4J0CA

Tannin acyl hydrolase from lactobacillus plantarum (native structure)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
470
structure length
452
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 162
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0cA00
4YK7A 5ESRA 4AO7A 3IVMA 5SYNA 1XLUA 2I3ZA 5ALMA 4EY6A 4UBIA 4FNGA 5HQ3B 5C8VA 3VXKA 4MYSA 4QDOA 1MX1A 1W6RA 2PUJA 3Q8WA 1XZHA 3MUOA 2WLSA 3FVTA 2ZYHA 1SFRA 5CTAA 2XMDA 1CUIA 5DLPA 2H7YA 2QMQA 4Q05A 3BF7A 1W1IA 1TK3A 4BDSA 1N8SA 4J0HA 5E2IA 2XMCA 1D07A 4Y2TA 5AICA 5LP1A 1CUSA 1H2WA 3WJ2A 1S8OA 3OTQA 1MJ5A 3A6ZA 3K2IA 4BYMA 2WHQA 2HRRA 1QIKA 4J3JA 4U2CA 4H77A 1X2EA 2W6CX 1VLQA 1H2XA 3L1JA 5T4HA 3SK0A 5YASA 3E3AA 5T4BA 3EIOA 1YR2A 1C7IA 1K4YA 3FNBA 3WI7A 5JD4A 2HA6A 3GROA 3FLAA 1N5MA 4QZVA 4X92A 4PO3X 1CUWA 2QJRA 4H7EA 2B20A 1EB9A 4ZRDA 4Q3LA 2H7XA 1UOOA 5A71A 2J4CA 1C7JA 3G0DA 2OCKA 5T4FA 4E11A 5AO9A 5ALFA 2WHPA 1L7QA 4X7BA 1K6EA 4H7DA 5ALIA 4DNOA 5JYCA 4DNQA 1YB7A 1M33A 1JT2A 1XZKA 1ORVA 3K6KA 4Q82A 5AI4A 4EB0A 2DSNA 3F8SA 4MWSA 4GEGA 2GBFA 3P2MA 4RE6A 4UBNA 3I2GA 3L1IA 4K6HA 4KAFA 1LZKA 2VAVA 2ROQA 4E15A 4OB7A 1CUDA 5FLKA 5HF6A 1QIJA 3I1IA 4DNPA 4Q34A 5AKEA 5ALSA 3R3VA 3HLKA 1EK2A 4WDRA 1EDDA 2HRQA 1AX9A 1LBSA 2HDWA 4X71A 1ACLA 1CUUA 1YCDA 4L9AA 4QLOA 4B7ZA 5LIPA 3KWJA 5K3CA 3KSRA 1YAHA 4GLBA 6YASA 3QH4A 3HC7A 1TCBA 4AQDA 2C4HA 4EZIA 1JU4A 3FBWA 4UHBA 5A6VA 2WUFA 2VT6A 1EI9A 2BJHA 2DHDA 2QVBA 3C45A 2CBGA 4FOLA 4RGYA 1UOQA 1YB6A 2Y6VA 3E4DA 2RIPA 1ODTC 3C5VA 3WK5A 3H2IA 3HXKA 5CT6A 1OXMA 4I19A 5DNUA 2AJ8A 3ZLUA 4MQMA 1EB8A 4KE8A 5IVHA 2CZQA 2WFMA 5ALZA 7YASA 1BE0A 1JI3A 5ALUA 1B6GA 1IMJA 1CUHA 5KWJA 2HA5A 1CUVA 2B61A 4PSCA 5ALPA 3IB3A 1ORWA 4RNCA 5D3KA 1VXOA 4Q1VA 2ACKA 3I2IA 2Z3WA 2NW6A 2WTNA 1CUXA 3C6YA 5CT9A 2DQZA 2VATA 2VJAA 4DIUA 1ZD5A 3QMVA 3AZOA 3RM3A 4PQEA 2C5GA 2D0DA 5LZ4A 3QPDA 2OPHA 5I7UA 1MPXA 1XZEA 1MTZA 4FTWA 4TPKA 4KE7A 4P9NA 1GPNA 1QIIA 4FNMA 3G0CA 3R41A 2E3JA 4MWTA 1DWPA 2VQ6A 2PPLA 5AI9A 2Y6UA 5KBYA 1HPLA 3WK7A 4GW3A 4WFKA 3U0VA 2XT0A 3DKKA 3FLEA 2GYWA 1J1IA 1W76A 2XE4A 4L0CA 5AH0A 4NMWA 4Y2PA 1YAJA 1XZIA 3ZI7A 4Z49A 5KWIA 2WJ6A 3ESAA 2WU4A 1QFMA 3EQ8A 4ZV7A 4CIAA 3JW8A 2GYVA 4U2EA 1G42A 3HEAA 1YA8A 1AURA 3AINA 3FWHA 1J06A 2VF2A 4UHDA 5HQ3A 3B12A 2PSFA 5JALA 2OAGA 1YS1X 3IDAA 1IZ8A 2Y1KA 4N8DA 3BJMA 4U2DA 3YASA 5JANA 4LXIA 4CG3A 4F0JA 2R8BA 4CFSA 2CB9A 5CXXA 5DNVA 1LPOA 1WCYA 1QIDA 1XKTA 5IVKA 5FP0A 4UBLA 3MUNA 3OPMA 2XDWA 4DYHA 4PSDA 1F0NA 4J0CA 1DQYA 4H7FA 2AJLI 5JAOA 1CUJA 2V96A 4QDUA 1WHSA 2YYSA 3LS2A 3OURA 3VJKA 1TCAA 5A7GA 3WL8A 1WM1A 5ALYA 5ALXA 4W1SA 4UBMA 5I8PA 3DEAA 4UUQA 4QEKA 4B81A 5EFZA 2WQZA 1QJ4A 2HIHA 5EI5A 5JIBA 2J3DA 1EX9A 1GPLA 5EHNA 4O08A 2RI6A 2JEYA 4DMHA 2AXEA 3OG9A 2Z3ZA 2I03A 3C87A 3C8HA 3D7RA 4QLAA 5AM4A 1IZ7A 2JIDA 4C4XA 3I2HA 2H7CA 2O7VA 4QWWA 4X6XA 1ZJ4A 1YA4A 4B9AA 1XZFA 4FKBA 4FBMA 2R11A 2XQFA 4UFNA 2XMRA 3DNMA 3ANTA 3ICVA 4XIIA 4UBJA 1XQXA 3R0VA 3IUJA 2O2GA 3ZLTA 2BKLA 4UHFA 3T4UA 3DD5A 1JMKC 4BDTA 4EY4A 4UFOA 4HRYA 1XRMA 1A8QA 2VAXA 1O6FA 4NZZA 5AIBA 3WYNA 2D5LA 1LNSA 2WIDA 5ALNA 2VJCA 1WPRA 2HA0A 5HCUA 4X95A 4ZI5A 2XMSA 5HK8A 5H3HA 1CUGA 1Q0ZA 2BCEA 3DOHA 3ZWQA 1EK1A 1NU6A 1FJ2A 2CMFA 2XQKA 4ETWA 2QXTA 1TKRA 4Y2YA 4H7KA 4JYPA 4N8SA 1XZMA 1RP1A 2BUBA 4B0PA 1LBTA 2XUJA 3AIKA 2AJBA 3AUKA 2JGLA 1XLVA 2WSLA 4JUIA 2WIKA 2X5XA 2WFZA 5C7YA 3WIOA 3RK4A 2V97A 4H7HA 4X94A 1BEEA 1THGA 2HFKA 1EDBA 3KOOA 5JZSA 3FAKA 3H2JA 4H35A 3R3XA 3PFBA 4X85A 3QPCA 2G5PA 4QDZA 1E5TA 3W2TA 4LIPD 4OU4A 1TQHA 1R9NA 5K3EA 1BCRA 1ZI6A 5BWCA 1GXSA 5DWDA 3EF3A 3ZPXA 3V1NA 5DYYA 3H2KA 3TRDA 1XZBA 4QE3A 2ZSHA 4C87A 2WUDA 2PSEA 2BGNA 4N5HX 1DWQA 4W1QA 4W9RA 3QM1A 5AHXA 5J3JA 3QMWA 2JEZA 5AKYA 4U2FA 3A70A 2DHCA 2PBLA 1WB4A 4CIBA 3ZLVA 1ZICA 3A2MA 4B85A 4WFIA 4F5ZA 3O9MA 5HF9A 3WA6A 1FFEA 4M0MA 2JGEA 4L72A 1SCIA 3JWEA 2WILA 3LP5A 4H18A 1HDEA 1E66A 4N5IX 1RWQA 1I6WA 1ZOIA 5DTJA 3DDUA 4FHZA 4OPMA 1G4HA 2XMZA 4OCZA 3WKBA 1DT3A 5EGNA 5BV7A 1LGYA 3VJLA 5AM0A 2HU8A 5K3DA 5I9IA 2ZYIA 4NVRA 4K6KA 4J7AA 2XUHA 3AZQA 5CBKA 4AMYA 4BTVA 5AM2A 3LCRA 3D3NA 3WKAA 1N1MA 4YASA 1CIJA 3Q0TA 1H2YA 3W9BA 1DINA 2ACEA 2GZSA 1BCSA 1DWOA 2YXPX 1U8EA 4KAJA 3G9XA 1R3DA 4JEIA 4BC0A 3STYA 1N5RA 3PI6A 1X70A 5LZ9A 1XRNA 4FFVA 3N2ZB 1QIFA 2RONA 1H23A 1KU0A 1E89A 4C4ZA 4B6GA 4LXHA 4B0OA 4DLNA 1MU0A 4FMPA 4V2IA 3PF9A 4BP9A 3IULA 1MT3A 3EBLA 3AIOA 1FFBA 4BC1A 1DT5A 1USWA 3WZLA 3QYJA 3GUUA 2HM7A 3CCCA 3ED1A 4LXGA 2EDCA 5ALQA 1QIMA 4BCBA 3T52A 2J4FA 3MVEA 2H1IA 1JMYA 4G8BA 5EIAA 4W1PA 4WCVA 4KRYA 5LZ7A 1VA5A 1XQVA 5K3FB 4Y2UA 2K2QB 2C58A 4ZGBA 2RHTA 3RKSA 5JZ9A 1AKNA 2ONCA 1FSSA 4Q3OA 1YS2X 1EVEA 1AQLA 4X3CA 3WK9A 2LIPA 1P0QA 5LLSA 4UPDA 1CR6A 3KD2A 4Y2VA 4G4JA 2QJWA 3ESCA 4HZGA 3G0IA 5FUMA 2WUEA 3FYUB 4AZ3A 1NX9A 2OQIA 1G5FA 3E1GA 4QA9A 5LKRA 2V98A 2OQVA 5AIAA 2QR5A 4IHAA 1P0PA 2QTBA 3R3YA 4KE6A 2C5FA 1VA4A 5ALWA 1THTA 4CG1A 3O9VA 5EHXA 1ZGBA 3QZUA 4ZV9A 3CN9A 4QDTA 3A2LA 3C43A 4OSEA 1WB5A 2O2IA 3PUIA 1ODCA 2BGRA 4LYEA 5CH5A 3WMRA 3TEJA 1A88A 2ORYA 2XQIA 1FFCA 3WKDA 4WJLA 3O4IA 5EIEA 1QO7A 4S0XA 4A5SA 2PSJA 1XKLA 3OC0A 1Q84A 4KE9A 4PSUA 4BAZA 4I4CA 1BRTA 1SCQA 3GZJA 1VZ2A 5LZ5A 1BN7A 1EA5A 1AGYA 1GQRA 4ARAA 1E3QA 4DSZA 5ALKA 5A2GA 1GZ7A 3STWA 3BL8A 5IH7A 3CCBA 1ETHA 1EHYA 4LYDA 3RARA 5SYMA 1R88A 2WG2A 2DHEA 2O2HA 3EQ7A 3ILSA 1QTRA 1XZCA 1K5PA 1MNAA 4F21A 1HLGA 3WIBA 3H2HA 3UMJA 1BEZA 1CUEA 2C0QA 5CH3A 1EXWA 3B5EA 1LZLA 1XRPA 1NU8A 3HI4A 2EEPA 2XMBA 3O4JA 2GZRA 2RGUA 1P0IA 3VDXA 3C6XA 5AOCA 3STTA 1JJBA 4DMKA 5AM3A 1U4NA 3SWWA 5AOBA 2ZVDA 4AX4A 1CV2A 4UFPA 1OILA 4AO8A 1WOMA 2G4LA 5ALVA 1R9MA 1E8DA 2G5TA 3VISA 3D2BA 2XQJA 3WYDA 3PF8A 5CT8A 2PX6A 4MJ3A 4C4YA 4CCYB 5KREA 5JD6A 5ISMA 1LPAB 5CT4A 1BROA 3BJRA 1UKCA 4ZREA 1ZIXA 1P0MA 1ODSA 1IUPA 1UOPA 4B84A 3C6ZA 1ZIYA 2RHWA 1VKHA 4H0CA 4GHWA 2Z5GA 4BE4A 5K3AA 3STXA 3G0GA 4M0FA 3M3DA 2XUGA 5IVIA 3H18A 1QOZA 2PSHA 2VTVA 1AC5A 5C81A 3DL7A 4X97A 4G9EA 1MN6A 1AUOA 1QE3A 5AI0A 2XLBA 5IVDA 4E14A 4BVKA 2Z8XA 5LZ2A 4KJXA 3I6MA 4W1RA 4EBBA 4C89A 1CUBA 3NUZA 1MX9A 1ZD4A 3PFCA 4X93A 4GI1A 1Y37A 4N8EA 4BVLA 1DX6A 1RYYA 2HA2A 3WWOA 1XZLA 4AO6A 2B4KA 1F0PA 5AKKA 2HADA 3H17A 4DMFA 3C6BA 4CG2A 4OB6A 1J07A 2OCLA 2WIJA 4HS9A 3R3WA 5AKHA 3FOBA 1UK9A 2XUOA 4X91A 3LIPA 5K3FA 1R1DA 4IH9A 2G63A 3ESDA 5AI8A 3BXPA 5CRIA 4UHCA 2OGSA 5JATA 4F60A 1WPXA 2XMQA 1Z68A 3IUQA 1JFRA 4DMCA 5E4YA 2Q0XA 5CMLA 2VJBA 4GXNA 3S2ZA 3U1TA 2QT9A 1MX5A 2ZJ7A 4IO0A 4FBLA 1OCEA 5AKLA 2ECFA 5JZBA 3D2CA 4BZWA 1CPYA 3RLIA 4J0DA 3G9TA 4Y2JA 4E46A 5JASA 4BATA 4X00A 3SC2A 2XUFA 3H1AA 3FYUA 3HABA 5HFAA 2HU7A 2GBCA 2C0PA 4CCWA 1XZGA 3V48A 1WB6A 4RE5A 5HKAA 5ALOA 1BS9A 2PM8A 1SC9A 5BOVA 3JYHA 2CJPA 4KACA 4FLMA 3M82A 3DJYA 2YH2A 1XZAA 5AP9A 3DYVA 3DLTA 4AMZA 1YSCA 4Q3KA 5ALDA 4YX9A 4G5XA 4Y2SA 3IA2A 3QVMA 3NGMA 3ANSA 5JAPA 3R3UA 5FRDA 4B82A 1E8NA 4JNCA 4KYVA 4K2AA 5HKBA 3STVA 1JKMA 4IH1A 3H1BA 4L3WA 1F6WA 5DTIA 5FKJA 3K9BA 1DX4A 1W4LA 1CUYA 4P08A 1K8QA 4AB1A 1KU6A 1F8UA 3I1YA 2O7RA 3WQHA 3BDVA 1R4ZA 4EY8A 5FPPA 3D59A 4AZ0A 3LLCA 1CUAA 3I2KA 5AKGA 2B9VA 1VXRA 2HU5A 5AI6A 5ALLA 1IUOA 1O6GA 1VE7A 2X8BA 5HK9A 1HL7A 4NS4A 4W63A 4OB8A 4MEBA 5CURA 3TJMA 2P8SA 2JGJA 3FSGD 1LPNA 4C88A 4PNZA 1ZD2P 1UK7A 4U2BA 2ZYSA 2PSDA 4BAGA 3VJMA 5AKIA 2AJCA 3O95A 2QZPA 5K5EA 1QO9A 4KAAA 1CEXA 4UBKA 1AMNA 4QDXA 2DQYA 4MEAA 3VVLA 3IURA 2BUAA 4WFJA 1GKKA 3C70A 2I3DA 1FFDA 1Y7HA 2WG0A 2XLCA 3ESBA 1B41A 1ZI9A 5BWBA 4XVCA 3NOXA 2HHAA 4GBGA 1HKHA 1T4MA 3M83A 2IITA 5DJ5A 4DTCA 1XFDA 2VA9A 2WKWA 2FX5A 3E0XA 1ZI8A 1UFOA 1ISPA 4CCYA 2RAUA 1XRRA 1ACJA 4OUKX 3IUNA 5ALHA 5HFNA 3BWXA 5EHQA 5AKZA 1H2ZA 3DOIA 3G9UA 4EUSA 2OGTA 2BUCA 3X3HA 5AJHA 1G66A 4BE9A 1X2BA 4C6HA 3W04A 1A8SA 2WFLB 1VZ3A 4JYMA 1MO2A 5LZ8A 4Y2QA 4BTLA 2V9ZA 2Z8ZA 2OXEA 1CRLA 5A62A 3F98A 4HXEB 1XROA 5AKJA 2HA3A 3BF8A 5D3ZA 1PV1A 2QOEA 2VSQA 4HAIA 3WKCA 3DYIA 4X90A 1YASA 4PW0A 5A7FA 1TIBA 2XUDA 4Y2RA 5JARA 4UBOA 2HL6A 2WHRA 1EH5A 1WHTA 4OYLA 3D2AA 2WM2A 2C7BA 1UKBA 3DCNA 3BIXA 4XWGA 3WKEA 3WK4A 4MYDA 3R40A 3GBSA 3DS8A 3HZOA 1Q83A 5AK6A 1U65A 2XUQA 3AIMA 2PU7A 2PU5A 4TVKA 1ZGCA 3FYUC 4H7JA 2XB6A 3H0CA 2GBGA 1QTIA 3AJAA 4AN1A 4FLEA 2I78A 1E8MA 1JJFA 3A2NA 1KEZA 2QXUA 4Y7DA 1LPPA 1VOTA 3AFIA 3S8YA 2BFNA 2HA7A 1MNQA 1EVQA 2OLEA 3I2FA 3WLAA 4B9EA 4DNFA 5AK3A 5FXMA 2JGIA 3HYSA 4K5QA 5D6OA 4IQ4A 2OG1A 1L7RA 3R3ZA 1QZ3A 2XUIA 4INZA 5E4JA 4JH0A 3W06A 1JJIA 1T2NA 1UWCA 4LHEA 3AILA 1QLWA 2JGKA 2XUPA 5C8XA 1CUFA 3I6ZA 5C8ZA 5ALEA 1QIGA 3UUEA 3STUA 2DCMA 2J3QA 2EDAA 4M0EA 2WIGA 4H7IA 4FDMA 3F9CA 4BCCA 1VJ5A 3HJUA 4HXFB 3I28A 5FV4A 2DR0A 4HVTA 2QKYA 1VE6A 2GBIA 4QWMA 3KWFA 5ALTA 2QM0A 3IUMA 3GELA 5AK5A 3CXUA 5AKXA 4BBZA 5LKAA 1CVLA 4BRZA 4B80A 3G8YA 3UUFA 1XQWA 3M81A 4GDMA 2HFJA 2GYUA 3I6YA 4EHBA 2ZYRA 2JGFA 3N0TA 1QIHA 5AK4A 5DYWA 3TGLA 4ARBA 4PF1A 5IKXA 2PL5A 4BP8A 4UHHA 3FVRA 5ALRA 1XRQA 1TAHA 1W75A 5CH8A 3GA7A 1L7AA 1BU8A 4AN0A 4G4GA 3MGAA 4OD0A 4G9GA 4BCDA 1CQZA 2CUTA 2ZJFA 2FJPA 1DTEA 3W9UA 1PJAA 5E4TA 3H19A 2ZSIA 4KEAA 2WUGA 1ZJ5A 1UXOA 3O0DA 4HXGA 4MXDA 3HSSA 5FDFA 4WY5A 2YASA 4GECA 3V9AA 2OCGA 4BB0A 1EDEA 3WZMA 2WJ3A 4B83A 1UT6A 2W22A 1XRLA 3ICWA 5ALGA 4DM7A 1J2EA 1XLWA 3G02A 3GFFA 4FWBA 2JGMA 3ZV7A 3G7NA 4ZXFA 1SCKA 2OGZA 3V1MA 3OM8A 3V1LA 4EA6A 2PUHA 1FFAA 4TGLA 5FPQA 1GKLA 4C01A 4J0KA 2XQGA 1XZJA 2BAGA 4WY8A 5ALJA 4P93A 3D4LA 2FJ0A 3FYTA 2HA4A 3DL4A 1GPKA 4DGQA 4G4IA 5AOAA 2X76A 5AI5A 2QRUA 2XMGA 2WHPB 2CEKA 1MAAA 4I3FA 3F97A 1IUNA 1R50A 1W52X 1QFSA 1H22A 3F67A 5CXUA 3QITA 2QS9A 2WTMA 4DSAA 4OYYA 4ZWNA 1ZD3A 1CUZA 2WFLA 2XI4A 3DKRA 3AZPA 4U2GA 1C4XA 4A23A 5D7BA 1IVYA 2UZ0A 3QPAA 1Y7IA 4HTAA 2WIFA 4FLFA 3C5WP 3G0BA 2QUAA 4X6UA 3B3QA 4Y2XA 3VVMA 3O4HA 4J0IA 5LYYA 1CQWA 2ES4A 2OAEA 2Y2VA 3WWEA 1GT6A 2XUAA 4G8DA 3BE8A 1AZWA 5AM5A 3WL6A 2AJDA 3FLBA 2IIVA 3DQZA 3FSGA 4FFWA 2ZJ6A 4EY7A 4OU5A 1A7UA 5JD5A 3WL7A 2WG1A 1TRHA 3WWCA 5JADA 1GGVA 5T4EA 1LPSA 1LPMA 1K63A 2CKMA 2DFPA 2QUBA 4XX1A 1CUCA 5CT5A 4AXBA 3WA7A 4IH4A 4ROTA 3I2JA 2FUKA 5FOQA 3PDCA 5HZGA 1CFJA 2VT7A 1DU4A 2WJ4A 4UHEA 4BZZA 1LPBB 3H2GA 1HBJA 3W05A 1U2EA 4ITVA 2VEOA 4QNNA 3PICA 3WJ1A 1UKAA 3PE6A 4GWLA 4CI9A 1GQSA 4G8CA 1XZDA 4J03A 3LIIA 3C8DA 1MAHA 1UK8A 1XQYA 2Y2UA 3QMMA 3O4GA 3D5EA 3G9ZA 3WK6A 3QBJA 3WK8A 5DYTA 2IX9A 3BDIA 4MQLA 4X6YA 1CLEA 3F96A 3IIIA 1HQDA 1QONA 4G1FA 4K6GA 4HRXA 4XJVA 5CW2A 4J0GA 2WU3A 4PV7A 4BAUA 1SOMA 3V1KA 3D0KA 2OCIA 1UZAA 3WWPA 5JAUA 3NWOA 5AM1A 1JU3A 4J0JA 3HRHA 1UK6A 3EQ9A 1TCCA 3VKFA 3L1HA 4KR0A 1EINA 1PFQA 1A8UA 1DQZA 4BVJA 4P92A 3KDAA 3FCXA 4WDQA 4BRSA 1BN6A 3PUHA 5F4ZA 3CN7A 2JF0A 3SX4A 4RPCA 5HF8A 3BIWA 1QIEA 5HF5A 5A7HA 4D9JA 5EIHA 2PVSA 5K3BA 4A16A 2PKYX 4YPVA 3OOSA 3FCYA 5JAHA 1LLFA 4EY5A 4KRXA 2VJDA 3IBTA 2XUKA 1QGED 5DNWA 3KXPA 3WL5A 5EHZA 3WWDA 2H9YA 4Y9SA 3H04A 1Q0RA 4LKOA 3HACA 2JBWA
chains in the Genus database with same CATH superfamily
4YK7A 2HEGA 1JFVA 4AO7A 3K70D 3EHDA 4TRRA 4W9MC 2C42A 4FT2A 2HR1A 3OFNA 2OZPA 4C4OA 4BKQA 4EY6A 1UM9B 2E4WA 1L4NA 3FSRA 3OFVA 5AXDA 4DA8A 1EUYA 2CCGA 3IKVA 4JP2A 3IMKA 1E3JA 1N6KA 2D54A 2OAP1 3MBKA 2HQBA 3L8ZA 4D0GA 4KUHA 3BN3A 5KU1A 2XH8A 4MYSA 3AU9A 3FPHA 4QDOA 4TV8A 5SZJA 2HLNA 2JCSA 4V3CA 4N5NA 3TOZA 1G6Q1 4FJ2A 1O8CA 1QYVA 1YL7A 1KYTA 2IA5A 3I64A 4EY3A 1L7VC 3CG4A 4IGEA 4NCIA 4QD3A 3SKVA 4HFRA 3VKUA 3GPLA 1QHIA 4EGQA 2QEQA 5CTAA 1FQWA 1PJQA 2C8LA 2VXCA 3LXUX 4Z86A 1KOLA 1N92A 2GA8A 3BCUA 2X4DA 2E4XA 3WLOA 5DXJA 1T8WA 3BF7A 1W1IA 3NHRA 4MHOA 2FSSA 4WN3A 2O8FB 1TF2A 2WNIA 2HX1A 1IQPA 4AIIA 2O54A 2GM4A 4QYXA 4U5QA 3K0SA 3LYUA 4QYIB 2IF2A 3TO5A 5GINE 1OXBB 2XMCA 3MCUA 4GGPA 1K4KA 3O8CA 5AW6A 2O2CA 2AE1A 3QFHA 4HGPA 5DBOA 4BNXA 2UXCB 2J0QA 3IUBA 2RGDA 4ZFNA 5LP1A 2H2DA 4BMOB 1H2WA 2GXUA 1JEQA 1N3YA 2D4AA 2LCIA 1OLSA 3L7BA 4W8HA 1L8XA 1LS6A 4CV3A 5DWVA 3DHEA 3Q7TA 1JHAA 2DP4E 2WJHA 3C5EA 1TA4A 1YR1A 1M66A 2GB4A 2J3LA 2WHQA 4OQDA 3SIXA 4A0HA 3UN1A 5JWHA 1QIKA 3CR7A 1DDOA 2FKAA 3VO2A 4J3JA 1HE3A 5A9SB 5KX5F 4GICA 1O94A 4GG1A 3B82A 3V4SA 4DL9A 3D3KA 3R4CA 4F8EA 3GZTB 1YI1A 3SK0A 5JVDB 5IXYA 4GUDA 4U7PB 2OHXA 3E3AA 1RRMA 2XA1A 4GSYA 2IQ5A 2QMOA 2XIQA 3EIOA 4RQAA 4DEXA 5A5EA 5JD4A 1KGDA 1PE0A 4Q48A 3WI7A 5ERYA 3UK1A 3GAAA 2ZUDA 3IEXA 2R6R1 3OM9A 2NU8B 3LCCA 4HAOA 3TTVA 2LW7A 4B2IA 1CUWA 3C7TA 1LJLA 1Z7WA 2ZLBA 3I4CA 2QU7A 2R6AA 3OTHA 1IN6A 1OREA 2RI0A 3KT3A 3S1AA 3ICQB 4UEWA 3RU9A 5I3ZA 2B20A 4R68A 1NBHA 4Q3LA 3ZDXB 1DO0A 3LUJA 4ODIA 4Q1BA 2OVFA 3CLSC 5DNYB 5A71A 4FW9A 2LNDA 3TE7A 1JEYB 2J4CA 1D2NA 1C7JA 1EFCA 2GDJA 2F55A 3JYLA 1JDUA 3E5HA 5FL7D 1UZLA 3PQ8A 2R2AA 1Q74A 1E3WB 2R87A 3A8TA 3CEPB 4YDRA 1NJ6A 2HO4A 5J63A 1PTJC 4FJ1A 3ZE7A 2BGMA 3GGJA 1Y3DE 2C2ZA 1KR5A 1TJPB 3HZZA 4REQB 3NBYC 3I76A 3B6ZA 3KYBA 1GPYA 2QJOA 4RF4A 4KFCA 1QQBA 2E37A 3K0AB 1RP7A 2IOFA 2R6HA 3KB2A 1YB7A 5GZ3A 1HTWA 1VCIA 2P6NA 1IB0A 4Y98A 5KWEA 4ZV4A 4U7DA 1IWOA 3LECA 1I4TD 4FQ5A 3A4TA 1AB6A 3NWEA 1Z0SA 1FVFA 5AI4A 2DSNA 4EB0A 3F8SA 4Z2YA 1UC8A 4ZVTA 3QKTA 5CPFA 2XPCA 4MV8A 4NTZA 4R2IA 5KPDA 1J9EA 1UBKS 1CIVA 4JU9A 1I8TA 1ZPDA 2Q4DA 2QAJA 1JZSA 1RJ9B 3BS4A 5THQA 4PCUA 2PO7A 4E15A 3K8YA 2OO5A 4E1VA 1EZ4A 4WACA 5I9LA 1VMKA 3BSSA 4JUDX 3L46A 4NOLA 4TMYA 1QM5A 1SKYB 2GEKA 1AIPA 1E2FA 3OJWA 4Z9YA 1IEXA 3FPLA 3UAOA 1VP9A 1SVUA 2IIPA 3RAPR 1KO4A 1OWMA 1O9HA 4QJBA 4XJXA 5GJWC 3L93A 5J5CA 4KPUB 4C7KA 1JH8A 7MHTA 4CM4B 3R7WB 2OENG 2I6SA 4JGBA 1WUTA 1JDBC 2QTNA 4WDRA 3AF5A 5JFTA 1AX9A 3PDIA 1E1DA 5I6DA 2ZFUA 4H0FA 1WMDA 4N6GA 3QFFA 4L9AA 4PG7A 4IDDA 5G1PA 1G38A 3I1JA 3GFQA 1XKXA 3AEKB 2C7VA 3U26A 3SSNA 5K3CA 1ODLA 3IJEB 1JHDA 1C3OA 2JIMA 1PSZA 2ZQ5A 4FIZA 5E7JA 2QDXA 1W5EA 3DW1X 3FGOA 1A1VA 5JS1A 3M2TA 1QDUA 2NO4A 3SXPA 5IHXA 2ZS8A 2W2VA 3GUHA 3LXMA 3NM4A 4QPNA 3NHSA 2FRDA 3HC7A 4HEJA 3GLKA 3ONWA 4LPSA 1TCBA 5FR2A 1VMDA 3BB4A 1BHO1 1HH4A 1YE8A 1ZA2A 2R44A 3ZDRA 1YUMA 3ZEIA 5GQSA 1M1NB 1RYDA 3B60A 4B7XA 1Z29A 3FBWA 2OOKA 4UHBA 2C9BA 4H4EA 4QODA 3E7PA 1GPH1 5A6VA 1HV8A 4P80A 4GKBA 2WUFA 2VT6A 4O33A 2BJHA 4TSKA 2AFRA 3EB9A 4HMQA 3W1WA 1FRVA 1ZD9A 4EL5A 5LJLA 3HVRA 4NV3A 3U3MA 2WMYA 1FRFS 1WXHA 2VCEA 2IZ5A 2NOAA 1RHRA 2AUTA 2K4MA 3DDWA 2FPLA 5KSYA 3CS3A 2DUUA 1N5OX 3NIBA 1P61B 3HCPA 3LVBA 4B5LA 2XAAA 2ZR7A 3EMBA 1NXVA 1LXCA 2PUTA 1ODTC 1JLLB 1XEXB 4KQIA 1G7TA 1XXHA 5JNUA 1DG3A 2NUAA 5CT6A 1NVTA 2PQ6A 3GO4A 5AUOB 1XLTA 4S1TA 4S2UA 3ZE0B 2RGAA 3UATA 4I19A 3I8OA 5DNUA 3A6JA 4DJ5X 2AJ8A 3LRTA 1YZQA 3OUUA 4WQMA 3C3EA 4YMUA 2YW2A 4TLEA 1PJTA 2FVYA 4GM1A 1BS1A 5JFOA 5G1OA 1YQWA 1PR4A 4NZ9A 2O0HA 4UXIA 1GUAA 3CUVA 3FPFA 3LYAA 1G8HA 2CZQA 1GGJA 1VSTA 5JVDF 3LL4A 1ZESA 7YASA 1WX1A 3ZV4A 3REGA 4ENVA 1YA6A 4PR3A 2NO0A 1Q2XA 3SYRA 4GE0A 3UV7A 1IMJA 1CUHA 3PKJA 3VR3D 1T1IA 2XNCA 3RSHA 2P4HX 1I6LA 3WLMA 4PSCA 3TZEA 2PS0A 2VF4X 2DC1A 5CFRA 1SIBE 2ZVQX 2C94A 1XV5A 3E1KA 1YB1A 2GILA 2GLUA 4AJ2A 1UC5B 2DFKB 3I2IA 4ATNA 1HE5A 2Z3WA 5JS6A 2NW6A 3ZLJA 1BCRB 2PGJA 1Q15A 2ZUSA 3NXKA 1RPJA 3EEBA 1GXSB 1Q95A 3N2NA 4IJUA 2H16A 4YP5A 4CM6A 4C3ZA 2DQZA 2GN4A 3EVCA 3BPSA 1H3EA 2W7TA 4I6GA 4JLMA 3ZHCA 2OORA 2VJAA 4D6PA 4I4IA 3PG5A 4M88A 3CLTD 4BMYA 1RM4A 4CNBA 3DBRB 4UVIA 1R2QA 2FE1A 5LYJB 5HM6A 3TSWA 1T29A 4PQEA 2C5GA 3WTBA 2ZJ8A 4XVQA 5LZ4A 1K7SN 3MINA 3JATA 3QPDA 2OPHA 5L4SA 2VWHA 2O2SA 1HC7A 3DFKA 1DHTA 1XJWA 1ZNYA 2C03A 3LQFA 2PRJA 5FCDA 4KE7A 4P9NA 2NZVG 4PY2A 5IC6A 3G0CA 4UDXX 1XDUA 3W5JA 3F90A 3RVSA 4W7HA 3ISTA 4QBGB 3WIEA 5FTMA 4QHTA 2C78A 2GAJA 4C3VA 4QVKA 4EJSC 2GPTA 3D6TB 1GQ2A 3R41A 2OLKA 4NCXA 4Q4JA 2Y71A 3CUTA 4KN9S 1DWPA 5EIBD 4FKZA 3NTVA 4B40A 4WOJA 3ZIAA 5AI9A 1SVOA 1GNVA 1OGJA 2R68A 1SHJA 4ITRC 4AD8A 5KWVA 1NC3A 3AY6A 1U0SY 1QZZA 4ZOLA 1WWKA 4IRUB 4NKRA 4WFKA 2VT2A 1H6DA 3EZGA 4GD3Q 2H4XA 2INGX 3R0JA 3U0VA 4EELA 1IBSA 5JZVA 3FLEA 3TVYA 3UG6A 5B4UA 4XB1A 4CU2A 1P75A 3CRRA 4JQZA 3JQAB 1GCIA 2PUGA 3RF6A 3RC8A 4L0CA 4NH4A 3OSZA 2PKWA 1NJFA 1HFKA 3L02A 1ZUNA 3A7EA 3DT8A 3A1EA 3ZIUA 1PJSA 1IM5A 3IAFA 1MO6A 2UKDA 2WYOA 4Q7KA 4CI0B 2WJ6A 2F1IA 3ESAA 3GN2A 2I6XA 4FD2A 4FYMA 1YU6A 3A37A 1YVUA 3JWHA 5B3JC 4P22A 2K7ZA 4BFYA 4FWIB 2IC5A 5BV8A 3JW8A 1LFAA 3J81A 2QY6A 2GYVA 4H4DA 1ZIDA 2D0PB 2H59A 4YCJA 4NBUA 5DK6A 4HEA6 2ID4A 1VJCA 2ZUFA 2F3PA 1MW9X 1EP2B 1GEEA 1OBFO 2QZJA 1YA8A 2R1TA 3AINA 5BR4A 2QG4A 1DKPA 4NU0A 3SX0A 4L76A 1CW2B 2WA2A 3UK6A 3H84A 4E7PA 3RT9A 3B12A 4DA4A 3GG9A 1D8AA 4KI0A 3DTVA 4BQEA 3ASYA 3K92A 1YHNA 2PUEA 3IO5A 2OAGA 2VPYA 4YJFA 4ZI3A 3GJTA 1N8KA 4ZZ1A 4PAQA 2IEZA 1RYFA 4K3UA 3M1AA 2C2WA 3MAAC 4ZRMA 1A8PA 3G6WA 2CDAA 4I3GA 2X3UA 5JQGB 2NAFA 4NBRA 3CTPA 1SXGA 2OL4A 3WG9A 4D9NA 4D5GA 4MCHA 3SJCA 3F6YA 4F0JA 3FHTA 1AHIA 2R8BA 4FMDF 4NBLA 1ZG3A 4CFSA 3NVMB 2IXBA 3IODA 2CB9A 2PA3A 1BOFA 3BAZA 2AZMA 2AC4A 2HRDA 3BMOB 3JQ7B 2EATA 3AESA 3EG5A 3PENA 3QKRB 4PC6A 1RWBA 1UC9A 5DNVA 5EVCA 3B85A 4D44A 2QAGB 2GYYA 1RPZA 4URVR 4P3NA 4CT0A 5T41A 3KU1A 3I5UA 1ZSVA 5JCJA 2W70A 5FUXA 1WCYA 3AF2A 4HFJA 4HY3A 3PFGA 2R66A 4YJGA 1QIDA 1S0UA 4MMXB 2RH4A 4BB6A 1R6DA 1VG8A 1UMCB 1KSHA 3COVA 3K15A 3OPMA 4MUFA 4N65A 5C8YF 3BVPA 3I6QA 2P0EA 4BNVA 1KY2A 2IRWA 1K6JA 2VQEB 1YHZA 2F2TA 2PMBA 1BVYF 3B5JA 2GZ1A 1E3IA 3JQRA 1PR9A 1FE8A 1DQYA 3BWBA 4EJ6A 2AD1A 1T25A 4HNGA 4C5BA 2VK8A 2ZYUX 3G2PA 2RC6A 3O93A 4JFAA 4Y6RA 5HYVA 2AR7A 2V96A 1FQKA 3QMPA 4QT0A 2GFHA 2YYSA 5D87A 3WHLA 2RGCA 2GEFA 1OBOA 1ZKMA 2EJCA 2PFKA 2O5RA 1FNNA 1K7EB 1ZU4A 3FF1A 3GVCA 4MI6A 4QSMA 4S2EA 2QR2A 3WL8A 5HUHA 4XWWA 1E9RA 2GAFA 3BWVA 3HR7A 2ZULA 1C0LA 1NV9A 3FRJA 1LWNA 1X8JA 3L4KA 3Q12A 3B6KA 4U7HA 5WRFA 5LOVA 4CM1A 1AT1A 3ORHA 5CCEA 4LHXA 5AVTA 1UOEA 1JHYA 2WQZA 2P9JA 1QJ4A 4ZPXA 1VJDA 1TO2E 1W5FA 2QRGA 3O7MA 3CLUD 4R4JA 1ZOOA 4DJFC 2V03A 3E82A 5FNVB 4QOIA 3MTAA 5JIBA 2J3DA 3BHNA 2HWKA 1FVOA 2AXEA 1VRWA 1MEJA 1XL1A 1U0TA 2ZRAA 2VP6A 3KOXA 4RU1A 5HDQA 1XYVA 2JJ2A 3I9NA 3OWOA 4P35A 3C87A 5LYJF 3K9FC 2EHJA 1OZAA 1TO6A 5CNIA 1O6ZA 2Z2KA 3EUWA 5E0OA 1V37A 6GPBA 1GLVA 1AKQA 1G7SA 2JIDA 4Y1EA 3EEFA 1I51A 1DL5A 4D4GA 1ZBDA 1Y4UA 3AJ9A 3I2HA 2W6ZA 1ZM3A 4N40A 2PRKA 3I4FA 1KEEA 1YWGO 3MERA 4ZMBA 4KFSA 1H1TA 4PZAA 4QWWA 1P31A 4FBMA 4Q9IA 2O1WA 3R7FA 2B30A 3VDNB 2XQFA 1WZNA 1EHIA 2XMRA 4MX8A 4UFNA 1QE0A 1WMFA 2FZKA 2H3EA 2X6TA 3CSDA 3ICVA 3SU8A 1CJVC 4ZYXA 1JAXA 1U1FA 1N9GB 1T3ZA 1U7UA 3NU1A 1XQXA 4ZARA 3S0JA 3CVUA 1NW6A 1T4CA 1UDXA 2AFHE 2GHTA 4PCLA 5MN4A 3EXAA 1E20A 3WBKA 1F2TA 2UYQA 4QGAA 4HFMA 1S5PA 4E13A 5C3MA 3VMMA 5CA0B 2BKLA 1ZEMA 4NR0A 5E2AA 1QRUA 1K0UA 2HMAA 4MS3B 4NJMA 4U5XA 1QDEA 5G4KB 4BDTA 2A78A 2J67A 5CVVA 4EY4A 1L7EA 4BGDA 1NW8A 2AG0A 3GJXC 1GRNA 2QPAA 3VPBA 3QWAA 1JE0A 1GZUA 2BE7A 5EIOA 3EVDA 4DDVA 3GLFB 4CN8A 4MWEA 1QNLA 2HMVA 2OHOA 3M9WA 1I1QB 3PXXA 3TX6A 4A6XA 5HVNA 1DAMA 5TGTA 3NJ4A 3JQGB 4HAUA 4Z9XA 1M8GA 1B8NA 2CN1A 2CHQA 1CR1A 3HQ4O 4ZVQA 3HB5X 4O2AA 1DS6A 5AIBA 2M2IA 2VP2A 5BSFA 1X8KA 1CRWG 5ALNA 2VJCA 3U4IA 5JCXA 1KETA 1PVVA 4HAYA 5E1BA 4RQTA 1P5HA 2G1UA 3NRCA 3BRSA 3S99A 1BEUB 4B3JA 1N2EA 4B3SB 1K7XB 3A25A 3GEEA 4P83A 1JL3A 4U0JA 4KNVA 1CZHA 4R7TA 1LSJA 5TRTA 3T5GA 2Q8PA 1QF6A 2D3TA 3K35A 2DPLA 3GW8A 1IVNA 4FYVA 3DOHA 1CFZA 4H17A 2JA1A 1EK1A 5BQ3A 3FFAA 4LYYA 5JQGF 2A92A 3QXJA 4B44A 2VUHB 1WF6A 3D8HA 4Q39A 2CJWA 4RLHA 4AWAA 3ZHOA 2JD1A 2P1DA 1V5FA 3F5FA 3GLRA 1X7ZB 3HZHA 4I9GA 1PVOA 3KKLA 4DY4A 5EUQB 2Z08A 1BDBA 3BWEA 3AJRA 4KH0A 1IN7A 3WQSB 3CRW1 2HJHA 3K1ZA 1NBAA 2FSIA 2R7AA 4WH0A 3V9PA 1QTNA 3RHSA 3F46A 3HI6A 4ZAYA 4QUAA 4PEVA 3SD7A 4DF3A 3LW8A 3OUTA 4B0PA 3GQBB 3OIGA 3GWGA 4B3RB 2NG1A 1GA1A 3INYA 2C4MA 4ZXPA 4GMDA 3RAJA 3TB6A 4CDRA 4OTZA 1GPJA 4Z3DA 3PD0A 1DVRA 1XAGA 1HZJA 3AUKA 1U7PA 3FHLA 3QVWA 2JGLA 3OWHA 4OG2A 5I7HA 4HMPA 1PDOA 2C54A 1OV4A 2Z1MA 2CMHA 4C20A 3FUTA 1Q77A 1QR6A 4GYKA 3IMGA 2ERCA 5C7YA 2ZBVA 3K16A 3A6DA 4X94A 3ZV6A 4FT4A 3SYMA 2HFKA 3KWLA 1Q7TA 1YJAA 3B1KA 1SZDA 4M9RA 4AKHA 3M4NA 5GV7A 4DW8A 3H2JA 3IDSA 2Z56A 1S3IA 2XYHA 3TTTA 3GVPA 2P6UA 1UODA 2FZ5A 3HA3A 2VPXA 4X85A 3RB8A 5JYDA 5TGZA 4QDZA 5H68A 1C7FA 2GD0A 1I0IA 2XR1A 4A15A 3JRNA 3ORYA 3W2TA 2P69A 2WK1A 5HDBB 3AEUB 1YD7A 1Z3CA 2GFQA 2HH9A 2C2MA 4LIPD 3TDNA 5JCZA 1L5VA 3CT6A 1JQJC 1KI9A 2BJWA 2BZSA 4K9LA 1R9NA 2Z1NA 2EU8A 2ZB3A 4O4LA 3KKPA 1XF1A 3GF4A 2XKAA 2CL0X 3QU5A 5DHQA 4MCAA 3UT6A 2PS1A 3QF4A 3L8DA 1HMYA 2G40A 4AUEA 4BNNA 5FNVF 1YJ5A 5DYYA 2R7KA 1G0NA 3AFGA 4WZAB 1JYFA 3ET4A 4X44A 2GA9A 1CS0A 1U63A 4CLDA 2X86A 2PJDA 1HDYA 3AHJA 4XH9B 3G6KA 4QE3A 4EO9A 1IVSA 1P77A 2QTMA 4QU0A 3F3SA 2KI5A 1R0BA 4TQAA 4BVHA 3CW8X 4CNQA 4F4UA 1DWQA 1EYZA 2CDRA 2GF2A 2EKBA 2Q5QA 4F3CA 2M6LA 4P4SB 4JQSA 3TQRA 3BCRA 3GLGA 3O47A 5AHXA 1K7YA 2EZ4A 1AK9A 3GJZA 3PVSA 5E9WA 5IXJA 2DUNA 2JEZA 4XPZA 4DCGA 2XOXA 3EDQA 3BDAA 4FGUA 4N4AA 1MAWA 4U2FA 1VG9B 1Y1RA 1ZCAA 2CNKA 2COEA 4NBNA 1P8AA 2I2DA 3I9V1 4NYIQ 5C8DA 5K0CA 2HNKA 4TLDA 4OATA 3BRCA 4HSEA 1NRWA 2IS4A 3NV9A 1G8PA 1KP2A 1IK6A 1NYTA 1UBNA 2VF8A 4RXMA 4WOBA 5EUMA 5TVGA 1ML4A 4G89A 3CZRA 4D3YA 3KAQA 2GJAA 4URZR 1WBBA 4C2AA 5JNRA 1IYZA 3CUKA 3D1VA 4EA9A 5AUQA 2OFFA 1LLCA 3WDLA 1NQUA 3AVYA 1E1MA 1Y80A 3FDXA 4LMPA 3OE7D 4XIYA 5HF9A 1FFEA 3HSYA 1EFVA 3T3MB 3WP1B 1V6CA 3RRNA 1XMJA 1FEZA 3FIJA 3AGQA 2LDBA 4G81A 4PS0A 1P4GA 3I9JA 4ALMA 1WXXA 3P9IA 3NANA 1E1CA 3OPYA 1O54A 4RPLA 1C5KA 1ZXXA 5JXHA 5FI0B 1Z6YA 3Q9LA 1NI5A 1R5JA 2JJ1D 5EE1A 3VNAA 2VP4A 4DOMA 3WRYC 1E66A 1V43A 4RJKA 1VYHA 3CRVA 2DLDA 3D6HA 1U0RA 1ZD8A 2AWNA 2EBHX 2EW2A 2HSZA 3NOVA 3RSQA 3GRUA 4HR7A 4R0NA 3LVFO 4FEEA 1OLXA 4FN5A 3OF5A 1II8A 1KMHA 4LGCA 3LBAA 5D84A 4EAQA 3UJNA 2A9VA 3C7CB 2RMKA 3LFUA 4OCZA 2AC7A 4ZVNA 4HYEA 2ILVA 4F4JA 1DQSA 1OPRA 2CDCA 1DT3A 1MF7A 3L41A 3P9NA 3GNLA 3ZWAA 3Q7PA 3LM8A 5L40A 5KSPA 2X2OA 5JT1A 4HPWA 2K7FA 1C29B 3VR5H 1JIUA 4HDNA 5BV7A 3OD1A 2C8JA 3VH1A 1K86A 2HSJA 3E7WA 5AM0A 3VJLA 2HU8A 1UPXA 3EK2A 4RW0A 1FYDA 3MRVA 5ER9A 4B6EA 5ITVA 3UY4A 3KXKA 1P60A 2PJZA 2B1IA 4EFLA 1ESZA 2WDPA 4CLRA 3X1KA 3M6LA 3PCRB 4K03A 3THOA 3UWKA 5JPDA 1FFXB 4K88A 5CBKA 3RIXA 4AMYA 1BMQA 4C04A 4CRWB 5IS2A 2JJMA 2J7PD 3KUKA 4IGFA 5TS3A 3W5AA 4PAGA 1BA3A 2GPBA 1H0SA 5AQEA 5KNCD 2OCDA 3HDQA 5JTTA 1V9SA 2JIZA 4YASA 4TMTA 5B57C 1I36A 4E2FA 3CKYA 2Z57A 2C1ZA 3ZJVA 4NHOA 4K9OA 5DRYA 1JSZA 5FUYA 3ZHUA 5IG2A 4JBXA 4L22A 3GJ0A 2FK7A 3LX4A 5MFZA 2AKEA 4XYLA 4I55B 2DEUA 2F6RA 1N0IA 4LGYA 4C5AA 2ACEA 3SXJA 3U16A 1AM4D 1BCSA 1PDVA 1QJCA 3GDFA 1IIRA 1CVIA 1DWOA 2FMKA 1KH2A 1M7GA 1TJ5A 5CYPA 2BKVA 4JEIA 1N8TA 1QFJA 5TSDA 4JQOA 3PXGA 3AF0A 3K9NA 3PI6A 4MVXA 4CR8A 4D9BA 5FADA 5KNDA 3BB3A 1TAQA 3LHSA 3VBCA 4OBXA 5LZ9A 1N7HA 2C4VA 4JV5B 2RARA 2VR1A 3AR3A 4OQ4A 3RUDA 4FFVA 1YNSA 2CVPA 5INTA 2BDUA 3VSDA 621PA 1EVIA 5SZIA 3CW2A 3K20A 1FQOA 2ISCA 3NRJA 2C5SA 4IIJA 5CFOA 4TRJA 4AJHA 2O59A 2QUHA 3IGFA 1Y0BA 1CY0A 5LQRA 3WB0A 1PS9A 4BWFB 5KTRA 1F4PA 4TV9B 2VT3A 4RPIA 1ZH4A 3R8XA 2GBLC 4I66A 4G1UC 4J7UA 1KZ1A 4N01A 3P1JA 4ENQA 1IC6A 3L49A 1GARA 5FAXA 2YXEA 3L92A 4EKDA 3SP1A 1CF4A 1QRDA 1W36C 1RHJA 3P32A 3QPVA 3IULA 2XTMA 4BP9A 3KBBA 1Y9EA 1QGUB 2PYIA 3KG2A 4L4SA 3E9RA 1ZEJA 3R44A 1A5ZA 1JE1A 2QUKA 4WKOA 3IFSA 4XTCS 3IHLA 2REQB 3OIYA 4V39A 1USWA 3QBVA 3WZLA 4AS3A 3BTUA 5F23A 3WISA 3QYJA 2P67A 4D1YA 2SHKA 3CCCA 3FZYA 4XKJA 4LXGA 3T1QA 2LBPA 4RPKA 4CEIA 3B36A 4JNKA 2R4UA 1LX7A 1Y6GA 1FNMA 2JZOA 2QWXA 2VNAA 3PCTA 2CJYA 1NJGA 1Z2OX 5ALQA 3V80A 5BYKA 4DB2A 2C84A 3FUXA 2QX8A 3T52A 3R5TA 1NW5A 1FPMA 4KXLA 3VKVA 4YMGA 5IF9A 4LFAB 2ZJBA 3JZAA 2H1IA 5HJ7A 5BQPA 3GWZA 4GAEA 1D0VA 1BWSA 2IZ7A 4ZVKA 7AT1A 3PGLA 4W1PA 2SCUB 2BGIA 1PP4A 4MKFA 3ZDDA 2OMKA 1E2NA 3A4MA 4GWGA 5CIYA 4AUKA 4ZEVA 1VA5A 4DYVA 1D6SA 2YV1A 4G5FA 1WMEA 5C2JB 1XQVA 3MM4A 5JW6A 4RH1A 3K5IA 5K3FB 4IDBA 1D4AA 4Y2UA 4ND2A 2K2QB 3HUEA 1Z0IA 2Q4RA 3AP2A 4XYBA 2BFEB 2H07A 4P3XA 3JYPA 4F2WA 5BPHA 1DC3A 4DV2B 3H05A 4C7MA 1HOTA 4QYMA 2Y1LA 4A6PA 5BMVB 1KXJA 1OA0A 3RKSA 2ZAMA 2PYDA 2WM3A 1AKNA 4MWCA 1QHHB 4YRGA 3OEYA 1WV1A 2J3MA 4I08A 3ZVNA 4EG3A 1M2FA 3P96A 3ELBA 1ZMBA 3L4BC 3HN7A 1AQLA 3K5HA 3EFOA 2NXWA 1MOZA 1PZFA 3JS5A 4X3CA 2G6BA 2ZROA 4UCWA 4R2KA 3BORA 4QOFA 2GNOA 4P33A 4RACA 3DZFA 2LIPA 4U4AA 2YZ2A 5L3RA 5M7EA 3M34A 3OE1A 3F4KA 4PYMA 3ZGNA 4R9VA 1WCWA 4QBTA 1EX1A 2RSLA 5BW6B 3ST7A 2ZYVX 4Y2VA 2QJWA 2OHHA 1W46A 1ZLXA 3LGSA 4ALJA 3BBLA 5TMDA 1BDHA 1H1LA 4Z4FA 1YF3A 5ED4A 4YQZA 2B7BA 1MFZA 2Z2JA 2ZI3A 1Z4OA 3G0IA 3I92A 5C7LO 2VK1A 2WUEA 5K4GA 3U39A 3CHYA 4PX2A 1X7XA 4IWNA 3LWNA 4ZANA 1RT9A 3MSCA 1O5TA 4Q66C 1NX9A 2OQIA 3A28A 3PYMA 3M4YA 4JUAA 2PXCA 2QQ5A 3VH4A 2V98A 1U5BA 1ADJA 5F7OA 4N7BA 1EWKA 3BJZA 3N0VA 1YRAA 5DEOA 2V7GA 1ISHA 1KS9A 2JEOA 1BE8A 1ZOLA 3BMQB 5FFFA 4BVAA 1Z4PX 2VHUA 4KE6A 3K6SA 1WQ1R 2C5FA 2LKDA 4HUTA 3G1WA 5ALWA 3LDAA 4YGXB 2GQ0A 2EP7A 3HR4A 4G2TA 1NJ5A 3OZVA 4PRKA 2FUG1 3U3ZA 2JW5A 4RDIA 2PHZA 2WNHA 3I9MA 5EHXA 5HKKD 4URFA 1NNI1 2B5VA 3QZUA 4ZV9A 2I9PA 3Q15C 4KBGA 3VNVA 3C43A 1E98A 1NSFA 3V8RA 4F06A 5C1BA 3KYCB 5A5FA 1O89A 2E5LB 1XDWA 4ZA2A 1ODCA 3AHHA 4I55F 4CQNA 3HVKA 2EQAA 1FUEA 3DVSX 4N5MA 2Q5FA 1II9A 2QRNA 1Z8NA 3WMRA 5CH5A 4CPDA 1NP6A 1XX6A 3IPRA 4JASB 2MSWA 1FFCA 4H3VA 4HDMA 3ETHA 4H9GA 3UGTA 1KRHA 4I36A 3OETA 2FWIA 4IFTA 4WJLA 3LT5A 2A1UA 2Z9BA 3P9YA 4YRQA 3BFXA 3CE9A 4C4RA 4EENA 4JY7A 1PLLA 3B6EA 4H1UA 2OFWA 4BNLA 1BGXT 1ZWKA 1XKLA 2WB4A 4RKFA 1A69A 3EQZA 4HB0A 3KJHA 3F4BA 3M4XA 4Q3BA 3ZGXA 4F5DA 4NXNB 1NXSA 5LQJA 5EXXA 4H3SA 3C98A 4JGIA 1YGYA 3A1NA 1GRVA 2YXLA 2R5FA 3BWCA 3DR5A 3ETJA 3GZNA 1LX6A 3H6KA 3HU2A 3PZRA 3QX8A 4UAGA 1PEYA 4I4CA 3GIDA 5I9MA 1EA5A 1BDMA 1H42A 2BTQA 2EFDB 2BM0A 2ZI6A 4JIGA 4ARAA 1A9ZA 1V8BA 4WZBA 4DSZA 1WXDA 1XN1A 2MDTA 2Q5IA 3ZKWB 5A2GA 3UAYA 3KYDB 3RC1A 4AZWA 4RZIA 5FBZA 4NNJA 1WCXA 4DDUA 2Z6QA 2Q2WA 5DHSA 3IELA 1KZ4A 4I5DA 5KVQA 3OLYA 1XMIA 3OJOA 2HMYB 4JUBA 4LTNA 4WAUA 5LUBA 1RLJA 1ZYUA 2H9IA 1ECBA 1ETHA 1GYQA 1E6CA 2CDNA 2VHZA 4PICA 3DGEC 4ASUD 1EHYA 1XCPA 4P3YA 1QHSA 2DCUA 2I1QA 2AK2A 3T4EA 4AZ0B 4BMXA 2IHVA 4RD2A 1NVDA 1L0BA 5EPEA 3WDSA 1STOA 5IYZA 3BT7A 1E2HA 1JQDA 1PWXA 4C2BA 4DBLC 1E62A 5EL0A 1K9SA 3ILSA 3KKZA 1XZCA 5F7XA 2NQTA 2UZ1B 1K5PA 2HTFA 3KJIA 2H54A 2QYHA 2WEKA 3PRJA 1QCDA 4ZHQA 3NTRA 4F21A 3I0MA 3FVWA 1C8LA 5REQA 3ZH9B 4JI4B 1B0UA 2OD7A 2VZLA 2DBVO 3B7WA 3CJTA 3WIBA 5EP4A 4B3TB 1BXKA 1DJMA 1C4WA 4KQ9A 5TQVA 2RH5A 4BL5A 2WWXA 1FNBA 1QQ7A 2HNBA 3JYQA 3S2EA 4BQPA 3EVFA 2C7RA 5F5LA 4BP1A 2IDZA 3KQOA 4FFLA 2B1QA 1NZJA 1TW3A 3EIEA 2CLDX 4CEHA 2R1VA 2C0QA 1YI0A 1RYNA 4EUKA 3A04A 3LBIA 1YK1A 3L8EA 3F7OA 3H7IA 3LX5A 6REQA 1KFCB 4LJ6A 1B8UA 1RADA 4I2VA 3ZVRA 2YVUA 3GD5A 2AYXA 3ITKA 1ESNA 1SK9A 2WMOB 3KYIB 4R69A 1IBLB 2FNAA 1TZMA 2QL7A 3BE6A 3T95A 3EPJA 1Q91A 1JIVA 1USIA 1TJYA 2XMBA 3W90A 1ESDA 2EYUA 5BMVF 4FC7A 2O1EA 4B3GA 4M1TA 3UJ3X 5GV8A 3WIDA 1Z7YA 2D62A 1Q1AA 2GVZC 9ATCA 1AXEA 2GZRA 2ET6A 2RGUA 3QEBZ 4MGYR 4Z4HA 3C3MA 2ZWMA 5GMOA 2Y0EA 3C6XA 4DLTA 5JWOA 4RM2A 4I81A 4RLSA 1GPAA 1VG1A 1N2BA 2R00C 3GT0A 3STTA 1VLZA 2W43A 5LQSA 1GYRA 2AZ4A 3GHHA 4WV3A 3SWWA 5BN5B 2FW6A 3EE6A 3MJDA 3ZIDA 3NHBA 3W5BA 2ZM5A 4A8TA 3E9MA 3ZZ0A 1QR2A 2RHDA 2VJMB 4L95C 4E5MA 3E15A 2B1GA 3FHOA 3IMFA 3JCZA 1CV2A 1U8FO 2MR6A 3N2YA 1OILA 4GKVA 4UMEA 2FG7C 3T7IA 3ZGLA 4EB3A 2KJQA 5K2OA 4UD6A 3BEDA 3PV0A 5ALVA 4OXNA 1R9MA 3EG9B 5LQDA 4QVIA 3CVXA 1ZH2A 2ZRFA 3BWMA 3HDGA 3FPEA 4L7QA 4MR8A 1J9GA 3O8BA 3OT1A 4RY8A 4E33A 1HE1C 3ODPA 2B4YA 1UJBA 4JB0A 1TAGA 3LOPA 2X58A 4M1OA 3DEIA 4OXKA 2XQJA 2VZ8A 4ACBA 1W4CA 1PR5A 5G4LA 4MV4A 2PX6A 1Z38A 3N6XA 1SXJB 1RZRA 2CD7A 1ESEA 4N82A 1HT3A 2Q5LA 3E3NA 5DASA 4C4YA 4ZCIA 4CEJA 3PNSA 3F5MA 1Y1SA 2BGKA 2KW5A 1WD5A 4RTLA 1IK4A 1PW5A 3SNKA 3C3WA 3VZCA 5AVUA 4MV3A 2YRWA 1R6XA 3OLQA 1X86B 5IUKC 3N39C 4X7PA 4MVYA 2RDMA 4MVJF 2C07A 4D56A 3RWOA 1IUPA 1HFWA 5TS2A 3KQKA 2CGEA 4M7PA 1NBMD 2HJWA 3A3OA 4L4XA 4KSBA 3ZCVA 1DBIA 2PYZA 1VKHA 1K8RA 3OM1A 3BWDD 1R9JA 5A4AA 1LW7A 4GHWA 3MT9A 4ZIRB 3GLVA 5B7PA 1QVVA 2OC9A 1NP3A 2Q8NA 3MCWA 2FPOA 1G16A 4UJ5A 4YLEA 2FPPB 3M3DA 4GPZA 1XZNA 1JYSA 1Q16A 1Y4AE 1YNOA 2QYOA 4S12A 4NFLA 4HGYA 2IIQA 4O4JB 5CW1A 2XGJA 2HJRA 1K7FB 4MUIA 2IH5A 1CHDA 1NSTA 1VL0A 2CMKA 4KUEA 5B5SA 4POOA 1SOVA 1V6SA 1MXFA 1BX3A 3OA2A 1EBUA 1U9IC 3QLUC 4HGZA 3AJ8A 4O6VA 4D0LB 3DL7A 3A06A 2XRMA 1ZONA 3A32A 2VYCA 3KJGA 4MKIA 3DBLA 5JUWA 3RWMB 2WM8A 4YJ3B 1UDBA 3OT4A 3ZDBA 1R8YA 2RHOA 3HKDA 3SJZA 4GZMA 2XLBA 4QREA 2QR3A 3K9QO 4ID9A 3EC1A 5FUBA 1OHHD 1YQUA 3MMXA 4BVKA 1K1EA 3FNRA 1EMDA 4MJXA 2Q45A 5H9WA 4Q6BA 5B64A 2XECA 2W2LA 3GT3A 3HRIA 5E6RA 5EHGA 2NVBA 1E1RA 1WZIA 2ZDQA 3ZY6A 4ZYLA 2A4KA 2P6MA 4W1RA 1WHTB 1DEOA 1MH1A 1CUBA 2IUSA 1A2KC 2GN0A 2NPIA 3GEGA 3NUZA 3P5BA 2GARA 3QNMA 5EE0A 5J59A 3ZU5A 1Y6RA 2JBHA 3LBFA 5I4BA 2C82A 3BE5A 5AUNB 3G49A 5FA8A 1FDWA 1W0CA 2GBLA 1DX6A 1E7MA 4KMOA 4N8EA 5GONB 4BVLA 4DA9A 1GL7A 4DQUA 2IXGA 2PRSA 1XQ9A 4WK0B 2IXAA 3FWYA 3GH3A 2B4KA 4BFUA 5AKKA 4YAGA 2QZ4A 3U5TA 3B1WA 1W5AA 1L4MA 5F1KA 4AWXA 2I87A 3RHTA 4IMJB 3LY9A 3KJNA 2WMNB 4RKYA 4YROA 4F45A 1YS7A 1H85A 4KSYA 1IBRA 1KAGA 3CH6A 4G5RA 4OGLA 5EKTA 3KHUA 1MJGM 3IESA 4HEQA 3I3OA 4N47A 3SAJA 1WP9A 1BXRB 1B2RA 2FY8A 1PDWA 3O8LA 1RLUA 4YVFA 5H5JA 3W3ZB 4B5KA 1S8AA 1WETA 2PT7A 2GX6A 1RHQA 3MJRA 4AP6A 3U17A 1NDHA 1YR8A 3AW9A 1DNPA 5DI3B 4CT4B 4HS9A 1CJMA 2I80A 1UK9A 4O29A 2XUOA 5IX8A 4X91A 3S29A 1CY7A 5LB2A 3KSBC 5GVSA 1FOEB 1XTTA 2G63A 3B1VA 3VNBA 3AUTA 3ESDA 4MKHA 5EWJA 1PWEA 3QW4B 4RZ2A 1SIOA 2C9OA 3BXPA 2BZ1A 2OGSA 4UHCA 5CRIA 2I54A 4F60A 5BUCA 2MU1A 4F9FA 4ZEWA 1KI2A 3W2EA 4D42A 2GSWA 4TV8F 1RIFA 1JFRA 1KF0A 5CNKA 4GMHA 1TVCA 4P2BA 1JLKA 5TMBA 2VHYA 2VJBA 3AR6A 3PB3A 4UTRA 3U1TA 3GGDA 1AGRA 1RZUA 4AJEA 1CG6A 1RKBA 2ZJ7A 2JFFA 1UPTA 4IO0A 3FWPA 1OCEA 3PJEA 2VDMB 1L5KA 2H6EA 3RVJA 5CG2A 3T4PA 3ROMA 1BWQA 4AUNA 1JVSA 3EUFA 5JZBA 4JEHA 4Q16A 4Y8VA 5FL3A 1V5EA 1CPYA 4I9UA 1VJ1A 3FFWA 4MQEA 3W5HA 5KOHA 4FYYA 5DLYA 4FZVA 3TQQA 2ODNA 4YCNA 1NE7A 2C2GA 2YVQA 4MIEA 3NNDA 2DZDA 3KAKA 1A5TA 1HGXA 1M6VA 1DX9A 1P39A 1CB7A 4BATA 1AMOA 3F5QA 3T1OA 1ZS9A 2IKQA 2QTCA 1L4UA 3FYUA 5HILA 3HABA 4PTLA 5HFAA 2GBCA 1VBNA 1D6NA 2D4HA 4US1R 4JQYA 1VCHA 3EH1A 5C4GB 3DLCA 1Z25A 4OX9B 2RK6A 3MUFA 1M34A 5H59A 2OV1A 2BV3A 2RCNA 2W58A 2XTNA 3MMPA 3MS2A 2P2YA 3ZYCA 1J20A 3H1TA 1BMTA 2AFIB 2QVYX 3UK2A 3GRAA 4A73A 3G59A 2QMEA 3VPCA 3IAUA 3QG1A 3R6DA 4QFCA 3KOZA 5ALOA 3SJBA 1DMRA 3T41A 1DC7A 1BS9A 2AN9A 2I1VB 4H6WA 3A4VA 2PM8A 4I1IA 4JC4A 4MB0A 1OWOA 4QFDA 3JYHA 4TROA 4B3HA 1C9DB 3D8UA 5HBGA 1UL1X 4ZODA 3RFVA 3LWZA 3DJYA 3WRWA 2QRQA 3FTDA 2ZU0C 2JZCA 4LGVA 5AP9A 1XB2A 4TN5A 3ZHQA 3VHXA 3CNQS 4AMZA 5J40A 4Q3KA 5B1DA 2ANCA 2Q0QA 3GJYA 4A8HA 4DR4B 2XNHA 1YACA 1NVVQ 1X38A 4JOSA 3U3KA 2UYCA 3HVUA 4ISCA 4JVSB 4RBNA 4NIMA 4YI5A 3O0TA 5G1NA 1I0ZA 3ANSA 4RJJA 4I1RA 1IY0A 5FQOA 5C3UA 5IJ0A 1ONNA 2HF7A 3AK4A 4E51A 5AESA 2LXNA 4LSGA 3B9BA 2G80A 2IZZA 3P5SA 3RVLA 4DE5A 2JKZA 4P98A 4NJEA 4WKGA 1E8NA 3C0KA 1N5LA 2OE2A 4W5WA 4R5HA 3OJFA 1IPHA 4O4JF 2IW1A 3RASA 3IERA 4BECA 1Y6ZA 3STVA 1YQGA 3BMNB 1JKMA 1FS4A 3V8VA 1A50B 2XF8A 1IG0A 3O8NA 3RWBA 16PKA 2WAMA 3AUSA 2B1JA 2AE2A 4L3WA 3MLAA 1ZVJA 3UANA 3DC7A 3FROA 3SQOA 1KY3A 5DTIA 4BP3A 5CGQB 2EL9A 1U8ZA 4G1CA 4DJEC 4ARUA 4EKIA 1Z07A 2Y0DA 3PHLA 4YJ3F 2UVPA 2ZREA 1TJ4A 3B3FA 2Y0BA 3HGTA 4ZAFA 1NQTA 4BE7B 1ULSA 5FWYA 2UAGA 3D6JA 3HJCA 4RF5A 2HIMA 1KU6A 4XGQA 4XLTA 2YHIA 1MG5A 1JNXX 1PZMA 1VJRA 4W8GA 2NVUA 1HETA 2FFJA 3OZDA 1F17A 221PA 3IAS1 3MBIA 3BDVA 2CF5A 4IF4A 3WB1A 4A5OA 3FOEC 2Z6UA 1MV5A 2ODQA 4UVDA 1RWOA 3T3NA 1FDVA 2XDAA 2HI0A 3DMTA 5K05A 1CXZA 3IBFA 3Q9UA 3IPAA 1CUAA 3I2KA 3OBIA 4XJTA 5GONF 4A1FA 4JP3A 4PFJA 1I5OA 5AKGA 2HSWA 2CFTA 1FSGA 1VXRA 5DSZA 3DDZX 3VTAA 1JQLB 2HU5A 2ODTX 1UH5A 2IPAB 2QP9X 3HFJA 2V7UA 3MS7A 1IUOA 2WY2D 3RLFA 3ENKA 4OV6B 1W94A 2Q5EA 1SUPA 1OYVA 1WUIS 1VE7A 2GHRA 4I1VA 3ROGA 3FYCA 5HK9A 4NS4A 1QQ5A 1WSBA 5B12A 1L4BA 2NWQA 4OB8A 4MEBA 1P7ZA 4FYKA 3U7HB 5KYWA 1XTBA 3IT0A 4IDHA 1R4MB 3OQNA 1LPNA 1QH0A 2XF2A 4WY8A 2QQEA 3GJ5A 1ZD2P 3I9OA 4PG6A 1W19A 2ZYSA 1C3JA 4NK5A 5EC8A 1KS2A 1TMKA 2JH3A 2Q1SA 4JKOA 3VJMA 4CTOA 3OZTA 4Q15A 2AJCA 2JJQA 4UUMA 1QS0A 5JR3A 4BFSA 3R2JA 2LGJA 2J9FA 4NESA 4IV5A 4KAAA 3T35A 1MHPA 1R15A 2V6GA 4KOEC 4IDOA 1G7CA 2FFRA 1FYVA 4QPCA 1P2BA 3JQ8B 3DMRA 2ATVA 3IQIX 4WGGA 4Q4CA 1YBAA 3DKIA 3P45A 2V8OA 1UJ5A 4J90A 4CU5A 2IELA 1EIWA 1MRSA 4MLCA 2IP1A 3KFLA 3FZNA 3IURA 2ZWOA 2O0JA 3VVLA 5DV9A 4WFJA 4R3WA 1GKKA 1L5WA 2W2QA 4N3AA 1K8YB 2XDQB 4Z9BA 3ZWCA 4XRGA 4LF5B 3LPCA 5KQMA 3UJ8A 4XUDA 2QXYA 3LK6A 1VMAA 4H1TA 1A72A 2JAOA 1FFDA 2JKYA 4GPTA 4IFBA 1RXIA 3SQNA 1VLMA 2XLCA 1KYWA 3G13A 4N5LA 1ZI9A 3OZBA 4NSNA 1K88A 1Y89A 1CRQA 3QBDA 1EBBA 1NGSA 1QZTA 3KCQA 1QVRA 5L4LA 3NNSA 2HHAA 4GBGA 3ZWPA 1BQ3A 1COWD 2NV0A 3AR7A 1JFSA 5BRNA 2CFOA 3HLTA 1JTEA 5EGSA 2VN8A 4Y67A 4LJ9A 1F9EA 2Y1OA 1L1QA 2IYVA 4PQGA 4DLPA 3NX4A 1MJFA 3EULA 1RAEA 3BZWA 3PDHA 5TJ9A 4CF6A 1UFOA 1KJQA 5KQGA 5KYKA 1ISPA 2P5SA 1CQJA 2AEMA 2C9YA 2J4DA 3E27A 3I62A 3FFTA 3A7DA 1EFRD 2RAUA 2XAUA 3G8BA 1E3TA 3L06A 3QXGA 4MVJD 2C2YA 3VFDA 1PR3A 3IXMA 4RADA 4YCMA 1L5MA 2IL1A 3IBSA 4OUKX 1RJEA 2KBEA 3IUNA 4Q3CA 1Z73A 4XQCA 2GETA 4EBFA 4IRMA 3BGDA 3LSYA 3P9KA 1I2MA 5EJFA 1C14A 2ECOA 4X0EA 3TIVA 1JB1A 4OREX 3O8OB 5HFNA 5LNK1 2H00A 3N2LA 3ZXUB 5I7FA 3BFJA 1H2ZA 2XKJE 1ZM2A 4EUSA 5J2TA 1G7RA 2A9FA 2BELA 2OGTA 4R8MA 4QSHA 1VB5A 3FR7A 3I52A 2B8EA 4AMGA 4D79A 3AEQB 1ILEA 4BEJA 4BV3A 3U44B 4TMFA 2WHXA 4L4RA 3R9IA 5KJFA 5IAAA 4EI9A 3QWIA 2DOKA 1AVTA 4UMVA 4A2WA 1VZ3A 3ZE2B 2V1XA 4BNTA 4NF2A 3FCOA 4OOFA 4MTCA 3QVLA 3V7WA 1TLTA 4YC7A 4B46A 5F73A 3ZWNA 1XEWX 4H4CA 3DO5A 5BSTA 5L53A 3CX4A 4B6RA 1MO3A 1PUXA 2NXJA 3P8ZA 2AMFA 3C5HA 1SG0A 4UM9B 1Z0FA 4KBYA 3PHHA 1B23P 5TV2A 2F3UA 4QUBA 3V2GA 3A9UA 4AMBA 5EXEA 2HA3A 3N8IA 1YDWA 1PKXA 4BLTA 5CFNA 1X1RA 2QOEA 1F38A 3MK31 1KJZA 5TT0A 2VSQA 4IM7A 2O7SA 2ZSEA 3DYIA 1FSFA 2O7NA 3R7AA 2HREA 1NRIA 1P7VA 2QI9C 4BPRA 5JAMA 3H99A 4YRPA 3LHKA 2XUDA 5IT4A 4AF6A 4UBOA 1KZGB 1KIMA 1W73A 2WHRA 5FPHA 5L4NA 5KAMA 3O3MB 4GH5A 4OYLA 2LE0A 3EQ2A 3BRQA 4KWTA 4DR2B 1PJLA 1UFVA 2P4EA 3BGOS 3C8ZA 3E0QA 3L40A 3CT4A 3G2JA 4G56A 1V26A 1NUUA 1TC1A 1YJQA 2R6CA 3BB1A 3HPQA 3MIIA 4N03A 1T4CB 4RQUA 2IEDA 5AW4A 2KLBA 2QM3A 2GXAA 2G9RA 3GQVA 1QUEA 2FR0A 3NPMA 4PZUA 1F2TB 3V8MA 3TOCA 3KSMA 5KSZA 3NYQA 3B1ZA 1P19A 3ZKAA 1BHQ1 3TG8A 1S02A 1ZK2A 3EIWA 4ZOCA 3SKYA 1XMQB 2BFAA 2JFNA 2AFIE 2ZITA 1GA4A 3HZOA 4TTQA 1X7HA 1XCLA 2JFZA 3N0WA 4G4SO 3VTFA 2OBBA 3BGVA 3B6MA 3OIUA 4I46A 2GUGA 4NV1A 4C6RA 5AK6A 3Q0IA 1J5PA 4GKAA 1U65A 4TQ9A 2E55A 4A6DA 4AKEA 4D3ZA 4DLZA 4DQVA 5KO2A 4RZXA 2O8EA 2GJKA 4AM8A 2R6JA 2XNKA 1QH8A 3BGIA 2R9VA 2NTVA 2R7LA 4M1SA 1LC3A 4TVKA 4BO9A 2ZDHA 2PZKA 3CNOA 1GNTA 3UAVA 4JBWA 2PH5A 4OHFA 1NZFA 3EPLA 4KGDA 2V4MA 1U7HA 1M72A 5L3QA 1QG0A 1JDBB 3K0BA 3NETA 3VR6D 2FLVA 3H1PA 4LI3X 3LH5A 4EM6A 1AQNA 1GUZA 3ZI0A 1JJFA 2F9LA 3NOOA 2WLTA 2JFYA 4Y7DA 3OP4A 2OM2A 3CF4A 3NI2A 1LDYA 3EXEA 5FOSA 4HDQB 3CF6R 4WCDA 5J1SB 1UZMA 3AFIA 3JAWA 4MV6A 5E9JA 4ZYWA 3S8YA 2JH8A 3LQ1A 4GZLA 2BFNA 1QO0A 4DPKA 1OBVA 1VE5A 2GRJA 3VV2A 3WLRA 3OZGA 5KYYA 1C41A 3NMUF 1BFDA 1IAQA 1DKLA 4RTKA 4WESB 3BSWA 1DO8A 1GTJ1 4NJOA 4TZTA 1GU0A 1WBDA 1EE2A 2IEBA 3HYSA 4WGFA 3DAFA 2EJVA 1RWWA 3EIUA 3KHTA 3MWGA 1IFXA 1I1HA 3N6VA 3N8DA 5BSVA 4EA7A 3KTAA 2D2IA 1L7RA 3SC4A 3E2PA 3R3ZA 4YN3A 2P2ZA 4A8JC 4G84A 2ZTLA 1QZ3A 1SXJD 1FP2A 3RE1A 1V6AA 1SQ5A 3GT4A 1O94D 4INZA 5FLYA 1J0BA 3R6TA 3T99A 3Q5EA 5AVVA 4MKRA 4BNZA 5E4JA 2IUEA 4OQMA 1CDZA 3DE1X 4JH0A 1JJIA 1GDHA 2JIOA 4EYKA 4L5YA 4PGAA 1T2NA 4MI1A 1UWCA 4LHEA 3HDJA 1NULA 3ZE8A 1ULTA 3S2FA 1DADA 1DXOA 2HCRA 2JGKA 1AHHA 1NG1A 3HL0A 2XUPA 3O1JC 3HY6A 3KKNA 4OHRA 1T5DX 3Q3CA 4PINA 2FDRA 5KCZA 4HYTA 3I6ZA 2IPOA 1D1TA 1HDGO 1V1RB 3L43A 1V9CA 3ZXYA 3DZ8A 4EJ2A 4I9FA 4IFIA 3WSWA 4LDQA 1JR4A 1ECPA 3C7AA 3F9CA 1T35A 3QA3E 4JLKA 4Q18A 4RLQA 5CJPA 5JBNA 1XMOB 1NBOA 3EDYA 3HADA 4PLTA 3VAZA 2ZJ1A 3IXQA 4JEUA 1R8JA 4TOIA 4HXFB 3RK1A 3O74A 4QBIA 2FV8A 3MAGA 1DRKA 3AR4A 1YZTA 3EVTA 4GVLA 4LOHA 1T9KA 1GADO 5EESA 1QYCA 4W82A 4PNEA 5FV4A 2IYOA 1XP8A 3OP1A 3TI9A 5EXTA 9MHTA 4S1VA 2QKYA 5CGZA 5DCLA 1KEUA 3OZ7A 2RGEA 3VGPA 4R9SA 3TGWA 3G2LA 1IM8A 1D2CA 5F1PA 3W4IA 4QWMA 3KWFA 4MVWA 1A5BB 2VDOB 1RC0A 2QVXX 4NE2A 1V5IA 4WLOA 1WUHS 2P90A 4G0WA 4GX1A 2ETVA 1XL0A 4BBZA 4BQIA 3R6GA 1SXIA 1CS0B 1MENA 3BE4A 4R1LA 2IGTA 3P71T 5LKAA 3IO3A 3ONEA 3VPFA 2PX4A 2GASA 1DG1G 2Y66A 4OA5A 4Q1DA 2PUVA 3SZRA 1DIRA 2OCYC 5B37A 4RYDA 1ZJWA 1TVMA 2DAPA 3PXDA 3ELYA 4GPD1 5DTMA 3WMXA 1QBKC 3QPUA 3W78A 1PKEA 2JGFA 1IAVA 3N0TA 5I7RA 2I8CA 1YR7A 5DYWA 2GZMA 2I7DA 4ZZ3A 2ETXA 3LC1O 1YFJA 2VNJA 2QMHA 3TM4A 2EW1A 5FTWA 4GSLA 3AL0C 4GYYA 3U60B 4BP8A 1R27A 2H2GA 3WNBA 1FL9A 5ALRA 5CA1A 1XRQA 3EUEA 1W75A 3EFHA 1TJ3A 1M10A 3HR8A 5AW8A 4AN0A 4WBNA 5L7TA 3B6JA 1NFQA 1KYQA 4YLGA 3UKDA 3FG9A 5CYOA 5DCYA 4KHZA 4DHEA 1M6HA 4FU0A 5EN4A 4Z7NB 1CEYA 3TLCA 2E6KA 2JG3A 2VDVE 3D6NB 5DLQC 4J8PA 5DX0A 2HXGA 3EAFA 2B4RO 2QN8A 4EJSB 4LJLA 3ZNPA 1B1CA 4IX9A 3MGGA 1ZN2A 1JS1X 3KQQA 1PUIA 2HMUA 4F3TA 1UJNA 4RHFA 3C3XA 1Z5NA 3CNNA 4BASA 5E4TA 4YY3B 4K81B 4X24A 4J0QA 4DARA 2ZSIA 4Z7OB 3OOWA 1YU9A 4J2HA 3OTOB 4OFBA 1UXOA 3SN6A 2O4UX 4PANA 1U7OA 4Z99A 3VQTA 3DMGA 3NBZC 4PO8A 4EHHA 2Q7DA 3PVZA 4LHWA 3FD8A 4NNPA 4RTSA 1PJRA 6ABPA 3HSSA 4B3DA 4E21A 1N1GA 1WXEA 1XTQA 1T36B 2Z9CA 4RJLA 5IAGA 2V6JA 3AVUA 1KL7A 3IQEA 4CKCB 1UP4A 2VCHA 4F3KA 2CNWA 4LE2A 1GPWB 3WO1A 4FD3A 2QTVA 4XWKA 3U4CA 3IALA 3S7TA 2ZQYA 4CV1A 3GJ7A 1SHLA 1GVHA 1UJCA 1M8KA 2BZ0A 1FDSA 2CHUA 3OCYA 2FPWA 1UT6A 1Y1PA 3EAQA 2WINI 4OHOA 4RK7A 2O7QA 4EQ6A 5GJVC 1P1CA 3K3PA 5KNBD 3O4VA 1H0HA 1K92A 2CLSA 4P2GA 3LY7A 1GG8A 2Q4BA 5EWMB 4BYGA 3PNBA 2FPGB 4DABA 1GDTA 3QYAA 5I8ZA 4I5FA 3JQBC 4WK2B 3C7DB 5FX2A 4IBOA 2GEJA 4HLNA 1RLMA 3B8HA 1JHVA 1ILWA 1JG1A 3OZCA 4TWJA 1ZGHA 1ZQ9A 2O2XA 1SHZA 3NLLA 4OSPA 3V1MA 1Y3AA 5K0GA 5FOUA 1Y3HA 3EGXA 2ZAYA 3FDJA 4AI6A 1UXIA 1PL7A 4A2CA 3CE6A 4P86A 1QK4A 2Q3FA 2Q4OA 3TMAA 2DULA 4BFTA 4ZJPA 2AOTA 4GX5A 4TGLA 1R0YA 1U6KA 2XZTA 5G2OA 3TQSA 3F6RA 3DZKA 5FPQA 2H5LA 3U6BA 1Y1TA 1GKLA 3I4LA 4KUGA 2D5BA 4CM9A 5DNCA 4C01A 1PX2A 2FMXA 4IUCS 1DQPA 3MWJA 4BV8A 1CZUA 1S8NA 3VR0A 3WLQA 2I66A 3HVHA 3NFYA 4KO1S 4L2IB 2Q3BA 1Z26A 2QRVA 2HJVA 2B1RA 5CAEA 3H1FA 2C7GA 4YAIA 4DGQA 2OFPA 1ORTA 3LZDA 2W2KA 4GOOD 1IJKA 5FBRB 5AOAA 1Q3TA 4MW7A 3MWDA 2HCJB 5GAJA 5B1HA 4RIGA 1SNYA 2JASA 3UGKA 2BFBB 3PR3A 4OFZA 4CTMA 2KLHA 2R62A 4C78A 2I4TA 2PWAA 4O4HB 4IINA 3ZZ1A 1IUNA 1QFSA 3T61A 4CIVA 4W8OA 1RWVA 3DVLA 2HDNB 3RVPA 4NAUA 3F67A 5CXUA 4HUQB 4JR1A 1W4BA 3A1FA 3OZAA 5ITWA 3OQ6A 1PJ8A 1A8HA 4HD8A 3GH1A 1T8YA 3HGMA 3QI7A 4HTFB 4MICA 4WTOA 5EE5B 1BE6A 1CUZA 2FJUA 3KSUA 3D81A 3SFZA 3PSHA 5DTQA 1N25A 3TAUA 2G08A 4U2GA 4FFBB 2VJPA 4Y1RA 3ECSA 4A23A 2WJAA 2QLFA 1SC4A 4PIPA 5JJCA 4P3KA 4JYBA 1X19A 1Y9ZA 3T7TA 1FBNA 4Q5IA 4CQLB 2UUCB 2VZ0A 4YAKA 1Q6ZA 1QAMA 2WHYA 3EUAA 1KH3A 3NKLA 2G0AA 4DGSA 1Y7IA 4HTAA 4PXAA 1P7YA 3IIKA 2JI7A 2WIFA 2H51A 1E0AA 1XK6A 1O1YA 1RCFA 1Y4SA 2OHFA 2O2EA 3A3NA 2RK4A 3FYSA 4Q4DA 3AKZA 1SR8A 1JIKA 3QXHA 3AO0B 1KC1A 2DBQA 2C5HA 5CDHA 4JQCA 5HTOA 3FMVA 3P9CA 4JT2A 3VVMA 3EYWA 2JRCA 3ZD8A 3KIPA 3K8OE 3L82B 4YQFA 1CQWA 3WV5A 4C6TB 1AZTA 5CX1A 5JPCA 5BSMA 2QP3A 5E3JA 1X7YA 4RJTA 1NVFA 2AN3A 1JJAA 4G0MA 2BFDB 1VL8A 2YWEA 4LNHA 4IX1A 2VVTA 3RJ9A 3CEAA 1GT6A 3OPVA 3BE8A 3R23A 3UAWA 5BN4A 2VOJA 1M1XB 4IS2A 1X9HA 5AM5A 2VYNA 4BWYA 3PUWA 1V8PA 4MVJI 2ZIFA 2W71A 3LUFA 2C5AA 4D8VA 3ZY4A 1XVUA 4C9BA 4EUNA 3DV0B 3KJZA 1V71A 2VLIA 1O7JA 1IHPA 3P20A 4FFWA 5GOZA 3RIHA 4DJJA 3V8PA 3R8FA 4CHTA 1IXSB 5F2EA 1OZHA 4Q3EA 4CM8A 1SZJG 1YMVA 3MOSA 2VDWB 3UT0A 2VZEA 4M6WA 4MUEA 1TRHA 5IP5A 2ATIA 4COKA 4ETMA 2MCFA 1P81A 3H5WA 1JRLA 4F5WA 1GLGA 5JADA 3PFKA 3VU9A 1GGVA 1DXQA 3QELA 1JKFA 3DTVD 3NBKA 1EU1A 3ND5A 4MKXA 3DDCA 2DFPA 4RK0A 1O57A 4U6NA 4XX1A 1UCFA 2OFOA 1T13A 2BONA 2R4TA 3NHAA 4L8YA 4LS3A 4AXBA 1XNQB 2P1ZA 2QTZA 3FF4A 3Q6MA 4M83A 1F9AA 1W8DA 5HQJA 4ROTA 4YYZA 2XXAA 1V45E 2YVKA 4KLRA 4HH4A 4E2XA 2VPIA 2FMTA 5BNZA 5FOQA 4LGMA 1ZL0A 2BRUA 4S35A 1OLUA 3NZEA 1M7HA 3P0RA 1CFJA 4ARZB 3SSMA 3NVKI 1DEKA 2BI7A 2VH5R 3NGLA 4IVNA 3RUPA 3T8YA 5B1EA 4BZZA 5BXQC 3TJRA 3E58A 4PYIA 3H2GA 2YC4C 5C8YA 1CZRA 2FEMA 3AKYA 3QTBA 4NEQA 4Q1CA 5G02A 3NV7A 3OQMA 1J5EB 3H5OA 4ITVA 1W49A 2PE5A 2DJ5A 2VDLB 5C0OE 5JCJD 5IRCD 1KWKA 3SHVA 4RPJA 2A7XA 3PICA 3RVOA 2DB3A 2B36A 2H4ZA 3ENVA 4A0RA 4JODA 1V3VA 1TVKA 2JK1A 1SBIA 3U4GA 3WO0A 1DIBA 3HBJA 1FNCA 3D7LA 3LO8A 1XZDA 3Q6NA 1XVVA 1CETA 1K3TA 4LYFA 1IULA 3LUDA 3A0UA 3CMMA 4NYIR 4EI8A 2VBFA 2PLRA 1XQYA 4WK6A 2QQFA 3V4LA 2Y2UA 1G63A 2HCBA 5JCOA 2CC2A 4AP9A 4P3OA 1PJ4A 3U3OA 3W8DA 3R5KA 3D5EA 5AYVA 1T34A 1TM5E 4KVZA 1DIAA 3QBJA 4RK1A 2XGSA 3WK8A 4NC9A 3TQCA 1CSEE 1ZW1A 3ROTA 3BDIA 4IDPA 3EPHA 5JSYA 1DUVG 1D2MA 1P72A 3MWEA 3PRHA 1LA2A 2HNAA 3F96A 3QEMB 3BXZA 3I53A 4R41A 1QONA 4K6GA 4A8JA 3FMPB 2A1UB 4HRXA 1QZUA 3MC1A 3WV4A 1T1GA 2QRZA 3BD8A 5CW2A 5D5QA