA 1G21E 2RGAA 3VHXA 4TYPA 2XJ4A 2ZYWX 3BBPA 4L16A 2IWHA 1YZQA 3ADCA 1JR6A 4I1UA 3A1SA 2QQEA 1KJWA 1AM4D 1S96A 5AUNB 1HYQA 2DHRA 1TEXA 1D2NA 5KO2A 1KYIA 4QL3A 1T6NA 3TUIC 1VHLA 3AVTA 1M7HA 2BEJA 1VKJA 3THXA 5TARA 1E99A 4LHVA 1G4UR 1T8TA 1ZIOA 1QZXA 4M9ZA 1N6HA 3T12A 3A1UA 4BWYA 1OXUA 2Q21A 1CR4A 2ZI4A 2O8BA 3MWYW 1HV8A 2GKSA 1W0JA 3QJYA 2PT7A 1E94E 5JBQA 1G19A 4MYCA 3EA0A 1YZKA 4OYHA 2VRWA 2Z4RA 4DEYA 2IYVA 4OJKA 1QHHA 3UPUA 3K0FA 1Z6YA 2REXB 4QGAA 3Q5DA 2ZRNA 2WSMA 1E96A 4PSKA 4R71A 4F38A 1KI8A 2ZI9A 2XNSA 3WHLA 1Z0FA 2CK3A 1P75A 1KK1A 2VP0A 3FGNA 4KSCA 1TTTA 3PEVA 2DWQA 2BCJQ 2QPTA 1S0UA 5JHGB 1HY3A 1XNJA 2UVQA 4IW3B 1F3OA 2RGEA 4QGGA 1OH6A 4PAMA 4KYUA 3CR7A 3EZ7A 5FUXA 3TH5A 4DLXA 3NBZC 4WZBE 1GNRA 3BAFA 2XITA 4I81A 3AVQA 1SVOA 2IEYA 4IRUB 2OCAA 3LFUA 3M4YA 4HUQB 2O0KA 1OB5A 1E3MA 3A36A 1N5JA 3K0CA 2LWIA 3QPVA 4M1OA 5ANRB 4JVMA 3KXIA 4MQBA 5D3MB 3VHLB 4GBMA 5E7JA 3RS5A 3GEHA 2AWOA 4DVGA 3E1SA 4AY2A 2QSZA 5TXGA 1P6XA 3R8FA 4FMCB 3CLVA 3RS0A 3WBJA 1Z0AA 3MFYA 2ODWA 2DPXA 2LKDA 1GILA 3EZFA 4Z1MA 4PZLA 3LRPA 1GNPA 2CHVA 2HCJB 5CYPA 1D5CA 3GJ5A 2ZVQX 2O8EB 1AA9A 4QFMA 4US1R 4GT1A 4LZZA 4C0LA 3NH9A 1HA3A 1ZC4A 2OZEA 2QP3A 4ASUA 1WXQA 4HAYA 3REFA 1P61B 4CYMA 4A15A 2W6ID 3LLUA 2JGNA 4XVQA 3SDZA 3AF3A 4ZKEA 3OZXA 2J5XA 2IEZA 4RD3A 3CB4A 3ETLA 3SN6A 1E9BA 1IQPA 1F2TB 1L8QA 3TSWA 4AD8A 2YWHA 4IDOA 2AL7A 3RWMB 1DEKA 4MRRA 3CRW1 4IDNA 1FNNA 1Z6TA 4IVQA 1AS2A 2BOVA 1MO5A 2YVUA 2HDNB 2I4IA 2GNOA 4DZZA 4C0KA 1NMXA 1E2JA 4CGZA 1UDWA 4TQ9A 1DAGA 4B75A 1T3SA 1Z5ZA 1XTJA 3GLFB 3T5DA 3OAAD 4K8OA 3QPWA 3LBHA 3CRRA 2H57A 2DFLA 2QN6A 3CWZA 3BK7A 2IHYA 3E70C 4IXNA 4PXAA 2HV8A 4DT1A 1BIFA 3RC8A 4LX0A 3PIRA 2VQSA 1JXOA 1B23P 2GZAA 4KBFA 4KJZA 3OAAA 4MYUA 5C46F 1UDXA 2REBA 3SOPA 5KDDA 3QKUA 1NSFA 1R10A 3DZ8A 1UBCA 1JPNA 3QG1A 1HTWA 4V03A 2GESA 3TW8B 4A2WA 4DT1B 1CEEA 5A0FA 1P2TA 2WJJA 2I1VB 1LS1A 2G1KA 4DSTA 4UXHA 5G3YA 1R5NA 4OQLA 2PBRA 5EZ5A 3OE7D 1L2TA 4LJ6A 1X1SA 3B1WA 3C7KA 3TQFA 1GAJA 1M34E 1KI4A 1NRJB 3U6KA 1G7RA 4UKDA 8OHMA 3QF4B 4EIWA 1KO5A 1GKUB 2CCGA 2Z6VA 1L4YA 3BERA 5IF9A 4M1KA 3KFVA 3DMDA 3EAQA 5CLLA 1WB9A 5JHHB 2ANCA 4QXAA 3AVYA 1V43A 1OHHA 4B33A 2IF0A 3K9GA 2YWEA 1X8JA 2CLDX 3NC0C 4I4LA 4MUAA 3FHOA 3FWYA 4LJ5A 1JEEA 2GCOB 3OEHA 4JLNA 3K0EA 4M9QA 3M6AA 4D80A 1E2GA 1COWD 3OIVA 2MMCA 1LW7A 3K8YA 2J59A 5KTYA 2FWRA 3O8CA 1W46A 1G3QA 3DM9B 1N5IA 3HYRA 3LX8A 4KCGA 2A5GA 2ZJAA 3TR0A 2YOFA 2ZE5A 3MRSA 3QF4A 2A30A 1RRCA 2CEAA 4OHYA 3HPRA 3NIBA 5EXSA 2BVNA 4ITRC 2DBYA 5L3VA 4OQNA 1FX0A 3S1AB 1ONBA 1T9HA 5DO9A 4PANA 2HF8A 2J7PA 3KKQA 1NN3A 4JS0A 2REOA 4Y0VA 4LYJA 5C2JB 1G18A 2PEYA 2QE7D 1W5TA 1Z8FA 2IL1A 1E2MA 3BORA 1FMLA 3CX7A 4M9SA 1T0JB 3EPHA 1UKEA 4DLTA 3RANA 1MT0A 1EFRD 2CHQA 2P6NA 1CXZA 4NPHA 1AS0A 3NHBA 1IOZA 4Q00A 1DAMA 4ZPXA 2VF7A 4BLPA 4Q9IA 2VHJA 2ZJBA 4NCIA 1F60A 3LH5A 3VU9B 1E2HA 2G6BA 2IK8A 5DI3A 1XDBA 2WAXA 4XSGA 3QBTA 3VR5A 1P73A 1Q1EA 3KJGA 2O8DA 1QHNA 1G6OA 1K6MA 2OE2A 5IT5A 2IYUA 2BBWA 1IY0A 1OT3A 1SULA 2BMJA 2PLRA 3GJ7A 3MMPA 2CL0X 3Q5EA 1XB2A 4PO1A 2NIPA 3B82A 5FR2A 5GVRA 3A6PC 3WP0A 4CEJA 2CLCX 2ATVA 2BBOA 1SXJC 4AKEA 1RW4A 3B8HA 5G40A 3ND8A 1L4UA 1AQUA 4OHXA 5GVSA 1OJLA 4GDFA 3KKNA 1E0JA 1JEDA 5AJWA 4UNPA 4TTRA 3LXXA 1E79A 4LCBA 1E0KA 2A5DA 2ORWA 4BFZA 1RRGA 2GJKA 4KLZA 4P0TA 1MRSA 1Q0UA 2MSCB 3CKLA 3HR8A 3QE0A 4MRNA 4NBSA 4UNSA 5FTKA 1YRBA 3TAHA 4XVUA 1LY1A 2Z5FA 1SXJD 2GEDA 1U0HC 4FCTA 4QOSA 3GLIE 4MGZR 4OKSA 4EPYA 4PPNA 5GJBA 2QTHA 2ZXUA 3SQXA 2Z83A 4LV8B 2O5VA 1GNQA 1T5LA 4US2R 3U6BA 2HCBA 1U0JA 3H84A 5EJEA 1FPMA 3JVVA 5FPTA 1T0HB 3GJ4A 4AG5A 4CEJB 1ZD1A 4BGDA 4PX9A 4TLCA 2O52A 3CNNA 2KSQA 4Q9KA 3CPEA 4LPKA 3ZDQA 4DLRA 3MUFA 3GLIA 2IYRA 2IS4A 3ZVMA 1Q1ZA 3MAAC 2D3WA 3N5CA 1ESNA 3QF7A 4MYHA 4RFSA 1CULC 1CLUA 1KZGB 1R8SA 2J7KA 2ZS9A 3ZS9A 4B3FX 3OE7A 4KAXA 3CX8A 3CH5A 3CNLA 3EIHA 5DLQC 4Q7KA 3A4NA 2GHIA 4TLBA 2F3TA 4JL8A 1II9A 1LTQA 1S2MA 1S9DA 1QG4A 1FMJA 3VX3A 1NKTA 4HLQB 4FMDF 1WCV1 1HE8B 1RFLA 2ZRCA 3C5HA 2Q9AA 5AJZA 4NYMQ 2YINC 1FP7A 4G01B 4X8LA 3FOZA 3KQHA 4TT3A 1D9XA 4QBHA 4I99A 5UKDA 3I32A 1OV4A 4JLMA 3CPJB 4XTRA 2V1UA 2PZGA 3I61A 2VA8A 2WJGA 3RAPR 2W58A 1Z06A 1HE1C 4PC2A 1GP2A 2FGKA 4NL4H 5FTJA 3WMEA 4KSBA 4TSFD 4YC7A 5TY0A 3IQXA 3CR8A 3FMOB 3TGPA 4QM7A 2J9RA 1OSNA 4QBFA 2P5TB 1VHTA 2OXCA 1EFHA 1BOFA 1G4AE 1P9RA 3CRVA 5J5CA 2P5SA 2ZAOA 2CL6X 3A58B 4Q19A 4BECA 2BJWA 2QG6A 4D0LB 3AVVA 3U44A 1VG0B 2EYQA 1EK0A 2QM8A 4DLYA 1HQCA 2DFTA 2WICA 1RRPA 1VIAA 4JLVA 1OB2A 3SBEA 3K09C 3I3SR 3WNCA 1A82A 2LKCA 2RGNC 3ADBA 3OEED 1HURA 1G20E 4Q1CA 5HR5A 3SE0A 2P67A 1KDTA 3AKDA 1UM8A 3PITA 5KDLA 5EP3A 4CEHA 2NQ2C 2W0MA 3K0AB 3W8NA 1FL9A 3ONWA 1KDRA 2C96A 1XD8A 4HLUC 4JT4A 5FBWB 4MGYR 4Q1DA 2QPAA 4MUBA 2BBSA 4FW9A 3BGWA 1ZCBA 1M7GA 4HLDA 2RGGA 1H65A 1AKYA 2B7BA 2X2FA 1XRJA 3U4QA 4O3MA 2OBMA 3V4FA 2G77B 2RB4A 4M1TA 1E2LA 3K70C 3B1VA 4BLTA 3TUZC 1WA5A 1EWRA 1OH7A 5JJKA 4IOKA 4ASUD
chains in the Genus database with same CATH superfamily
2ZVJA 4TWJA 3TL2A 5CDHA 4M0PA 4P5EA 4JELA 3ZDDA 4H3KB 2G07A 2CHGA 3L8EA 2OHJA 3O7WA 5H82A 3TSYA 4RQBA 3BYZA 2VJLA 3QYAA 4TZ0A 2YJ3A 5A4AA 4JB8A 5CLIA 1V3UA 1GUZA 2AEJA 1YS7A 1IAQA 2HPHA 2POQX 3PSHA 4RZ3A 2VQDA 1V2HE 4AQ7A 4PLVA 1TM2A 2ECKA 3ZOKA 4KR2A 3ZNPA 4JC0A 5ALGA 1ULTA 3H6KA 5HKLA 5B30A 2Y2VA 4KW7A 3CBQA 3R09A 4JBYA 4B87A 3GGDA 3PT9A 4PZYA 3BA1A 4GI1A 2IEDA 5JD5A 1IH8A 1N8SA 2PMCA 3S81A 1J9EA 1LJUA 3LS2A 5HOEA 2PUBA 4L74A 1TMOA 2HF9A 2WT9A 1YB2A 4G26A 1Q0ZA 2H17A 2ZCVA 1G3IA 2QV7A 3GDWA 4FQ8A 2QN3A 4EW2A 4OP3A 3I53A 5KREA 5JY6A 2VF5X 1EWYA 2QMZA 1GFZA 1U8XX 3FMGA 1VKNA 4YECA 7AT1A 1X7WA 2ZB2A 3KAPA 2RC5A 4ZQBA 3U4GA 3AUAA 3CUKA 4DAEA 1GPYA 1GPBA 2OESA 5KQMA 5IH7A 4PRZA 1RJ9B 2DGDA 4WDRA 2W70A 4PV7A 4EB6B 1JG7A 2H6EA 2VSOA 4CLOB 1SMKA 2WZCA 3HRHA 2G0NA 5T3YA 3GFBA 1A98A 2A8YA 1YHNA 2EFYA 1LLUA 1X9IA 2VHWA 3SC2B 3WAGA 3IULA 1RHKA 3TOVA 1NDQA 4HL6A 4I55A 4JUBA 4NWIA 1HRKA 1UC4B 3UMBA 2AFIB 3H9QA 5FWXA 3RHZA 1QZTA 1J2UA 1S6YA 1W4AA 1P5FA 1L5SA 3WBFA 3RVPA 2BFDA 2R8OA 1E2PA 5C1PA 3EVZA 2B8TA 4EA9A 3OPYB 4HLCA 3IRVA 4A0SA 4HSGA 2M98A 2JH8A 5CA1F 4X7RA 5FPPA 1NNSA 4JB2A 1BA3A 3W5JA 3SYTA 4DC9A 3H7AA 5DNUA 1OBCA 1DINA 2I3BA 2GS9A 1GUFA 1U2EA 3FPJA 4UTRA 2GF9A 3MJRA 5KYWB 2O2SA 2PY6A 3NG1A 4RMHA 2BGTA 2GD2A 5AVUA 1K0FA 1JVBA 5EXTA 3KX2A 4CWAA 1NQXA 5CEFA 1OREA 1SVUA 3BHJA 2JAHA 3L8CA 1JQLB 1NSTA 2MINA 2OCGA 2OLJA 4HRXA 4ETWA 1GNLA 1QGED 2WU0A 4JLWA 1QHFA 3DKKA 5B12A 4OYRA 2YN4A 4FMDB 1M33A 3KV3O 2HBQA 2AOTA 5KU1A 5H70A 2F55A 4CTKA 3B53X 1H0KA 4QOFA 4RZSA 3JQ8A 2QMHA 3CLRD 3R8XA 4IRMA 3PQCA 2Y8EA 2GXQA 2VAPA 3OBIA 4JBXA 3Q8LA 4K3VA 2Z98A 4Q6WA 1ZJZA 1GL7A 5B4UA 2O1XA 5IARA 1KYQA 2V5UA 4NBTA 3NHRA 1SKYE 3OQIB 5CK5A 1RHQA 2ASEA 2ZTLA 4MCHA 4JCOA 5F21A 4H15A 2VI5A 3J81k 1ZM3A 3SXUA 3IOYA 4CM9A 1GTL1 5C8YA 2BH2A 4KRFA 4CM8B 3N8HA 3BMQB 2CLKB 5IDQA 2JAOA 1Z12A 3DE0X 4R1UA 3QFFA 3GRCA 2DU8A 1KBZA 2DR2A 2Z8ZA 2OZLA 2IH2A 4PHTA 4LHZA 3AT1A 2AI2A 2RKOA 2ORVA 3VZSA 2INGX 3X1MA 3C3DA 4K9DA 3R4VA 1JR3E 4HX2A 1A9ZA 5KI6A 1CUJA 3UATA 1E3IA 2QP9X 3CLSD 2AG6A 3SQNA 1ZCFA 4CR8A 6ABPA 2BTQA 2QQGA 1D0SA 1U3FA 3LAWA 2REQB 4INZA 3T1TA 2ZUDA 4L15A 4NZOA 3EDOA 3PCTA 4DFDA 1Q57A 4F6RB 5JO0A 3BGDA 4I6EA 2AVDA 1IY9A 3EAGA 1DCFA 3VXKA 4A16A 3YASA 1Z6ZA 4ALMA 2VYND 4BCBA 1YZVA 1PFVA 3X1JA 4WBSA 3O82A 1AUPA 1MB0A 2WKQA 3AQ4A 3NNSA 3P2EA 4TWBA 4ZQGA 1A69A 1KYYA 5FI3A 1K8XB 4B09A 1JHMA 2JD2A 4EFLA 1NPTO 7GPBA 2OBFA 4J4HA 2C2OA 2QZSA 3UMSA 3W5IA 4CL2A 5AJUA 2PX3A 2WDZA 1ZD9A 2W71A 4KXMA 1JEJA 4KNVA 1MX5A 5E6SA 4PQGA 1VIYA 3GJQA 5F1YA 1PLKA 1HM5A 1NW5A 2PKRA 3WP1B 1FU7A 5JFOA 1N75A 5MFZA 1GZDA 3F4LA 4IHAA 3P9ZA 4WGFA 3ZQ6A 4EF6A 3EDQA 4N7RA 4IDCA 3IKJA 1N6KA 4LAFA 1AIPA 1ULSA 2V45A 2R6DA 4LK2A 1GZ7A 3FNEA 4RTOA 4OK5A 4V2UA 6Q21A 2QQFA 4R0NA 4DBLE 3DZHA 4TQUS 1ZMBA 5DM0A 1SXPA 1RE0A 4Y6QA 4HX5A 4DCNA 3JQDA 3L2OB 5KMGA 2Q49A 2HK7A 2LCIA 5KKCA 2WTEA 4KO3S 1B8UA 4LGVA 2VTDA 1DRVA 1LFDB 3LYUA 4LBWA 5KNLA 2YFHA 4EB3A 5C8ZA 5E7IA 3H5VA 2MCFA 1C0EA 3FUWA 1HQYE 3RREA 1F51E 1W1UA 3U1BA 4KI0A 4EYQA 3T7JA 4XVHA 3PRJA 3TAXA 1SCIA 2QXTA 3R1IA 3TE7A 5KSZA 4BP3A 1SKAA 2BPOA 1PS0A 2H1LA 4NZYA 2MOKA 2C78A 4LF9B 2VRCA 3WB9A 2WE8A 3NJ8A 3LWZA 4KGXA 2ZSBA 3NOOA 2GERA 1PWYE 2JF0A 4MYDA 5D1HA 2FPPB 4BP9A 3LRXA 4XARA 3RS3A 3E7FA 2GNPA 3ROZA 4OHFA 4ACAA 3WGKA 5JLAA 1QGUA 3DTNA 4MI1A 4WX2B 1WBBA 4F5ZA 1GA1A 1MB2A 1RAIA 3LOQA 3CA8A 3DMRA 1QFYA 1D5WA 4BV2A 4Q4JB 4DBZA 1OYOA 1IY1A 2LDBA 3ABQB 4P58A 1JKXA 3CG0A 4RNDB 1WKBA 2WWFA 4BNTA 4G8DA 1D8AA 2FUCA 5BYKA 4WTOA 1E6WA 1RYEA 2VWPA 2WJVA 2Z2YA 4OXKA 5CAEB 2FF5A 2W6MA 3E3NA 1D1PA 3L5KA 4PO9A 4LRQA 4Y30A 1TO6A 2FXVA 1NJFA 4FFSA 3K3PA 4RJTA 4DQUA 4BCCA 3V8RA 2FZEA 4CMJA 1TT5A 4A2PA 3HXOA 1PVDA 5D87A 1Q3TA 1RC8A 3KALA 4I1PA 3GXOA 1DTWA 4BZQA 1WTCA 2V6IA 5BVGB 4HATA 3WJ1A 1CQIB 1FFBA 3T7IA 4IX1A 1ZS9A 4Z54A 4PCLA 1QU2A 1QZ3A 1LDMA 3EVGA 4TTQA 4HAUA 5A6SA 2DPGA 3DMHA 3FDZA 3I52A 5ALZA 5JCOA 1LF5A 3K9BA 5EI5A 1AVTA 1XPJA 2HDWA 1IUOA 5JYBA 4X97A 1OBFO 1P31A 1CV2A 2I5PO 3VNAA 3SJBA 3A1NA 5B6JA 4O2AA 3KWLA 3HYLA 4NMHA 2WU4A 3LNCA 5F76A 4OX9B 1ZG3A 2YYAA 2YZ7A 1R8QA 4E6EA 4Z4QA 3OOSA 1WDKA 3IE2A 3OA0A 3W3AH 4RV4A 5T57A 5BW4A 3R7SA 4GZLA 4RDXA 3BHMA 2VJNA 1Z2OX 1TW3A 2CNDA 3KKMA 3VV2A 4DA0A 1RS0A 2B9EA 2OXRA 2VCYA 3ZK9A 2H0QA 2DBQA 3DJFA 1JLMA 1ZNWA 4B3HA 4JYMA 1KJJA 3I9LA 3QXGA 3SLRA 3QVTA 1DX4A 2R8RA 3QKSA 1NBMD 4RS4A 1RYMA 2EFJA 1U1FA 4KQ2A 1PHPA 3KHTA 1DJPA 4UEKA 1U2PA 3SY8A 4AZ3B 1DDIA 4AYXA 4EUHA 5DTQA 2I78A 1XVTA 3H2JA 5MHTA 3THWA 4CEIA 2OHIA 5B6PA 2YH2A 3OCYA 2PWAA 1B14A 3GJ0A 3U44B 2GNAA 2HO4A 3HXMA 1T24A 1I13A 2I54A 3DAGA 5I9MA 4RORA 1PV4A 4LV6A 2QSYA 2R751 4YAJA 4B6QA 1UPUA 3P26A 1X7YA 2ZJYA 5EE1A 4BTVA 2R7AA 3T5PA 1XNQB 1SQFA 2VAVA 3AY7A 3EBPA 4FHGA 1U8FO 1MEJA 2QR2A 2HI0A 4O8CA 5K3FA 1R74A 1A8SA 2X0NA 4DGQA 4COKA 3BEOA 2W00A 2JKYA 4OHVA 3R24A 1GR0A 4D5GA 2PXXA 3R5JA 3SJAA 1DUVG 1YJ8A 4O33A 4XGQA 3PC4A 5KVVA 1ZK3A 4AW9A 5BQ3A 3OJOA 5MN5A 3HA7A 2BMDA 5LIRA 1B0ZA 3U4QB 4LKOA 4QUEA 2P6RA 3GRRA 3G2IA 4R2KA 2V6BA 3WZ2A 5BSUA 1LPMA 4EOGA 3WL5A 3KCNA 4RH3A 3F6EX 1Q1GA 1MAWA 4E94A 4MVJF 2GPYA 4TWAA 5JIBA 1O87A 5BPFA 1Z8DA 2XUKA 3KP1A 4CQMA 4V02A 5G4KB 1SIWA 2QI9C 4F04A 3PT5A 1W88A 3T7KA 1IXKA 4JKYA 1E2EA 2R1VA 2BFCB 3C1AA 2YFYA 5FI0B 5JSUA 1OH5A 5F73A 1Y6ZA 2WMDA 1NW8A 2Q7XA 1ECJA 3UMFA 3B1JA 1G59A 4GE3A 2VHTA 3KVYA 1YZFA 2XNDD 4MRPA 1NZJA 5J2UB 3QVKA 4UOEA 3HJRA 4L22A 1ZGJA 2Q3EA 2WNIA 3E22A 1OOEA 3WHIA 3ISJA 4OKNA 4IPTA 3O7MA 1SY7A 4TOIA 1PWZA 1AGYA 2HJVA 4CKCB 3TLKA 3RFFA 3U7IA 2JJ2D 3PGJA 5H16A 2VUUA 2BMWA 1I4TD 1MFZA 3CURA 3NNDA 4MKZA 4MKIA 2GAIA 2XZDA 5EQFA 5CU7A 5AW5A 4Z86A 3VYSB 4DUGA 2X6QA 1B1CA 1M6WA 3BX1A 2AHOA 5JQGF 3GG9A 5JZOA 1GHTA 4B3RB 1CCWA 3V8VA 1O6GA 3WNVA 4E07A 3FSGA 4LFBB 3FLMA 5TMPA 5DE3A 5LP6A 5CTJA 5EVCA 1P80A 4IX9A 4XIYA 5CM8B 4FXOA 3S44A 4IO1A 1F1JA 3OQ1A 2JW5A 3GEIA 4G4IA 1ORDA 1NM5C 1OVMA 2HFJA 2GN9A 4GS5A 1Q7RA 1U0SY 4W1SA 5EKUA 4YHHB 4CM6A 4K40A 1ESMA 3DHWC 2FUKA 5M34A 3K9LA 3L43A 2QEQA 2QYHA 4YRCA 2EGGA 3EF0A 3B85A 3HCBA 3A14A 1Y7PA 2XWQA 4DG5A 4DS3A 3WV4A 1MMFB 2XXJA 1LBIA 3V7YA 1VJRA 3IPAA 5JWRA 3Q2KA 2WFZA 5ELXA 5D3KA 4K05A 3DVLA 1E92A 1TO2E 3AR6A 4FFNA 3PQDA 4KV9A 3OIWA 5HVNA 2GCEA 3A06A 2BYTA 2FRDC 2QRMA 5AHOA 3CMMA 3OC6A 3ESQA 4LC0A 3W3AA 4OQMA 2WYUA 1Z2AA 2OZKA 3N2KB 4WACA 4G1BA 1XLUA 5HRUA 5C8XA 3VZPA 3PYXA 4JIMA 4LOLA 3RABA 1OIVA 2OA0A 1HDRA 2C2WA 3RRZA 4BO3A 5I7FA 2W42A 4KTTE 4HGPA 4Z1MD 5JC1A 2R6JA 2CMGA 5CCDA 4M6WB 2WUFA 2XXAA 1QKKA 4EKNB 3F97A 2PKCA 1AKRA 1TIBA 2XCLA 1B0UA 4TV9B 3AEQB 4AF7A 5BSGA 2RGCA 5IKXA 1AF7A 4D4HA 3KR0A 1A27A 3HCRA 1L5HA 3EVAA 1E7WA 4BKRA 4UNRA 5A5DA 3QUTA 3KSBC 1SQ5A 1VBNA 3SM9A 3BM5A 1BSVA 4GPBA 5F23A 3V9AA 3UV6A 3M9LA 3F74A 2PRIA 2Q99A 2D0IA 2C59A 4M22A 2JCVA 2QLLA 16PKA 1QCZA 4BNUA 1XPRA 3GZNB 3BF7A 5IDYA 4A0HA 3UCEA 1JAYA 1H42A 1ZN9A 1ICIA 4KUGA 1G5HA 8AT1A 2CCJA 4G85A 1OWPA 3OZDA 4QJBA 2QDXA 4TROA 1SUSA 4PXSA 2YYZA 2RHHA 3DMTA 1ZNXA 2QTNA 5GM2A 4NMWA 3VOTA 4A6EA 3AKCA 1NF8A 1ZD3A 4M9RA 4RKEA 2WV7A 1TCCA 1QFXA 4KE8A 3EXG2 4GXRA 2H7XA 4ICIA 4HB4A 1N9KA 2CXHA 4XSHA 1JHVA 2GT1A 5CPBA 2JZCA 2C9YA 2OG2A 4G3XA 2DBZA 4Q66C 3THYB 3AILA 1SHZA 4EHIA 3K70D 4YCLA 1RFGE 4JI7B 1R0ZA 3A6HA 3GMIA 1N2CE 1P29A 4GPEA 1RLTA 1Z74A 3LUKA 1VL1A 1PLLA 1Z2DA 3N59A 4FN5A 4GI7A 2RBGA 4AICA 2VLIA 2W6QA 2KMLA 1KETA 4OSOA 3FDJA 4YGYA 3EIEA 4P3NA 4D4LA 3UAWA 3LDGA 3E23A 4CLEA 3V4SA 5AW4A 1SBZA 3CONA 1EM6A 1KVTA 5ALFA 1AMUA 3PE4A 4J29A 4B3DA 121PA 1QK5A 2QG4A 2WABA 3AY6A 5DI3B 3VVMA 2SHKA 5IT0A 1JTFA 1NXXA 1PK9A 1Y81A 3S8EA 2D8AA 1NVVR 3OEYA 4R69A 2ODNA 1VJDA 4ZOAA 1E1RA 4EH1A 4GWLA 2RKBA 2Z6AA 3AP3A 3TJRA 4QT0A 1WDLA 1RM4A 1VBMA 2X2PA 4NNJA 4A6DA 4D3XA 2DG2A 3U3OA 4QARA 9MHTA 2V1XA 3GELA 2AXEA 5E9JA 3T3EA 4NH4A 2PJRA 3ENWA 5FWNA 4M7WA 4RXUA 4X3OA 2OSVA 4HRAA 2IP1A 4B85A 2NNLD 3O5AA 1FW8A 2WOJA 2ZJOA 4YALA 5HQ3B 3MBOA 3TRJA 3ORHA 5F9MA 1KPHA 4YQFA 3O21A 3PEWA 1TKCA 4JX8A 1XDWA 1N5MA 2O2HA 4NOKA 3I92A 1G3MA 2VATA 3W6PA 4D74A 3PU6A 3S1AA 5C3UA 3V7FA 1WMEA 1N25A 3KTAB 4GLFA 5ICFA 4RKWA 4DIOA 1OF1A 3U3DA 4U0JA 1HMYA 4CKBA 2GUGA 1THMA 4N3AA 3BXHA 3V1NA 4EUEA 2XRMA 5JAIA 4OHRA 2AZXA 1OBHA 3TSOA 3K9HA 5A9TA 1KZ4A 4EUSA 2YV1A 4EI7A 4Z0PA 3OHPA 5BR7A 3FOFC 2OXTA 3ENNA 4POOA 2PMFA 1RXYA 1MOQA 1DBQA 2HNAA 3L1UA 2O2IA 3KVNA 2OOSA 3MB5A 1J70A 4GX5A 5K0LA 3T9DA 3BGIA 3GQBA 3QTLA 5EFZA 2AMLA 4DWJA 4KE9A 4MLCA 2I6TA 2X3UA 2B8JA 1N2ZA 4OLHA 4BIMA 1MUUA 2Q8NA 2QL5A 3EHEA 5FTMA 3MOSA 1W52X 3VJLA 1N7JA 3M6UA 3FSEA 1MQ8B 3HABA 1U8UA 1RZVA 3GUVA 1O7JA 4G5GA 5BW8A 5DULA 3S0JA 5K6RA 3IO3A 5I9IA 1NG9A 1P17A 3VR2A 3LCJA 4H16A 3C6YA 2PKQO 2AFHB 2KBFA 1KP2A 2DFKB 2NUAB 4CCWA 3MCVA 3OEEA 5KYKA 1JAZA 1BAPA 2BEWB 4DMRA 4D8UA 4DRYA 2Q62A 4JKIA 1EH5A 4ND6A 1MR3F 3L77A 4ND1A 1CJUC 2NSLA 4X5OA 4A0QA 4D9JA 5A6VA 3MA0A 3TCXB 4BJ6A 1W59A 3UGJA 1I8TA 1V71A 2DSTA 1DAKA 3BWCA 3FRJA 3GEDA 4FOSA 4KH0A 5FWDA 3OLZA 1C50A 1XT6A 4IIEA 1BE8A 1HLGA 2JVJA 3KZ1E 3NGMA 5ESDA 4NECA 3A3KA 1H66A 2H2FA 3IUNA 5GIPE 1XELA 3Q6NA 5F9FA 4EPRA 1NFRA 4ARUA 2IY8A 2ZSEA 5IABA 3DR5A 1JLSA 2NV2B 1BXRB 3G8YA 3N53A 4IQ0A 5EHIA 4Z2YA 1U7HA 3PKZA 2PA0A 3QK7A 2YUIA 1IMOA 4IGAA 3KKEA 4K88A 3DXZA 5KAMA 4CL0A 1E63A 4BJ3A 3GEEA 4AIIA 1JDVA 1PTJC 3H3XA 5CITA 4S04A 2P4SA 2VN8A 1I6LA 4L2IB 5TSDA 4XKJA 2J7PD 5I9TA 3I0ZA 3DBHB 2QYSA 4UNIA 4O4HF 3KDAA 4ADSG 4B4WA 4WXRA 2UUBB 3ET5A 3BQ9A 1J1ZA 4LPSA 3K1ZA 4XGIA 1A1VA 5L9AA 1TCUA 1R6TA 1TZCA 1CQZA 4PLGA 2ONCA 3PD7A 4IMRA 4BVEA 1R0XA 4RCZA 4CZ2A 3DHYA 2DPMA 3GC6A 3OCWA 3WLHA 1QFJA 3FUTA 4R81A 1DMRA 2AK2A 1EVIA 4KJXA 7ADHA 2XEXA 2JLYA 2ZYUX 1EE1A 3OX2A 4OXNA 2YUTA 4AXBA 1SCNE 3DZDA 1I01A 2UZAA 3JQ9A 3QHAA 4TXHA 3EZNA 4PPGA 3PCRB 1CZKA 4WXPA 1MDFA 3GA5A 1SCJA 1FQJA 1I36A 1UBSB 1YB1A 3QIAA 3MOIA 4UCXA 3R9IA 5JYCA 4U39A 5ICCA 4F8YA 1W1IA 3G2JA 5EPEA 1MB4A 2ZBEA 3BXPA 4ZXPA 1TQ2A 3CZQA 1YMUA 2ZE8A 5HZMA 1MAHA 4YBRA 2JLQA 4JP2A 4RS3A 1V4BA 3GEMA 4LOAA 4RC9A 4Y2TA 4KKXB 2Q07A 4NTZA 5D84A 1SGWA 3KUCA 2XTJA 5ED0A 5ALNA 3ZZ1A 1WEHA 4CT4B 1FC0A 2RGBA 2XUIA 2ZRHA 4OI4A 5BSEA 3M6IA 2A7XA 1INLA 3V9PA 3ZHBA 1TL7C 4Y6PA 3ANLA 1CUCA 1EHYA 3NFRA 4Z7OB 3IDOA 4FNGA 1F8FA 3ZXIA 1JJ7A 5FUYA 4BO5A 5FXMA 1TLFA 1NTOA 4DAOA 3C5WP 4DIDA 3CZ4A 1IPEA 2C2XA 4PW0A 4HB2A 4K2AA 1ULZA 4AQYB 2Z95A 3F49S 4JUFA 2YZKA 3OJLA 4CF7A 1LTHR 1UJ2A 1CRQA 2P69A 1JLLA 3ZX4A 3G9XA 3K05A 1RKVA 3N2LA 3LKDA 4PG8A 1SUEA 2PU5A 2JHGA 3N5KA 1RWKA 5L3SA 2MMGA 5KYXA 2QIOA 4F46A 1BDMA 4YEDA 1F48A 2Z5VA 1IM8A 4B40A 4J03A 1GCGA 4W6ZA 1WD5A 2AOWA 4PLPA 4B2YA 1BJRE 4J1TC 1I7QB 1A8IA 1SUIA 1M73E 3MPOA 4MV0A 4TRRA 3K53A 2BGNA 1QMPA 4NENA 4EA8A 3SYKA 1LK0A 1CF9A 3IR6A 1W35A 1XA3A 4E51A 2GN0A 3CRQA 4N4AA 1QF9A 3DDHA 3FA2A 4FMBB 1VTKA 4X1IA 4BLRA 4CRWB 1WB6A 5L4NA 4F7WA 3UNXA 1HE2A 3U81A 5JRJA 3M83A 4FDTA 1C3OB 1PR0A 1XP5A 4KQWA 3ZBUA 2B4AA 2NADA 1K6XA 2VL7A 4KMMA 2FZKA 3OZVA 3JWGA 1MLDA 2G36A 2XTNA 5J2TF 3ZWBA 1KI3A 4BXOA 3AL0C 4HZUA 1BDJA 2FGJA 1V16B 3PFHA 2HNBA 3BCSA 2X5JO 4IF6A 4Q15A 4OOFA 4UZFA 1BA2A 2JLBA 4JBWA 4ZZ0A 5CA0A 5IF3A 1VJ5A 3ZDAA 1SURA 1DEHA 1M6NA 2V7EA 2XADA 3GBSA 4OVKA 4QD3A 3SAJA 3ZH9B 4KEAA 1S7GA 4QELA 5M2QA 4ZVLA 1JQEA 1J09A 4G97A 1D04A 3BZWA 3R3ZA 2HA3A 3B60A 4HADA 5TQVA 2I1LA 1P9OA 3TR6A 3KFLA 4NE7A 3WICA 3ZKWA 4EF5A 3ZZTA 3IP6A 2HRQA 1BKDR 4KMRA 2G7ZA 2J0UB 3TK1A 4Z3OA 1NULA 3RJ9A 1R0WA 3ZE0B 3H2GA 3ZJ5A 3ZWPA 4KFTA 2QVCA 3JVDA 2R47A 3ZD6A 1OLSB 1TZJA 4CDMA 3DW3X 2EFCB 1QH8A 3KC2A 3GLSA 1C14A 2O54A 4YQYA 1BKSB 4J75A 1PD1A 4PYRA 3W2GA 4PO8A 2ATIA 3NOXA 3O9VA 3VC1A 4YRBA 3HJTA 5E4FA 4A36A 2QM7A 2AI1A 2RI6A 3HI6A 1K6IA 1VLZA 2FOLA 3EJ6A 3FB1A 3FSJX 2CXSA 4O4LF 4EG3A 1UDCA 5HCUA 4QU5A 3F6RA 3I9KA 5A5VA 1FDTA 3K0SA 4O59O 5JSZB 1MX1A 1XQ9A 1T8YA 3FCSB 1IDN1 5G1PA 4E88A 1D8TA 2PSFA 4W99A 5HZGA 4PGMA 4TTSA 2RB5A 5DGDA 4RXTA 4G0XA 4XIGS 4YRPA 3VPSA 1FSPA 1TJYA 4EEKA 2ORED 4MCIA 3VJRA 1EUQA 4OP2A 5CYOA 3W2IA 1NM5A 4GYWA 3ZWNA 2HU7A 5J47A 4PINA 2VWQA 1SXQA 2GZ3A 4TTVA 3HSSA 5D8DA 3ITEA 1U7ZA 2YDYA 2P9ZA 4MPDA 1XTQA 3QHPA 4R9UC 3KXDA 1RPNA 5EWJB 5HILA 4CQJA 1JPVA 5BN1A 5TEVA 5LP6F 1DP4A 1KSFX 2NZJA 4WQMA 4M1WA 1WVGA 1T5DX 3W05A 4XD7A 2Y1LA 4UASA 1W6RA 2OHVA 2Z9CA 3PDCA 4LJ8A 3VTKA 4Q7JB 4JC5A 2Q8QA 4POAA 1ISIA 4U7DA 4AURA 3O8OA 3H5AA 4L78A 1J49A 1OA0A 3KJQA 4RJLA 4Q48A 3C4VA 3EGXB 4S35A 4U7TB 3MILA 1YK0A 3IXQA 1U7UA 3RRFA 2AE1A 1CLEA 1X3SA 3OM0A 1B0PA 1EYZA 4B46A 2C98A 3V4LA 3ONNA 5CW2A 2FMFA 4D8XA 3GPCA 5K0BA 1ULAA 3LD9A 3VNBA 4XIFA 1QRTA 3WY9A 3V33A 2AI3A 5C80A 3LDAA 3NBQA 4BMPB 4O2BB 3WSTA 4BNDB 3OLCX 4H0FA 1PZMA 4ESOA 5C52B 4JR1A 3ANMA 1OXSC 2WM3A 4MWSA 3SBDA 4EJMA 1HTTA 3JQ9C 3MC1A 2KB0A 2COUA 4OJNA 1NJ1A 2ERCA 4G5SA 2KI5A 2PJUA 3C0KA 3OE1A 4BMZA 4WN3A 4JGGA 5ERYA 1DJMA 4FR2A 1TAGA 4EL0A 5AI5A 4ANFA 4B17A 2J32A 4C22A 3PGLA 4GI5A 2DPLA 3D31A 4AZ0B 4F3CA 5LIPA 3ETCA 3I1YA 4HQNA 1RMYA 2V6GA 1Y37A 5ALSA 3HYTA 4KXYA 4EX7A 1KKLA 1NDUA 4RM3A 4NZPA 2Z3VA 4EG7A 1B8VA 1C9EA 1DIGA 2C95A 2OQ2A 4YAUA 3RIEA 1U8ZA 3AGQA 4U2CA 3ZWOA 4BB9A 4ML3A 4FUTA 1JBKA 2DECA 2HMVA 3ZZUA 4ER6A 4WJLA 3WLIA 4D92A 4URFA 2XAUA 5EP4A 1DBVO 4P83A 3I3OA 1PR1A 1Y1SA 3H7IA 4ZRDA 2GD1O 2PH1A 1IY2A 2HA4A 2IV3A 4E7PA 1SQGA 3QE4A 5IM4F 3MS7A 4G5OA 1Y3BE 2MYTA 3R7BA 3ZR4B 4GUDA 5I51A 1K7EB 1CJVC 2P77A 1E1NA 4B4UA 1Q7EA 4YXWD 2J9YB 1Z7YA 4XW2A 2VHVA 2W2LD 1OJ7A 1PV2A 4UCQA 2O2GA 3MXOA 3GNLA 3DTTA 3IHTA 4D4IA 3H8JA 4RA6B 4A6XA 2ZVDA 3VU1A 1YTLA 2FWBA 5JS6A 2QE7A 1J2YA 3FPBA 1XLTC 2UZIR 4QPJC 5IJAA 4S05A 2WKPA 3Q6MA 3AXSA 1N3BA 4TXLA 4R9NA 3IUBA 3TR5A 1FVFA 2XR1A 1LF0A 1WLYA 3LZCA 4YRMA 2P7HA 3EWIA 1BXGB 1J0EA 5HF6A 1AQ6A 4YP7A 2G1AA 3ZNQA 4AF8A 3ZHTA 4FFBA 3V8QA 1OWLA 4O25A 1VKRA 4HF7A 1Q0PA 3IRUA 4IILA 4C0HA 4B5LA 1WNTA 1AGRA 1YR7A 2QD2A 1W19A 2B6HA 3WGGA 2WUGA 2A0UA 5H9WA 2GVDC 2IDMA 2ENWA 1HETA 3O95A 2OOKA 1MV8A 1S9HA 1UXHA 2BDTA 1WETA 1QFZA 1KZ7B 3E9RA 2V3VA 3L7JA 1RQXA 4URYR 4N5DA 5FUWA 1F9AA 1EB9A 1ZZEA 2DLDA 4A82A 3X1YA 1EZ1A 4LNHA 2B4KA 1C9MA 3HM9A 2P90A 2J6CA 5CM9C 3AF0A 2NYAA 3BZUA 1P62B 4IZIA 6ADHA 3P2IA 3BTOA 4FSDA 2ZIXB 1BH2A 2D1FA 5BSRA 1TO1E 3ZC3A 3IO5A 4C3ZA 3BREA 1QPBA 1YFZA 3HB9A 1PIWA 2XB6A 1Z08A 2PWPA 2VJQA 3F9RA 1UBEA 4LSWA 4Y6GB 3AVXA 1WPRA 2OKGA 3CCCA 3TOSA 5AKYA 3ZNNA 1XKXA 2R9VA 3L0BA 5KSWB 3NFYA 1V11A 2VIIA 4H27A 4L5AA 3SOZA 5KOJA 2AA3A 2IZ7A 1ADCA 3I58A 4ENTA 1FQOA 1LI4A 1PX2A 3R3SA 4NATA 1N9ZA 4TS4A 5B53A 4D9FA 1OTHA 4O4LB 3A1DA 3EFOB 3VA7A 4FEYA 3T9FA 2BGWA 1Y8QB 4LHYA 2PPVA 2XTZA 2RAPA 1RI1A 2ZRQA 421PA 2I4NA 3NBYC 3QXXA 4LZJA 2Q3FA 1NLFA 1TC1A 3OKPA 4XLTA 1O03A 3R7FA 2I2DA 1TTQB 2GARA 1XZ8A 2QVYX 1DCKA 3GJZA 1CDDA 3FAKA 1F0KA 4GQBA 4G5HA 1Z38A 1MENA 2FDRA 1DHRA 4BFUA 2ORYA 1F9EA 4FHZA 4XWAA 1ORHA 2BBTA 5EIFA 4PWZA 1GRNA 1LPBB 2IDKA 2V59A 1QQAA 1O54A 5I5EA 3C5EA 3GGPA 3SXPA 4ATNA 5JD4A 2WMYA 4KPEC 3HJHA 2IS6A 4R2JA 3CG4A 3ZV6A 2XHZA 5DB4A 2OP1A 1KE1A 4M2LA 1U1IA 4DOMA 1OT5A 1I7NA 3N28A 5EP2A 1JR3A 4Q03A 5AOBA 4C04A 5AKIA 1K3UB 4JBLA 2J9XB 2XTMA 3LY8A 1C0LA 2QN7A 3Q15C 4DUGD 5AXCA 2IKSA 1FJGB 1FMFA 4IIFA 2QX8A 1EM8B 1W4BA 1IDOA 1UKZA 2XE6A 5F12A 2MSWA 4BQEA 4EBBA 3CVWA 3P71T 1AJEA 4U1RA 3HBFA 2E21A 2UVPB 3GN1A 2X5NA 2FN7A 1ZFNA 2EW1A 4GEGA 1GZHB 4QE3A 4Y2JA 1UZMA 2WTBA 5K3EA 2P35A 2G5TA 3AEQA 5HDQA 1SU8A 5CFZA 1MABA 3WGYA 2I0FA 2LBPA 3A2NA 4D9EA 3EPLA 3EG9B 2IY7A 2Q3MA 1IQRA 1K06A 1KIFA 5L4LA 2VBIA 3RFTA 1N9GA 5D5QA 5C7IO 1ODSA 3I37X 1WDWB 1C7RA 1G16A 5GMOA 4X45A 1F7UA 4D8TA 2XJ9A 4D5EA 2QMQA 3TVDA 1FUUA 4C3VA 4ZC1A 2QAGB 3KR9A 1GGFA 3COVA 3OWXA 4JGBA 3RVLA 4ZI7B 3DXFA 4JLSA 3OMWA 1XRLA 2J0SA 4G0UA 3OCCA 4KTVE 2PGDA 4D8VA 1TYZA 2EXXA 3LOUA 4OHUA 2C9OA 3ZHSA 2C5LA 1JALA 1OBOA 4PX2A 2LV8A 4DL9A 5B57C 1MQAA 4YK7A 3ZCXA 2C99A 5JS8A 3S2GA 1M6VA 1XYYA 1GPLA 4UAJA 3T0FA 3CXRA 3PKIA 5LM3A 1K3FA 1H2EA 1PKXA 2PV0A 2RGXA 2FVYA 3RVDA 3LT4A 2IVZA 2E6KA 2WTXA 1CRWG 1OPRA 5DCYA 5A7GA 4YMLA 4EI9A 3OEWA 1EGHA 1P81A 4WA8A 1Y8RA 2BEKA 3D8SA 4L5BA 2O1WA 4YASA 4A73A 2PZAA 3LBIA 3OM8A 3VU0A 5AMXA 3B38A 3Q8WA 1QE3A 2PUTA 1VSTA 1TAUA 1Y98A 4WKBA 4B8ZA 1JQKA 5KZMB 2Z5LA 3M1IA 2C3UA 1W5AA 4IXWA 5AUQA 2ZIXA 2AX4A 4DSNA 4Y1GA 4EKEA 2G9RA 1F4VA 1IRIA 4YAIA 1JEQA 3WVNA 1JIIA 1NQWA 3CW8X 2BZ0A 4NESA 4U2BA 2WG1A 5DJ5A 4RPCA 1L4BA 2IGTA 2ZATA 2OBXA 4KXQA 3IAFA 2XT6A 4NQZA 5FKJA 2FFJA 3PVZA 4I2VA 2GCOA 1ZUIA 2QY9A 2R85A 2HLDA 4QXQA 1YZGA 3WGIA 4KREA 1DXQA 3ICCA 1BMFA 2YY6A 1KA9H 4JLBA 4L85A 2XDAA 2XUPA 2GVZC 2PH5A 4MRVA 3BB1A 2R79A 3PICA 1T8WA 2HMUA 2OUKA 5EPOA 1EMDA 2ZI7A 4TWIA 3O2JA 5K3CA 5DGTA 4DTCA 1T9KA 3CLTC 4RF4A 5LMCA 1B76A 5CNKA 3UPTA 5TRTA 2GAFA 4O08A 4I6JA 4UHJA 2ZZMA 2CT8A 4PCUA 4IKEA 4TLEA 3U3MA 3G0HA 1E79D 4RIFA 3MCUA 1XYVA 3MRTA 1D6SA 1MVLA 3QH4A 3E7XA 5C5EA 2Q6OA 5LQCA 2EWMA 4I7EA 1Z3IX 3AUJB 1M6EX 2WLSA 4TTTS 3DMPA 3RRNA 1P2UA 2WWYA 4Z9XA 4E5PA 3LCVB 2DLCX 2CXUA 3P32A 2I87A 4B83A 1GPNA 4F91B 3KOYA 1U63A 1R8JA 3RHFA 1AKNA 1JG6A 3WDSA 4UBJA 2OLKA 1FQWA 2OM6A 1DAFA 1HFKA 4HQOA 1NRIA 2C7BA 3I6QA 1FLNA 5BW6B 4YJDA 3NORA 1R5OA 3LU1A 2FSSA 1XU9A 1I4DD 2E55A 5K3FB 4BB0A 4DRZA 2D4HA 3EFEA 3Q12A 1KP3A 4G81A 4PBTA 1BE1A 1H2ZA 1K5GA 4FX5A 2OWEA 4Y1EA 5FT9A 3ASVA 3TL6A 4B3IA 1UXIA 2NUPA 3ONFA 2ZBFA 3GT3A 2R7LA 1H69A 3B8EA 3MJCA 5ALUA 3SMVA 3KHUA 1ZKDA 3DVAB 1LBHA 6REQB 4RD1A 5AHXA 1OPXA 3TIFA 1XL0A 5DF1A 2EZ8A 3GLHE 5L4SA 2O4UX 1QCDA 2GASA 2YJTD 4ZVKA 1BG6A 1FFYA 1EVQA 4B45A 3TXXA 4Z51A 5CA1B 1POXA 1TUIA 1W96A 2G8NA 4OU4A 2YXNA 4XA8A 4YAEA 1V3QE 2GKOA 2PLFA 2Z8YM 5AW6A 4DDKA 3WRYA 4KIFA 4FWTA 1RWNA 3E4DA 4Q3CA 5L7WA 2P8SA 1XZEA 5LXTB 5CIQA 3UT5B 4P1ZA 1NV8A 4P4SA 4BMCA 1MEOA 1WB4A 2YXEA 4C4TA 4JSRA 3GEPA 4G2TA 3LT5A 3CPSA 2J09A 3MJVA 3FRIA 1YJ5A 1GAWA 4UBNA 1N92A 3OFNA 4HDOB 3B6EA 5IBRA 2YZMA 1VYTA 4CUKA 4ER0A 2R65A 1L1QA 1Z83A 3DDNA 3N2ZB 4EEXA 2QRUA 1MRZA 4ZMBA 5HXAA 1RLUA 1TM5E 1UZNA 3OIYA 4D8WA 3UV3A 2IV2X 4M0DA 1FYXA 3VSBA 4IWYA