3Q3JB

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
175
Chain Sequence
RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/protein binding
molecule keywords Plexin-A2
publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
total genus 59
structure length 175
sequence length 177
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q3jB00
2OAQ1 1DTSA 2WSMA 4XD7D 4MKIA 3IILA 4F38A 5KSZA 1A4RA 4PC1A 3U6BA 1P73A 4JLOA 3IIMA 1BO6A 3IIKA 3UANA 4D4KA 4E09A 5HKKA 4OQXA 3X1YA 5AUOB 5EE1A 1D9ZA 1KAGA 1Z0DA 4IFBA 5JCPA 2C03A 2EFCB 3AUXA 3TH5A 5CJPA 5IDVA 5BN3A 3LLUA 2H57A 3GLIB 2OBLA 2QPTA 3CF2A 4JLDA 4RD0A 2KSQA 2QP9X 1XXHA 2O8FA 3EA5A 1NVVQ 2CJWA 3LDAA 3C41J 3LXRA 1XPRA 4YMWA 2QEQA 2PZGA 1CR4A 4JT2A 1TF7A 2Z5FA 5CLQA 2FE4A 1SGWA 4QOSA 1IBRA 2WSSA 5DN6D 1G18A 3LO5A 1XF9A 3LX8A 4IOJA 5TY0A 3I92A 2D2EA 3BORA 3BFXA 3CUEF 4XVQA 1MABA 3NDPA 2F1JA 3MFYA 4ZO4A 1X6VA 3LRPA 2BKEA 3K70B 4JSTA 2DR3A 2NIPA 2BVNA 1GKUB 5KOYA 5ELXA 1Z29A 3CIOA 3WXMA 1R0XA 3CKLA 3OZXA 5IK2A 4C9BA 2GETA 3Q5DA 4D2IA 2HXYA 1XTIA 3TK1A 2RMKA 3LBHA 2Q9CA 2IYQA 4IRUB 5BN4A 1T5LA 4L16A 5UKDA 2G77B 2ZJAA 1YR7A 3B85A 2RHDA 4B47A 5J5CA 2WPDA 4JYBA 1SXJB 4X8MA 1G8HA 1GG2A 1WQ1R 3BRWD 4ZI2A 3CNNA 2BM1A 3VQTA 4Q1EA 4PHFA 4IDOA 3RRZA 1OH5A 1W36C 2ZSFA 3KKQA 4QXAA 2R6AA 3PUWA 3SS8A 2REOA 4P31A 1NRJB 2H17A 1XXHE 4TQUS 1XDBA 4WBSA 4C0HA 5J47A 3THYA 3RSOA 4FCTA 5K8LA 4GT1A 2IC5A 4PO9A 3UMFA 4AD8A 2CCJA 3PV0A 5KSPA 2WKQA 3JVUA 3QKRB 1VCNA 2NO7A 1ZNYA 5EXTA 3E2IA 2W6JA 3CNLA 2J0QA 1AJEA 4BECA 2B92A 1LF0A 2UZ3A 5A5GA 3CRVA 2FA9A 2ZS8A 4LPSA 4C0LA 2YHSA 5B57C 4OI0A 2ZU0C 1NSFA 2DWOA 3PG5A 1IY1A 1RJ9B 4AI6A 3FFAA 1OIWA 4MDEA 1F2TB 2C95A 4DCTA 1GAJA 3PUVA 3RSLA 1IN5A 1G5PA 2R2AA 4DT1B 1A2BA 2BCGY 4D4LA 3H1TA 4GL2A 2BBOA 1HEIA 4OQFA 3P1JA 3DOEA 3RYTC 4HAUA 621PA 5IF9A 3I1FA 1GTVA 2GK6A 4ZKDA 2J1LA 3EC1A 1TL7C 4KVGA 4OL0A 2QROA 4RD4A 4GP7A 3C7KA 1NKSA 1W46A 3LFUA 5SZHB 1A2KC 3DM5A 3L8ZA 1FQJA 3PUYA 2IHBA 3CONA 3KFVA 2REXB 1WF3A 1E2QA 3H0KA 3THXB 1S1MA 4B71A 3L82B 2JIZA 5JI2E 5FOTA 1KAOA 2QAGC 2FSFA 1HA3A 2AXPA 3EC2A 4O0MA 4EFMA 4BLSA 1YZUA 3G82C 4LGMA 1JAIA 1E0JA 1ZM7A 3AUYA 1LFDB 2QMOA 3GFPA 1MO6A 1N6IA 1D2MA 2XTZA 4PPFA 1Q12A 2V4ZA 5C18A 4Z54A 1XTSA 4AG5A 4IDPA 5DYIA 3O8DA 3GMTA 1DO0A 4ZCMA 2CLSA 4JVSB 4Q4JB 4M9ZA 1PVOA 4Z51A 4L5BA 5FOVA 3VHLB 4OHXA 4UKDA 4I1VA 5TDHA 3FWYA 1MOZA 4PO1A 3R8CA 3SYNA 3QPWA 3VTKA 2I1QA 4YMSA 2A78A 3RLFA 5H1YA 1PLLA 3ZVNA 3R20A 4A1FA 1Q1EA 1ZVQA 1RKBA 2V55B 1DG3A 2OT3B 4C0BA 1W4RA 3VX4A 5HTKA 4CYMA 1GFIA 1UBEA 1CJTC 1CP2A 3PCRB 5EE0A 1J7KA 2VHCA 5KNCA 1JJVA 2GK7A 3SJZA 1Z0JA 4A8JB 3ZDQA 3QPVA 4NCNA 2ANCA 2ZI5A 3EPHA 5FBVB 1II9A 2G1JA 2X8AA 2BMFA 3FHCB 2QAJA 1W0KD 1CJKC 2ZJ5A 4RFVA 2RAPA 4OJQA 1DPFA 1KZ7B 3SYKA 3CH5A 1XEXB 2R9VA 5FPSA 3NH9A 4KSBA 5D3MB 3KB1A 3GLGE 2ZETA 4EJSB 4NCKA 3X1WA 1UFQA 1U9IC 1E4YA 3AB3A 1E2FA 2C8VA 4B2PA 1U9IA 3W5JA 1QHIA 3KJGA 4PSAA 3OEEA 4Q4HA 1UDXA 2D62A 2FNAA 1CEEA 1T4GA 3DVLA 4U00A 1Q57A 3C8UA 2IYYA 4S2EA 5HZKA 2QG6A 4GZMA 4M9XA 4U7DA 2F9LA 3QOFA 4HUQB 4TQAA 5JZVA 1S9HA 3OIYA 1WBDA 4OQNA 5DI3B 4I81A 5FOSA 1Z83A 4S35A 1TU3A 3MCAA 4URWR 4US1R 5AJYA 1XEWX 5EP2A 1G16A 1G8GA 5F2EA 5AJWA 3U44B 5AUPB 1KI6B 1H8EA 1P5ZB 3FVQA 5P21A 1QHYA 2V8OA 2WWHA 4O25A 2RB4A 2QU8A 3LQQA 1DAMA 2ZYTX 2Z83A 4JJKA 4LCBA 4M1KA 4TT3A 5K8UA 1NY6A 4M22A 3TW8B 4DSNA 1UPTA 2E9SA 4MGZR 2HV8A 2WOJA 3CM0A 2WJIA 5FTKA 5H70A 4LY6A 4A0RA 4DLUA 2KI5A 4B6EA 4C0SA 1D2EA 2J7PD 4ITRC 2AK3A 4QM7A 3WBKA 4HLUC 1J70A 5BYKA 3SBDA 2J7KA 4JBXA 4DUGD 3A1WA 4OHVA 2IYZA 3FHOA 1IN7A 1KMQA 2WJGA 4JL5A 5J4KA 4ERNA 4CEIB 1E99A 2FFQA 3H2YA 3W90A 1KMHB 3QEJA 5JSZB 1R5BA 1G8FA 1D8TA 2BMJA 2FPLA 4R9UC 4AKEA 1RVDA 4LHYA 1RRGA 1Q20A 2HF8A 2Z4RA 3C14C 4WW0A 1AK2A 5TV2A 4W5HA 1KDPA 3OEHD 1E2GA 2A7QA 3R9IA 2AD1A 1NL3A 3A58B 3AVYA 2GVZC 4ZV4A 3E5HA 3GLFB 3LY5A 2J41A 3CX6A 2WIAA 4QL3A 1UBFA 2GF9A 4DLYA 3VNUA 1U2RA 1QRAA 2RGXA 1W4BA 4M53A 2F9MA 3IHLA 4G1UC 2AN9A 2QENA 4HAZA 2ZRMA 1E9BA 1PZNA 1UF9A 2IYLD 2X19A 5KO2A 4JVNA 4NPHA 1XU4A 2O0JA 1YZNA 1LY1A 3UATA 4UNSA 5L3QA 2IS4A 2H5EA 4P4UA 4M9SA 4DKXA 3O8BA 3L0PA 2A5JA 1H8HD 1N5IA 2DFKB 1F3OA 1W0JD 3KUCA 2G9NA 3TQCA 1R5NA 1P61B 2CJWB 3SN6A 2NG1A 3TVTA 2EWWA 2QMHA 1COWD 4CDGA 4D6PA 3PQCA 4QHTA 4PC3A 1S9DA 1OFTA 3VU9A 4B3GA 4GMXA 2VF8A 3ADKA 1FUUA 3NTUA 2FMXA 4JKIA 1FPMA 1N25A 1NVWQ 1MABB 3EARA 4PXAA 4UXIA 5JWOA 3QBTA 4I1UA 5BWMA 3CBQA 1NIJA 1GITA 2QTHA 3QXHA 3B1XA 3V00A 4R2IA 2IF2A 3GFOA 5FUXA 2IX3A 4FMDF 5SZKB 2PBRA 1K5DA 2BOVA 4MYCA 1QHSA 3MJRA 3BE4A 1U94A 4P4SA 2VP6A 2PMDA 4JL6A 1VYUA 4PSVA 2VLIA 5HE9A 1UKYA 2ZJBA 2OG2A 5LDDC 1KSFX 1ONBA 1FW6A 3UG7A 1YJ5A 1Z07A 4E22A 1KI9A 2BBSA 2Q3HA 4Y0AA 4KV9A 1FZQA 2QL6A 1E0AA 1OFIA 2EVWX 4GPTA 1T91A 3ZQJA 4JLNA 4MYUA 5DHFA 3GQBA 3EASA 3G5UA 3RNLA 2I4IA 3SDZA 1XMSA 1OKKD 3WP0A 1W36B 1CULC 4UNNA 2IS2A 4B34A 1HV8A 4P4TA 2WWFA 3IBGA 3KXLA 4M21A 3THYB 2JLRA 1QDEA 2WKPA 5CK5A 5IRCD 1ZJ6A 2BJWA 1XPUA 1XNJA 3B78A 1TUEA 2IYVA 5DGXA 5LD2C 1J2JA 2HT1A 2W58A 4OQMA 1E1RA 1W4CA 2PJRA 3SEAA 2BMEA 3LW8A 2FZLA 4KVAA 5JEDA 4RD6A 2F3RA 3VR6A 3A6PC 2PLFA 1X86B 4TZ6A 4OKSA 5G41A 2W6ID 3WP1B 2Q9BA 2F1IA 4XTCS 3RS3A 3PENA 2WZQA 1EG7A 3VR2A 1RC8A 4LV6A 221PA 3ZZUA 4K46A 1ZYUA 2YOGA 4LHVA 5TXGA 2ZXUA 5GADl 1P60A 2W0SA 1LV7A 4GBMA 4KFRA 1G8PA 2OILA 1NMXA 1Z8FA 4WZAE 1R2QA 2IXEA 3ONWA 4QNRA 3N70A 3I8XA 1ZC4A 4GOKA 2EQBA 2XAUA 3K0AA 1JEDA 3QXXA 1TMKA 4IVQA 4JS0A 4F4JA 2SHKA 3J81k 2H18A 3KDSE 1P9NA 4EIWA 2LCFA 1UEIA 2ZRCA 5BXQC 4HDCA 1CR2A 2J45A 1EGAA 3K70D 2GTPA 3W34A 3QVUA 4GP6A 3KQNA 3LV8A 2JLVA 4PSKA 1G4AE 4P32A 1KDRA 1T9HA 1XD2B 2CMKA 4TLDA 4DIEA 4NYMQ 3S1AB 1DOAA 3HU2A 1SVWA 4QKQA 1N5KA 2HYIC 1GNQA 1GNRA 3K09C 2EYQA 5EZ6B 4BRUA 5CB8A 2FSGA 2D7DA 2CDNA 3VR1A 3ZIAD 4U02A 1G41A 1W47A 4A15A 3TW4A 1NLFA 2BIFA 3NBZC 2CXXA 3VKWA 4DB2A 1TF2A 2QAGB 1XCGB 1JPNA 3GLGB 2WWYA 1SXJD 3U3KA 5L3SA 1RPZA 5EE3A 3K9GA 2GCOA 3I73A 4QJ3A 4ESHA 2C5LA 1NN5A 1DG1G 1IY2A 4P33A 2I1VB 3QUSA 1KI8A 4RZ3A 1Z6GA 2CCKA 4H1VA 2PL3A 3N2EA 2XNDD 3EWSA 2QP3A 5JRZA 4TLBA 4RZUA 4M1SA 4NP6A 3IO5A 1W5SA 1G64A 2WJVA 4IKEA 1G3UA 2J0SA 4R2HA 5CM8B 1FNNA 5JMTA 3ICEA 4O3MA 4YQFA 2C99A 1CJMA 3KTAB 1T6NA 4XWAA 2ORWA 1GVNB 1E32A 4GI7A 3NH6A 4WAUA 2DWQA 4PPGA 3X1XA 2GJSA 1E3MA 1OXUA 1NN1A 3T1QA 2WVJA 4HAYA 1P7CA 4C0KA 3U61B 4A82A 3OE7D 4MYHA 1Q0UA 1OF1A 2G83A 1KO4A 4EPYA 3KQUA 2QE7D 4C3ZA 5JI3E 2EWVA 2O8DA 4Z1MD 4FMCB 3K9HA 3UIEA 1XX6A 4D25A 2AL7A 3WBJA 5EP3A 2WM9B 4DLVA 2C2HA 1DAEA 5JS8A 1Z08A 4R71A 421PA 1KKMA 1R4AA 1GSIA 5DE3A 5SZJA 4Q9LA 1IQPA 2ZI7A 5J4YA 1O3YA 5F3WB 1MRNA 3I32A 2ZS9A 4I99A 2Q6TA 2QNRA 3T1VA 4Q4AB 1WA5A 3WYAA 1L2TA 2JJ1D 4LUCA 1EK0A 2K5UA 2EFGA 1TTTA 1AKYA 4QGAA 1J90A 2CVHA 1UADA 4TN1A 2V7QA 1E96A 3KQLA 5CYOA 2WHXA 1E9DA 2J87A 2GF0A 2IT1A 2W0MA 4TMXA 3CRMA 1NI3A 2KBEA 1JEEA 3FE2A 3WHKA 4Q1DA 2GJ9A 1WDTA 3B5JA 3B1WA 4NCHA 3UWKA 3NXSA 2BM0A 4Q1AA 3R9XA 5CIQA 1XZPA 1JB1A 2J3EA 1KY3A 1TF5A 1PUJA 2REBA 1US8B 2GILA 1E9RA 3F5FA 1NMZA 2HYDA 2PZEA 1WB9A 4RZXA 4KYIB 4Q1FA 4G0NA 4EPXA 3CB4A 4HAXA 5CIWA 3U7EB 5JHHB 2J59A 2OFWA 4N0EA 1G3RA 1Q22A 5C2JB 3KL4A 2F43B 1JJ7A 1N0VC 2YV5A 3O47A 4NCJA 1II8B 3VAAA 2ODNA 4NHOA 3T34A 2YWEA 4KXFB 3K0CC 1E2DA 2ZM5A 4HAWA 2DFTA 4LHWA 3QE0A 1EX7A 1E94E 4KSCA 1R5OA 1T3SA 1XWIA 1E2EA 4NBSA 4Q5IA 2ZI3A 4H9GA 4DLTA 1E6CA 1NKTA 2PH1A 3QQ5A 4M8NE 5TVKA 3M6AA 4YDHB 4PAMA 3VX3A 3K53A 1N0UA 1Z0FA 1M74A 2DYKA 1UBCA 4C7OA 4P0TA 3IQWA 1TNDA 1ZC3A 4NYJQ 1GNPA 2ASEA 3BFVA 4UXHA 1MO3A 2JEOA 2VIIA 4ZCLA 1EWRA 1U8ZA 1U90A 1G7TA 1E2LA 2CHVA 2D4HA 3CF6R 4QFMA 5JWRA 1RRFA 3ZYCA 2EFEB 1UM8A 4URUR 4DLRA 1DAKA 2YWHA 1ZCAA 2PX3A 2J0UA 3NDBB 1KY2A 2PT7A 4BGDA 3RRYA 4B73A 4E07A 1ZNZA 2FDCA 2B8WA 4HB2A 2VHQA 3REFA 4B35A 4B32A 2ZUDA 4CT5A 1NVXQ 4L9WA 4MGKR 4EFNA 4IFEA 1N6HA 2ODEA 2G88A 3FMOB 2QQEA 4PHTA 1KK0A 4IOMA 1XPOA 1NJFA 3PUZA 1TPZA 1E9FA 1U99A 2CE2X 1I4TD 5L3QB 4Q7LA 2OBNA 2PT5A 4C0AC 2JLWA 3OIVA 4UNRA 2OCPA 2WV9A 1KK1A 1O87A 3AF3A 4LPKA 2BEJA 1QHGA 1XRJA 4B75A 3EG5A 1B0UA 2ZRBA 1BH2A 4R7ZA 4PTLA 3WY9A 3K0FA 2HLDD 2A2ZA 2ERYA 2QM8A 3IO3A 1PLKA 1L4UA 3AVOA 1P9WA 3K8YA 2JLSA 4V0MA 3NBFA 3BB4A 1E98A 1YKSA 3A1VA 2VRWA 1ZD8A 4OK3A 1KNQA 2WWIA 3FB4A 4Q18A 4DB4A 1KI2A 4TLAA 1N6NA 3K1JA 1AQYA 4EKDA 1EXMA 4KHZA 3FPAA 4YXWD 5JFGA 3QNUA 1F2UA 4P4SB 1G3IA 1N5JA 1RRPA 1M8PA 1MO4A 1RYHA 2HF9A 1Z6YA 3SFZA 3EIEA 3ZD7A 2QT0A 3BAFA 4FCVA 3LAWA 5AWFC 2C98A 3AKDA 3CH4B 3RRMA 3L43A 2GEUA 5SZIA 5C1BA 3H4MA 4CZ2A 1KTVA 1PLJA 2IL1A 4LJYA 3EPJA 4ABYA 1LW7A 3UMRA 2NTYC 3LW7A 3KXIA 3OFNA 2IBMA 2A30A 1VYTA 4OI4A 4W5JA 2QBYB 3HU3A 4KODA 3IGFA 4AIIA 1G7RA 5EQTA 2ECKA 4ASUD 3P27A 2H16A 1I2DA 1SHZA 2F7SA 1Z63A 2Q21A 4ILEA 2C77A 3ZZ0A 4JL8A 4PR0A 2GXQA 1JI0A 3ZGXA 2F1HA 2ZRIA 1IXZA 1P4SA 3QY0A 4KFTA 5EXSA 1ZCBA 1K8RA 1M2OB 4BASA 1IXSB 5HKKD 5LD2B 4MRPA 3B13B 1D2NA 4V0ME 2HUPA 1HE8B 1VG8A 3PR1A 3GJXC 1D9XA 1Z6AA 3ZS8A 1SHKA 2ODWA 5EJEA 3C5CA 1JBKA 2ZAOA 4MQBA 2D3WA 3AP3A 1KJWA 4O2LA 1ZINA 5FR1A 4PAQA 5IHPA 1DO2A 1ZAKA 2IHYA 4DLZA 4HZUA 1Z2CA 3TE6A 3NHBA 2FF7A 1OHHA 4MRVA 3B8HA 4DLWA 4IDHA 6Q21A 2ZITA 2E1RA 2FEMA 2Z43A 4RCYA 1KO1A 3MWKA 4RCZA 4TTPA 3TSZA 2OAP1 2MSCB 2ZSEA 1KHTA 2N1BA 2FG5A 3NVAA 4E5UA 1SVIA 4QBHA 3N2IA 4FWTA 2HEIA 1E9AA 4ESVA 1OV4A 4JVLA 5E3HA 3BOSA 3T35A 3EZ7A 4NYMR 2RGEA 1NJGA 3MGCA 4DCNA 4ZIRB 3NIBA 4UNQA 1ZD1A 3BB3A 4TLCA 1OXTA 1KK3A 2DWPA 3QF4B 3KQKA 4PZZA 5HE8A 2ZJZA 4D0GA 1ZD9A 4DSTA 2PEYA 2A9KA 4V0OA 2EYUA 4HLQB 1XB2A 1SVKA 1BMFD 1W5TA 3PEYA 3UPUA 1GRNA 1G5TA 1A82A 4X8LA 2KE5A 4L9SA 3IDQA 1Z6XA 3CZQA 1W4AA 2GCOB 2OSBA 3U7GA 3RS2A 2GKSA 4XVRA 3QXSA 2YNMA 4BFYA 1Z0AA 5JBQA 2O8EB 2O0KA 1RE0A 1W36D 4CEHA 1YVDA 3DO6A 3DHWC 1X1SA 1YHNA 3P4YA 4F91B 4Q7MB 3UXMA 1EFRA 1G17A 4PHGA 2ZUCA 3HDTA 3DMNA 3SI7A 4WOPA 2NO0A 4D4MA 1YZTA 2FGKA 1J8MF 5EUMA 4RFSA 1VPLA 3GJ8A 2XITA 4TMZA 4BFVA 4EPVA 4DRZA 2W6JD 2IYXA 4Q7JB 3CF0A 3DEFA 4PQFA 1VYVA 2RGDA 2P5TB 1AIPA 4LYJA 1S8FA 2ZRHA 3DMDA 2ZI9A 3PUXA 3FHTA 1P2TA 1P72A 4Q9IA 2JATA 1Z6TA 2QZ4A 4DUGA 2FFHA 4IVPA 1NSTA 4MUAA 4WVFA 3I61A 1XZQA 4F7WA 3CR8A 3TUIC 3T12A 1PV4A 5KPDA 5L8VA 1NLZA 1XEWY 1EFCA 3A4MA 4LWZA 1KO5A 4IOLA 4B33A 2RGNC 4FD2A 3HYRA 1M7GA 2RGNA 4UJ5A 1KI7A 1S0UA 3OEHA 3TJZA 2Q3MA 4BFZA 4CW7A 5FBQB 2AFHE 2H92A 1ZUIA 2ZJYA 3LVQE 1HH4A 2JLZA 4GOJA 2CLCX 4B3XA 1FFHA 1Z0IA 4GDFA 4HSEA 4ZKEA 1E0KA 5K8IA 3ZVMA 5F9HA 3O8RA 3BC1A 2JDIA 2RGBA 2X2FA 4XWOA 4ZPXA 4HB0A 3F3YA 1EFTA 1CF4A 5FPTA 4YC7A 5E7IA 2GJKA 2P65A 1N6OA 2GRJA 3QG5A 1WP9A 4AYXA 4FMCF 1NLYA 2P6UA 2W2VA 2ZI4A 1XTRA 2FJUA 1E9EA 3U5ZB 1LVGA 4ZDKA 1NN3A 2BEKA 2D2FA 4OHWA 2ZRFA 4GSYA 3BD9A 1DVRA 4KJZA 4B44A 5KDOA 2P6NA 2OLKA 3ECCA 1S1CA 1KI3A 3WRYC 2Q9AA 5DO9A 2PLRA 4LHXA 2HDNB 1IAQA 2X1VA 3SJAA 3GLHA 3PIRA 2BHRA 2AKYA 1HY3A 4G3XA 4DJTA 4CF7A 1W0JA 2DFLA 2GESA 4QGGA 4BLRA 1R7RA 4Q9HA 1AQUA 1AS0A 5FBRB 3I8SA 4D0LB 1OLOA 2CCGA 2N46A 2WAXA 4CEJB 1XJ0A 2Z6VA 1COWA 3LBNA 2YVUA 2ZE7A 4Q48A 1XCPA 4ACAA 4A0GA 1QF9A 3R7WA 4V02A 1YU9A 1G6OA 4LRWA 4LK2A 3FOZA 4OK6A 1YZLA 3QG1A 2ZRGA 3VHXA 1Q44A 2ZSDA 4RD2A 3X1ZA 2JLUA 1IHUA 2QP4A 4FWIB 4OI1A 3BB1A 1NG1A 3T5DA 4JIMA 2FGJA 3NG1A 1FTNA 1XJQA 5G40A 1C4OA 4HB3A 4C30A 4C7OB 2MMCA 4IDQA 4Q02A 1DE0A 5KU1A 4PQYA 4LV5B 4TL7A 2EFDB 3U4QB 2VF7A 4J0QA 3F0TA 3CW2A 1SKQA 2IUUA 2ZI6A 3ADCA 3QEOA 2VP5A 1ESNA 4H1UA 4JZKA 4LYHA 2XJ9A 3DZ8A 2CBZA 3K9LA 1P3JA 2WJYA 2WWXA 3IKJA 2GNOA 3OEED 3C16C 3NEJA 1II0A 2ZE6A 3A4LA 3NWJA 4TLEA 4KU4A 2TMKA 3DPUA 2J0UB 3HWSA 2PCJA 2B8TA 3GJ0A 4BLQA 2OE2A 5JRJA 1OKKA 2YOFA 3UKDA 4F4IA 2CL6X 4TMTA 4NYIQ 5G53C 2YYZA 3LBIA 1IN4A 5LB4A 4URXR 5GJCA 3AKYA 4Q4LA 2GZAA 5DISB 5B30A 2GDJA 4PZLA 3W3AA 2IYTA 4AYTA 1G21E 1NVVR 4YMVA 1BKDR 1XXHB 4XH9B 2O8FB 1SZPA 2DHRA 2GBLC 1KYIA 3CNOA 2GBLA 1AA9A 1H8ED 2VTKA 2FWRA 4LBVA 1P6XA 2W6IA 1RFLA 3GLIA 2CNWD 3KFXA 2I3BA 4CGZA 1Z3IX 2ZRJA 1VIYA 4KO8A 4L4UA 1AZSC 3WNDA 4QJ4A 1AGPA 4PQRA 4HATA 2DBYA 2CHGA 2JA1A 4BFSA 1A7JA 1FNMA 4DC9A 1D6JA 1HQYE 3SNHA 3W6NA 3A1SA 3A36A 4PZYA 4YLGA 1Z22A 3W9YA 3ICQB 1KO7A 4JBWA 4Q1BA 3TRFA 4B76A 4TQ9A 4Z8XA 2BCJQ 1P62B 1XTKA 3A8TA 5FOUA 1Z0KA 5FPHA 2QMUA 4C2TA 1I4DD 1NIPA 4PC2A 1G3QA 2QSZA 2YWGA 4C4PA 3AVXA 4K8OA 2QTFA 3ETLA 2MMGA 1KSGA 1TEVA 2P0EA 5FTMA 4DSOA 2IF0A 4B3FX 2YWFA 2ZYWX 4BFWA 3B2EA 1YRAA 1SXJA 1ZM9A 2XZOA 2GCNA 2C96A 4MRNA 5DLQC 5C4MA 3M0EA 1CTQA 1W7AA 2J46A 5GVSA 2WICA 2ATXA 2AXNA 2XSZD 2A5FA 3KX2A 3C15C 4X8OA 1G291 3GLIE 5AUQA 4HLDA 3AVPA 4PPQA 4U5XA 5H8WA 1YZKA 4KAXA 4NU0A 5FI0B 4LJ9A 4BUJA 1JALA 1JR3A 2J0VA 2ZRKA 1Z2AA 3F8TA 2W00A 4IEEA 1KGDA 3Q7PA 1FX0A 5FTLA 3BH6A 3QKRA 3EZ2A 2V1UA 1OH6A 2H8KA 5GJWC 1FUKA 1XMIA 1FOEB 1IJFA 1OT3A 2XX3A 2EFHB 3MD0A 1N5LA 2OV2A 3DDCA 4K81B 5E4FA 4WXPA 4DVGA 1HT1E 5TMPA 3AVQA 1VHTA 2V54A 4URYR 2OBMA 4OHYA 3U7FB 3OE7A 2ZUBA 1RJ9A 2JGNA 3MUFA 1YZGA 4Q47A 721PA 1NP6A 1OYWA 1YR8A 2QE7A 4FW9A 1F2TA 3CX8A 3FGNA 2QMEA 1R8QA 4DT1A 3WMFA 4F4CA 1SVMA 3DKVA 3SFVA 3TNFA 1LF5A 4II7A 1QHXA 8OHMA 3KJEA 5A4JA 3T1TA 4MRSA 1IJEA 2O0HA 2BV3A 1SXJE 2XOKD 3CRQA 1U8AA 1GL9B 4JKYA 1J99A 4NTZA 4O2RA 3OIWA 821PA 1E4VA 5GJBA 1P2UA 3GFTA 3VKHA 2J9RA 3L0IB 2CL7X 3N5CA 1TUIA 2JJ1A 5FUYA 1TX4B 2QUZA 2R6DA 5KYKA 4Q00A 1M6NA 2WWWA 3THXA 3I3SR 2HJVA 5FL7D 1U8YA 3AH8A 2PEZA 4A6XA 4DBLC 2B7CA 1HQCA 1VTKA 1ZW6A 1PUIA 1JR3E 1Y63A 1NN0A 4F93B 1R0WA 5KPJA 3UMSA 5JWHA 4Q66C 2O8CA 4OJKA 5JEEA 1LS1A 3RWMB 1G19A 2N42A 3WMGA 1LB1B 1GRRA 3TGPA 4E03A 5JCZA 1NY5A 3SQWA 1JECA 2NPFA 1C1YA 2QSYA 1NVUQ 1VHLA 2C9OA 2D7CA 1ZRHA 4JLBA 1MH1A 1NBMA 3EPLA 2JLYA 4Q4JA 5E7MA 4DHEA 3W8NA 3SU8A 1BOFA 1GKIA 1G1MA 1VCMA 2NZ8A 4A4DA 3BERA 4DEXA 2XB2A 4B74A 1U0HC 5B58C 3V4FA 1XFAA 1VG9B 2VBCA 4LV8B 1M7BA 2GXSA 1LS6A 3TIFA 1OH7A 5JLJA 1T3HA 5CYPA 3SBEA 5KDDA 1QVRA 1JXMA 3D8BA 5CM9C 1XTQA 3A37A 4ARZA 3DKPA 4KLZA 1P2SA 1AGRA 3W5IA 3QI2A 1TAGA 2BC9A 2ORVA 2ZR9A 4QBIA 3HPQA 4QBGB 4Q01A 2NO9A 4TSFA 3ND9A 121PA 2GCPA 4ZDIA 4RZ2A 4AYWA 3H84A 2PCLA 1TADA 4L15A 2HXSA 4DLXA 3Q5EA 4NDZA 1XEXA 4Q4HB 4AK9A 4TTQA 3RVBA 5D3MA 2VO1A 3U6KA 2CK3A 4BEBA 4V03A 2FPMA 5ANRB 1RW4A 1R8SA 2MSEB 4ZCIA 2IYRA 1XTJA 2FN4A 4FIDA 1K6MA 4LOAA 3JZAA 2ZVPX 1WRBA 2GZHA 1IXRC 4NH0A 4HDQB 4XD7A 1ESMA 4NKRA 2KB0A 4BLOA 1NBME 3AF2A 1CU1A 2OCBA 2HCJB 2OEPA 1U81A 4FXPA 4HUQA 2GZDA 1S4QA 2ZAMA 2V3CC 3VR5A 2YZ2A 3M1IA 4X8HA 1DAGA 2FSHA 5DI3A 4PAOA 2IWHA 3TR5A 3GEIA 2R65A 1NF3A 5K8TA 1ZUNB 4YMUA 3QKTA 1GIAA 3WHLA 4DDVA 4XIGS 3FKSD 2F1RA 1CR1A 2XGJA 3MRSA 1ZIPA 3CRW1 3U44A 2V6JA 3MG9A 5KSOA 1KI6A 4M9QA 1D5CA 5HR5A 2NO1A 2ZR0A 4URZR 1AS2A 4D82A 5DN6A 3TSOA 5B2ZA 4BE7B 5FUWA 3AQ4A 5HCIA 4A0FA 1ZM2A 4RKEA 1M1YE 4Q19A 3SYLA 2WBLC 4OK5A 1R0YA 2W2TA 2HLDA 3AV0B 5CB6A 3AF4A 1R0ZA 5EP1A 1BYUA 1JQJC 1Q21A 3AGQA 2HT6A 4QGHA 2BBTA 1YR9A 4QRHA 1ZU5A 3B82A 3RS0A 1E1QD 5J40A 3AVVA 1X8LA 3WRXC 3IUYA 2A5GA 2NGRA 3IEUA 2XXAA 4C2UA 1G5RA 1Y3AA 2QI9C 3B1VA 3EPKA 3U2QA 3LA6A 2FU5C 3QXJA 4MKHA 1KMHA 4MRRA 4MKFA 1E69A 2UZIR 2JJ2D 5IT5A 1G9XA 2FEOA 2ZANA 2WTUA 1CJUC 1EESA 4A36A 1VDZA 2PMKA 2ZQ5A 3QBVA 4N0DA 3AKCA 2ONKA 2NQ2C 2QA5A 3EZ9A 2A5YB 3B1ZA 3U3OA 3GLFA 3QKSA 2F3TA 4BWYA 3FDIA 1Z28A 3AF1A 3IPXA 4HLCA 1MO5A 2ZE5A 1GWNA 1N6KA 1L4YA 2VSFA 4TYPA 3G0HA 5CDFA 4FI3C 4IW3B 2ODBA 1XJCA 1E9CA 1VMAA 4HEJA 4BZPA 4LBWA 3GEHA 5JJIA 1ZUHA 3I4LA 4HDOB 3W8RA 1Q1BA 1X1RA 1SULA 1KI4A 3C4JA 4LC1A 1LNZA 1ELOA 1WXQA 3OAAD 2QORA 1CKEA 3A1TA 2ZJ8A 4M4SA 3CR7A 1KSHA 4TMKA 4FINA 1T8UA 1JR6A 2C9CA 1MR3F 3THOA 5KDLA 1I2MA 3KJIA 1TQ2A 2DY1A 4FMDB 3ZZTA 2OCYC 3VU9B 4RY2A 2JCSA 2WMNB 4IDNA 1CS4C 4MH0R 5EP4A 1G20E 2V6IA 2A3RA 2OZEA 4JT4A 4M1TA 5EXPA 4RD3A 1RZ3A 4XSGA 5AK0A 4TTRA 4RJLA 3R9WA 4MYTA 1ZM3A 1JQLB 1TU4A 3KJHA 5BYJA 4QNMA 4V0NA 1U0JA 1T8TA 4Z8YA 1QZXA 2FFBA 2W83A 5FL3A 5J4LA 3NC0C 1VIAA 3VR4A 3LWNA 3GLFE 4B2IA 1KOFA 3DM9B 2GVDC 3BJIC 3SC3A 1G6HA 2P2LA 2VSOA 1VCOA 3T06B 5CDFE 1G4UR 3GPLA 1UBGA 2ERXA 3I5XA 1P2VA 3TMKA 3OHMA 3TAUA 5FBWB 1UAAA 5L3RA 1KSJA 1FP6A 3GJ3A 2ZS7A 1GDDA 2UKDA 2ATVA 1WE2A 1BMFA 4US0R 3VMFA 5DNYB 1U0LA 2IK8A 2WKRA 2VEDA 3QSYA 3SE0A 2QY9A 2QRNA 1DBSA 1E79D 3DZDA 4HUTA 1SVLA 4LBYA 2HJGA 4PHHA 1SVSA 3R8FA 1VECA 1XCMA 2IXGA 5CITA 4JLAA 5E7JA 2OCAA 1HTWA 3VKGA 2WAYA 2IEYA 3HU1A 4AURA 1OPXA 3AVUA 1OJLA 4Q03A 4MGYR 5FBLB 1WCV1 2VP4A 1IM2A 3MWYW 3THWA 5AJXA 1ZP6A 2JLQA 4BZQA 4ZDWA 3T61A 4AC9A 1FX0B 3QPUA 3AF0A 1EFHA 1OXSC 3IQXA 3AVWA 4BLPA 4TZ0A 2QPOA 3GJ4A 4AWXA 1N6PA 1XMJA 1KDOA 2D74A 1OSNA 3K0AB 2WSSD 1BYIA 3GJ5A 3PXGA 4A2WA 1W0KA 2DB3A 4OHZA 3LXXA 4URVR 3U3MA 4BZXA 3V9PA 4LHZA 3TLXA 4BFTA 3ASYA 3WNCA 3SHFA 3CWQA 2XEXA 4DWJA 2QTVB 2V1XA 3RC8A 2FX3A 4G5GA 1E2PA 2ZRNA 3TQFA 2AWNA 2D06A 2XTMA 4EFLA 1Q3TA 1F5NA 1GILA 3ZLJA 3O8CA 4I4LA 2R6CA 2R44A 5IK2D 1A1VA 5FR2A 4YONB 1GZSA 1JNYA 2HCBA 1N0WA 4DDTA 1OYYA 5L3VA 5EZ5A 2FH5B 3ZQ6A 4EDHA 1QHHA 3OIUA 3RANA 1KIMA 3KQHA 1KJZA 4QHSA 4QJ5A 1XD2A 2BJVA 3KB2A 4KLNA 1HUQA 1CJVC 1S3SA 1QG2A 3BS4A 3S1AA 4RKFA 3WMEA 2WPDD 1ZU4A 3WYFA 5L3SB 2CE7A 3LLMA 3RWOA 4G5SA 4UXJA 3FMPB 3QXCA 4PO8A 2G0NA 2XTNA 1ZNWA 4KI0A 2GAOA 3UK6A 4AG6A 2QAGA 3FTQA 4JLPA 3GLGA 4A9AA 1HYQA 4DCVA 2ZJOA 4GRAA 3GCGA 3RABA 1ZIOA 1R6BX 1SKYE 2QM7A 4D81A 3FFBA 4EQ6A 4B48A 5AR1A 4DDWA 2O8CB 5F9FA 1U98A 3A1UA 1OE0A 3OFND 4LSGA 1TQDA 2JLXA 4UNPA 1FQKA 1GKYA 1X3SA 4YDSA 1RYFA 5AJVB 2OXRA 4ZDJA 2O52A 2G6BA 1W44A 2J7PA 2OESA 1UJ2A 3Q85A 4M2LA 3ADDA 2XZLA 1QHNA 3OF5A 4IOKA 1YE8A 3KTAA 5DSZA 1KKLA 3VR3A 4LJ4A 2Z0MA 2AD5A 1X8KA 4DEYA 1TQ4A 2O5VA 5FI1B 2GEVA 2ZEJA 2VP9A 3ZH9B 1YZQA 2WWGA 4XTRA 3I5YA 3NC1C 4A92A 4G5QA 4LJ5A 1W2GA 4YMTA 5EXXA 2YJTD 2WJJA 3CPEA 2QQ0A 4JLVA 4BRWA 1OH8A 3KZ1E 1P9RA 1T0JB 3P20A 3RDPA 3PJRA 3BBPA 2O8DB 2PZFA 4GFDA 2FFAA 4ARZB 2GEDA 1T3LA 3LD9A 2DCUA 2QT1A 1GRQA 4IEIA 1OHHD 2OFXA 2VQSA 3QF7A 3E70C 2H7VA 3EZFA 4PFSA 1ZBDA 1G7SA 3PFIA 1AKEA 3EXAA 2R6GA 5FPKA 1F6BA 2RGGA 3NKVA 5FOXA 3RAPR 1G8YA 1XD9A 5EE9A 3MSXA 5JJLA 2ZSAA 3DL0A 5JHGB 4TYQA 1UEJA 2JIZD 1KI1A 3BWDD 4JJZA 2FPKA 3PVSA 2YC4C 3L8YA 4Q4AA 3AP2A 2JJ8A 4NL4H 3QIAA 4LJAA 4Q7KA 5LB2A 3AM1A 2RH5A 1MT0A 4L8GA 2DPXA 2VP2A 3HYTA 3BFKA 4D26A 3D7MA 1TEXA 2NPIA 2GWHA 2ZRAA 3I72A 1ZNXA 1IOZA 5BQ5A 2FZ4A 1KZGB 3KKPA 1QBKC 1L8QA 1H8HA 2GXUA 4UJ3A 2MSDB 2C04A 3NHAA 4WZ6A 1US8A 4LJ6A 4DIDA 3MMPA 1EFRD 4MUBA 3ZVRA 2CNWA 1G3MA 1YQTA 3WYGA 5KNDA 1FMLA 3BH0A 4XJXA 3PITA 521PA 5F98A 4G01B 2F43A 2VL7A 3BGWA 4B3BA 1IONA 1II8A 1GM5A 1E0SA 4LJ7A 4CIDA 3LVRE 3TR0A 4A6PA 3U7HB 1Z47A 1AM4D 1V5WA 3IBYA 4HLUA 4N3NA 4OBEA 4NYJR 3ND8A 1YR6A 5JJKA 2XXAB 2X2EA 1N3BA 3BXZA 1EX6A 2VP0A 2R6FA 3Q9LA 1M34E 3GJ7A 4IHQA 1A5TA 2P6RA 3RHFA 1DS6A 1S2MA 1TQ6A 2OXCA 3B60A 4Q1CA 2O8BA 2F55A 1NMYA 4MKGA 4N1AA 4RVCA 5D3QA 1H65A 3EWAA 2L0XA 4BQSA 3PEUA 4WXRA 4B3DA 2X77A 1SVOA 5FH9A 4PC7A 4V0KA 3GLHE 2RHMA 3QKSB 4ACBA 2OUKA 3DOFA 3IPYA 3KUDA 3GP8A 1DAHA 4D80A 5G3YA 4P3YA 1W1WA 1M7HA 1QVAA 4OYHA 4GNKA 4F92B 2JDID 1AN0A 2XSZA 1MKYA 1OB5A 3X1DA 4RSGA 5KSYA 4DCSA 4Q9KA 4M1WA 2ZRLA 1XD8A 2KJQA 4JBYA 5BW8A 1JAHA 3KKMA 4ZI3A 4I1SA 3CZPA 1CRPA 2ZREA 3P26A 5KUTA 2ZTSA 4EAQA 2VH5R 4W7SA 1CIPA 1OIVA 2ZRPA 4M0LA 3AVTA 2JASA 2LKCA 3B1YA 4TT3D 4BFUA 4HAVA 4LJ8A 3CPHA 5EE5B 4CRWB 1UKEA 2OLJA 5DI9A 2QRZA 5JECA 3BK7A 4HI0E 3HR7A 3K0FB 3CPJB 5GVRA 3ZD6A 4KFSA 2IUTA 4KBGA 3WNBA 4C0QC 5KNBA 1KDTA 4A0HA 1E2IA 3SJBA 3JZMA 2B21A 5TARA 2ZRDA 3ZJYA 2NMVA 3T15A 2QN6A 1IY0A 3KKOA 4DCUA 4Q21A 3T5GA 2CVFA 3EAQA 4EUNA 3K70C 5AUNB 1DAFA 4EPRA 5HZHA 2YC2C 4US2R 3JVVA 3VFDA 1T0HB 4TL6A 4OI2A 1F2UB 2BMDA 2BDTA 1B23P 2XOKA 4HB4A 2B7BA 3HPRA 2GAAA 2YINC 4QBFA 3ZIAA 2C9YA 2NZJA 4BEJA 3TAHA 2KBFA 2YOHA 5CLLA 1GP2A 1SXJC 3NEYA 3TKLA 1JXOA 2XJ4A 3AGPA 3RRNA 2IA5A 2WJHA 1YRBA 2PJZA 3MLEA 2P67A 5DYGA 3A4NA 5M04A 1NNEA 1E2HA 3EW9A 1AS3A 2G3YA 1ZM4A 3CX7A 3IHWA 5FL7A 4DSUA 3PEWA 2UVQA 1FL9A 3FMIA 1HE1C 4A2QA 2ONJA 4D4JA 2RKOA 2QGNA 2XNDA 1CBUA 4XSHA 4LDJA 3U60B 4LZZA 5EUQB 3K0SA 4XWKA 4KCGA 2ZJ2A 4WIAA 3LX5A 4OQLA 1IN6A 2BBWA 2VSXA 4HYYA 2IWRA 1FTSA 2CEAA 3GJ6A 4PX9A 3GD7A 2QBYA 3L0OA 2CLDX 1CR0A 1OXXK 2GXAA 2IYWA 3P32A 1GL7A 1BIFA 2GJ8A 4HZIA 1ODFA 2LWIA 2Q0HA 4BFXA 3THWB 2DFNA 1N6LA 5FUVA 3UWOA 4KITB 4TYWA 1R10A 1F60A 2VHTA 4NE2A 3FKQA 4MA4A 1SKYB 3AKEA 3E1SA 3MWJA 4QHYA 3IIJA 4LYFA 2IXFA 4HZUB 1PJRA 2G0TA 1GL6A 1X8JA 5DH9A 1OFHA 4WZBE 1WMSA 4JSYA 3OESA 5CJ2A 4XVUA 3TUZC 2AX4A 3CWZA 5FTNA 4BLTA 4C0JA 4TYNA 4BPBA 3B9PA 4Z1MA 5TB5A 3EIHA 4RD1A 2AWOA 5HCNA 3SZRA 3TSWA 4NMMA 1V43A 1JPJA 1IN8A 1CRQA 1S96A 2ANBA 3LNCA 3Q7QA 2NOAA 3T1OA 1Q1QA 2RCNA 5E95A 3MAAC 2QPAA 3ZVLA 5FTJA 2AFIE 3EZ6A 4M1YA 4B43A 3ASZA 2VHUA 1E2JA 4JLKA 1OFUX 1Z5ZA 2R62A 3Q8XB 3ZS9A 4W9MC 4AKIA 1KJYA 4POAA 1DEKA 1QHHB 1WBBA 3SQXA 4MITA 2IYSA 2IEZA 3Q72A 3SJCA 1E2KA 1S3GA 4ZIRA 1T5IA 4UQOA 1LTQA 3QF4A 4B2LA 4IXMA 1ANKA 1EWQA 4V0LA 2F6RA 3KKNA 3FMFA 1VCIA 4Q9JA 4TYYA 1KO8A 3K09A 3W3ZB 2Z4SA 4FCWA 1HT2E 4DDUA 1KNXA 3HP1A 1W48A 3EX7C 3CLVA 2IS1A 2AK2A 4CEHB 2H1LA 3HR8A 1E2NA 3KXKA 4EPTA 1FMJA 4EQ6B 1XEFA 5G3ZA 4NONA 5B64A 1EFUA 1Q3HA 4TMWA 3NBXX 2KWIA 3RS5A 3FKSA 4KYUA 5FOWA 1CLUA 2O8EA 4RFSB 2AHOA 1Z06A 1E1RD 3P4XA 4XOIA 4D0NA 4B6FA 1I4LD 2P5SA 1DARA 2ZVQX 3EA0A 2XNSA 1ZMXA 5JS7A 3K0EA 5KTYA 2WIBA 1JR3D 2PX0A 3H86A 2LKDA 3B6EA 2VPPA 3UG6A 4AKGA 2ZSBA 1DAIA 3BIFA 2ZR7A 2QGZA 4A8JC 4DZZA 2OFOA 1W2HA 4LBZA 4B3CA 4A8JA 1MV5A 4MDFA 3MJHA 3CRRA 1DADA 4WA7A 5LBIA 2ZPTX 3M4YA 3B7GA 1OB2A 1RIFA 1E1QA 4LYAA 2CHQA 2ZYUX 1F48A 1HURA 2P3SA 2VHJA 1FP7A 1UKVY 5FPYA 2FOLA 4TL9A 5BN5A 4EJSC 3TVDA 2XB4A 4G5OA 2WOOA 4G5RA 2W2XA 5C46F 3Q3JB 4EJSA 4LI0A 1GUAA 2OM2A 3RS7A 1XP8A 3D31A 2JJ2A 3D6TB 4LC0A 3SOPA 4IJMA 3PEVA 4TMVA 2RGCA 3ADBA 4KBFA 3SHWA 4AY2A 2RGAA 5GJVC 3TUJC 3L0SA 2AR7A 4EPWA 4ON9A 2YKGA 4M1OA 1DELA 1QG4A 4W5WA 2ZE8A 1AZTA 1UKZA 4JVMA 4LX0A 2OO7A 4PPNA 2BWJA 4GZLA 2WMOB 4JLMA 4QGFA 2Q3FA 1E2MA 2EU8A 4A2PA 3AP1A 3K9NA 3W6OA 2B6HA 2J5XA 3LQRA 4JLJA 3RS4A 3X2SA 3SR0A 2R8RA 4DXAA 2EW1A 3GEEA 2ZYVX 2IW3A 1K5GA 2JAQA 2FV8A 2OHFA 4IXNA 3I62A 1VKJA 2ZU6A 3EIQA 1NG9A 4GOXA 1CXZA 3W6PA 4MGIR 3GLHB 4QM6A 3TBKA 4IVRA 1Q1ZA 2G1KA 4JMPA 1W49A 4M1MA 3AEZA 3OAAA 5CK4A 3HJNA 3BH7A 1ETUA 2ZIAA 2IUSA 4PC6A 1RRCA 3VNVA 4Y0VA 2E87A 2V9PA 5LPNA 4AKHA 1NBMD 2CL0X 4NCIA 1SQ5A 4JYCA 3QENA 3R7WB 5J4HA 3IEVA 4KFUA 3U3JA 3NBYC 5J4VA 2ORIA 3FYHA 4PANA 4CEJA 2Y8EA 2NO6A 3QKUA 3C5HA 5C4GB 3QVVA 3L2OB 4QG7A 5H68A 5HPYB 5KHOC 1C9KA 4R98A 4TL8A 4CEIA 3U3RA 5JSZA 4YXWA 2GA8A 3K0CA 1N2CE 5DIFA 4NZYA 5AJZA 3REGA 1OXVA 5DHAA 4CVNA 1XMVA 1N6RA 1OW3B 1E9SA 1OIXA 2VYFA 3RC3A 1XBTA 2A5DA 2VA8A 4TSFD 4CT4B 4TWZA 5A0FA 1GOTA 3QJYA 5FFMA 1L7VC 1BS1A 2GJAA 2O8BB 2C78A 4FMBB 2AKAB 1P75A 2BKUA 4QC2A 1MRSA 2XZPA 3U4QA 1UDWA 2FSIA 4I1OA 3CO5A 4FN5A 2IS6A 2IYUA 1VG0B 2CK3D 2GHIA 1J8YF 2ZROA 4GMDA 4NYIR 3B9QA 3D3QA 4DLSA 3V4RA 3LH5A 1E79A 1KK2A 1VG1A 4ASUA 3MWLA 2V7QD 1G7CA
chains in the Genus database with same CATH superfamily
2OAQ1 1U4SA 2AE2A 4NICA 2WSMA 3N0WA 4R1QA 4MKIA 2ZIXA 2FPUA 4XD7D 3ZD9A 1DEXA 2VNHA 1D2HA 2YDXA 1GFZA 3D3NA 4LNHA 1A4RA 4BQQA 1V8ZA 3DG9A 1T2CA 2FZEA 3T1NA 1BO6A 1IIBA 4ZMSA 1XN1A 3WGKA 4BLVA 4U2BA 1VA4A 4NS4A 1KAGA 1SBCA 5CFRA 4YK7A 3M81A 1NUTA 2C03A 2EFCB 3DLCA 3DOOA 4MR8A 4AQ7A 3LLUA 4N5DA 1ECLA 3GLIB 4JLDA 2QPTA 5F2KA 2PX4A 3C3KA 3RV3A 4DGSA 2QP9X 1XXHA 3EA5A 1XPRA 4BBAA 5ADVA 4EM6A 1R9MA 3IAUA 5D7BA 3TX6A 3PNSA 4EGFA 4Q1VA 2NU6B 1CR4A 2IEAA 1TF7A 1SGWA 4EHKA 1UDBA 2R87A 3JTMA 4KIJA 3FETA 3ZNPA 4B1FA 3O4HA 4F9EA 1YC2A 2NX2A 1Y8QA 5DN6D 5K6AC 1RAHA 4QOHA 1BXRA 2GMWA 3I92A 4XE5A 1MABA 2PSSA 2YMQA 3MFYA 4ZO4A 4BPRA 3DTYA 3M6UA 3LY9A 4B0OA 1CZRA 3JQ9C 4Y2XA 1XNGA 3ZKWA 4EKIA 2BVNA 4G5YA 4DQLA 3C85A 3TSYA 2AQIA 5HIKA 1D2GA 1QG0A 1R0XA 5IK2A 1YDHA 1IFXA 4Q93A 2HXYA 4TKLA 4OFBA 1LXCA 4WZBB 1N2GA 2OECA 2NSHA 3TK1A 3L7KA 3LBHA 3QVLA 4W5QA 1UBHS 5EIBC 4L16A 2J6IA 2UYGA 2P78A 2ZJAA 3OCWA 2R5NA 4CMHA 1WUYA 5J5CA 1T5HX 4INPA 2QSJA 1SXJB 1VB5A 1G8HA 1T0UA 2O9JA 4MUGA 4X8MA 1UAGA 5HDBB 1Z4OA 3FPCA 5HVNA 4ZI2A 1DAPA 4UDXX 3F9IA 3CLRC 4Q1EA 5G0TA 4RQTA 3SGLA 3VQTA 3RRZA 5JANA 1W36C 1KYXA 3HCCA 3LNTA 2XF8A 1A69A 2ZSFA 4O29A 3KKQA 3A2KA 2R6AA 3PUWA 5IM4A 3SS8A 4MVJG 1E7QA 1P1RA 4I14A 3CURA 4P31A 1NRJB 2BDUA 4OQ4A 2XT9A 4X9XA 4C0HA 2VG8A 1EVZA 5KWIA 1L4HA 1CEYA 1GG8A 3RSOA 2WV7A 2BP7A 2PN1A 3UMFA 3AERA 4AD8A 4CI0B 4CTKA 1H4SA 4E5SA 3FYUB 3WGQA 3ZWCA 3EEFA 3MINB 1PNTA 5EXTA 1A9RA 2C3YA 2J0QA 4OF4A 5IG2A 4BECA 3OZAA 2B92A 3HFSA 1UOQA 1N2SA 2FPSA 2QN7A 5A4KA 4LPSA 2FA9A 4QGBA 5A5GA 1USIA 3DFFA 1ZMRA 3ET4A 4C0LA 3ZDFA 5B57C 5KWSA 2Y9PB 2PA3A 3R77A 1TJYA 4MPDA 4C87A 3AJAA 3EIFA 1HSOA 3HVHA 1BX1A 1DTWB 1E1KA 2ACKA 2G63A 2JHGA 3FDXA 1RJ9B 3HWRA 4ESOA 5CDUA 4KQHA 2BGTA 3FFAA 4R71A 4MOWA 4EECA 4NBRA 1QGED 3TINA 2G4VA 3CG0A 3H5NA 4I5DA 4ZVOA 2C95A 3EW7A 4UBJA 4JHXA 1AMNA 4E1VA 3K32A 2OMKA 1IRXA 5I9IA 2BCGY 4X1KA 2GYUA 4V2UA 3UMGA 3H1TA 4GYYA 4WL0A 2BBOA 2HJWA 4IH4A 5A4DA 3HG7A 4JZYA 3V4VB 4XUDA 2HX1A 4ND3A 3P1JA 3DOEA 4OQFA 4OYYA 4ADSG 4HAUA 3G9XA 3I1FA 5LP6A 2DLCX 2GK6A 4EGSA 4RD4A 2WIFA 1TL7C 4J0JA 4IZIA 4KVGA 3SSNA 4GP7A 3C7KA 1W46A 1C0EA 5SZHB 3IJ5A 1Y4SA 3U4CA 1C9MA 5FO0A 2UYQA 3OFVA 5FHQA 1V1JA 4Y18A 1KF0A 2IY8A 3PUYA 4XWGA 5DHRA 5DWDA 4ETIA 1QSGA 5FO1A 1DRKA 3RTBA 1MXHA 4D8UA 1O96B 4B71A 3L82B 2JIZA 1RBYA 1T6BY 3CZCA 3DR3A 3GNSA 4J07A 4N3BA 4XGIA 4FE3A 4CUJA 3H87A 1KFJB 3D8NA 1YFZA 4B5KA 2EBHX 1WCYA 1MXFA 3O90A 1K7SN 3PUKA 2IYPA 4MAMA 4WLNA 4D99A 5KTRA 3OZIA 3G8BA 1XLTC 4RH1A 3KZOA 3MT0A 3OOWA 3KE9A 3AUYA 5J2TB 2QMOA 2WJWA 3AW8A 5HFNA 4ENTA 4A8TA 1Q12A 3M2TA 2QMZA 2GCGA 1XTSA 1W0CA 2R84A 5TX7A 3O8DA 2VK1A 1JAZA 2FWIA 4ZCMA 3EVCA 3H19A 4Q4JB 1XRMA 2PKQP 3WADA 3VHLB 4FFDA 4UKDA 1XZAA 4UPVA 3UCXA 1FYVA 4I1VA 3FWYA 1WKVA 2YMMA 1XQ9A 3GT0A 1GQ2A 4BQPA 5J2UB 4YRPA 5ED0A 1BCSA 3RLFA 5H1YA 1CP3A 1Q1EA 1U5CA 4MP3A 3GG9A 5ETJA 3X44A 1D1PA 1DG3A 4J16C 4L5CA 4C0BA 3VX4A 5GMOA 1F38A 2PUGA 2LUOA 1EU1A 1GFIA 1NXOA 3GJQA 1HKUA 3H4TA 1J7KA 2VHCA 2NUPB 2WHPB 1P2FA 2EERA 2M6SA 5LQRA 2FSSA 5FA8A 3QPVA 4NCNA 2ZI5A 4HDKB 4UHBA 3EPHA 3AX6A 5BV7A 3KQMA 2CZCA 2VF4X 3LX4A 2G1JA 3I09A 4JUIA 5JBNA 2P62A 3VZRA 1W0KD 1CJKC 1CY6A 1QP8A 3RBAA 3AZOA 4OJQA 1DPFA 3SYKA 4ZEVA 3Q10A 1LWOA 2H11A 3DZIA 3ITKA 4MQFA 4WNAB 4F2HA 2D1YA 2ZVJA 5C35A 1L7AA 3T0IA 1YMVA 1XUOA 1JHVA 4L7QA 3ZBUA 4CHTA 1BS9A 3NKFA 1E4YA 3BCSA 2Y2VA 4J4TA 1U9IA 1QHIA 3KJGA 3OEEA 3IMKA 4QVGA 1TMYA 4OQZA 1RD4A 1RHQA 3IDFA 3M9XA 1CEEA 2H63A 4N3AA 5LYJA 1YZFA 1Q57A 3IMFA 2ODAA 4RJIA 2ZSIA 4EYOA 2VTBA 2KHZA 2F9LA 2PWZA 4HUQB 4M86A 5F1YA 3C8HA 1WTAA 2AXQA 1KJJA 1W35A 2VWGA 4NLLA 5HM6A 2UZAA 1RCFA 1QMPA 4OQNA 1R0CA 3ZKAA 3TLMA 1I7DA 2PXCA 4S35A 3MGBA 5FPPA 3QGMA 2P68A 1T5BA 2QUIA 3WLQA 1G8GA 3OQMA 2RAFA 3M3PA 2CLEB 3EOZA 4B6OA 1YR2A 1EK6A 1M0TA 2XDQA 4XUCA 5F64A 1PWXA 3RAJA 3UW3A 1QHYA 2WWHA 4CKEA 4DNFA 2H1IA 2P41A 2QUJA 4LCBA 5LDGA 5K8CA 3E05A 1QH1B 5T6BA 2H5JA 3H2SA 3IA7A 4AN4A 4ZZ0A 3O91A 4MGZR 2HV8A 1C2YA 1BEZA 5JVDB 4PN7A 4GWKA 2UV8A 4NV3A 4A0RA 4DLUA 4CM4A 3M82A 4K9QA 4C0SA 3WL7A 4K5QA 1D2EA 1F20A 1HNNA 1ECBA 2J7PD 2XMPA 3KRTA 4N01A 1DFIA 3BD7A 4R3WA 4WDQA 2QHXA 2I7VA 3AK4A 3ZQUA 2PUHA 3V1NA 3NYWA 1K89A 3E18A 3F4BA 3LTNC 3H1FA 1RWWA 4UM7A 1TLTA 1YHYA 2QTCA 3WRVA 4F1KA 4UVIA 2VPIA 3PHCA 1VIVA 5GINE 4GRIA 1Y0BA 4OQQA 1M67A 2HBYA 1LLQA 2C1EA 4IG4A 3M34A 2KX7A 5FX2A 3QLVC 5ESWA 3R6LA 1O6BA 3R3UA 3R3YA 4JL5A 4R7TA 1BQ4A 2FFQA 3SFTA 1YCHA 3W90A 1NVGA 4ERNA 1C7EA 3K5WA 3I28A 3NBKA 2H65A 3TOXA 3B5IA 3NHZA 3JYOA 2I6QA 1RVDA 2YJ3A 4FJ1A 4AKEA 1RRGA 2D13A 1JH9A 3OT5A 2P79A 1PNOA 4JAVC 5BSMA 2WE8A 5G0SA 5TV2A 3GJSA 5ESRA 4ZYVA 4U2GA 2A7QA 1SAYA 2Q4EA 4XB2A 4KGZA 4LTMA 2D2VA 2AD1A 2IU3A 4ITUA 5CP8A 5LC1A 3AVYA 1XTPA 3E5HA 1SG6A 3ZCXA 5CG2A 1O97D 1B6RA 1C9JA 1K3FA 3CX6A 5FIUA 1K8XB 3COWA 4GOMD 2GF9A 3EYWA 1AB6A 3L1UA 4WFKA 4DLYA 3VNUA 1U2RA 1YK0A 4QUGA 1W4BA 2R1UA 5FBKA 1JG1A 1E7MA 2F9MA 1MNQA 3KR2A 4IIBA 1GQYA 4IUDS 4WXEA 1FU7A 1EG2A 4Z53A 4JYMA 1I5OA 4G1UC 2AN9A 3HJFA 4HAZA 1P2DA 1PZNA 1UF9A 1YCDA 2X19A 3HL0A 1YBFA 5KO2A 4DYHA 3IKVA 5I47A 1FTYA 1L4FA 1O54A 3BMQB 3ROPA 5KX5F 2BGRA 3O7MA 4OXRA 3DYIA 3QOWA 1H69A 4JD5A 4A4DA 1YFLA 4MUFA 3EODA 1XU4A 4IXTA 5A4AA 2GUWA 2O0JA 2AMJA 1RFGE 9ABPA 1NWCA 4XGKA 1QO0D 2V74B 4YECA 4CKCA 4R54A 4N54A 4U4AA 3TTVA 1TVKA 1UBNA 5HKLA 3WK6A 1DMRA 1R16A 4P4UA 1ISGA 3O8BA 3G8DA 4MP6A 2IDZA 2A5JA 2N75A 1N5IA 1Q92A 4XQ9A 1F3OA 5E0KB 3WSWA 4C2AA 2C7RA 3U9LA 2CJWB 3GBSA 3IP1A 1WMAA 1Z4PX 1C80A 1YXMA 4MUKA 3IAHA 5JNWA 3BJRA 1T0BA 3PQCA 5EZYA 4K9PA 3QVJA 4QHTA 3RE1A 4LFAB 2VRNA 1Y81A 4J3JA 1OFTA 4FFBA 4B3GA 3ADKA 1MIOA 1PJZA 2BHNA 3EZGA 1H6CA 3L6BA 1W2WB 4G24A 4NBLA 2RCYA 3WYBA 4DLKA 3OJCA 4PXAA 1NVWQ 4YCLA 4GYKA 4LF5B 3G2LA 5JWOA 1J1UA 1XZHA 1CJBA 5A0VA 4CQJA 2GEJA 1NUSA 1P7ZA 1R4MB 4ZVKA 3G2HA 4F8YA 2IKQA 1QU3A 2C5GA 3H8VA 3JX9A 2PBRA 3R3VA 1UMCB 1YD7A 2BOVA 3ENNA 4MQMA 2R6JA 3EDMA 3MJRA 1UXJA 4WZAA 5A04A 4HNVA 4E12A 4G5HA 4WRRA 1K8QA 4HGOA 2EG9A 3DLBA 4RF3A 1V9CA 3SEFA 4U63A 1I3OA 1IOLA 2ZBUA 4PSVA 4BATA 1FE8A 4MW5A 2NLOA 2GASA 3F7MA 3GI1A 2ZJBA 3NWBA 4O4IA 4HAIA 1Q74A 3GFFA 4NCXA 2HXGA 4MUHA 3UG7A 4HH0A 4PSCA 1DQZA 1NBOA 4N9QA 2Q3DA 2BH9A 4GYJA 1KI9A 4ND2A 3DVRX 1C4WA 3HRHA 4Y0AA 2YS6A 5THXA 1HPLA 3ZQJA 3ZWNA 5SYMA 1ID8A 3UK0A 1GZHB 3EVBA 2VXBA 3I5MA 4NFSA 4MYUA 4BQRA 3EASA 4IIEA 3RNLA 2I4IA 2Q4DA 1XMSA 3SDZA 1OKKD 1YH3A 4TROA 3WP0A 1UP6A 1N3IA 1WUIS 2CVQA 3KZCA 4UNNA 3UWSA 2IS2A 5KYWA 5IBPA 4PAWA 3UGQA 3UMMA 3CS3A 4I5IA 5BNZA 5I7SA 3THYB 3WYCA 1LVHA 4OBXA 1QDEA 2OK8A 3GRRA 3MXTA 3R5SA 3FSRA 4LTDA 2ONZA 2FN7A 4TKMA 5BV8A 3RUFA 2R66A 1TUEA 2IYVA 5LD2C 2FPRA 4AP5A 3OBIA 1E1RA 2RHCA 1W4CA 3GUVA 4KRYA 2BMEA 3RC9A 2DZDA 1DXQA 2VHVA 4RORA 4EO4A 1AG9A 2F3RA 4GMGA 3HO6A 5EA2A 3F7NA 2O7RA 2PLFA 1QS0B 2NVOA 1Y8RB 5H9WA 1TT7A 5I9LA 1MIHA 3LDUA 3VNQA 1QOQB 3E8SA 2F1IA 3OC6A 5LWHA 3RS3A 2KYRA 1EG7A 3P2OA 3MEQA 1PT9A 4IIHA 3WK9A 3ZZUA 3NTQA 2FEAA 5GADl 1WPXA 2OILA 1NMXA 1Z8FA 1R2QA 3ZIDA 1P81A 3ZWWA 3I8XA 5I7OA 2Y93A 1WEHA 2W4MA 1TMKA 4IVQA 3V46A 1RYDA 5I7FA 1Y6GA 2QXUA 5AHWA 1FFEA 2FX5A 2V98A 2VHXA 1P9NA 1UQTA 2QMYA 2V7VA 1OU0A 5BXQC 5A05A 3STXA 1J0XO 2QTVA 4WUTA 4YPVA 4L07A 3KQNA 4MULA 1UFRA 4P32A 1KDRA 1XD2B 1XWWA 2GOYA 2J3LA 2JCGA 4NYMQ 3M6MD 5C37A 2HJ9A 2HYIC 2YRWA 2NTEA 1J4AA 3DYBA 1Q1AA 3K09C 2EYQA 3CJRA 5DLYA 3SP1A 4CIAA 1PYGA 3C8ZA 2D7DA 4FE4A 5K3EA 3K31A 3O92A 4CDRA 3MIZA 3WQSB 4TKVA 3WG9A 3IHTA 3NBZC 5ITZB 3QQPA 4DB2A 1AUQA 1TF2A 2QRHA 1R6VA 1XCGB 5A1TA 5C0OE 4RIIA 3F5DA 1C1XB 5L3SA 1EHIA 3EGIA 5AJTA 3TRIA 4KLAA 3UQZA 1QF6A 1TW3A 1GUYA 4EG4A 3K9GA 1AHIA 2QX9A 2ZWIA 1ECFA 3P52A 5IJAA 4CQMD 4QJ3A 1MEJA 1SBYA 1KDZA 4P33A 3CSUA 2ZYRA 2PZJA 4X3CA 4ZO7A 3WL8A 1SD5A 2CCKA 1IIRA 2PL3A 3BWMA 3KS9A 3OQVA 4RGVA 3VR6H 2E5WA 2ET6A 2TSYB 3LC1O 3AB7A 1PQ4A 4M1SA 2JHFA 4UMDA 3WIDA 4BC0A 4LOLA 2WJVA 2QL7A 4TS3A 3IT2A 1F8YA 5CM8B 4QUJA 4PCUA 3OLVA 2ENUA 5CHYA 5JXJA 4HY3A 1U0SY 1B2LA 1HE5A 4I4TA 1MA3A 2JS7A 4JUFA 4EHIA 1OOEA 3HDVA 3A1CA 3HBNA 2W6CX 5EL0A 1P0FA 3ADOA 3NH6A 2DWQA 3QPAA 3QXGA 1GPKA 1PK8A 5ER6A 2XODA 3T5CA 3CKKA 3TIXB 1CJSA 2GJSA 1E3MA 4XW2A 2R25B 1P8JA 4OUDB 3T1QA 2I2FA 4HAYA 2W2KA 3PJEA 1AGXA 4CM9A 1WW2A 2DKFA 2B78A 1F4VA 3LHKA 4RIEA 5CGQB 2F48A 2PX5A 4L76A 4UEKA 5K4AA 4MYHA 3W05A 2G71A 4RGBA 1CJCA 1Q0UA 2G83A 3JAMA 1KWKA 1KMCA 1ZJ4A 4BVHA 1PBNA 3OUZA 3I3OA 4BCDA 2D54A 4D5EA 4X6UA 3DV9A 5KZMB 2ZWVA 4GG1A 4MWBA 3LZCA 1DQSA 4V38A 2AL7A 1RI3A 2GPTA 2DBRA 1F0PA 3A4IA 5HKOA 5H02A 5JS8A 4REMA 3QVGB 4XGQA 3SLGA 3DHEA 5DE3A 1GSIA 3AEKB 2P4SA 3QX9A 2O5CA 3ODGA 1ZH6A 4BKMA 5CPFA 2EJBA 2ZI7A 3BXEA 1XRPA 5K3FB 3PD0A 2R48A 1WY5A 3AEUA 3QKWA 4MO9A 4CLOB 3U56A 2AG8A 1EWTA 1IZ7A 1L2TA 3I8OA 4LUCA 2LCIA 1ADBA 4L0DA 2JBAA 3KHUA 4O5AA 4E2FA 3CT6A 1VHDA 4HPWA 1XCOA 2CNBA 4QGAA 3SZUA 4WD3A 1G66A 1SZCA 3C6YA 2D00A 2AJTA 3RT9A 1NV8A 1UADA 3KQLA 1ULSA 3OI7A 4IGFA 1O95C 2WA2A 2WHXA 3WQHA 4AJEA 2DQKA 2VDOB 3I2FA 2IT1A 4G2NA 3KVRA 4AZTA 4CN9A 1SZJG 2C5AA 1PG0A 1B8VA 1NQWA 1YB6A 4LQ4A 5MGNA 2PZ8A 1SKBA 2H5LA 1C9DB 1WDTA 3L7OA 3H9GA 3MYYA 2QTAA 3K72B 2BM0A 3R9XA 4H1HA 5CVVA 5EGSA 4XYLA 3KUUA 2X6RA 1JB1A 4B7ZA 1KY3A 2B1QA 4X6YA 2CZQA 2ZB2A 1WUHS 3L93A 1E9RA 2JI9A 3F5FA 4IEFB 1NMZA 1R8XA 3ELDA 3HA5A 3L7CA 4QQ8A 4R1MA 3L06A 4KYIB 4RZXA 4ESEA 3H2HA 4HAXA 5CIWA 4A6DA 4ZALA 2AJBA 4EMUA 3COJA 1RXUA 1ZMBA 2BMAA 4X1IA 3V4ZA 4N0EA 2X9QA 2YVQA 5C2JB 1ZWKA 3FHLA 1MOSA 2F43B 2XNCA 3W79A 2I2BA 2YV5A 3CSSA 1A5AB 3L7JA 4D3DA 1FTGA 1GXSB 4G2TA 2ODNA 4CL0A 3F98A 2WWTA 3NGXA 3BE6A 4CPDA 4TXLA 5KWVA 4WNYA 3UAWA 5E4YA 3K0CC 2N9UA 2FQYA 2GKOA 3ZDZB 1Y4UA 4HAWA 4YAUA 1EX7A 4P4NA 3IESA 3ZHVA 1UCFA 2R3SA 4KSCA 1JA9A 4RQUA 1T3SA 2EJTA 1J8QA 1NBWB 1U1IA 2JI7A 3GRKA 4Q5IA 2B98A 2YW9A 4ISCA 4PG6A 1NKTA 3IV9A 5TS3A 1YS2X 2GKGA 1Q0PA 4XB1A 3K53A 1N0UA 1Z0FA 4TTAA 5MF6A 2QZJA 1UBCA 4MQ4A 4EHBA 1NLUA 1BHJA 4FEGA 4UE3S 4P0TA 3IQWA 1ZIDA 2AYXA 3U3ZA 3V7NA 1Y4ZA 1J5EB 4MS4A 2HIMA 4ENWA 2PKQO 4UXHA 2B25A 4ZD6A 4AT1A 4HKTA 3Q41A 3V4PB 1ADJA 4TWBA 2VR1A 2O57A 1U8ZA 3IUPA 3GGDA 4ZOLF 2CHVA 1G7TA 9MHTA 3DQZA 5LQUA 4QFMA 2AOVA 4P0QB 3JQ7B 4CCYB 2WE7A 1ZUD1 1PW7A 1H2YA 1UM8A 1BA2A 3EUFA 1X7GA 3KPUA 5IBRA 1GG5A 1FS4A 4DLRA 2HQ1A 1K0UA 1P2GA 3PC6A 1QOZA 1CQXA 4MP8A 3VDMA 3DMHA 1KY2A 2PT7A 2NTJA 4BU1A 4BGDA 2DH6A 2QVXX 3MJEA 1GTJ1 4IV0A 4HB2A 1ZJ5A 4BEVA 1B6GA 1W8DA 2CYBA 3ZYZA 3OTWA 1NM5C 1NVXQ 1N7IA 2C84A 3ITDA 3N8DA 4MGKR 4QTXA 1ZR2A 4BGUA 4GBGA 4JLUA 5LQNA 5A02A 1RKXA 3M83A 1KK0A 4D8XA 1KC3A 3RYHB 4AX4A 4U8HA 4CUZA 3QWAA 1JIJA 1R9NA 4B6JA 1IEVA 3GEPA 1EFAA 1QRRA 5E9AA 4C7VA 1OZGA 2V7TA 2VZ8A 1HNXB 4C0AC 2QRQA 4OFZA 2JCYA 3IV7A 3OIVA 4L1KA 3SKYA 2WV9A 4UNRA 4EF4A 4ED9A 4NK4A 1MB9A 4FI3F 1QHGA 2XMZA 1RAGA 3LQKA 1A88A 1WV1A 1V96A 4PLZA 5BWOA 2ZRBA 1BH2A 1QHEA 1RPTA 4H3VA 2GAFA 1W6UA 5K0GA 3VC2A 1XP5A 2QM8A 4WGGA 4CKWA 2A58A 2QDXA 2XVXA 3UAZA 3AVOA 4DLNA 3GEMA 3NBUA 4V0MA 1QIMA 3CLSC 1L9XA 3U4GA 2Q7XA 4OHBA 2XGOA 4G6ZA 3N2GB 2HTFA 2JZNA 5CT4A 4CU2A 4CQLA 4DARA 1DC6A 2XCIA 3UUFA 4ENUA 3GP5A 2ZTUA 4OK3A 2ORYA 2XWQA 2WWIA 1V4BA 4YV7A 2XQKA 2E48A 3E23A 3FB4A 4IIJF 3UMCA 3WV4A 4DB4A 1AQYA 1AY0A 3L04A 4WLFA 3FPAA 5T67A 4RPJA 1JHAA 1NR1A 1IVNA 1I14A 3VR0A 4BJHB 1G3IA 1RRPA 2I66A 3DT9A 3FPBA 3OOSA 4DCMA 5BSEA 3RJMA 5BSFA 4TYNA 1VPVA 3EIEA 4NENB 5IJ9A 2QT0A 5EWLB 5L53A 3SWWA 1PTJA 3LAWA 3F74A 3FFXA 3CH4B 3HI6A 1JHRA 4LNAA 4C5CA 3SF8B 4LSWA 5DYYA 2MSNA 2GEUA 2WT8A 1P4HA 5C1BA 3H4MA 3IAM6 1REQB 3FPKA 5AKLA 1KTVA 4GZ5A 4M54A 4C78A 1PKXA 4IDDA 4LJYA 4XXHA 2FUCA 3EPJA 4DPLA 4WBNB 1C8VB 3VNSA 3AB8A 3O4IA 4M7WA 2E82A 4MO2A 1U0NA 2QBYB 3QX7A 1LBQA 4F8JA 4QA9A 2VDQB 1NW8A 3G85A 5IWCA 5EQTA 5AHKA 4ASUD 1GAWA 3W4IA 3D6VA 4PLPA 1LDBA 1SHZA 2F7SA 2FRVA 2ZTLA 3T7TA 4C0XA 1EAMA 4E2WA 3GHHA 3ZOZA 5DM0A 3ZZ0A 4ODIA 4DIDA 4JL8A 4RHYA 5HXAA 1WVMA 2N1MA 4PR0A 1DX6A 4LAFA 4F45A 3W1VA 3HHEA 1PD0A 5ALGA 4DJJA 2GD2A 2CD9A 1M2OB 1E5DA 1Z2NX 5BVGB 5ICFA 5LD2B 3B13B 4HDSB 4N5MA 3RUCA 1HMYA 3C6BA 4GR9A 4JI5B 1Z6AA 4A23A 3O93A 1X1AA 2ZAOA 3KCQA 2JJYA 2AIRA 1SPXA 3ZGVA 1SWVA 3AR2A 5FR1A 2IHYA 4TS9A 3F73A 1HE3A 1LDNA 2D7JA 5DU2A 4D42A 4DLZA 5HQTA 1THZA 3FI0A 4YI5A 4HXFB 3NHBA 4MCAA 2X4IA 1PQYA 2NUAB 1P31A 3FA2A 3QMPA 1SQ6A 4MRVA 3B8HA 1J42A 4QASA 3RK0A 5IKOA 4TVOA 2FEMA 4HQOA 1TA4A 5DNCA 1IJKA 3LHFA 3TSZA 3OM0A 3SDSA 3PCTA 2OAP1 2ZSEA 1JJBA 2N1BA 3NVAA 2J5KA 1FSSA 2NT3A 4ESVA 4E2ZA 5EJ5A 4UASA 4LF7B 3IPLA 1DUSA 2P4UA 3T35A 2A4MA 1UK7A 2C1ZA 3DTTA 4UNQA 3TLGB 1EVJA 1RWVA 1ZD1A 3LCVB 4GXQA 5HQJA 3RPEA 1VM6A 2BZGA 3KQKA 3D1JA 4RIFA 3FNFA 1CEQA 3FM9A 3HWX1 2RIRA 3I53A 3LPNA 1DIGA 1E3WA 2X14A 3GT7A 1NGSA 3DTVA 2QJOA 3ILVA 1W5BA 1CEXA 2EP5A 4QLOA 3CV3A 1KOGA 2A9KA 2B8JA 1DKQA 2GSDA 2EYUA 3AUKA 1A2QA 1EUCB 1GZUA 3JSXA 3OWXA 3FGOA 4F1JA 4KRFA 2H1SA 2QB5A 1BMFD 3IBFA 3PEYA 1U8EA 3NXKA 2WHRA 1UDAA 3GWGA 4X8LA 5AIBA 5LNK6 1S8AA 3CZ5A 3NHUA 3GF4A 4I19A 3BDAA 3BSWA 4TS1A 2JGFA 4Y0NA 1V8PA 3V7UA 1XAGA 2JHPA 1C4XA 2OSBA 2DQYA 2RHHA 4JI6B 3U7GA 1EHCA 4RO0A 5KJEA 3OPQA 2YNMA 4O2AB 2O0KA 1RE0A 5FQOA 1X39A 3QVTA 4CEHA 1YVDA 1X1SA 1YHNA 4FDLA 5KYYA 2DUMA 4F91B 2ZATA 3UXMA 1G17A 4PHGA 5ITWA 4K0RA 2ZUVA 1XK7A 2Z2ZA 4UHHA 1ZCFA 3AFIA 3SI7A 1GGMA 1FDOA 3HA7A 5JOQA 3G2NA 1J8MF 2IZ0A 1BMQA 5JAMA 1VPLA 3GJ8A 4DNXA 2QX4A 1X1BA 2VZLA 1JDZA 4DRZA 2KPOA 4Z4HA 3EB9A 1G9TA 3CF0A 5EXEA 3DEFA 1XO1A 3GRAA 2P5TB 4P35A 4DZRA 1PJ2A 1XKQA 2H5IA 2ZRHA 2ZI9A 1EGQA 1U7WA 4AZ3A 3VYVA 3DNMA 3DZFA 3HNPA 4OTZA 4DUGA 3N8KA 4IVPA 2H2WA 4WVFA 1XZQA 2Y9MB 4NXMB 3TUIC 5DYWA 4YS6A 3DA8A 3T12A 1PV4A 5KPDA 3VKUA 3TRJA 1NLZA 5FI3A 1DHRA 1XEWY 4AUNA 1AB5A 4ZK6A 2W6OA 4LWZA 1LNSA 4IOLA 4FD2A 4B33A 3L8MA 1M7GA 2BONA 3DF9A 4PCAA 4QT0A 4UJ5A 1I2BA 1S0UA 3TJZA 4KVFA 2Q3MA 4YUVA 2MR5A 3KHTA 3L8FA 5FBQB 5EKTA 4CW7A 3LVQE 2Y66A 2Y92A 2DJ5A 2NXNA 4OXKA 2J6CA 1UZMA 3VYWA 1E1MA 1I2AA 1Z0IA 1ZPDA 2HQOA 5IK2D 2X0KA 4GDFA 1H2HA 2C2OA 3OJLA 3OPYI 2RGUA 4KAJA 5B7QA 1PZFA 1X7ZB 3FB1A 2VK4A 2YV2A 3ORFA 3GP3A 2OV1A 3GHYA 2X2FA 2XQIA 4A0SA 4EA6A 2FPXA 3OEWA 3VBCA 3AETB 3O2QB 4RH0A 4HV4A 2WYVA 2XNKA 3UMVA 5CDGA 1MORA 1Q0QA 1ZSVA 1PS0A 2YVKA 3BULA 2AUNA 5A3JA 2HKIA 1P0CA 2GB4A 2OLEA 4LDNA 4X90A 2EP7A 6GPBA 5LZ2A 2MU1A 2EW2A 3U5ZB 2B34A 1NN3A 1D0SA 2V3WA 3QELB 1EX1A 3O1HB 2X23A 3BD9A 2X0RA 2DF8A 2B2NA 2JIDA 1K88A 2XRMA 3P9RA 5AK6A 3OO0A 5H9VA 5BQOA 5JAQA 5LBUA 4EBBA 1L4LA 5KCZA 1KI3A 3EPPA 2O3SA 3OD1A 4YWHA 4B79A 1ZSNA 4KAFA 1E3SA 2HRCA 4FYPA 1IAQA 3N6RA 2X1VA 3GFRA 3R7FA 3UAYA 1GRCA 4WMLA 4U9HS 1YUNA 3G7SA 1FK8A 4KUEA 1W0JA 2GESA 4R8RA 3EZYA 1AQUA 2RBGA 1TUGA 3AU9A 2N46A 3VR3D 4IQ8A 3WR5A 4QOEA 2UYHA 3U3XA 4CEJB 4TT8A 3IOEA 4FSDA 1HKHA 3Q7SA 1I7LA 2ZE7A 1XC7A 4UUAA 4ACAA 4ZYWA 1LC3A 4Z5XA 1FNCA 2B9VA 1QF9A 2FHSA 4OB8A 4V02A 3ZLVA 4LRWA 1Z5UA 4LK2A 4AS2A 3ZV6A 2POCA 4OK6A 1Y7PA 3QG1A 1K68A 1AK9A 4UTVA 4RD2A 3DW3X 3GAAA 1IM8A 1JI3A 4F71A 4FWIB 4OI1A 3HK2A 4GM1A 2FGJA 5EFOA 2PTHA 4MARA 1FTNA 3C70A 4IDFA 4COOA 1TZKA 4M89A 1BXGB 5J1SB 1Z0UA 4Y7CA 5CM2Z 1S01A 4C30A 5GZ3A 4J1TA 1A4XA 3ZIUA 4FOTA 4IDQA 1ZVKA 2MYUA 3B6JA 4YYZA 4E5DA 5KX5A 3U4QB 1VSQA 2VF7A 3F0TA 3OU2A 3BJMA 5AI8A 1SKQA 4WFIA 2CLOB 4Y9TA 4YJ3B 5TPWA 1JU9A 3AL2A 3IUBA 4ND7A 5LXTF 5CEFA 3KETA 5ICMA 1OFGA 1RADA 4HH3C 3HRKA 2XJ9A 3C5VA 4ZJPA 2CGEA 3DZ8A 1VLQA 4HDRB 4L22A 3EH2A 3ER9A 1P3JA 3GAZA 1U28A 2WJYA 3TW4A 3PJRA 3C16C 3NEJA 4INJA 1DJQA 4KU4A 4DR1B 3HWSA 4Y6PA 1N32B 4EKNB 3GJ0A 1Y9EA 3U40A 1FDVA 1NNI1 4CM8B 4ZI7A 5A06A 4ND8A 4ZP1A 2LE0A 4P4GA 1JAXA 3URKA 3CKMA 1IN4A 4R1SA 2C2YA 3AKYA 2GZAA 2X7JA 2B5OA 4XGRA 4UTNA 3H16A 1X1QA 1R12A 1A9PA 2OWDA 1NYQA 4LVNA 1U1EA 3U7RA 1RQPA 4AYTA 4UUOA 4YMVA 3OT1B 1GYQA 5B5SA 4LWOA 1QRSA 1M2VB 1Z2OX 1MDBA 4ZRMA 5KQRA 1KYIA 4ZPJA 3C3BA 5BRAA 2JKYA 2W6IA 5D1NA 2Q1UA 1NF2A 2DTEA 3GLIA 1JILA 3A6ZA 3KSBC 1JLSA 2AUTA 3VO9A 2SKEA 2I3BA 4CGZA 1WM1A 2ZRJA 1GU1A 3CEJA 3OIDA 3Q3CA 3LUDA 4L0CA 3L6RA 3COVA 2EKQA 3A6KA 4Q82A 3K2IA 4X6XA 4OD0A 4C4ZA 3O1LA 4PQRA 4C7BA 4J9UE 4HATA 2DBYA 3CU5A 2NU6A 5LDHA 3GMDA 1KY5A 3SHOA 1FNMA 4V0QA 3E7PA 4KTTE 3OX3A 1LDMA 4P84A 3X1JA 4XM1A 2XYPA 1K8YB 3SNHA 3ZWYA 3UGJA 3E9RA 4MW2A 1RTTA 4PZYA 3MNFA 3W9YA 4JBWA 2AC4A 4Q1BA 3TRFA 5K0TA 4BMVA 4DRXB 3BF8A 4TQ9A 2BCJQ 1RRMA 5A3QA 3PGVA 1USWA 4UAGA 3CW8X 1IHDA 4AROA 4DJFC 5FOUA 4JK3A 1PZGA 5FPHA 1FVFA 2AEMA 4HZGA 4KXLA 4YAOA 1I7QB 2FR8A 1YCFA 3HSKA 1JB9A 2D0DA 4PC2A 4KPUB 4RCVA 2YRXA 5B7PA 4C4PA 4PN3A 4F56A 5FLEX 3ER8A 1TEVA 2OVBA 2JFOA 4B3FX 3ZV3A 2YWFA 3A2LA 4D8TA 4DMHA 2OHHA 2NO4A 4LRYA 1SXJA 2XZOA 3N8HA 2GCNA 1TCVA 1XNRB 2IV7A 3VH1A 3GJTA 4OCZA 1Y6RA 1GARA 2ETXA 1CTQA 1EX9A 1R6UA 2G4CA 4NNJA 3RIGA 3S6JA 2J4CA 4LRTB 5H0IA 5GVSA 3L5OA 2WICA 5JADA 3GLVA 2A5FA 4F5DA 3Q1KA 3BRCA 3H2BA 1G2OA 3EDYA 4QTTB 1KBOA 5D01A 1X14A 1P77A 5AUQA 4HLDA 2RKWA 1UBTS 2WTAA 4CMAA 4PPQA 3OCCA 5BUSA 4PVCA 1N9KA 4E14A 2GN0A 3SICE 2QRGA 1JALA 4TV9B 4LZPA 4ER3A 4JXKA 2QOEA 1FUYB 2FB9A 1Z36A 2J0VA 1TO6A 2JH9A 2ZRKA 3HDJA 2W00A 5DW3A 3FYUA 3BIJA 3Q7PA 2CEKA 4NSNA 2FI1A 3MINA 4BX8A 4E1AA 2O2JA 5K5EA 2GFQA 2H8KA 5GJWC 1P4JA 1DINA 3D6FA 1PEAA 3H7IA 2UVDA 1CNMA 2IP4A 4MSUA 1IJFA 5IAGA 3OOEA 3SC2A 5IUNC 2GO1A 3QJGA 4WBNF 2IH2A 1BOOA 4K81B 2WNHA 4EB6B 1HT1E 3PUHA 1X38A 4JB0A 4ZRNA 1ZK4A 3MB5A 4DV0B 5CNKA 4CV1A 4TXJA 3ZZNA 4QVIA 3OE7A 4HOYA 2ZUBA 1RJ9A 4FOOA 4IMJB 3V1LA 3W2FA 5GAJA 2VDKB 5IS2A 1ZN8A 2ONYA 721PA 1OYWA 1YR8A 2QE7A 3SNKA 4MW7A 3E3LA 1NUAA 3AHDA 3CX8A 5IH7A 3U5TA 3ROTA 1QC5A 4BJ1A 4F4CA 1XLWA 1YQDA 1CDDA 1NE2A 1DIAA 2H31A 2OHXA 1K98A 4FHZA 1RI2A 2P77A 4YJ2B 1Z6QA 3TNFA 4GC9A 2Z08A 3H11B 2RHWA 1YL5A 3DBRB 4PFQA 3LPMA 2QZSA 2XOKD 5HJEA 4HL6A 3F90A 1JSXA 3IVCA 4FIZA 5KMGB 2I7XA 1U8AA 4JKYA 2XCUA 4J6FA 4YMHA 4NTZA 2X0DA 1G8MA 3A9CA 1X1EA 2J4DA 3UHAA 821PA 1VJCA 1E4VA 1J24A 4OJMX 1SXPA 4MJ7A 5GJBA 5C5DA 4KWEA 3WMXA 2QN2A 2HA5A 1P2UA 1NNLA 5EIAA 2J9RA 3L0IB 2CL7X 4LMBA 3AM3A 4FEAA 1ISSA 1NBAA 5F5XA