3Q3JB

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
175
Chain Sequence
RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plexin-A2
publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
total genus 59
structure length 175
sequence length 177
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q3jB00
1E9FA 2TMKA 5DE3A 1KSFX 2O8DB 1KJZA 3A6PC 2IK8A 4B48A 2BIFA 3U7FB 1JR3A 2IW3A 2SHKA 3ADDA 3PEUA 1JNYA 4F7WA 4HEJA 1NN3A 4OHZA 2YOGA 2H18A 3DEFA 3LDAA 2WTUA 4AC9A 3I5YA 1TX4B 1OXTA 1UBGA 1YE8A 2KE5A 3HU3A 4DLXA 1LNZA 4NONA 2BCJQ 3CNNA 3T1QA 1ZNZA 2GXSA 5DNYB 2ZREA 3C14C 4ZCLA 3A4MA 4EJSB 821PA 3WP0A 3H0KA 1R6BX 4NP6A 2QE7A 3GQBA 2EQBA 4L8GA 2QSZA 4RVCA 5AUOB 1CF4A 1OFHA 2IX3A 3DZDA 3B5JA 3SJBA 3TQFA 4BLTA 4PC1A 3K8YA 4DLZA 4NCKA 3PXGA 3BB3A 2VQSA 5FL7D 2PZFA 3GEIA 2CNWA 3B78A 3O8CA 2OCYC 2ATVA 1IQPA 1CRQA 1Z06A 4FWTA 2WWFA 4RD3A 1QG4A 3C5HA 2OAQ1 4K81B 1NKSA 4IVRA 2C9CA 1KDOA 2YWEA 3ZD6A 4KVAA 2R6DA 1I4LD 2FPLA 1XJQA 4GZLA 4HSEA 1RZ3A 4Q00A 3THWA 2F55A 4DLRA 3ADCA 1SVKA 1JQJC 4OI2A 2HLDD 3WYGA 5L3QB 4B2PA 1KTVA 1UJ2A 2W2VA 1IM2A 1G7TA 4PAOA 4G5GA 4Q9KA 3AB3A 2WV9A 3TRFA 2EFGA 2R6FA 1X6VA 3EPLA 1Z83A 4MRPA 1XFAA 4URYR 3U44A 2ZVQX 4KCGA 1VPLA 2F1HA 1HV8A 2RGBA 5UKDA 3KXIA 2B92A 2JJ2A 2AK2A 1Z08A 2C5LA 3VKWA 2J7PD 3BXZA 1BMFD 3C5CA 4IFEA 1XPOA 1NIJA 3LWNA 3X1XA 3CNLA 1V43A 4V0OA 5B2ZA 3HYRA 3QUSA 2C2HA 2ORWA 3PUZA 1PLLA 4HB0A 1S9DA 1S0UA 4JZKA 2KI5A 3C15C 3CRQA 1JR6A 1PLJA 1Z0DA 2YOFA 3VR2A 2ZRJA 1QVRA 3VMFA 4BFWA 1TF5A 2GZAA 4L9SA 2QI9C 1ZM7A 2BBOA 3VX3A 1KI8A 3D8BA 3QPUA 3GLHA 5E4FA 1F3OA 2MSDB 3U7GA 3B1VA 1OPXA 2EFHB 5KDOA 1B0UA 2ZS7A 3FKQA 2D7DA 4EQ6A 2G77B 1HYQA 4TL7A 2OAP1 4NYJQ 2JDID 3AVVA 4YQFA 1GKIA 1P6XA 1XD8A 3UIEA 1FQJA 5EXPA 4EJSA 2ERXA 5IK2A 3AGPA 3CLVA 2NZ8A 4MRRA 3DO6A 4PHTA 4IJMA 5DLQC 4Y0AA 4Q21A 5FBRB 2Q0HA 3R20A 4XTRA 4D82A 3W34A 5HPYB 2C8VA 3IO5A 3RS0A 2MSEB 5JWRA 4IXNA 2KB0A 2BM1A 2WJGA 5CM9C 2JIZD 5HZHA 3NIBA 2J0SA 1ZMXA 2WWXA 3PVSA 1IY1A 2ZAMA 1G18A 1XB2A 3SN6A 4TLDA 5SZHB 1NJFA 1UKZA 1Q3HA 2GBLA 4WXPA 4GOXA 3ZS8A 4XWOA 5FTNA 3GP8A 2GAOA 2VYFA 1EGAA 3W90A 3QF4B 3KUDA 1RKBA 1BOFA 1L8QA 1GOTA 1LFDB 3TVTA 1NY6A 2HJGA 2YWGA 3HR8A 1NF3A 2OT3B 2WKRA 1N5KA 3EZ2A 5CLQA 1IN8A 2HCBA 2F9MA 4B47A 1LW7A 2FGJA 2C98A 1BYIA 3L8YA 4A6PA 4AYWA 5FPKA 5J4HA 5KUTA 1W7AA 2A7QA 8OHMA 4D0GA 4Q1CA 4JVMA 4HAWA 2QSYA 3R9WA 1OFUX 5TY0A 1FP7A 4A2QA 2ZJBA 2V54A 3PEYA 2IUUA 1O87A 1DAKA 3Q7PA 1FTSA 1WDTA 1E0AA 1T3HA 3NC1C 3QENA 1OXVA 3UK6A 1GM5A 1ZM9A 2BDTA 1W44A 3FTQA 4TYQA 3O8DA 3CNOA 3ZQ6A 1A82A 2VLIA 4V02A 2JA1A 4KLNA 1N5IA 1F2UB 1Q20A 4XOIA 4DSNA 4LSGA 2I1QA 3CWZA 3O8RA 4MRVA 1XPUA 4O25A 2EFDB 3R9XA 1GNQA 1Q1BA 3G5UA 4X8OA 4CIDA 1G3QA 2A30A 3TGPA 4RFSB 2DWOA 5JJIA 1ZNXA 3PIRA 3NEYA 4P4TA 1NN0A 5CB6A 2RGNC 1AZTA 1ZC4A 5FR2A 2H17A 4TL8A 3TLXA 2GCOB 4NZYA 2W0MA 3KQLA 2YC2C 4V0MA 2F43B 4LBVA 3PEVA 1TUEA 3ASZA 3D31A 1E32A 3IHWA 3TW4A 1GKUB 5L3VA 4R2IA 1JXMA 2OHFA 5G3YA 4B73A 2CHGA 1R0XA 3KJHA 3FVQA 1ZUHA 2FSFA 5B64A 4QRHA 5EE0A 3WHKA 4AD8A 1PV4A 1E1QD 5L8VA 1U9IA 4JT2A 2Z5FA 3QY0A 3AF1A 3ZVMA 4KO8A 5EE9A 2C9YA 4LJ7A 2Z4SA 4I1VA 4HLUA 5AJZA 1TTTA 4FMDB 4FMCF 4DCNA 2QY9A 4HDQB 1EFUA 1U9IC 4LJAA 1KK1A 2Q3MA 4Q4JB 2X2EA 5DHFA 4ARZB 5J4VA 4YMVA 3K9NA 3A4NA 3CUEF 2DHRA 4P4SA 4M1TA 4Q1EA 5KU1A 2N1BA 3MJRA 4HLUC 1E9EA 4HATA 4WZBE 1RVDA 1XMJA 3IIJA 4US2R 4B35A 1TF2A 1ZAKA 3VR1A 2ODBA 3QF4A 4A4DA 4D4MA 5DN6D 1U90A 2IYLD 3PUWA 4GZMA 4UNRA 5FL3A 2O5VA 2OG2A 1LV7A 3ZZ0A 3W8RA 1E0KA 3AVYA 4GOKA 4Q4HB 2NQ2C 2HXYA 1ZD1A 1Q12A 1X8LA 3AP2A 1R8SA 2HJVA 2R6CA 5DH9A 4OHVA 1N2CE 1HA3A 2WOJA 5SZIA 3NH9A 4ASUD 4TWZA 1CJVC 2PMDA 4UNPA 5FR1A 1AQUA 2B8WA 3RAPR 2IWHA 4DZZA 3N2IA 4KVGA 5FPTA 3CF6R 2UZIR 3GPLA 4A8JA 3P26A 1GZSA 4A1FA 1OSNA 5JJLA 1XRJA 2Z0MA 1SVLA 1W4BA 2XZPA 5ANRB 5LD2B 1PVOA 2R6GA 3RS5A 2WWWA 4RFSA 1SXJE 2DCUA 3SJAA 1MR3F 2V3CC 1NRJB 1IBRA 1C9KA 4Q4LA 1CJKC 1E2EA 2XSZD 1NN5A 2J45A 1ZCAA 2A5DA 4D80A 1KAOA 3U3OA 3IQXA 4G1UC 1I4DD 1NVXQ 2GCOA 3KFXA 1GSIA 1HY3A 2GJKA 1XXHE 2QMUA 1DO2A 1KNXA 1QRAA 2G1KA 3K70D 3OEEA 1CEEA 5C1BA 5KPDA 2QBYA 5E95A 3GJ5A 1GAJA 4Q7JB 2QENA 1ONBA 2VA8A 2CLDX 3EXAA 4GBMA 1P5ZB 2ZRFA 3QXHA 4PX9A 4BLOA 4F93B 1X3SA 5HCIA 4TT3A 5TVKA 4TMZA 2V7QA 4NL4H 1X1SA 2IYYA 4PTLA 4PQFA 1W0KD 3FKSA 1DS6A 3TE6A 2A3RA 5CJPA 1QHYA 2ZJ5A 1E4YA 1NL3A 3MRSA 4BFSA 1BIFA 1VG8A 1GITA 3QG5A 4JT4A 2ZROA 2W6JD 4NU0A 1JR3D 5CYPA 4Z8YA 1ZU4A 4Q4JA 3ZZTA 2VP6A 1SXJD 4JYBA 2DFKB 4M21A 1F5NA 3JVUA 1Z6XA 4HLDA 1AGPA 4URXR 4Q9IA 4NYJR 1NVUQ 3RRMA 1EFTA 1OYWA 1RRFA 2VHQA 4E07A 4B75A 1UAAA 4LHWA 5BN5A 1G1MA 3SZRA 4H1UA 3GFPA 3M1IA 1UF9A 3MFYA 1J2JA 4AYXA 4BZXA 3E5HA 4JL8A 4QM6A 1R5OA 2CK3A 3GLIB 4JLJA 3GJ3A 4URZR 3GLGB 1SULA 3OIUA 3CPEA 1YU9A 1H8HA 2ZR7A 3F0TA 3HPQA 5JWHA 1S8FA 2CLCX 1H65A 2BWJA 1GNRA 4P32A 1P72A 4MYTA 1WQ1R 2H57A 2CDNA 3L82B 1I4TD 4FINA 2AXNA 2FSGA 4S35A 2DFNA 1QHIA 4QKQA 1ANKA 2DFTA 2J46A 4LV6A 2J0UA 2I3BA 1XJ0A 4KFRA 2FNAA 4BLRA 1E4VA 2WPDA 1L2TA 1WBDA 4P4UA 2ZRBA 4BFZA 3GMTA 3EIEA 3MWJA 2WJYA 3VHXA 4DBLC 2F9LA 2WWHA 2GHIA 4NH0A 4KI0A 2EYQA 1SVWA 5LD2C 3U5ZB 1QHXA 5P21A 1W48A 1N0UA 1II9A 5EXTA 1R2QA 2REOA 1LF0A 1TNDA 4D4KA 3B85A 2F1IA 2BM0A 5CLLA 4ZPXA 2O0KA 3ONWA 1SGWA 4GPTA 3BOSA 5FTKA 4BASA 3AVOA 4LZZA 2D4HA 1FX0A 3CX7A 2ZYTX 3B2EA 3SOPA 2IHYA 1KO4A 2GCNA 2V4ZA 3I72A 1OH5A 3RSOA 4QJ3A 1S96A 1SKQA 3NBXX 3R8CA 3I1FA 4WIAA 1GKYA 2XNDD 1UKYA 3LH5A 5E3HA 4EFMA 3ZYCA 1E9CA 3SJCA 2VSOA 4TN1A 4LC0A 3QXJA 3AVWA 1KMHA 1EXMA 4JIMA 2YZ2A 1AKEA 1DARA 4PR0A 3TAUA 4XVRA 5JHGB 1K6MA 1OT3A 1U8YA 3GEEA 5CIWA 3A36A 1KSHA 4DCSA 4GRAA 2F3TA 5C2JB 1DAIA 2V9PA 2H1LA 1NBME 1VIAA 3HU1A 5J5CA 1R5BA 3H4MA 4H1VA 3U3RA 3VR3A 1EFCA 4B76A 3GLIA 3EPHA 2QN6A 1VHTA 4TLAA 5A0FA 3GLGA 4C7OA 1FUUA 3BD9A 3ND8A 4ZCIA 2PT7A 2JLQA 4IDHA 3IPYA 2R9VA 1KI2A 4Q7MB 3X2SA 2J9RA 3PEWA 4RZ3A 2B6HA 4XWKA 5EE5B 2K5UA 2O8FB 1JEEA 4TYWA 4NYMQ 2QROA 4YC7A 4AKHA 1NMYA 1ZCBA 4LWZA 3U3MA 1QHSA 1Z63A 2QT0A 2ZR0A 1T0HB 3SS8A 5JCPA 1FW6A 1XMVA 1FPMA 2WVJA 3NH6A 4RD2A 4C0SA 1FMJA 3QI2A 3QKTA 3AP1A 2YHSA 3V4RA 1SVSA 4JLPA 1U99A 4KHZA 1E2KA 5JEEA 1U0LA 1XTSA 3BE4A 4C3ZA 2QG6A 5FUVA 1P2VA 1L4YA 3HP1A 3B8HA 2XZOA 2VHJA 4GL2A 1KNQA 3AKDA 4PPQA 1JPNA 2NO6A 4OHYA 1Z3IX 3QKUA 1KI9A 1QHNA 1Q1EA 1QDEA 4M9ZA 2X1VA 421PA 2KBEA 3TQCA 4LHXA 2GAAA 4PO8A 3QKSB 3DHWC 2NPFA 3O8BA 4XJXA 2H5EA 2ZTSA 1UBCA 2XAUA 3KQHA 1FZQA 1U2RA 2XITA 2ZI4A 1XNJA 3P27A 3DZ8A 3ETLA 4MGKR 4OL0A 4KSCA 4M1WA 1T5IA 3CB4A 4X8HA 3U3JA 1OB5A 5FBQB 1QBKC 4XTCS 2BJVA 2RGGA 2XOKA 1T8TA 1CBUA 3U6BA 2G1JA 2AFHE 1COWD 5JBQA 1ZNWA 2AD5A 2ZRLA 4ZV4A 2GXAA 1E2GA 3AVQA 1FQKA 1RJ9B 2VF8A 4MKGA 3SI7A 2DR3A 4DHEA 4UJ3A 2IYSA 5EQTA 3N2EA 4BUJA 4G3XA 4OJQA 4JLNA 1G64A 1R7RA 4PHFA 2ZJ2A 3T35A 3VFDA 4CZ2A 5JZVA 2JLUA 3W5JA 1U0JA 4DDWA 1I2DA 5HKKA 1KK0A 3E70C 2I1VB 5D3MB 1HE8B 5DSZA 3VKGA 3L8ZA 1KDTA 4NYIQ 4MDEA 4UXIA 2OFWA 1DBSA 2FFQA 2GXQA 1G5TA 2C03A 3LRPA 2JJ8A 1N25A 2QEQA 4UXJA 4HUTA 4PQYA 3T5GA 3EW9A 3K0SA 3QPVA 2B7CA 1XTQA 4R98A 3NEJA 3TJZA 4DDUA 4J0QA 3OHMA 1NY5A 3DKVA 4MKHA 1AM4D 1Q3TA 1R0YA 4E09A 4ZIRA 2OILA 4DT1A 4KYUA 4NE2A 5ELXA 2UVQA 4QBHA 1KI3A 1E79A 2O8FA 1W2GA 4BFYA 3WBKA 1SXJB 4G5SA 4QG7A 2A5JA 3KTAB 3W6PA 3W3ZB 3OE7D 1ZD9A 5J4LA 2BVNA 3RABA 4B32A 5JLJA 2O52A 5BN4A 3AF4A 1HQYE 1JAHA 1OFTA 1X1RA 3OAAA 4PO1A 3T06B 4Q1AA 4B3CA 4EPRA 2G0NA 1XXHB 4MITA 1MH1A 2GJSA 2UZ3A 2ZRIA 3GLFE 3BK7A 5TDHA 4O0MA 2QRZA 1KI6B 4Q18A 1KY3A 1ZUNB 1Q22A 3SJZA 4M22A 2QUZA 2FDCA 4WBSA 4B2LA 4XSHA 2ZE7A 3WY9A 2N42A 4BFTA 1E9DA 2HV8A 1IXSB 1G19A 2WBLC 2BHRA 4W5HA 1OH8A 1N6IA 2GA8A 2F1RA 3F3YA 5FOXA 3ZQJA 2QPAA 4LV8B 2HYDA 2AKAB 3MCAA 2CJWB 1J7KA 3EASA 4AKGA 3DOFA 1F2TA 1KKLA 1KI1A 2ZRGA 3ICEA 4FIDA 4ERNA 2ZSBA 1G4UR 4R7ZA 3DVLA 5DYIA 4ESHA 5SZKB 1C1YA 3B9QA 3KZ1E 1XPRA 1B23P 5CDFE 1Z6AA 2O8BA 1R4AA 3FFAA 4GSYA 2ODNA 2BMDA 4D0LB 1G17A 5D3MA 3JVVA 3TW8B 3RS3A 3KKQA 1SHKA 1EK0A 1VDZA 3OEED 2KBFA 4PAQA 3HPRA 4PC7A 5FUWA 3PUVA 3H2YA 4Z1MD 2D2EA 4Q1DA 1HQCA 1KO1A 2BV3A 1US8B 3UATA 3CIOA 3S1AB 2PX3A 2HF8A 2QM7A 3LW8A 4M0LA 721PA 3FKSD 3Q5DA 4FMDF 2XEXA 5FOUA 1M7HA 5KPJA 4EPTA 1QHHB 1E0SA 5FOTA 4URVR 4LCBA 3JZMA 1XZPA 4IOLA 5JRZA 3Q5EA 4NPHA 3SYLA 4AWXA 2OBLA 2IXGA 2GDJA 1HTWA 1VKJA 1P62B 2OCBA 2X2FA 4F91B 3AQ4A 3WRYC 1GRNA 1EWQA 2YWHA 3B13B 4PO9A 1Q44A 4M1KA 4B3BA 1SXJC 4OK6A 4YMTA 2GVDC 3EZ9A 4TSFA 4WA7A 1GP2A 1U8ZA 2ORIA 3DL0A 3LXXA 4LHZA 4PANA 2YNMA 1FOEB 1EESA 2CK3D 3SHFA 4DCVA 4JVNA 2ZI7A 4G5RA 2A5YB 3K0FA 1E2LA 4EAQA 3IHLA 4OJKA 4C2UA 1OB2A 5EZ5A 3RSLA 2HT1A 5SZJA 4GMXA 1VG9B 2ZI5A 4NYMR 1E9RA 4CDGA 3RNLA 1V5WA 5JCZA 3NBZC 2GETA 4LYAA 1GNPA 3KJGA 2ZRMA 2WPDD 4FCWA 4XSGA 4QBFA 4EPVA 2CJWA 3GJ8A 4FWIB 4KYIB 2WSSA 1J99A 3VR5A 3N70A 1PJRA 4C0LA 2XZLA 4DSOA 4TTPA 2HUPA 4FMBB 2IS1A 1BYUA 1RYHA 5FTMA 4BZQA 2FFBA 1GVNB 2QT1A 5IRCD 5EP1A 3FB4A 5JFGA 1MV5A 3E1SA 4Y0VA 3AF3A 1KKMA 2ZRHA 2OEPA 3HR7A 2O8DA 3W6NA 4HB2A 3B1ZA 3K09A 3DM5A 4I1UA 4ZI2A 2P2LA 3K9GA 2J3EA 1E2PA 2IYWA 4OK5A 1KO5A 5GVRA 1R10A 3K09C 4YDSA 1U94A 2JASA 1TU4A 4CGZA 4CRWB 1E69A 3C7KA 2V1XA 5KSYA 3AGQA 2PT5A 2WAXA 1AS0A 1ZU5A 1QHHA 5KTYA 2C95A 4TYNA 2C99A 2EWVA 1YR6A 4D4LA 1Z6GA 4DUGD 4D25A 2ERYA 3QJYA 5G41A 1KO8A 3TAHA 3AUYA 1GIAA 1F48A 2W2XA 3L0PA 1TMKA 1Q1QA 4NCHA 2Q9AA 4LY6A 2O8EB 2GJAA 2WWYA 2ZJAA 1A4RA 1OXSC 3AM1A 4NYIR 3B1WA 1DAEA 4QBGB 2QAGB 3K1JA 1KI7A 3ZLJA 3L0SA 2EFCB 4PPFA 2JLSA 3BFXA 4NKRA 1X8JA 2BMFA 1P7CA 1ETUA 2J87A 1NVWQ 2G6BA 2VTKA 4RY2A 2ZU0C 4KU4A 1TQ2A 4JLBA 3OFNA 3ZH9B 5L3QA 3TSOA 2VF7A 1H8EA 1VIYA 5AJWA 4BEBA 1Z28A 2BCGY 4LK2A 2OBMA 1DTSA 3UANA 3ZVNA 4WOPA 2WSMA 5BYJA 1Q1ZA 4PPNA 3SFVA 4DVGA 1M1YE 3W8NA 1VTKA 2DY1A 4A9AA 3LFUA 4A0FA 1XEXB 3B9PA 1CU1A 3SC3A 2PZGA 4MKIA 2OLKA 1C4OA 1CP2A 1ZW6A 3LBNA 1E2HA 2FSIA 3I8XA 4QGFA 2Z4RA 1KK3A 2P65A 1AN0A 2BJWA 3L43A 3TR0A 3RS2A 1ZIOA 3OEHD 4TMXA 2CL6X 2AN9A 3KJIA 3AKYA 3T12A 1G7CA 4OK3A 5KO2A 3OIYA 3QSYA 4TL9A 3HU2A 3T61A 3RS7A 4HAYA 1VCOA 2RGNA 1Z6TA 1E2IA 2QQEA 3K53A 4OYHA 3RVBA 1S2MA 3LLUA 3W3AA 3SE0A 1JEDA 1CJMA 5BXQC 1E2JA 4YMUA 3BH0A 1RRPA 1WRBA 4A82A 3KJEA 4AURA 3CR8A 2QGZA 5DHAA 3KQKA 4GMDA 5EJEA 3UMRA 5DGXA 1G3RA 1N6HA 4RZUA 4CEHB 5EZ6B 5F9HA 4OHWA 4RD6A 1QVAA 3E2IA 1FNMA 2EFEB 3LX5A 4YXWD 4EUNA 1OKKD 1E94E 4EPYA 1R5NA 3T5DA 4LJ5A 3VU9B 3ASYA 1G7SA 4QGHA 4DSUA 1GL6A 4OI4A 2O8EA 2G83A 3PENA 1Z0KA 3SHWA 1P9WA 3PJRA 2QMOA 1XU4A 4B3DA 1AGRA 2PBRA 3CZQA 1ZIPA 3GLFB 4MDFA 3SEAA 1GG2A 4GDFA 1P75A 1LB1B 1HH4A 1OXUA 1Z5ZA 2RH5A 3U2QA 1CTQA 4IDQA 4RSGA 1AZSC 1HT1E 1BO6A 4YDHB 2QAGC 4PSVA 1OF1A 2IWRA 4U5XA 4B74A 1T3LA 2ZETA 5J4YA 2REBA 4XWAA 1WF3A 1NI3A 1Q21A 4PPGA 3UMSA 2JATA 1IJFA 2CHVA 2ZE6A 1Z07A 3K9HA 3WNCA 3MJHA 2A5GA 1AS2A 2CCGA 3KB2A 1AKYA 1KIMA 1UDXA 2WIAA 4BGDA 1KDRA 2IYUA 4DDVA 4C2TA 2NPIA 4LPSA 1Z22A 2Z83A 2AHOA 3FHTA 1G8HA 4HAZA 4NMMA 3QXXA 5K8LA 3BH7A 1VG0B 1Z2CA 2ZRCA 2VRWA 4A0HA 4B71A 4L16A 1D5CA 2BBWA 2R44A 4C0BA 1LS6A 4OKSA 1CXZA 4NCJA 2MSCB 3EARA 3QPWA 1OHHA 1J8MF 1D8TA 2GWHA 2IT1A 2VL7A 1E1RD 4UNSA 4QHSA 2GZDA 3RANA 4RKEA 1DAMA 2RHDA 5H1YA 2Q6TA 3UMFA 4EKDA 3NC0C 4TLEA 4URWR 5HZKA 3CH4B 5M04A 1F2UA 5TV2A 3B60A 2ZJ8A 3NBYC 2FU5C 3GJ4A 1HURA 1WXQA 1JR3E 5H8WA 5IT5A 1FMLA 2QTVB 2WAYA 1IXRC 1W36D 4CT5A 2FPMA 1U8AA 3LA6A 4RD0A 4OI1A 4UJ5A 2V8OA 4LDJA 1UM8A 2FEMA 4IDPA 4AG6A 4OQXA 4M2LA 3B82A 1M7GA 2IYTA 3V00A 4KFUA 3A37A 2Q21A 5E7MA 3ZIAA 2F43A 1RRCA 3CRRA 1T91A 4XIGS 2P6NA 3T1OA 3IEUA 3LVRE 4HB4A 2ZM5A 2W2TA 4OQLA 4KJZA 4DKXA 2VH5R 3CX8A 1F6BA 1ZNYA 1KOFA 4M1SA 1EFRD 2VP2A 2XGJA 5TARA 2X77A 2ONJA 2WJIA 2QNRA 2EWWA 4JJZA 2JCSA 3EA0A 4BECA 4BRUA 1MO6A 1Z6YA 3AUXA 1CLUA 2GJ9A 4OI0A 4ARZA 4GOJA 2H7VA 2ASEA 2BBTA 1QZXA 2G0TA 1IN5A 1TPZA 2WWIA 1OLOA 2OCPA 4XH9B 2J0VA 5FPYA 3T34A 3WXMA 1S9HA 3EIQA 4B6EA 2YINC 4BLSA 1DAHA 5TXGA 3V9PA 3CKLA 4RFVA 3LV8A 3NHBA 1Z0FA 2QE7D 1OJLA 4MA4A 4JMPA 1NSTA 1J70A 2ZANA 4Q4HA 2FF7A 3RLFA 2OFOA 1EX7A 3PITA 1P2TA 1RFLA 4R71A 2XTMA 2DWQA 2IF2A 2RGEA 4US0R 2RKOA 2WM9B 3A1SA 2PL3A 2CNWD 3HWSA 5CK5A 3GFTA 1KSGA 3BC1A 5FL7A 3KXLA 2CBZA 4M8NE 3IIKA 1D9ZA 4P31A 3Q8XB 4RCZA 3C8UA 4W5JA 1EX6A 2QGNA 2QTHA 2C9OA 5L3RA 4F4CA 3HDTA 4M1MA 2LKDA 4QFMA 1NLZA 2H16A 1K5DA 3GLHE 1FL9A 2FPKA 1U98A 1MABB 2HLDA 2ZPTX 4UNQA 2DB3A 2FV8A 4R2HA 2R65A 3GJXC 4QGGA 5HTKA 3CWQA 1L7VC 3K0CA 1TL7C 2FZ4A 4NTZA 3TR5A 3AVUA 2JJ2D 3WMEA 5EE3A 3NKVA 4M1OA 2XNSA 3KX2A 1FFHA 4G5OA 5FPHA 1IAQA 3K0CC 2ZS9A 4GNKA 1I2MA 1BMFA 1MO3A 4UQOA 4PAMA 2B21A 3RWMB 5E7JA 1M8PA 4F38A 1K5GA 2ODEA 3PV0A 3TNFA 1P61B 3TKLA 4C0HA 1XBTA 4M9SA 5F98A 4WVFA 4BQSA 4TMVA 4P3YA 1XCMA 5TB5A 3ZGXA 4PZYA 1RC8A 3R7WB 3WMFA 3MD0A 5AUQA 3RC8A 3SDZA 2JLRA 1N6LA 3IO3A 1TAGA 2R62A 1P4SA 2WIBA 1AK2A 2ZYVX 4KSBA 4V0LA 3CF2A 3SNHA 3LY5A 4GFDA 4B43A 4XVUA 4JLVA 4TTQA 2XB4A 2QPOA 2I4IA 1G3IA 2D2FA 2MMCA 1XJCA 3OF5A 1XTIA 4CEJB 2OXCA 4LX0A 4KITB 4FCVA 5IK2D 4BE7B 3A4LA 4ZDKA 4BRWA 2WICA 3T1TA 2RAPA 1LF5A 4L5BA 2XTNA 1UKEA 1E2MA 3IPXA 1JJVA 2FFHA 2W83A 5JS7A 2A2ZA 2CE7A 5JI2E 4MYUA 1A7JA 4AYTA 1G20E 2ECKA 2J59A 4I4LA 2XB2A 1X8KA 4DIEA 5GADl 3KB1A 4Q7LA 2BBSA 4MRSA 4IFBA 3WBJA 2UKDA 3KKPA 2RMKA 3X1DA 2JIZA 4O3MA 3CM0A 3AP3A 1ESMA 4JLDA 3LVQE 2GRJA 2OESA 1KHTA 1UBFA 1YQTA 1LS1A 4DLSA 2ZU6A 1DG1G 5FOVA 4FW9A 4IOMA 4DCTA 3QBTA 4PSAA 1UDWA 4CEIB 3CW2A 5GJBA 4QJ5A 4ITRC 1H8ED 5LPNA 4LC1A 4P0TA 4II7A 1CR0A 5EXXA 1MABA 4JJKA 4GP7A 2AK3A 3FE2A 2ZJZA 2O8CB 1AIPA 3BORA 3AH8A 2IC5A 1CRPA 3PUYA 3KXKA 4V0ME 1NN1A 4ZKDA 4PC3A 4KV9A 1TF7A 2OUKA 2CVHA 4RD1A 2QZ4A 3EZ6A 5AK0A 2ZRNA 1XCGB 3QKRB 2IF0A 1CR2A 2J1LA 3HJNA 4KBGA 2OCAA 1W0JA 2ZE8A 1MT0A 3I73A 3K0AB 1EWRA 1WP9A 5FUXA 1N3BA 2ZRDA 4A36A 2IYRA 3NBFA 3FWYA 4AKIA 4U00A 3EG5A 4Q5IA 2ATXA 1CR1A 3FFBA 2REXB 2G9NA 4I1OA 4TTRA 2J7KA 4JLOA 1A1VA 4Q7KA 2H92A 4WXRA 3RRNA 4Q1BA 2VIIA 5L3SB 3EIHA 3MSXA 1IY0A 3AVXA 1LY1A 4KBFA 1E2NA 4FCTA 4TYPA 3BH6A 1S1MA 4ZCMA 3OESA 2GEVA 1P9NA 4Q02A 5AJVB 5AUPB 1HT2E 2IHBA 3BFVA 3BRWD 4GP6A 1UFQA 1BH2A 3MMPA 4D26A 3K70B 1VG1A 4XD7A 1D2EA 4FI3C 3BERA 4AIIA 4LRWA 4LHVA 3GD7A 3KKNA 1AA9A 2PH1A 1T0JB 2AFIE 3SQXA 2FZLA 3WP1B 2F7SA 4DDTA 4DRZA 3WHLA 3TMKA 2ZI9A 3LD9A 3LW7A 1E1QA 1OIWA 2YVUA 1DO0A 1SVIA 4LJ4A 4OBEA 1II0A 2HDNB 1ZM4A 1NLYA 2NO0A 4PHGA 1GRRA 1CR4A 3AKCA 3T15A 5KDDA 3NG1A 4ON9A 2QQ0A 5FI0B 5FTJA 3TK1A 5C46F 3ZS9A 1P9RA 3J81k 2WJVA 3ZVLA 4Q48A 1MOZA 1MRNA 1M2OB 5F2EA 2YJTD 3FMIA 1JBKA 2BEKA 1NLFA 1ZVQA 5FOWA 4CEIA 4DB2A 4X8LA 2QU8A 1RW4A 2CLSA 5DISB 1M34E 4JBXA 3P4XA 4HDOB 4CYMA 1G9XA 2O0HA 3BGWA 4E22A 3GCGA 5DN6A 4L4UA 5J40A 1UPTA 1ZINA 1G8GA 2PZEA 4O2RA 2GF0A 1G16A 1ESNA 2ZRPA 4UXHA 1MRSA 1A2BA 1ZM2A 3OIVA 3AVPA 2B8TA 3TSZA 2VBCA 2J41A 3N5CA 1XF9A 4Q4AB 4G5QA 2P6RA 3EWAA 4Z51A 4Q03A 3QXSA 1P60A 1UADA 3QKSA 4Q19A 2ZR9A 5FPSA 5KYKA 5AWFC 4ESVA 1E6CA 2W58A 3MAAC 2IYQA 5GJWC 2XTZA 4ASUA 2JLXA 1KYIA 2Q3HA 3VAAA 1PUIA 1EFHA 1VCNA 2OZEA 3LO5A 2NO7A 4NBSA 4ABYA 1G5PA 1E2FA 2D62A 3FYHA 4KFTA 2JLWA 2OXRA 1JQLB 4LJYA 4JLMA 2IS6A 3CF0A 2GEUA 2CEAA 4WZ6A 3KQNA 3THWB 2C78A 3QXCA 1RJ9A 2VP4A 3L0OA 3AV0B 1NIPA 2CHQA 3PCRB 1KGDA 3M0EA 2VO1A 3V4FA 2IYVA 3BJIC 5KSOA 2OBNA 1N0WA 3GJ0A 4BFXA 2XSZA 5FH9A 3U44B 3ICQB 3Q72A 1XCPA 2ZJOA 1YZNA 5H68A 4A2WA 2W0SA 1E99A 2DFLA 2P3SA 2Z43A 3C16C 5JWOA 2V1UA 3MUFA 4TT3D 2RGDA 2V7QD 1GWNA 2D3WA 4I81A 2JJ1A 3K70C 3R8FA 2FE4A 2RGAA 2VHUA 2ZITA 3ADKA 5KNBA 1ELOA 1FP6A 3SFZA 1T6NA 1T4GA 1G8FA 4DCUA 3EC2A 2OM2A 3IGFA 2W6JA 2FSHA 3NDBB 3RWOA 3K9LA 3U7HB 3GLHB 1D6JA 3BWDD 3MGCA 1SXJA 4L9WA 3KTAA 3R9IA 4ZI3A 1GDDA 2FA9A 3FMPB 4MH0R 4F4JA 3GJ7A 4EQ6B 2G3YA 5KHOC 1XTRA 1N6OA 2IXEA 3PFIA 3F5FA 1N0VC 1T8UA 1XXHA 2F1JA 5FUYA 3LQQA 4TZ0A 4B33A 4BLPA 4B3GA 3AVTA 4BZPA 1D9XA 3CPHA 5HE8A 1KI6A 5G40A 2CL7X 4IDOA 4C9BA 3OZXA 4Q4AA 1H8HD 1UEIA 2P67A 2IUSA 4DEXA 3DMDA 1DVRA 4R9UC 4B3FX 3THYB 4ZO4A 4TMWA 2VPPA 3I61A 2PJRA 4GT1A 4JKIA 3QOFA 4QC2A 1IJEA 2A5FA 3IBGA 5EE1A 4DSTA 6Q21A 1VMAA 4WAUA 2J5XA 1ZRHA 4AY2A 2CCKA 3CRMA 2IBMA 3C4JA 1G4AE 3PUXA 4TQAA 3LQRA 1ZM3A 4EDHA 1E3MA 1E9AA 1XZQA 1TADA 2R6AA 2WHXA 5JRJA 4PC6A 3VR4A 1RE0A 4QHYA 1TUIA 1E9BA 4DLYA 1IN4A 3EX7C 4WZAE 4IEIA 2WMOB 1SHZA 2X19A 1YZTA 1ZYUA 2GVZC 4LYHA 2Q9BA 3M4YA 1NG9A 1YVDA 5DI9A 5CJ2A 4A6XA 1OIXA 1LVGA 5K8IA 1F60A 121PA 2KWIA 4HI0E 3LNCA 4JSTA 4MUBA 5F3WB 5E7IA 2PLRA 4DIDA 2NOAA 4MGZR 2EYUA 1US8A 3GLIE 3S1AA 3GLGE 4H9GA 1YJ5A 5KSPA 3REFA 1NMZA 4QOSA 1MO5A 3EZFA 3UXMA 3W5IA 3THOA 4TZ6A 3EAQA 4QJ4A 2IS4A 3P1JA 4DC9A 2GK6A 1RPZA 3A1VA 1Z29A 3QEJA 2IEZA 2XNDA 2YWFA 4W9MC 4AI6A 2ZJYA 2QM8A 1GUAA 4K46A 4TMTA 3UWOA 3ND9A 1AJEA 4HDCA 3UPUA 1DOAA 5EUQB 1YZKA 4PZZA 4F4IA 5B57C 2ZSFA 2HT6A 4M53A 4W5WA 2WMNB 5GVSA 2OFXA 1S3GA 1W5TA 1S4QA 1G21E 1WE2A 4N1AA 2ZRKA 1M7BA 1E2DA 2RCNA 4MGYR 4Q9HA 4TQUS 3LAWA 3I3SR 4TMKA 3CPJB 2ZUCA 4FD2A 4LV5B 4EIWA 1U81A 4BEJA 1DG3A 4YLGA 3X1WA 3QNUA 2W6IA 2O0JA 2X8AA 5J4KA 1CJUC 1NP6A 1D2NA 1JB1A 2GILA 2EW1A 3C41J 3QEOA 4JKYA 4LBYA 1VHLA 4EJSC 1BS1A 4KXFB 5A5GA 4LUCA 3THYA 2YOHA 1Y3AA 4BFVA 1KK2A 3O47A 3THXB 1OFIA 3ZVRA 3DMNA 2J0QA 2QAJA 1DELA 1N5JA 3QF7A 3A1UA 5DO9A 1TEVA 1KAGA 2GJ8A 4HZIA 1E96A 4P4SB 5HR5A 1W4AA 4ZDWA 5G3ZA 4JBWA 1JI0A 4US1R 3CRVA 2FG5A 2NMVA 4DB4A 1IHUA 1JXOA 2GBLC 2P6UA 4FN5A 3I4LA 2OE2A 2GKSA 2WJJA 3T1VA 4MYCA 2QTFA 1NVVQ 4N0DA 1NBMA 1KSJA 5EXSA 4AK9A 2AXPA 1KMQA 3WMGA 2MMGA 621PA 2WKPA 3X1YA 5AR1A 2GF9A 1W0JD 2WKQA 2ZSEA 4MYHA 2ZUDA 3IEVA 5BYKA 3CRW1 2QMEA 3LBIA 2IEYA 2ZS8A 1RIFA 3EC1A 3SYNA 4C0JA 3U61B 3RC3A 3ECCA 2BKEA 3LXRA 3Q9LA 1KJYA 2XOKD 5C18A 1N6KA 1J8YF 1OIVA 1DE0A 2ZI6A 1Z8FA 4M9XA 4A8JB 1KZ7B 1COWA 1ZJ6A 1FNNA 2HCJB 1ODFA 4IOJA 1CJTC 5DI3B 1NSFA 1WCV1 2CMKA 3RRZA 1Z0IA 3PG5A 1SKYE 1MKYA 1XP8A 5GJVC 221PA 5HKKD 4IVPA 1SVOA 4LBZA 4DXAA 3U60B 2ODWA 4JLKA 4HLCA 1G3MA 1WA5A 5LB2A 2YC4C 2OSBA 2PCLA 3H1TA 1N6PA 2Q3FA 2QAGA 3L2OB 4JLAA 4DEYA 4XD7D 4M4SA 1U0HC 3IQWA 2QBYB 2XXAB 3AEZA 2ZYWX 5FFMA 5HE9A 3EZ7A 4A0RA 2ZUBA 4QXAA 1YR7A 4Q01A 4DWJA 1GL9B 4LHYA 4PZLA 2GK7A 4IOKA 5JI3E 5JHHB 3ZD7A 4TLBA 3Q85A 4IDNA 2YYZA 3EPJA 2IS2A 1E79D 3THXA 2FWRA 4M1YA 5FTLA 2HF9A 3RYTC 1CIPA 1DADA 4LJ6A 5FOSA 3D3QA 1JECA 1YR8A 1XMIA 3DOEA 3TUJC 4JBYA 1AQYA 5JS8A 3F8TA 3QIAA 2ZYUX 1XEXA 4RZXA 4UKDA 2OLJA 2VSFA 1TQ6A 3UG7A 4Q66C 1G6HA 3IUYA 2F6RA 2HXSA 4TLCA 4HUQB 4ACAA 1KO7A 3OAAD 5KNCA 3OE7A 4LYFA 1HEIA 1HUQA 2ZSDA 4OQFA 2PX0A 4X8MA 1XX6A 3W9YA 2ZI3A 4I99A 1W4RA 1N6RA 2DPXA 1P3JA 4LGMA 2PMKA 1NJGA 4KODA 1DEKA 1Y63A 3ZJYA 3AF2A 4IHQA 1NG1A 4IXMA 1UKVY 5JEDA 4LJ9A 1W49A 4F92B 1UEJA 2VP9A 1OH6A 2RB4A 1P73A 5LBIA 4Q1FA 5KSZA 3BAFA 3BS4A 4PFSA 4B3XA 4HAVA 5AJXA 2QL6A 2KJQA 5C4GB 1Q0UA 3IDQA 1QG2A 521PA 2WWGA 1AS3A 3GEHA 4XVQA 5B30A 4PSKA 5G53C 3MWLA 2ZEJA 4RCYA 1TQ4A 2BKUA 4NDZA 1KDPA 2AL7A 2J0UB 3I5XA 3Q7QA 4OQNA 4QL3A 3NWJA 4CEHA 4PXAA 2Y8EA 1CULC 1G6OA 2NGRA 5DI3A 3TVDA 4D2IA 1DAFA 4PC2A 3VU9A 3LBHA 2V6IA 3NDPA 4A8JC 2F3RA 5HCNA 5CIQA 4PHHA 4S2EA 1SQ5A 1RRGA 2LWIA 3P4YA 1FTNA 4UNNA 5KOYA 3GLFA 5FBVB 2DWPA 2W00A 2ANBA 2Z6VA 1OW3B 1J90A 4NHOA 3W6OA 1W4CA 3KKOA 2XXAA 4Z8XA 2JAQA 4Z1MA 4WW0A 1GRQA 3QVVA 3EPKA 2XJ4A 2JJ1D 3SQWA 4U02A 1FUKA 1FX0B 1XEWX 4IW3B 3BB4A 2AWOA 3IKJA 4JVSB 2GTPA 5JECA 3A8TA 4YMWA 4RJLA 2IXFA 1ZUIA 2OO7A 4HB3A 3EWSA 1OE0A 2P0EA 2RGXA 1KMHB 5A4JA 3FPAA 1XTKA 1W47A 4C0KA 2LCFA 1W2HA 3LX8A 1ZP6A 4I1SA 3NTUA 4HUQA 5CDFA 3TSWA 5F9FA 3RDPA 1S1CA 3WNBA 2XX3A 1P2UA 3SR0A 2BOVA 4JL6A 3QE0A 1E9SA 4TSFD 1GILA 5IHPA 1GFIA 2QORA 3I62A 3MG9A 1JJ7A 4A15A 3U7EB 1X86B 3IIMA 1OXXK 1XEWY 2KSQA 4JL5A 4OQMA 2GXUA 4W7SA 2CL0X 2ZIAA 3FMOB 3Q3JB 3AF0A 3QG1A 2V6JA 4B34A 3A1WA 4C7OB 2Q9CA 3RHFA 2ZXUA 3CH5A 2EU8A 1YZGA 2ZRAA 2P5SA 4RZ2A 1CKEA 1W46A 2NG1A 4MQBA 4BWYA 5AJYA 4C30A 2CCJA 2IYZA 4HLQB 1KZGB 3TIFA 1ZC3A 3VR6A 2DYKA 2QRNA 3KUCA 1N6NA 3I92A 3NVAA 5DIFA 2L0XA 2NZJA 2RGCA 2GNOA 2YV5A 1T3SA 4AG5A 2WSSD 1PLKA 3U4QB 1PZNA 1QHGA 3BFKA 3FHOA 3KDSE 2J7PA 4YONB 2C96A 4Z54A 1UBEA 2NTYC 2VP0A 3QVUA 3JZAA 4RKFA 4QNRA 5H70A 4A0GA 1NVVR 3SBDA 5CK4A 2GEDA 4QNMA 2VEDA 3CR7A 3KKMA 4HZUB 2ORVA 3AKEA 5EUMA 3ZZUA 1E0JA 1OH7A 2FH5B 4P33A 4CT4B 2E87A 1G3UA 1RYFA 1YZLA 3PQCA 1XD2B 3UKDA 3FDIA 1YHNA 3MWYW 4GI7A 4FXPA 2QPTA 5BQ5A 4ZDIA 3WNDA 1GTVA 4IEEA 3VNUA 3OIWA 1VECA 4B2IA 3PR1A 2OV2A 4ZKEA 3VNVA 1TEXA 1E98A 1ZD8A 2FGKA 3TUZC 5JJKA 4ACBA 5DYGA 4LBWA 5D3QA 2FJUA 3B7GA 4L15A 1G7RA 2JDIA 4DLWA 2XJ9A 3KFVA 1JAIA 1CS4C 3ADBA 5KNDA 2JEOA 4DUGA 5JMTA 3CO5A 1WBBA 1PUJA 1S3SA 4V03A 3QBVA 5GJCA 4G0NA 4DLTA 1IONA 4B44A 4QGAA 2IYXA 4MUAA 3A58B 4POAA 2QA5A 1KY2A 3MLEA 3RRYA 4C0QC 1O3YA 2QMHA 1BKDR 4ILEA 2FFAA 1XMSA 3FHCB 2NO9A 3IBYA 2QP4A 3VKHA 1TU3A 3WYFA 4M9QA 5FBLB 1GL7A 2NIPA 2R8RA 2YKGA 4NCIA 2CXXA 1EG7A 2W6ID 3P32A 1N5LA 3MWKA 1Q57A 1G8YA 5EP4A 4Q9JA 3OFND 4FMCB 5BN3A 1P2SA 3BB1A 4G01B 1G5RA 2IUTA 2ONKA 2FOLA 4Q9LA 2C77A 2VHTA 1VYUA 4C4PA 4E03A 1NMXA 1XWIA 1G8PA 4ZIRB 4N3NA 4DT1B 3I32A 1K8RA 1XTJA 4KLZA 3H84A 4K8OA 4YMSA 2FMXA 2AX4A 4D81A 4BLQA 5C4MA 4MGIR 4D6PA 4EPXA 3U6KA 5J47A 2P5TB 3DPUA 4CVNA 3U4QA 1SKYB 1OYYA 3D7MA 3WRXC 3IILA 2A9KA 4LJ8A 4V0NA 2ZE5A 1Z0JA 4E5UA 3UWKA 2FN4A 1A2KC 5JSZB 2D06A 1DPFA 3OEHA 1NBMD 4JVLA 1VCMA 4ZDJA 4V0KA 2BMEA 3VX4A 4HZUA 2D7CA 3CBQA 1XEFA 3RS4A 3D6TB 1XD9A 4IRUB 5IDVA 3M6AA 1M6NA 1HE1C 2AR7A 4DJTA 2N46A 1DAGA 1XD2A 1ZBDA 5K8UA 1IOZA 1W36B 4IVQA 1R0WA 3NXSA 3BBPA 3CONA 3R7WA 4EPWA 3L0IB 1R8QA 1G291 2ANCA 3TBKA 3LLMA 3B6EA 2GESA 3FGNA 4DLVA 2JLYA 3KL4A 1KI4A 5FI1B 4TL6A 5K8TA 2BC9A 2WJHA 3FMFA 4CEJA 3TH5A 1F2TB 2PLFA 1L4UA 1D2MA 1OV4A 4QBIA 1E2QA 1JPJA 4Q47A 1VCIA 2FX3A 4LPKA 2PEYA 4YXWA 4URUR 2V55B 1OKKA 4JSYA 1YR9A 5BW8A 4OHXA 2WOOA 3VHLB 5CM8B 2GZHA 2EVWX 4D4JA 5BWMA 4DLUA 5LB4A 2IL1A 2PEZA 4LOAA 2HYIC 1II8B 2O8BB 4IKEA 3SBEA 1IN7A 1VYVA 3X1ZA 4RD4A 2VSXA 4TYYA 2VHCA 4KAXA 4CF7A 2AWNA 3CZPA 3SU8A 2BEJA 1XDBA 1IXZA 3G82C 4AKEA 3KQUA 1VYTA 2IA5A 1QF9A 1MO4A 4A92A 2CE2X 4LI0A 4HAXA 1JALA 4TQ9A 5KDLA 1A5TA 1IN6A 2PJZA 3GFOA 1W1WA 5CYOA 3SYKA 2O8CA 3I8SA 1G41A 3B1XA 4JYCA 4BFUA 5IF9A 1IY2A 5CB8A 2WZQA 3VTKA 4BPBA 3QKRA 2C04A 3HYTA 2ZQ5A 3VQTA 1NKTA 3REGA 1WB9A 1LTQA 1Z0AA 1OHHD 4HYYA 4O2LA 3TUIC 3K0AA 3BIFA 3QQ5A 1M74A 1T9HA 2B7BA 2JGNA 4CW7A 5EP3A 4QM7A 2AKYA 1E1RA 4EFLA 2A78A 2HEIA 4C0AC 3WYAA 4LYJA 2AD1A 2RHMA 2QP3A 3DM9B 3CX6A 3EA5A 5JSZA 1T5LA 1YZUA 4PQRA 4U7DA 2JLZA 2VP5A 1Z47A 2NO1A 3G0HA 2D74A 2E9SA 1NNEA 1YKSA 3GJ6A 3K0FB 5CITA 2DBYA 3P20A 2LKCA 2ZSAA 2QP9X 5FBWB 3B1YA 2JLVA 1YZQA 5L3SA 2G88A 4D0NA 1SVMA 3K0EA 1WMSA 3A1TA 4MRNA 1TQDA 5LDDC 1W36C 3ZIAD 4N0EA 4QHTA 2BMJA 4EFNA 2GCPA 3NHAA 4MKFA 5EP2A 3ZDQA 3DKPA 4JS0A 2R2AA 4KFSA 2H8KA 2CVFA 4HAUA 1YRBA 3U3KA 1W5SA 1SZPA 2ZVPX 1R0ZA 2E1RA 5TMPA 3DDCA 1EFRA 3UG6A 1KJWA 5AUNB 3FOZA 1II8A 2FEOA 1Z2AA 4NCNA 4A2PA 3H86A 1W0KA 1YRAA 2ZAOA 2PCJA 4B6FA 5B58C
chains in the Genus database with same CATH superfamily
2VJAA 1JNXX 2H31A 3WAGA 1KJZA 2XUPA 5KBYA 3ZDCA 2HK6A 2Z9BA 4DBLE 5CH3A 3RTDA 1JR3A 2LP4Y 2J3MA 3JV7A 2YS6A 3U7FB 1JNYA 4GHWA 5JW6A 1GPYA 2R1VB 3E53A 4HWOA 4EMSA 1M2OA 4OHZA 4E2WA 1R8JA 3BXXA 3H0EA 4ZAGA 2I62A 2P1RA 3KZCA 2ZDHA 1OXTA 1UBGA 5ALIA 2FKNA 3PIDA 4DLXA 1TVKA 1HKUA 1Q3KA 3LC7O 4EWLA 2C0QA 4I4TA 3T1QA 1G2OA 1ZNZA 2AEFA 2TYSB 2PG3A 2GXSA 3OUZA 4O29A 1X7GA 3QE2A 1HRDA 4X91A 4DJ5X 3WP0A 4LGVA 5C4IA 5LMCA 2QE7A 3GQBA 4RVCA 3TD2A 2QSZA 3LC1O 3RI3A 5AUOB 3DFKA 1CEYA 1CF4A 1OFHA 4E5KA 3DZDA 2ACEA 4NBKA 2WG2A 3AR3A 2XNKA 4HR7A 3TTUA 4MW9A 1L8LA 3L8DA 5J63A 1H6BA 1WPQA 4IL5A 5JQGA 2O7VA 1XFDA 1PYGA 4U0KA 1CB0A 3PXGA 3T3PB 1GXSB 3UGQA 1ECCA 2BZGA 2QVLA 1HZJA 3QKIA 1HSOA 2HA2A 3FYUA 4AMGA 4B17A 1IQPA 3PVZA 3RVQA 3SZUA 2B25A 3WGQA 4CKBA 2C29D 2PVSA 4D6YA 1Q50A 1M2GA 3SX0A 3WGGA 2FW6A 4IVRA 3G13A 2C9CA 2YWEA 2Z9DA 1KEWA 2R6DA 3KRTA 2UYHA 4EYGA 4GZLA 4Q00A 3THWA 2R5WA 4NBNA 2MHCA 2F55A 4HVCA 1SN7A 3IUMA 3MB5A 3H17A 5LP6C 4MV3A 2BONA 2HLDD 2MJLA 4OI2A 4PRLA 3WYGA 2YNMC 1UJ2A 2R85A 3DDUA 2OA0A 3VBEA 4AJ4A 1LPMA 3PFBA 2WA1A 1AUXA 3AB3A 2WV9A 2EFGA 4MR8B 4ARSA 1T8YA 1XJ5A 3MHPA 3JQ9C 1XFAA 2PBLA 1BVRA 4D9FA 3SF0A 4KCGA 3Q3GE 4EY4A 4P2BA 2F1HA 4FGJA 1H0KA 4OXIA 1U4OA 1NYQA 2BI4A 2Q0SA 2Y1EA 3A0UA 1GVHA 1HV8A 4H17A 2PGXA 4L4RA 5UKDA 5JU6A 4B7ZA 2JJ2A 3N86A 1WEKA 4KACA 4BNXA 4WLFA 2J7PD 3FETA 1RCFA 3BXZA 4MRMB 3C5CA 4B31A 1RBYA 2A9OA 3NBMA 3PRHA 4BZWA 2FCRA 1SCKA 2XDYA 2FPIA 1TJ3A 3GJRA 2NNWB 3H2KA 3M5WA 2C2HA 3R5HA 4GR5A 1XQ9A 3C15C 4NFSA 8GPBA 4LYGA 1Z0DA 4JJ8A 1EJ6A 1EDOA 1GGKA 3K6JA 1M66A 3NUQA 3VR2A 4H1WA 4PZUA 1X13A 1YJCA 4PBSA 5EWLA 4IYRA 2GZAA 4O4JF 4WN3A 2QI9C 1ZM7A 1Y7PA 1YD7A 3IUSA 1U2GA 1JHUA 1NBWB 3D8BA 2MSDB 3U7GA 2R1VA 1OPXA 1W75A 2Q45A 5E8JA 1YA6A 1E2UA 1ZS9A 3TNDA 3UCEA 4MP3A 3N0WA 3T41A 2OWEA 1UDAA 3LECA 4DCPA 4TL7A 2OAP1 2MDTA 2BTEA 4BNDB 4BKQA 3AVVA 1CUCA 1E1LA 1GKIA 3H9EO 1U5AA 1IEVA 2IZ5A 1PR6A 1Q74A 3HXKA 4GGPA 3B89A 1ONPA 4N8SA 4QPPA 5IK2A 4B79A 5FUMA 1RLOA 3LGXA 2OSVA 1IYZA 1YB6A 3DO6A 4PHTA 5DLQC 4XGQA 2VUTA 4O5OA 1Q5PA 4Y0AA 3WJAA 3EVBA 4Q21A 5H4HA 4XTRA 5BSMA 5HPYB 1F8YA 4EF6A 5FADA 5JWRA 4IXNA 3Q98A 2H1WA 5CM9C 1D0SA 2J0SA 1H4QA 1GXSA 3LJKA 3WL7A 1G18A 4OM8A 3L6RA 2D1QA 5DJ5A 5DIZA 3CLKA 1JLSA 2SNIE 2R7AA 5EPUA 1CZRA 5LIPA 1A8QA 1JDTA 2ZTVA 4QLBA 2Y67A 2OQRA 5A9RA 4V1CB 1QRSA 1ONOA 4WXPA 3ZS8A 3J80A 4XWOA 2Z56A 1KJ9A 4HNVA 2VYFA 3RSFA 2OXIA 3GUHA 3E7PA 2Q1TA 4I3FA 3GBSA 5FB3A 5F77A 4HYTA 2GF2A 3EWNA 4DARA 2WKWA 3GX1A 4WCFA 2YJNA 4FR2A 1B2LA 1L8QA 1GOTA 4FXOA 2HJGA 3EF1A 3CURA 1G6Q1 1YI8A 5I7AA 1XL0A 1DIRA 3PI6A 1PCXA 3AJ9A 4TTSA 3WFZA 2FDXA 3OPYI 4A6PA 3ZK7A 2A7QA 3IQEA 1ZO8A 4OO3A 4JVMA 4HAWA 4C29A 5TY0A 3U1BA 3RF6A 3IDZA 1M1ZA 4DWVA 2PX5A 1TAHA 4MRMA 4BUCA 4RK7A 4YIHA 3GPCA 1KE2A 1P1JA 2FDRA 1B1AA 3FIUA 4Q3OA 1OXVA 4FD3A 3GPIA 1Z2PX 2BDTA 2VZ8A 4X9XA 3PP8A 4TYQA 3I23A 3C43A 4XOIA 1JDBB 3OQOA 3CMCO 4LSGA 4GAEA 4Z0NA 1C3OB 4E6PA 4TKZA 5JARA 4PYOA 3JASA 4MWZA 2ADOA 1NVTA 1Q1BA 2Q8QA 5A62A 1G3QA 3A9UA 1O6CA 3GEGA 1V1JA 3X1MA 1C29B 2VDWB 5JJIA 1NGSA 4EEXA 1M6VB 2JI7A 3FWNA 5CB6A 4EUSA 1PTKA 4KWIA 5FR2A 4FILA 2VDRB 3OETA 3TLXA 1EGQA 3AHFA 2GCOB 2W0MA 4BNDA 4V0MA 2F43B 2HX1A 3TXXA 1TUEA 1TMGE 3AX6A 3EAGA 1YA8A 5L3VA 4R2IA 2OHFA 3G68A 4HDMA 1R0XA 4AY6A 4KBYA 3FVQA 5CA1A 3N8GA 3TOVA 2BGKA 1RAIA 1ISPA 2H52A 2J09A 3GT4A 1KP3A 4GQAA 1V3UA 1XZMA 5L8VA 4X66B 1U9IA 4NJEA 4JT2A 2WD7B 4HNAA 4RTQA 2I2AA 1Z35A 4KO8A 3ZJ5A 4I1VA 3WQRA 3DB2A 2E4AA 3KDPA 4YALA 3L7NA 2PY6A 2DVMA 2IOYA 3G9TA 1KK1A 5J4VA 4RK1A 2X2EA 5DHFA 1W25A 4RENA 4Z3OA 3KO8A 3A4NA 5H5JA 3FG9A 3D3JA 4O2AB 3IC5A 4M1TA 1FXUA 2N1BA 3MSCA 4HLUC 4BGEA 4HATA 1UWVA 3O8QB 3O4IA 4L95C 3EQ2A 2O2YA 3IIJA 5EXDA 4US2R 3PWKA 3WOHA 3VR1A 4OJMX 2ODBA 3D5EA 3JYHA 1ZN9A 5F9MA 2IYLD 3PUWA 1X7WB 4OQ4A 3ZEIA 2X9VA 3OTWA 4K6KA 4WKPA 5FL3A 4QZVA 2O5VA 2OG2A 3W8RA 2FQ1A 1I6WA 5KX5F 1Q11A 3QPCA 4K3UA 3T9BA 4NV0A 5KNDH 2JIQA 1Q12A 1X8LA 3C2QA 2VBGA 3JQEA 2P4EA 4GM4A 5DH9A 1QNFA 4FSDA 5JTUA 2YASA 2RK3A 1ZESA 3FA2A 4IG4A 1E7SA 3HBAA 3GW8A 1LEHA 2JAOA 1Y1PA 1NMQA 3QYFA 2J9FA 1M76A 4MW5A 3RAPR 2IWHA 1M8JA 4ANFA 1UMBB 3PZBA 4DZZA 4F3CA 5B6PA 1QRDA 1XE3A 3NWBA 2KM1A 3N2IA 1W30A 1S3FA 1TZ2A 1Y3FE 2WU4A 4FK8A 3RIHA 4MS3B 4FYIA 3LT0A 1C3OA 1GCOA 1GZSA 2EKBA 1W8IA 4F21A 5JJLA 1B6TA 1XRJA 4V38A 2AKEA 1SVLA 1W4BA 3KYBA 2XZPA 5KQGA 2R6GA 3RS5A 1H4VB 1C0EA 3PL1A 4GKVA 4O5AA 3H65A 3Q7EA 2Y68A 4Q4LA 3GRZA 2IOHA 1Z6ZA 1FS5A 4HSGA 3V34A 4U5QA 2QLNA 4D80A 4R1SA 3ETEA 4BMYA 1XQVA 2CGEA 4KUHA 3AEYA 3U3OA 4YP7A 4RQBA 4EHKA 5I9MA 3U7QA 2GCOA 1NUAA 5COQA 1GSIA 1HY3A 5NLLA 3K70D 1Z75A 1JSLA 2YVAA 1GNVA 5AKEA 5DTQA 2WF7A 5KPDA 1QG6A 4EGQA 1SHLA 4S05A 2QBYA 2PV0A 1TVMA 5BORA 4AT1A 3E58A 1ONBA 4R5MA 3JAWA 4GBMA 1IB6A 1P5ZB 2ZRFA 1P5JA 3P9IA 3QXHA 4JENA 1JTFA 2X0FA 4F93B 1X3SA 3QLVC 2GAFA 2NUAA 4RDHA 4DMCA 3E7FA 2V7QA 4NL4H 1X1SA 1CJBA 3GO4A 1SA0B 2XKBA 3EZYA 3OQHA 1W0KD 4PTLA 2A3RA 3MERA 2WD7A 3IAFA 1QHYA 3VO8A 2GN2A 2DHQA 5TPZA 1BIFA 3I2FA 1KWKA 2W6JD 3T7IA 2UZ0A 3PB3A 1JR3D 5LBTA 1AB6A 3R1IA 2Z8YA 1T8WA 4FFOA 4FFMA 3K7EA 1ZZEA 2OKCA 4IQ0A 3KV1A 1HO3A 1F5NA 3G7SA 3JVUA 2LZ0A 3TVYA 3O8QA 4ZTBA 1PW7A 1W85B 1JG3A 2QRVA 4WZAB 5DNVA 5AXAA 3TTYA 4BGUA 4Y98A 2PD3A 1DJPA 1C0KA 1EFTA 1KKUA 4E07A 4DJAA 5HOEA 1MB4A 1X7WA 3RSSA 1VI5A 4RL6A 3ZBQA 2EX4A 2H63A 2Q9UA 4LHWA 3UK2A 5HKBA 1WP4A 4K5QA 3MBOA 3FVWA 2JHPA 4KZPA 4U7GA 3AJAA 3GFPA 3QWBA 4AYXA 4QM6A 4BZXA 4JL8A 4EUKA 3GLIB 3NHUA 3A6JA 1U3WA 3GJ3A 1P1BA 4BC1A 4HV4A 3GLGB 3ESAA 4MWSA 3CPEA 3I58A 5CNMA 2GOYA 1PG5A 1IHPA 3N9IA 5CHEA 5GOTA 1H6CA 1D1PA 1O9GA 1V1MB 1GNRA 3GMIA 3HSYA 1BHO1 1IY9A 3DFUA 4FZJA 3SEZA 3TQRA 1E7QA 3QNMA 2AXNA 5K0SA 1VHWA 2FSGA 2P2NA 5G1NA 2PUEA 1UMBA 1QHIA 1DJMA 1ANKA 5KTKA 1P7VA 2J0UA 2I3BA 3S55A 1VMDA 3C4QA 4D25A 2YMMA 2CXTA 2AS0A 3UJHA 4P4UA 3HK2A 4FYHA 2QJRA 3OIGA 3GMTA 3SXJA 2OY0A 2WJYA 2OYSA 5L7YA 5A3SA 3RUDA 1G21B 4AG3A 2WWHA 2GHIA 2VWGA 1A5BB 2YUTA 1IJKA 3AG5A 3O1LA 1Y4AE 2FG7C 2LW7A 1QHXA 3IIEA 5F7JA 5P21A 1HR0B 1J0EA 1M8FA 3DFMA 5LU9A 4XIFA 1R2QA 3DLHA 3R44A 4HF7A 4MI9A 4QQRA 3OTHA 4KRFA 1JWLA 1SBQA 5TQVA 2F1IA 3GJZA 3ZKAA 2CLOB 3HR4A 2CJFA 1Q0RA 3WSVA 1NI4A 2GH1A 3ROKA 1M6YA 4GPTA 3BOSA 4I5EA 5H9VA 4EB8A 3D2CA 2EZUA 1XRPA 4WK0B 2D4HA 3CX7A 3JD2A 3SOPA 3AM3A 4J0EA 1E6LA 4MV0A 2IPXA 5BMOA 1F4LA 3KQQA 4QJ3A 1SC3A 3ENZA 4RDIA 1D4OA 1SKQA 3I1FA 1U3TA 1GKYA 2CVZA 2XNDD 3VR2D 4QODA 2N1MA 1Y98A 4E2YA 3PGLA 3RREA 3N58A 3UC5A 4D3FA 3E8MA 1VLHA 2W6ZA 2ACKA 1GU0A 2NVWA 2VJLA 3NNDA 1G9SA 1ODCA 3FVVA 3OM9A 5DKFA 5CGZA 1AKEA 3SFTA 1DARA 5IT0A 4RHTA 5I45A 1QE5A 4ZEOA 1U63A 1W85A 4WZAA 1CW2B 2JL1A 1NYRA 2WUEA 5EJ6A 2YHUA 5CIWA 3A36A 3R7LA 1P4RA 2NO5A 4MVXA 1A95A 3HZHA 3VNRA 3HHPA 1QOQB 1Q0HA 2QD1A 2MWMA 2PFGA 3S68A 2ID4A 4BN0A 2XCRB 1GPWB 1MX3A 1YJXA 2YIJA 1CC1S 1OZHA 2VOEA 1JDSA 2F2TA 3PRYA 3MUOA 2GM3A 5ETJA 4AY5A 1MNQA 4P7GA 2J4FA 5J23A 5J5CA 3QVWA 1H4TA 3H4MA 3INTA 5AHXA 5A7HA 3VR3A 4B76A 3GLIA 5TT0A 3DE5X 4L8LA 3R2JA 4WFJA 4TLAA 5A0FA 3WI7A 4AN4A 1C3XA 4K26A 1J25A 3GLGA 3BD9A 1SC4A 1M2JA 1X1TA 1U8TA 1L7QA 1OAOA 2WJ4A 1GTMA 3BMCB 3D3WB 1VRVA 2DUNA 1QQTA 2PT7A 3I04A 3G2IA 4DDMA 3HCEA 3UAOA 3AF6A 4C21A 3X2SA 3PEWA 3A32A 1WNFA 2O57A 4GGMX 3HNRA 4YV1A 1XRQA 4JJ6A 1P7WA 2X1HA 2HGSA 3I64A 1NMYA 1FQOA 1QH8A 3BGOS 2ZBQA 5AKHA 5HDQA 3HACA 2XZLA 4DYDA 3QVTA 2RK6A 3PDJA 4BNTA 3T4UA 1SO8A 3L4JA 1TE2A 1FPMA 2WVJA 1Q0SA 3NH6A 1Q14A 3HMKA 1FMJA 3NJ8A 2F3QA 4R1NA 4D3DA 3KXDA 4XCQA 3GJQA 5HF6A 2HMVA 3BSWA 1SKBA 1U99A 5HJ2A 3H18A 4H35A 1DBIA 1G21A 4KIWA 5JEEA 3A7DA 3IE0A 3BE4A 4JGIA 4E4RA 3HP1A 1I3OA 2P2CA 3IP8A 1MB9A 3B8HA 1RYBA 3GAAA 4IJUA 4QXPA 4OQQA 1VPWA 1SCJA 1KNQA 1H2WA 1VJDA 4OX9Y 1JTVA 1TZBA 4PPQA 4I9FA 4K3VA 1XZKA 4KVFA 3AHIA 1QB7A 4H31A 4M9ZA 2X1VA 3N05A 5H7XA 4FDMA 1I13A 2KBEA 2OVBA 2IP1A 5IH7A 3QKSB 3A9SA 5IVKA 2RAVA 4IF4A 1VMKA 2XD4A 2HFKA 1K7YA 3I9JA 4J2OA 3NJRA 1GFWA 3CX4A 2H08A 4DNXA 2XITA 4D4HA 2ZI4A 4FFRA 4AO8A 3DZ8A 3PJGA 4UASA 4OL0A 4M1WA 4X8HA 2AYZA 1VIMA 2V0CA 2W4IA 5G4LA 3HYNA 2RGGA 2JZNA 4NBTA 2HQOA 2YY6A 2V5VA 1DP4A 4TV9B 5JBQA 3OJEA 1VJGA 3KWFA 4TT8A 2PU7A 5DTJA 1RJ9B 4MKGA 4E5PA 2DR3A 2IYSA 3DMYA 5IVDA 3E61A 4G3XA 4OJQA 2JLUA 4PHFA 2ZJ2A 1NVAA 4K40A 4JYPA 4MI1A 4W5QA 4E5MA 2DBQA 4R8RA 4LWQA 4OGWA 1MJ5A 4KV7A 3C5EA 4KOAA 1HE8B 4WPGA 5TRTA 4DHWA 5BRAA 1WHSB 3G8AA 3L8ZA 1KDTA 3C8HA 3CUKA 4UXIA 2OFWA 5JYEA 2ILTA 1C9YA 3A14A 2ZIGA 4A7PA 1YBMA 2FLKA 4I1YA 1P74A 2C03A 1OX6A 3LRPA 4I9NA 1N25A 5ULLA 3B8EA 3L0DA 4ZHQF 4KKVA 3UPDA 1RM4A 2FR0A 4BIIA 2HPAA 3EW9A 1EUZA 1P91A 3OO1A 2WSBA 3K0SA 4O4HF 4DDUA 3F7MA 2HSGA 2XUIA 3BMCA 2VP3A 3IUQA 3HRIA 1WQ4A 3RFFA 2GCIA 4FYXA 2Z3WA 2Z6UA 1AM4D 1Q3TA 1R0YA 4NOKA 4E09A 4ZIRA 3CSSA 4DT1A 2BE7A 4KYUA 5AVTA 5JJ5A 2FUG6 2WSIA 2UVQA 4BMCA 5LMUB 4D8VA 3F1LA 3HSKA 3LF1A 4Q37A 3NBKA 5IBCA 3AR7A 4PAGA 3M9LA 5KMGB 2H2FA 4YJHB 2P62A 2D6FA 3W6UA 1R3UA 2F62A 2PMFA 2BJHA 2AQKA 2JLAA 3OJWA 4N39A 5ALOA 1GLGA 3UMBA 5KNCD 1DLJA 1MRZA 2PQMA 1P2DA 1WTAA 4BLWA 5JO9A 5I3CA 3IP1A 5IUNC 3KE9A 1HQYE 1L9XA 2PX2A 4OSPA 5DX1A 1OASA 3R5XA 1T2NA 3QHPA 3G8DA 4N12A 5AI0A 3BMQB 2FUEA 4EPRA 2G0NA 1D4AA 1G1AA 4GOLD 5AOAA 5JAHA 2OGWA 5I6DA 1QR6A 1WX1A 1FCJA 4FB4A 5T4EA 4HVLA 1UOOA 2V7UA 5TDHA 3K20A 4YDRA 3JYPA 2XCQA 3LRTA 4DPKA 3ZJTA 1YHYA 4XYLA 2Z2YA 1M2VA 3LUPA 4WBSA 4IXDA 2CXNA 2H2IA 5C37A 4HH1A 1GPH1 1OXKB 2HV8A 1G19A 4YRJA 5BSVA 3FZYA 1Y9JA 1UWLA 2CMHA 4OHCA 2YS7A 2QPAA 5JZOA 3WBBA 1J7KA 4MUMA 2JFGA 5JE8A 3OP4A 2DR0A 4F6LA 1NW5A 3DOFA 4TV9A 5ISMA 2AUNA 2XRZA 2O8FB 1KKLA 2ZRGA 4ERNA 1G4UR 3ZI7A 4LF8B 3H9CA 5DYIA 4ESHA 5SZKB 1SCNE 1R37A 3D3KA 3CTPA 4EY8A 1C1YA 3OZAA 1VGVA 3CZCA 4JWTA 2O8BA 1SHJA 2CDRA 4S1PA 4RQUA 5T3UA 5GINE 3ZDAA 4H1HA 2I78A 2P6OA 2SBTA 3ZIDA 3JVVA 1E1CB 2UUCB 1EA5A 2VHEA 3OFJA 5ICFA 3ZHOA 3KKQA 1SHKA 2VF2A 5FUWA 4XCXA 3H2YA 3OFKA 2D2EA 1NDHA 3D0OA 1NVEA 3H3XA 3QVLA 3BMNA 4Z0PA 1KO1A 1GA1A 2G7ZA 4JT9A 3ZWXA 3ZK8A 1AE1A 3LC2O 5DVZA 3ESDA 4GD3Q 3ZWCA 2P2SA 5ADWA 4ZZIA 3GCZA 3NTXA 4JFRA 2YL2A 3AOGA 1UXGA 3A7EA 4B3MB 3IPAA 2LCQA 3U17A 3GL9A 2AN3A 4JH0A 4QU9A 4LCBA 3WX0A 2UXDB 3MEQA 5SYNA 3JZMA 4MJXA 2FX5A 4EB3A 2HA6A 2VJNA 3DEKA 3WRYA 2GKGA 1LNSA 5A3VA 3WWDA 3Q5EA 4NPHA 2ZTLA 3RTCA 1BS9A 4G8DA 1MOPA 2JCGA 4U7WA 4WNYA 3SDBA 4CTJA 1BH6A 1FYFA 2IXGA 1DOZA 3L6OO 4IM7A 3BMOB 1VKJA 4Y9DA 5CH5A 1UM9A 3DD5A 1V4BA 3C48A 3NBUA 1BE6A 1GRNA 1K0UA 1HDOA 4QLOA 2YWHA 4P9NA 3QU9A 1SXJC 1A9QA 5FYQA 4UE3S 5JO0A 3M4XA 1WUYA 3VOAA 5LP6A 3I9KA 3BCUA 3R8XA 1U8CB 2C58A 1YI1A 1ZHHA 2PMCA 2EL7A 1FOEB 2YNMA 3H1AA 4MWTA 4PANA 5JTTA 4ARVA 1U6IA 3SHFA 5HKOA 2A5YB 3OTGA 1TCAA 4WV3A 3JQ9A 1I6KA 3IHLA 3EUWA 4OJKA 4QUIA 4I2NA 2OK7A 2Q3LA 3I9OA 4PNPA 4BNIA 3H9BA 3NV9A 1P7ZA 2UZAA 4PWZA 5ALSA 3USZA 4PG4A 3UAGA 4NYMR 1V3TA 2CFTA 4HEQA 3GFVA 4JCCA 1G6KA 2QN7A 3CRZA 3JQBC 4RF3A 5ED0A 3ZLUA 1ZFNA 5JXJA 5ARCA 2AW3A 5AD1A 2ZWMA 1DQYA 1JEQB 3ZXSA 2FUNB 2KLHA 4QBFA 4KPUB 3GYBA 1YBVA 2GVNA 3FMVA 1IHXA 1VLMA 4QQFA 1YE3A 4LXTA 4Y0NA 1SU4A 1PJRA 2DY0A 3P7MA 1L4BA 4C0LA 2BW0A 1SPBS 4EHAA 5C8ZA 5JR3A 4OXKA 2HUPA 4TTPA 2IS1A 3VJKA 2FRXA 4K88A 5AOCA 2YVQA 1WABA 4E70A 4I5DA 3MRXA 3HCFA 1FMTA 4C87A 4YUXA 5JMWA 4LE2A 5IRCD 3KTFA 2YHIB 5BR7A 1MD9A 3HGQA 1I80A 2BYTA 1PD0A 2J0EA 2YJZA 3FLBA 4P3PA 5BV2P 3AG6A 1IUOA 2O8DA 3W6NA 7MDHA 2CNLA 3K09A 5AVZA 5FAXA 4ND8B 5TGTA 2W8BB 3TWOA 4E7OA 4L2IA 2IGTA 4ZYTA 1YB4A 3CNHA 3EDQA 3KBOA 1KY4A 2VZ9A 3ORQA 2IYWA 1XVLA 3ZWWA 1JJFA 4ZN6A 3QVXA 4YDSA 1ZOIA 4NOMA 3BMXA 3VZPA 2Z1MA 4CGZA 5LDHA 3WHIA 3C7KA 2GDZA 2V1XA 3MZ0A 4B5LA 4BDTA 4MHTA 2IKSA 5HDBB 3P5SA 4R69A 4DR5B 1RAAA 3FN4A 1PFKA 1ZU5A 2PANA 5BT8A 2BFPA 5KTYA 3QEKA 2EWVA 4D4LA 4DUGD 3CYFA 4YUYA 2RKBA 3F6BX 3D59A 3QJYA 5G41A 1KO8A 3AUYA 2W2XA 2Z1NA 2EEZA 3F6SA 1TMKA 1K8YB 1Q1QA 1DC6A 2D5LA 3FPKA 3H1FA 5IYZF 4YECA 3V1YA 4JD5A 3GLUA 1GQSA 2O8EB 1GGHA 1T10A 2Z2KA 3TLMA 4ZYYA 5KHLB 3PQ4A 1OXSC 3AIIA 1H22A 4PXYA 4IDFA 4NYIR 1LPAB 2X8BA 4M36A 1OV6A 1VLLA 2R1TB 3F6YA 4M1ZA 4D9BA 3M5CA 1CUSA 4IIJF 5IKOA 1VLQA 4MWEA 2P90A 3ON5A 4Z7QB 1KQPA 2I6QA 2JLSA 4LG1A 1X8JA 2PXAA 3QQPA 4YUWA 1JHZA 1QRTA 3RR2A 3VR3D 1P7CA 1NVWQ 1JHYA 3U0BA 4AS3A 4UHFA 1FSSA 2QTLA 3OQIA 3D6JA 1DHRA 1JHDA 4G4IA 4L0QA 3G3EA 3V4PB 1E3DA 2C3PA 5CW2A 5EG5A 4DUZB 1SIUA 2BCGY 4UNIA 2OBMA 3Q88A 4XCVA 2AFHB 2Z5LA 1XWFA 3ZVNA 1MAHA 2W4MA 3W5VA 3PL5A 4OGLA 3SFVA 4DLNA 4DVGA 4YRRA 3W8NA 1JEQA 3WIBA 3HDYA 5EN4A 3OVMA 3V8EA 1CU1A 1P1CA 1OOEA 2WTXA 4IHJB 2HBZA 2PZGA 5DEOA 3VBCA 1GO2A 5B7GA 1C4OA 3FTCA 4LNUB 1GUFA 4X7PA 3RH0A 1VIVA 5C9ZA 2Z4RA 4L4XA 1KK3A 3L43A 4ZANA 3L4KA 4Q7EA 3RS2A 4C6TA 3OEHD 4LOIA 2IX9A 4A5OA 4TS3A 2BRUC 2AN9A 3HKCB 1Q92A 2YW2A 5E3JA 2YHIA 4UOZA 1G7CA 4OK3A 5KO2A 2PRZA 3S7ZA 3T61A 3KKKA 3MIIA 2DH5A 1VCOA 4ZVNA 1Z6TA 3VYTB 3O9VA 4GOOD 4ND8A 4WK4B 3HDQA 3TIIA 2X5XA 3EOZA 3PSHA 3GGCA 5F2OA 1MIHA 2RHCA 4HHEA 4LXHA 4N8EA 2OG1A 1QTQA 5BXQC 1Z5WA 3Q6MA 2XVZA 1F4PA 3U1TA 5B2FA 3JRXA 2WMDA 1WRBA 2IY7A 2RC5A 3EPHA 3Q11A 2B3DA 3CCCA 3GFBA 2QGZA 3KYDA 3NDIA 3QA3E 4NNOA 2WHPB 5IW8A 2WM2A 4L3VA 1Y7HA 5EJEA 1G3RA 4NMHA 1N78A 4RZUA 4CEHB 3JWGA 1MPXA 3NV7A 4OHWA 3V3TA 1FDTA 3ICVA 1QVAA 4HWTA 3TRDA 3LX5A 3ZI4A 1JG4A 1UC8A 4IHKA 4N0MA 4RE6A 1OKKD 4GLFA 1KDVA 1QCYA 2VZ0A 2UYYA 2QL9A 3RJMA 1PSZA 1OD6A 3VU9B 1GL6A 4I36A 3OEYA 2O8EA 2G83A 4B81A 1Z0KA 1YO6A 2PYDA 3PJRA 3DEZA 2QMOA 2VAXA 4BB5A 3CZQA 4XPIB 4A2CA 2GPWA 5L40A 4MDFA 3SEAA 1DZIA 1ZONA 2PUVA 1LB1B 1KMCA 1EFKA 4NXNB 4BQQA 5HQJA 2CKMA 3FROA 4TUYA 4DC1A 3EGVA 1HT1E 1MQAA 2QAGC 1Z62A 4JP2A 1ZOLA 4N82A 1L5WA 1EDZA 3N6VA 4RAQA 1T9CA 4U5XA 4B74A 1T3LA 3H2JA 4BNYA 1YQXA 2X6QA 2WF6A 4MVJI 3EGDB 1PR3A 4HG2A 5IP5A 2N9UA 2A1UA 2CHVA 2ZE6A 3C5WP 3K9HA 5KWEA 3KT6A 2DQ4A 3AZPA 1N9ZA 5BOVA 1UDXA 1PJBA 3FRHA 4V1CI 4DDVA 2QYSA 3ZX4A 4LPSA 1Z22A 2ZB8A 2VKQA 2HREA 3F97A 3FYDA 1ESCA 2B9EA 4HAZA 2XY4A 3FZNA 3QVGB 4BU0A 3BH7A 5BUQA 1T25A 1V41E 3CUYA 1UZAA 1JIKA 4M54A 2VRWA 4N76A 3TKAA 4B71A 4JI2B 1GA4A 2BI8A 1LS6A 1CXZA 4LNUA 4NCJA 2BR3A 3ZVKA 2GWHA 3QBJA 1D8TA 4M86A 1TU0A 5DGDA 3M4NA 4UNSA 1Y1TA 4ZU1X 1DAMA 3KAJA 5AKLA 4XDGA 5I4BA 4EKDA 3UMFA 5CA0B 1V8OA 2FPGA 1MAAA 5TV2A 2ZJ8A 2JCBA 1B73A 4E14A 3E8SA 2FU5C 1H5NA 2OR3A 3GJ4A 4MPTA 5DSXA 2Z58A 4MVCA 1JWBB 1JR3E 3CKYA 5HGJA 1CDOA 5H8WA 1FMLA 2WAYA 3EB9A 1W36D 4NENB 2PIDA 1NVGA 1U8AA 4RD0A 2V8OA 4GRIA 4J2HA 3RK4A 1A4XA 1LRKA 1UM8A 1SBYA 1Z17A 1T6YA 2PL5A 5D00A 4IDPA 4BYGA 1M83A 4EI9A 5I7OA 3RC2A 4EF5A 1M7GA 3R3SA 2M9MA 3MUEA 3IESA 2YYAA 4ZK2A 3I2GA 4JEUA 2VNSA 2WHPA 3OA2A 1Z12A 2UAGA 2PUDA 1RP7A 2B1JA 2ASVA 1PBTA 2P6NA 4HB4A 2ZBVA 3Q0TA 4ND4A 4CJXA 3UMYA 1M75A 1QYIA 4I9UA 3LZCA 4QLAA 4URHA 4M1SA 4LXUA 2X77A 2MYNA 4XM2A 4HEA1 2ONJA 1T3TA 4FX5A 2WJIA 2VVTA 3IB3A 4G0ZA 5HIMA 2XQKA 3ZQ4A 5LWQA 2X15A 1EJBA 5JDCC 2FMIA 3EA0A 3I6ZA 3MT7A 2G82A 3K31A 1M54A 3LIPA 4ZO8A 1QGOA 1B14A 2V7PA 4XPIA 5KYGA 1SKMA 3DE0X 3H7IA 2NSDA 1JYFA 5IM5A 3WDKA 4D46A 5K8VA 1QLHA 2P9TA 2WUGA 3NAQA 4G84A 2FMFA 4DMGA 4DTCA 4LJSA 4Z53A 5ALMA 1RXSA 2ASEA 3ILHA 3BXHA 5AW3A 2FW7A 3DGEC 1TPZA 4M0FA 3LQYA 4XH9B 2DFPA 3JQGB 3T34A 4GMGA 4HH0A 1CHNA 1BHJA 3DG9A 4Y1RB 2Z6AA 4YCCA 5T57A 2O2XA 3SF8A 2HCRA 1YI0A 2JAXA 4CGYA 4BO3A 2WU8A 2WINI 3JQRA 2CKDA 4IPTA 1IVSA 3PWZA 4JMPA 1J70A 3Q2KA 1JV2B 2NN3C 2OFOA 1EX7A 4KMRA 3PITA 4AP9A 4HFJA 3O4VA 2WQZA 4Z54A 1EGVB 2IF2A 3QVGA 1MMFB 3A10A 3EVNA 4W99A 4US0R 5GMOA 3FNRA 3PD7A 2VBIA 5BV1A 3F5MA 2L18A 1AA6A 1Z18A 1BJRE 2L82A 2J5BA 3A3OA 3C87A 4KQEA 4L22A 5K4AA 4W5TA 3GFTA 2H1CA 3PDIA 3KK0A 1A4UA 1CJSA 3KXLA 4M7WA 2AG5A 3DONA 4NARA 3IIKA 1E8DA 1D9ZA 1E1NA 2O4CA 5A7GA 2HCTA 3Q8XB 1DZ3A 4W5JA 5CA0A 3U9TA 1B7GO 1O54A 2PMWB 3ESXA 3JQ8B 4GLJA 4Q3AA 4F4CA 3MINA 4GBED 1ZJ4A 2VDMB 4M1MA 4BBAA 3AR9A 1ONNA 1Z4OA 2LKDA 4QFMA 3UXHA 5LIRA 2ZWPA 4TWIA 1BWRA 2P78A 3RUFA 5EJ2A 1J9EA 1XI2A 2AC2A 2VDJA 4FLEA 4OYRA 5IZCC 3UUGA 3STVA 5KQSA 2ZPTX 5FF9A 4UNQA 2VJKA 5IJAA 2DB3A 4G1EB 3UJ8A 5KHAA 1KETA 1IL0A 4N54A 4CKCA 3CWQA 3TTTA 3UWDA 3W2TA 3GN2A 2HU7A 2HRDA 2FZ4A 1RQRA 3R0ZA 4QBKA 1YRWA 3CRNA 2GN0A 3L46A 5EE3A 4OAQA 4AX4A 1RWVA 1LDYA 3QE3A 5TEWA 1JKIA 1FFDA 3OFSA 2MOKA 2X4LA 3H04A 2QSUA 1FFHA 2Y99A 3C85A 3KX2A 5B5SA 2WYVA 1IAQA 3K0CC 2HJHA 2QD3A 5LYJA 3WZ2A 4C22A 1DXOA 3II6X 1BMFA 5IAGA 4BYMA 4YRMA 4YCBA 3BQ9A 4FT2A 3MJVA 3TW0A 3EMVA 1JAXA 1LQUA 2ODEA 3KOOA 4MLCA 5E6UB 5EFOA 5FLEX 3IKLA 1P61B 3TNFA 4F84A 4HYQA 3TBHA 3STUA 1SIOA 3FWZA 4KREA 4M9SA 2ONZA 4EEKA 3PXEA 2PU5A 4KQGA 4L7VA 3S2EA 2HWXA 4JGGA 4JUFA 5TB5A 3FSJX 2RG7A 5HTOA 1UBTS 4TKUA 1IBMB 5AUQA 4BKOA 4JJ7A 2JLRA 1XLVA 3ZE1B 3DMFA 1UDBA 3A11A 1SG6A 3GP3A 2V8BA 3Q2OA 4MLPA 4MNTA 4RSRA 4KN5A 2Q5IA 4V0LA 5CAEB 3VYVA 1PFGA 4Y1RA 2I54A 4CIBA 3U13A 2YWBA 4JLVA 4TTQA 3V4OA 4NS4A 2W11A 5CDGA 4DR6B 2D2FA 2MYTA 5U4XA 1XTIA 4OXRA 4V0SA 1NXVA 1UXHA 3DCNA 1XYYA 4LX0A 4OL9A 2WABA 4D7AA 3F78A 3SBOA 4BE7B 4KITB 3RT1A 4BRWA 4K28A 2RAPA 4ZVKA 4CUKA 2XTNA 1F2VA 3N8KA 1CJCA 1U2ZA 2B34A 3LPAA 3F8SA 3IPXA 4IRXA 2FFHA 3K9CA 2EHJA 3PGJA 5JS7A 1D2RA 4MYUA 2ECKA 4IMRA 4ZAZA 1CS0A 2QD4A 2NSYA 3JQCA 3Q8WA 2FZKA 4KRYA 4RNCA 4M8IA 1XYVA 4YJ2A 1LQTA 4Q1VA 1F5SA 2M98A 2BEUA 3Q3IA 3CM0A 4RCVA 3I9FA 4LQLA 1CVRA 5JG7A 5BR8B 5CCBA 5DMXA 2YJGA 1AV7A 3EQ6A 3ND5A 1UBFA 1JLLB 1JAYA 6ABPA 1YQTA 1TYAE 1DG1G 1WG8A 4MGHA 4DV3B 1KZYC 4DCTA 4WLEA 1QANA 4R41A 3TEFA 1XELA 3T52A 3RV3A 1GPNA 3SYRA 4QJ5A 4AJEA 4JU9A 4LMRA 1KF0A 1P1HA 3R6LA 4C20A 3WISA 1EE2A 1TIBA 2X6TA 5EXXA 3Q6IA 4AZTA 4HMPA 2ZJZA 3O4HA 4RHXA 5IDXA 3L41A 3P2OA 1CRPA 2YR0A 3QYAA 2VNJA 3KXKA 3OO0A 2UUOA 3R3XA 3M9WA 4V0ME 2BMVA 1JBQA 1O6GA 4JGBA 4PC3A 5H16A 4FNMA 3VXKA 4EKNB 2BI7A 1ZD3A 2VHYA 1J22A 3EZ6A 4S0ZA 1S8AA 1DIHA 4COKA 1JMKC 1XCGB 3QE9Y 3K0HA 2J1LA 3ZGYA 1S01A 2Q46A 3HJNA 1GUYA 2I91A 4KBGA 2A9PA 1MLDA 3GH3A 1TM4E 3B20A 3A9VA 4HWKA 4O4IF 1N3BA 5JJBA 5HIAA 1QYWA 3EQZA 1D1SA 4YB8A 2VUSA 2W90A 3AHCA 1CR1A 2V3WA 4I50F 2REXB 1M2HA 1NVFA 1O95C 4TTRA 4YQZA