3CCFA

Crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
238
Chain Sequence
FVWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSGAEVLGTDNAATMIEKARQNYPHLHFDVADARNFRVDKPLDAVFSNAMLHWVKEPEAAIASIHQALKSGGRFVAEFGGKGNIKYILEALYNALETLGIHNPQALNPWYFPSIGEYVNILEKQGFDVTYAALFNRPTTLAEGEFGMANWIQMFASAFLVGLTPDQQVQLIRKVEATLQDKLYHQESWTADYRRIRIVSIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase
publication title Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Transferase
total genus 74
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.144: Trans-aconitate 2-methyltransferase.
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ccfA00
2E5WA 3HCFA 2G72A 5GWXA 5ICGA 2FPOA 2AZTA 3G2MA 1X1DA 2P3OA 2PWYA 2BM8A 3KU1A 4GOLD 3VSEA 2BR5A 2OYRA 2HV9A 5EMKA 4BLUA 2HR1A 3FTDA 1DCTA 3DMGA 2AS0A 2ZW9A 3R24A 5E1MA 1KXZA 4FP9A 4AZSA 3BKXA 3LSTA 1P91A 2FYTA 5LQKA 4QVKA 2O06A 3V97A 2AVNA 4DCGA 3OU6A 1SVUA 4LWPA 4ER7A 5K0GA 3ER8A 3ORHA 2P3LA 4GF5A 3I9FA 5K8VA 3O31A 5CD1A 1UIRA 4IWNA 3VYWA 2IIPA 4IV8A 4PONA 4C06A 4DCMA 3HCAA 5HOQA 2H11A 2IH2A 5LQNA 3P71T 4FGZA 5E9QA 3KPJA 2YUIA 1XJ5A 3E8SA 4K6MA 3BKWA 5FTWA 1X19A 3P9IA 2XVMA 3C3PA 1EQAA 2BR4A 5EVJA 5DSXA 4A6EA 5T6BA 2HTEA 4ER3A 3DXYA 5T67A 3UJ7A 2GPYA 3EVDA 2YR0A 2I62A 3MCZA 4PYIA 4QQKA 1RJDA 3RW9A 1L1EA 4LECA 4X41A 3HNRA 3I53A 3NDJA 3ANXA 2B78A 5EHGA 5EZSA 3THRA 2ZBRA 3BT7A 2B3TA 2QM3A 1TW2A 1ORHA 1KPHA 3P2IA 2VDUE 3DULA 3R6TA 5C1IA 1G38A 3G7UA 3PVCA 5HILA 2QYOA 4DA4A 2H1RA 4OQDA 2A14A 3GXOA 1VQ1A 3EVEA 3LGAA 2AOUA 3BWMA 1JTEA 2OZVA 3MQ2A 5F2KA 3SX0A 3FPHA 1P1BA 1Z3CA 2G70A 3BGDA 3IYLW 4E2WA 3KQPA 4GOMD 1WS6A 3KR2A 1YFJA 5BW4A 3O4FA 5EEGA 3FRHA 4KDRA 2Q41A 1JG4A 2BZGA 4XUCA 4ER6A 3E05A 4FSDA 2PVCA 3MB5A 5CVDA 1PJZA 2PWPA 2Y1WA 1EJ0A 5EZQA 3G5LA 3P2KA 5FHQA 3SSOA 3M6VA 1O9HA 4R05A 3UJAA 1NBHA 1NW6A 2ZZMA 3HTXA 3F4KA 3KPYA 1R00A 3C0KA 4CKCA 5K0NA 3IV6A 2ONYA 3TKYA 3B5IA 5EEHA 3THSA 1V39A 1JSXA 2DPMA 2PY6A 4LWOA 5FADA 3B3FA 2PX2A 3OE5A 4RTLA 2WA1A 5FQNA 2IDKA 5IH3A 3PS9A 5FWDA 4A6DA 1OR8A 3GIWA 5CVJA 4P58A 4AX8A 4POOA 3UWPA 3A7DA 3AWIA 4RVHA 5DTQA 3A4TA 5K0EA 3A26A 3AXTA 3KPWA 2ZWVA 2ZIEA 3EVFA 4M37A 5B1SA 4RTNA 1AQJA 1IXKA 1YZ3A 3BGIA 4EKGA 4YUYA 4IKPA 2G1PA 1L3BA 1RI5A 5E1DA 4R6XA 5GIOE 1NT2A 3OFKA 4GUAA 3M6XA 4PYMA 1SQFA 1SQGA 2UZ4A 4YMGA 2AOXA 4E70A 4PYLA 2BM9A 1BOOA 3P97A 3HM2A 1P1CA 5KQSA 5LQRA 3G5TA 3K0BA 3SM3A 5K0CA 4BP1A 4KW7A 2IFTA 2UYQA 4KWCA 5F2NA 1KR5A 4RTOA 5EMJA 5DM0A 2N47A 3FZGA 3NDIA 2AOUB 3Q7EA 4QTTB 4RVFA 4CXMA 2C7RA 2CL5A 5CIYA 1RJGA 5LQAA 1N7JA 1ZGJA 3KQOA 3P9KA 5K0FA 1G55A 4RTJA 1NW3A 3EVAA 2GH1A 3R0QA 5DRYA 2NP7A 10MHA 4RSRA 2JHPA 3DLCA 2PT6A 3PFHA 2AN5A 1JQDA 2F8LA 4RTSA 3B3JA 2P35A 1RI2A 3GO4A 3NWBA 4P7FA 1RI1A 3EEYA 2JHAA 4GC9A 5GP1A 2JH9A 1JG2A 2NXEA 5FHRA 5E9JA 4F84A 3TM5A 2NXJA 5P8WA 4M7RA 3CBGA 1QYRA 2PT9A 2PX5A 1O54A 4FZVA 3A27A 4HSGA 3T7RA 3OZTA 1ZQ9A 3LBYA 3ELWA 4AZVA 5EQJB 1QAMA 5BXYA 1H1DA 5CUQA 3R9XB 4C03A 4QPPA 1KYZA 5FA8A 2ZLBA 3NMUF 3NJRA 2VS1A 2HNKA 2ONZA 5DRTA 1F3LA 4LG1A 3L8DA 1QZZA 2VP3A 3ELUA 3GGDA 4X1OA 4FR0A 4KIGA 5G02A 3PFGA 5DM2A 5DX1A 1R8XA 5EHIA 8MHTA 2O07A 2OPBA 3I64A 2PXXA 1SUSA 5DSTA 3B7PA 5E1OA 4UOEA 1N2XA 3LDGA 2NP6A 4X60A 2C7PA 4RTQA 2Z6QA 3LBFA 5E8RA 4E2XA 2ZBPA 2FHPA 2H00A 1D2CA 3E23A 1VP3A 5HEKA 5GIPE 2B25A 3EMDA 2OKCA 4RVDA 3OE4A 4HGYA 3KHKA 1KPIA 5DXJA 3JWJA 3M6WA 2P8JA 2UYOA 4V0QA 5JUWA 1ZGAA 2PX8A 5KYGA 5EGSA 3AJDA 3OZSA 5K09A 3G89A 3LECA 4AZTA 2G71A 3HA5A 2YTZA 3MERA 5EC8A 5DLYA 3M70A 2KW5A 5FQOA 5ICFA 2B2CA 4OA8A 4C07A 2BR3A 2O0LA 1Q0TA 1KHHA 4QDJA 3FTFA 2O57A 3LCCA 3O7WA 3BUSA 2V7EA 3WSTA 2QRVB 3ELDA 2GLUA 2VDWA 2AOVA 5GINE 2C7OA 3UJ9A 3MHTA 4OBXA 2FK8A 3HCCA 3PT9A 1T43A 3EVGA 2ZTHA 2NNWB 1WY7A 1XDSA 1ZG3A 2AOTB 1WG8A 3MGGA 3SVZA 5LQCA 2ZFUA 4GOOD 3EGIA 4PCAA 2IBSA 2WK1A 5DPMA 1MJFA 3K6RA 2XVAA 2ZWAA 5HZMA 5K0BA 2HMYB 4CTJA 5E9WA 4E30A 3KQQA 3SR4A 4XUEA 2LD4A 5KVAA 1VPTA 4HRAA 3P8ZA 2ZBQA 3ID6C 4QVGA 2P40A 1M6EX 1VBFA 1AQIA 3UJ6A 4MWZA 3CJQA 3UBTA 4E32A 3GRVA 3TOSA 3PX2A 5U4XA 1ORIA 3G2OA 2PJDA 3MTIA 4HC4A 2IPXA 2R6ZA 2OXTA 1VLMA 3BWYA 3LKDA 3MTEA 5CVVA 3PB3A 1U2ZA 3VC2A 4ZTBA 2IH4A 3EVCA 4DMGA 2ZIFA 4HGZA 4HTFA 3JWGA 4FSXA 1D2GA 2AVDA 5BP7A 2XYVA 3OU7A 4PYQA 1SKMA 3KQTA 5KS2A 3NW9A 5DXAA 4GOND 5LSAA 1NKVA 1N7IA 1SG9A 3ME5A 4IV0A 3C6KA 1I1NA 4H0NA 3CCFA 1XXLA 1NW5A 1VE3A 3DOUA 5C9ZA 3FUTA 3KQVA 4GQBA 3TKAA 3SMQA 3BGVA 4YUVA 3EVBA 3T7TA 3VC1A 3UJCA 4QPNA 2NXCA 2V74B 5K05A 3DLIA 5D1HA 5DM1A 3M33A 1M0EA 4F86A 2B9EA 3FPJA 4YV1A 3NWEA 1EG2A 1D2HA 1JR4A 5EG5A 2UYHA 3LDFA 1M6YA 2FK7A 2ZULA 5DTMA 1RJFA 2XYRA 3HA7A 5K01A 2C7QA 2ZIGA 1R18A 2AR0A 3PX3A 2G8NA 4GC5A 4YUZA 2XBMA 2PKWA 3EPPA 4PIMA 4RVGA 4AUKA 3T7SA 2OBFA 4OBWA 1JTFA 3LCUA 4BLVA 5D1NA 2BH2A 2AN3A 4E31A 4EQZA 4P7GA 3CC8A 5DX0A 4YUXA 7MHTA 4RTPA 5CCBA 2VZ9A 2YX1A 1X1AA 2IP2A 2PGXA 2ZZKA 2FCAA 3EVZA 5F2OA 2QE6A 3CKKA 3KR9A 4EVIA 3ERCA 3CVOA 5C0OE 5CVEA 2ORED 5T64A 1XDZA 2ERCA 3BWCA 3EEOA 2DULA 2PXAA 4ISCA 1IY9A 4QTUB 3KQSA 4E2ZA 1NV9A 1XCJA 1EAMA 3EMBA 3P9CA 3FPGA 4PGGA 4GBED 4CKEA 3DMHA 1NW8A 4MQ4A 2CKDA 4KIFA 4YMHA 1KYWA 4BLWA 4DQ0A 5FWAA 3D2LA 1WXWA 3UJBA 1Q0SA 3HVJA 3FTEA 1B42A 2XYQA 3E7PA 5CVUA 5FCDA 2WA2A 1XDUA 5GOZA 1O9GA 3TPZA 1UFKA 1YB2A 4ER5A 3B3GA 2GAFA 1R6AA 1JG3A 3QOWA 3CJTA 3HEMA 4RV9A 5H02A 3TFWA 3Q87B 3TM4A 5JR3A 4MIKA 5M5BA 5EIWA 4E2YA 1G60A 3CJRA 1HMYA 5EMLA 1FPQA 4WXHA 2IH5A 2GB4A 2Y1XA 1VIDA 4M36A 3HCEA 3FTCA 2R3SA 3V8VA 2ZZNA 1JQ3A 4EK9A 1RJEA 3S68A 1WXXA 2YXEA 3T0IA 4R8SA 1YFLA 1X1CA 3LKZA 5GM1A 3GRYA 5EKXA 1R74A 3G88A 5EIFA 4X63A 1YF3A 3DR5A 4PGHA 4BP3A 2JH8A 1YZHA 2K4MA 2OO3A 3FUXA 4RX1A 2OB2A 3HCDA 1L9KA 3SSMA 5E2BA 3HCBA 5E2AA 2YXDA 3UA3A 3OPNA 5EMMA 3DUWA 1RI3A 4AZWA 2EJUA 2CWWA 1NE2A 4QQNA 5EOVA 4FT2A 3G8AA 3A7EA 3NVMB 5HIJA 3FYDA 3HA3A 2JHCA 4NECA 3RIEA 4B17A 3FYCA 4E33A 1F38A 3GCZA 2Z6AA 1IM8A 2ZSUA 2NXNA 4PYOA 3TQSA 1DUSA 3TRKA 2HWKA 2EJTA 5CCXA 3GWZA 3UJDA 3FPFA 4JXJA 4KRGA 3X0DA 3R3HA 1JQEA 2ZVJA 3FUUA 2AOWA 2P7HA 3HP7A 1FP2A 4PINA 4RYLA 4OQEA 1JSZA 5E8JA 2JJQA 3GDHA 1NV8A 3OU2A 5FA5A 5HFJA 4R8RA 5LQJA 3UJ8A 2OB1A 3GNLA 3SSNA 4U7TB 5LR6A 1I4WA 2YXLA 3OZRA 1UWVA 2P7IA 5GM2A 5KQRA 2IGTA 1WZNA 2P1DA 4DF3A 3DMFA 1RI4A 4FS8A 3FUWA 3U81A 4PNEA 3IEIA 4CWAA 1KPGA 3OCJA 5K0JA 3C6MA 3C3YA 4YUWA 1QAQA 4Z2YA 3RODA 3SXJA 2YQZA 3AXSA 3UA4A 2ADMA 2EFJA 4DM3A 4R6WA 3KR1A 3BWBA 1EIZA 3EGVA 4QDKA 1FJXA 4RTMA 1BKYA 2O05A 4PWYA 3QV2A 3DXZA 1NBIA 2GA9A 3P9NA 4KVZA 2PBFA 3KPVA 1FP1D 3I58A 2QY6A 1XCLA 2PSSA 4PCLA 3B89A 4PIPA 5FULA 2IBTA 4U7PB 1TPYA 1INLA 4WVLA 3LDUA 2VDVE 3KQMA 5IKMA 2CMGA 5DX8A 3A25A 2CMHA 4CTKA 2FRXA 5ERGB 1I9GA 2EG5A 5ICCA 5LQUA 5DT2A 3GU3A 3G2QA 3I5UA 4Y2HA 3DH0A 3IHTA 3QOXA 5FUBA 4RWZA 5DWQA 4ER0A 4V0RA 3LHDA 2PX4A 3HVHA 3EGEA 3H2BA 4C04A 4YV2A 1VL5A 1KIAA 5ICEA 4P7KA 1DL5A 3MAGA 5DTRA 3SGLA 4MTLA 3GRRA 1ZKDA 1MHTA 3NVKI 1L3CA 4FT4A 3OFJA 1BHJA 1PRYA 3BXOA 3JWIA 5MHTA 1XTPA 1X1BA 3AY0A 4XUDA 1QANA 3LX6A 4DZRA 1KP9A 2P3QA 2PXCA 4PYJA 4BY9E 2OY0A 4P7JA 3M6UA 5K03A 1BC5A 3DP7A 5BW5A 1ZHFA 3JWHA 1FBNA 4C05A 4HH4A 2UYCA 4EMSA 1QAOA 2YVLA 4HG2A 1SUIA 3GRZA 4PYNA 4M38A 1G6Q1 3UZUA 3REOA 4C08A 3FPEA 4RTKA 1TW3A 5DM4A 5E1BA 2ZCJA 3LL7A 1VP9A 4L7VA 1XVAA 4RTRA 3P2EA 4ATNA 3TLJA 1R8YA 5EPEA 1G8SA 3HVIA 5HIIA 3TMAA 1AV6A 3ER9A 4YV0A 3DTNA 4HTFB 4CKBA 1EJ6A 1P39A 2I6GA 4KDCA 2EX4A 2Z6UA 2AN4A 3UFBA 3LCVB 4C4AA 3KR0A 2I7CA 5HIKA 3KKZA 2PLWA 1YUBA 2ESRA 2IDJA 3KQYA 2PV0A 3KPUA 3KQWA 1Y8CA 3NTVA 4X61A 5K0LA 3FUVA 3GRUA 5CM2Z 1JG1A 4EKIA 3M4XA 3BZBA 3PLAE 1L3IA 2QRVA 3MCTA 4MHTA 3G8BA 3DXXA 4OX9Y 3FRIA 3ELYA 2P41A 3PTAA 1NW7A 2I9KA 2GS9A 1HNNA 2NYUA 1G8AA 2AOTA 4G56A 3TR6A 4PYKA 4OA5A 4Y30A 9MHTA 3LPMA 3CGGA 3G2PA 5EKUA 4O29A 2JG3A 3GJYA 1AF7A 4GEKA 4DKJA 3HVKA 4F85A 5HIMA 4XCXA
chains in the Genus database with same CATH superfamily
2WYUA 2PO5A 1Z13A 3P26A 4CEIA 1BNCA 2O2EA 3O8DA 3G2MA 2P3OA 1GAJA 1PUXA 2AMFA 3CTMA 3DMGA 4FFSA 2W58A 3CLKA 3EZFA 1CY2A 1NP7A 3QGMA 1UFQA 1L6IA 4IWYA 4KFSA 3WFZA 4GS5A 1E18A 1KI9A 1SVMA 1HDZA 3E8MA 1UOEA 2ZB4A 5PGMA 4B3FX 4Y2VA 2W2MA 1J56A 4DSAA 5JAZA 1L7EA 1YU9A 3KUXA 4WACA 5J2UF 3ZW8A 3AVXA 2CYCA 4B82A 5I7SA 3MYYA 2HDNB 1G20B 4QUDA 2ZE7A 4IV8A 1KQPA 3UMGA 1RQGA 2FW6A 3RUDA 1RABA 1KBQA 1JQLB 1CEXA 1H6DA 3ETJA 2R7AA 4HDRA 1RSZA 3AIIA 3QPUA 2XQJA 4RVOA 3TQTA 3ONWA 4MPPA 1P7ZA 5F51A 4FMCF 3TW8A 4CGYA 3KHTA 1Z83A 3L0CA 2HRQA 4A73A 3OJLA 5CRIA 2HW8A 1EEHA 3AYZB 1CCWA 1MF7A 1RQXA 4JIGA 1LRLA 2ECKA 1H66A 5DN9A 1OAOC 3WNVA 3W0LB 1RP1A 5I4KA 2NV0A 2FE4A 1RWMA 4QGGA 4Y6OA 3AY3A 4AJIA 4LMAA 1TW2A 2OL4A 3HI4A 3OTIA 3DVQX 3F9RA 4L5AA 4Q7LA 1A98A 3F6CA 1LSUA 3OQIB 1CUBA 1GT91 1U94A 4MCIA 1NG9A 1BHO1 1M2FA 4ENRA 1GYRA 2M1XA 4K86A 5AHWA 2POCA 3LVQE 4XQ0A 2PLRA 3RQIA 2WC1A 1JTVA 1XPJA 5DGIA 3W9UA 4B45A 1YCDA 2W6JD 1MJGA 3OC6A 4LXTA 4D3YA 4G5HA 3KQPA 3HJBA 4UU1A 1OZFA 1Z5WA 1FFBA 4OIMA 2JI7A 4PU0A 1KDRA 3JARA 4BMCA 5A7FA 3ZWKA 1TM5E 2W9XA 1QX4A 2PMFA 2WNSA 3E05A 5IT0A 1B4DA 1PJZA 3AJRA 4L27A 3VR4A 2PO7A 5J4VA 4K9RA 5HX7A 2WU0A 1Q44A 2MYNA 1R00A 4KLAA 3IV6A 1ISIA 1LC3A 2NM0A 2VLBA 5EEHA 2XWBF 3FPCA 3QLJA 3BB4A 1ZN9A 4GAEA 2FEOA 5KPJA 4GXRA 1A9YA 3H83A 2DFTA 3F6RA 4JCOA 2PQMA 2QOEA 4JYBA 5KQMA 3UKJA 1RNLA 4I81A 3T95A 1M83A 2C82A 4QBHA 1D9XA 3CLTD 3D0QA 4JBYA 5ALPA 3OQNA 3FR7A 4DMCA 4GLBA 4S1OA 4ZP1A 1K7XB 4RJTA 4RNCA 1HT1E 2V7BA 3EVFA 2JKYA 4EHDA 1YJ5A 5A1TA 3ODPA 2ZK7A 4NMWA 3KZKA 4YP6A 2QSYA 4Q12A 1IXKA 1P7YA 2A1UB 4IUCS 4P53A 3V80A 1F1BA 1TF5A 4B47A 1XTSA 1RI5A 1UKZA 3LWDA 5LQMA 3RASA 1KFJB 4R6XA 4TSFD 3OQMA 2JARA 2B6HA 1JDNA 1JXMA 1OD6A 1B16A 2ZB7A 2AOXA 2NO0A 4QUAA 4YO7A 2SHKA 1CR0A 3SY8A 1QHHA 3JZMA 4BNXA 1FNNA 1DADA 4EB3A 1NBWB 4PF1A 3CNOA 1SIBE 2JS7A 4BP1A 1KR5A 3BRWA 3HH8A 3BERA 1CUJA 2IK8A 2B37A 1IIRA 3IP6A 3AHEA 3FOAA 3NDIA 3Q7EA 2FSIA 4PC6A 4F4JA 5KJ6A 1RJGA 1NM5A 1CUCA 1IHDA 3CUUA 4WKOA 2GYYA 4C30A 3SS8A 3UMRA 1J7JA 3AU9A 3BJZA 1NUPA 1VPEA 2D3WA 2VNSA 5KNBH 1NG1A 2Y92A 3HYNA 1T10A 4BZQA 5FDFA 3U37A 4N8EA 2QVGA 4H1UA 4IS3A 1A82A 2BHNA 1ZW1A 4DOMA 1FTQA 2X1VA 3NWBA 3AI1A 1KSHA 4OK3A 2J0SA 3A2KA 4XUGB 4FX2A 4OMCA 1A9TA 1E1MA 2WJWA 1DKNA 4DJDC 3LBNA 3EGDA 4O3MA 2X58A 1W5EA 2EBUA 4MH0R 5A62A 3HBNA 1ZOLA 3AK4A 1KO1A 1U7DA 2MYTA 1K2WA 2WMYA 1TIKA 3A27A 4KE6A 2UVPB 4ZXFA 3R9IA 3M49A 5HQ3A 1FCJA 1O94A 2IUFA 3CRVA 3G8YA 4BKMA 1PNVA 1M34B 2C54A 3FNBA 4MYSA 2GPNA 2WJ4A 2YN0A 3LW8A 4L57A 4AJ2A 3EASA 1H65A 5I3ZA 1WRBA 3AV3A 1L5QA 5BSTA 1JLRA 2YW2A 2ISQA 1ST3A 5C18A 4ZT6A 1VMDA 3CPHA 3L8DA 3A9UA 1L8AA 1QZZA 3LNCA 2BELA 3S0JA 3ZQUA 1IRXA 1OTXA 2NTVA 5ALVA 2QX4A 1A96A 4KGXA 5HM6A 1Y42X 5HS4A 4X71A 3I6BA 3HBAA 4TLAA 2OUIA 4XVUA 4QU5A 3S2ZA 4GKVA 1HWYA 5JQWA 3O5AA 1K08A 1VC2A 2YWJA 3MQ4A 1SA0A 3M6IA 4Q02A 3BHJA 3L6RA 4ZT7A 3U3XA 6LDHA 2RGBA 3DEAA 1AQNA 1KPIA 2E89A 1J9EA 2W93A 4MVJG 1YV9A 2IY7A 2O5RA 1RBZA 4G5FA 2ZROA 3HRIA 3R7DA 5KX5A 2A0KA 4JP8A 4G26A 4FJ0A 4R01A 2EIXA 5FAXA 3TKLA 5JD5A 3G2NA 1QG4A 1YZVA 4ZVQA 4QDZA 4Y7CA 3WL3A 3FTFA 3K4QA 1JEJA 2GT1A 4HQ6A 2I22A 4H1HA 2GPJA 1N0WA 5DGCA 2WD9A 1O0SA 1EDZA 4I50F 4YA6A 1F6DA 2C7OA 4HD8A 4MI6A 3NG1A 3K0KA 2C97A 4ZI3A 2YBEA 5KQLA 3FCCA 3G68A 4YY3B 1LBQA 4GMDA 1A4UA 1UMKA 3BFXA 3R7BA 3M4ZA 2F3PA 3PG5A 2IBSA 1EMDA 2REQA 3JRWA 4INOA 3EWNA 5K0BA 1BD4A 4WZBA 1CY8A 1Y5IA 1KF0A 5FBRB 5LA6A 3WYNA 2YOFA 4HRAA 1U8FO 4CEIB 1OFIA 1U28C 2ZBQA 3PRKE 2WJIA 1LVHA 1YB6A 4JLJA 5G4KB 3SEAA 5LNK6 2AW5A 2OECA 5ED0A 5IT5A 1F14A 1PJBA 4RK0A 1O57A 4G1EB 2PJDA 5AM5A 5K0SA 1G3QA 1XWIA 3KSRA 4WZBE 5TGTA 1W47A 3GZNA 2IH4A 4K2AA 4AY3A 5J43A 1P3DA 1JJAA 1QMPA 1U98A 2GN9A 1FTYA 2AK3A 3C8ZA 5FPYA 3ZBPA 4CU5A 1QRUA 2PZBA 4IJQA 2XZOA 4WOBA 5FYQA 3IUSA 1BSVA 2DQYA 2FMFA 3NW9A 4FU0A 3OTOB 1SKMA 3SEFA 1DINA 2C4HA 4TXMA 4ZVKA 2ZYRA 3RS2A 3THWA 2Y2VA 3BZWA 5KBYA 4R8KA 1NW5A 3B52X 3IA2A 4HWGA 1JPJA 3RH0A 2J0UA 3W1VA 1BDBA 1CVLA 1H2XA 3I0MA 3E3OA 1BDIA 3D3WA 3PNPA 4Y2XA 5ESRA 4UVGA 1MC5A 3FPJA 3H6KA 5GGYA 1Y5LA 2VHEA 1JKIA 1EG2A 3BIWA 4OUDB 3AMVA 3PGMA 1GYPA 3OZEA 4UW9A 2TYSB 4RZUA 1ISRA 4DCNA 1JJBA 3QZUA 1R18A 2ZE6A 5A3SA 3E22A 2C9MA 1T29A 3NAGA 1CZOA 2O8NA 3EQ8A 3L92A 3ONNA 5KYUA 4L0DA 3GJZA 3IAAA 2YZ7A 3UIEA 2IITA 2Z8YM 3GHYA 1EVJA 1QP8A 5C34B 2CV0A 1Y1RA 3Q7SA 2VP2A 3QKRA 1YNOA 4LI0A 3CX7A 2QE6A 3KR9A 3FNHA 3QE2A 3L3BA 4P82A 1QORA 4PCVA 3N2LA 4S1NA 4PSKA 1SG6A 2AW3A 5T64A 4YLEA 2XITA 1IOZA 3ZGOA 3EEOA 1EE2A 2VHZA 3WB0A 1BX0A 3H1BA 1EFRD 3KQSA 4UE6A 3WX0A 2WM9B 3QQ5A 2R8ZA 4JP5A 4DA7A 5BUSA 5GAJA 7ADHA 3VA7A 4U63A 3IESA 2OAGA 1G66A 4FFPA 2R8OA 4BQEA 1BRTA 2QN7A 5CFLA 5E3JA 1TO6A 3J80A 5TF4A 2R1ZA 4EX7A 3GB9A 4G4SP 3VQTA 5JYBA 1X14A 1UFKA 4JKYA 1JEYA 2I29A 1E63A 1VLJA 3Q87B 5M5BA 2W6JA 3QVVA 5EHQA 3EXHA 4B40A 1RKXA 2J7KA 2CB0A 1PWZA 2GZDA 2H7YA 2RHWA 3B2EA 3D8UA 1VIDA 4WXHA 5JH7F 5HF6A 2QNIA 5I7FA 3LXUX 2Q4OA 5D85A 4PX3A 3OFVA 4YROA 3GUZA 4PSVA 3LKZA 1UBLS 2HSZA 2ZJOA 3GRYA 2WJ3A 2VHCA 1QHHB 2C4TA 3CLUD 3O3MB 1AN9A 4I1VA 4JLPA 3DMTA 4PY2A 3RSFA 3W2HA 4M8IA 4R5MA 3DZGA 4OIFA 2R7LA 3VVBA 3ZX5A 5D6OA 5IJZA 5LYJA 1J09A 3K71B 4AIRA 1G2QA 5G0VA 3F3SA 1WMEA 3HCBA 2JCGA 4M86A 4FFLA 1KZ9A 4WJKB 5EMMA 1E58A 1PT6A 3RS9A 1XZNA 2XUZA 3A2NA 2H59A 1OVMA 1B3BA 1N1GA 1IZ0A 4YAJA 5D6NA 1L4MA 5KNDH 2PCLA 3WL5A 1YE8A 1GAEO 2OO7A 3G8AA 3IUEA 5AM2A 4KO3S 5FTKA 4AKSA 3BXEA 5ITWA 5B4TA 4ZQBA 1M2KA 4Q7KA 5A4AA 2XLBA 1Z0AA 2NUAB 1UBSB 2W6NA 4H7PA 3VAYA 4CUKA 5EIHA 4F60A 4TSFA 1GPYA 2IYYA 1NVXQ 2ZYAA 3MILA 3GJSA 3QYAA 4KXYA 3C85A 5E6SA 1J0CA 4JXJA 1JFLA 2C0PA 1ZC4A 3ZBUA 3R3HA 4XWOA 1JHPA 1J2RA 1SNYA 1YZYA 3BIXA 3FGZA 5K0FA 1V2GA 4FYWA 4QPDA 1TJPB 4QYIA 4G5RA 5HQ3B 1U8UA 2QL9A 5THXA 2JA2A 1RXEA 2OB1A 4CMJA 3MTBA 1Z2DA 4H6XA 2EGHA 1ZK1A 1ZL2A 2HA7A 3L79A 5BW5A 2H3HA 4II2A 1T5BA 1OI4A 1VIYA 1T36A 1A77A 1WZNA 2C2YA 3NI2A 3RVLA 3D7SA 1PV2A 3U81A 2QGFA 1QGAA 1A7AA 1DFGA 4GXQA 2JHGA 4AN1A 1T4BA 4YUWA 1CY6A 3SXJA 3TIFA 2AL7A 4U2DA 1E64A 3CRW1 2GBLA 3MNFA 4NK5A 4ZQIA 1KU6A 3N5KA 4KB5A 2E6UX 3P9PA 4O4HF 4WXYB 4W6ZA 2R1TB 3AI2A 1ZUNB 5LFAA 1NGSA 3QV2A 2E9SA 4OQXA 1SA0B 2AJLI 3FR8A 3CN7A 4W1QA 4BRSA 5A6SA 5CURA 2JCVA 5AFSA 2GJ9A 3LD9A 2HMVA 3VBCA 4S2UA 1TEZA 1Z28A 4HLNA 2IEGA 4PIVA 2CZGA 4MI3A 3FBGA 3UGTA 2W00A 2XUOA 5KX5B 2D7DA 4JVLA 4TMZA 2CXNA 1CR1A 2CMHA 3H5NA 4O8CA 2L42A 4DDTA 1I51A 1T13A 1UK6A 1AC5A 1KI6A 1ABEA 1C7JA 2XT6A 3EYWA 3NDPA 3IHTA 4PX5A 4FYJA 3DBVO 1H1LA 2ZIAA 3LBHA 4FK8A 4MRPA 1ODKA 1BXRA 1VL1A 2CSXA 1Z6TA 2DECA 1E8MA 1KIAA 1ZMTA 3E9ZA 1PTJC 2QL6A 1JN0A 2VH5R 2ATCA 4QBIA 2P91A 1C8VB 1DMSA 1P9WA 4P81A 4TTSA 2BN4A 1S2OA 3BE5A 3G1WA 1N5MA 3ZWNA 2ZRIA 3E0QA 1EVYA 2C4VA 4G63A 5EXXA 4EMBA 2EJBA 1TJ3A 3FSRA 4WZBB 3V8EA 4AWXA 1DV2A 5LA6B 5CT5A 1GCOA 2AWOA 2WDPA 3U6BA 1VI2A 2BT4A 4I1IA 3U19A 4B3IA 2VTVA 2PXCA 2PT7A 1ZH8A 3G13A 4O4LA 5C52B 4B73A 1BGWA 5K20A 1KJNA 4ZRDA 2RGNC 4CE6A 5HJ5A 2UYCA 3GUVA 3ZE9A 2LP4Y 1BVUA 5CNIA 4HG2A 4JNKA 3A3PA 4MARA 2N75A 3BF8A 2IU0A 5F5LA 3IOCA 1Q22A 1QWSA 2TMKA 5BV0A 3WQQA 3BL5A 4NYJR 3WIUA 4EM6A 1KEUA 1O89A 4FS3A 1VBMA 3DTNA 3IODA 3QYPA 5DHSA 3CPEA 1E9EA 4DTIA 5JS7A 1D6SA 1JG7A 1TZBA 2MYPA 3EDMA 3GCWA 3F74A 3NTVA 3VH4A 2W7TA 2V7QD 2EJVA 4KYIB 3THWB 1B43A 1AY0A 2RGCA 3NNNA 3TSOA 2E4ZA 3TZ6A 3ESCA 2E48A 5B3KA 2H4JA 5BSKA 2FZKA 5C1DA 3L7CA 5JZVA 4CVNA 3DZ8A 1TC2A 2XODA 2IKSA 4DC1A 4ZO6A 3PTAA 1T5LA 2M98A 2QGNA 4B3MB 2HQBA 3AP2A 1OAAA 3ER6A 3GMSA 4OCZA 1FYWA 4UM8B 4BWYA 3IC5A 4PYKA 4B5KA 3KJEA 4DG8A 4CEHA 1HORA 1A50B 1C9DB 4IDOA 5C81A 4KAFA 4GEKA 1X9GA 4BQPA 5EJ4A 1ULBA 5KYUB 4KGDA 2H1LA 3NC4A 2QNRA 1QS0A 5JLAA 2J07A 2FQ1A 3LVFO 3VSEA 1KDTA 1WUIS 4DJ5X 3DB1A 1H2RS 5J23A 1VI5A 1XZJA 2CJWA 4HVCA 5JZBA 1W8DA 2GNOA 4CM5A 4HDQB 1WPRA 1Z0FA 1IQ0A 2JFVA 4D81A 1BE1A 2FH5B 2WQZA 4CF4A 1QH0A 4CYMA 1P1JA 2H7XA 3I01A 3LS2A 2XOEA 3OU6A 4HQOA 4PCUA 4AG3A 4DCGA 4QFDA 5AVKA 5CA1F 3BE8A 3A2LA 3DPIA 5BSUA 2A9VA 3RLIA 4AXXA 3HYSA 1OBHA 3F2VA 4XX0B 2ZREA 2H07A 3GPCA 3UW1A 2ABWA 3ZE6A 4C4OA 2IH2A 2YBDA 4NH0A 3H4MA 3BCUA 4TRJA 5JS8A 3UPTA 3WKEA 1W9HA 5TPZD 3LDAA 1IBRA 1Y6QA 4HQNA 2B5WA 4M9QA 4BJ6A 2ACVA 4PLTA 5EVJA 4OLFA 1I3CA 3N39C 3PTZA 4RGVA 3WKBA 4F5EA 3X1ZA 2HTEA 5BUZA 4W7SA 1D2AA 2GPYA 2I62A 3C6QA 1A9OA 3EXHB 3L4BA 3WLQA 2BHLA 4Y18A 5KTYA 3IP5A 1Y81A 1GUFA 3BT7A 1Q50A 4XDYA 1VRCA 1NQTA 2QM3A 4D82A 1TT7A 2QRJA 5GPBA 4Z6KA 1EFRA 1LW6E 1ZS9A 1ZLXA 4BASA 2A88A 3W7BA 4B84A 3VZDA 4E4RA 1I4OA 1XR3A 1VHLA 3ESBA 1G5IA 1S2MA 1JDVA 5LYJB 3NC0C 4XQEA 1Y9JA 2H85A 4ID3A 2ARKA 2DWCA 3O94A 3HO8A 1YR1A 5CXQA 1Y82A 2HDOA 4B6RA 2JAWA 2XW6A 1DPGA 2LCIA 3KR2A 3L5OA 3LWZA 3QXXA 4ALKA 5H4GA 1ZOSA 3O73A 3KG2A 2FEMA 3QH4A 2O52A 3BK1A 3VPBA 1GQRA 5AMXA 3PFKA 1FDOA 2PWPA 3AUTA 4WZAA 2OTCA 3SSOA 3DV2A 3WY9A 2PZEA 4R05A 1Q20A 4D9FA 3HEBA 3QE4A 1MX1A 4TTJA 1SBZA 4RFSB 4XVHA 1G2IA 1YR7A 5ENVA 3ZHSA 2PY6A 5AVUA 4LWOA 4BEVA 4QARA 5E6SB 2J6IA 1MU0A 3OQOA 2LDXA 1FUEA 2MTBA 3N2KA 2PUAA 4HGRA 1E4VA 3H1GA 4N3NA 4QYIB 3UWPA 4GHWA 4B3JA 3KBOA 3QJYA 4QQ8A 5DTQA 4YR9A 2PA3A 3OLWA 1YRAA 4MTCA 1GUZA 1FA9A 2XQKA 1IXSB 3H2KA 4RTNA 3DEIA 2XUGA 1VBKA 2Z95A 1KZ4A 5JAQA 1KVRA 4A26A 2IS6A 2JLYA 1CUFA 4MS3A 1EUQA 1YHNA 4R0NA 5AXCA 3P4XA 1YVPA 1PD1A 4I9GA 2XT0A 3OFKA 4G41A 3WK7A 3TMKA 1JLHA 3QHPA 2D0DA 1JF8A 1GKLA 2ZE8A 1IOVA 3OTGA 1BOOA 1LK0A 4HOYA 2QR5A 4RCVA 1KFEB 2YZGA 2ZRNA 4DNXA 5C46F 4C87A 3CKYA 2V6IA 5EY5B 5K0CA 1I6KA 1IZZA 3UMJA 3I45A 3QJGA 5FFNA 5A6SB 1N5OX 3HJGA 3MTGA 1MG0A 2AOUB 3L9WA 5H3LA 1L1QA 3AR7A 2K7FA 2LXNA 1Q57A 4K03A 2WJYA 3PC8C 3CZCA 3K5HA 3PDIB 4V2IA 4WERA 4XYEA 3TLXA 1OY1A 3FHTA 7AT1A 4C21A 2BMAA 5DCWA 3I62A 1Z8HA 3SHWA 2HHLA 3U49A 3HI6A 1KI6B 1Z5OA 5GZ6A 1H1LB 2J6CA 3EEYA 4FJ1A 4Y9RA 2OV2A 4AO8A 1LW7A 2QRHA 3T9EA 3VV3A 3OKFA 2QI9C 1Y5MA 1Q7GA 2NV2B 3SQMA 4JDPA 5FTNA 5K3SA 3VVCA 3PIIA 4ECEA 3HUEA 1CX9B 2X4GA 4RDHA 1OTHA 1KWKA 4EITA 3GUUA 4XX1A 4D0RA 2OGSA 3K9BA 5FA8A 4X8MA 1SM4A 1YXMA 1HYEA 4LA4A 3WL6A 4GW3A 4O4LB 4G4IA 2BFAA 1FNCA 4DR1B 3BHIA 1XLVA 2WSYB 3PR3A 5H7XA 2GRAA 2R8EA 1GRNA 4AY2A 3B7PA 4Q3LA 4BV8A 3AF4A 1N2XA 3U4IA 2QRPA 5CA0A 3VISA 1RXUA 4RTQA 1ORVA 3IQHX 3WQRA 4NMXB 3Q8LA 4DLWA 5JWRA 1GNSA 1NRWA 1KEVA 2PAFA 2GVZC 4MYDA 2G6BA 1QHIA 4BO9A 4ZC8A 4IDEA 1DBIA 3KU4A 3DTVD 1JYSA 2VO1A 3SE0A 5CBKA 2P8JA 2GPWA 1Z74A 2X1LA 3F0TA 1U2RA 2ZUVA 4TVOA 3OZSA 4R8LA 1TQ6A 3LECA 3QKSA 4KX5A 1I3MA 2NX2A 3HA5A 3ICWA 3LW7A 1JEEA 1VPLA 4US1R 2F1RA 1GSIA 5EN4A 1SC3A 3JZIA 1QDEA 3IAHA 1NVVR 1AGRA 2ERXA 3PKZA 3E2IA 3LCCA 2RH8A 1EG7A 2X0NA 4QSHA 4MQFA 5C5CA 1G21E 1BS1A 1TQ4A 2ATIA 2P6NA 1G16A 2VDWA 1HM5A 3EUAA 4MHSA 3ZKAA 4BFCA 4EDHA 2D5LA 3CVWA 4PX2A 3JPYA 1G8MA 2O7QA 3IE1A 3O75A 2ZTHA 4WK4B 2ECPA 4AP5A 3D5TA 1XDSA 1ZG3A 1CY0A 3CX8A 3IAS6 3MGGA 3P96A 1CQWA 2RSLA 2Y9MB 4OQZA 2R1VA 4NQRA 1VSQA 1ICEA 3QF7A 1NJSA 3DHYA 4CEHB 1GPLA 1MJFA 1OUMA 2C4WA 2ZWAA 3RFVA 3FG9A 2Y66A 3PVSA 4FOSA 4K9LA 1USGA 3A6ZA 3B1YA 2PKQP 1W4RA 3O9MA 4HI0E 4JT8A 4CMEC 2PZFA 4UHFA 4TXLA 2P40A 2UZIR 3AF5A 2NIPA 2CJWB 4XWAA 4RKYA 5J5CA 1JFFB 3PGXA 1HDYA 4B3TB 2X3YA 1LRJA 2PRZA 4MCAA 5KJEA 3PB3A 4P84A 5TMPA 5ALGA 1O96A 5ALJA 1LPOA 3I6MA 2ZIFA 1W6RA 3QUBA 4EFDA 2VDMB 3WXMA 2KE5A 5INTA 4QREA 1BDHA 3VNVA 3OU7A 1HQKA 4Q1EA 4GSLA 4RACA 1IHUA 1VYHA 3FTNA 3TI7A 2CNDA 1MABB 1PG5A 4MB2A 3LTEA 5IAEA 4BX8A 4OYHA 3C6KA 5FJJA 3A4NA 5SYAA 2GBCA 1A71A 4WN3A 1ETUA 4M1YA 1XZBA 1SVWA 3ETGA 3H4IA 1XHEA 5BNWA 2X41A 1YKSA 1ZMBA 1OZHA 1XK7A 3T9FA 5BURA 4BAGA 1ODSA 1EGHA 3KXKA 4F86A 4RFLA 1LSSA 4WJZA 4L6CA 5E3HA 1JR4A 3DHEA 4F9GA 2Y4OA 4GMGA 4MGZR 4HN4B 3VYUB 3GLTA 1JA9A 4WRRA 1N3IA 5J4LA 2C7QA 3CLRC 4J6FA 4NZOA 4DKXA 3AUFA 2XUQA 4JR0A 3V4RA 2EKQA 1LRKA 1TYAE 2VIIA 2QYHA 4RVGA 1SVIA 3WFJA 4BLVA 3GEMA 3WK5A 4RL6A 3SC6A 1RCUA 2XMDA 3DZBA 2EF0A 2VP0A 3KV1A 4X20B 5TPZA 1CQXA 1J2UA 4A0GA 2O8DA 4ZU1X 2AUNA 5BQXA 5JALA 5A4MS 3HLYA 2JRCA 3L6UA 3EMKA 1QGZA 3I05A 4HVTA 4TRMA 4W7HA 1J2TA 4N54A 5A0TA 2GLXA 4IRMA 3WMXA 1GNRA 2UXCB 3BWCA 4DR7B 4J1QA 4N40A 5LZ5A 2G28A 1B8UA 4TQAA 3M5WA 6NULA 4WZAB 4YP1A 4UXJA 2ZRKA 3GLIE 1MFZA 4ED9A 3ZTYA 3U60B 4K87A 3S27A 3Q8MA 3OOYA 1T1IA 4LBWA 1M2HA 4WNIA 1EVLA 2G5GX 1J99A 3WIEA 4BAZA 1V45E 3AZOA 4XFDA 3HVJA 3TDKA 4NYIQ 5GOZA 1XDUA 5TE9A 3C5EA 3D64A 3TPZA 4EI8A 3N2KB 5T57A 1UINA 2NPIA 3BH7A 3GGCA 1A8SA 2GAFA 1L7DA 2C3MA 4FFVA 3LMKA 5E4TA 2OC9A 4B1FA 4E11A 1RKBA 1EJBA 4AJKA 4KXVA 4LY0A 3HU5A 4AULA 1MOPA 1P1HA 1IB0A 1RWKA 4RENA 4TRNA 2PE5A 4MV0A 4UMEA 4MVCA 4FGLA 2Z3ZA 4MS3B 2VAWA 3HYRA 5IBRA 3L49A 2J32A 4NV3A 2DCMA 1JU4A 1YZTA 3EW7A 2REBA 3NBKA 3QIAA 4YAFA 4MUKA 3THXB 4V2UA 5KTOA 2AD1A 2RHOA 2CJYA 1A9QA 4DGQA 4YHHB 1E32A 5G2OA 5B3AA 2P75A 1PR3A 3WFIA 4B2YA 4GZMA 4MJLA 4OXIA 5FR1A 3BX1A 1D4FA 2CVOA 2ZSBA 4MROA 5EYPB 3W5HA 4Y2TA 1EVZA 1K5HA 1L4UA 3AW8A 3ZDQA 1Y4AE 4K3VA 4YJ3F 1LKZA 4Y9DA 4LPKA 2KLBA 4AZWA 2I3AA 1RRCA 3MELA 1G8HA 3LO5A 4N5MA 2GVNA 3U0BA 4XEUA 4IFBA 2A94A 3NZEA 4YO8A 3H7AA 1HL3A 1NFFA 1PZHA 3NTUA 4EG5A 2ZJ3A 5E7JA 1UPTA 2Q0XA 1J9GA 1TRKA 1XMVA 3GG9A 4RPJA 4V38A 3TTWA 5K8CA 2D5CA 4IEIA 4IVRA 1YI8A 2YHAA 5H1YA 2BDEA 1RFLA 3S70A 4H59A 4OGGA 3BZUA 1BQ4A 2UDPA 4UCXA 3C7AA 4KO2S 2QY9A 3FUUA 3UUFA 4EL0A 3U3ZA 1TU0A 1W73A 5KI6A 1NVUQ 1IWPB 4XI9A 5JSKA 1V3QE 4DM4A 5J2TA 5LP6A 3SD7A 2X4DA 1XEAA 1ZA1A 4KFUA 3G9ZA 1P3JA 3G0BA 2YXLA 3OZRA 5GM2A 4D0LB 4OFXA 4G3XA 1R37A 2P68A 4GM4A 3C8UA 1A4IA 1F4LA 4C0BA 3C6MA 2YINC 3S7TA 4Z9BA 1JAIA 1QG6A 1ZD1A 3I73A 2O14A 4DM3A 2ADMA 2XKJE 1IHYA 5CA0B 3IBCA 4ZALA 3T5AA 4EJFA 4OH1A 1RBQA 3OO0A 1BKYA 1TMGE 3WHLA 4PWYA 4BNZA 5AVRA 2QTWB 4QWWA 2KSQA 4B09A 5CGQB 4KVZA 2OV6A 1FRFS 4JLWA 5F12A 2AD5A 2HBRA 2FFJA 2MINB 4BCDA 3DC2A 5I4IA 2Y71A 4D9MA 2IBTA 1IUPA 3EISA 1N2EA 1U2DC 1FVFA 3TSCA 4OHCA 4GOKA 2WZBA 2X8BA 2VYVD 3ENZA 3ITKA 1ANKA 4RH1A 1BO6A 3TL3A 1EFAA 2CMGA 1KYTA 1FFEA 5KVSA 1LH0A 3OPQA 1PNOA 3NHFA 2VDWB 3O2JA 10MHA 1X38A 1S9HA 2QZZA 1LV7A 2GO7A 5DYIA 3A05A 5B55A 1LDBA 3NJ4A 5ALRA 4BKUA 4YPOA 1IN5A 1EWTA 4L7QA 5TMEA 4PRZA 5IX8A 1CJTC 3GRRA 4ZOLF 2X6QA 4EUFA 1QIMA 2C94A 2W2NA 4KSCA 2E49A 4F4FA 2PJUA 3DTVA 3IP1A 2J8ZA 4UUNA 3TXAA 1AO3A 3D7NA 3RIMA 4LWQA 4LYEA 1YIAA 4UATA 3SHQA 4IMIB 2UZAA 2J9YB 1MXHA 2WVGA 2EZ9A 1O08A 2PMCA 1OPXA 3K96A 4NESA 2H5IA 1BJRE 1ZHFA 3JD0A 5CW2A 3K9LA 1SCJA 1ZK3A 4HH4A 2V55B 1KQFA 2BGTA 3BEOA 4FJ2A 4M55A 3TMYA 4C08A 3FY4A 2GX6A 3ESXA 4GRAA 4NMHA 1XVAA 5ALWA 4DR2B 1Z29A 2D1SA 4I1RA 5HIIA 4JJKA 1ACJA 4MRMA 1XROA 2HGZA 3A36A 3QE9Y 1IDOA 4Z4GA 3NONA 4IHKA 3PQ3A 1PNTA 2ZBVA 1SOAA 4H16A 3TN7A 1SCNE 2I7CA 3S6JA 5HIKA 3V8NA 3N6VA 4JC5A 2PKCA 3E2PA 1GRVA 4YAOA 5DYTA 4W5OA 4AJHA 1ZIXA 2IIBA 5B7PA 1W85A 4KXFB 1K27A 4ALNA 2WKWA 5AKJA 2Q3JA 3IUYA 1EGAA 4PZ0A 5TS3A 3EZGA 2FV8A 5H5JA 4BUJA 4ZTZB 3EXG1 1HG0A 4L0QA 2QX6A 4BGUA 4ZEVA 1MENA 1QHYA 1E8DA 3TE6A 2E5LB 2PIAA 1GU0A 1E9CA 3TI9A 3JQAB 1PZMA 2AFVA 1LBEA 4DG5A 3UPDA 4JHLA 5CH8A 3JAMA 2H0QA 4NBRA 3GVXA 4DUZB 3G2PA 3E7WA 3AOEC 1ORDA 4PSUA 1SBYA 2AKEA 1MOSA 5AICA 4XRGA 4I8IA 1Q6YA 3GAMA 4HBGA 2VZ0A 4EI2A 5GVSA 2BSQA 4P0PB 5CB4F 5KKCA 2GEUA 1SHUX 1VGRA 2HHAA 5AKLA 1DKQA 2YKGA 2O8DB 5D5PA 2JI9A 4I4LA 2G9UA 1E6CA 3K31A 1Z33A 1LTQA 1MGOA 2OESA 3PK0A 1CQJA 4IDPA 4N3AA 4BGVA 2ZYTX 1C0EA 3FE2A 3OEED 1XVUA 2BKVA 4QVKA 4X97A 1EVQA 1NRIA 2AVNA 2VDQB 4YJFA 1CZRA 2P11A 2Q46A 1MB2A 4DIFA 4Z8XA 4KLZA 4XARA 4PG6A 4PONA 4TWJA 4EW3A 3DLHA 2GO1A 4MV9A 5K45A 1JLMA 1GPKA 2BBTA 3D2AA 1W5FA 1YDWA 1M8GA 4OI2A 2O3SA 4WNAB 2COUA 3EBPA 5LUBA 1KORA 3WXBA 5CEJA 1GL9B 1NDUA 4B83A 4C6TB 1QKJA 3QNMA 4DSZA 4DB4A 5SZJA 3W7AA 4AY4A 1ZIPA 4OL0A 3HSYA 4QQKA 1WKCA 2BFEB 3QVOA 3M82A 3QXGA 4PC1A 3NDJA 1A2BA 5G41A 3SJBA 3UUWA 2O2XA 3WOHA 4CFZA 2H2WA 1P2SA 2X3UA 5EZSA 4X3OA 3RG8A 3LY5A 3P4UA 4JU9A 5HF8A 1UF9A 4EO7A 3LFHA 4E22A 2NYRA 2ZJ5A 2DSNA 5LQDA 4U7WA 2GCGA 4DMUB 1I2ZA 4AYWA 2PUBA 3ZE1B 1FXWF 4OQDA 2ZTSA 2H4WA 3W2IA 1VQ1A 1NUQA 3Q5GA 1VKHA 2EL7A 4JL6A 3SI7A 2WNIA 3MQ2A 1NBMD 3LQYA 3QENA 3P32A 1RQ7A 1Z3CA 1Y7LA 3DV9A 4O4JF 2DJ5A 1BEZA 3I8XA 3IGFA 3EVTA 3LFTA 3K1AA 4AECA 4OK6A 4B4OA 4E2WA 4X1KA 3T1YB 3UCXA 2Q9CA 1TA0A 4D4JA 3HSKA 1ARZA 3M9WA 4PZZA 3KYCB 1QG0A 4RFVA 1EDOA 4H3HB 1OE0A 1D6JA 3G5LA 3IP3A 3M6VA 4ZU6X 1DTWB 2XMQA 2P4HX 4XXHA 2DBYA 5JQGA 1UXIA 2IWHA 4FGSA 3DO5A 3EW9A 4MUJA 4M9XA 5FADA 1RLTA 1PGQA 2RGAA 3LXXA 2EKDA 1CRLA 5FQNA 2ACEA 1QRRA 3D8NA 5T3YA 1OR8A 4D0GA 1BXGA 2ZR8A 3T3HA 3RKRA 4TLDA 5J2TB 3HFSA 4UUOA 5DNDA 4MVWA 5LP6B 3AXTA 3KPWA 3ZE0B 2GQ0A 3K20A 1GCAA 3TL2A 3DT6A 2QVXX 1NLMA 2H1FA 2ZITA 4H7JA 4PPQA 5IBQA 4HUTA 1EUYA 2P6RA 1K5GA 1ULAA 2WT9A 3DPUA 3M6LA 4OD0A 2VHUA 4LJKA 3PI6A 3E9YA 2J3IA 3H2SA 1QNFA 1JEAA 1E9FA 3U9TA 2UZ4A 1HQCA 1GARA 2C2BA 4K1XA 3FHOA 4JEIA 1ZEJA 3CKLA 4X62B 4Z86A 5F1PA 1WCIA 5JSYA 2PRYA 2C2GA 3TOXA 2CY0A 2OE2A 3CIOA 5ALDA 2VQEB 4KUGA 1XQYA 1O4WA 2R7NA 2UYQA 4KWCA 4M1MA 5FPTA 3VNQA 3VZQA 4RQTA 1PL0A 3V6MA 5I3CA 4QTTB 4C78A 1PX0A 3AVOA 4WZZA 1HG1A 1SQ5A 3FOBA 1EIWA 2ON6A 3TBKA 3VKWA 5IN4A 3KQOA 3K32A 3L0OA 1GUBA 3VPSA 1IIBA 1TLFA 4F56A 4CQNA 1M8PA 3L93A 4OB6A 1MA3A 3LPCA 4OM7A 3I5MA 2PUEA 1UT6A 5CX1A 1ONSA 1NAHA 2CLHB 1OX5A 2P9QA 4BMDA 1IPFA 4FYIA 1Z0DA 2F8LA 2VF2A 5G53C 4RF5A 3OI7A 3R74A 4DMHA 1YKGA 4IXDA 1OXXK 4FW9A 4QD3A 4NCXA 3LCJA 4TZKA 4L15A 4Y2YA 3FMVA 5GP1A 5P21A 5KC9A 2X9GA 4P5PA 4ARZA 2WOJA 5H3CA 2JKVA 4UHJA 1CUSA 4HWOA 4A0RA 1QYRA 3H8VA 2I6SA 3L1KA 3WI7A 1OBOA 3RYIA 2B1RA 2D1FA 4XAQA 1IEXA 2OCYC 1VE7A 1E6EA 3L4EA 1V4BA 4EY8A 2BI4A 2HREA 3M5PA 5DSZA 3JQRA 1C4OA 1K3TA 2QPLA 2E7ZA 3KJQA 1ACMA 1NVDA 4AJ4A 3AF2A 2CMDA 3A1CA 2VYVA 3I0NA 1ADJA 4FR0A 5DHQA 3H11B 2Y1OA 4ILEA 4R2MA 3Q7RA 1NMSA 2Z09A 3N8HA 3E9DA 3OFND 3VHRA 1JAZA 1NLFA 1JPVA 4DR5B 1IZ7A 3G1UA 4GR5A 3GBPA 4QYWA 2Y05A 1QLJA 3JAWB 3ND9A 2ZBPA 5E8RA 4E2XA 4EF4A 5C1BA 4QRDA 1SWWA 4XQGA 2OV3A 4MRMB 1QYVA 1LBSA 3EMDA 4WW0A 5ALSA 4ADSG 3M6WA 2DQZA 4ON9A 1GL7A 3SHTA 2IT1A 1JQAA 4BO3A 1E2LA 3R3WA 5EC8A 1W85B 1SBIA 2XMRA 2DEUA 3M70A 3EZLA 4J2OA 1KYQA 2P9BA 2POQX 5AXDA 4YAUA 1I6LA 2O0LA 4G2TA 3PC2A 6PFKA 5HKBA 3ILVA 3U3MA 2FOIA 5JROA 5AVYA 1IBLB 4V39A 3PYMA 4ICIA 4ZRMA 3MMNA 1IY1A 2GLUA 4ZODA 4HB3A 1DCMA 4QOSA 1IPHA 4B6OA 1KKLA 3AF1A 4OBXA 4QICA 1PWHA 3B9PA 1SC9A 3ZQ6A 1DJNA 3REQB 3D5QA 3TTVA 2Y77A 4ESVA 1CIJA 1DRJA 4OFZA 3EGIA 2DOKA 2VFAA 2ZIZA 2FUG1 3F9CA 1ILWA 4O5OA 4V1CA 3PXBA 1W46A 2V6MA 3ZKWA 1Y7PA 1YR9A 3V9PA 2R65A 1G9SA 3KV3O 4M60A 4WY5A 5ALNA 3U4DA 1L7RA 4F5YA 1T9AA 3PUHA 3WBBA 4A0FA 4EY7A 4G5QA 1M6EX 1Y3FE 4LPSA 1Y1QA 3BFPA 2GBFA 3DEYX 3GRVA 4X44A 3IAFA 4I1UA 3EZ6A 4WDRA 3VSBA 5ALYA 1P29A 4DANA 4ZK6A 3NTOA 4Q47A 1CQJB 2A84A 3BMXA 5D3QA 4DCTA 1ISPA 1G9TA 1U1DA 1WUJS 2JK1A 2WG0A 2KS6A 2ZJ2A 3GLHA 4YJFB 3V8PA 4YAIA 4RCYA 2EGUA 4UDOA 1U0OC 4OAOA 1ATIA 5I9SA 1JZQA 2R44A 4E6PA 1N8KA 2ID4A 5AVZA 1PYOA 4ZKEA 5BP7A 1SUDA 3X2FA 1DRKA 1R6XA 3QU7A 4U9UA 4A8TA 3C14C 1RU3A 4TLLB 4UREA 1UBKS 1RKVA 3I1FA 3KKLA 5I6DA 3KT6A 4GYJA 3NB0A 3O84A 2AXEA 2OZKA 5E9AA 2JFYA 2DWQA 1J8QA 4CJXA 4EF6A 3P2OA 3SMQA 1LBIA 4QEKA 1UDWA 3OG9A 1Q2UA 4QAJA 3HRKA 4DABA 4DAEA 1EFKA 1V8DA 1PJSA 2O1SA 2Y93A 2X0RA 4HX5A 4KMMA 1DXHA 3LQRA 4ZHQA 2IVFA 3T9CA 2I2BA 4BVAA 3GGJA 4Q82A 3HUUA 2H17A 2AYZA 4FDMA 3SJUA 1Z0SA 1K6IA 1N8SA 1UEXC 1W75A 4PR0A 2OORC 1U3CA 1OROA 1Q1BA 2WKPA 4GC5A 4RZHA 4GX1A 3OWOA 4PIMA 4EJSC 1AVTA 5LDHA 3EX7C 2GZRA 2Q99A 3BGOS 3BXHA 4EGAA 4YRJA 3PQ2A 3UTDA 4JP1A 1KMQA 4LK2A 5EJMA 3QA3E 4BQSA 3KEQA 1WM1A 5DGTA 3QITA 1J5PA 2J59A 3R09A 1IVYA 3K1AB 1PV1A 4TTAA 2A4MA 4X1KB 2F90A 4BB6A 5BQPA 4OSOA 1AKUA 1MC1A 3HB1A 4QRIA 4JGIA 1AS0A 1J0BA 1JEDA 2IIQA 1NASA 3HPQA 3KWFA 3FROA 3WWZA 4ND6A 3C7KA 1SH7A 5PNTA 2IDMA 4NZZA 1LK7A 2ZYDA 5JJCA 1JA0A 1IY9A 3H2JA 5IMSA 1R5BA 1W4AA 4FZRA 2C4UA 3RC7A 3EMBA 1WUTA 3CCBA 3HLTA 4PRYA 4RZ2A 4J0KA 5BNTA 1MR3F 3P9QA 3BS4A 5JQGB 4YMHA 3IEMA 2NYAA 2NMVA 2QPTA 3MMZA 1TD9A 2IZ5A 5J59A 1MO6A 3UJBA 4GG1A 2R6R1 3NH6A 2GPBA 2YWEA 5KVQA 4GXNA 4OHXA 1AZTA 3C2QA 1BXGB 3HJNA 4HH0A 1ODJA 3EB9A 4FZ5A 5IXJA 4DARA 2D2IA 4J91A 1P0QA 1NBMA 3AX6A 1Z88A 4WFJA 3H0EA 4D4MA 1EYZA 1E3SA 1MO2A 1XZFA 3QOFA 5BSGA 5C5DA 5JAPA 2D4AA 2ZRCA 2Q5QA 1QLWA 5SZHB 1ZONA 1VJCA 1PR6A 2JCSA 4EY4A 2BDTA 2YQ5A 5CJ2A 3WLFA 1RYFA 2VXOA 4HUJA 3IR7A 1XJQA 1NBME 1BEEA 1YB7A 4KITB 1WCIB 2JAPA 1ZX1A 3C3CA 4MLCA 1SC6A 1YF3A 2JAQA 1HKHA 3RRMA 2JD0A 4RX1A 4LZJA 1T91A 3OZ7A 3AEYA 3Q72A 4OMUA 4ZPJA 3U17A 1TUBA 4NAHA 4PQRA 1RLIA 2EP5A 4QULA 1D8AA 3OECA 4UXIA 1CIPA 3VNSA 1CT9A 1DOAA 1YJBA 4DSOA 1NMYA 5CX1B 4MGIR 4JEUA 2NXNA 2FMKA 2HJGA 3NOXA 2XIJA 1YUNA 4GX2A 3ZCUA 3UC9A 2ZM6B 4KBFA 4L8GA 4WX2B 1UADA 3NC1C 5D00A 1BMTA 1TFUA 2VAVA 4ARZB 4KSYA 5EHNA 3MJFA 5FV7A 3UJDA 1Q3HA 4WHMA 3GEDA 3RYIB 3UWSA 4WVFA 2R47A 2REXB 2XDYA 4ZFNA 4CZ2A 4ROSA 1BX3A 4EG1A 1VLHA 1BVRA 1W94A 2D1QA 2JJQA 2Q3CA 2W8BA 3GDHA 3OU2A 4MW5A 1Z22A 5FL7D 5JASA 2GAOA 1RYEA 1WF6A 2GXSA 1O6CA 2NT3A 3RT9A 1M2WA 4EL5A 3JU3A 3QFRA 4CUJA 2ETVA 1T9HA 3FDZA 2QLMA 4ZAGA 1CEYA 2CN1A 4W9NC 1W0KA 3OCJA 1E9DA 3AM1A 3A3YA 2I7DA 5EMHA 3WGKA 2Q1XA 4OP3A 2WHYA 5FI3A 1MX9A 2DY1A 3C8MA 2A9OA 3VDNB 2D1RA 2C58A 3EGVA 5EE1A 1W4LA 2O05A 3IMCA 5TIIA 4CL8A 5KINB 3BOSA 3EY9A 2DSTA 3QKTA 4AWBA 1U4NA 1XTKA 3KPVA 1FP1D 5DFAA 5IJWA 3QX8A 2CLEB 2NAPA 4FPXA 1NBEA 1WAMA 3QLTA 1YCHA 4TV8F 4U7PB 3T3MB 1PGJA 4LZZA 2ZETA 3A4MA 5BPFA 5G0WA 4F3CA 2ZOSA 3NX4A 5FFMA 3AESA 3ZJTA 3O4GA 2I1VB 4C4RA 1W0JD 3HL0A 1U8YA 2O9JA 3M6MD 5TR9A 4BX9A 2FOLA 4PG8A 5U4QA 1VL2A 5B7QA 3OT1B 3RSSA 1NFRA 4X66B 3BILA 3S2YA 2FXIA 4DMLA 3PL1A 5LMUB 4XQCA 2KBEA 5ILQA 1PSZA 3OFNA 3R40A 3T7JA 4JS0A 3TCXB 4TXHA 3JY6A 2PRIA 5C37A 1TO1E 4KR3A 1U8AA 4MTLA 2DFDA 1VMAA 5AH0A 1HT2E 3SP1A 3MBOA 2OC4A 2P2CA 1Y8ZA 1MZPA 5ESXA 1XRMA 2XDQA 4FCCA 3PDJA 3C5WP 3I9V1 2ROQA 3OM1A 5MHTA 3KHSA 3ZKWB 1O7JA 1K0FA 1QCCA 4Y6SA 4MVJD 4I19A 4CV2A 4RIGA 3FVTA 1UBRS 2RMKA 1X7DA 2GN1A 3QEAZ 1UBCA 2X7HA 2YRWA 1SWVA 3UCFA 2VYFA 1FDWA 1QAOA 2Q45A 2FDXA 4GBGA 4HUQA 2HF9A 4JIMA 2L19A 1IEQA 4PYNA 3REOA 2WICA 4D43A 1LNQA 2C8VA 2MR5A 3GLHB 1VP9A 1JDBB 1JQBA 1OFUX 4P33A 2XMZA 4AN0A 4JV5B 3D3NA 1ZU5A 2GZ2A 2PEZA 4LCBA 1K6XA 4PLCA 1EH5A 2C5HA 3DBOB 1QTQA 2CK3D 2I91A 3IVAA 1D1SA 1BS2A 2F17A 3ZHOA 3EZYA 2XMCA 2WKSA 2XKBA 4G09A 4L72A 5A5DA 1AURA 1I6WA 2H2AA 5IZCC 1GTJ1 5U1PA 1N1EA 1TXGA 1V37A 2HCFA 2HSEA 3BDIA 2ESRA 1BHSA 4IZOA 3G02A 2VHVA 3FUVA 3ZCPA 1XQVA 2ODEA 1PT7A 4CM7A 1L4EA 2PK3A 4IQGA 5FLKA 2HRCA 2IXAA 3MCTA 3PEUA 1ZKMA 3G8BA 5IARA 3PEEA 4NFLA 5E0KB 4CQLA 3FRIA 4PLWA 2GS9A 4F93B 3JQQA 2H1OA 3E70C 4ZHQB 2PLAA 4YC7A 3PHIA 3TR6A 3GJ4A 4OA5A 3O2NA 1K7SN 2Y1EA 1SAYA 4KUHA 5BNZA 3HBMA 4LXGA 3T52A 5BWMA 5IYZB 3RRYA 3HABA 5J58A 5GZ1A 4KU4A 1CVRA 2P6OA 4O29A 2JG3A 4ZCLA 2FCRA 2AZXA 2RHRA 2A33A 5FOSA 1JFTA 4CIWA 1GRCA 4ZAZA 3D6TB 3M4JA 5THKA 5E4JA 3DUFA 1JDTA 2EJCA 3Q98A 2FFQA 1BEUB 5I9TA 3H1PA 1V2HE 2Q3LA 2Q5LA 3MC1A 3RTAA 3WZ2A 1Z68A 2HADA 4Q6WA 2AR9A 3LQKA 4ESEA 2Q21A 1SVLA 3FJ1A 4PV7A 1DRWA 3GH1A 2C20A 3V97A 3FF1A 3I2JA 1TAQA 3K9QO 4Q39A 1H8HD 3K5IA 3FCUB 2AQKA 1P5HA 1DXOA 2GNPA 1PK7A 3I30X 4G2NA 4C4PA 3QUTA 4G84A 4HAUA 2WPDA 1X39A 4C06A 3RVRA 1ZNZA 4LQLA 1KETA 5DGXA 1YBMA 2HOQA 2Q2QA 4J0FA 5HMLA 4BNHA 4DLZA 4HEQA 3BB1A 4NEQA 4U2KA 3CMCO 1XJ0A 2FEXA 1KFBB 1HSOA 5IULC 3LL4A 3U3KA 1PKXA 2GYVA 4A6EA 5FH9A 3WS7A 4CM3A 5CYPA 3WP0A 3TAUA 3I5AA 3C16C 2YWBA 3O2QB 1RWVA 3MCZA 4IGEA 2TECE 1X8KA 4H18A 5E6RA 4MINA 3PNBA 3RF7A 1NUHA 1M3SA 1VJDA 2B78A 1BVHA 3KALA 4W5QA 1UMCA 5JCXA 5ALMA 2V6JA 3C41J 5GZ3A 3O4RA 1NAIA 1UM8A 2HU5A 3QVWA 1AHHA 3IB6A 1SB8A 3MQFA 4G8DA 3QY0A 5H16A 1L5HA 1S01A 2QK4A 2QYOA 3DFMA 4KK4A 3W5JA 1AXGA 5FRDA 3ROFA 1EA7A 3UOWA 1SXJD 1NXSA 2VJPA 2WINI 2ZGVA 3B60A 3A4IA 3L7AA 3TGPA 4HH1A 3HHEA 1TUBB 2V9PA 1VYVA 3DOCA 3EPHA 3ZU3A 3C1OA 4GOMD 5FORA 1I7DA 1XMXA 3DFFA 4BNWA 4QOEA 3DDSA 3IVRA 2Q41A 1XSEA 1FFCA 5B1YA 3JQEA 1NDHA 3WB9A 1G9XA 1R0XA 2FW9A 3NJ8A 1XP8A 4WD3A 3WLHA 4RU1A 1NNSA 1D4AA 4RGBA 4GOXA 2YJ4A 4C43A 1U04A 3D9QX 3HTXA 5ELLA 1LDYA 3OF3A 4UNRA 4A9AA 3ZLBA 2OBLA 1U2EA 3COWA 1JIKA 2IHTA 3AR5A 5FWDA 3X1YA 1L7PA 1E5QA 2AFHB 4O3FA 1W1UA 5LMNB 1TL7C 3BD7A 4MW4A 4MW7A 3GJQA 3R9XA 3VH3A 1CXZA 3UOAB 1M2OA 2VTDA 2BFBA 4HNQA 3RV3A 5AUOB 1WD5A 2AF4C 1AQJA 2QTVA 2QD4A 2C95A 1F2TA 4BB0A 4MMXB 4D9EA 2I33A 3FDZB 3HY6A 2J3MA 1NXXA 4P2GA 2AEJA 4U0KA 3P45A 3RFUA 3O9VA 4URUR 1LVUA 2ADOA 2AB0A 1KAGA 3N07A 4O2AB 5CT6A 2ZXUA 1MAHA 1OAKA 4ZT3A 2YFQA 4GKKB 5ICMA 4IG4A 4Y8VA 5LB4A 4IO1A 4RETA 2A57A 4A82A 4AKHA 1Q92A 1LXCA 1L7XA 4KBYA 1KDOA 4PFSA 1Q1AA 1SUAA 2J5RA 5CIYA 4KQWA 3M34A 1YE5A 3AESB 4JDUA 5FL7A 2J3HA 4I55B 4N5HX 4DDKA 3AR4A 1N2ZA 1QQAA 4H77A 4G8CA 5FBZA 3JQBC 4UQLA 4NH4A 3GO4A 1WNTA 2PX0A 1RI1A 1MOZA 1XYVA 2JHAA 1IVNA 3FLBA 3EAQA 5EHXA 5FHRA 2CMFA 3N6XA 1DIGA 4R9NA 2EQAA 4ZJUA 4JAVC 2O1WA 2VT2A 3IDZA 4PN7A 5JLJA 1TZ2A 3L06A 4LRXA 2F4VB 1GL3A 4GQIA 2OHVA 4D41A 2RGXA 1AQUA 5FR2A 3NAZA 1QAMA 1KEZA 1DX4A 3NATA 1U3WA 2ZUTA 2DUWA 4H17A 1GRRA 4X64B 4EJMA 1B6TA 3N2YA 3NJRA 3UT0A 4K0RA 2IPLA 5DWDA 3M9LA 4TMWA 4WXRA 1S3SA 4G1BA 2V5VA 3USZA 1E6MA 1BQEA 1W0JA 1A8UA 4ZC1A 1UDRA 4HUQB 1XXHA 4JL5A 2EP8A 4JYMA 1DAPA 1MW9X 2GK6A 2C7PA 3PXUA 2O2SA 1EQ2A 1XZAA 4JI5B 4G8BA 3ACCA 1NJ1A 3I34X 4BBAA 5BVGA 1PDWA 5GADl 3KHKA 1KMHA 3GAFA 5K8JB 3VO9A 4BN4A 5FO0A 5ITSA 3D3EA 1XXHE 2SKDA 2NO1A 3F7NA 4HEA1 3UANA 1QF9A 2C5AA 2L0XA 3AF0A 5IXYA 2ZIWB 1V95A 3AYXB 2KW5A 2ZP1A 5CNMA 4MVJA 3EK2A 1KEPA 4OHMA 2QVCA 1FC0A 3EJWA 4WFIA 1DG1G 2P27A 4CQLB 1RXIA 2Q6VA 3R5TA 4G36A 4IIGA 1L5MA 2OILA 3K9WA 4JC0A 2FAXA 2FX5A 2ODWA 4RK5A 1Q2XA 2GFQA 2C9YA 4IIJB 1SB9A 4MUEA 1BS9A 4XH9B 4AG5A 3OE7A 1CVIA 5AHXA 1PLKA 3P2MA 2ZI4A 1UJ6A 3RR2A 4LE1A 1N33B 2VOEA 3PUYA 4KPUA 1GN9A 1GSOA 2OWEA 2XB9A 3HACA 4FEYA 4K6KA 3T5PA 1KDYA 1P62B 1G19A 1DNPA 5E9WA 3A1UA 4DMKA 1RAIA 2QAGA 4BFTA 1T26A 2Q29A 5AHOA 1GDTA 4N3GA 3P8ZA 4M2LA 3OSZA 1HI9A 2HA5A 1E5TA 3DUFB 4GGMX 3RBVA 3RB8A 2Y1CA 4ZEOA 2BCJQ 5H82A 4ZXPA 5EPUA 2X22A 4DLBA 1I24A 2G36A 2GK4A 4PHCA 5CJPA 1YOBA 4C0KA 4F8JA 3DE5X 3VC2A 1NULA 2ZSFA 4YJ2F 4J3FA 5TT0A 4XW2A 2XZLA 1NOJA 3VR6D 4GD3Q 4EEXA 4E5SA 1SXHA 4TKUA 2AXQA 2F59A 2W6MA 3C39A 5D86A 4YDQA 3KHUA 5BQ3A 5KYTA 1FIUA 1BOFA 4NBTA 3CE9A 5CP8A 4DWWA 3WL4A 5F98A 1U1EA 1N7IA 4ID9A 1W6UA 4IJMA 3QK7A 4KQKA 1DMRA 4CDGA 4DA6A 1WDTA 5BRAA 5H3HA 3DSRA 3R0XA 5LMCA 1ULTA 2V9ZA 1M75A 4IIYA 3S2IA 2RJNA 1ETHA 3BGSA 1I5OA 3BGVA 4JBNA 5JFGA 2OMKA 3OIYA 3Q9NA 2HJVA 4D97A 4P22A 2NXCA 2OA0A 3EXEA 3SLKA 1KARA 4B4KA 5E6RB 4DWVA 4C88A 3H75A 1PBTA 1A69A 1VRWA 2XDAA 3NWEA 1UMCB 4TM7A 4OY3A 2F6RA 4RY8A 3L40A 3R5HA 1ODFA 1H8HA 3JYLA 3LJKA 1LFDB 1SMKA 4U5XA 3I32A 4LW8A 3UUEA 4C20A 1NX6A 2OP1A 4JZYA 5L3VA 2PKWA 4AUKA 1LB1B 3W4IA 3CM0A 3QLEA 3KVVA 2XNSA 4ZI5A 3PE4A 3QWAA 4NDNE 5BYJA 5HSGA 4AWAA 3NBMA 1S2LA 4L5IA 2BEUB 4Q9HA 5L45A 1U65A 3DEJA 2CBXA 1M6NA 4HNHA 5MN5A 2AFIB 3UAGA 4CMHA 1U9ZA 1XD2A 1N0HA 3MTQA 4ZDKA 2VK1A 3HKEA 4LXQA 4ZOQI 8ADHA 1OBCA 4H4CA 5DMHA 5FOXA 1MQ8B 3VX4A 4BL5A 3QVKA 4WUTA 3WQBA 4A23A 4BMNA 2ZTLA 1X86B 1LI4A 2QLJA 3EGCA 2BFPA 3ZCXA 4I4CA 2D5BA 4KVAA 3V7FA 1SBHA 5HRAA 3AM3A 3FFWA 1CR2A 1Y4DE 3BQMB 3KC2A 3NRBA 4JGBA 4B71A 5FUXA 2ZR9A 2JGFA 3I8OA 5KWVA 4MO9A 4LQCA 4RV4A 1MTOA 2O7RA 4LGCA 1UXJA 2CLLB 3FBWA 3IOBA 4DCSA 4OU4A 1SXJA 1H3FA 2YXBA 3LT0A 5H02A 1M2OB 1OYYA 3WA7A 3GRFA 3TS1A 3AM4A 3AY7A 3VSDA 2H2FA 3ZY3A 5JDIC 3ZJUA 3IOMA 1ABBA 4LHWA 2EKZA 3SE7A 4AMBA 3VKHA 3UK2A 4F4IA 1E9BA 4DXDA 3PD7A 1WP4A 3BTOA 1JQ3A 6ABPA 3TJZA 4DDVA 1PZNA 2VSQA 4R8SA 4A92A 1BU5A 3ISVA 1J1IA 2PS9A 4D1YA 1BFDA 1R16A 2FHSA 4J0EA 3W79A 3EGXA 1NXWA 1TA4A 4PVCA 1ATZA 3QMVA 5A3RA 2I67A 2PDAA 4RPCA 1I10A 1X77A 1L5VA 3AEUA 3DL7A 3VZSA 1IQPA 2FN7A 1RXCA 4C4XA 1NF9A 4S1TA 8LDHA 4HXYA 3ZCQA 1B73A 5D5HA 5TQ2B 3O1JC 1HBJA 3U6KA 4JMPA 5IVPA 1NNEA 2FLWA 3CRQA 3A32A 3G2HA 3VPCA 1ZVQA 3IPRA 4OX9B 4CR6A 4JB2A 2VK2A 1XTRA 3GLKA 4JI8B 1LF5A 4RZIA 2OQRA 1E79D 4R2HA 3T7AA 1Y6FA 4LZAA 3AETA 2R86A 4JI4B 2WD7A 3NIWA 4YTEA 3U4MA 1O97D 1T8TA 1IBCA 5DH9A 4LJYA 4BO6A 2XEXA 2A30A 4E5MA 5LXTB 1DKOA 4OQEA 4Q18A 1QVZA 1W52X 2E1RA 1U3DA 4FYYA 4MWOA 1B14A 2BZ1A 5JAMA 2OV8A 5F5XA 2PWZA 3EFBA 3P4YA 5B5SA 2ZYWX 2HF8A 1MT3A 3GT0A 2PQ6A 1KI1A 3MJTA 4MV8A 3NT5A 3FLMA 3WWYA 4EA7A 1LS1A 3GUCA 3WV4A 3N7AA 1FOEB 4HWKA 3OLCX 2C8LA 1NLZA 2R87A 1RZUA 2WDZA 2KQUA 1EZZA 2WUGA 3N0WA 4K05A 3I2IA 5F23A 1Z8DA 4KAJA 1E1CA 4RSHA 4WA8A 2GJSA 3ROMA 1MIHA 1T9DA 3P0FA 2UUOA 1KJ9A 3WB2A 1FLVA 3PUVA 5TSDA 5KVVA 2COEA 3P9NA 4P92A 3QNWA 2IEYA 1E2QA 5BVGB 1UAGA 4EYGA 1JU9A 5T6MA 1NR1A 1TM7E 4IS2A 3CT4A 1KMHB 3B89A 2HYDA 3FTQA 4M9RA 4MUBA 4KQ9A 2Q5FA 4PIPA 4R2XA 5DKFA 3T7CA 4GWKA 3WLJA 4WVLA 5SY4A 3LDUA 3RJZA 1MVLA 3MOIA 4NY1A 1SBQA 1RP7A 5ELXA 5AVVA 1PVVA 3PSAA 2A5FA 1V1RA 4BNIA 1KY5A 3GIDA 3FSEA 5FB3A 2AYYA 4JT4A 4PLFA 2I87A 2ZRGA 1EFCA 1OU4A 3T1QA 2NVWA 3GLGB 4YMVA 3AL2A 2EDAA 2IYXA 4X00A 2H8GA 1PJ2A 2BJHA 4ND3A 2R8PA 3RV4A 2FEPA 4QGFA 5CFQA 3LYAA 3ZVNA 4R9RA 2B20A 2AJBA 3NVDA 4LE2A 3E9QA 3ENNA 1ZKDA 2WTMA 1JSRA 3KVRA 4KPUB 1L3CA 4L5BA 3ROKA 4EJ2A 3NVKI 2A0WA 1S3IA 4BFYA 1K5PA 1RCTE 3BAZA 4M1OA 2QX8A 3AY0A 2QAGB 3GUHA 5I7VA 1SKYB 3LX6A 3ZDBA 2M1ZA 3CUKA 3SN6A 4CL0A 4E15A 2V98A 3MXTA 3ON5A 1BC5A 5HZKA 4G86A 3LC7O 4AYTA 1OT5A 2I4OA 1PFVA 2X4IA 3UV7A 2IUSA 4TWRA 4DLRA 4MW0A 3HFGA 2PIDA 2FUNB 3LL7A 1ZNQO 3Q3EA 1HNZB 1T8RA 5AW4A 1E2EA 4TKUB 5BNFA 3U26A 2C3UA 2ZUBA 1DG3A 3MRTA 1ZUD1 3RRJA 3KR0A 2VT3A 3GLFA 1E4OA 4BGDA 3MLAA 3OJFA 2GBPA 4B8WA 4MKFA 4BQOA 3HU1A 2HRBA 3L6EA 5F3RA 3CKMA 2FMTA 3LUPA 2WJPA 4IINA 1LPBB 1VMIA 1E60A 1EX1A 2VPYA 3H97A 2ERYA 3GVIA 4FWIB 4LYFA 1PD0A 3AVPA 3QRWA 4M7WA 2XCLA 4O59O 4XRRA 2C5FA 1KZHA 4CIYA 1WEHA 2XCSB 4MHTA 4LRQA 2WWHA 3EXEB 4EG7A 3GLFE 1Q1ZA 2V7VA 1GGMA 3RROA 2YV5A 3C3KA 5FF9A 1E3EA 1V0JA 1RM0A 4LDAA 4EHIA 4CQMB 1TA9A 3DDUA 4G67A 2GPTA 3VR6A 3IDAA 3RFFA 1Z6ZA 4LHSA 4UTRA 1Z82A 2R66A 4HWTA 1JR2A 4KJXA 4UAGA 1AF7A 5DOZA 5K4GA 4PSAA 5T4HA 3C3AA 1XDWA 1LCIA 3SYMA 5I45A 3JQFA 4QXQA 1U81A 3ICPA 2AZTA 3SR0A 5JWOA 3L4SO 3FW1A 1C9NA 2BR5A 3ISJA 2OZEA 1DCTA 1I8TA 3WYAA 3H99A 1WSAA 3TRFA 3H4TA 5E1MA 1IUKA 1F60A 1XD2B 4QBFA 2W6ID 4CV0A 2ZT7A 3HKEB 3SQNA 2QJRA 2C1EA 3URKA 3ZDCA 2AZ4A 2DUMA 3OZGA 3KYBA 3ADOA 4TYWA 5AKIA 3KOXA 3O31A 5L4NA 1ML4A 2NZ2A 1CPYA 2AZDA 1QBKC 2AG5A 1CZNA 1QOQB 2HMUA 4TL8A 1U80A 3NHBA 1P75A 3PNYA 2XZTA 5AUQA 4DIBA 5HOQA 1TADA 3DL4A 3P71T 4FGZA 2W2VA 4MV5A 3TLGB 1OH6A 2B34A 3KWMA 4XE5A 1NMZA 3F3MA 4JITA 4Q1AA 1SVNA 5EJAA 5FTWA 1UT5A 3RARA 5KSYA 1G64A 4MR9A 3WMWA 4BQFA 5F7JA 1SXJB 2I4MA 1XEWX 4LF8B 2EG9A 1GPH1 2QUBA 4NCJA 2IPNA 1K06A 1NI5A 1YE3A 1EWYA 3RS3A 3CUSA 4HYYA 3NWOA 4X7MA 1UP7A 2ZBRA 3RJ9A 4BIIA 3HMQA 3FHJA 1NMXA 2W2XA 2JNWA 4QOHA 5LD2B 3I04A 3QFCA 5C1IA 1BFUA 3EDQA 3HXMA 1QNLA 1TUEA 2J0QA 5DI3A 3EIHA 4NNPA 4M83A 4EABA 1MW8X 2UU9B 1TQ8A 2VNHA 3FDFA 3KJGA 4NATA 3LHFA 2GEVA 4EG4A 2HF7A 4EZIA 1Q14A 5CLLA 4JLDA 3LUAA 2PFGA 4S1PA 3O90A 3L7JA 4JUBA 1VFNA 4NPCA 1HEIA 2TMGA 1WS6A 3DW1X 4JI7B 1ISJA 1CJUC 3PWSA 4KDRA 2YV1A 1YJXA 2GKOA 2A9QA 2BFDB 3H9JA 3QLVC 4DBLC 3QU5A 1FZTA 1VSVA 3U7JA 1E2FA 5FHQA 1NQVA 3L8ZA 2DQKA 2OYCA 1FMLA 4AUNA 1ZCAA 5CD9A 1EA5A 1RBMA 1TMKA 4P8RA 3ZW7A 1O95C 3C3BA 3NUQA 2VQ6A 1FFHA 5B12A 3ROXA 1DELA 3FYUA 1K8QA 1ZXBA 3AETB 3SOPA 2WD7B 3D5EA 4II7A 2IOQA 1FVHA 2IDKA 3R41A 2F62A 1N5KA 3PS9A 4PG4A 1QH1A 5EL0A 3W1EA 1E59A 2MR6A 1DBWA 1KYVA 2CSUA 4JLVA 1XRSB 4JVMA 4P38A 1H2EA 2YYAA 4AX8A 3RU2A 1PSWA 2WYWA 4RVHA 3OJ0A 5B36A 3H5VA 2P77A 3DAGA 2NU8B 3AVYA 4S24A 2GAJA 1EBBA 1XA0A 1ZOPA 1PTJA 4KYTA 3BGIA 4ND4A 3HB9A 3G17A 2QAIA 3RRNA 2L17A 4ARVA 1L3BA 5ENZA 3DHWC 2DT8A 2YV3A 4IV5A 4U9HS 2DT5A 2X5XA 4PYMA 2I6XA 3V42A 1W34A 3C8DA 4MP3A 4PZYA 2FSPA 1E1CB 4ZCTA 2EVWX 3QBEA 3VFDA 3BL8A 2AQ8A 4RC9A 1MEEA 2P6PA 3NBFA 4BMPB 3H18A 2QTFA 2IHNA 1E79A 3AI7A 1Z37A 2HX1A 2DERA 1YL5A 2RGNA 3E5HA 4XWYA 4F11A 4TYNA 4CQJA 1YHZA 1WHTA 2ENUA 4OHFA 5EQFA 3DMPA 3UEOA 4YP5A 3TLKA 4YI3A 2Z98A 4C4TA 3ZD9A 1S3GA 2GH1A 2GMWA 3W5BA 2QLNA 4FBMA 1NDQA 4FB5A 1V1RB 1FUUA 3Q3HA 2DBVO 2PT6A 5AK6A 3KUCA 2W6ZA 2Y6VA 1REQB 3WDMA 5DP2A 4L16A 3DOFA 2PJRA 3IKVA 3RS8A 1NOKA 1Z7BA 4PO1A 1BAPA 4Y0AA 1XPOA 2ZWPA 3IBGA 3BCRA 4BLTA 3NOQA 3G0DA 1P80A 2NXJA 5DLDA 3RRXA 3CONA 1Q7BA 2ZI5A 3GJ6A 1B2RA 3CBGA 1H0RA 2F1KA 3NTXA 3PQ8A 1WU8A 3HXLA 3Q2KA 4J2HA 5HJ2A 2WNHA 3ZJ4A 4EBFA 2XTJA 1M76A 3BXGA 4RHCA 2CUKA 1YVEI 1KSFX 5DCUA 4QUKA 4YMWA 1H1DA 2AC4A 3DYVA 4BS9A 4WKBA 1KYZA 3OURA 4MYHA 5A5EA 4BLPA 2ADFA 2WF6A 3MGCA 2ONZA 2XBLA 2YYYA 4XDGA 4A0HA 4BO8A 1QHEA 4ZGGA 1DZ3A 5GOTA 1NI3A 4DLPA 2W2LD 2HI0A 2O6LA 8MHTA 2O07A 1FX0A 5KX5F 5F5NA 4CU2A 3WGQA 1CQIB 3ZV5A 3AEZA 2HQOA 1L5KA 3ZGLA 1KGDA 4QL3A 5J4KA 2FJUA 2PSFA 1VECA 4RY9A 4EEZA 2YCBA 5FTMA 4UHCA 3SZOA 1P2GA 1QYWA 2AK2A 4PGMA 4D8VA 4CM8B 2PL9A 1G5RA 1OX6A 4QBGB 3TZCA 2QW8A 2R97A 1ZGAA 1JH8A 1CERA 2C59A 3MPOA 5AO9A 1ZUHA 4AQ7A 4WH0A 4R3NA 2BSXA 4XYBA 4QDTA 5AI8A 2PGJA 2F9MA 2AMJA 2H7VA 2INGX 1XZKA 3UMBA 3ADKA 1EFDN 1JHQA 3CLRD 2FWPA 4RMJA 2DY0A 5LA6F 2QT0A 1XLTC 4D7AA 5LQSA 3NBXX 3JVEA 4YRPA 1QHSA 4IIXA 1OVGA 1CRWG 4MGEA 1Z6AA 4TS9A 3C1TA 4MJXA 5DW0A 1FFYA 1C30A 4HSEA 1YIOA 2G0AA 5H0IA 4EB0A 4J9UE 1GHTA 5KKNB 2WK1A 5A3JA 4MWGA 2FW8A 1JI0A 5FPKA 4QUGA 4ZYWA 5MFZA 3F1LA 9GPBA