4J0CA

Tannin acyl hydrolase from lactobacillus plantarum (native structure)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
470
structure length
452
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 162
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0cA00
2E3JA 1H2XA 3TGLA 4KE7A 3R41A 3C6YA 4Q34A 3BIWA 4N5IX 2R11A 4H0CA 4V2IA 1ZGBA 7YASA 1DWOA 3G8YA 1DU4A 4CG1A 4B6GA 3FLAA 3C6BA 4BZWA 5CT6A 2B9VA 3JW8A 1BROA 1S8OA 1DQZA 1K4YA 4LYEA 4UBKA 1MTZA 3VISA 4J0KA 1H2ZA 4DLNA 5AOAA 2QT9A 1BS9A 1E8NA 5FP0A 3AILA 4WFJA 3B3QA 3X3HA 5FOQA 3DQZA 2WTMA 4DSAA 1E66A 4X00A 4B9EA 1GKLA 5ALFA 2H7CA 4PF1A 2CJPA 2AJ8A 2ZYIA 4L72A 2W6CX 3ZV7A 3I6MA 4J0JA 2JEZA 3C87A 5K3DA 4BZZA 2BKLA 1LPMA 1UXOA 5AM3A 5LZ4A 3C6XA 3FOBA 1MNAA 1ZOIA 2V98A 4H7IA 1QFSA 4X94A 1R3DA 4NVRA 3WYDA 4P9NA 3DOIA 4PSDA 1XRRA 3VJLA 1G66A 4IH9A 4XVCA 3ICVA 5ALPA 2W22A 5ALXA 3VXKA 4B82A 1N1MA 1LZKA 2HRQA 1UK9A 1AQLA 4GI1A 1MT3A 5HF9A 3HRHA 3O9VA 1XZKA 1WCYA 4DSZA 5AIBA 1DQYA 4MWTA 1EDEA 1SCQA 4H7EA 2JEYA 3HABA 3G02A 4JYPA 4RNCA 2J3DA 3FAKA 3ZI7A 4X85A 5JATA 3IB3A 4F0JA 3H04A 1XFDA 1WHSA 4KAFA 3K2IA 4Y2XA 3A2LA 2JBWA 1GKKA 4FBMA 1HL7A 3FSGA 2XQJA 4W1SA 1EHYA 1SOMA 4N8EA 1EH5A 3KWJA 4UHFA 5HK8A 5FV4A 3G7NA 4BAGA 2CBGA 1QO7A 1XZBA 4DMHA 4CFSA 5AP9A 5K3FB 3RK4A 2V97A 4QDXA 3PICA 1LPAB 3F97A 2NW6A 4BRSA 5SYMA 5AKKA 3UUEA 2IX9A 1ORWA 3CXUA 3FSGD 2BUAA 4UUQA 5LKRA 5AM2A 2BUBA 1W6RA 1EDDA 1ISPA 1ZD5A 3W06A 1W76A 3WA6A 4EY4A 4H35A 3O4JA 4U2DA 1TCAA 1MPXA 2PU7A 3C70A 1BCSA 2VJAA 1N5MA 4LYDA 4OB8A 5EGNA 1XLVA 1QJ4A 1VLQA 1R9NA 1QO9A 4WY8A 1XKLA 5SYNA 3V48A 2HU5A 3WZLA 4MQLA 3WK6A 4EY5A 2DFPA 3C43A 4ZXFA 2JF0A 2OGZA 1UFOA 5AKEA 2VQ6A 2XMCA 5ALRA 5FKJA 3G0BA 4BDTA 3H2KA 1SFRA 4OYLA 4DNQA 2PUHA 3ANSA 2AJLI 4J0IA 3A2MA 1J06A 1EK1A 2XUIA 1XZAA 2I03A 2PSJA 3FWHA 3M81A 1E5TA 4HAIA 2P8SA 2BGNA 2WHRA 3E1GA 3WK5A 1MU0A 1XQYA 2QZPA 1WPXA 3QMWA 2WJ3A 2HHAA 2OLEA 4G1FA 3FYUC 5ALHA 2ONCA 2RAUA 2I3DA 2QVBA 2O7VA 1U8EA 3EIOA 3KWFA 3HZOA 3LLCA 4BVJA 5E2IA 4B0OA 4BAUA 5EFZA 3HEAA 3H2JA 4CCYA 2VT7A 3FNBA 2OAGA 2H9YA 5HQ3A 1M33A 3BF8A 1U65A 1ACLA 3FVRA 3HSSA 1CV2A 3I1IA 2LIPA 5KBYA 1W75A 4UBMA 2B20A 2DHEA 4EY6A 4ZV7A 2Z3WA 4TVKA 1KU6A 1DTEA 4I4CA 4MJ3A 2OPHA 5FRDA 3SX4A 1X70A 1HLGA 1XZFA 1K5PA 1L7QA 4HXFB 1C7IA 2J4CA 3G0IA 3HI4A 4J03A 1CUSA 3BDIA 3C5VA 1XQVA 1CUIA 3NWOA 1ODCA 4FFWA 3T4UA 1B41A 5ALMA 4CCYB 4P08A 5ALWA 1U4NA 5T4FA 3WKDA 1JJBA 3GUUA 5AKLA 2QJWA 2RI6A 3DJYA 3KSRA 3LCRA 2WFZA 1H22A 4EB0A 2EDCA 4KE9A 1THGA 4UBNA 1QIKA 2OAEA 1C4XA 3BJRA 3WWOA 3WYNA 1R88A 4J0CA 1CUZA 3C8HA 1YB7A 3VJKA 1XZGA 2OGTA 2AXEA 1KU0A 2XUPA 2HA5A 2OCIA 2G63A 3FCYA 1MAAA 1LBSA 2J3QA 3E0XA 1X2BA 3WL6A 1R9MA 2XB6A 2ZVDA 1UOQA 2BJHA 1A7UA 3IBTA 1K63A 4DMFA 3OTQA 2DQYA 3SC2A 3U0VA 1EB8A 5JYCA 1YB6A 4WDRA 4YX9A 2RHTA 1GQSA 3O9MA 1EB9A 5EHQA 1XLUA 5DNWA 4QDOA 4HVTA 4G4GA 1UOOA 3H19A 4N5HX 4XJVA 5FPQA 3FYUB 5IVIA 2WTNA 4BP9A 4DGQA 2WQZA 5EHXA 1P0PA 4FNGA 4A16A 4BE4A 4WY5A 4LXGA 4Y7DA 2WM2A 4UHCA 4M0FA 5ALVA 4Y2JA 2QOEA 5CURA 3YASA 2DR0A 4LKOA 2WFLB 4BYMA 3SWWA 4M0MA 3R3UA 5CW2A 1JU3A 2ZSHA 1CQWA 2BFNA 1E3QA 4BBZA 2JGKA 2ROQA 3CCCA 1JMYA 2ORYA 2PSHA 5K5EA 1G5FA 3RM3A 2Y2UA 2ECFA 3WK4A 3FBWA 2WFLA 3OG9A 5EHNA 1GQRA 4GHWA 4Q82A 5E4YA 3FCXA 2QUAA 3I2HA 4K6HA 4PSCA 1YSCA 3WK8A 3AFIA 2JGEA 2GZRA 1UK6A 2BGRA 1DT5A 1QZ3A 2YYSA 1BN6A 4RGYA 3W9UA 5ALJA 3WL8A 1VA4A 1VZ2A 4U2GA 5AI6A 4WFKA 3I1YA 1P0QA 4FMPA 2PBLA 3OC0A 2WLSA 2VTVA 5JZBA 2WIDA 1XRMA 4AX4A 4D9JA 3CN7A 3QBJA 4O08A 3UMJA 4YK7A 2ZYHA 3VVLA 3JWEA 2WHPA 2GBIA 5AHXA 2Y1KA 4ETWA 4Y2UA 2HA4A 2ACEA 3ZLTA 5IH7A 1XZJA 3I28A 4XIIA 2Z3ZA 5HCUA 3W04A 2C58A 4BAZA 4UFOA 1UK7A 2CZQA 3DCNA 4W1RA 4FTWA 5ALIA 2DHDA 3STTA 5I8PA 4DM7A 4HXGA 1SC9A 4F60A 2C5GA 4DTCA 2XUOA 5EI5A 5LZ5A 4AXBA 1QTIA 1QIIA 3QZUA 5I7UA 2JGIA 5A7GA 1JT2A 3BWXA 1ZIXA 1Q84A 4MEAA 5K3EA 3DNMA 1RP1A 5DWDA 2VT6A 5JZSA 4K6KA 4EZIA 2JGMA 1F6WA 4JYMA 4DMKA 5HF6A 5ALYA 1N8SA 4DNFA 2PX6A 5LP1A 3ICWA 1QTRA 2XLCA 2O7RA 4H77A 4RE6A 3IVMA 5JD6A 3AINA 4IH1A 3WKAA 4UHBA 2PSDA 2XMRA 3DKKA 3H1BA 1YAJA 3KDAA 1VOTA 2WIGA 4Z49A 3L1IA 2QM0A 5D6OA 4UFNA 4C01A 4AN0A 2H1IA 4H18A 3DYIA 4X95A 1UKAA 1QLWA 4JH0A 1E89A 1JJIA 1HKHA 3KD2A 5AM4A 3AZPA 1BRTA 1VA5A 1Q83A 5K3FA 3LS2A 5DYTA 4BATA 4EBBA 3WMRA 1BCRA 1LPSA 1CUBA 5KWJA 1WPRA 2HU7A 3PE6A 5H3HA 3QVMA 3WWCA 3EQ9A 3HLKA 4A5SA 4FFVA 5HF8A 1IZ8A 1Y7IA 1YCDA 5ISMA 2XMQA 5CT5A 1P0MA 5CH8A 2G5TA 4AB1A 4MYDA 1QIMA 5E4JA 2VATA 1AUOA 4CG2A 1MX1A 3HACA 5T4BA 4DIUA 4C4YA 1USWA 1THTA 4X93A 1Y37A 1L7RA 5CBKA 3DYVA 1CUVA 4C88A 1TCBA 1WM1A 2D5LA 3MVEA 3C6ZA 2PPLA 5AKGA 5AK5A 5BWCA 2FJPA 2XUGA 5EIAA 1OCEA 3CCBA 5A71A 2HA3A 2AJBA 3AUKA 4QLOA 3IDAA 5LIPA 3D7RA 2WUGA 1CQZA 1FFAA 3L1HA 5HKBA 5CXUA 5DNVA 1ZD3A 2CKMA 4EY8A 3K9BA 3O0DA 1ZD2P 4PO3X 1EX9A 3WIOA 1LPOA 1XRQA 5DTIA 3IURA 5ALZA 5ESRA 4PQEA 1UK8A 4KRXA 4P93A 2X8BA 3FLEA 3AIKA 4BDSA 4UBIA 5AO9A 1E8DA 1CUCA 3GROA 1VKHA 4G4IA 4W63A 2O2IA 2K2QB 4Q05A 3NGMA 3FYUA 2I3ZA 2X5XA 2V9ZA 4K5QA 6YASA 5D3ZA 5BV7A 5CH3A 5YASA 4A23A 1ZI9A 4PNZA 4W1PA 4BVKA 1AKNA 2C4HA 2WIFA 2PUJA 5DLPA 1VJ5A 3G9TA 1IVYA 4Y2QA 4BCBA 2BCEA 5JAHA 3GFFA 4BVLA 3V1MA 2BAGA 1A8UA 3B5EA 4DNOA 5JAUA 1XZHA 4AMZA 3HXKA 2GYWA 3VVMA 5AM0A 4JUIA 3R3YA 1SCKA 4BRZA 1EK2A 3STYA 4ITVA 2XDWA 1SCIA 3BXPA 4EY7A 1YASA 2OQVA 2IIVA 1JU4A 3PF9A 4OU5A 1QFMA 2WUFA 1CUUA 2XT0A 5ALNA 1EA5A 2ZJ7A 2QMQA 5EIHA 4U2BA 5T4HA 1J2EA 4B85A 1CUYA 2RHWA 3RARA 2DHCA 2ZYRA 3RKSA 4JEIA 1R1DA 4KE6A 4MQMA 1DX6A 3C45A 3VKFA 1CUDA 3IULA 3WIBA 1CPYA 2WHPB 3OPMA 5C8ZA 1HQDA 4AO8A 3I6ZA 2PSEA 4PSUA 5BWBA 2HRRA 1MX5A 4WFIA 4CG3A 1QONA 1BEEA 1YAHA 2XE4A 3O4GA 1QIHA 2HA0A 4G5XA 3R3XA 3A70A 4C89A 1PFQA 1TKRA 2OCLA 5HZGA 2WU4A 2OG1A 4HRYA 2Q0XA 4X6YA 2GBGA 2C0PA 3S2ZA 4UHDA 3D59A 2O2GA 1AGYA 4B7ZA 1VE6A 5LZ2A 3IUMA 1XRPA 4KACA 3BF7A 1CLEA 3WKCA 3DL7A 2XQGA 3C8DA 3KOOA 1DWPA 4KAAA 3R3WA 1JI3A 2XMBA 2EEPA 2XUDA 4MYSA 4ZRDA 1LGYA 1ZGCA 5AI0A 4Y2TA 3WLAA 2ZJ6A 4G9EA 3V9AA 3BIXA 1CUXA 2DSNA 3H1AA 3NUZA 3EQ8A 2QUBA 2VJDA 5A6VA 2YASA 3I2IA 3H2IA 3F9CA 1QIGA 1QE3A 5FLKA 3H17A 1EXWA 1T2NA 4HZGA 5J3JA 1ZJ5A 5CT8A 3Q0TA 3WI7A 3K6KA 4DMCA 1WB4A 4C4XA 4WDQA 5LZ8A 4QDUA 3W05A 2PU5A 5IVDA 4IQ4A 3HYSA 3AJAA 1Q0ZA 3PFCA 4L0CA 4ARBA 4GW3A 4HRXA 1NX9A 5ALKA 1QIJA 2O2HA 4YASA 4K6GA 3QM1A 3GBSA 2RGUA 4OUKX 4AMYA 1IMJA 3D4LA 4FLEA 5AOBA 4LHEA 1D07A 4MWSA 4DNPA 3B12A 4W9RA 1ZI8A 3DLTA 5AICA 1AX9A 2WG1A 3MUOA 3STWA 4H7KA 5FDFA 4OD0A 5F4ZA 2H7XA 3O95A 1FFBA 1TIBA 3WJ1A 1ODTC 5JAOA 1AC5A 5CT9A 4Y2PA 3U1TA 2B61A 3WZMA 1Z68A 4AZ0A 2DCMA 1UKBA 4KE8A 2FJ0A 4H7JA 3R40A 1UZAA 1ZD4A 4AO6A 2CEKA 5IVHA 5A7FA 1J07A 4UHHA 5AK4A 2GBCA 5JANA 1LPPA 1ZICA 1JMKC 3F8SA 1TK3A 4B81A 3GELA 1LNSA 1CUFA 5A62A 2C0QA 3ED1A 1K6EA 5DTJA 2GBFA 4KRYA 3D0KA 3V1KA 4Q3OA 4X3CA 2HA7A 4NZZA 3F67A 2X76A 3I2GA 3H2GA 1F8UA 2VAVA 5A7HA 3R3VA 4IHAA 2H7YA 4B83A 1CUEA 2ACKA 2XMDA 3G9XA 2QXUA 4E46A 4IH4A 1CUJA 5AIAA 3D2CA 1R50A 3O4IA 3G0GA 1T4MA 5D7BA 1VXRA 1P0IA 3EF3A 3IIIA 2JGJA 5I9IA 1GPKA 4FNMA 3S8YA 4OPMA 4BCCA 3T52A 5ALUA 4I19A 4UBJA 5AH0A 4KJXA 3UUFA 2WILA 2GZSA 1ODSA 4ZV9A 4UHEA 5JIBA 2HFKA 4HXEB 4IO0A 4E14A 2VSQA 2RIPA 3WQHA 2CUTA 1AZWA 2GYVA 1FJ2A 4QZVA 3L1JA 5A2GA 1QIEA 4FKBA 3AIOA 2QRUA 5ALTA 2WKWA 5JAPA 4OB7A 1QGED 4GXNA 3HJUA 1YA8A 3PF8A 3W9BA 1IUOA 3GZJA 1BE0A 5AKHA 5AKYA 1VZ3A 2QJRA 3PUIA 1XKTA 3Q8WA 1A8SA 4CCWA 5FXMA 2AJCA 2VEOA 1W52X 3ESAA 4J0HA 2V96A 1FFEA 4Q1VA 2Z5GA 1GT6A 2IITA 3EBLA 4JNCA 4KR0A 4F21A 1Y7HA 5AM5A 1UT6A 2Y6UA 1DWQA 1E8MA 2C5FA 2ZYSA 5T4EA 4QNNA 2QR5A 4PW0A 2R8BA 3QITA 3ESDA 4LXHA 3D2AA 4AQDA 1KEZA 4GEGA 2PM8A 2JGFA 2XUAA 2PVSA 1MX9A 2RONA 5DYYA 1B6GA 4ZWNA 4Q3LA 2XUHA 3DKRA 5ALQA 1CIJA 3QMMA 2FX5A 3QPAA 3N0TA 4WCVA 1C7JA 5CRIA 2XMZA 1FFDA 1XZLA 3GA7A 1JKMA 4OCZA 4PV7A 4GBGA 1EVQA 5AI8A 5IKXA 3LIPA 1XZEA 4N8SA 3E4DA 4U2CA 5ALOA 3JYHA 1LBTA 1ORVA 3V1NA 1AURA 2GYUA 2WFMA 2XUQA 2Z8XA 3G0DA 4H7FA 5JARA 1YS2X 1JFRA 5LLSA 3ZPXA 3OM8A 4Y2VA 1XZIA 4W1QA 1OILA 4OSEA 1QOZA 4X6XA 4MEBA 4TPKA 4QDZA 3R3ZA 1CRLA 3AIMA 5HQ3B 4Q3KA 4BE9A 1A8QA 4E11A 3V1LA 4X92A 5AOCA 4CIAA 3LP5A 5FPPA 4J7AA 5HK9A 3FVTA 2XQKA 4DYHA 1RWQA 3D2BA 4FHZA 3STXA 2HA6A 3I2JA 4K2AA 4UFPA 2Y2VA 5AJHA 4UPDA 3QYJA 3EQ7A 2XMSA 3P2MA 1AMNA 4WJLA 4AZ3A 5DJ5A 4L9AA 3QH4A 5D3KA 5LKAA 4ROTA 1PV1A 1XRLA 2HADA 3WK9A 5E4TA 4NS4A 4Y2RA 2AJDA 4BC0A 3BL8A 3DDUA 4NMWA 1QIFA 3D3NA 4QEKA 4FDMA 3WKBA 4X7BA 2WG2A 5AK3A 4C4ZA 3AZOA 1A88A 4J0DA 2Y6VA 1PJAA 1Q0RA 1FSSA 2XUJA 1LPNA 2XLBA 2I78A 1GPNA 2D0DA 2WIJA 3AZQA 1CEXA 4ARAA 1F0NA 4E15A 4J3JA 4FBLA 3I2FA 3WWDA 4BTVA 2CMFA 1XZDA 3IUNA 2WHQA 2XQIA 4I3FA 5AI4A 4BB0A 1GXSA 4MXDA 1IZ7A 3BE8A 1I6WA 4AN1A 2B4KA 3IUQA 2YXPX 1OXMA 1ZI6A 2WJ6A 2OCKA 5DNUA 2ES4A 1MNQA 3ESCA 3H0CA 1DT3A 3ZLVA 3DD5A 2QXTA 1DINA 3IA2A 4RPCA 1U2EA 5CXXA 3QPDA 2VJBA 1EINA 2VAXA 5JD4A 3QPCA 4XX1A 4G8CA 4CI9A 2VA9A 1CFJA 3A6ZA 2YH2A 2WUDA 1X2EA 4C6HA 5AM1A 2HL6A 5EIEA 4CIBA 3I6YA 4GDMA 5ALEA 5IVKA 1LLFA 4J0GA 1YA4A 3M3DA 3O4HA 3STUA 2JIDA 1MO2A 1CUAA 5LYYA 4BC1A 4QDTA 4M0EA 3M83A 2WG0A 4QE3A 4N8DA 1HDEA 5K3AA 4P92A 5FUMA 4KEAA 3I2KA 1LPBB 3TRDA 2ZJFA 2QKYA 3DEAA 5AI9A 4G9GA 2WJ4A 2C7BA 4EHBA 3PI6A 1MJ5A 3MGAA 5JASA 3ANTA 5HFNA 5ALLA 2HU8A 3N2ZB 2HIHA 2JGLA 5KWIA 1WHTA 1VXOA 4Y2SA 4X71A 3BJMA 1CR6A 1UKCA 3DL4A 4FOLA 4U2FA 3TEJA 4FLMA 1VE7A 4FLFA 1IUPA 3H18A 2XMGA 4OB6A 1ZIYA 4OU4A 3FLBA 5ALGA 2CB9A 1TCCA 2PL5A 1TQHA 3E3AA 3G9UA 1H2WA 3KXPA 2PKYX 4HTAA 1EVEA 4S0XA 1G42A 5AK6A 5EHZA 4QA9A 4AO7A 5LZ7A 2BUCA 1ACJA 3WL7A 4B0PA 3IUJA 2XUFA 3VDXA 4KYVA 4BP8A 3R0VA 4X91A 4B80A 4G4JA 5C81A 2WSLA 1CUHA 2XUKA 3WL5A 4U2EA 1NU6A 3ILSA 1W4LA 2PSFA 2XQFA 1H2YA 4EUSA 4Y9SA 1L7AA 1BEZA 5C8XA 1O6GA 3FYTA 5C8VA 4ZGBA 3G0CA 1CVLA 1XQXA 5K3CA 4HS9A 3BDVA 1F0PA 5JD5A 4OYYA 2DQZA 1BU8A 5AKJA 4H7DA 1N5RA 3PDCA 3MUNA 1WB6A 5CH5A 3OOSA 5HF5A 1DX4A 3WKEA 1GGVA 2Z8ZA 5HFAA 1BN7A 2G4LA 5JADA 1W1IA 2EDAA 1G4HA 4X97A 1UOPA 3DOHA 3D5EA 4XWGA 5ALDA 1K8QA 1XRNA 2OCGA 4QLAA 1WOMA 4B84A 3H2HA 1CUGA 4GLBA 5CTAA 4C87A 1GZ7A 2HM7A 4LIPD 1TAHA 3RLIA 1XROA 2QTBA 3G9ZA 3WK7A 1R4ZA 3OURA 5AKIA 2VJCA 3F96A 5CMLA 2VF2A 1GPLA 3ESBA 2HDWA 3LIIA 3WJ2A 1IUNA 4G8DA 3M82A 1XZCA 2OXEA 4ZI5A 3VJMA 1YS1X 4B9AA 5HKAA 5JZ9A 5CT4A 1FFCA 5K3BA 5JALA 4G8BA 4GWLA 3WA7A 2XI4A 1ZJ4A 3F98A 4QWMA 2G5PA 1ETHA 3PUHA 4LXIA 4EA6A 2HFJA 2FUKA 4YPVA 4INZA 1QIDA 1CUWA 2OQIA 3WWEA 3PFBA 5AKZA 3QMVA 3C5WP 2WUEA 4TGLA 2HA2A 4FWBA 4RE5A 2QS9A 3ZLUA 5AKXA 1YR2A 3CN9A 1WB5A 1EDBA 1XQWA 1O6FA 4QWWA 2WU3A 4UBLA 1EI9A 3A2NA 4X6UA 1TRHA 4Y2YA 4KAJA 1XZMA 1HBJA 3STVA 1LZLA 2J4FA 4ZREA 3W2TA 1XLWA 4X90A 2ZSIA 4L3WA 3DS8A 5C7YA 4GECA 5DYWA 5AI5A 4BTLA 2WIKA 5KREA 1MAHA 1NU8A 1MN6A 1JJFA 3ZWQA 3NOXA 1J1IA 5BOVA 3HC7A 3TJMA 1UWCA 1HPLA 3SK0A 5LZ9A 3WWPA 2UZ0A 1RYYA 2OGSA 4UBOA 5ALSA 4H7HA 1H23A 4BCDA 4F5ZA
chains in the Genus database with same CATH superfamily
2Y67A 4LJRA 4MV7A 2IU6A 2E3JA 1QV9A 4BGVA 4GR5A 1Q91A 1CF9A 1EJ2A 3NJRA 4G5FA 2G06A 3DMNA 3R41A 1RS0A 1OWMA 2O6LA 4PX5A 1JAYA 4ZCSA 1SQ0A 4F4DA 5DO9A 2DEUA 3ZX4A 1NUUA 2FG7C 4FFMA 3UJPA 3R6GA 4ZOLF 4WMLA 3I0ZA 3SY8A 7YASA 4V03A 4DZZA 1AHPA 1DWOA 3G8YA 2GA9A 4CG1A 2YZKA 4HWGA 3UZUA 3MINB 1X7HA 4KXUA 4LTNA 3RANA 1H4QA 4BZWA 4E5VA 2OP0A 1KBZA 2O2JA 2FLWA 3T3EA 3R76A 1UJCA 1PQ4A 3TSZA 2XBLA 4NV3A 1NF3A 1L6IA 4Q48A 4JLOA 2JW5A 3DOFA 1APBA 1DRWA 3HCNA 1IAVA 4R01A 1Y48E 3TSWA 2PQMA 4MVWA 3JSXA 1GZVA 3VSCA 1IN6A 2F43A 1XEXA 4Q9IA 3VISA 1RXIA 3G2LA 5D2CA 1P5ZB 1H2ZA 1DP4A 4D81A 2OXFA 4WT7A 1Q2XA 4CL0A 1NDQA 1BA2A 1WKBA 1ZVMA 2CD9A 1P39A 3LK7A 3ZR4B 4J4TA 4WD3A 3UKDA 2QT9A 1BS9A 1B8VA 1RQLA 1Z0ZA 4Z5XA 3NHBA 5D6NA 1E8NA 4GPZA 5FP0A 1B73A 3VR6H 4IRUB 2D54A 1FRVA 2HV9A 3IXMA 2O1EA 2BHRA 2XF8A 3AUYA 3OZDA 4LSMA 4RVHA 4WFJA 5EKXA 5GVRA 1FVOA 4ZI3A 1AJEA 5KQGA 3X3HA 1SBHA 3RNOA 2FQYA 3KFLA 5FOQA 3UMFA 4M1OA 4WCFA 1PR0A 5HBGA 4DDWA 3GARA 4K8OA 2IHUA 3DB2A 1MG0A 4X00A 3UT5B 4PIMA 1GZUA 4DL9A 3THXB 3UO8B 4FFBA 4PAMA 3FI0A 1Z34A 2AS0A 2JK0A 3DZKA 4L5YA 3C3CA 1N7JA 1U3GA 1JB9A 3X1WA 3KPWA 3WMWA 1NFQA 3I01M 3VKUA 1G7SA 5B4UA 4N82A 2FP4A 4EG4A 4KXLA 1A8IA 4BFYA 3VR4A 4O4HF 1YE5A 1C3EA 2W6CX 2R00C 3GAFA 1G8GA 1W0JA 4J0JA 1Z0DA 2GM4A 2QTWB 3PEVA 4R2WA 2IZ1A 3RREA 2I6XA 3LYHA 3OD1A 3Q1LA 5H4GA 3P0HA 2XCTB 1DBSA 3DBLB 4KV9A 1V45E 1ZWLA 3SVZA 1FDWA 1LPMA 3FJYA 3LBAA 3UFXB 5L8VA 2IYWA 2P6PA 5AM3A 1M5UA 2C4WA 2HZBA 3BJIC 3AYXB 4GGMX 1BMFA 3V4ZA 3IQEA 5EMNA 3O7WA 2V98A 2WZBA 1XRSB 2YN0A 3EH2A 4Z9AA 1KI2A 1V1JA 4RTMA 1O9BA 4D3DA 1R3DA 1Z29A 2ECOA 2J6IA 4GMHA 5BWOA 1SUBA 4ESVA 1KDTA 2EFJA 3B8HA 3M0EA 4KQFA 1YB4A 2TECE 2ZFUA 4OL9A 4DY4A 4EB3A 1WCIA 4J0FA 3WMGA 4WBNF 6CHYA 5KTYA 1E60A 3ENZA 1KR2A 3HY6A 1DOHA 1YQQA 2OAQ1 3IUBA 5GV8A 4GKJB 1QZTA 1GSIA 1XEWY 3C7CB 3ICVA 2C8LA 4JBYA 4ZT4A 4MAAA 1YGPA 2IUUA 3JAKA 2Q1WA 1YF3A 3F6PA 1L5ZA 3CNNA 1UJ2A 4K0KB 1KA9H 3VXKA 2VP3A 3EW7A 4QUGA 2C2HA 4Z2YA 4MQEA 5M5BA 1T3HA 3W5DA 2QN3A 2OLJA 1AQLA 1BH6A 3OOYA 3L0YA 1C1YA 2QTLA 1MT3A 4JIGA 3O47A 4NOLA 3ORFA 3HFJA 4EYQA 1TTTA 2CVFA 1YVPA 5AJUA 3HRHA 2P3LA 3O9VA 2HI0A 1NW6A 1R64A 4UZEA 3VZQA 2WQ6A 4DSZA 5AIBA 4CMEA 1RXEA 1L4FA 2Q3CA 1EDEA 3OMLA 1DXQA 3EZNA 4LTMA 5E2BA 4DOMA 4CKCA 2JZNA 3AEXA 1B6TA 3I23A 2YVUA 2QUZA 3JQ8A 3P9SA 4Q93A 3T9BA 2JEYA 4DUGD 1FP6A 3EIFA 1JLRA 2O50A 1V7ZA 2DSTA 3G02A 4JYPA 3IERA 3CR7A 1GCAA 4L15A 4A2WA 1A4IA 1KVRA 2VQFB 3CEAA 3OKAA 5LIRA 2OHHA 4X85A 4D9FA 1KOJA 3VYSB 4CM9D 1K4KA 1QX3A 1E18A 2H18A 2FW6A 1SUCA 3D3JA 4GE0A 3VR5D 5LQMA 2C78A 3GLQA 4F3TA 2OO5C 1QCDA 3A11A 1K5DA 1VHLA 3NVDA 4YMSA 2NO1A 3VC3A 2JBWA 2XBMA 4Z99A 2PUWA 3BGWA 4Z4CA 4WH0A 1UJ5A 2DFKB 2ZJ2A 3FUVA 4PGGA 2C7RA 2VQDA 3BFXA 1XP5A 1E63A 1U0JA 3FTCA 2QTRA 1TADA 2IX3A 1EHYA 1PR3A 2AVNA 3I0MA 3PEWA 3PRHA 2Z0MA 1V11A 3D4NA 4KV7A 2EOAA 1ZESA 2A5YB 2RAPA 4G1UC 4HF7A 3WP1B 4KXFB 2I8AA 1LCIA 1UODA 1E99A 4L4UA 1NOIA 2NUBA 1YZYA 1D4AA 1R0LA 1GP2A 2YHIA 1UDCA 2QHXA 3Q2IA 4KQMA 2X9NA 3VU0A 3WNDA 4B2IA 3LY8A 3HJHA 1E2EA 3BCSA 1TK2A 3DE5X 1F0KA 3F5SA 2BCJQ 1U7XA 4RK5A 1AS2A 1AUVA 2H85A 4MGEA 1EUQA 2X13A 1MT0A 3UTDA 2KM1A 1E6UA 1MORA 1XZBA 5LA6A 4D4GA 3HY4A 3HA2A 4WE3A 3VH3A 5CM8B 4ALNA 4CFSA 1FL9A 1Q0UA 2DPXA 5HRCA 3JD1A 5I4BA 2CYCA 3GGGA 3OJFA 3PICA 4XCVA 5J58A 5LNK1 2X9QA 3N5CA 3PDWA 3BKWA 3WYFA 2FW1A 2IXEA 4B6FA 3HUUA 4LZLA 1QE0A 4GI5A 2W83A 3K5PA 2NW6A 4IJ5A 1IHUA 2C3PA 1KEWA 1VLZA 1WQ1R 4FD2A 4ILEA 4NAVA 5AKKA 3UUEA 1ORWA 2AGVA 1XV5A 1NJ6A 4TMWA 5CUQA 3FSGD 5AM2A 4X1IA 1M0WA 2BUBA 1W6RA 3WBJA 3T3IA 3KQLA 4BEBA 4KYUA 1BW9B 1EDDA 1H8HD 1B23P 2JA2A 1E0DA 1K0FA 3HO6A 4KLNA 4EK9A 3EPKA 3K0FB 4U7HA 1YQXA 3U39A 3CNBA 2XCOA 1JDSA 2ILVA 2LUOA 3RVPA 2M98A 4KG7A 1EM8A 2YHBA 4J07A 4Z9XA 1TCAA 3AUTA 4OI4A 4ZQCB 2PU7A 3UOWA 5BSGA 2NYRA 2X9VA 3EGCA 4HDCA 2EVWX 1V1RA 2Q4OA 3IEKA 2YNMD 3JALA 2F8MA 4NZOA 4D0NA 2EFDB 4JOBA 1PN3A 1UH5A 1DC4A 5E95A 5ERXA 1Z4QA 3CIFA 3OPYA 7AT1A 2Z2XA 1EX6A 2C9YA 4N39A 3EVAA 1R9NA 3BM5A 4J1QA 1T9GR 2PX8A 4Y98A 3UAZA 1M5TA 3SC3A 4ZJUA 5ICEA 4MICA 3V48A 4KGVA 4EO9A 5A06A 1OOEA 2ECKA 2WJGA 3HXMA 1VM6A 1I1OA 1A77A 4V3CA 3K8OE 2EL7A 3Q12A 3T3OA 2DJ5A 4H16A 4L9RA 4CMEC 4ZXFA 5J4HA 4XX0B 2JPDA 2CDCA 2JF0A 3EVBA 4UTRA 3H7IA 3F7NA 3EIHA 3HY3A 1M6WA 4B4VA 3DLCA 4G5OA 2FE1A 3AV0B 5FBWB 4LC1A 3KLNA 2VQ6A 3TECE 4WLEA 2X2EA 3EH1A 5FKJA 3OM1A 5KUTA 3PEUA 1QHNA 2FN3A 2WMOB 3EBPA 3FYCA 4F7DA 3H2KA 1SFRA 3I39X 1E7MA 2FW7A 3NONA 4J7XA 1E7RA 2PUHA 3ZWBA 1UKZA 2XRFA 1YRYE 3ANSA 4FR0A 1FU4A 2DKNA 1N1GA 2AJLI 2BR3A 2PY6A 1J06A 5DT2A 3ZYZA 4ZHQF 2I03A 4LZNA 1QGZA 5KQPA 4CMGA 1DLJA 3V8BA 4HX5A 4IQ0A 4FIZA 1CIPA 3JVUA 4LY0A 4PCVA 5AWFC 2BGNA 4YGXB 1B0ZA 5IFLA 3E1GA 4PGMA 1VG8A 3BCHA 3P9ZA 5K6AC 5C37A 1MU0A 1TNDA 3U48A 3QPVA 4HSGA 1RJDA 1MF7A 4YQZA 3U7HB 1UZMA 1G5IA 4RSGA 2XB2A 3BJEA 4WNAB 5E3IA 1ULAA 1KPHA 4GMGA 2O54A 4LZOA 4G1FA 3DT6A 1B8OA 1E0JA 4GAEA 4ZU1X 1SZPA 3ZHTA 2C2MA 4QFCA 3GZ4A 5ALHA 5ABPA 5BQFA 5LJIA 3SHQA 1X9GA 4UZFA 4F4IA 3EX7C 3ASYA 5T57A 4XYLA 2O7VA 1RCFA 3GIDA 1ZVQA 2HGZA 1AVTA 4IIDA 4TS9A 4UARA 4UXIA 1KL7A 3ND9A 4IDOA 4DRXB 1P8AA 1HTBA 1Z83A 4RHFA 4DCPA 4BGDA 1OHHA 4YCDA 4Z4FA 4KWEA 1YZLA 4W5HA 2GCOB 3E15A 2XE6A 1GAEO 4E3WA 3DH0A 4QUDA 3BWYA 3UAOA 4OKNA 4JJKA 4LZPA 5DMXA 3O26A 4A6PA 5EFZA 4BAUA 1T3TA 4K9RA 4MYRA 5IYZF 2I1LA 4A0RA 2HQBA 3FYDA 3HEAA 4V24A 4KB5A 1V3TA 5H02A 3JAKB 4OF4A 1DIOB 5GZ1A 1Z88A 4CDGA 1JHXA 1JDBC 2VT7A 4NU8X 5J43A 3IL2A 2O8EB 1QMPA 3WICA 1FNDA 4KITB 4DLBA 1PUIA 2FE4A 3N8GA 1GR1A 1QFJA 1QWSA 2J0UA 3AM5A 4CF4A 5AHWA 2VG8A 5K3OA 1JHAA 3GH1A 1NLUA 5LR6A 2P2CA 4QD3A 4M9ZA 2BFFB 3DZJA 4B3DA 2ZRQA 3HSSA 2FYTA 3NWEA 3Q40A 3U19A 3LD9A 2DAPA 1NR7A 2C5AA 2LIPA 1EEXB 2V74B 3U17A 2QB5A 5I9MA 3MG9A 3ZWPA 3HR8A 1XGKA 2YHUA 4L6CA 4N6NA 5JW6A 1XC7A 1CRWG 4N65A 2EFYA 3CZ5A 5DBIA 1UBFA 4S05A 2WJWA 3GN1A 4FFOA 2FQ1A 2WSSD 3SX4A 3SZRA 4DSUA 1K5PA 4EJSB 4RZIA 1DNPA 2PJUA 4FKZA 4NV1A 3IAAA 4WEOA 1C7IA 2AHRA 4J03A 4CCAA 5L3QA 3W2FA 5EEGA 1RADA 2H1SA 3UFXA 2F6RA 5C31A 2RKOA 4I4TF 1XCLA 3JVVA 1XQVA 4AJJA 2H07A 1QK4A 5CVDA 4BWVA 5D3QA 3NWOA 3UHOA 3X1MA 3A37A 3L7BA 1ODCA 4ND1A 1U1EA 4FFWA 5DISB 1W36C 5ALMA 3HZZA 4BMPB 1JHZA 1XRJA 4N3NA 4P08A 2ZS7A 1ZAKA 1CQXA 5T4FA 3O93A 4CMIB 3WKDA 1JIXA 4PQGA 2OBMA 5LBUA 4BFVA 3DDHA 4I50F 1OWLA 1ZU5A 1PS8A 3HA5A 4MWZA 1MUUA 4XSGA 4RHTA 4PYQA 2TS1A 4AZSA 5DHUA 3LA8A 3S1AB 2OOSA 4K3UA 3VQTA 2B8JA 4O29A 4EB0A 2WAAA 4KE9A 2OQRA 3OJEA 4RZQA 3RTAA 1TYDE 4TTRA 4Z54A 5CVUA 5BSUA 3UJ9A 2JHFA 3IR7A 2V4UA 4ZVUA 2R8OA 3MELA 2BDEA 1MR3F 3QHAA 2PN1A 5AW1A 4Q03A 1IJEA 1Z3IX 3LLUA 4F3NA 3BA6A 1OYOA 5DHRA 1SCDA 4QYMA 2MHCA 1FJXA 2ZI5A 4M1SA 3N6XA 4MPRA 1RQRA 4OREX 3M4XA 1F4PA 3ZH9B 3RH0A 1Y63A 3VJKA 3ZKWA 1F38A 1XZGA 1H2FA 2AXEA 5FA6A 1S7CA 1I2MA 3KUKA 4IWXA 3QELB 4GS5A 1W8IA 1KMQA 2OV1A 4QJ5A 1RAHA 2Q27A 1GLNA 3QVGB 1LB1B 2J3QA 3U31A 1RZRA 4BQOA 2GLUA 2V7VA 4H08A 4TLDA 5GJCA 5EXSA 1TZCA 2FLKA 3U7RA 2X40A 2RC5A 2AOWA 1UOQA 2B9EA 4Z86A 3TXAA 4U39A 2BJHA 3MK31 3GQBB 1IM5A 2X3FA 4MR7A 3WLLA 4A26A 1DAPA 4ERXA 1JFTA 1NJ1A 2ZAMA 5CFPA 1BDHA 4UNRA 4QSHA 4XWKA 3WHKA 2LDXA 3QQ5A 3R3JA 5F2EA 1ZW1A 3U0VA 1OROA 4Y7CA 3ULKA 4R2JA 4NMMA 3EMBA 1TUGA 1ODLA 1Z28A 4MV8A 2Z58A 4C4PA 1RIFA 1VLVA 2EG9A 2CLFB 2IIQA 5JR3A 5L95A 5IDWA 2AC2A 4ZANA 1W4BA 5SZKB 3S7ZA 2V6IA 3KQSA 1IPHA 1KK1A 1GQSA 3B2QA 3H11B 4NQRA 5IDYA 3NVAA 3VU9A 3O9MA 2UXCB 3AEKB 1FDRA 2WJHA 3QXCA 3NG1A 3NGXA 3MWEA 1XLUA 2W2VA 1IQPA 3BJZA 2PAFA 5T5QA 3L4JA 2R3SA 4QDOA 2ZSFA 4FYMA 1U2SA 5K3SA 1PR5A 2NYAA 4G4GA 4DQUA 5DHSA 1UOOA 1I1QB 2DWCA 4N5HX 3I9FA 2BHLA 3FYUB 2O7SA 2PBZA 5IVIA 4AYTA 1HGXA 1U5CA 4MW4A 1U7OA 4MK4A 2YZ2A 4EO7A 1KQOA 1P77A 2WQZA 4Y1FA 1V4BA 4BWGA 1P0PA 2I99A 1EM6A 2X1LA 3OA2A 3EGVA 2F62A 2MIIA 3T7KA 3V7FA 3NDBB 4TWRA 3GNLA 1I3MA 4IILA 3K0CA 3SLRA 1NHWA 1L8AA 1UBSB 1XA4A 2H63A 5FFFA 4CF6A 3Q72A 3TE6A 2CFSA 2L2QA 2WZDA 3R24A 5EA2A 3NT4A 4BFXA 4CT4B 3HSYA 1MEEA 3VKHA 4HEHA 2WM2A 1WQ3A 3RAGA 2EJBA 5ALVA 1TDJA 2QENA 2DUWA 1G9XA 5JNSA 1VCOA 4YJGA 1VMDA 1XHFA 3I8XA 2WSSA 3DVSX 4HBGA 4ITRC 1TZ2A 4DC0A 1DKPA 1Z25A 3DEYX 3QY9A 4HI0E 4B17A 5HP4A 2NO0A 1R5NA 5SYNA 4XCQA 2FMKA 5TMPA 3DFIA 4RY0A 2BW0A 4HS4A 3UCEA 1GAXA 1DAKA 2YC4C 2ZSHA 1SBIA 4IFIA 1YHZA 2JLCA 1S2MA 3WSTA 4DIMA 1CS0B 1E3QA 2B4RO 4JT8A 4Z4IA 4KFCA 3CCCA 4RETA 1Y5IA 4XEUA 2P91A 4HZUA 2GPAA 2Z2ZA 4R2XA 3SJBA 2PSHA 4CRWB 1N2HA 1Z75A 3KTOA 4HN4B 1ZK3A 1U9IA 1T8TA 1L1EA 2EX0A 1FBTA 2WFLA 3H3JA 3OG9A 5EHNA 4CMKA 4Z4EA 1GQRA 5D85A 3MGKA 4ZXPA 3FCXA 3TUZC 2AMYA 1XVUA 1H3NA 2BLNA 2H0QA 4K6HA 3QGMA 4HWSA 1DWUA 1T5LA 3P7MA 1PK7A 1NF2A 3G68A 4PSCA 4F9FA 3WGMA 1EG2A 1IBCA 2QSJA 4LHYA 2JGEA 4R6XA 4QJBA 1WUTA 1NTOA 1P80A 1ECCA 4ARVA 3OY2A 1UFKA 2BGRA 1T8SA 5B58T 4WNCA 3WMFA 1GITA 3I1FA 2ZR8A 3DNPA 5FI3A 1PGJA 3N05A 2HJVA 3NHJA 4OUDB 4RGYA 4IS3A 4E1BA 2X4LA 3LE8A 2XTZA 1TYZA 3ZXIA 2NZUG 5KNCD 3ZNOA 2AWNA 1QG4A 2Z1DA 5CLFA 2ZAOA 2ZZNA 1AY0A 1E7YA 4GI2A 5BMVA 5JEDA 1QFYA 1SKQA 3MTJA 4TMVA 5LQAA 1IM2A 3RFXA 1N2CE 2PBLA 2C82A 4C4TA 4DUPA 5JZBA 3AKEA 5J4LA 5AVWA 4JBLA 1Z2NX 2DWUA 1IJFA 4PYIA 3PIRA 2OFFA 2BZ0A 4IDGA 1XRMA 3RK0A 3MIIA 2XKAA 4HBZA 3BMOA 4IOKA 3WB2A 4D9JA 2HMSA 1JFFB 2X5JO 5BQOA 3UMJA 4Q02A 4YK7A 4EG8A 2XIJA 4DMRA 3TOXA 3AESA 4A4DA 2ZYHA 3HMQA 3VVLA 1ODJA 4AY6A 4Y1GA 2WHPA 4DJJA 1W6UA 2VDQB 4AJEA 3AL3A 4Q4AB 4AJHA 3P2KA 4Y2UA 1H69A 3CLSD 2J1LA 4BNYA 4G0ZA 2UUBB 1XDWA 3UCFA 3GRUA 3BORA 4TOIA 1XZJA 1OZHA 3IMEA 3TK1A 1GPDG 4JJZA 3KQNA 4ER0A 4OI2A 2BFEA 3I8OA 2YMQA 4U5QA 5C3UA 4XIIA 5LQSA 4CKBB 4KIUA 3NGLA 2COEA 4JHLA 1T24A 2O2XA 1U99A 3MOGA 1P1JA 1SK9A 2IY9A 4R7ZA 4GBED 1V9LA 1DQRA 1SIUA 2MYNA 1OW3B 4UFOA 2XEDA 3IDZA 1P2VA 3WQSB 3DCNA 1BWSA 2C8VA 4I7EA 1JLLA 1P74A 5L7TA 4NNOA 3MFQA 2P3SA 2JFQA 1HE4A 2X0JA 1K7EB 1DIRA 4KSYA 1R5BA 2DHDA 2QU8A 1ISGA 1BS2A 3AEYA 1KYWA 4WESB 4ZVTA 3ZE7A 5I8PA 2J0SA 1PT5A 4HXGA 3S1AA 2EV9A 3GD5A 4BQPA 2F1KA 1CQPA 4I5GA 4LXUA 1K2VN 1QG0A 2XMPA 3AHIA 1YR9A 2V45A 2XUOA 4TMXA 2PJZA 3EEIA 2X7XA 4WVLA 3WL4A 4YRIA 1SELA 1V71A 4JOQA 1PG0A 4WOPA 5C51B 2Y1GA 1QTIA 3O83A 3BPSA 4K8RB 1WXQA 1ZIXA 1U3VA 2VPPA 4MEAA 4KO4S 3F6EX 3GVIA 4GWGA 2XYHA 1JFLA 2Z3VA 5DWDA 5GJVC 5JZSA 3VTKA 3G5LA 4K6KA 1Z4MA 2JGMA 1F6WA 2G9ZA 3NALA 2LCIA 2P3QA 3JYQA 1OAKA 3RU2A 3UMYA 3SQXA 5EL0A 3LXRA 3IMKA 5E7JA 3RIGA 1XQ9A 2J3HA 2PX6A 3B7WA 1FRZA 3K1TA 2WKSA 2J8ZA 2A0FA 3JQ7A 2EIHA 3ICWA 2ZG6A 1JV2B 1W5EA 4GPBA 4M76B 3NOOA 3DZFA 4Z3OA 1RWMA 3DLAA 1T9DA 2H6EA 4Z0TA 2IXTA 3CTPA 3EIUA 4X3PA 3T9AA 4MV9A 4IH1A 3WKAA 1A7KA 4YP0A 3W8RA 1TXGA 2VP9A 4PLVA 2IOFA 4GR4A 5BSHA 1HNNA 4LWOA 3FYSA 1O03A 4S1OA 5JRJA 4OHVA 1L5SA 2AH5A 1SULA 1YAJA 4YUZA 1XAIA 1EGQA 4HDMB 4MWCA 3QBEA 1A2BA 2WIGA 3GUCA 1Z35A 2NZJA 4B3IA 4V0NA 1CYDA 1RPTA 4D0LB 2QM0A 1KOFA 5FBKA 4BEWA 3N0XA 4UZSA 3D9QX 4J2HA 2EJCA 4EJFA 1G6KA 4JC4A 5HM8A 4P0QB 3LLSA 4G5RA 1L5QA 1EK5A 2O8EA 3LBHA 4H18A 1U0EA 2YYZA 1UAGA 1UKAA 2H9AA 4MLPA 3R0IA 4DLXA 1GVNB 2H2DA 2CXTA 3INNA 1R8SA 4W82A 3ZU3A 4WZAA 2ZROA 2QMHA 3R9KA 3TD2A 2RGCA 2V7GA 3ZH2A 4PYJA 5K0BA 4ZQIA 5DTRA 3TD6A 2BD0A 1TEVA 1TVMA 4YBRA 3WLSA 1DIHA 4DLYA 3AEQA 3HWX1 3KD2A 1KOGA 3ABIA 3HEBA 5F4BA 4UAVA 4G5SA 4AICA 4C7XA 4PXYA 1XEAA 2Q3HA 3NUGA 2Z6VA 5IKOA 3L4EA 2W2XA 4NAUA 3IIKA 4AYWA 2HJGA 4JY7A 3D31A 4LZJA 2EKLA 2BGMA 3OMXA 3VKWA 4YPOA 1QOQB 1RLUA 1V1MA 2A1IA 2JANA 1AGNA 3IELA 1VA5A 3OFJA 4IXDA 1HE1C 1Q83A 3IVRA 4O2AF 1VP9A 5K3FA 2REBA 2FW0A 3OPQA 3L18A 4EBBA 4DC9A 5GIPE 2H5IA 3IA7A 1AA6A 3RU9A 1SXPA 1OTHA 2J5BA 2QVCA 1NNUA 5C8YB 2XSZD 1Y6FA 5DRYA 4NF2A 1E2JA 2WJVA 3D6FA 1WPRA 4UNNA 3K70B 2ZKIA 1BTOA 4U3JA 2GR9A 3DDNA 1E9RA 2WJJA 2VCYA 1RBQA 3D8BA 1P7ZA 1W0KD 2P2DA 3PE6A 3T7RA 3E7XA 5K8CA 3H86A 2ANCA 3EQ9A 3FWYA 3HLKA 5I8ZA 4A5SA 2H17A 4LFBB 1YCDA 4UEJA 3TE7A 3TO5A 2R68A 4QBKA 2FPWA 3KQTA 4FN4A 5KIAA 3MRXA 1HI9A 2YMMA 1CY7A 5CT5A 4JI4B 2P2LA 2NXJA 1TU0A 1M1UA 2E9SA 2MSKA 2Q6OA 3EZ6A 1GVHA 1DC5A 1YOVA 1LFDB 3NNSA 1H6CA 4D42A 1A50B 4NJMB 4ZYVA 4AB1A 1BA3A 4MYDA 1QIMA 4MVJI 3QY0A 1E6MA 3IHTA 1AUOA 1MX1A 3FCCA 3HYLA 3PE3A 4D46A 5T4BA 3COZA 4Q9HA 1FOEB 1RRMA 2BFBA 3H6HA 3NNNA 4KC0A 3WGQA 2YIJA 3ZCXA 5CFMA 1T5OA 5D01A 1FFXA 1R8QA 3SX2A 1SXGA 2A8YA 4E03A 3HJFA 1BHSA 1LJUA 2QT0A 2KE5A 5DM60 1P19A 1YKFA 1MD9A 3NAQA 3HK2A 1L7RA 4GKAA 3Q7PA 3S8MA 2DWQA 3H13A 2ETXA 3DYVA 4YRRA 1CUVA 1UZLA 1ETUA 1NQUA 2XYVA 1WW8A 2IEYA 3TJZA 1TCBA 1WM1A 1A7JA 3F3KA 3FFXA 1L8QA 3GN2A 4R40A 5BQ5A 1BQEA 4Y2GA 1RLMA 4DM4A 1UKEA 4P31A 4KRFA 4YRDA 3GX1A 1F4VA 5CB4A 2ZQYA 4YI5A 2PPLA 4YRFA 2VHZA 4A73A 4DMGA 4KR6A 2JFHA 5AK5A 2WT8A 3DYBA 3NJ8A 5BWCA 3PXDA 2Y93A 2E4WA 2JJ1A 2P9JA 1KKLA 3DWGA 1X77A 3FCEA 3N2IA 5EIAA 1OCEA 1ZNZA 2G4CA 4BVGA 4RZ3A 4F6RA 5JWRA 2A9RA 2I87A 3OICA 2HA3A 5JWHA 1MJHA 4EG7A 1M2NA 3NWBA 4ZOBA 1A8HA 2ZSEA 5TPWB 3KQHA 2AJBA 2WWVD 3AUKA 2R8EA 4QLOA 3PCXA 1VIMA 4DQXA 2HYIC 1KO1A 3GCDA 4RWZA 1P44A 4KQCA 4NCAA 1HDRA 4HWKA 4JX8A 1ECJA 4IQ8A 5CXUA 2X6RA 1NRIA 5BO5A 3QLVC 3RD5A 1SWVA 1WULS 5DNVA 5B6JA 1MABB 2IIBA 1C14A 4L8FA 4BP1A 2CKMA 3DWEX 1ZWKA 6AT1A 2EBFX 4IIUA 2UZ3A 3NXKA 4YJ3B 2C1ZA 3ZTWA 1HEUA 2D59A 2VDNB 5G1PA 5K0TA 1EFPA 2WICA 4MV3A 3RVBA 2HCFA 2Q6VA 4F2PA 3R23A 1OLOA 4M7PA 1G6HA 5ALZA 3DMFA 3NEJA 1H4SA 1YJXA 4C7KA 1N0HA 4JELA 1M2VA 4MUHA 4W5QA 1R6BX 5ESRA 1P62B 2WHEA 2FA9A 4N7MA 1XJ5A 2P4QA 4KRXA 1DXOA 1I7LA 1N7IA 3W5VA 2F9FA 4ZYUA 4CQLA 5JXIA 5H8WA 4YJ3A 821PA 1QPBA 3HDYA 2AEMA 3KHUA 4BDSA 1C0KA 4B8ZA 5I51A 4UBIA 3J80A 1EWVA 3UTCA 1IWPB 3DKIA 2FRDC 4UOEA 4NJOA 4MWOA 2LTAA 3EGXA 4NBLA 2VXCA 2Q5FA 1WSAA 1E8DA 3WAKA 1G21B 2FPPB 3GROA 1M1XB 1DQSA 4IDBA 4Q0MA 4F1JA 3ZDBA 4D43A 3F8WA 4NOJA 2W9XA 1NJGA 1I4DD 3ET4A 1JLHA 4RSRA 3RYFA 4GMFA 1TM5E 3H1GA 3ITNA 3RGGA 4KPYA 4RZXA 1WCXA 4KLAA 5JPIA 1YR1A 1C7FA 2K2QB 2V65A 5L45A 3LUHA 1GQQA 3HJTA 1TIKA 2G1JA 4KNYA 4OSOA 3EPRA 4F6RB 3SEAA 3CURA 3L6DA 3ZHXA 2AXNA 5EIOA 4ZC1A 4EUKA 2X5XA 2L82A 3EUEA 3KVVA 2VUUA 4JBIA 3WAJA 1NSYA 4BO5A 1QF7A 3FSEA 3UBTA 1AQ6A 3FZGA 3L6RA 4NYIR 3SE0A 4DLVA 4FMCB 1O3YA 4PNZA 4DYDA 3LUKA 3EAFA 3I64A 3UGQA 3WLJA 2ONZA 5DHFA 4XZ3A 2OO5A 3S27A 3T9EA 3G2NA 4PRYA 5CNIA 4EPRA 4GUDA 4DIFA 3FOAA 3G9TA 1AT1A 1ZINA 2YQ4A 3QWAA 3K71B 2BCEA 4QUKA 1ECGA 1WUYA 1T4CB 3M33A 1KO5A 4PY2A 1NQXA 4UTNA 3RSHA 1B6SA 3CX6A 1QHSA 4BVLA 3BRQA 1J7KA 1HORA 4JLVA 3O1LA 1F2VA 2FPRA 1MOPA 1PL8A 3P9YA 1A8UA 3PQ3A 4K05A 2W70A 4XWOA 1RMQA 2GESA 1CJUC 2AK2A 3HBAA 4GRDA 4N5MA 3OZXA 4BBPA 4D4MA 4P53A 3BB3A 1VHQA 2V3WA 2CCGA 5I01A 3LXUX 3K96A 4JJ8A 2Z6AA 1B1CA 1NLZA 2VP2A 2D7CA 3IAS1 1ENPA 3W79A 2FMTA 2RGRA 4MQEB 4OKSA 2C99A 1V39A 1T2AA 1DFIA 2ISQA 2VK8A 3JQBC 4BRZA 5JAOA 5JTUA 1EK2A 3ZCUA 2I4RA 5JPDA 4DWWA 3PX7A 2QU7A 1P18A 4I1OA 4I5DA 4EHJA 2CNWD 5HZMA 5K2MA 1KXJA 1B74A 3BXPA 3MCUA 4ZRMA 5G0TA 2ZUTA 3RSZA 5KNBD 3HU5A 3JQPA 3KELA 3CKYA 4M99A 3ZE6A 1JU4A 1LV8A 2GTHA 2GZ3A 3VTAA 2EJWA 4DDVA 5L51A 4MCHA 3WNVA 2JCXA 3NOVA 4FYXA 1D5CA 2AN1A 2EFCB 2ZUWA 3KYCA 3IKTA 3CU5A 2DC1A 2NG1A 2ZJ7A 1KKMA 2GN6A 2QD5A 1A71A 3B2NA 3KZVA 2HO5A 3W34A 4L4RA 1XJCA 1J8VA 3WG9A 3QHQA 4KVZA 3HP1A 4XM1A 4RANA 2G09A 3RYIA 2AG5A 3CGGA 1Y8QA 3M6XA 4OV6B 1E6EA 3A6PC 4AKHA 4FI3F 3CKKA 3WHIA 5GV7A 3ZHOA 4TSFD 2DHCA 3VNSA 1KJZA 3W4IA 3PTZA 3PC3A 1SHJA 3V33A 1HEYA 4CQMB 1H5NA 3UK6A 4PYNA 1EJ6A 3AU8A 3MQFA 3F49S 3D8SA 4RC9A 5HVNA 2OV8A 3HZHA 4RSHA 4HD8A 3OF5A 3VYUB 5EE0A 2JRLA 4QDKA 5B2FA 5FX2A 2JAQA 2XPCA 1RKBA 4CTOA 1GA1A 4RM2A 5IH3A 2O4UX 3WIBA 4BE7B 2V8OA 4GYWA 5C8ZA 1HY3A 1N0VC 2DJIA 4WK2B 3IT2A 3E18A 1Q1BA 4TSKA 3UMRA 5EP1A 5L7YA 4DV6B 1SBCA 3PQ2A 3I1JA 4Q3BA 1IQ0A 5FOUA 4ES6A 1R10A 1W5BA 3NHMA 1IN5A 4P82A 4E30A 5JNVA 5I7AA 4WFIA 5LFAA 4J6EA 2JVJA 3E9EA 1KVTA 2FPOA 1M1NB 3K1AA 3GLFA 1XYVA 4QGHA 5A0FA 2OXIA 3A06A 3ELUA 3NDIA 1AZLA 4WK4B 5M3BA 2VJMA 3LHKA 1P5RA 4EG0A 3H2ZA 3LW7A 1TO1E 2WU8A 1KYXA 2HRZA 5HUQA 1TKRA 3K2QA 1OH7A 3FTEA 2QQ5A 1U2TA 4MA5A 1ZRNA 2BJWA 4YAEA 5AVSA 1UOEA 3FDJA 3C7DB 4G0NA 3MPOA 3A7EA 1W48A 3GG9A 3VUFA 4G0UA 2Q0XA 2G5GX 4X7MA 3PXAA 2A9QA 1G3MA 2C0PA 2PS9A 2QJTA 4WZBE 4UHDA 1Q19A 3L7CA 3VX3A 4O33A 2CF5A 3D59A 2CXPA 3ZBTA 2GJAA 5LP6C 1A76A 1X87A 2O2GA 4B7ZA 1VLMA 5DMHA 4ZU3A 2C4MA 5LZ2A 4RMIA 3IUMA 1XRPA 1V96A 2ZSJA 4DA7A 5K0EA 1MJNA 1I5EA 2PHZA 1ZH2A 3NCHA 3CUKA 4K9LA 2IYXA 1RKUA 2ZRFA 3AXSA 3F5QA 2XXAB 2D1TA 2VC2B 4FGLA 4TKVB 1BMQA 1TYAE 1XCGB 2GDZA 2NSDA 3CRNA 3HA3A 1KDOA 4G1CA 4KAAA 2O7QA 2Q1TA 1JI3A 1JHDA 2P9ZA 4F5DA 2ZB2A 4EHDA 4RFVA 4CM7A 3K6RA 3KUXA 3I92A 5CXSA 2IC5A 5KSWB 1K4MA 4GXTA 4WKNA 5DBFA 2H54A 2YY7A 4ZRDA 3A4VA 3ZY3A 1LGYA 1NVWQ 2CXXA 2V6BA 1RPNA 3UNXA 3EC2A 3GJ0A 3NWJA 1UC8A 4PIPA 5AI0A 3WJAA 2QRVB 2PH1A 5E1DA 3DXXA 2WU0A 1BDJA 4HYYA 1F9AA 5EKSA 5JYEA 1N3YA 1DG3A 4EBFA 1RFLA 2P35A 1NI3A 3MCTA 3GLHB 3P2YA 4BLOA 4ESOA 3TTYA 2GJKA 3EQ8A 4OO3A 3GFGA 1K3TA 5A6VA 1NY5A 3H2IA 2CV2A 2QSZA 3F3YA 3TW4A 2V6GA 4ILKA 4LDRA 4D4JA 3D8UA 1QE3A 2PZLA 3RT7A 2ODEA 1DQNA 3H5AA 4W5JA 2V1UA 1T2NA 2VJNA 3AB3A 3H1FA 4QVKA 3N3AC 4FWIB 9LDBA 1DMSA 2E55A 1FDIA 2F43B 2IV3A 3WI7A 1I2DA 2YV1A 4C14A 3UWMA 1N6IA 1WB4A 1A9YA 1FNCA 4X44A 3HXQA 3UWOA 2J9FA 3ZVKA 1QCYA 4K40A 2GPTA 2N9UA 1W88A 3BWBA 4I2VA 3VMFA 4C22A 1B8NA 1Q1ZA 4PYMA 1QF9A 1PYGA 4ZOQI 1BOOA 1RI3A 3D1JA 3OAAA 4V0KA 1U0TA 4EENA 5K9ZA 1YMQA 1LVUA 3MJRA 4OI1A 2Z30A 2XNCA 3H8WA 2IXAA 3QE2A 2I2FA 1QS0B 3L6UA 4NCHA 4TKUB 4U8GA 4L0CA 3S28A 3SCZA 3CUEF 4GW3A 3IRVA 4HRXA 1TMOA 1PU2A 1UDBA 4J1TA 1HDOA 4DW8A 4NE2A 5LUBA 2IS2A 1KO8A 1VBFA 1YU9A 2VTEA 1O58A 1VE3A 3R8XA 5MFZA 3BFKA 4I5IA 1X42A 5ED4A 3TGWA 1V47A 3FETA 4LBYA 3C3MA 3OT1B 3T0FA 5BMVB 5K01A 2PLAA 1QANA 5FO1A 1HQYE 1NT2A 1FYWA 5LMUB 4LDNA 1U2DA 3BS4A 4XIFA 1SOUA 4AFNA 3FGOA 3ZDDA 2H1RA 3PFGA 4Y0NA 2HY7A 2ZS8A 4PEVA 2ZBUA 1X19A 3B9QA 4B31A 1N0IA 3DLBA 1IM8A 2Y71A 5JXJA 5AOBA 1PDOA 3DV0B 4B3JA 1EJ0A 1D07A 3ZV3A 2ATXA 2G72A 4HC4A 1SUEA 4G0PA 3SKXA 2GTPA 2HQOA 1GA4A 1X38A 3DUWA 3B12A 2YS7A 1L5KA 1JBQA 4RVSA 3TRJA 3HJGA 3ICQB 1SQ6A 2C31A 3I32A 1AX9A 3DTTA 3ZXSA 4C0SA 3BFVA 3VR4H 5B57C 1TM3E 1ICIA 1VJCA 4F56A 4MARA 1W59A 3N59A 1J33A 1VE1A 1ZJ6A 2JFXA 3QVOA 4GSLA 3GFPA 4YPFA 4TMYA 3K30A 2GILA 4OHWA 2XVAA 3SF0A 4OFXA 3V2IA 4I0WB 5KJFA 2QR3A 2QRPA 3PVZA 1M34E 3BWEA 1ZA2A 4IG9A 2DM6A 3RC3A 1BDMA 1QWOA 2CVQA 3E22A 2J3LA 2IPLA 4MS1A 4G1BA 5J5VA 3W3ZB 4OJYA 3RFTA 4JXJA 5JS7A 4H6VA 2DPGA 2XX3A 4HGOA 1AZTA 1PR6A 4RS4A 4M3NA 3UFBA 5E6UB 2NU9B 2ABWA 1VL2A 4Y2PA 4RIEA 2YFYA 1KI9A 2RGEA 5BWMA 5FH9A 4I14A 1IDN1 3FKQA 1MRNA 4RIFA 2RAFA 2X9GA 2XE8A 4AZ0A 4CFYA 1JDVA 4AF6A 3AF6A 2DETA 3FPBA 5KQSA 1ZISA 2GZDA 3NHKA 5FTJA 5F7ZA 2C7VA 4U9IS 5HIJA 4GZMA 4L4XA 4DHWA 3K72B 1IHXA 2W0MA 4PCLA 1WD7A 1YRWA 2G17A 3FNHA 5GGXA 3TR6A 4ZYLA 4IDQA 4CKZA 5IVHA 2HU2A 4PX2A 1SXIA 2QAGA 1GTL1 2PX4A 4JLSA 4BNJA 1WAMA 3ZV6A 4K0RA 2VUHB 2CGEA 3PHHA 4F4CA 2REOA 3QVJA 1MDFA 2VH1A 1ZICA 1ZO8A 4FGZA 1LV7A 3U3JA 3RJ9A 2I7TA 1Z2OX 2C03A 2OHXA 3LY9A 4FFNA 9GPBA 5A6SB 3SSOA 3ZXUB 3P32A 3CZ9A 5H9WA 2ZKLA 4OOFA 1KQPA 3EF0A 1I4OA 1X3SA 3BKXA 3E6AA 4QUIA 2BOVA 3RFFA 3WLQA 1IXZA 1AS3A 1D2CA 1DELA 3H5OA 1F5SA 2C0QA 1BJKA 1UQTA 2WWHA 1BHJA 3MGGA 3DDSA 5KDOA 4H4CA 3MTEA 2VDOB 1J9GA 4Q37A 2RBGA 2OCAA 3V1KA 3LQRA 4L78A 3SM9A 3UKOA 4K1XA 4X3CA 2QYTA 3F47A 1PRYA 3O1IC 5KOJA 5DX8A 1T5HX 2OT3B 4MO2A 3AUJB 4MVXA 2WTUA 1KJ9A 2I6UA 5BQXA 5KJCA 2ZIWB 2YVQA 4QULA 3F67A 4TLCA 4ZCTA 4L4SA 5KCMA 3I2GA 2FCAA 2GPSA 1EBFA 2B4AA 5L4SA 2VT2A 2C3YA 1YIAA 4BXOA 4XM2A 4D02A 1E79A 1PBTA 3IEUA 4XWYA 4IHAA 1AUXA 2EL9A 5IM5A 4FE3A 4N18A 3W6OA 4LE2A 4B46A 4CV2A 3DG9A 3G9XA 3EWNA 4HN9A 1Y8RA 3DOEA 5EWJB 2V03A 1Z2CA 1P4HA 3IDOA 4RGBA 2O5CA 4MV6A 3UXYA 2SKEA 3E7FA 1MW9X 4IH4A 3SNHA 2RHRA 5K8LA 2JZOA 3IBGA 1WABA 2A35A 1EQAA 1QZXA 3G0GA 2OHFA 2G9VA 2FH5B 3AVOA 1OA0A 2IZ6A 3K31A 4NDNE 4QYIA 3O31A 4XIJA 3V8MA 4CM1A 4EUHA 5IC6A 1JFVA 1UXIA 3CH6A 4J9UE 4CCSA 4HQ6A 2NTJA 2R6JA 2BKAA 3F9RA 4GICA 4II2A 4LX0A 3IIIA 1E1DA 5BXQC 3LBIA 1ZQ9A 3GWZA 3V3KA 3D7MA 3UJHA 2HMAA 4BP3A 2VBGA 2TSYB 1RYZA 2MCFA 5EJ6A 1AQNA 1U0OC 5CVEA 5FOXA 4UU0A 3JZMA 1U8AA 4JVLA 3JQFC 1KH1A 1T9BA 4UBJA 4ZVNA 3RC9A 4DMUB 2VHCA 1RI1A 3BSFA 1U7TA 4G36A 1YNOA 5LD2C 3JQGA 2ZUFA 1R8YA 1HLPA 2ZRAA 4PXSA 2WILA 3I05A 1YTLA 1EE2A 2GZSA 3QLTA 4WOKA 4YVFA 3R8FA 1CNEA 2VYVA 4JLDA 3NHFA 4LOKA 1GU1A 1R66A 2CNBA 3KKQA 2BEWB 4FEYA 1DEKA 3S81A 1VE9A 1RXVA 2VWHA 2M6LA 3UW1A 4EL0A 4N01A 5AOVA 4ZGGA 3EE6A 4NENA 2AZTA 4LNAA 2HMVA 3D81A 3FFWA 2VPQA 3H5RA 4WUTA 1IZ0A 1H5UA 1VSQA 1DVRA 1FDOA 2OFXA 3WDMA 5LYJF 1UEIA 4MULA 1LF5A 2VP4A 4NZYA 3WRYC 3PHLA 1KEPA 1H2RS 1PJ2A 2FPSA 2E82A 3DL0A 5KMGA 2RIPA 3KC2A 1QR6A 4F9GA 3BEOA 3BX1A 3NJ4A 2VNIA 3T06B 2JLUA 1H6DA 4NV0A 5JNTA 1SU7A 1GUFA 4FFPA 1DZIA 2GD2A 3NBFA 4DLTA 4YAUA 1M2OA 1FJ2A 1D6SA 2JLRA 2PZFA 4EG6A 1PWXA 1RDFA 2YXLA 4YB8A 4C7MA 1OXVA 1M66A 3AIOA 2R87A 3SMQA 4MZDA 4RESA 3EPJA 2WKWA 3R7WA 3CLKA 3I6IA 2NUAB 4A6EA 4GQIA 2WWRA 4RA6A 3MWDA 3TG2A 3ZU5A 5JAPA 2WOOA 4PCUA 1T26A 1Z7EA 4R9UC 5E7QA 3PF8A 2QGNA 3H99A 1N1EA 3N7TA 1OX5A 4MUBA 2Y27A 2O59A 2VNAA 1IUOA 3GZJA 1C50A 1DAIA 2J6CA 5EZYB 1Q50A 2Q45A 3W5SA 4C6TB 1NIPA 2OO7A 1SCAA 1ZGHA 2IW1A 4MKXA 4N9QA 4R54A 3L04A 3ZE9A 4Y9RA 2DLDA 4YIKA 5JAZA 3Q8WA 1A8SA 2QPOA 1NP3A 2FDRA 1T9AA 3BMXA 1KDZA 2AJCA 3WQQA 4BVEA 5IJWA 1E9EA 2F3TA 2D2FA 1K6JA 1SUAA 1W52X 2RBKA 2VEOA 3C1TA 1ESMA 2QX9A 3ILYA 4I9HA 4J0HA 4OY3A 3D6JA 4W8HA 4U2KA 4YAFA 5TC4A 3UANA 1W4ZA 1MAWA 3T4PA 3DGFC 4BHTA 3EBLA 3WJ1A 3TZBA 1Y7HA 4P38A 4QQ8A 2WAMA 3NH9A 1Q6ZA 3LT2A 1UT6A 3PQFA 4OLJA 4YJHB 5AM5A 4B6JA 4DC1A 2BSQA 4H27A 1XUOA 1DWQA 3E2MA 5DGHA 4ZA2A 1QR2A 5H0IA 1E8MA 1Y8QB 1U1GA 4WWHA 3LTNC 1J42A 4OHBA 4YRLA 1GNLA 1HF3A 5BY2A 1R0WA 1XMXA 1AQJA 2JJ1D 2ZYSA 3CZMA 5CLGA 3TLZA 1U28A 1C0IA 4DLUA 2A94A 2HYDA 2QTVB 1XWIA 3UJ6A 2R8BA 3T5MA 2ZM5A 3KSZO 4JT2A 2IYNA 3DCYA 2Y4OA 1X9IA 2B7LA 3LGXA 3D2AA 3ND5A 4PG6A 5AK0A 3VMMA 4AQDA 3JR3A 3ZQUA 1GU7A 1KEZA 3FHOA 4YJFA 2GH1A 4L8WB 1XPJA 2IEGA 2WV7A 2YIVX 3GFRA 3PB3A 4IS2A 3SFTA 4RTQA 1YRAA 3GUVA 4P6VF 3RADC 3NI2A 3ZGYA 3IP1A 1QVAA 2GRJA 5BSWA 1KJNA 1JR3D 4KO2S 3UWPA 3VKVA 4QT4A 5IAEA 1NMEA 2CVOA 2GXSA 1QDLB 4IPTA 4AIIA 1M2GA 5EKTA 1GRNA 1YI1A 2Q1UA 3C8ZA 4P84A 4ZO7A 3TDMA 1OBCA 1PZMA 2PMKA 3NBMA 2FX5A 3QMMA 4INOA 4LY6A 1BYUA 1S3SA 3ORHA 1Y1PA 2C9CA 3ENNA 4MIYA 3HYNA 3M1LA 5KTTA 4GRAA 2XMZA 2FFAA 3K9GA 4L3OA 2CDAA 4BL5A 3C3YA 5EJGA 3GA7A 1JKMA 3TAHA 1FS4A 4YT5A 3SLGA 1X0XA 1V5EA 1GN9A 4FZVA 5F5LA 1REQB 2CEAA 5C1PA 1EVQA 1TMGE 2CMHA 2YXEA 3B89A 3ZOKA 4D0SA 3A1TA 4FR5A 4E2XA 4RVCA 4XB2A 5JY1A 3OH8A 3DLHA 2ZVPX 3JALB 5I5GA 3D8RA 2P67A 3E4DA 3TL3A 3UAWA 1KZGB 1KQGA 4UTXA 5GM1A 3X1KA 2VSNA 4AUMA 3BRWA 1YS7A 2C2XA 2FLVA 2JLXA 3B1WA 3RRXA 1TL7C 2O1XA 1JAZA 2CL5A 2Z95A 4E5MA 3THWB 1AURA 3G1WA 1J8DA 4YMGA 1LRLA 1PSWA 3DOUA 4TYQA 4DMMA 3OU7A 3VR1A 1YS2X 1JFRA 2C4VA 4DR2B 1RSZA 3TRFA 4F8JA 1GDTA 5LLSA 2C1XA 3GLVA 1V3QE 4L5JA 4TVOA 3T5AA 1R6UA 2QG4A 4II3A 3WDLA 1IHOA 3ZPXA 3OM8A 1EBUA 2YJZA 4H15A 2C4NA 4Y2VA 3C5EA 5I9LA 1ULUA 3GVCA 4TSFA 2I7XA 3T7AA 4A91A 4D7AA 3INYA 1JEOA 4XJTA 3BMQA 4HDSB 3TQTA 3AKYA 4YR9A 3PKJA 4GOKA 2R751 1LS6A 1QOZA 2WAXA 3EGXB 4MEBA 4OQLA 4OK3A 3RWMB 5AVVA 3RAFC 3KHKA 3DP7A 2JD2A 1MV8A 4KPUA 1W5SA 3JVIA 2H1OA 3Q7IA 4DR4B 3A4YA 5LDGA 5AESA 3R3ZA 4LWQA 3JWHA 1NKTA 2PLFA 3QLJA 3UIEA 1A8QA 1R0KA 3F4LA 4KBYA 1J23A 3PI7A 2VDWA 3V1LA 4AJPA 3VNUA 3PFHA 1K3FA 3IGFA 2V0NA 3MWFA 4OQYA 2WM9B 4RZHA 3LSYA 2QV7A 1FNSA 2WWIA 3VA7A 3FGPA 4TMKA 4J2TA 5ECGC 1Z7WA 3DHVA 3HPRA 2R62A 4K28A 1U90A 1CU1A 1UIMA 1RWQA 2FGJA 4FHZA 4AIRA 1KYVA 3B3AA 4QOJA 2YBEA 4HAVA 2FSHA 1Q57A 3H5LA 4A92A 1L7PA 4PLGA 1NAIA 1YB5A 2AOVA 4JC0A 1E32A 4YMHA 3B70A 1SVMA 3IIJA 3QYJA 4B44A 4NCNA 5C7OO 2QVXX 2ZYGA 4ND2A 3S2YA 2IHVA 5BR7A 5KX5F 1NPYA 4IMRA 4YUWA 2SECE 3TQRA 4RVUA 3LCJA 4OVKA 1NVMB 2WM8A 1NBHA 2J9XB 2WINI 4G25A 1JF8A 2BTOA 5LXTA 3OE7A 3PC8C 4Q4LA 5DIZA 3M6FA 4XGKA 3INRA 1TEHA 3B1XA 2Q28A 3QH4A 1RYNA 4AU1A 3EG9A 5BMOA 1NBEA 5LKAA 5IYZB 1YA6A 4HATA 2CFRA 1PV1A 3ADOA 3MQ2A 4HLUA 5CX1B 1LD3A 2O52A 4NZNA 3IQDB 5AXDA 5TS3A 3ODPA 5LXTB 1JEDA 4P80A 5A1TA 4L02A 1SMKA 2XHEA 1I7DA 2B0JA 2R9VA 5JCXA 5E4TA 2JIZA 2AFHB 2VO1A 2QPAA 4J91A 5LQJA 2KI5A 4Y2RA 2AJDA 3GJRA 4ZYWA 1VKJA 1Z3CA 2QZ9A 3Q5EA 4IGAA 4KZPA 3KOZA 4PANA 3BL8A 3DDUA 3HDQA 2RGXA 1Y1KE 1O08A 4ONEA 4NOMA 4HRVA 3GLUA 4GZ3A 4IV8A 2M6SA 5JG7A 1U9CA 1L9KA 1D2GA 4UDXX 5SZIA 3E0QA 2PAAA 1JHVA 3CLRD 3L4SO 3SD7A 3A6KA 4AJKA 3BTVA 2GNAA 1MAUA 1A88A 3QTLA 4UPEA 1KAEA 1GEEA 1O96B 2ERCA 5DDIP 4F72A 2QBYB 1B2RA 3FIUA 4ARIA 1G63A 2FW9A 3RUAA 2OBYA 1JVSA 1IWOA 2WWGA 5DN6D 2ZUEA 2HSWA 3GP8A 4BV3A 4NNPA 1LPNA 4KXMA 4JUBA 3BCUA 3IE0A 1ZXXA 5EZYA 2BGIA 1QYWA 2IDJA 4J3FA 3WGJA 4OQMA 1RRCA 3FZYA 2F1JA 3DF7A 3IPAA 1Y4ZA 1CJKC 3AZQA 1RM3A 2DQSA 3N74A 4I55B 2FN9A 3O8QA 3EDRA 1O77A 4DJTA 5JSZB 3WAGA 1WCIB 1K5GA 2FEOA 3GF4A 4FBLA 3I2FA 3OPYB 1FP1D 4DXAA 1PFUA 2ACVA 2NUAA 1I4LD 1M8JA 4XYEA 2ZUDA 5A3RA 2WR8A 4J16A 4CIXA 4BTVA 2ZJ8A 1XZDA 1NMZA 3SYLA 1OD6A 3ZS8A 2RH4A 2XZPA 5AI4A 4FZJA 4JITA 3R9XA 1R8JA 2V6FA 4CIWA 3HB7A 4S1TA 5I7HA 3BE8A 1I6WA 4AN1A 4PZLA 1N75A 3MA0A 2R86A 5L53A 4CHGA 1ZSYA 2H8GA 3PQCA 1NWHA 4K9MA 3UW3A 2OA0A 3F3SA 1EFKA 4XFJA 4CM5A 1RI5A 4RK6A 1FTSA 1OY1A 4XPIA 3PC2A 4O59O 4B2PA 8ATCA 1RC8A 4LKRA 2YTZA 5K0JA 1Y1RA 4MLDA 2FSSA 1WXEA 2UZ1A 3H0CA 1DT3A 1E2QA 2HRBA 3R6WA 4LYAA 2I2CA 4QU8A 2AXPA 1SBNE 3OCUA 3UQZA 4EAAA 3IEVA 2JLQA 1P3JA 2C00A 1ISJA 1VG1A 5TPZA 1RI4A 3VHXA 1JAXA 4C20A 5CXXA 3I83A 3IR5A 3H8JA 5H83A 4LI0A 1BG6A 2A9VA 3L4KA 3FCAA 2ACWA 1E3TA 1S9DA 5G1NA 3HN6A 3OPNA 1M0TA 4N3CA 1T0UA 2GWRA 2KBEA 2VA9A 3FPJA 3TKAA 3WOVA 3GDFA 1CFJA 4OXIA 2R7AA 4N7JA 1MO3A 1CJTC 1Z8HA 1WDWB 1JQEA 1TVCA 1BCSB 2LPMA 1T36B 2YH2A 3FA2A 5FLYA 5D5HA 1WX1A 1L4MA 2HQSA 2HL6A 5HCNA 4BTEA 4ZVPA 3O6VA 4CIBA 4UD6A 4GDMA 1QPZA 4XOIA 1RM5A 3KE9A 4GSKA 4JDPA 1O5TA 1OBOA 5DYGA 2YX1A 2F3PA 4J0GA 1YA4A 3HGMA 4MKRA 3M3DA 4UTPA 3ZDQA 1BQ4A 1BVRA 4XARA 1ADCA 5LYYA 1F8GA 2VP6A 2XRMA 3C3DA 2FG5A 4B6SA 5I3CA 3ZWDA 2Z5FA 4QE3A 4FHEA 1FPQA 121PA 1I3LA 3H9GA 4LCEA 1UDAA 2YVKA 3OAAD 4Y1RB 4N8DA 3HG7A 5TF0A 3H8VA 3W77A 4CUZA 2W42A 3KKMA 1ZJJA 4R1PA 4KEAA 2YFKA 1XDGA 1ARZA 3NTRA 4BUCA 4DLRA 2ZJFA 2QKYA 4M53A 4IDCA 4QPPA 3DUFA 3T1TA 3T34A 4G56A 2ZWIA 4RV4A 4KSBA 5JXWA 4JJAA 3NHLA 5FTWA 5FOVA 5L4NA 5C53B 1X1EA 3ANTA 3B52X 4NP6A 2MMGA 3PGLA 4K6OA 3AVQA 2VQEB 5B6PA 3GFTA 1Z4PX 4JFRA 3N2ZB 3QX8A 1IBLB 4MJLA 2VPWA 5C4MA 3QUBA 2R44A 2Y0BA 3ZCVA 4MI9A 2VFAA 3H5TA 4DA8A 3OOHA 2IHZA 5FLEX 3S3TA 1TGVA 1RKVA 3R5HA 1CR4A 5CJJA 3UV6A 2H5EA 2JKZA 3KB1A 4FQ8A 4IIJA 1TB4A 3DL4A 3NM5A 1RYMA 2AR7A 2TMDA 2QT1A 1VE7A 1F9EA 4HGYA 2DPYA 3LBFA 2BBTA 2FX2A 1EP3B 3KCQA 2PLWA 3MTIA 4MCJA 5E4FA 1R6TA 4C1NA 2BHTA 5EIXA 2I4NA 3OVMA 1E1NA 3A1SA 3PXBA 4OB6A 3SEFA 2I4TA 3BA1A 3E9ZA 1JECA 1MB9A 1X7ZA 4P4TA 1VMIA 4K9NA 4BNGA 1PSZA 3E3AA 4MKGA 1TF2A 2CJWA 4ZJZA 1I1HA 5IT0A 3CVXA 1EFTA 4HTFA 4BMCA 4L27A 1I4EB 1SIBE 1NBAA 2P9CA 1F3OA 2F8LA 1CQJB 1GNQA 1CB0A 1E9FA 3HBJA 4EKYA 3CEPB 2J5RA 2P1ZA 1Y3IA 4CIVA 3I9MA 1V6AA 3PQ4A 5LYJA 1C41A 2BUCA 1EVZA 3PK0A 1ACJA 3ZE2B 4B0PA 3I61A 1KI7A 4MGYR 4BO2A 2NSHA 1JQJC 3IUJA 4HMQA 4MO9A 1UM8A 1PW7A 4B6PA 1KP2A 2W37A 4ODIA 1NMSA 3KZKA 1NOKA 5T6BA 2ZRCA 3B51X 1M6VB 2Y1LA 1ZU4A 3ZWXA 4HH3C 4LJ7A 4B80A 4ACAA 5KU1A 4BN0A 3ABZA 4DV3B 4BEJA 3ZWNA 1QCCA 1SC1A 3CNLA 1CUHA 1I9GA 1ZOPA 3G1TA 1OC2A 1GGKA 2XUKA 4KTVE 3TNDA 3KTAA 3LZCA 1KVUA 1X1TA 1NU6A 4QFDA 5BNZA 1W4LA 2PSFA 2REXB 1DB3A 1H2YA 1IBSA 2FEWB 2VYNA 3S55A 3EG5A 3CKLA 4UUBA 3I9NA 1A82A 4ZDWA 2R8ZA 1KNQA 2FZVA 3UPUA 3RB8A 4DZRA 2EWWA 3H6GA 4I5FA 3CINA 3T5DA 3T95A 5CA0F 3E9QA 4WN3A 1CNMA 3DEJA 2QVZX 1XQXA 2QTHA 1OBVA 3CV3A 2BC9A 3BDVA 2E4AA 2PUDA 2VLBA 2YXDA 1JPVA 5CITA 4KHZA 3M70A 3LGAA 3G8CA 3BH7A 3LFUA 5KYVA 5TV2A 4BV2A 5EJ7A 2XCRB 2DQZA 1S2LA 2O19A 4R8VA 1N5RA 3UJDA 1NF8A 3D6NB 4D3ZA 5AVTA 2M6KA 4BNKA 5K2OA 3VOAA 5KSYA 1E2MA 2GCPA 5CFQA 3K4PA 3MUNA 5G0WA 5FOSA 3TQIA 5C7IO 1DRUA 2R60A 4G0OA 5CH5A 3OOSA 1B8UA 4DTIA 2O8CB 3P26A 1P73A 4XKJA 2Z8ZA 3DPIA 1XKXA 3BSYA 2PS0A 4JSTA 4PVDA 4AS1A 1J8YF 2XHZA 4I8XA 1Z74A 3KVRA 2YHAA 4GX1A 1KJJA 1WBBA 4CEHB 2K87A 5BV2P 1PG2A 2NTNA 3SXPA 4Q1VA 4IMJB 1A5AB 2FPXA 4G5QA 1ZOSA 1HOXA 2HF7A 2I4MA 1S4QA 4RDIA 2VNSA 4GOLD 1SKYB 3D8TA 4HLUC 2HWKA 2HJRA 2PQ6A 2IV7A 4GMDA 2CXRA 2H1CA 1EQUA 3JQ7B 3UQYS 3KPUA 2QQEA 2IWHA 5I7VA 3JWJA 1V8FA 4N41A 1RPAA 2NVOA 1SOAA 3L0OA 3LDFA 3RKRA 4BB5A 4TVSA 1SA0B 1DOZA 4P3OA 4RKQA 2HK8A 3D5EA 4NU6A 3GFOA 4XWGA 4QASA 5DPMA 3HN7A 1PLKA 2I54A 1K8QA 2HTFA 3DMDA 2B1RA 2HXYA 1VL5A 3GJ5A 3GLKA 4XJSA 4DV2B 4B84A 5IF9A 3U4AA 1Q1EA 1RBYA 2M9MA 3AYZB 1ZSVA 2H52A 3IVGA 3JARB 1Z4IA 3DZHA 5JS2A 4AJ2A 5BUQA 1KH2A 3H1PA 4BLVA 5CTAA 4IIJF 2A1UA 2X42A 1KY4A 3T54A 4C87A 3B85A 4PGFA 5CHYA 1VLHA 3GGDA 3OCWA 4LIPD 4H3HB 5AJTA 3W3AH 3IP5A 5FD8A 1B4DA 3M4YA 1WEHA 4GRIA 4ARZA 2UYGA 2WV9A 1Z26A 2WWWA 1TAHA 3DBIA 1ZRHA 2RGNA 4TYYA 1WQ4A 2PH3A 1XROA 3EOAI 4DKJA 2JRCA 2B3TA 2W58A 4PHCA 2WWXA 4PHGA 4R0MA 2L69A 5C5DA 3PDIB 1ADJA 5BUSA 3EB9A 1W0JD 3ZDZB 1BO6A 1GL3A 1KSGA 4DARA 1TM1E 1Y0BA 3BXXA 2BEVB 2AB0A 2VYCA 5KQMA 1TU3A 2HF9A 2TMGA 1B76A 3OX4A 1XKQA 2AOUA 5CMLA 3KXLA 5E8RA 5I9TA 2CUZA 4NMLA 3VHRA 1GPLA 1BWPA 2V59A 1NC3A 2ILTA 3ESBA 1QK3A 2HDWA 3LIIA 3HXLA 3T5CA 1IUNA 2PL9A 3OP4A 4HVCA 2OCXA 3BE6A 4NE9A 1ESZA 4E07A 3KYIB 3HUTA 1WBDA 2BN4A 3AG5A 1P7VA 3EHDA 5LA6F 3WV4A 2HBZA 5I8WA 4NYJR 3CTMA 4UMEA 2HIAA 5CXQA 2OXEA 1Q0SA 1D0VA 1LK7A 3HCEA 2PBFA 4DR6B 3PNVA 1YRHA 1YS1X 1ESEA 1NN3A 1Z0KA 4B9AA 5KQLA 3V8EA 2FXVA 4C08A 1PL7A 2X14A 4Y1RA 5BVGA 1ADYA 3ACBA 2PV7A 3ILHA 1L4EA 2PZAA 1W85A 3D4BA 2QF7A 5FOWA 2AVDA 3G2MA 4AMUA 4J2OA 2FSGA 4TWBA 1QP7A 3PGJA 3PRKE 4KVGA 1EDZA 3DVLA 1A98A 4XGRA 2H48A 2DFLA 2UYCA 1L1FA 3O3CA 1ZJ4A 2DECA 4W7HA 1NQOA 1C1DB 1DBVO 3DOJA 1ETHA 2E48A 1JAHA 3F98A 3K05A 1MA0A 1GJRA 3AOGA 4L7VA 1KVSA 2F4VB 5GAJA 4RD2A 4Z9YA </