3Q3JB

Crystal structure of plexin a2 rbd in complex with rnd1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
175
Chain Sequence
RCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of plexin A2 RBD in complex with Rnd1
rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
molecule keywords Plexin-A2
total genus 59
structure length 175
sequence length 177
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q3jB00
2XZOA 3B6EA 1NMYA 3AVPA 1G8GA 4A2WA 2O52A 1AGRA 3LAWA 2KB0A 2VF7A 1DE0A 5FI0B 4QRHA 2OZEA 2FEOA 5FOSA 3PIRA 1FX0A 1P3JA 2FV8A 1HURA 4PANA 5LBIA 4M1SA 1HE1C 1GVNB 3NTUA 2DHRA 2EFCB 2IBMA 3OEED 4LCBA 3JZMA 5L8VA 3U5ZB 3G0HA 1EFRD 2YC2C 3SYKA 3MJRA 1OIVA 4P33A 4A8JB 2GXUA 3CPEA 2BKEA 3CWZA 4KFRA 1U8AA 1RZ3A 4OQXA 4TLEA 2WOOA 4JIMA 1RPZA 4P4SA 2GJ8A 5BW8A 1ZJ6A 3RDPA 5EQTA 2VP9A 4XTRA 4TZ0A 1RVDA 221PA 3CO5A 2XEXA 4R98A 3C5HA 4B75A 2H16A 4QHYA 1GKIA 1R7RA 3PUWA 4KBFA 1T9HA 3U61B 1GRRA 1F2TA 3CUEF 4V02A 2FPKA 3QJYA 2CHQA 3BJIC 3EA5A 1GDDA 1GKYA 2GCOB 2WJHA 3KXLA 2QAGB 3NC0C 4GP7A 5LPNA 1NVWQ 4PZLA 1I2MA 2PLFA 5J4KA 1SXJD 3ICEA 2R8RA 2UZIR 2F1HA 1G291 3U7HB 4C0HA 1KMHA 1YRBA 2IA5A 4MGZR 5JI2E 2WOJA 2NIPA 1AZTA 1Q12A 5FBQB 1IN5A 1SVKA 1UPTA 2AWOA 2QGZA 5K8TA 2OAP1 2YWFA 2ZYWX 1U0HC 4A2QA 5EXPA 1CEEA 3AGQA 5FTJA 1MT0A 1XJCA 4C0JA 4D0LB 2ZRBA 5H1YA 5JS8A 3VR6A 2FU5C 2JATA 4F4JA 1G3UA 1KTVA 2JJ2D 4NKRA 2HLDD 4NONA 3FKSA 1CR0A 2ZRDA 1CR2A 3W34A 1BS1A 3CX6A 4LJ5A 3WY9A 1UFQA 2PT5A 1Q44A 2YJTD 4C0KA 4HB3A 5M04A 4DLWA 4TTPA 2DPXA 1IY2A 1W0JA 4IVPA 4PHGA 4ACAA 4ERNA 1AS2A 4GOJA 4DT1A 4QM6A 3T34A 3WP0A 1XU4A 4L16A 1P72A 3VR2A 4OHYA 2YZ2A 2P67A 4CEIB 2R6FA 1TQ4A 2CE7A 4JBYA 5L3RA 1FQKA 2N42A 5FPSA 3BC1A 1CJTC 3THYA 3R8CA 4ZDWA 2ZI7A 1DAIA 3BD9A 3NDBB 1YZTA 4KLNA 2A5FA 3DZ8A 4GP6A 4A9AA 2F55A 1G6OA 4ZI2A 4PAOA 2ZE7A 2NG1A 4Q7JB 5K8IA 3BERA 4GT1A 4IDNA 4L15A 2QROA 4JLDA 5AUOB 1OF1A 4WIAA 3T5DA 3GD7A 3E1SA 4LX0A 2P6UA 1XB2A 1ZIOA 2CVFA 2MSDB 4LBZA 4DEXA 3IO3A 4QNRA 2YKGA 4AG5A 2ZREA 2PCLA 4RVCA 4W7SA 2Z5FA 3FGNA 1Z6XA 5CK4A 5EE9A 4Q02A 1QDEA 2C2HA 3SNHA 1GRNA 3C14C 1OH6A 5JMTA 4DLUA 2AFIE 3NHBA 3RS7A 2WWHA 4HUTA 4I1UA 4JVSB 1E1QA 1KO1A 3RSOA 5AUNB 5CB8A 2GXQA 5DHFA 1AIPA 1HH4A 3AVVA 1M1YE 4RD1A 4A4DA 3EZFA 4HEJA 5AJZA 1XPUA 3CIOA 3EASA 4UKDA 3TUIC 1HQCA 4CRWB 4RD6A 1ESNA 1XMIA 2A78A 4HAXA 5KO2A 3UG6A 3WHKA 1WXQA 3IO5A 2ZI9A 4BLOA 4EJSC 1P9RA 1FNMA 3IEUA 3WP1B 1GSIA 1YR8A 1DO2A 4QBGB 3VX3A 1E9BA 2IYUA 1NJFA 5EP2A 2QENA 4K81B 1II0A 1MOZA 4B2PA 2L0XA 2DCUA 2X77A 4AK9A 2D7DA 4OHZA 2YC4C 5ANRB 4HB0A 1L8QA 1DEKA 2PL3A 2WAXA 5H70A 1II8B 1VTKA 2F7SA 1MRSA 2IHYA 3VQTA 4B6FA 3U60B 4DLVA 1CP2A 5JEEA 4RFSA 2GK6A 3W6OA 5JEDA 2IYTA 1WBBA 1M7HA 2QP9X 5HCNA 4DCSA 1CRPA 1Y63A 2BEKA 4EJSA 2JLXA 4LBWA 2A5GA 4US1R 3ZQ6A 4C2TA 1N6PA 4BLRA 1Z0FA 3KFVA 4LC1A 4Q03A 3ZIAA 2PZGA 1UKEA 3K09A 1I4TD 1L2TA 3IKJA 1MO5A 1XF9A 2OLKA 5KPJA 1U0LA 3N2EA 2ZJZA 2IYVA 3HJNA 2ZQ5A 5KU1A 4JJKA 4LPSA 1AGPA 5K8LA 4A15A 4U7DA 4BPBA 2ZETA 1K5DA 1W2GA 2NZJA 2FPLA 4BZXA 2O8BA 3IQXA 1OKKA 1T5IA 3TBKA 1SVWA 4DSTA 3TR5A 1GNRA 4TTQA 2V8OA 3KUDA 1IY0A 3SBEA 2IYSA 3KKPA 1A4RA 4YLGA 4OK6A 1JEEA 4KHZA 2ERYA 3TGPA 3B2EA 3CH4B 1Z29A 3I32A 4IOLA 2AD1A 4TMZA 3CM0A 3O8DA 5DHAA 3PXGA 2QM7A 4K46A 4Q7KA 4B47A 1SXJA 1Z6AA 4PO8A 1P6XA 3GEEA 4KVGA 5E4FA 3TAUA 1II9A 3Q5DA 2D7CA 1E0AA 2BHRA 3FHCB 2ZTSA 5B30A 4LHXA 4QL3A 4BRUA 4OBEA 4H9GA 1IAQA 4TT3A 2H1LA 3FVQA 5FUXA 1K8RA 5A4JA 4OJQA 5LD2C 3IEVA 4MITA 2ZS9A 1F2UA 3GJ6A 3SR0A 4JL6A 2R6CA 4B34A 1N2CE 1OIXA 1E79D 3LV8A 4AKIA 2JLSA 2V55B 2PMDA 4FIDA 3Q3JB 4M9XA 4XVUA 4Q4JB 4RJLA 2Q21A 3NEJA 1RYFA 4PFSA 3R7WB 4QBFA 2YWEA 2WHXA 2VP2A 2WKQA 2VH5R 2NOAA 1Q20A 3TVDA 4RFSB 4LBVA 3JZAA 2BBWA 2WSSD 3AVUA 2F3RA 3NEYA 1FP6A 2FDCA 1G3RA 4L4UA 2JLRA 5JFGA 4H1UA 3HU2A 1HYQA 2ZJ5A 2J87A 4KBGA 4KI0A 1AS3A 5FTMA 4Z51A 4D4MA 1TUIA 1ODFA 3TAHA 3GJ3A 1JPNA 2Q9CA 2ASEA 1IN8A 1E0KA 2XGJA 5B58C 4HB4A 5J40A 5DE3A 3X1XA 4EQ6B 1NKTA 3QUSA 4GZMA 2EQBA 4Q00A 2CE2X 3OE7D 5BN5A 5JLJA 1OH5A 5F9HA 4V0LA 2OESA 3RABA 2AN9A 4EPVA 5KYKA 3PEWA 2J9RA 2ZUBA 3LBHA 4XVRA 1T3SA 1U8YA 1SKYB 2KBEA 3QXSA 1KZGB 4N1AA 1M8PA 4IRUB 4LSGA 5KNDA 1MABB 2JLYA 1KI3A 3CR7A 4A36A 4GZLA 1EXMA 4U00A 3QBVA 3B5JA 1N5KA 3GQBA 4RFVA 4ZPXA 2P6RA 2F1RA 1KKMA 4GRAA 4MGIR 1O87A 3LX5A 2V7QD 1GITA 2YOFA 1DO0A 3HPRA 2R9VA 1F3OA 3D8BA 1MRNA 1VIYA 3QE0A 3GJ7A 3ZYCA 3THWB 3L8ZA 4A0RA 1AN0A 3GLIA 1KDTA 4TQ9A 5DN6A 1X1RA 1X6VA 3QKRA 1OHHA 4ESHA 1XTJA 2GVZC 2GWHA 3BFKA 3R8FA 3M0EA 2IK8A 2ODNA 2Q3HA 3AVTA 1G21E 3A4MA 1G3MA 1PUJA 3UK6A 2FEMA 2GXAA 3AGPA 4Q66C 4C0QC 4Q1AA 2BMDA 2Z6VA 4KSCA 2LKCA 1UM8A 3EARA 4TTRA 4Z1MA 5GADl 2H5EA 2H17A 5CLLA 1XCMA 1QHYA 1KI6A 4DZZA 4PZYA 5LB4A 2PH1A 3FPAA 3T1TA 5AJWA 3IDQA 1OFTA 2FZ4A 2VHCA 5AJVB 2RGNC 1P61B 1XD9A 1RJ9A 2JJ8A 4PPNA 4B73A 2ATXA 2O8CA 4JLOA 1CJUC 2QMHA 4KYIB 3Q7PA 1E6CA 4HI0E 4DLXA 1E2IA 1F60A 4JLBA 2Z0MA 1SULA 1XTSA 3A1WA 1EX7A 4UXIA 3KKQA 1D5CA 2VIIA 2ZRHA 5KPDA 4FCVA 4MGKR 2FFQA 2OCBA 3OFNA 3ONWA 4DSUA 1GNQA 3DM9B 2IYQA 3IGFA 2XB2A 1F48A 1E9FA 4YMUA 1W4CA 2WWYA 1F2TB 4C7OB 1T5LA 1YZUA 3D6TB 1S2MA 2CCJA 4DUGA 1OFIA 2HLDA 5E95A 4Q1CA 3P4XA 2ZI4A 3PUYA 4IDHA 4TMTA 1YVDA 5EZ6B 5C4MA 1ZCAA 4BFYA 2Z4SA 2V1XA 3MJHA 3LFUA 3M4YA 1NVVR 3BH0A 3FB4A 4MYUA 4C0LA 4QHSA 3VNUA 5J4HA 1UEIA 2PEYA 2ANBA 3FMFA 2C9OA 4IDOA 4WZ6A 3UMSA 1GL9B 4JZKA 4RCYA 4F91B 2OFOA 4KU4A 4OHXA 1CIPA 4IOJA 2CLCX 1KO4A 1NVVQ 1N6HA 3P20A 4NCIA 2A5JA 4NHOA 3B9QA 2FSHA 4PC1A 2ZE6A 3QF7A 5FL7A 1NF3A 1BIFA 4HATA 1CU1A 4YMVA 5HPYB 2OM2A 1IJEA 4AKGA 1S3GA 3NH6A 5IT5A 1M6NA 3TUZC 1G20E 5EUQB 1BOFA 2J41A 3F3YA 2JA1A 4ABYA 2WJYA 2FE4A 3L0PA 3AF4A 2OBMA 4MUAA 5EUMA 2C96A 1T8UA 4P0TA 3ZGXA 1WRBA 1KJZA 2IUTA 2VLIA 3L2OB 5HCIA 5TXGA 2QQEA 3HP1A 4NYIQ 2BWJA 1G17A 4I1VA 3TSZA 1DELA 2FFAA 2H18A 4TMWA 1W0JD 2FN4A 1E2GA 2ZRMA 5ELXA 4WVFA 3O8BA 4PQFA 2EFEB 4M22A 1E32A 1XWIA 2WWGA 3BB1A 3ZVRA 5FOWA 3L8YA 3RSLA 1SHZA 1E79A 2Z43A 1P75A 2KI5A 3EWSA 4PSVA 4NYJQ 5JWHA 4XIGS 3DEFA 4GSYA 3LRPA 5JJLA 2PJRA 3ZIAD 2ZAMA 3PG5A 3K09C 4G5OA 1XD2A 4RCZA 5DIFA 1KO8A 1S0UA 2SHKA 2YNMA 3T06B 3ZD7A 4BFTA 1VMAA 1GFIA 5FFMA 1Q0UA 2HT1A 2ZYUX 5C4GB 1JALA 2IEYA 4OK3A 2OUKA 1AQYA 2C98A 4PZZA 4B2IA 4CEIA 4JLPA 1W0KD 3SHFA 4JSYA 3PVSA 3AVQA 4WW0A 4YQFA 3UMFA 4B43A 1BMFA 4P32A 3ZJYA 4G5QA 1DAEA 1M7GA 4IFBA 4OKSA 1AQUA 2RAPA 4HYYA 1OXSC 2GNOA 2WPDA 1D2EA 1SXJE 1Z06A 3LQRA 4TYNA 3QPWA 2E9SA 2RGEA 3A58B 2VEDA 2B8TA 3L0SA 3RRNA 2P5SA 4W5WA 5KDOA 4LYHA 3EX7C 2YYZA 2QUZA 5FTLA 1I4DD 2GBLC 1NN0A 3EA0A 5HE8A 4IFEA 2N46A 3V4RA 2XOKA 2YOGA 2IWRA 4JLMA 4PSAA 1WDTA 3DMNA 5JCPA 4E22A 1UKVY 1DARA 1QG4A 2CLSA 1XEWY 2ORWA 1KDPA 2RMKA 2W83A 2ANCA 4MKIA 3J81k 3EW9A 3B1WA 1JAIA 1IN7A 1Z5ZA 4QBHA 2G9NA 2NZ8A 2PX3A 4MYCA 2RHMA 5JRJA 4CEHB 2GRJA 4FMCB 2ZVQX 2QE7D 3BAFA 1W46A 1E2KA 2J0UB 3GMTA 3KB1A 4L9WA 2J5XA 3DVLA 1Q1QA 4KV9A 1T3HA 3CNNA 3OEHA 1NLYA 4YDHB 3AM1A 3KB2A 2GCOA 4IVRA 2ZU6A 1L4YA 4BE7B 1FUUA 2IL1A 3Q7QA 5TVKA 3I61A 5J4VA 4CW7A 3TUJC 3NHAA 1E2JA 1W47A 1HA3A 4DDVA 3ADKA 5BN4A 3CR8A 4G5GA 5FUWA 4PC3A 3I8XA 3H1TA 5EE1A 3CX8A 2JLVA 4G1UC 3B1YA 3H0KA 4AURA 2O5VA 1E94E 1S9HA 1FTSA 1DAMA 3X1ZA 1NIJA 1G8FA 4PSKA 4ESVA 2O8DB 3EWAA 3H84A 3SDZA 3MFYA 2H57A 1KAGA 4Q4LA 4CIDA 3W90A 1QHXA 1GL6A 1U81A 1M7BA 1RJ9B 2QM8A 2D2FA 2XAUA 1KSGA 2ZR0A 3FKQA 2D62A 4ZCLA 4NCNA 1TQ6A 4Q4HA 2CXXA 3RLFA 3LDAA 5KSZA 4PO1A 1Z08A 4P4UA 1HTWA 1ZUHA 2B7CA 4A8JC 1JXMA 1ESMA 3LO5A 5EP4A 3FOZA 3WNDA 5D3MA 4B33A 1P7CA 4DJTA 4D2IA 3CZPA 1KSHA 2WMOB 4Q9JA 3NH9A 4AWXA 1YR7A 4DIDA 1SKYE 1IOZA 3PEVA 5FBLB 2O8FA 4PTLA 121PA 1YE8A 1BKDR 3PUVA 2J0UA 2PX0A 2JJ1A 3TQFA 3W6NA 2QBYB 3NC1C 3LH5A 1G1MA 3GLFB 2WMNB 2GF0A 3QKSA 2ZS8A 3CF6R 1IJFA 4JL5A 3QI2A 1EWRA 1IHUA 3RC8A 3DKVA 5DN6D 5SZIA 2AR7A 4FMBB 3A37A 4M1MA 2DY1A 2W6IA 1W4BA 2CEAA 3RS3A 2BEJA 2BVNA 2C9YA 2RB4A 4HLQB 3U2QA 4A6XA 3K1JA 1Z63A 3QPUA 3BORA 4M1TA 1N0VC 1U90A 1J90A 2NO7A 4BLSA 1W1WA 3PENA 3Q9LA 2B8WA 3B13B 2BMJA 4F93B 3TNFA 2CL7X 4EFLA 5G41A 4PC7A 1CXZA 4C7OA 2QPAA 4LJYA 4ZDKA 2GZHA 1YRAA 4B2LA 1OH8A 1JXOA 3EZ2A 1FUKA 4TSFD 1Z07A 5AWFC 1UBFA 2HUPA 1F6BA 3U4QB 3BIFA 1GKUB 1JEDA 1NN5A 3B82A 4URUR 1C9KA 3CPHA 2DWPA 3QG5A 2XJ9A 3CPJB 3ZZUA 4XWAA 4KODA 1GTVA 5C1BA 3LLMA 4JL8A 5LB2A 3KQNA 4FWIB 2BMEA 2ZJBA 4DDTA 2QNRA 3WXMA 2R44A 3PFIA 2KSQA 2Z4RA 1HY3A 4DLRA 5JECA 5J4LA 3KQLA 1FX0B 4JT4A 2AXNA 2YV5A 4LJ7A 1TQDA 1OH7A 3QKSB 4S35A 2FWRA 4BZQA 1JI0A 3D3QA 4TWZA 1KI6B 3D7MA 2A3RA 1HQYE 1TTTA 1BO6A 2C95A 3FMIA 4JS0A 3REGA 2O8FB 5CK5A 1G3IA 1E2DA 4P3YA 1AZSC 1FQJA 1MR3F 2XNDD 3B9PA 3QXCA 3GLFA 2QT0A 1II8A 2WPDD 3QXXA 2PJZA 1XCPA 1VHTA 3V00A 1Z0DA 4BFSA 5CM8B 3DZDA 2HEIA 5DI9A 3QEOA 1Q22A 2HYDA 5GJVC 3RANA 3FE2A 1RRPA 3AVXA 3EXAA 1A5TA 4LYFA 4A0FA 3DDCA 5G40A 1AK2A 2ZJ2A 1DOAA 1KAOA 4Q7MB 2ECKA 4RKEA 5CDFA 3ADDA 1XEFA 5FI1B 3O8RA 3BE4A 1M74A 3SHWA 5IF9A 3BFXA 1BH2A 4S2EA 4TL9A 2JDID 3FHTA 1XD2B 1DVRA 3KFXA 5BWMA 1H8HA 1IONA 1IBRA 3NBFA 1G64A 2VA8A 421PA 3PUXA 2BCGY 4DEYA 1GNPA 2J46A 1HV8A 3QXJA 1WP9A 4F7WA 3TH5A 4QHTA 1ZC4A 3AF0A 3R9WA 1NG1A 1R10A 4TSFA 1W5SA 1YQTA 1ZU5A 2VF8A 1TEVA 5KUTA 1WB9A 3L82B 2XB4A 3MWJA 4US2R 1EG7A 2G6BA 1S8FA 2F9LA 1GG2A 2QRNA 4QG7A 4AI6A 1M34E 4ZKEA 1G9XA 1XJ0A 2XNDA 4IKEA 1RE0A 4F4CA 4Q48A 1US8B 3F5FA 4OI2A 3LY5A 4XVQA 4LHZA 1SGWA 1KI4A 1XTRA 2OCAA 4MRVA 5EP3A 4CDGA 4ARZA 2J7PD 4D25A 1NBMD 1T4GA 3THXB 3IBGA 4I1SA 5KNCA 3FWYA 1EFHA 2B92A 2BC9A 2PCJA 3EZ7A 3QF4B 2R62A 3EC1A 1QHSA 2GZAA 2QP4A 4HLCA 1LS1A 1RW4A 1KO5A 4QM7A 1VG1A 3W8RA 4DB2A 1OT3A 2IYWA 4TT3D 5DSZA 3ZZTA 1LV7A 4DKXA 4QFMA 2IW3A 4ZCMA 4NL4H 5SZJA 1VCOA 2I3BA 3BH6A 1JJ7A 4QJ4A 3TSOA 4YONB 3EAQA 4V0OA 5FL3A 2BBOA 3S1AA 3OHMA 1A7JA 3EPLA 3ICQB 3I5XA 2TMKA 2VP6A 3B1XA 4ASUA 4LY6A 3IQWA 4Z1MD 4E03A 2QTFA 1LW7A 3ZVMA 1NSTA 1UBCA 2HCBA 4Q9HA 3BB3A 4LHVA 4DUGD 5JBQA 1KO7A 3ASZA 4RZ2A 3K70D 3SQWA 2FFBA 5FPHA 3BH7A 2QZ4A 2A30A 3ZS8A 3LW7A 4TYPA 4N3NA 3PV0A 1XTQA 1E9SA 1ZM9A 3GLHE 1E2EA 1KHTA 2GKSA 2HXSA 1UF9A 3EC2A 5FPKA 4M9QA 3F0TA 2O8EA 4GPTA 1W4AA 1GRQA 2QPTA 1XX6A 3UATA 1ZUNB 2FX3A 5KHOC 3CBQA 2QU8A 3A1SA 2OE2A 3P1JA 4OI0A 3KXKA 2ZVPX 1F5NA 2A5DA 3KX2A 4AYWA 2O0HA 1I4LD 1QHIA 1VDZA 3U6KA 3GJ0A 5A0FA 3E5HA 2N1BA 3TR0A 3WNBA 1DTSA 1RC8A 2J59A 3MRSA 5BYJA 4MDFA 4M9SA 3GLGB 5TDHA 2WZQA 5CLQA 4LJAA 3THOA 4BECA 2J7PA 2WWWA 3GJ8A 5DYGA 2QEQA 4TQAA 1JR6A 3SYLA 5BQ5A 2G3YA 3CKLA 4JJZA 5KDLA 1OHHD 1M2OB 1S9DA 2WICA 3P32A 5G3YA 2VSXA 2AKAB 1CBUA 5C18A 4A0GA 2OFXA 2QTHA 4PR0A 5TB5A 4BQSA 3GFPA 3K0EA 1FPMA 3KTAB 4V03A 2EW1A 3WHLA 5GVSA 4Q1DA 2IT1A 2XITA 3THWA 4IEEA 1VG0B 1CR1A 1UKZA 3R9IA 1ZINA 3GJ5A 3U3RA 1P9WA 5E3HA 5JCZA 3FMOB 3U7EB 3HPQA 1P5ZB 3T15A 1SVSA 4Z54A 1EFCA 3QG1A 1L4UA 3SJZA 1KY3A 4RZ3A 4RD4A 1JQJC 4URZR 4N0EA 5HTKA 3W5IA 4LJ4A 1T0HB 1MO4A 4CT5A 4LBYA 2CHVA 2J1LA 2W2VA 4B3XA 4CEHA 2ZEJA 1KDRA 2IXEA 2Q9BA 2OBLA 5JHGB 1J99A 2OFWA 4GOKA 1P62B 1TAGA 1TF2A 2GCPA 3UKDA 5FOTA 1NNEA 1YJ5A 2GCNA 2D06A 2IF0A 2WJGA 5DH9A 2QN6A 5J4YA 5F2EA 4B3FX 2GEDA 4GBMA 2VO1A 3IIMA 4I1OA 3AKYA 4QGFA 2OXRA 1CULC 2IYRA 3NDPA 3LNCA 3OZXA 4D0NA 4NBSA 5FOXA 4JLAA 5KSOA 1UJ2A 2HJVA 3K0AB 4GL2A 4M1WA 2CJWA 4DHEA 4Q4JA 4OJKA 4R2IA 3LXRA 3KTAA 2CNWA 1GWNA 4HUQB 2J3EA 1ZUIA 1T6NA 2UKDA 1FP7A 1OYWA 3EZ6A 1ZAKA 3I72A 4LC0A 4NCJA 1E9EA 4KFUA 4IW3B 4Q5IA 4IDQA 3KJIA 1EFTA 1Q3HA 3K9GA 3NBYC 1TX4B 3P4YA 4HDCA 2ZRPA 1IXRC 2H92A 5KSYA 4KFSA 1E0JA 4AKEA 5KTYA 3A8TA 1RYHA 2RH5A 4LV8B 2JCSA 4NCKA 3ECCA 2GVDC 3CH5A 1KI1A 4ZDIA 5G53C 2GBLA 1LVGA 2AXPA 2ZRGA 3SE0A 4KFTA 1TMKA 3TQCA 1DG1G 1MV5A 2C5LA 4BZPA 3ZQJA 1FZQA 3TW8B 1N5JA 4DLSA 1XZQA 2XSZD 2IF2A 3KXIA 2UZ3A 1KI8A 1QF9A 4Y0AA 1GZSA 4DDWA 2AWNA 1WE2A 2BBTA 3ZD6A 4B44A 5J47A 1CLUA 1D6JA 1HUQA 4B3DA 3HYRA 1NY5A 3ZLJA 1O3YA 2WV9A 3BOSA 2QL6A 5E7MA 1E2FA 4FW9A 1JJVA 2X2EA 4ZKDA 1P9NA 4JKIA 4KITB 4US0R 1LTQA 2JLUA 5AJXA 2RKOA 2G1KA 2A5YB 4TMVA 4LHWA 4GI7A 4MUBA 3REFA 3N2IA 3KKMA 1PLJA 1GILA 2FFHA 1X86B 3UMRA 3C7KA 3TW4A 1ZNZA 1RKBA 3GEIA 1A2BA 3A1VA 4P31A 1OPXA 5HE9A 2HYIC 1AJEA 5FUVA 2F1JA 1FMLA 3IIJA 1KMQA 4OL0A 2O8BB 3IHLA 3ND8A 1ZC3A 4JBWA 4KSBA 4W5JA 3CRW1 1P2TA 3QKTA 1CKEA 2VYFA 1DAHA 2ODBA 3SN6A 2W2TA 4YMSA 5BN3A 1JQLB 4PHHA 5FL7D 5KSPA 721PA 3GJXC 5AR1A 4DWJA 2EWVA 1P2VA 4HLDA 3TLXA 4NCHA 1E99A 4GMDA 4MRRA 4GDFA 2ZUDA 4G3XA 2G0NA 2EFDB 4F38A 1E1RA 1ZNWA 1CJKC 3O47A 1R5BA 3QEJA 1G8YA 3CF0A 3HWSA 3WYFA 4DT1B 3QOFA 2DFLA 2GXSA 1SVMA 2ZIAA 1OKKD 1ZVQA 3CZQA 1OLOA 2CLDX 3AF1A 5FBWB 1QVAA 1I2DA 4M2LA 4QGAA 3WRXC 3KJHA 3U3KA 3MAAC 4D6PA 3AUXA 1PLKA 3I3SR 3VX4A 1SQ5A 2CNWD 3EIHA 4Y0VA 1GP2A 1OE0A 5DI3A 4B35A 1G5PA 5FTNA 5FPTA 2IS1A 3L43A 2G0TA 1ZM3A 3FHOA 2K5UA 1PZNA 1D9ZA 1E2QA 2Z83A 3OEHD 5SZHB 3SYNA 1X8KA 1LB1B 3A1TA 3MWKA 1RFLA 2ZRCA 4ZIRA 1MABA 2J0SA 3W8NA 4X8HA 4LOAA 1ZD8A 5IRCD 3LW8A 2AK3A 521PA 3SI7A 3R20A 3AKCA 3UG7A 5JRZA 3LXXA 1DBSA 4D80A 4B76A 2IYXA 2ZI6A 4TLBA 1U98A 5FBVB 1E4YA 2V6JA 5F3WB 1NBMA 1QG2A 4G5SA 5TV2A 4URWR 3AP1A 4WBSA 4CF7A 1G5TA 3ZS9A 4QNMA 1N0WA 2ATVA 4K8OA 5FTKA 2P0EA 3KKOA 4C3ZA 1MKYA 1OSNA 4JLNA 4I4LA 4FCTA 3OF5A 3K70B 1SVOA 2YHSA 4V0KA 3CRVA 1LF0A 4WA7A 1N3BA 1Z8FA 3OIYA 1V43A 3ZH9B 1YZGA 2P3SA 3PITA 4H1VA 2ZJAA 5JI3E 3C5CA 3ZDQA 3M6AA 2HF9A 4FXPA 1S3SA 1ZM2A 1KI2A 1R5OA 2VPPA 4R7ZA 2GJSA 1OB2A 3VMFA 2W6ID 3DO6A 4UXHA 2WM9B 3QKUA 4RKFA 2XXAA 5B64A 4A2PA 3BXZA 4HLUC 3CW2A 2NO9A 2ZSDA 1RRFA 1U0JA 3UWKA 3IPYA 2IXFA 5FUYA 5P21A 4D26A 2ZSBA 2I1VB 5DI3B 4M21A 2WIBA 4LJ8A 3MWYW 1KK1A 2GEUA 4MYTA 4LGMA 1KMHB 2OAQ1 2JEOA 1KNQA 2IYYA 1JNYA 4BASA 3LBIA 2GDJA 3MLEA 2XZPA 1ONBA 1XBTA 3HDTA 4EJSB 2GESA 1N6KA 2QTVB 4II7A 1QHHB 4D82A 4FCWA 4NPHA 1N0UA 621PA 2E1RA 5JHHB 2GK7A 1E2HA 2B6HA 2OG2A 1OXXK 3MG9A 2RGCA 2FSFA 1E1QD 2YINC 3ND9A 4HLUA 4M8NE 4PAQA 3MUFA 3NG1A 4MYHA 2EWWA 4Q01A 2GJKA 1OFHA 1NJGA 3LQQA 2DWOA 3EIEA 4QGGA 3H2YA 2HXYA 3NBZC 2JAQA 5CIQA 5EE5B 1E2MA 2C78A 2I1QA 4HAUA 4D81A 3I1FA 4LUCA 2WSSA 5TY0A 4XD7D 2BM0A 2REXB 1Z0IA 1Z47A 1Q3TA 5DYIA 5L3QB 3THYB 5J5CA 3T1QA 4BLTA 1Y3AA 4EDHA 1XDBA 3P27A 2FJUA 3BFVA 2P6NA 2RGGA 3FKSD 3FTQA 5FOUA 3EZ9A 2ZYTX 2JIZD 4PHTA 3KJGA 1VKJA 2ZSFA 4CYMA 1AKEA 3UWOA 4X8LA 4M1KA 4Q21A 1XP8A 2V6IA 4KYUA 4TLAA 4TYWA 4UJ3A 1KJYA 2PZFA 3K8YA 1TF5A 4ASUD 4LV5B 4O3MA 2VP4A 2QAJA 2VSOA 4XTCS 4LV6A 3T5GA 3KZ1E 2DBYA 2W58A 1Q21A 3F8TA 5DO9A 2WJVA 4JKYA 3U7GA 1OV4A 1WQ1R 1D2NA 2A9KA 2GHIA 3QBTA 2NO6A 3K0SA 4WZAE 4HAYA 3NXSA 1RRGA 4MRSA 5IK2A 3RWOA 3VHLB 1H65A 1KSJA 3I62A 4MH0R 2ZE5A 4AKHA 2OHFA 2OLJA 1YU9A 1WF3A 3GLHB 4M1YA 1UADA 2VHJA 4EPWA 2X1VA 2O8DA 4NP6A 1G3QA 1W36B 3GJ4A 3NBXX 1BYUA 1SHKA 3X1WA 4J0QA 2AHOA 1NG9A 3L0OA 3DL0A 1ZD9A 2CCGA 2Q0HA 2R6GA 1AKYA 5EP1A 1EWQA 3AKEA 4UNSA 1MO3A 4W9MC 2OCPA 4URXR 3K70C 3QSYA 1NVUQ 2IYLD 1WMSA 2BJWA 2LKDA 2P65A 2QY9A 4B32A 1J7KA 2ZI5A 1XZPA 3VR5A 4E5UA 1W49A 1G7TA 2XTNA 1JPJA 1KJWA 5D3MB 4RD3A 3RS4A 2ZRAA 2R2AA 3CB4A 4EUNA 1KYIA 3KJEA 2WIAA 2OBNA 1LFDB 4AYTA 4X8OA 2XTMA 3PJRA 1LNZA 4LZZA 1DAGA 5E7IA 3LD9A 5L3SB 3LLUA 1NMZA 2W0SA 3W5JA 3ADBA 4NTZA 3QPVA 1B23P 4TYYA 4OQLA 2WAYA 4YMTA 1YHNA 1P4SA 4P4SB 4B74A 1OB5A 3UANA 3OAAA 2JLZA 2B21A 4EPRA 4BFUA 2W2XA 4F92B 1YZQA 2QP3A 1U94A 2ZUCA 4Q18A 4PAMA 4XSHA 5SZKB 2FOLA 1C1YA 1P2SA 2W6JD 1ZM7A 1IQPA 2C9CA 3LX8A 1YR6A 4HZUB 3SOPA 4BFVA 4NDZA 3QVVA 2QBYA 2O8CB 1XEXB 2HJGA 3AVOA 4MQBA 3SU8A 2GZDA 2FPMA 2NQ2C 3MD0A 4JLVA 1MO6A 2CL6X 4JLJA 4MRPA 1JB1A 3SJAA 2ZRLA 2DFKB 2H7VA 2CHGA 2GF9A 2ZRNA 3AB3A 1R6BX 3VHXA 4B48A 5HR5A 3RS0A 2Q3MA 1R4AA 2CK3A 4CT4B 4B6EA 3U3OA 2FSIA 1Q1ZA 1EK0A 3QY0A 1QVRA 3TIFA 5F9FA 1R5NA 3NVAA 1N5LA 2D74A 3R9XA 1NSFA 1CRQA 2YWHA 4Q1BA 5B57C 3RNLA 4ILEA 2FGJA 2GA8A 4OHVA 4HUQA 4Q4AA 2JLQA 1KI7A 1E2LA 4NU0A 3L0IB 1Z0AA 2WWFA 3K0AA 4DBLC 2NMVA 1E4VA 1U99A 1T8TA 2Q6TA 4IOMA 4UJ5A 4QGHA 1S96A 2XNSA 1X3SA 1VIAA 1R8SA 2DB3A 4ZI3A 2F6RA 4ACBA 2O8EB 4JLKA 2CVHA 2QQ0A 4MKFA 5DISB 2V9PA 2O0JA 4DDUA 1Z28A 1XRJA 3DHWC 1QBKC 2BBSA 3TE6A 3DMDA 4QBIA 1Q57A 2IX3A 1XPRA 1UDXA 1N25A 1CTQA 1NN1A 1R0ZA 1XTKA 2DR3A 1OXTA 4NYIR 4WOPA 1KY2A 5AK0A 3AF2A 1KSFX 2C8VA 2NTYC 4KVAA 4CEJB 4JSTA 1COWA 1Z6YA 3CONA 4OK5A 4OQMA 1OW3B 4O2RA 2IC5A 3U44A 3K0FB 5C2JB 5CDFE 1OFUX 1EGAA 1NVXQ 4I81A 2BOVA 5FOVA 2NO0A 3W3ZB 1IXZA 4ZV4A 3TJZA 1K6MA 3ZZ0A 2KJQA 4LHYA 2D3WA 3TKLA 1GAJA 2H8KA 2QORA 4MKGA 4DXAA 2QE7A 3RYTC 2OT3B 1HT1E 3R7WA 1XEXA 1A1VA 1PUIA 1G18A 2WBLC 2VTKA 1N6LA 1NMXA 5L3VA 2YWGA 2MSEB 4WXPA 1OXUA 1UKYA 1Z3IX 4P4TA 1TPZA 4X8MA 1GUAA 1CJMA 1N6RA 2YOHA 4FMDB 4Q9LA 4PXAA 1P73A 1JAHA 4YMWA 4FMDF 2QMOA 3SS8A 4Q47A 2ZJOA 3FFBA 4TQUS 2GJAA 2PT7A 3LWNA 4QC2A 4Q19A 3GP8A 3K0FA 1UEJA 1KOFA 3Q72A 1KZ7B 3CWQA 4RSGA 1TU4A 2VP0A 3Q85A 3RHFA 3SZRA 5JSZA 1E3MA 4B3BA 5GJBA 2RGAA 4Q4HB 2WJJA 2ZANA 4M53A 2C99A 4DLZA 1NRJB 3A6PC 3H86A 2EYQA 1IN4A 2XTZA 2V7QA 3B60A 2WTUA 1DS6A 4YXWD 3WYGA 1ZCBA 1QHGA 3B78A 2ZJ8A 1XXHB 5AJYA 4BFXA 3HU3A 3QKRB 4UQOA 3W9YA 3UXMA 3CRMA 5H8WA 1KK2A 2ZAOA 1A2KC 3EIQA 2G88A 3EG5A 2ZJYA 4R9UC 1G4AE 1OXVA 2ZXUA 1U8ZA 1FFHA 1YZKA 4YC7A 2XSZA 5EE3A 1ANKA 4EIWA 3A1UA 1HE8B 2IUSA 3GCGA 2WWXA 4NH0A 2GTPA 1PV4A 2OEPA 4V0MA 1G6HA 1TUEA 2IEZA 2BV3A 1LF5A 1GM5A 1W5TA 5FPYA 1G8PA 1CJVC 3BS4A 4AIIA 1VCIA 1NLZA 1RRCA 3NIBA 5UKDA 4G01B 3B1VA 3PCRB 1E0SA 3K9HA 4NYMR 5FR1A 1VYUA 3OIUA 1J8MF 3I5YA 2MSCB 2IS2A 4WZBE 4WAUA 2EYUA 3S1AB 4EQ6A 3B85A 3X1DA 1R8QA 1T3LA 3E2IA 1E9CA 2BIFA 1ZYUA 4JVLA 1SXJB 4EFNA 1EESA 3WMEA 5CYOA 4B3GA 4QOSA 4TL8A 3QNUA 4NE2A 1VCMA 3AQ4A 3RRMA 2OCYC 1LS6A 2QGNA 2QSYA 5FBRB 3TVTA 2RGNA 3C4JA 1PLLA 4GMXA 4ZCIA 2VRWA 2XJ4A 4PPQA 3WRYC 2R65A 1JBKA 4HDOB 3VKHA 5JS7A 2NO1A 4E07A 4YDSA 1W36C 3E70C 4CGZA 1CR4A 2LCFA 3C15C 1GOTA 4HAWA 4NZYA 1NP6A 3BB4A 3EPKA 4B71A 2BDTA 3JVVA 3OFND 4TLDA 1XNJA 3GLHA 3AVWA 3VR4A 1J8YF 1NIPA 4Q9KA 3V9PA 3H4MA 4BFZA 1DG3A 1G7CA 4JVNA 1QHNA 1T0JB 2GAAA 1BMFD 3IBYA 3DOEA 2V4ZA 3BK7A 3I73A 5G3ZA 2ZM5A 4U02A 1JECA 4EKDA 1SZPA 4JYCA 4C0BA 1W7AA 1TL7C 1XEWX 1FL9A 4AYXA 2EFGA 3C8UA 1YZNA 5CM9C 1N6IA 4XWKA 1QHHA 3I8SA 2F1IA 4OI1A 2F43B 3ETLA 3GLGE 2FG5A 2GEVA 4KAXA 3MMPA 4Z8YA 4D4LA 4ZDJA 5KNBA 2QA5A 1HT2E 3G82C 1NKSA 1XFAA 3WMFA 4PC6A 3EPJA 2C77A 4KLZA 3RS2A 1N6OA 1R2QA 3B8HA 4XSGA 1IXSB 2CL0X 5DNYB 3GLFE 1AM4D 3LA6A 1X8JA 4QJ3A 4KXFB 4D0GA 5K8UA 2PEZA 1S1CA 2F9MA 1NI3A 4O25A 4PQYA 3BRWD 5EXSA 2CBZA 3GFTA 1X8LA 1Z2AA 1IY1A 2W0MA 3FMPB 3MCAA 3T12A 4IOKA 4N0DA 4Q4AB 3ADCA 4DLYA 4A1FA 3RRYA 3SJCA 4EAQA 3MSXA 5DLQC 4FD2A 4A6PA 2FSGA 3GLGA 1E1RD 2B7BA 3RAPR 3U44B 3T61A 1XPOA 1JR3A 4TZ6A 1ZP6A 4DCNA 2BMFA 2X8AA 2A7QA 3FDIA 2J45A 4JBXA 3QENA 1G7SA 3WYAA 3CNOA 1OJLA 3T1VA 1UAAA 1TNDA 4TMXA 1Z0JA 2REOA 4DCTA 4QXAA 3AV0B 1AS0A 1KK0A 1H8HD 2HV8A 4D4JA 3GLIE 2V3CC 4RZXA 2BJVA 2X2FA 4C9BA 1TU3A 1J70A 1XMSA 1KIMA 4V0ME 3VU9A 4DCUA 1VCNA 1OIWA 2PZEA 1R0YA 3FFAA 4LRWA 1S1MA 4O2LA 1MH1A 3TMKA 3PEYA 2RGDA 2IS6A 1B0UA 3QF4A 4C0SA 4WXRA 1VPLA 1A82A 2ZSEA 1X1SA 2CMKA 4IEIA 1ZBDA 4Q9IA 3THXA 1T91A 1EX6A 1ZRHA 4ARZB 2VHUA 2VSFA 1V5WA 2KWIA 3CNLA 3D31A 2AKYA 2QPOA 2WKPA 4DC9A 1W2HA 3K0CA 2Q3FA 3CX7A 3DOFA 2QG6A 3LVRE 1ZW6A 4F4IA 4LJ9A 1NL3A 1FW6A 5CJ2A 5KDDA 3OEEA 5JJIA 4A0HA 1COWD 2PMKA 3K53A 5L3SA 4BEJA 2X19A 3AF3A 2F43A 4LWZA 1W0KA 5TARA 3ZVNA 5JZVA 1AA9A 3I4LA 1YR9A 1FOEB 2NGRA 1FTNA 1LY1A 4BFWA 3BGWA 2JDIA 5IK2D 1S4QA 2DWQA 3W3AA 5GJCA 5LD2B 2V54A 4MGYR 4PC2A 2BCJQ 8OHMA 2EFHB 1G4UR 3C41J 3RVBA 3AVYA 4OHWA 4U5XA 1KDOA 4D4KA 2OSBA 4L5BA 2QRZA 4C4PA 2CK3D 2R6DA 3VKGA 4BEBA 4ZO4A 4AG6A 3IIKA 2QT1A 5HKKA 2WKRA 1FMJA 1G7RA 1OYYA 1QZXA 3PEUA 3X1YA 4AC9A 2DYKA 1SKQA 2RGXA 1DADA 4NMMA 5CITA 1G5RA 2G77B 2ZYVX 4PQRA 4FMCF 1KNXA 3GFOA 1XCGB 3VU9B 3Q5EA 3AKDA 1Z2CA 2VQSA 4MDEA 4POAA 2J0QA 2R6AA 4RZUA 4YXWA 1EFRA 1YKSA 5HKKD 2ZRFA 5BYKA 4PPFA 3CRQA 5IDVA 4O0MA 1SXJC 3VR3A 2JJ2A 4JYBA 3GEHA 2AK2A 1XMVA 1UBGA 4V0NA 4ITRC 5E7JA 4NYJR 3CF2A 4GNKA 4DSNA 3OIWA 1D8TA 3OE7A 4FINA 1XJQA 1N5IA 2W6JA 1G16A 1GIAA 4PO9A 2IWHA 2ONKA 5A5GA 3SFZA 5F98A 3RRZA 4IXMA 2JLWA 3KL4A 5B2ZA 4ON9A 4Q7LA 2RCNA 1VG8A 5L3QA 3PUZA 4I99A 2REBA 1U2RA 3QIAA 4L9SA 2W00A 4TMKA 4FWTA 2FMXA 1G8HA 2ORIA 4BWYA 4KO8A 3KQHA 1Z6GA 2ODEA 2AL7A 2ZROA 3KQUA 4UNQA 3P26A 5IHPA 2QMEA 3K9NA 2OO7A 2ZU0C 3AP2A 5EXTA 3T1OA 3U7FB 3IPXA 2HDNB 4HSEA 1E9RA 4HDQB 4IHQA 1C4OA 2QAGC 5AUQA 3TK1A 3Q8XB 4UNNA 2ZRIA 4Z8XA 1IN6A 1E98A 2BKUA 2ZSAA 4EPXA 2XOKD 1VYTA 1E96A 4URYR 3KUCA 2GAOA 1XMJA 2PBRA 2UVQA 3FYHA 3QVUA 3TRFA 2A2ZA 3C16C 1Z22A 4IJMA 4DRZA 4URVR 4XOIA 4A92A 4BRWA 4A8JA 4AY2A 1N6NA 4ZIRB 4R71A 5JJKA 3IHWA 4XWOA 1ZMXA 2IS4A 4TL6A 1ELOA 4M9ZA 1G19A 2O0KA 3A4NA 5LDDC 3KQKA 5JWRA 2E87A 4DB4A 4DSOA 2KE5A 1P2UA 4R2HA 3U4QA 1D2MA 3VKWA 1EFUA 3OESA 1FNNA 5HZKA 4OYHA 3B1ZA 3M1IA 4PPGA 4PX9A 1XXHE 4W5HA 2ZRKA 3GPLA 3O8CA 1PJRA 1IM2A 5EJEA 2GILA 3SEAA 3PQCA 4G5RA 2CDNA 2Y8EA 2JIZA 1VG9B 4UNPA 5D3QA 4MA4A 2XZLA 3ZVLA 1BYIA 3EPHA 4FN5A 4GOXA 5GVRA 2HCJB 5EXXA 5JSZB 3PR1A 2OILA 1WBDA 1JR3D 1KI9A 2RHDA 2DFTA 2QI9C 1KKLA 3SFVA 1Q1EA 1ZM4A 2ZI3A 2C03A 2HT6A 3RC3A 1WCV1 2G83A 4HB2A 3JVUA 1E2PA 3V4FA 4DLTA 1G41A 1E69A 1TQ2A 3K9LA 1SVIA 1U9IA 4BUJA 2AX4A 3GLIB 3VFDA 4DVGA 1W4RA 1VHLA 3AEZA 5CYPA 4LYAA 4NYMQ 2VHQA 5C46F 2YVUA 1NBME 3DPUA 4AD8A 4KCGA 2FH5B 4Q1EA 2FF7A 2CJWB 2GETA 4HAVA 2ZRJA 3NWJA 4IXNA 3MGCA 1GL7A 2GJ9A 2KBFA 3AH8A 5DGXA 1KK3A 4JMPA 1DAFA 2IYZA 2D2EA 1YZLA 1UBEA 1L7VC 1DAKA 4LK2A 4QJ5A 4JT2A 1E9DA 1QRAA 3RS5A 4LYJA 821PA 3AUYA 2IHBA 2ORVA 1XXHA 2D4HA 1U9IC 4DCVA 3X2SA 2VHTA 4OQNA 2ONJA 2MMCA 2AD5A 2WJIA 1Z6TA 3HR7A 3MWLA 3VNVA 1SVLA 2CCKA 4TLCA 3SC3A 1W48A 1E9AA 2FNAA 5CIWA 1JR3E 4PHFA 3B7GA 4C0AC 2ZE8A 4M4SA 1ETUA 3WBKA 4CZ2A 1NY6A 3KKNA 4HZIA 2XXAB 5H68A 5JWOA 1R0XA 4RD2A 3IUYA 2WWIA 1HEIA 5EE0A 4HZUA 4M0LA 2P2LA 2QMUA 2FZLA 4OQFA 1KGDA 1DPFA 4LI0A 2DFNA 2I4IA 2QSZA 3QXHA 2IUUA 1CF4A 4RY2A 3U3JA 4DIEA 4MRNA 5AUPB 4BGDA 3LBNA 3HU1A 4XJXA 1NLFA 3SJBA 3IILA 4OI4A 4CVNA 3I92A 3T35A 4E09A 1P60A 3HR8A 3NKVA 2MMGA 5BXQC 2EVWX 2JASA 2WSMA 4L8GA 2P5TB 1F2UB 1WA5A 2QAGA 2ZPTX 3ASYA 3WNCA 3BBPA 2JGNA 3K0CC 4IVQA 1E2NA 1D9XA 4A82A 4BLQA 5CB6A 2FGKA 3SBDA 4C2UA 3CRRA 1H8EA 3A4LA 2VBCA 1VECA 2Q9AA 2C04A 3BWDD 1TEXA 4TYQA 1Q1BA 4LPKA 4CEJA 3WMGA 1XTIA 1UDWA 2WVJA 2FA9A 3VR1A 2LWIA 2PLRA 2ERXA 1Z0KA 3VAAA 4MKHA 3SQXA 5GJWC 4XH9B 3TSWA 2V1UA 1ZU4A 2G1JA 2OV2A 1VYVA 3HYTA 5TMPA 1TADA 4TL7A 4EFMA 1CS4C 3RWMB 3N70A 4RD0A 2ZR9A 1ZIPA 2VP5A 4LDJA 3A36A 4G0NA 3G5UA 4Q1FA 2J7KA 4UNRA 1NN3A 1RIFA 4UXJA 3OIVA 3DKPA 2BM1A 1ZNYA 3U3MA 2ZR7A 2ZS7A 4LJ6A 1Z83A 2VL7A 1ZD1A 4QKQA 3U6BA 1ZNXA 3AP3A 5CJPA 5EZ5A 4XD7A 5FH9A 1R0WA 2ZITA 2NPFA 3WBJA 4C30A 5KOYA 4M1OA 3UIEA 4FI3C 4JVMA 2RGBA 3KDSE 1W44A 4KJZA 2ODWA 3LVQE 3QQ5A 2IXGA 1US8A 2NPIA 2HF8A 1W36D 4IDPA 4EPYA 3UPUA 3DM5A 1TF7A 2J0VA 2F3TA 4GFDA 6Q21A 2AFHE 4HAZA 4BLPA 1PVOA 3CLVA 1XD8A 2XX3A 4TN1A 3N5CA 2JJ1D 1J2JA 5HZHA 5FR2A 1H8ED 1K5GA 4EPTA 3VTKA 2EU8A 3OAAD 3W6PA 4B3CA 2OXCA
chains in the Genus database with same CATH superfamily
2XZOA 1G8GA 2BHSA 4MVJI 1AGRA 3TG8A 3MWGA 3M5PA 1JG1A 2VF7A 3JS5A 4A3SA 1XRQA 2H1RA 3W9BA 3I2GA 4NBWA 2Q6OA 1GGKA 3ZHXA 1M9NA 1ZL0A 1M10A 3SG0A 3GRKA 3K0KA 3GGCA 1M2OA 1XUOA 4IS3A 3WLHA 3IYLW 5AKIA 3AFOA 3SYKA 2CSUA 4Y1EA 2A0FA 4ER5A 4EMBA 1MIOA 2GXUA 2E3JA 2BKEA 1FDOA 3VV2A 4MZXA 3ZBQA 3PFBA 1XZIA 1BS9A 3WGZA 5B3KA 9MHTA 5B2FA 3MBKA 3MGKA 4WJZA 5BW8A 3CNQS 5EQFA 4G67A 4XTRA 3JSXA 4TZ0A 1VL1A 4P54A 2VT7A 4ENVA 3CO5A 1P5FA 3DFKA 3R6DA 4KQMA 3A06A 3C5HA 1XQXA 1RWQA 2H16A 2WHPB 4B75A 5DEIA 4ENSA 3GN1A 1C7ZA 2B35A 3PUWA 3PXBA 1A2OA 1S8AA 4I4CA 4QGSA 2YWJA 3D8SA 3GOHA 1F2TA 3OP4A 4ZVLA 2FPKA 3QJYA 3VR0A 4B81A 4MVJG 2CHQA 3EA5A 4RTMA 2GN2A 2GCOB 3W4JA 3INRA 1NQVA 4J94A 1CZOA 3SQLA 1I2MA 1JHAA 1SC1A 1T1GA 2WNSA 1SXJD 2Y1LA 5CT6A 3X1JA 4AVYA 2BH2A 2UZIR 1I32A 1K8ZB 2Z2JA 5DCYA 2EX1A 2F1HA 4IGEA 4BN5A 4ZYTA 1YRBA 2BZGA 1QO0D 3N28A 1ADFA 1B6SA 3SIPA 2YXEA 2WQ7A 5FBQB 1IE3A 1IN5A 1VSTA 1Q0PA 2GMWA 4ZICA 3ZZMA 5DNWA 5K8TA 3PP8A 1SIBE 2WTBA 3QBEA 4RHFA 2M6RA 1QIKA 3A1FA 5JBNA 3IOCA 4DMGA 2O4UX 4YV0A 5JAPA 4QPCA 2ZYWX 1U0HC 4PGMA 3ZWWA 3B7PA 1AUPA 3DBLB 4LZOA 4WK0B 3INGA 5EXPA 1CEEA 3GG9A 4BO7A 5KVVA 3EQ7A 4KO1S 2A6PA 4BE4A 5JS8A 3L4BC 1FSZA 4ZANA 2OQIA 3F3KA 4JDPA 3VR6A 4YGYA 3CEJA 2JATA 4CU2A 3WIVA 5K09A 1T0PA 4FJ1A 2IGBA 1MAHA 1EVLA 3WMWA 4MYRA 2YR0A 2O2SA 1CUEA 3DFIA 4JB2A 4EF5A 2R0QC 2IOFK 5DBEX 4LRQA 3QYPA 1YCHA 4GQAA 3PVZA 3KWJA 2RE8A 4HPWA 1CR2A 4KMRA 3W34A 4LJ5A 3DUWA 2CLOB 1TZMA 1M6VB 2VSNA 2BR5A 2W5UA 5F3RA 1GYRA 1Q44A 1VCHA 4PZAA 1USIA 4DLWA 1OC2A 3RC7A 1KJJA 4PHGA 4NR0A 3OLVA 1RAFA 3VAYA 3GLRA 1Z5GA 4ACAA 4DT1A 4EGCB 5G4KA 1RQ2A 4LC9A 4K6CA 2RHJA 1NNSA 4OB7A 2HR1A 2XHZA 1YUNA 1P72A 1X9HA 2HMAA 2AUNA 3H5VA 1N2ZA 1P2DA 2AC7A 4TZTA 2R6FA 2W2NA 3FVRA 5ALJA 4JBYA 5L3RA 7REQB 1LRKA 3GLKA 3IMGA 3O8OA 1T9DA 3GA5A 2CXUA 5GZ3A 2J3KA 5IWCA 3FCUB 3LECA 2D0IA 3GAMA 4ZALA 3ULKA 5CEEA 5E4JA 3AJAA 3DBLA 4NV1A 3M2TA 1SCDA 1OA1A 4PAOA 3IR7A 1H3EA 1JFFB 2ZE7A 1ECGA 1QIEA 2GYVA 3ZCVA 3UHOA 4DZRA 4GT1A 5K8IA 1NRIA 3BDVA 3QWIA 3EXFA 4FEYA 1DINA 3HFRA 4IIUA 4JLDA 1ENYA 2ATCA 2BDUA 2X13A 4WIAA 2ZP1A 4U7HA 5FHQA 3T5DA 4DBVO 4TM7A 2NVUB 4PPYA 4IDCA 4GWKA 3ISJA 3JZDA 4ZOLF 3ZCQA 4QNRA 1C30A 2YKGA 3UV6A 4AG5A 4BDSA 2F67A 2P91A 4FFNA 3EYWA 3PNVA 4IQ0A 3LNTA 5DKFA 3X43A 4ARSA 4FUQA 5KWVA 4F97A 4MPDA 2LV8A 3NPAA 2XE8A 5EE9A 4Q02A 5CXUA 1Z16A 2IEGA 1GRNA 5D87A 2Z2XA 5F7XA 1KEZA 1KQ3A 2AFIE 3EVDA 1T34A 3NHBA 3MQFA 4G0YA 4RIEA 4YRZA 1FNSA 1QYWA 2NPOA 2Q9UA 4XEUA 2IP1A 4DILA 1KO1A 3RSOA 3HADA 1O97D 5AUNB 5CB8A 4S12A 4JIGA 2JHPA 2CMFA 3HYLA 1U8XX 4Q3KA 4A4DA 1KDYA 2QRPA 4CTNA 4MPTA 5CAEA 1ATIA 2CNNA 3K92A 4RD6A 3T7JA 3DNFA 4PG8A 1R6UA 2O06A 2UVPA 4PCLA 1WDWB 2JGFA 2QLTA 4UHCA 1WXQA 3WHKA 2WJ4A 3TF5A 1Z5VA 4EJSC 1RD4A 3PYXA 5BO5A 3WK5A 4CMBA 1SKAA 1YR8A 5AK3A 3I64A 3IAM1 5A9RA 3KSZO 2JEZA 5H0IA 3TM5A 3SZLA 3A4IA 3RKRA 2IYUA 2X8BA 4MUFA 1R0KA 3LCUA 4PFQA 4UUNA 3OFVA 3V2IA 1V8FA 1DRKA 2ODAA 3NKFA 3ZWOA 4B2PA 2JFHA 4HB0A 1L8QA 1C9YA 2PL3A 2WAXA 4EJFA 1DT3A 4DUPA 1LWOA 5LP6A 1VTKA 5E2IA 2F4NA 3DVAA 5CEFA 4B6FA 4RHCA 4ZV7A 4YRNA 2IU0A 4DSAA 1Y89A 5LQNA 4I19A 1YQGA 1VLJA 5AYVA 5ICFA 4CBVA 4X65B 1C9JA 3VDQA 1O77A 2VZ9A 3WNZA 2IYTA 1M7HA 5HCNA 4DCSA 4LZPA 1MXHA 1TZKA 2H7YA 2A5GA 3B3FA 1HT0A 3AETB 2FR8A 1E6KA 4LC1A 4Q03A 1ZA2A 3VV3A 3KSMA 1X92A 4G97A 3AR8A 2P9QA 2PO5A 3GPDG 3N53A 3PNOA 4R7ZA 5FJIA 1USGA 1XF9A 3PWKA 1KARA 1U0LA 2YASA 1QIMA 3HJNA 2IYVA 3OIDA 4LZAA 2GAIA 3D7LA 4JJKA 1U7TA 4U7DA 3ROFA 2GDZA 8LDHA 1OTXA 3M33A 4J1TC 4LXGA 2G9ZA 3U80A 2HZ7A 4IX1A 4LFBB 4FB5A 1SVWA 3WLQA 1WXHA 1D0VA 2JFGA 2BZ0A 3A0UA 3EHDA 5I7RA 3QGMA 1JKJB 2FUEA 3GBPA 4LE0A 2MCFA 4E5SA 3KUDA 1SMKA 3VC3A 2IH4A 2EJVA 3KKPA 1O94C 2JZCA 1IYZA 2WIDA 3BJEA 2WVHA 3KU4A 4UM8B 5DHRA 3MB8A 2EZTA 4L6AA 2ZZKA 2ALJA 3IALA 3TGPA 3I32A 3ZI0A 4IOLA 4TN5A 3S2YA 5EWJB 2AD1A 2FN8A 2NXNA 5DHAA 5F5XA 3PXGA 1CVIA 1SXJA 1UH5A 3FNBA 1RS0A 3GEEA 1FRQA 3QBDA 2XYVA 1E0AA 4D02A 3GNTA 1I36A 3PR2B 4LHXA 4P86A 5IU6A 4WCFC 3IDFA 5AK6A 1QWOA 4OBEA 3W2HA 4FGWA 4H9GA 4TT3A 3KYDB 5ICEA 2R3SA 2HBZA 2FUG1 3PD1A 2HMYB 3D6JA 4LSWA 3RROA 1IDOA 4MVJF 1F2UA 1GXSB 3GJ6A 4M9UA 4WESA 4XCQA 3SR0A 1N2CE 1OIXA 3V7YA 4B34A 1E79D 1ZSNA 2OPBA 2JLSA 2V55B 2X5KO 3HXOA 3FVWA 3KSRA 3P2EA 4JBHA 4I6GA 3Q3JB 5IAOA 4FR2A 3QX7A 4M9XA 1I4EB 4YIHA 4KKVA 3DPSA 1KVQA 4R9NA 3NEJA 4ZOEA 4RJJA 2WHXA 5H59A 2WKQA 3F71A 3TN7A 1XT6A 5CCXA 1U6JA 1JFSA 2NOAA 4LBVA 5GONA 1WWKA 1OTYA 3OA2A 4JJFA 3AVUA 2H1HA 5IZCA 2HTFA 2F3RA 1MDFA 1G3RA 1PS8A 1NP3A 2H7CA 4HR7A 3FZGA 2ZJ5A 2J87A 1FFEA 2XCUA 1YB5A 2H9AA 4KI0A 3PC8C 4WD3A 5TPZA 5FTMA 4G5XA 4BLVA 4E5PA 5JNTA 1F3LA 2WF7A 3GJ3A 3MAGA 4PYMA 4X1OA 1OOEA 3RYIB 1J23A 2VYQA 3U4CA 2AFIB 1U3VA 4N47A 4HB4A 4IRMA 4ND4A 4RAOA 4EQ6B 2EGUA 1Y81A 3L9XA 5ALMA 1N32B 1O6FA 4GZMA 5EKXA 1A5BB 4MTLA 2JJYA 3PEWA 1Q0HA 2FLKA 1XO1A 2VWPA 3IPAA 3K7EA 1ZD4A 3LBHA 5IKXA 1V5EA 2CD7A 2QX7A 3ETDA 4M0EA 3FPBA 4C1NA 2D7JA 1M8PA 1Z8HA 1DUSA 1KI3A 3CR7A 2O9JA 2WFLA 2Z1MA 4DR3B 3H2BA 3QBVA 4ZVVA 4H4DA 1TU0A 3F3MA 2YHAA 1Z38A 2GF2A 2QHXA 2Q4BA 5CDHA 1O87A 2QL9A 5L6MB 1VIMA 2XUQA 2Y66A 4U2FA 4FFLA 1DPGA 1GITA 2CFIA 3HPRA 3KDAA 3RVDA 4OUDB 3GJ7A 4IF6A 3U40A 4NWIA 1Y5LA 2BUCA 2P69A 5F12A 1JIUA 4GXNA 4G0UA 1TYZA 3DMTC 4A0RA 2JRCA 1RACA 1TKBA 1W9MA 1N1MA 4TQ9A 5EHXA 2IPMA 1I2CA 1OHHA 4ESHA 2GVZC 3AUUA 4FYMA 2PZBA 3M0EA 4B7XA 1WEKA 2IK8A 3WLTA 5J2TB 3AVTA 2GXAA 2ZUFA 2ADMA 1LV8A 2JCXA 1IJKA 3AGPA 4AUEA 4Q1AA 4YRDA 4IH1A 1FX1A 2BMDA 4PZCA 3QE3A 4KSCA 3KQQA 1UM8A 2CD9A 3JQAD 1OVGA 2H5EA 2H17A 5CLLA 1XCMA 1GFZA 1T9ZA 2QTGA 3HKEA 5TSDA 1AUXA 1BXZA 1XZHA 2PH1A 2X7JA 3D6VA 4PZYA 2YBDA 3T1TA 4PM4A 2FZ4A 4UU8A 5ALEA 1AHNA 1GAQA 3UK0A 2CKDA 1RJ9A 4BNDA 4CG0A 4RK0A 2MU1A 1CPYA 4LXXA 2ATXA 4NY1A 2O8CA 1CJUC 3HKBA 1F60A 5D84A 4I14A 1SULA 4PIPA 4GGMX 1E3JA 4N3CA 4JVOA 3KVYA 4I9NA 3SEQA 2LDXA 3F78A 3OVMA 5DNCA 5KI6A 4GYKA 1D4ZA 2Y68A 1WUHS 4RW0A 2VIIA 5KPDA 1WS6A 3BL8A 3I1JA 3ONWA 1EHCA 3E9ZA 1GNQA 1KS9A 2IYQA 4N0MA 4RMGA 5DV9A 2J5BA 3E5RA 3H8WA 1FLDA 1SM4A 2LVBA 4P3XA 3ND5A 4G4IA 1X2BA 5M3BA 3HJFA 1PGOA 1F2TB 3HS3A 4WKOA 4C7OB 1YZUA 4CCAA 3COWA 4TUYB 2WT9A 1XG5A 3VYUB 1CG6A 1KP2A 3WYBA 3P4XA 4DQKA 4GE3A 4RKWA 1C8VB 1BROA 1PI3A 2HH9A 3I09A 3HKEB 3PUYA 4IDHA 2CEKA 4XIIA 1YVDA 5DTIA 4CI9A 4E33A 9LDBA 2J33A 1ZCAA 3CWCA 3I4FA 4K9DA 3T4UA 1Z73A 3QEMB 1P1JA 2ARKA 2H08A 4F5DA 1A9QA 4CLOB 3FB4A 3RSCA 1FZTA 3Q8MA 3IT1A 4HH1A 4GPEA 1SRRA 4QHSA 4BHTA 3VNUA 2ANBA 2WP0A 3SDBA 3RVPA 1SCAA 4IDOA 3FSEA 1GPUA 1Q15A 1L3IA 4LGVA 2YH2A 2FFRA 4F91B 3QA9A 1EIZA 1JLHA 4YQYA 1TT5B 3WADA 1R12A 1NVVQ 1PYGA 1RXIA 2FOIA 2RI0A 3JYLA 4NZOA 4WK4B 3IKTA 2FX5A 4BVLA 3V1MA 1L9XA 3QNWA 2QU7A 4NHOA 3SXUA 4YRCA 2ZE6A 2ZB2A 2PMCA 3D7SA 4KQKA 1BIFA 4D0RA 1CU1A 4ZHQA 4LQ4A 5HPYB 5JY1A 5KWSA 5FA6A 1N9ZA 1C9EA 3R0QA 3MINA 5FO0A 1G63A 2AC2A 3NH6A 1JQBA 1XLTC 2CXTA 3C45A 5HKBA 2WP8J 1G20E 4ENRA 3RJ5A 3DULA 1WY7A 2JA1A 4JYZA 2WJYA 2BTQB 3L0PA 2OBMA 4HV4A 4YR7A 3O83A 1H2WA 3QVKA 1JHMA 4MUAA 3ZGXA 1N77A 2VLIA 1FJHA 5DX1A 4W9NC 1JPUA 2JKVA 2WJPA 4I3GA 1F0PA 3TSZA 4DR6B 4Y1FA 3H8VA 1DELA 3MWFA 2FZGA 4H0NA 2ZRMA 4JI4B 3BXOA 4QFCA 5ELXA 3JQCA 2FW8A 1U0EA 2PRKA 2XB6A 1ECFA 3JAKA 3O8BA 4QOIA 4WVFA 3ZVRA 3IAEA 3Q8KA 1SHZA 3L1IA 2V5VA 1F4PA 1E8DA 2V58A 3ZCSA 2ONZA 3O2QB 2Q5IA 2XT6A 3FMVA 3PJEA 3W78A 4K03A 5I7EA 3T5MA 2ILTA 1ADBA 1H66A 4XIGS 4D9EA 2RDMA 3ROKA 4W9RA 3W2TA 2H5IA 5JJLA 5HS6A 2Y05A 3ZIAD 4DADA 4MV3A 3VSBA 4O2BA 2ZBVA 3T7SA 2O0LA 4JR0A 1NBWB 5L40A 1SC9A 1SCIA 3I0MA 4G5OA 4L51A 3EG9A 4X3PA 3OOWA 4RCZA 3T06B 1JSLA 5JZOA 2YNMA 5JNWA 4LXHA 1PVVA 5FFMA 4A5SA 5C4GB 1GXSA 2ACKA 2BGJA 4OK3A 5C8DA 1FMTA 4ZFNA 3W4KA 4OB6A 2PBFA 2VDWB 3HYSA 2E0IA 3INNA 2FSVC 5D6NA 3W2EA 3WL7A 4FEEA 2OK7A 1W0KD 1V16A 4JSYA 1PT8A 2OBFA 4WW0A 4YQFA 3UMFA 1R9GA 4PCVA 3TZBA 4P32A 3T0FA 3VTFA 4BNFA 1M7GA 4OKSA 4EG0A 2E2WA 5AESA 3TIVA 4P35A 5I7UA 2RAPA 3QLVC 4MJ7A 3JQ7B 3X3HA 4Y1RB 4C01A 1NJ8A 5IT4A 1Y8CA 4P7BA 2BFNA 3RRNA 5LXTB 3GXOA 3WK8A 5BSKA 1YBFA 1IOLA 4YAUA 2B5OA 1DC7A 2WU8A 5KTRA 1EX9A 4PV7A 4BKRA 1NKVA 1E2UA 2GBLC 1NN0A 3EA0A 3ESBA 2C4VA 4QDZA 1LSJA 4ZTBA 3ZZ1A 4C6TA 4IFEA 2N46A 3ESCA 1MENA 4JEMA 1XVTA 3RVOA 3ZGVA 3UUWA 1DIRA 2NYUA 1NHWA 2WM8A 4HNAA 1PJLA 3KKKA 2CLSA 3TL2A 1HMYA 1GLGA 2RMKA 2W83A 3O1LA 4WFJA 2IQIA 3K5PA 4JR2A 3R40A 5DRYA 1KEUA 2KMLA 1JAIA 5IF3A 2PZMA 4JXZA 1H4QA 1P9LA 1V9LA 1XVAA 4YJ2B 5JRJA 4B1FA 1GSOA 3OUUA 1FSGA 3BL5A 4QQFA 4YJDA 3DE0X 4UCFA 1W46A 5CVCA 1YS6A 3FIJA 5JLAA 1MZVA 2HWYA 2J0UB 3FOBA 3GMTA 3SBXA 2J5XA 3U1TA 1DSSG 4JU9A 4B40A 4KV9A 3OEHA 1FPQA 4YDHB 3AM1A 4DL9A 1MMFB 3ZKWA 3A6FA 1E9VA 3W5HA 5DTRA 1LA2A 1EBUA 2DM6A 3R5XA 4FSHA 4GBED 2R1TB 4V24A 5ADHA 4OQZA 4S1NA 3Q7QA 2JW5A 4C4AA 5K3OA 4CW7A 3TUJC 4IYRA 4RVGA 5IYZB 2AF3C 3KPVA 4NZMA 1Z2PX 1W47A 4RMIA 5IYZF 4C7JA 1HA3A 5LMCA 3SF0A 1MAVA 3A6ZA 3RFUA 5MF6A 3GDFA 3HDHA 4MYSA 3ZV5A 5BN4A 5KKNB 4M9RA 1QZZA 4PC3A 3I8XA 3V7NA 2X9GA 3VPCA 2JIDA 3OLQA 1Q1NA 3CX8A 4IIBA 5IC5A 1SJ9A 4AJLA 5BURA 3FBWA 1S9HA 4RM2A 1MJHA 4YCMA 3VO1A 4PTZA 4YAKA 1G8FA 1U8EA 4JXKA 4JY7A 5DOZA 4F9GA 1DKOA 1PZGA 2R8OA 2JIPA 4R8RA 1QP8A 5DTQA 5JD4A 4PIVA 1TCAA 1X87A 3EDMA 4UU7A 2J6CA 3RT9A 3PDHA 1KAGA 2BGIA 2P0YA 1QHXA 1U81A 1JEAA 1M7BA 2WFAA 2VQDA 5FV7A 3GFQA 1KSGA 2XAUA 1XR3A 3FKQA 5T8KA 2WSYB 1FNDA 2D62A 4NCNA 5KSZA 1ZMBA 3G8CA 4ZRMA 2W4MA 3MGBA 4PO1A 2L82A 4QU0A 3T7TA 3OTHA 4OYLA 4CNQA 2FYTA 3UMCA 3KS9A 1C9DB 1ESMA 3LO5A 4JI6B 4MRMA 1UMCA 2F9FA 2HHAA 1V9CA 1YVRA 4R51A 4D2IA 3VKVA 1PRYA 4DJTA 3V4PB 5BQFA 1XI2A 1LDMA 3NH9A 3ORQA 1TM7E 4JA2A 5CHEA 4Q9JA 3FUVA 1VE9A 1F0NA 3H2SA 2WWTA 1N2OA 4HKTA 4IDGA 4KGXA 2O8FA 3TQFA 2PX0A 2V0CA 1MPTA 3S5JA 3LXMA 5CH5A 3OZSA 3SXJA 5L6LB 3GLFB 3WJ7A 3AU9A 5AVWA 3HK2A 2XNCA 1GPH1 2VJYA 3CF6R 4HAIA 3JQ8B 4JL5A 3NUQA 4QOFA 1OAKA 1GY8A 3ZWXA 1EWRA 1P80A 4PRLA 4R9SA 2PUFA 4OMDA 5SZIA 1NUPA 1OBFO 3A37A 2BM8A 1IZ7A 5FWXA 2DY1A 2I67A 4S0ZA 1I94B 2ASVA 3ZW7A 4HYTA 2C9YA 4N7RA 4A6XA 1BDHA 3DAHA 4OP3A 3N2NA 3BORA 3SS7X 3ZHVA 1JVSA 3PHJA 3H05A 3FJYA 1U90A 1TEZA 1UT6A 4EI2A 3G2MA 4GYYA 2NO7A 2JZOA 4BLSA 1BGWA 3N9IA 4OJNA 1W1WA 3H2JA 4YK7A 3VR5H 4EF6A 2XCSB 2PRSA 3GFVA 3Q9LA 2Z58A 5F7OA 2XODA 2CL7X 3UICA 5G41A 1CXZA 4D8XA 1E6MA 1JJFA 4DLKA 3BXFA 1U1EA 3FNHA 4I5DA 5BQPA 2GPJA 4LJYA 3U0BA 4ZDKA 2C3UA 1O96A 5DGIA 3RI3A 2PX2A 1NTRA 1NVKA 5LWQA 1TYEB 4P36A 2P11A 4DY6A 1TW2A 3EZ2A 4NIMA 4UVHA 3VAZA 1NVTA 5AVVA 5AWFC 1UBFA 1ZI8A 1W87A 3WL5A 4G5FA 3BIFA 3U4QB 3R0JA 2O2CA 3JASB 4BUZA 4KQCA 5KCMA 3DMRA 1C9KA 2F00A 3QG5A 1DC5A 2R66A 2ZYSA 4XQCA 4KODA 4REQB 2VDRB 5C1BA 1BFUA 1JMYA 4P38A 4ROSA 1RABA 4FWIB 4GHWA 5T57A 1FA9A 1AB6A 2ZJBA 3NTVA 3Q7TA 3T7CA 3EQ9A 3WXMA 4F72A 2R44A 2Y4OA 4I5GA 3PFIA 1AO3A 4E6PA 1HY3A 1E59A 1L7XA 1WL8A 4DLRA 2D6FA 4EAAA 3M5WA 1YJQA 3K71B 1DG9A 3F7MA 4Q3CA 5CX4A 1JI0A 4YP6A 4TWZA 2LCQA 1KI6B 1E92A 1KJNA 3IAXA 3JQRA 4FYIA 3RSQA 3TIIA 1V7CA 3OU7A 2GCGA 2C95A 3GP5A 3VPDA 2O8FB 2W9XA 1Q5PA 4DAOA 1ZGZA 3ZK9A 3PPVA 1MR3F 1QMGA 3UMMA 2D1SA 2K6GA 2DHQA 1FYXA 2WTAA 2XNDD 1THGA 3DVSX 2JGAA 3NTQA 3QXCA 2X8JA 3DEAA 2W4QA 3NJRA 3OBBA 4G5YA 3DTTA 1II8A 2G9UA 2PJZA 2FRDA 1XCPA 3W5CA 2D3TA 4BFSA 1Y4SA 2WU1A 1DQSA 3A4YA 4TV9F 5CX1B 1C1HA 1Q22A 1QGAA 1SC3A 2GNAA 2E5LB 1J21A 1FP4B 1HDGO 3KZOA 1T2UA 2HCTA 3E9YA 1LUAA 3OOHA 4N40A 4AMVA 2NO5A 4BQQA 5L7WA 3VR6H 2ZSHA 3B7WA 1RRPA 1T26A 2FZCA 3IT0A 3AVXA 1JG7A 2I4TA 3EXAA 4LYFA 3IEKA 5HJ5A 1JHQA 5IAAA 4L0QA 2GWRA 2ZJ2A 4DCOA 4FHGA 1C8LA 4RIGA 1PNRA 3VH2A 5JO0A 5EC8A 5JSHA 1G1AA 1V25A 5DMHA 1PYOA 2EARA 3H1GA 3IUBA 1ZX1A 1M74A 5IF9A 3DS8A 3UW3A 4TL9A 3VNRA 4ER0A 5L45A 4O4IB 2R6JA 3TZLA 5CA1B 1IBRA 2XF8A 2C4MA 3N76A 5B1DA 4BN0A 1YZ3A 1P0CA 1QCDA 3STTA 3V6MA 3CH7A 4DXDA 2QNIA 1GNPA 5ECDA 3K16A 4BTEA 1MU0A 3ECAA 3LC7O 3ZV3A 3FW1A 1EQUA 1GGEA 4QHTA 3ZHBA 1Y1RA 1ZC4A 2DT5A 3IQIX 4TSFA 4EYOA 1S4MA 1YQTA 3DAPA 3I0ZA 3JVDA 4QBKA 2XB4A 5I9SA 4JJ8A 5HOEA 2QRNA 1GG2A 4QG7A 4AI6A 3ESQA 3TBHA 1H2HA 1ZZGA 3CC8A 5HXAA 4Q48A 5HJ2A 3RQIA 2YCBA 1US8B 5FO1A 2OECA 5U9CA 1YUBA 2FWAA 2PLAA 3BIWA 1IXYA 1BCSB 2J5RA 4XVQA 5DMXA 4LHZA 5HJEA 1QGOA 3CA8A 2OCAA 1VPWA 3QX9A 1V1RB 2FWBA 1GZVA 1T6BY 5AM1A 3T3IA 3ONEA 4FYWA 2VK1A 4Z1OA 1NBMD 5KOJB 2E7ZA 4D25A 4DS3A 5KNCA 4UAVA 3HB4X 3L1UA 4R68A 3H8JA 1EFHA 2B92A 4RHEA 4YRFA 2R62A 3HEBA 5HF5A 2GZAA 1KO5A 2VVTA 3AWDA 3C1AA 2ZIXB 3W8RA 4ES6A 3CN7A 4HD8A 4DB2A 1N8SA 2IYWA 5C1IA 2W37A 3WKDA 3ZZTA 4DKXA 2I76A 5HNKA 3CUKA 4MWZA 4NNOA 4DOMA 2C5SA 1OFVA 1SXHA 1XTPA 5HFAA 4ND2A 4D8UA 1HDZA 5EJ9A 3PFHA 4Q12A 2Y1XA 1JJ7A 2OHOA 3KT0A 3FPHA 4KQWA 5ADWA 1HSZA 1R16A 1QX4A 2ZIUB 4ZQEA 4GXTA 5FL3A 3DZKA 3EZLA 3QYJA 3OHMA 3EPLA 1K3FA 3I5XA 3ICQB 2VP6A 1X7ZB 4A23A 4LY6A 3IQWA 2IXBA 1Y9EA 2RHWA 2QTFA 3G9UA 1LW7A 3H18A 3ZVMA 1NSTA 4YI3A 3DHEA 2O6HA 1KRXA 1GDTA 1DC3A 2VQ3A 1P1FA 2FR0A 1E3DA 1AKVA 2I0FA 3NEPX 1LJ8A 4LOLA 4I5EA 5FIUA 4DF3A 5AW3A 1WMBA 1OU0A 5FPHA 3SQWA 3BH7A 2QZ4A 1RXVA 3ZS8A 4EI9A 2AEEA 3H9GA 4K28A 2CNKA 2OHGA 1XTQA 2R1VA 2QRJA 3EDCA 3IDAA 3KFLA 3GLHE 1E2EA 4IVNA 5DT9A 3RRFA 2GNPA 3L04A 3ZQKA 4YLEA 5IXSA 1KFBB 4E1BA 1DJPA 2H11A 1XK6A 4KLCA 3UT6A 3WVNA 3EC2A 2GPNA 2CVOA 1OWLA 1JG2A 4JHLA 1K2WA 2XAAA 3GGPA 4RPKA 1W4AA 3WSTA 5BVGA 5C3UA 1MAWA 4YDQA 4YJGB 2OHIA 2X42A 4WLEA 1PHPA 2DVMA 1USVA 3RHSA 1UBHS 1VYHA 3D8TA 5HFJA 3ID6C 2GBIA 2H0RA 1F8YA 3T1NA 5ESWA 2YJGA 1OAOC 1HT3A 1U1IA 1L8LA 2A5DA 2ZVPX 3KXKA 3KX2A 4HRYA 4X93A 3KM0A 4M1QA 2ID8A 4LY3A 1EXWA 1VDZA 3GJ0A 3K5WA 4K0RA 5A0FA 3C4QA 4G6ZA 3UUFA 3WNBA 1E1YA 4FGUA 2BFBA 1GN9A 5ALGA 3KT6A 2QWXA 5BYJA 1OPRA 3D64A 4XM2A 3PTLA 2B1GA 5TDHA 3FVTA 2WZQA 1RHMA 4LDAA 1NNEA 4LJAA 3THOA 4YCCA 2FDRA 2PKEA 2WWWA 5WRFA 4A6EA 1M8KA 5JANA 3G17A 1ONNA 3H4IA 3CXUA 4WBNF 3BIJA 1S8OA 4KPUB 2VSXA 1D4OA 2AKAB 1ULBA 3EMDA 3ON5A 5E4YA 4B4UA 5LL6P 5E7QA 3WMRA 4BQSA 2J8ZA 2VDPB 1PUXA 2VOJA 3QHPA 5JTTA 1H5NA 2A33A 1AO0A 1NQ5A 4CDNA 2HA6A 3GV0A 1GZ3A 1ZINA 3TX6A 4K2AA 4E30A 3E2PA 2OXFA 3IBTA 3U3RA 5HP4A 2J32A 2B34A 5E3HA 3CXRA 3FMOB 3U7EB 5CCBA 3DV0A 1DBRA 3CG4A 3NAZA 1SVSA 4D56A 4Z54A 2VJOA 2OKGA 3L6CA 1D6MA 1JLSA 3QG1A 1OT5A 4CIWA 4P22A 2OFFA 3SJZA 4I2VA 1O0CA 5KOIA 3FOWA 2Y93A 1JQJC 4I36A 2VDKB 3T3HA 3HMQA 2D2IA 3KOWA 1NNLA 3PD0A 4MDHA 4B7CA 4LSMA 4TWIA 5COAA 1ZR4A 3NHPA 3LOUA 4CEHA 2GI4A 3JQGA 4JASB 3EZGA 1KDRA 2IDZA 4CKZA 4OATA 4RS3A 4OSPA 4UE3S 3FPFA 4HJRA 3W06A 2GCPA 5LQJA 1JDUA 2IF0A 4CQMA 3G5LA 2FAXA 5J4YA 5F2EA 4M55A 2GEDA 1GTSA 2W8BB 4I1OA 3DBRB 3AKYA 1V3TA 4ARVA 1H69A 1DFGA 3IUQA 2XT9A 1Z9BA 2H1FA 3OZXA 4D0NA 2CWWA 4DR4B 2OMKA 5J59A 2EQAA 4KKXB 5FOXA 2C3PA 1KY4A 4QD3A 2P6OA 1QNLA 1QOPB 3EZYA 3K0AB 3OSZA 4UOEA 3A9WA 4GL2A 1P5RA 5JDIC 5BWOA 4XGIA 3I2JA 1AG9A 4L7VA 4OJKA 4R2IA 3FKJA 3KTAA 2B98A 2CNWA 3I23A 5ABPA 2J3EA 2AG6A 3OX4A 4K9OA 1MPXA 3EFHA 3P9RA 1A8UA 3QX3A 1FP7A 1TVKA 2YV2A 2NVBA 3M82A 3EZ6A 3TB4A 4NENB 3UM9A 5JVDA 4F6RB 3MWEA 1UL1X 4LNUA 1RWPA 3I72A 4LC0A 1M2KA 1SA0A 2HMVA 4WKPA 1A76A 2I54A 3OQJA 2ORED 3P19A 4QICA 4KFUA 4MUYA 4WY8A 4Z5XA 1KR2A 4OH7A 2AYXA 3KJIA 5THKA 4B4VA 1TX4B 2HWUA 5JH7A 2G5TA 2ETVA 4HDCA 3PFWO 5AFSA 4F4DA 4GDMA 3U81A 5LP6F 1DBPA 1LVUA 1X1EA 4B5KA 2DHDA 1XLWA 4PWZA 1E0JA 1NONA 3D4NA 2B5VA 5LA6A 2RH5A 3NO4A 1QIJA 2AIRA 1UFRA 3AJ9A 3ECCA 1KI1A 2NSLA 4UDYX 1E6EA 4YH1A 2GBLA 2GZ1A 1LVGA 3F2VA 3BILA 3U4DA 3WB1A 1IMOA 1XN4A 5AI4A 4UTNA 1JAXA 1UQUA 4TS1A 3TQCA 4D9MA 4EGSA 4C88A 3NT5A 4QOJA 1Y7TA 3JR3A 4E5YA 1BRMA 3C5WP 1XZQA 4MVXA 1UANA 2IF2A 4JFAA 2AI3A 1U0FA 4Z3KA 5JW6A 5K4GA 2JAUA 3MOGA 3X2EA 4MA0A 4M87A 1OBHA 3DCYA 2M6LA 4DQDA 1XZ8A 2AWNA 2FEWB 3JQ6A 1TE2A 1WE2A 4XM0A 1H2YA 4D9HA 1IQ0A 3ITEA 1T6XA 3RVRA 2A59A 2C8LA 3ICWA 3HYRA 3N39C 4UZSA 1RT9A 1V5IA 4NEQA 3PFKA 3R0ZA 4BKOA 1MH9A 1X1TA 3L7YA 3ZLJA 4PGHA 2I99A 1O3YA 1SG6A 2AFHB 3IVGA 1I7DA 2C2ZA 3BOSA 1U1DA 5J5AA 1Q14A 3AUAA 4UULA 1HI9A 3FRIA 4MQFA 4RH0A 1P9NA 1RFGE 4RIIA 4R54A 3IMFA 4US0R 1JNXX 2A0XA 2XUKA 1GG8A 1Y7LA 2RKOA 4MO2A 4DV6B 4C3UA 2ZUVA 4TMVA 1YZVA 3GDWA 4KOEC 3KG2A 3SQMA 5LVAA 3OZBA 4KRGA 3N2IA 3PU6A 3C24A 1QKIA 3BM5A 1JWLA 4IJKA 1X86B 4ZEWA 3I37X 3UMRA 5BUZA 3TW4A 3I53A 2DBRA 5BMVF 1H9AA 3M4XA 3BMCA 4YJ3A 2IKQA 2G1AA 3UJPA 3ZE6A 4E2ZA 5LN1A 3CLUC 4P31A 3NHLA 1AJEA 4MQ4A 5FUVA 4MUXA 3AUJB 3D8RA 4IQ4A 5EMMA 5CJJA 1KMQA 1TAHA 5FBZA 2O8BB 3SZOA 3DF9A 4JBWA 4KSBA 3E7FA 1LD3A 4IXWA 5C9ZA 5I8WA 2WMDA 2ODBA 2VI5A 3UFBA 2W2TA 5LJLA 5BN3A 4PHHA 2GKGA 1XVIA 2QL5A 721PA 4AO6A 4LKOA 5I6DA 1N7HA 5BPHA 2EWVA 4GM1A 1A4XA 2R4QA 4S0XA 5CNIA 3TLXA 1KMIY 4E14A 2WAOA 2QF7A 4OPMA 4PLTA 1BTOA 4X61A 5EJAA 3HC7A 2ZUDA 3AR4A 4IEFB 2H0QA 4G3XA 2A1TS 4ZO7A 1PJ3A 2EFDB 3EGIA 4XWYA 1N57A 3CX3A 3A1DA 3WYFA 5AVTA 1N5RA 3CF0A 3ENNA 1NVBA 2EKQA 3ZCTA 4MAAA 1VLVA 2JHFA 1EWYA 3CZQA 3N7TA 2UUOA 2Q5EA 3NHZA 3FG9A 4EYKA 1QVAA 1T5BA 2FN9A 3JSAA 4M2LA 1DX6A 3BJMA 4ALLA 1DFIA 4YRQA 3B2NA 3DE5X 1XDGA 2C9MA 3VO9A 4QA9A 5REQA 3EXEB 1JWBB 3HH8A 1RIIA 1FJ2A 1PLKA 1JLKA 2IU3A 2VC2B 2BW0A 3Q88A 4E51A 4Y0VA 2PX6A 3OP1A 1RMQA 3V2UA 2COKA 4C2AA 1FS5A 1NP7A 3A3KA 2VUSA 5FPTA 4C06A 2TRSB 1P29A 1XJWA 3FH0A 2J5KA 3L43A 2K5UA 4IZ6A 2AMJA 3OEHD 3TW6A 2IPAB 1N92A 3LIPA 2B25A 3KUXA 2QG4A 1KOLA 2DLDA 1IZZA 2B0JA 2J0SA 4ND3A 2QUIA 2D1TA 2XF2A 4MS1A 2VHYA 3GO4A 1G21B 1L9KA 1CZNA 2VDLB 4Q9DA 2A86A 2JIMA 4U7GA 1Z33A 4AROA 3R3XA 2WZDA 3ORSA 2YRFA 2F1KA 1NM5A 1L5ZA 4I4TF 3V55A 3HLYA 4X71A 2GRAA 2IYXA 4LMAA 3D81A 4X41A 5FBVB 2J9ZB 3IAM6 1T9GS 3ZDFA 5KU7A 2JAHA 1GKLA 1O95C 2W2QA 3FJ1A 4TVSA 5LMNB 3KSUA 1JQ5A 1Z7BA 3LUGA 3DD1A 4G5SA 3H5NA 4CF7A 4JEUA 3WLIA 3WDKA 1G5TA 4QNMA 1N0WA 2Z98A 1QU3A 2ATVA 4K8OA 5GGXA 3UK2A 1OYVA 2EKPA 2WDPA 4Q7EA 5B37A 1VC2A 4L5YA 1KEKA 1MKYA 3Q6IA 1EMDA 1H4VB 1OSNA 3GIWA 4D5GA 1Y9JA 2AFVA 2X9NA 2GFQA 3FF1A 2O7VA 1SVOA 4V0KA 1LF0A 2Q1WA 1V8OA 1N3BA 3Q4GA 1PL6A 1VMIA 2I4OA 2CLMB 3KALA 4U2BA 5DM60 4NABA 3U39A 2QXTA 3K1TA 5JI3E 4FYKA 4TKMA 5H9WA 1Z74A 2WE7A 4FYXA 1J2YA 1WMAA 1ZM2A 1R5OA 3PRHA