3CCFA

Crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
238
Chain Sequence
b'FVWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSGAEVLGTDNAATMIEKARQNYPHLHFDVADARNFRVDKPLDAVFSNAMLHWVKEPEAAIASIHQALKSGGRFVAEFGGKGNIKYILEALYNALETLGIHNPQALNPWYFPSIGEYVNILEKQGFDVTYAALFNRPTTLAEGEFGMANWIQMFASAFLVGLTPDQQVQLIRKVEATLQDKLYHQESWTADYRRIRIVSIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase
publication title Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Transferase
total genus 74
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.144: Trans-aconitate 2-methyltransferase.
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ccfA00
5EZQA 4PYMA 2AN3A 2JHPA 1XDUA 3LX6A 2ZBQA 4M38A 3G2PA 3OE5A 3VSEA 3LGAA 4MWZA 4IV0A 3K0BA 5CVDA 2YQZA 4AUKA 3B89A 4DQ0A 4RTJA 3FTDA 1YFLA 3C6KA 2IPXA 2G72A 3ELDA 3DUWA 1TPYA 2FYTA 4BP1A 3T7RA 2NXEA 4CXMA 5GP1A 3A26A 3KQPA 1ZKDA 3VYWA 2N47A 4C4AA 4ER0A 2O05A 1I4WA 3LDUA 3M6UA 4U7PB 5EGSA 4EVIA 1FPQA 1G6Q1 2BR4A 3E23A 3HNRA 3I9FA 1KXZA 2FK7A 2XVMA 4KDCA 1P1CA 3QV2A 4RV9A 5DX0A 3BXOA 5DTRA 3EVBA 5LQJA 3GU3A 3ANXA 2NXCA 2QM3A 3D2LA 1SG9A 4C03A 2HV9A 4E2WA 2AN5A 5E1MA 3R24A 1G55A 3IV6A 3M6VA 5GINE 3BWYA 2HR1A 2QRVA 3B7PA 5EEHA 3JWHA 1JQDA 2CL5A 2P3OA 3TM5A 4KIGA 2AOUB 2JHAA 1INLA 3A4TA 3HCAA 3I64A 3JWGA 4RYLA 4Z2YA 2AS0A 3CC8A 2BM8A 4OBXA 3TRKA 3BWCA 5KQRA 2Y1WA 5K0FA 1G38A 2AOTA 4GF5A 10MHA 5HIMA 5E1BA 1L9KA 2ZCJA 5E9QA 1G60A 1RJFA 4X41A 5LR6A 3FRIA 2LD4A 5FHQA 4DZRA 1R8YA 3TOSA 3OZSA 5K0NA 4DKJA 3FTEA 4KRGA 4FS8A 2EX4A 5EG5A 2I9KA 2GA9A 1I1NA 1P91A 3Q7EA 5B1SA 5LQRA 5GM1A 5U4XA 2UYCA 2PSSA 3OFJA 1XVAA 5HEKA 4RX1A 3DOUA 5GM2A 1NKVA 3KPUA 5HZMA 1HMYA 5F2KA 3O7WA 5C0OE 3TFWA 1D2GA 1VBFA 1VL5A 2OKCA 3DXZA 4HGZA 5FULA 3TQSA 3OU2A 4C05A 4F86A 5KQSA 3ER9A 4PGGA 5CVJA 5DWQA 3FPEA 3NWBA 3THSA 3G8BA 3PS9A 1T43A 3G5LA 1JG1A 3R0QA 4LG1A 4QTTB 1NBHA 1PJZA 1AQJA 2ZBPA 3HCCA 3MTIA 5FA8A 5CVEA 3UJBA 3GGDA 2ORED 4YV1A 1X1BA 3FPFA 1SVUA 5E1OA 4QVGA 3TKYA 5EHGA 1F38A 5DLYA 3B5IA 4GEKA 5DXAA 3GDHA 5EMJA 2P8JA 1JG4A 2Q41A 2OZVA 2Z6QA 3FYCA 1RI3A 3ER8A 3NMUF 3LPMA 4RVGA 5CD1A 3UA4A 5DXJA 1UWVA 4E33A 1VLMA 3HCDA 2IGTA 2OBFA 2PX2A 2VDUE 1O9GA 3C3YA 2AVNA 2P3QA 3O31A 2C7PA 1NV9A 3KU1A 3B3GA 4PGHA 4DF3A 2P35A 2ZVJA 4PYJA 2ZLBA 4AZSA 2ZZMA 3RIEA 5EMKA 5FWAA 4FSXA 3ME5A 3EMBA 4POOA 3G7UA 4RSRA 5K05A 1RI4A 2QY6A 5T64A 9MHTA 1AF7A 1JQEA 3HA7A 3Q87B 4AX8A 3ERCA 3KPYA 2VS1A 3FUXA 3UJ9A 4DCGA 5KYGA 3NDJA 3UFBA 4PIPA 1WS6A 1WY7A 1G8AA 1YZ3A 1L3CA 1SUIA 4Y30A 2B25A 2UYOA 3MTEA 4U7TB 3RODA 3SSOA 3ELUA 3TLJA 5HIKA 3KPWA 1QAMA 4PYNA 5ERGB 2AOVA 1IM8A 3GRZA 1NT2A 5CIYA 4YV0A 1DCTA 3KQSA 2UZ4A 1MHTA 4G56A 3FYDA 4ER6A 4IKPA 3A25A 3H2BA 2WK1A 3NVMB 3TMAA 2R6ZA 5LSAA 4HRAA 2FHPA 5HOQA 5F2OA 2KW5A 5K0GA 1BOOA 3R9XB 2R3SA 3HTXA 1N7IA 5ICGA 4HSGA 1VIDA 2HMYB 3CJRA 1WG8A 3F4KA 2IIPA 2ERCA 3LCCA 3NWEA 4LWOA 2WA1A 3DMGA 4PWYA 4PYOA 5DX8A 4XUEA 4GOLD 1SQGA 3P2KA 3I5UA 2PXAA 5FA5A 2O57A 2ZTHA 3CCFA 3UJCA 2XYRA 3M70A 5E9JA 3KKZA 3AJDA 1XCJA 5HILA 3HA5A 1QANA 3HA3A 4E2XA 5FTWA 1VPTA 3OE4A 4CTKA 2I7CA 3BKWA 1XDSA 2PX4A 5FWDA 3FPJA 4RTQA 4KDRA 3GWZA 3DLCA 4M7RA 3TKAA 3BGVA 3FUWA 2JG3A 3EVAA 2OO3A 5IKMA 1O54A 3ID6C 3KR1A 3P71T 3R3HA 2HNKA 4OBWA 4ZTBA 4R8RA 3OCJA 1F3LA 5D1HA 2YTZA 4WVLA 4DM3A 4QDKA 2ZSUA 3G8AA 3LBYA 2PJDA 2QRVB 3EGEA 3NDIA 4C04A 3K6RA 4QQKA 2Y1XA 5EOVA 4GOMD 3FUUA 3AXTA 2PX8A 3HP7A 3THRA 2B9EA 4QPNA 2BR3A 4YMGA 2ONYA 4R05A 1M6EX 4CTJA 4RTNA 2AOXA 4MHTA 5FQNA 4RTSA 3BGDA 3P8ZA 2AOTB 4ER5A 1NV8A 1KYZA 3AY0A 5GWXA 3DXXA 1NW8A 3KR2A 1RI5A 2PKWA 4FT4A 5DRTA 5FCDA 4EKIA 3SM3A 3UJAA 4E2YA 4EKGA 5BW4A 2K4MA 1NE2A 1QZZA 3DMHA 3HVHA 2OB1A 3KPVA 5EMLA 2NNWB 2PX5A 1JQ3A 5EPEA 1YUBA 4YUXA 5HFJA 2VP3A 3UJDA 3IHTA 1U2ZA 3FUTA 4Y2HA 5K0BA 1SQFA 1TW2A 1Z3CA 2XVAA 2ZIFA 1VQ1A 3DULA 5LQUA 5LQCA 4RTLA 2YXLA 4K6MA 2CMHA 2F8LA 2ZBRA 3FUVA 3GRRA 2AZTA 2NYUA 3LBFA 4L7VA 4RTRA 1X1AA 3DXYA 5C9ZA 3GIWA 5BP7A 3HVJA 3MCTA 4X60A 5P8WA 5KS2A 1DL5A 2IFTA 2ZZKA 3CVOA 4FSDA 2ZZNA 4C07A 5G02A 5F2NA 2EFJA 4F85A 2PT9A 4IV8A 5BW5A 5HIIA 2EG5A 3CKKA 2FRXA 1XXLA 4E30A 1KPGA 3M33A 4PYQA 3NTVA 5FADA 2JHCA 2ZIGA 4KIFA 4C06A 2H11A 1YZHA 5GIPE 1AV6A 1ZHFA 2PV0A 1NW5A 1R8XA 1YB2A 5E8RA 1WZNA 2VDVE 2AVDA 5DM0A 4UOEA 2BR5A 5M5BA 2HWKA 3TM4A 4RVHA 3LDGA 1JSXA 1WXWA 4A6EA 3BGIA 4KW7A 3EGVA 4BP3A 3ORHA 3KHKA 3OFKA 4KVZA 5EHIA 4CWAA 3P9IA 4EQZA 4BY9E 3PFGA 3LSTA 1KR5A 3R6TA 4MQ4A 5CVVA 2GS9A 3IYLW 3UBTA 2DULA 2NXJA 1ZGJA 2VZ9A 1IY9A 2P7IA 1QYRA 3LL7A 2H00A 3OU6A 4X1OA 2OPBA 5DSXA 3FRHA 1EG2A 3CBGA 3PB3A 4JXJA 1ORIA 5T6BA 4M37A 5CCXA 3HCEA 3WSTA 1KPHA 3HCFA 3EVGA 1XCLA 5FHRA 4GBED 1EAMA 5E8JA 2OB2A 3G2OA 3M6XA 3ELYA 4R6XA 3SGLA 3SVZA 7MHTA 4RWZA 2JH9A 5EKUA 5FQOA 3NJRA 4CKCA 5EVJA 5T67A 4YV2A 2C7QA 5K01A 4E31A 3CGGA 2G1PA 3ELWA 4PCAA 3BWBA 1JSZA 2ZULA 4BLUA 3KQOA 3OU7A 1KP9A 1N7JA 1ZQ9A 5DTMA 2HTEA 3PX3A 3UZUA 3OZTA 3EMDA 3A7EA 2BM9A 3AXSA 3PVCA 4GC9A 1KPIA 3AWIA 3LDFA 5EQJB 5GOZA 5EKXA 1G8SA 2O07A 5E2BA 3EEOA 2Z6UA 2XBMA 4YUVA 3TPZA 3E8SA 4BLWA 2V7EA 5LQNA 1EJ0A 3GXOA 4GOOD 2B2CA 1XTPA 1FP2A 2YXEA 4WXHA 4HTFA 4CKBA 4HH4A 1P39A 3C0KA 3G2MA 1ZG3A 1Q0TA 5D1NA 4EMSA 4RVDA 1UIRA 4FR0A 1ZGAA 4EK9A 3G89A 4FT2A 3SSMA 4V0QA 2Z6AA 1R6AA 3EPPA 4PIMA 4XUDA 3BUSA 5GIOE 4FP9A 2CKDA 1EQAA 2PVCA 3A7DA 1R74A 2I6GA 3E05A 1UFKA 3JWJA 4LWPA 4RVFA 3LCVB 1NW3A 4PINA 3KPJA 4HG2A 2AR0A 3C3PA 2XYVA 1NW6A 1VP3A 1RI2A 3EVCA 3MCZA 5DM2A 1SKMA 2PLWA 2ONZA 4PONA 2P40A 3REOA 5EMMA 3SXJA 4YUZA 3KQWA 5ICFA 3M6WA 2ADMA 5LQKA 1VP9A 4ISCA 3EVEA 4YUYA 1YF3A 2A14A 5DTQA 3PX2A 5EC8A 2P1DA 2BH2A 3L8DA 5C1IA 3DR5A 1PRYA 2FK8A 2P7HA 5DM4A 2IH2A 3DLIA 4P7FA 3KQYA 1KYWA 4OQDA 4PNEA 2OXTA 4FGZA 3PT9A 2B3TA 3HCBA 4GC5A 4P7JA 4PYKA 5E9WA 3BWMA 1XJ5A 2B78A 1L1EA 3I58A 1YFJA 3HM2A 1QAQA 3FTCA 3KQQA 2YR0A 2NP7A 3V8VA 4XCXA 5K0JA 4NECA 4AZTA 4C08A 3OZRA 4FZVA 5HIJA 2G8NA 3DTNA 3SSNA 4OX9Y 1L3IA 3MB5A 4AZVA 4DA4A 1D2HA 3LKZA 3DMFA 3S68A 3MERA 3TR6A 3EVFA 4GQBA 3E7PA 2ZWVA 2CWWA 2H1RA 3B3FA 4OA5A 3UJ7A 1RJEA 4E32A 3MAGA 1AQIA 3BT7A 1XDZA 3MQ2A 3KQTA 2OY0A 3P9NA 1I9GA 3HEMA 4QPPA 5CVUA 3MGGA 5IH3A 2PGXA 2IBSA 4OA8A 5BXYA 1IXKA 2I62A 4R8SA 4QDJA 2AOUA 3PTAA 3GO4A 4ATNA 1V39A 3IEIA 1DUSA 3HVKA 1NW7A 3QOWA 5K09A 1FJXA 3PLAE 2GPYA 4X61A 3UWPA 2QYOA 1BKYA 3DH0A 3FZGA 2EJUA 2YX1A 3LHDA 3P2IA 5DM1A 5DSTA 5FUBA 2V74B 3V97A 1OR8A 2WA2A 5K0EA 1BC5A 1JG3A 1H1DA 5CCBA 4QVKA 3T0IA 1P1BA 1BHJA 2IBTA 1L3BA 1EJ6A 2EJTA 2GH1A 3VC1A 1TW3A 2GAFA 5CUQA 1X19A 4P58A 1JR4A 5H02A 5DRYA 3KR0A 3UA3A 3P9CA 3EVZA 3T7TA 5LQAA 2IH5A 3O4FA 3GRUA 5E2AA 1N2XA 5E1DA 1M6YA 1R00A 2IDKA 4F84A 3LECA 3SR4A 3FPGA 3U81A 1QAOA 4B17A 3VC2A 1O9HA 1Q0SA 2ESRA 2FCAA 3GCZA 3I53A 3OPNA 4MIKA 4MTLA 4X63A 1VE3A 4RTKA 5EIWA 3M4XA 5EIFA 5K8VA 2AOWA 3B3JA 2PXCA 1SUSA 4DCMA 2IP2A 4XUCA 4BLVA 4RTMA 1B42A 1ORHA 2E5WA 2UYQA 4IWNA 3GJYA 3SX0A 4PCLA 3A27A 2C7OA 3P9KA 3CJTA 3T7SA 2IH4A 5EEGA 2IDJA 2FPOA 2PY6A 3G5TA 1JTFA 2ZW9A 1JTEA 2G71A 2PWPA 3LCUA 4P7KA 4LECA 2JJQA 4E2ZA 3QOXA 4YMHA 3RW9A 2YVLA 5JUWA 2G70A 3JWIA 3KQVA 4CKEA 3CJQA 4ER7A 1NBIA 2NXNA 4PYIA 1KHHA 3C6MA 4DMGA 4HTFB 4HGYA 1Y8CA 3GRVA 4QQNA 1RJDA 3FPHA 4R6WA 4ER3A 2DPMA 2O06A 4QTUB 5DX1A 3KR9A 3EVDA 2ZIEA 3P2EA 2BZGA 5EZSA 4OQEA 3UJ8A 3NVKI 3G2QA 2GLUA 3SMQA 5K0CA 2UYHA 1KIAA 3EEYA 8MHTA 2JH8A 3DP7A 3NW9A 4HC4A 5ICEA 2YXDA 1FBNA 5MHTA 4A6DA 4KWCA 1MJFA 4H0NA 4AZWA 2OYRA 2ZWAA 2QE6A 3PFHA 4V0RA 4M36A 2PWYA 3BZBA 5CM2Z 1WXXA 4O29A 5K0LA 1M0EA 1X1CA 2NP6A 1EIZA 2PT6A 2XYQA 2O0LA 3HVIA 5KVAA 3BKXA 3LKDA 2CMGA 2YUIA 2VDWA 3G88A 3P97A 4YUWA 3UJ6A 4P7GA 4GUAA 1JG2A 2P41A 1X1DA 3GNLA 5JR3A 2AN4A 5K03A 5DT2A 1FP1D 5ICCA 3MHTA 2GB4A 3EGIA 4RTPA 1D2CA 4PYLA 2ZFUA 4E70A 2C7RA 4RTOA 3FTFA 1RI1A 1RJGA 2PXXA 3GRYA 3KQMA 4GOND 1R18A 5DPMA 2PBFA 2P3LA 1HNNA 3X0DA
chains in the Genus database with same CATH superfamily
2VOJA 4OJKA 1NQVA 3VVCA 4DUYB 1MW8X 1A9SA 2RHTA 3PTZA 4HADA 2C7GA 3OE5A 4IIJA 3RK4A 1SVLA 1PLJA 3PXBA 1TKAA 2ASEA 4NESA 4R9VA 3Q8WA 2D0IA 3DHVA 4LK3A 1ZCFA 1G5PA 3FTDA 1BS1A 5KX5B 2PZBA 3TW8A 5M2QA 1WJGA 1M66A 2Z08A 2HXSA 3IDSA 4WOPA 2DBZA 1O58A 4CN8A 2ZUFA 3IVMA 1DJMA 3EN0A 1OD6A 4JBGA 2WHRA 3KB1A 1ZKDA 1ZWLA 4I7EA 3ROEA 3OEHD 8OHMA 4PSKA 3AUYA 3X1WA 4D0SA 3JQBC 1B41A 1L8LA 4JKOA 1DOHA 4UC0A 5LB4A 1V8FA 2EKLA 4DJDC 2JL1A 5T7BA 3AVTA 1SG9A 3FKJA 5A06A 2WHPA 1M1ZA 4DM4A 2XKKA 1YS1X 2DSTA 2QD5A 1MQ9A 1RWNA 4A15A 5CJ2A 1A5SB 3PE4A 4G0MA 2CD9A 5EEHA 2V96A 3HUDA 521PA 1O9BA 5IMBA 3TM5A 5IASA 3AEUB 2JF0A 3PGXA 2G9NA 2Z8ZA 5KKAA 1U0BB 1MO4A 4BFZA 3UAYA 1PR5A 2I4OA 2Z2IA 5LA6A 1SUEA 4OBXA 4OHFA 4F9EA 5B7GA 3THYB 3NEJA 1EZ1A 4KCGA 1VCNA 3CEMA 3LOQA 4OQZA 3U7QB 2R8ZA 1FYEA 4QZVA 1E99A 5FBLB 2MOKA 2XQGA 4PPGA 1DDIA 1E1YA 3R41A 1R8YA 3FGPA 4C2BA 3PIRA 4J16A 1QYCA 4QUHA 4AD8A 3ZYCA 4MUEA 3RI3A 3D0QA 5LWHA 2E4XA 4UVGA 2Y1LA 3U3RA 1VG9B 3KTOA 3OOEA 3OCUA 4HQOA 4JFAA 4RZUA 4DLBA 4OP1A 5CIWA 3AEZA 3GMDA 3CZRA 1XRQA 4PCVA 4A0QA 3ZS8A 5GM2A 1UJ6A 2BH2A 1XDGA 3UOGA 1K8ZB 3L1IA 3ZNOA 5JFGA 1LSJA 1VL5A 5FULA 3AC0A 2ATIA 3DE0X 2YOFA 3FPEA 3QELA 2XZLA 3PS9A 3ZJ5A 2QPLA 1VKZA 4F3YA 5SY4A 5B12A 1Y7IA 4MLCA 5FA8A 3ZX5A 1A9ZA 3C3KA 1B0ZA 1X1BA 4ZXFA 2QLLA 3FCYA 2VN8A 5F76A 2H31A 1P18A 3EWNA 4A2QA 2VNAA 2F43B 1E7SA 3B1XA 1D2MA 2W2XA 4JBYA 1C3JA 4XFKA 5G53C 5HX7A 2ZZMA 3ZGYA 4BO1A 2P8JA 2Q41A 3A6ZA 4A2WA 1Y1SA 3FF4A 4X6UA 3WGIA 1H6CA 3C4QA 2Z9BA 5DXJA 3B38A 4FNGA 2HRQA 2QTCA 3C3YA 3FVRA 5F98A 1NHGA 2AVNA 3I1IA 4QXAA 2P4SA 1KJWA 1PJ3A 2NVBA 1TF5A 3DCYA 4W7HA 5BYKA 2C7PA 1VDMA 2EKZA 2XV1A 3TNYA 2M6SA 4F5DA 3OQMA 4C2UA 4C4YA 4FILA 4BMSA 1LLUA 1Q17A 4PRLA 2DECA 4M6WB 5H3HA 3WI7A 4RESA 4EZEA 3BH0A 5FWAA 1U7DA 3G7UA 1RYMA 3H5LA 3KQUA 2E55A 4DHEA 2P62A 2QY6A 3EQ9A 5LBUA 4AC9A 4EY6A 2AJCA 1DUVG 2M9MA 3Q87B 5KCZA 1VFNA 4GEGA 4O1MA 1B3BA 1E3JA 3PUIA 3LQ4A 1WS6A 2D1QA 3WYAA 1Y7PA 4EYSA 4WOKA 4JJEA 1G0NA 3TO5A 5HIKA 4EY8A 1XD2B 2ZAMA 5P21A 3EZ6A 3UHOA 3WNCA 4UHJA 2A1UA 3VDQA 1PK7A 5KTPA 2AKAB 4QGHA 4ZO7A 3ZTYA 4EF5A 1RM4A 4C6TB 4QLAA 2Q5HA 1GPMA 3A25A 1ZGGA 4YXWD 3D7NA 2NNLD 3VOSA 5AH0A 4DIKA 1AT1A 3ONDA 1ZFNA 3T9DA 4GP7A 3WBKA 2FHPA 4B82A 1SXJE 4GL4A 3IPAA 3AETB 4UNNA 2R3SA 3Q3JB 1V3QE 4DA7A 4DPLA 5K20A 4QM6A 5ALQA 1P0IA 5BSMA 3WHPA 2IIPA 4TV9F 3MJ4A 1EFDN 4AQYB 2PZ8A 1OPRA 3FYUC 2MSDB 3PDCA 2CMKA 5IAGA 4C21A 2VCEA 1E79D 3C6BA 2RB4A 3G3EA 5CTJA 5FP0A 2XSZD 2DR3A 3GUUA 1GDDA 3GNQA 3JARB 3H9CA 4KQFA 5DO9A 5IPFA 3DDUA 4KR9A 3NALA 2PZJA 3WJ2A 1I2AA 2XNKA 3MTJA 2O8CA 3PFWO 3DLPX 3UT6A 1WQ1R 1NVXQ 4LNUA 1HFWA 4UTPA 4Q4HB 2EYQA 1UZUA 1EQ2A 4V38A 2MYPA 4AKGA 4B81A 3K9FC 3D6UA 3FPKA 4MUAA 3V7FA 2QSJA 1DSSG 4NYIQ 1C14A 3FUWA 3MWFA 3ZKWB 1QQ6A 3GUVA 5IKMA 2PA0A 1KXJA 1TZKA 3R3HA 4HGNA 4S04A 4RPCA 5F33A 4X1IB 2IDZA 4UEWA 4I4TF 1X86B 5KWVA 2E4UA 2ZJ1A 4J7CA 1BCSB 3GLIA 5JJIA 2Q4DA 3AXTA 5DCWA 3SIPA 5JNWA 4QASA 1DZIA 4MWGA 1ZESA 1UKYA 2ZS9A 4GECA 2ZYGA 4HLQB 4LXHA 5AJHA 4UXJA 3U3DA 4AG3A 4IIDA 4ER5A 1YJBA 3EDQA 3LC1O 3UGKA 1ZNQO 5DBGA 3P9QA 4D9JA 4TSFA 3ZDDA 1JR3D 1NF3A 2K4MA 1OV6A 2UXDB 4FUQA 5KQLA 4B7UA 2GNAA 5JROA 2JVIA 4G2TA 2EVWX 4TKVB 4AYTA 2ZYVX 3K6KA 3RSZA 1XMIA 4GX2A 3WL6A 1T9CA 3DULA 3C8MA 3B5EA 4MV6A 4G9BA 5HTKA 3RYFB 3ZY4A 3OC6A 4K9PA 4JXXA 2YXLA 1E8MA 2Z43A 3GLHE 4LYGA 4MDHA 4QKQA 3WLOA 2AZTA 2WU0A 4RTRA 1M8PA 1G1AA 4X3PA 4I3HA 2WYIA 2P68A 1F3OA 1GFZA 1C9MA 2AMYA 3CN7A 3HDHA 4LYDA 3LLCA 5P8WA 5TEWA 2B92A 2XMPA 4LJAA 1H6DA 2ZZNA 1NUQA 1P44A 3KVNA 2H1IA 4X7BA 3HV0A 2HIAA 4QJBA 5ECGC 5A3QA 1RPZA 3NWPA 4L5CA 4X84A 2J08A 4XQ0A 3R7WB 2IEAA 3SZLA 4M0UA 4BX8A 1U2PA 3OOWA 2Z09A 1AZLA 3TJRA 4UNIA 3Q2OA 4D98A 4G8CA 3RJ5A 3FYTA 5DM0A 4ZJPA 3LKBA 3RROA 2Y0EA 4IVNA 5EE3A 2HK9A 2CVPA 2EKBA 2X1LA 3E9QA 4KQXA 3ZQUA 4URXR 1UOPA 1O1YA 3O0DA 3PFGA 3LSTA 1KR5A 4GPBA 5HF5A 3H3XA 3BSYA 1GGKA 2NTYC 2AEFA 1YFZA 2X9QA 2XRFA 4NKRA 4P08A 2GPAA 2O4CA 4XWGA 4Y6RA 1VHWA 5CH3A 3ADOA 2OGTA 4HH3C 4TV9A 4OXYA 1W36B 4KDEA 1IONA 3LZCA 3OU6A 5JS6A 3A1NA 2AI3A 4BNDA 2RGXA 1MJNA 3QU7A 1ORIA 2Q5OA 1DUIA 1KEKA 3IA7A 1S2GA 3AIIA 2IXEA 3H9EO 3PWKA 5FOUA 4YJ3F 4EM6A 4GE3A 4LMRA 3EY4A 1OTXA 4NBVA 4JB8A 1U2GA 1Z2NX 4ONEA 7REQB 5E9AA 3HK2A 2JAPA 1FF9A 3FFBA 2W8ZA 5HBGA 4IRMA 1DJOA 1M2VA 4NG5A 4FWBA 3WFIA 1Y1LA 1IEVA 3RKUA 1T4CA 2VDLB 4CR6A 1JEOA 4G24A 4C4OA 1OH7A 5JD6A 1V1MB 4KBFA 1JVSA 1DP4A 3T4XA 4ZOLB 5DP1A 4ARIA 1SHJA 4YAGA 5DTMA 4OK5A 1E2LA 1ZH0A 2C8KA 2SICE 1GGVA 2B2NA 3CLTC 3DO6A 3M81A 1D9XA 3PNQA 4I5IA 4IZ6A 4L85A 4UU0A 3GPDG 5AW0A 2NYAA 2JJMA 3M8KA 4CDMA 2OGSA 2OV6A 1NSFA 1WDLA 3A2LA 1WW2A 3H9JA 4WZBB 4IEIA 2ES4A 2GD6A 1GPWB 5HQ3B 3PJFA 1EUQA 3DEAA 2ZK7A 3A6KA 3DMRA 4FEAA 3KVRA 5C5DA 3QVTA 2XRZA 4B87A 2CHUA 2E6KA 1Y7LA 2QR2A 4OHVA 1W94A 1E1MA 1ZG3A 2BZSA 4JL6A 4MEBA 1RWPA 1UIRA 4EK9A 1HDEA 4CMIA 4D44A 3WDLA 2P2LA 1BXRB 4ZYUA 3BTOA 1HE3A 1SHZA 3N87A 5AVVA 3BUSA 1HDYA 4BZQA 5K3DA 2X5OA 3MTDA 3W8NA 3OHMA 4DLVA 1THTA 2ZSDA 3Q11A 1U98A 5B2ZA 3KEMA 1ZL0A 4X91A 4CLRA 3F98A 3GFBA 2VPPA 5F4BA 2FEMA 1G3UA 1JPJA 1VI6A 3PFIA 1VLJA 4BV8A 5IJZA 4OMDA 4NYMQ 5IM4F 1QHFA 2HJGA 4YAEA 1CF2O 5KMGA 1M8GA 2VF7A 1DX9A 4YREA 2GLTA 3KWJA 4BQIA 5L6MB 1BWPA 2JGIA 3EGWA 4D4HA 2C2ZA 3COPA 3OFSA 4G5HA 5ITSA 2J5RA 4AP9A 2AIRA 1GGHA 5FPYA 1RXVA 2BH9A 1OW3B 2OXCA 2OXTA 4QFDA 1JZTA 4LE0A 2IEIA 3KLMX 3HCBA 4GC5A 1Z6ZA 3RS4A 2GEDA 1PUJA 1G7CA 4MWSA 1U2DA 5D3ZA 5EWLA 5JEEA 2RIRA 3U5TA 3B20A 4X20A 2HADA 3BORA 5CB4B 2DX7A 4KG7A 4OGFA 3X43A 1VHQA 2W9XA 4L8VA 3V8VA 5BV8A 2QVGA 4PFQA 2BRUC 1GTRA 2P2CA 3WV5A 3M1LA 4CU5A 3ZY2A 3BQMB 4FZVA 3H4VA 4ON9A 5ELLA 1SQ6A 1YI8A 3R7NA 2K7FA 4XX0A 3ZI4A 1ZSNA 1I3MA 3EC1A 1H0KA 2PZGA 4JLDA 1RXEA 3R7FA 5JQGA 1J0CA 1OWNA 1A9QA 3DAPA 3LT0A 2QV0A 2ZWVA 3EZ7A 2DH6A 3I12A 4J91A 4TLEA 2GEFA 1TEXA 3LIPA 3GJ8A 1FJHA 1PJTA 4H4EA 2BELA 4X45A 2AG6A 4EP1A 5F7XA 1YJAA 4NHOA 4YJ3A 3HKDB 4V0SA 1XHLA 3D7MA 4HGQA 4KXWA 1SVWA 1YDMA 3AP3A 5AI4A 2ONCA 1MOQA 4M0EA 5TX7A 1Q22A 2VHXA 4AKEA 3Q12A 1GUZA 3ANYB 4HEQA 4DEXA 2IPLA 3N5KA 4P4SA 1A9PA 1RRPA 3B6JA 3VPSA 3FSGD 1NBEA 4RHTA 3DL4A 5A0FA 2BEVB 2PIDA 2QIOA 4I14A 4YV7A 4TSKA 5BN3B 3E53A 1W76A 1KDTA 4FYYA 4J0JA 1ZKMA 4QT4A 3GAMA 1E9DA 3UWPA 5I8WA 1AXGA 1X7XA 2J9XB 1LSOA 2WIFA 4OSOA 3TUIC 1YRQA 2WA2A 3T1NA 3WMXA 4QVKA 1GNSA 3S2YA 4DT1A 4YB8A 2VXCA 4Q3BA 4IWYA 2UUAB 1DMRA 1E5TA 2IJGX 2IZOA 2KMLA 2QAGC 1UBNA 2Q8NA 2R7MA 3JYQA 4RS3A 2QE7A 1HE2A 4X6LA 4D6XA 4PGMA 4EG0A 4M2LA 5KREA 1GXSB 4H7DA 3KETA 2ZRMA 4KXNA 1TAUA 5M7EA 1GNRA 5EIAA 3T0GA 5HE9A 2WHEA 1WV1A 4GHWA 1HURA 4P33A 4GNRA 4P98A 4DCPA 4NOKA 4LGVA 4W7SA 1DV1A 1EGHA 3FMIA 5FD8A 1QAOA 2OBMA 1T2NA 2RDMA 2XE4A 2Z8XA 3W05A 2OCPA 2QTGA 1J25A 2AMJA 3QRWA 1G3IA 3CV3A 4UM9D 5B6JA 2VRBA 3M4XA 4B3MB 1QBGA 3HYSA 1I5RA 1ULZA 4CKCB 2GCNA 5A04A 4RABA 2TMDA 2ZJ8A 2OBXA 1G2PA 2DQKA 2NPIA 5JO9A 5J4KA 1B42A 5IM4A 2UYQA 4IWNA 3GLUA 4MLDA 2ZUWA 5HZHA 1XZCA 4FIZA 2MT9A 4DUGA 5C8YB 2JFQA 2IDJA 2OZLA 3HH8A 5LB2A 2ZW9A 2CLEB 2OFXA 3Q0EA 5HIAA 5JZOA 1AK9A 1Z6PA 2HK8A 3ZZUA 3PEUA 4NBLA 4QUGA 2CDCA 3K53A 3SKVA 2BTQB 3CJQA 3SVLA 1HFKA 5FFMA 2Q9UA 2COEA 4LZJA 5A9RA 2R6FA 4KXMA 2NT4A 3SMVA 1H66A 4L6IA 4N49A 2JCVA 3OC0A 1LWNA 4PAOA 4LHYA 3NJ8A 4LX0A 4ZI5A 3M7IA 5C53B 1MU0A 1ISFA 1E1QD 2IOFK 1ADYA 2O3UA 4PPNA 3SBOA 2G1AA 3TZBA 1DQNA 4KO3S 1I2CA 7MDHA 5EUQB 2PUDA 4NONA 1SAYA 5CHYA 4KVAA 2AN1A 2VC2B 4WVFA 1U1IA 4BKQA 2H18A 1MJFA 2JFBA 3ZVKA 1L8XA 3RAJA 3PLRA 3E15A 4BBPA 3C14C 1BMFA 3BILA 2PWYA 3KNZA 2WTEA 4O29A 3LY9A 1YBMA 3SR3A 2PT6A 5BNZA 4EFDA 1GG2A 3U80A 3WAGA 3FYHA 3OY2A 1TFRA 3WIUA 1XRSB 1Z6GA 3H4MA 3U44A 3RU7A 1P61B 2ZJ3A 1JG2A 3PRKE 3S28A 2J0UA 3ZX4A 4X66B 4WADA 3MHTA 1U1CA 1U9JA 4QD3A 1B2RA 4E70A 2PAAA 4LZZA 4MUIA 4NQRA 1OU0A 5IDXA 4KWIA 3AM5A 2I67A 5IVIA 2IHTA 3WLEA 4CIDA 3QLVC 4Y7DA 2G1KA 1KTVA 2E4WA 4H7HA 1XDUA 2JAWA 4GPZA 4MPDA 5KSPA 3S7ZA 4A0HA 4BO2A 5KBYA 1MABB 1AMOA 2I80A 3EGXA 4S1VA 2BBOA 2NUAA 3BE6A 3ML1A 2DWOA 1FDWA 4ZO9A 4MROA 2DWUA 1OAAA 3KUCA 3NT2A 2AF4C 1F8XA 2D5LA 2HU7A 4ASUA 2V1UA 1DO8A 3T9BA 1NVAA 1Z34A 2VWGA 5CPBA 2Q45A 4IOJA 3ZZ0A 4QELA 5JYEA 2LGJA 3EGOA 3MZ0A 4U7PB 1CY6A 4YEDA 1ULHA 3DDHA 4QU8A 5DX0A 2JRLA 2IIBA 1M1XB 5H68A 3K96A 2I87A 2NQ8A 1QE3A 4UEOA 3G2IA 2NXCA 1SY7A 2QM3A 2WD7A 3B3QA 3DJYA 3IMFA 1GAQA 1Z8HA 5JAUA 4EI7A 2X4DA 5LYYA 5F1YA 1R4AA 2DT8A 1G5FA 3T7EA 2VJCA 1ZNZA 2RE8A 1NBMD 4LISA 5EZYA 3INYA 1IEQA 5K7SA 1HQCA 1GM5A 1FNBA 3KXIA 1RBYA 3QY9A 4HAIA 1CUJA 4UCQA 2YOHA 5EZ6B 3USZA 2IYZA 1C3OA 2NAFA 2FR1A 1W1UA 2QR5A 3ZK9A 2XBLA 5LLSA 2QS9A 3WIVA 3JSXA 4EZBA 2X5NA 3GLFA 3FLAA 4AJ9A 1WX1A 1L9KA 3GBPA 1QPZA 1Q83A 3HP4A 1B6TA 1V16A 3LT1A 3OCVA 3QLJA 1XB2A 1NP6A 1XVVA 2I29A 3CH4B 4HVTA 4LSGA 4TVOA 2RHCA 3I1JA 4QU0A 5BSUA 4I0WB 5REQA 1VL0A 5K0NA 1SXQA 4HLUA 3VTFA 3K9QO 3D5QA 4N03A 3I2HA 3U4IA 4MA5A 1UWLA 2GA9A 5CYGA 2UYGA 2I65A 3HKCA 2QMQA 1UQUA 3LIIA 3EUAA 1PR1A 2IT1A 2OD9A 3GGCA 1VKHA 1QFZA 1XVAA 3KPUA 2L18A 3HI4A 1EYZA 1VGQA 2A8YA 1ZS9A 4O4HB 5ALEA 1EDDA 2GZRA 4ESVA 3D6VA 1DJPA 1GYQA 4GM0A 5TARA 1N2IA 1K89A 4HQNA 1Q57A 4DANA 4UOZA 4D4GA 4DLKA 4NENB 4QTTB 4OQNA 1GRQA 4LG1A 5FL7D 1B16A 1PJZA 3I39X 5ADVA 1TA4A 2P9EA 4G9GA 2FQQA 4ZO6A 5FORA 3ZPXA 3PUKA 4B8WA 4YV1A 5L4LA 1W48A 1OHHD 1QX3A 5HF8A 1GARA 4MW9A 4KTVE 1HDRA 5FOXA 3S8YA 4DLUA 3TSZA 1EGMB 1IEWA 2Q6KA 3DZFA 3D3WB 4PR3A 3A6DA 2E6UX 3AG6A 3KKEA 3SBDA 5EMJA 1BE8A 2JFZA 5A3VA 4WN9A 2LZ0A 1AS2A 4BBAA 5JAHA 3KEQA 1Y3BE 2X19A 1SA0B 4QQ8A 2M32A 1YUMA 4YBZA 3A2MA 1PBTA 3BQ9A 4TTAA 3HACA 4G97A 5AJWA 2XX3A 4HQ6A 2C94A 4HGPA 2FXVA 4E5VA 1SBHA 2PK3A 1EJBA 2O23A 3KRTA 3C7KA 5DNCA 3IEUA 1MGPA 3MUOA 3OE7D 1Y8ZA 3NHZA 4ND8B 4W6ZA 5TXGA 1QKKA 4Z7OB 8LDHA 3ADCA 5AKJA 1O57A 3SX2A 1OLOA 1A2KC 4NBRA 4NQZA 9MHTA 1AQUA 2GXSA 3QVXA 1UPFA 3E5MA 4PGAA 4WKNA 2CC2A 3VYUB 2JVKA 4YJFB 3S7TA 3EZYA 3U19A 5KYGA 4RQAA 1BD3A 4K6CA 4Q34A 4M89A 3A31A 1LNQA 1L3CA 1Z07A 4U7HA 4E11A 1DCKA 1VCHA 3RS7A 2AFHE 2H8KA 1O0SA 2C2MA 4KU4A 5CIYA 4F96A 5DYGA 1DIRA 1M5TA 1FFAA 1DCTA 3TTSA 5AW1A 2WJGA 1U94A 2VDWB 3GVIA 3TGWA 3DV0B 1YS9A 3KWMA 4MKGA 3T3PB 4ER6A 1DRWA 2P0AA 3FJOA 4PZCA 3QWHA 2QTTA 4JQZA 3GA7A 1YH3A 3UMBA 2BGMA 2R00C 1U8AA 3UHJA 1USKA 4HRAA 4BNJA 5DU2A 1Q77A 4OQLA 2PUEA 4LHWA 5CURA 1UJ5A 2QD3A 2UZAA 4V03A 2Z2YA 1UMDB 1IUOA 1L5ZA 2GTPA 4HEA1 5AHRA 1O94A 3EARA 5LKAA 1A7JA 4QOGA 4KDFA 1E2IA 4QBHA 1ULTA 3DT9A 4GT1A 4J0QA 1H2AS 2L17A 3HY4A 4O4LF 1Z82A 2C3UA 4ETMA 2VUTA 4G0NA 5G40A 3E2PA 5HWSA 4MRSA 2F4VB 2C3OA 2I91A 3O4HA 3BREA 4NS1A 1SBQA 2QZSA 4OYHA 4P2GA 1KQGA 1OU4A 1YGPA 2GR9A 5GJBA 1CUBA 4G5YA 2DSNA 1E2PA 2ZI4A 3GYGA 2PX4A 1WXGA 3L6BA 3FPJA 4MV4A 4OP3A 5DULA 1IHDA 2AK3A 2O2XA 2FVXA 1PF7E 4ALKA 3BWXA 1P8JA 1R0LA 3V7WA 2MYTA 4MKZA 4PC7A 5HKKA 4OU4A 4DM3A 3L4BA 2GASA 2VSNA 3AUFA 4G0YA 1V25A 3LBYA 4AK9A 3AHCA 1E2QA 5AKEA 5AM3A 5HS4A 4GSKA 1FPMA 4KVFA 2YKGA 4GOMD 3FUUA 4E6EA 3C8HA 3COSA 5ALUA 3WMGA 1ORTA 3JQGA 2C3YA 4MVJA 1MFZA 3P8ZA 1GCAA 1Y9ZA 3C6QA 3OEYA 4TTRA 4ZAWA 3RAGA 3AY0A 3OURA 2PUVA 4CIXA 4EKIA 2BI7A 3KOMA 4TQ9A 5CX1B 5FPTA 4KE9A 3UJAA 2WB4A 4JD5A 2IYTA 3VHRA 3ZGXA 4BBJA 1S3SA 4EELA 1NKTA 1AKWA 1LGYA 5FPSA 2OWEA 3E7WA 4Z0TA 3ZLVA 2BCJQ 1WLYA 2BEJA 4DLXA 3ZGVA 3BWEA 2C2WA 2ISQA 3HUTA 4IGEA 3EGDA 1FDTA 5TSDA 3WLNA 4ZJUA 3LOPA 4IFBA 5AJYA 1YDGA 5D5QA 1M6HA 3EISA 2ZRAA 2RBKA 4Q15A 4AKTA 4BTEA 1NMQA 4ECEA 1GL3A 1VJRA 1TUIA 4LRXA 2IV3A 3VUEA 3AM1A 3WJAA 1Z0SA 2B99A 4YJHB 1KP2A 4U6NA 2CSUA 2ZZKA 4KAAA 1XQWA 3WQBA 2XLCA 4X7RA 2XMCA 4GFDA 4LJ7A 4CLHA 3C45A 3EXAA 4FYKA 3PNPA 3NHKA 5D7BA 4G09A 1X1SA 4D8WA 2VKTA 4E30A 1KPGA 4BX0A 4PYQA 4QNNA 5H80A 4QOJA 3HBMA 3AUSA 1E5XA 4WKOA 2AYZA 3FMFA 3NPAA 3GLGB 4OJYA 2QM7A 8ABPA 1E69A 4LF4B 2HY7A 3CGWA 2MINB 2FR0A 3PGA1 4KVZA 3D3QA 2XNDA 3PQFA 3ZE7A 4CLOA 4G5QA 2HUPA 3DPUA 4H1WA 2Q27A 4RKQA 3DYIA 4FYVA 1S96A 2GLXA 3SHFA 3J81k 1UR5A 3ABQB 1FUYB 1PLKA 1QYRA 3BMXA 2JEOA 1H0HA 4MVXA 2REQA 3D31A 1Q5PA 3QFHA 5AW6A 4X1OA 2OGZA 1J2TA 1SO8A 5DSXA 2J4CA 3K6SB 2NO1A 3CX8A 1P0MA 1SC4A 1EUYA 5CDHA 3SSAA 2AW5A 2PL3A 2OGWA 2ZRLA 2OB2A 3B1VA 1NP3A 5LZ8A 3M6IA 1W2GA 5FQOA 3GMIA 5TQJA 3SHOA 2LPMA 3AKDA 3CZ5A 3LCMA 4NFSA 4RH1A 5D5PA 5ALOA 2DQSA 1WR8A 5I9NA 3A1WA 3OF5A 2HLHA 2PUCA 3ZI7A 4C0HA 5J4HA 3IP8A 4M46A 3W0LB 4B7XA 2EW2A 4D8YA 4BZPA 1ZQ9A 1Y1RA 3FLBA 4F2GA 1VBMA 3EMDA 4MYTA 3HRHA 3K0CA 4D9MA 4WZBE 1KJ8A 1P7VA 4L8WB 3M6MD 2VYFA 1L7EA 3BGOS 1RZUA 2YASA 4XD7A 1HM5A 2HPVA 1C30B 1RXYA 1ZGHA 2RHBA 2E21A 4ZHSA 2XUZA 1JDBC 1P9WA 1R15A 5LQNA 2C95A 1EJ0A 1MQSA 2A0FA 3ESDA 4LBYA 4UJ3A 3I42A 2IODA 4MW4A 1Z3IX 5CB0A 1V1RB 1H93A 1PD1A 2QTMA 5DI9A 3O47A 1O87A 1WDWB 2GHTA 3AGQA 3KYBA 4EMSA 1XTIA 1WY5A 1CFZA 1U8ZA 2OUIA 3KD3A 3LP8A 3VAAA 1BS2A 1E7QA 2PZLA 2Q3MA 3QUBA 1XCGB 3A6EA 3BJRA 2ODWA 2UVPA 3OKPA 5LP1A 3O3MB 1NI4A 5D01A 1CNMA 1GSHA 3A7DA 5JI2E 4XRRA 2I6GA 1NU8A 4LWPA 3OZWA 1EFVA 3IAXA 2NSHA 1GZ5A 3JAKA 4PINA 3LS2A 4XX1A 5KJ1A 4L4RA 3RFTA 1CR6A 4ESHA 5CXQA 2Q2WA 1ODTC 1CETA 3IOCA 4DIOA 1SH7A 1DXQA 2PLWA 1TLTA 1D09A 5ITWA 5IT5A 4IJ5A 3GD7A 2JFGA 2P40A 3E8XA 4TTTS 2FPGB 4TL6A 4EB6B 4LC1A 1JBKA 1TYEB 4FN4A 5IYZB 3S8EA 2OEPA 5IT4A 4Y6GB 5LFAA 3NRCA 1EWVA 4XIYA 4R1SA 1PZXA 3SQNA 2IA5A 2VZ8A 2IU6A 2W71A 3I0MA 5ALYA 3HCNA 3K31A 1NVGA 3SHWA 3FOEC 1R5BA 5IVKA 1R7RA 3G8CA 2MTBA 4NC9A 2ZQYA 3HYTA 4NCXA 4UM9B 1J9EA 4G5SA 1SVNA 4KJZA 3ZBPA 1OTYA 4AIRA 5F4ZA 3PKJA 4Z9BA 5B2EA 1HNZB 4B6QA 3V7UA 5HIJA 2YJGA 1TLLA 3GG2A 2Q4BA 3C3DA 3ITEA 3OZ7A 4BVAA 4OJQA 2QG6A 1SBZA 1OFUA 5FNVA 1JJVA 1OGJA 2RK3A 2XDWA 4O2LA 3ZW9A 3ESBA 1C1HA 4JLNA 4GMDA 4L07A 2M1ZA 1J56A 4KQ1A 4M9UA 4PYRA 2DRIA 3G1UA 3O4GA 1K4MA 2JI9A 3PJGA 4HQRA 2CV2A 3EDMA 3R6DA 1Q74A 1AM4D 2B6NA 4ZGWA 3MG9A 1G9SA 2GFQA 3OFNA 2WU4A 4KPGA 5JTUA 4WXEA 1C50A 1XNRB 5CVUA 2A6PA 3GX1A 3RV3A 7ADHA 5KTMA 4D3DA 2PSDA 2P77A 2QK4A 3BCSA 3MW8A 2PR7A 4ILKA 5IH7A 2EG9A 3NTQA 5BWMA 2D5IA 1OI3A 1JMVA 2PUTA 3WIBA 3I5MA 2XVZA 5ALZA 4F46A 1G20B 2VTBB 4RMJA 2I3DA 2J48A 2W2MA 2VPTA 2YZNA 1AURA 2EJUA 3G9XA 3OZUA 2QRHA 3P9XA 3QXSA 3V97A 4KPUA 2C3MA 2POCA 1KZ7B 2OHVA 2ZE5A 4LDRA 4PQGA 4ZOEA 1MD9A 2CF5A 2DF8A 1FS5A 3U48A 1NQUA 1CXZA 3FH0A 1TKRA 5KYXB 2PMKA 3ZLJA 2RG1A 1EBFA 3M4YA 2E2WA 1AKTA 2X6TA 2H5IA 5LUBA 3IPRA 4ALMA 2WYHA 3ZWQA 1KOJA 4CQNA 1YB1A 1DWQA 2HM7A 3E9CA 4QE3A 3N28A 1N2XA 3RVBA 4B48A 1U31A 5KVSA 1LPSA 3RNLA 3ZUGA 3A2KA 2FP3A 1A76A 2A88A 1P9NA 4DPMA 1KAEA 3HFJA 4EG7A 3IAFA 1FYWA 3QBEA 4CETA 4NL4H 1B93A 4KC0A 1I6LA 4DS3A 1YJQA 1WZIA 2PGDA 3RGWS 1SVMA 2YCBA 1VE3A 3E22B 4G84A 1Y9EA 2H6EA 1P1IA 3HU2A 1HYHA 1LTQA 5CBPA 5C1PA 3EDYA 4MR8A 3N0WA 3GLQA 2OORC 1ISJA 3T15A 3E2IA 5LL6P 3N8DA 3GUZA 3NP7A 4LKRA 3RS8A 5JSUA 4H3VA 3A3OA 5EUCA 3T95A 4BIIA 3MJTA 2CK3D 2O1SA 1PKXA 4N5LA 1XD8A 3GDGA 2PFKA 3EXIB 5EUMA 1JTEA 2G71A 4Z3OA 3SJCA 3ZDAA 4N5IX 2VJYA 3U1VA 4AMGA 4E2ZA 4AECA 1SCBA 4YHBA 1JQLB 4MPTA 5HFAA 2R68A 4PPFA 4D8UA 1H9AA 4RPHA 3NFYA 3NGMA 4NS4A 4BWYA 5DTIA 3BH7A 4HWOA 3L1HA 1OX4B 2QUKA 2WFLA 3IS3A 1E58A 1XQXA 4L9AA 1DI0A 4B45A 2NWQA 4CKBB 2FRVA 2RJNA 4ZC8A 4JUDX 3PR2B 1NUAA 3JZIA 1M34A 5IAKA 4QBFA 3E35A 5LU8A 3PR1A 1UXHA 3ILSA 2OD2A 5AICA 3RUHA 4ZK2A 4O8ZA 1LLFA 2PQ2A 4HNGA 1UBKS 3UUEA 2B1JA 4IFEA 4BPRA 3WGUA 4H3SA 3TPFA 1E1CA 1F2TA 3RS3A 2RONA 3ZDXB 1U5AA 1DOAA 4CM3A 4CIAA 3RC2A 4YRQA 2VAXA 1WXDA 1ICEA 5AM1A 5CM2Z 1M0EA 3CZAA 1J0AA 3QEJA 5K0LA 2HCJB 2HXGA 1FX1A 2ZITA 1MT3A 3C8UA 4R8VA 1A8HA 1YUNA 3BKXA 4TXNA 1H0SA 4DRXA 3V6MA 4AXBA 4BXOB 5E4JA 3I9V6 3HZZA 4PICA 2SECE 3GGJA 4Y3UA 2IKQA 1JNXX 3E9NA 1FU8A 2YN0A 3PGKA 1WB5A 4NCJA 2CXQA 1PBNA 1YASA 2MSKA 4B3RB 4KPEC 4AO6A 3R9XA 4U2KA 5HDBB 4QICA 5EHXA 3O8OB 2R1VB 3N07A 1M67A 1R18A 2PBFA 4RSHA 1T9KA 5EKDA 4OI0A 3AMVA 3F5FA 4WL0A 2P9CA 2ZBQA 3QV1A 3KT3A 4M38A 2Z57A 5K6RA 3H8WA 1TOAA 2O2CA 4BUZA 4PEVA 4JJ6A 4S1OA 2HD4A 3ETDA 3VNAA 2AKEA 3C3CA 3WX0A 4QWWA 1US8B 2O8EA 4N8DA 2IYEA 5HS6A 4MQFA 3SEFA 4P54A 4G89A 3ZHOA 1MP0A 2H1LA 2JCXA 1LSUA 5D7NA 4ER0A 2AXNA 3ESAA 3TX2A 3RRYA 2CXPA 3E23A 4HDMB 2REBA 3ETJA 4KDCA 3GFFA 2H17A 1N3YA 3VKHA 3AVUA 5IWAB 5AT1A 1P2DA 1WVIA 3K0AB 2A9OA 5A4IS 2GJ9A 2VO1A 4MJ7A 4EUKA 1S1MA 4QJ3A 4HWTA 4IWXA 5A03A 4Z4IA 4Q0MA 1KI1A 1Z47A 3CLSC 3O8CA 3AL2A 3KQKA 2CCGA 1IBCA 3D3NA 3I92A 4R7TA 5JSZB 1JFSA 4J94A 1JQDA 2OR3A 2AOUB 2G06A 4XWWA 2AD1A 1DJQA 1P1RA 1CPYA 5BN1A 2HI0A 2ATEA 2C7VA 2HQBA 4YA6A 1KARA 1AKRA 1HDXA 4RIFA 4ZP1A 2CDBA 1N32B 1XF1A 1NBWB 5NULA 5B1IA 1W47A 5K51A 4PF1A 3OTWA 3RRBA 4F72A 1REQA 1PLLA 3PRHA 4ZI7F 1E20A 1LPOA 3OZSA 3RWMB 1GJRA 2J59A 1XRLA 5IBQA 1ZJ6A 3PD0A 4FD3A 3O94A 3WLAA 2XQFA 3MWDB 4JP8A 4KJXA 3JD3A 1T91A 1EQUA 1U7ZA 2W2KB 2YDXA 1ECPA 1XZPA 3LW8A 5F7JA 1M3SA 1E3WB 3SNHA 4DVGA 2GCPA 2KLHA 3A3NA 1J0EA 5C0OE 2HBQA 3AOEA 3DXZA 3GEBA 2JPDA 5DGIA 5K3CA 4ARVA 1XCBA 4ICIA 1CUZA 4QT0A 3UWOA 1UJCA 4JLJA 2KE5A 3GGPA 1CRLA 4HZIA 2IVFA 3SDZA 4DWWA 2BM1A 1XPJA 3LXMA 2OHXA 1NBHA 2MR6A 1I6WA 4H0FA 4DEYA 5A6VA 1JDSA 2MSWA 1KWKA 4B4VA 3ICVA 3VSCA 4EECA 2FZLA 2Z5FA 4JITA 1F6BA 1YB4A 2R86A 3FE2A 4QGBA 3WFJA 4XJXA 1MHPA 4LYHA 3ESCA 1U11A 1TF2A 3GDHA 1HFJA 1WP4A 1ZPDA 2XCIA 3NX4A 3H5VA 4DILA 1XD9A 5JZ9A 4NCHA 1O6ZA 4Q9JA 4CHGA 4DADA 2P6RA 2XXAA 3R3SA 2DJIA 3EEIA 3NMUF 2F17A 3DOCA 1P1JA 1ZLYA 1KEWA 1KKLA 3PDIB 3OMWA 3OIGA 4MRNA 3DVRX 1A8SA 3K8ZA 4WUTA 1DBQA 1YC5A 3LA6A 5ESDA 4KHPB 1N2CA 2PKQP 5DCUA 5LOVF 1NV9A 4FEEA 1GUFA 3HB1A 4HDNB 4J76A 4R1LA 2GYVA 3ADBA 2I6XA 3PQ2A 3BHNA 1GDHA 1U5BA 2JFWA 4IVRA 3H19A 4I4NA 4P53A 3GNTA 1X7YB 4UUBA 3DSRA 3MRXA 4TUYF 4POOA 5JC8A 5LQMA 4C5BA 2X8WA 4C6HA 1RXWA 2AR7A 4KPYA 4JNCA 5DWVA 5LYJF 1HY3A 2VS1A 3B1WA 4M8SA 4TT3A 5JSQA 1JWLA 3UFBA 2Y66A 2C0PA 3FBTA 3GG9A 3I28A 4P35A 3TAHA 2R7AA 3NI2A 1ZRSA 4O2BF 2UYOA 1L0BA 3RODA 4F8EA 2Y1EA 3BZWA 3SQDA 1Z63A 2Y93A 2J6BA 2C5BA 2QUIA 3IHLA 5B57C 2O7SA 1ZD4A 1M74A 4ZO8A 3QX3A 5J2TF 1KVQA 3UUFA 2IHJA 4CLDA 1QRDA 1DPGA 2QE7D 5F2EA 4NPCA 1FYXA 5IN5A 4HWKA 3SY8A 1TEVA 5IS2A 3VJRA 3O4VA 2FUEA 2J1LA 4RA9B 3UEOA 3ZDFA 1XZ8A 4AUNA 2BSQA 4HKTA 2V7XA 4H7KA 4JI1B 3QE9Y 5HZKA 2VYVA 1SCKA 2ZUSA 5MN6A 1N2EA 5AHWA 1BAPA 1JBEA 1JJFA 1MB9A 2O7NA 4KLNA 4IIJB 1E0JA 1FFHA 1YJXA 3E9DA 3MM4A 4OKNA 1PZFA 1WB6A 3BWVA 1G17A 3CCFA 4G37A 2VDOB 3TW8B 4Y0AA 4BNHA 4ND5A 1IBRA 1QKIA 2CJFA 1VLZA 3WXBA 2H1FA 3JAWA 1MW9X 1WUYA 3AJDA 1SVIA 3L9XA 4N3AA 1H8EA 1P72A 1BW9B 3GELA 1MO6A 1P9OA 1UBGA 2B4AA 1OXMA 1E6KA 3Q15C 3ESXA 2W6OA 3I8OA 1K86A 2GUGA 4JOBA 3WLTA 1Z0ZA 2ZI7A 3KKNA 2ZBFA 3ND6A 4JZKA 1X1RA 1ZK4A 3KLPX 3UAXA 3WRYA 4B43A 4ID9A 4HEHA 4OY3A 4C4ZA 1O54A 3HJBA 1I0LA 2WHPB 1D8AA 2GAJA 1IY2A 1NDHA 2HU5A 2JJ2A 2KI5A 4KAFA 1KI2A 3D3EA 5F1PA 2DXIA 1BEZA 5FDFA 5H8WA 3JU3A 5AVJA 3HJTA 4KQ6A 3F49S 3GHHA 1C29B 2IYFA 1LPBB 3EEBA 1ZM4A 3X2SA 5LA6B 2P9TA 3LFHA 2C03A 3CR3C 4HYEA 1V6AA 3WWYA 4GLLA 5C52B 3RADC 3F3KA 4RH3A 1AY0A 3OQHA 3QNMA 3NBXX 4QEKA 1TVKA 3MT8A 4R1NA 3L6UA 1TE2A 4C3ZA 1W2HA 3HSKA 4NCIA 1R4NA 1H2WA 1XHEA 2RHDA 2F1HA 2NTJA 3QLTA 3AEQA 1T26A 3VA7A 2PX5A 3AEKA 4S0ZA 4XEUA 1Y4DE 4MINA 4FLFA 3E5RA 1Y4AE 4QHYA 2P4HX 2VDNB 5K0BA 2O6LA 5C4MA 2CLIB 2ID4A 3N6RA 3RFVA 1YRHA 1PFWA 2P9ZA 4BNKA 4DV4B 1II0A 3THXA 1DEAA 3PDJA 4C14A 2DBQA 4EY7A 1LRJA 1VIVA 3QELB 1U3CA 2GKSA 3HVJA 3N8NA 2LTAA 1AXEA 2HJSA 1OT3A 5F2NA 3IUQA 1UBRS 1E2MA 1P2SA 2DQZA 4O1HA 3WNBA 4EKDA 4FR2A 2Q7OE 4YYEA 3F9RA 3PC8A 3M33A 1K6XA 4A6PA 3N8HA 1AV6A 3WRWA 1WMBA 1YZHA 4NPHA 1TCVA 3WGHA 3WGTA 3N8IA 1HT3A 1Y9DA 4ASUD 1W0KD 1KE2A 4JJZA 2DR0A 5M5BA 4UTOA 1P75A 3TM4A 1LY1A 2ID8A 2AXPA 2LP4Y 1ZJ5A 2RFLA 4KW7A 3RUDA 1XAGA 2X1HA 1OIXA 2D8AA 1P5ZB 5KO2A 3W2IA 2PGIA 3R1IA 4ZPXA 4TX1A 821PA 3OFVA 1YRLA 4UFPA 4OHYA 2JIZA 3R40A 1SG0A 3U4HA 1BVRA 3B2NA 3ZJ4A 4YRZA 4H7JA 1I4OA 2RJ3A 5CLHA 2H00A 2EFEB 3IVXA 1S3GA 2XMZA 4EHLA 1T4GA 4CCWA 4JT4A 1BFKA 2PO5A 3D54D 1TA9A 2HCFA 3KUDA 3L4SO 1KVTA 4RJLA 1N3BA 3TYXA 2OZKA 1RWXA 1QTQA 1LI7A 4FMDF 5GJVC 4GLJA 3PWTA 1VPEA 3EWAA 4G8BA 4XVUA 5MFZA 3I1FA 1Z4KA 4OQXA 4PSCA 3UH0A 5EVJA 5F77A 3TRFA 2IZ6A 2ZYRA 4INOA 3B2QA 3I4CA 3F4BA 5ENVA 4W7IA 1E6MA 2R2GA 4N3CA 2A1UB 4IIYA 2ODPA 3JTMA 2XXJA 3E82A 2PHZA 4P4LA 4WRRA 1CUFA 5GONA 1OFIA 1NXOA 4DV6B 1WUJS 2D0PB 2C4MA 2OCKA 1U6KA 4AG5A 1GA6A 3IVRA 1L7MA 1BD4A 2EWMA 4JQOA 1GITA 4AJPA 1AUVA 3LNTA 1BH6A 4GKKB 4AUEA 2EYUA 1FP2A 1KJZA 1IHPA 4HTFA 1F8GA 4UPVA 4RLHA 2BFMA 5BYBA 4HPWA 1TUGA 1ZM9A 3DD5A 4L9WA 4QFBA 2FPXA 2JIQA 2W6NA 4UTXA 4OI4A 5DASA 1L5KA 1WPXA 4G6ZA 1XTKA 4DZTA 3LUHA 1J8VA 1Z37A 1WNTA 1EWKA 3NYQA 4YT5A 3NXSA 2PVCA 4GBMA 4ITVA 1DBRA 2GK7A 3AOGA 5A3SA 2PSJA 3B53X 3G2NA 5JALA 1LC3A 2O8CB 3EG9A 2P9BA 4JFRA 4LOHA 2FQXA 4LNUB 4QYSA 3EAFA 1A04A 1O97D 4YDHB 5KTYA 1SKMA 3A0RB 4KN5A 2VDRB 1SQ0A 3AP1A 4XZ3A 3UMCA 4R2KA 4ND3A 2JD0A 4J49A 1PGQA 3AZQA 1L4MA 1UDCA 5I9SA 2Q3CA 2PYZA 4U2EA 4WKBA 4YCJA 4AY3A 1FMTA 3B13B 4D74A 3W7AA 1SPXA 4W5NA 1GNQA 1JEDA 2IYVA 2QL9A 3G5UA 3RAEC 3A1TA 2OENG 8ATCA 4PLHA 4R7GA 3GLIB 4PNEA 3DV2A 4KZKA 4DCOA 1FLAA 5AVRA 5ICMA 4P7JA 4XIIA 5EIOA 2OYSA 3D3KA 4DA9A 2YZ7A 4E94A 1L1EA 1YFJA 1CUAA 3BXXA 5FPHA 5JSFA 2FG5A 4PC2A 3EB9A 1GPUA 1U8EA 1V7QA 2FSIA 3EBPA 4KLAA 4OOFA 2IZ0A 1DKLA 1DC7A 2DE0X 2SHKA 3HG7A 4US0R 3ZE2B 3NHLA 3QMVA 2I8LA 1WU7A 3K32A 4GW3A 3ILHA 4RENA 4WN3A 4OHWA 3N6XA 1ANKA 5BQXA 4HLCA 1UJNA 2DHCA 4O4IA 4TZTA 5KINB 4CT0A 5G02A 3OHSX 4RJTA 3FN4A 3SU8A 1KH3A 4EG8A 7MHTA 4E2FA 4TVSA 1TEHA 2BBTA 4I5DA 1L7AA 3N8GA 1E7YA 3NKFA 1JLLA 4GMHA 2CJWA 3OQBA 5AKXA 5KQGA 1FUIA 5HJ5A 4DIEA 3HWWA 3LVRE 4ALNA 4OFBA 3MTQA 3W5HA 2RGRA 4QPPA 3FZNA 2GWHA 3O95A 3QPVA 1V11A 2R7KA 3I6YA 4HN9A 1Q1GA 4LE2A 4J0FA 4V0LA 3PTAA 1QM5A 1KS9A 1JH9A 4N5DA 2ABWA 2XCSB 5HM8A 4XQGA 4N7BA 3OP4A 4KH0A 2JCBA 1HYQA 2DB3A 2AEJA 3SJZA 4ZQEA 3PNKA 3PNOA 1KZ1A 1I14A 3W34A 1LV7A 2GVDC 3CRMA 4GWKA 4KRXA 3FXAA 3WQSB 2FE1A 1THGA 3BXZA 2IBTA 2PMDA 3VC1A 4BE4A 3E5HA 4C2AA 4PN3A 4WJLA 5KTSA 4J1TA 2HDHA 5CUQA 2B1IA 3VYTB 1AX9A 1V4BA 4KR3A 2JGAA 3HYRA 5HOEA 2IH5A 4TV9B 3H8SA 5COAA 1SKYB 2QZJA 2HWUA 3OQOA 5BQ3A 4BFYA 3EZXA 4F84A 1MO2A 4BNDB 2I78A 1J23A 2UUOA 2JFYA 1U2TA 2YJ6A 3FPGA 4Q18A 4HTAA 1DWOA 2Q1UA 1UP7A 4NDNE 4OAOA 4PSDA 2ESRA 1P4AA 2NSDA 3OPMA 3UA3A 3ZWXA 3NWJA 3WZLA 3W5BA 1YDFA 3W6PA 1IOZA 4N41A 1M2VB 1IG3A 1NQTA 1P29A 4H18A 4NEHB 3SZUA 5F3DA 1T4CB 3STXA 3RKRA 1NRXA 3RTCA 5FUWA 4B46A 1X3SA 1UK7A 1GLNA 1WQ4A 2VR1A 3BMNA 1QIJA 4UD2A 1E59A 3DYVA 3SX0A 4ZICA 5CB8A 5JZMA 3CJTA 4UU7A 4WQMA 2C2YA 2QT0A 3BD8A 4P31A 1O97C 3OAAD 5J63A 1BFDA 1GPLA 1NVEA 3ZTWA 2EATA 3SHVA 3T0FA 4ARCA 3QNUA 3WLFA 4X7PA 4ID3A 1NBME 2I2DA 1V9CA 1O95A 4LJRA 4GZ6A 5AVWA 4EJ2A 1NVVR 2JW5A 2O0MA 4Q47A 5E6RA 1BKDR 5KUTA 2QLFA 2ZBUA 1FFWA 4FU0A 4HGYA 1BDHA 3DKVA 1Y8CA 2A9FA 3FPHA 3TQHA 5HYVA 2Y0BA 2YYZA 1JHZA 4CMIB 1R6DA 4TYQA 5K8JB 2B2XA 1XYYA 4JEMA 3NVKI 1PFYA 2I6SA 4CV1A 5KSZA 2FW6A 1NNI1 1SK8A 1QR6A 2ORWA 2VTKA 2WV7A 4OKIA 4J0IA 1TJNA 4X8HA 4AS1A 3A11A 1KBQA 5MHTA 1SC3A 4KWCA 5DHQA 4WBSA 4JMPA 3VZPA 4CLRB 4PC6A 1TQDA 1P73A 4HNRA 1BVUA 5DB4A 1PR9A 2D13A 1O0CA 3OJOA 3WGVA 3TOXA 5KMGB 2XMGA 2JVJA 1YRWA 3HV2A 1B7GO 1SWWA 3LPNA 4BMOB 4FOOA 4FFMA 4F2DA 1NBAA 3RUFA 1N6OA 1OVMA 4Q01A 4RMGA 3W5CA 3LOUA 1LPMA 1K9VF 3LLSA 4HN4B 4TV8A 4XARA 4RTOA 3TGPA 3BN3A 5CMLA 2ZRBA 5DPMA 1N4AA 4DCNA 4WK6A 4AN4A 1KI8A 1LV8A 2AMVA 5EWLB 1OBHA 2KBFA 4X20B 3WISA 1HE4A 2AYYA 2JHPA 1SZDA 3MF4A 1EUCA 4UBJA 3BFJA 3GDFA 3U3ZA 4A0SA 2QTWB 5J2UA 1GQSA 1CKEA 2OO5A 4Q4AA 5C4GB 4IJWA 3T7JA 1UMKA 1X9HA 3U4AA 3H5IA 1FX0A 1GO2A 5SZHB 5KU1A 2JGMA 2IXGA 4XX0B 2IZ1A 4Z9XA 4GKBA 4QYTA 2FMKA 4R9NA 2QRNA 4TZ6A 3VSAA 5JQGB 2N47A 1R5OA 4XI9A 1LXCA 1NC1A 1ZZEA 1HX7A 2XNHA 1ZR4A 3B6KA 2FWJA 4N9QA 3FSJX 3V48A 4MIOA 5DTRA 4XD7D 3EPRA 3QSYA 4ZGGA 1HNWB 1KA9H 2H2GA 2HV9A 4YJ3B 4YO8A 3KFLA 2PKYX 3K5PA 2J5KA 1TX4B 1G55A 1WDTA 1ZK1A 1N75A 1KFJB 3BIOA 5A6SA 2J3DA 2OOKA 1DJNA 3ZDBA 3NIBA 4MQ5A 4RU1A 5DNDA 4ALLA 4BFLA 4U6SA 4PNHA 1JDTA 4TYWA 3SR0A 4HDQB 4P4SB 3I64A 4RS4A 1T5IA 2P5TB 4GUDA 1SR8A 4AG6A 2VPZA 3CC8A 4LUCA 2XB4A 2QX8A 4I6GA 3SS7X 5HR5A 4JBNA 3QKTA 3R3JA 4F56A 1C7QA 1X7XB 1ISHA 2AG1A 2BFOA 4YMUA 3GW8A 2FJ0A 3BH6A 5LR6A 4G0VA 2IY7A 1NE7A 2AC2A 4LEIA 1B6RA 1JPVA 1OTHA 3IEVA 3Q8XB 1LU9A 1BU5A 3KE9A 1CDZA 1AZSC 5AIAA 4Y1GA 4BVJA 2QTAA 4FS8A 1M2JA 1SHLA 2X0JA 3IQFA 3VBEA 5KNBA 2ZU0C 4ZOQI 3E70C 1W5AA 3QXCA 1L5RA 2WVHA 3QTLA 2LKCA 1Z6YA 2UYCA 1E18A 2A4KA 2CJPA 5CAEA 4BVBA 2WWFA 5K3EA 3N75A 3VNBA 2YHIA 5CVJA 1TO6A 1Y82A 4RADA 4A2PA 1YB6A 2WKWA 4KQMA 3T54A 1Q91A 2H16A 4QOHA 2FWIA 6AT1A 4P38A 1E6LA 1L1QA 3GFQA 5AXBA 2C8JA 1KY3A 1YNOA 3P0JA 1H05A 1ZHHA 2ZBVA 3WMEA 1V2HE 2Q2NA 5E1OA 3P26A 4IV5A 4X0EA 3WWDA 4U9UA 4X6XA 3VVMA 1XLVA 1Z6QA 2QRUA 3Q7IA 4XVRA 2Z6QA 2OZLB 5KHAA 1CVRA 2AC7A 3HABA 3VPFA 4D3XA 1BGWA 1BN7A 3T12A 4ZFNA 2FVYA 3VSBA 4ZV4A 1SC1A 3TZEA 5F12A 4C4XA 3CMCO 1LDEA 2NUBA 2XRMA 3DDWA 4NZ9A 1VE6A 2YRWA 4TOIA 3T3MB 5JDIC 1EXNA 1M5UA 2ZANA 3BXFA 1Y3DE 1LQUA 1NYQA 2HMWA 3HADA 3PT5A 2GAIA 1XOIA 4ZQBA 3BF7A 3DOHA 3TBHA 1G64A 3UXEA 2I3BA 3IQIX 3RVPA 2V58A 4YJ2A 2CXRA 1U8CB 2B4YA 1GRRA 5G1NA 3TSWA 3KQHA 2FRDA 1E3DA 2SKEA 4YCCA 5K0ZA 2XUJA 2ZUUA 1B1CA 3GEEA 4LXQA 3DOIA 1UPUA 1CF4A 1V5WA 2JEYA 4QU5A 1XKTA 4DSTA 4EF4A 3TGLA 3RVQA 3TRIA 3ZCSA 1RVDA 3LW7A 1J00A 3W6NA 3TF5A 2B25A 2XITA 3ASYA 5JXHA 1RKXA 1Z2AA 2XB6A 4TLCA 3WIOA 4ZREA 3N2GA 2DU8A 2VPQA 2FNAA 1NT2A 2D00A 3RVSA 1DKNA 3BL8A 4Q9LA 1UXGA 3A1VA 2UZ4A 2FZWA 3BE4A 4H1VA 3U44B 1JHYA 1LBIA 4MUNA 5CGZA 5K3FA 2V4UA 2VXOA 5BWLA 4RJJA 4JSRA 4X62B 2QNRA 1LBTA 2J0UB 3TMAA 2FE4A 4BTLA 5JS8A 2FPRA 4D8XA 4F4FA 2DKOA 4N40A 1DO2A 3NBYC 5KNCA 4GZLA 2ZKLA 4DIFA 1N7IA 3B60A 4N0PA 1LBHA 5AI8A 3CJRA 5C32A 4KYIB 2JIRA 3C5CA 3GLKA 4Q9HA 4PWYA 2OP1A 3M49A 3GP3A 4J0DA 3EGXB 5FLEX 4Y2YA 2NUAB 5MN4A 1A27A 4XSGA 2O57A 3U7GA 3ZLBA 1NLMA 2XYRA 4DDKA 1QH8A 3I61A 3HJFA 1JEJA 2G1UA 5FAXA 3WWOA 4AZ0A 1OFUX 4XM0A 3N53A 4DV7B 3E7XA 1KFKB 4OVKA 4B2PA 1RYEA 2YJNA 4LJKA 4BUCA 1RBQA 5C2JB 2BF4A 1L8AA 4D5GA 3DLCA 2V5AA 3IDOA 1I5EA 2YWCA 4LXUA 5JW6A 2F2TA 1KGSA 3UMGA 2WD7B 2WICA 5AUNB 4RHCA 3ZD6A 1TADA 2PUJA 3DAOA 2V3VA 2YTZA 3Q2KA 5TC4A 3DOJA 1QH1A 3T52A 3NUZA 5EZYB 3K94A 2PJDA 3MAAC 4QUKA 4QRDA 4RVNA 3CLKA 3F0TA 1XEXA 4X71A 4BLOA 1RPJA 1PG5A 2WI8A 3K1YA 1YI0A 1C3OB 4ITRC 4IX9A 1L5FA 4ZVQA 3LG2A 3DE1X 3GLFB 2FFRA 1QB8A 2WTXA 4KGXA 4MEJA 3ZHXA 4CZ2A 4HWGA 5GWXA 2W90A 2ZB8A 1FLVA 1RI5A 1V16B 2PT7A 1WEHA 2VYND 4E2YA 2GBLC 3H3JA 3K16A 1PK8A 1N6LA 1KKMA 2WLTA 4HPJB 1TDJA 4KO4S 4NULA 3NCHA 4XPIA 5REQB 4AFNA 1UC4B 1V7CA 2OB1A 2ZAYA 3AI7A 4XVHA 4CG0A 3F9IA 2GN1A 1NAHA 3RCBA 3P4YA 2VP3A 4S35A 4UKDA 3VR6D 1ULAA 3AV0B 3HKCB 1ODIA 3BD7A 1ZI6A 4EW1A 1P4GA 5LN1A 1G8MA 5KYNA 1VQ1A 4JR0A 3H4IA 1LTKA 4D56A 5B3AA 1YKFA 1A50B 3AUTA 1Q3KA 2YNMA 5EHQA 2Y2VA 4C89A 3QVKA 5A3RA 5IMSA 3ZJUA 1EK1A 4N8SA 5CP8A 3U4GA 1H4VB 3JW8A 1DRVA 1OXXK 5I9TA 3ENNA 3KTDA 4F85A 2ZSHA 2PT9A 4KOEC 2WOOA 5EZ5A 1BX0A 1OI4A 3FVWA 1PWZA 2QYHA 1PAUA 1Y4UA 4IRUB 5AKIA 3N2KA 1THMA 1XNJA 1YRAA 5GIPE 2HSGA 3PBKA 4QNMA 4HVAA 1J1UA 1MOZA 2ZT7A 3U62A 2LXNA 2O2SA 3CLUC 4M86A 3CSDA 4WN9B 2DEUA 3LV8A 4ZO4A 3JQ6A 4A6EA 5KKCA 4RVSA 3N6VA 1Z28A 1S8FA 4TL8A 3O91A 1E63A 3OTOB 3RSQA 1TGYA 3IBYA 1F1BA 1NJ8A 3UPDA 3VO2A 4EVSA 1Z22A 4NZOA 1KSJA 2QMOA 3Q6NA 1QO7A 4I4IA 5SZKB 2VRCD 5CDSA 1ZAYA 3T5GA 2D7DA 1VECA 1JQBA 4NCKA 1VL8A 4Q00A 5JSKA 3SC6A 5H4GA 2WTBA 5CFZA 1VLHA 4KXVA 1B8PA 4I6JA 3R23A 2E4VA 4UZSA 4HDCA 2H4HA 1ZMXA 3N76A 4EG5A 3QBTA 1T24A 4IJQA 2BPOA 4LHVA 5CCXA 1A9XB 1QIIA 3QUSA 1KMHA 4Z99A 1ENZA 1JHUA 2PJUA 3AB3A 3V4SA 3ZS9A 3CO0S 1XCPA 3WBJA 1NVFA 3KAKA 4PQRA 4P7BA 2JH9A 1C8LA 3N0TA 1V48A 4DYDA 4AF7A 4YV2A 2H2DA 3GZTB 4LHXA 3DAYA 4EATA 1YIAA 1N8TA 1AU9A 4BNYA 2M6KA 3IHWA 1QPGA 2A92A 3I8XA 4MVJI 2J0SA 4XGIA 5EWMA 2G76A 2H9AA 5KWJA 3LZDA 2WJPA 5C8VA 3FY4A 1G8SA 3OECA 3EEOA 5BNTA 4EKEA 2XBMA 3ROPA 3EEQA 3M34A 2PLNA 5BVHA 3VYSB 3V8EA 5CH8A 4NNJA 2VHVA 4TXLA 4ARBA 5TMBA 3B8HA 4HMQA 2PUBA 1JUDA 3H5OA 3G2MA 3OHPA 2K87A 3RG8A 4MZXA 4Z54A 1ITZA 3G89A 2FR8C 1AN0A 1EA7A 2P3SA 4XVCA 5AW3A 4CRWB 5CYOA 2XJ4A 1G59A 2CKDA 4MVYA 3E05A 1QE0A 1UFKA 4LOJA 3NDBB 3Q98A 2Q7DA 4FHEA 3ZH9B 1ZOLA 3OT4A 1C0LA 4NJOA 1UFOA 3MFQA 2QB5A 4XE5A 2I6QA 2PEYA 1LPAB 4WINA 1KC3A 2W2OA 4GSYA 4MB0A 2I4IA 3LWZA 1IZZA 1JB9A 3OA2A 4G5GA 4J3JA 1LPPA 1PL7A 4RK5A 4RD3A 3AI2A 1CEQA 4Q21A 1UPAA 2WJAA 3GLIE 5C1IA 3PYXA 1N25A 1W29A 2FK8A 2Q49A 2Z5VA 4NRDA 2WKSA 5DM4A 2ANCA 5EY5B 4P7FA 2QQEA 1EM6A 1KYWA 4BNMA 4JENA 1Q0UA 4H35A 1SXJA 4MRRA 1JXQA 3U4CA 2O5CA 5E9WA 5K3BA 5DNWA 2R97A 3JQGB 2E82A 6REQB 4HRXA 3LE8A 2ZI9A 2WM2A 3QKUA 3FR8A 5ICSA 4TT3D 1CJCA 2F9LA 1ECBA 2YMPA 3LUKA 1KI4A 3U4MA 1QLHA 2XMRA 5LM3A 3DOEA 4JC8A 4TYNA 5JD4A 2I0FA 4ENVA 4OX9Y 4JXKA 3BAFA 4NDZA 2Y27A 3WKBA 4WFQA 3ZU2A 2ZYHA 4DNXA 4DA4A 2HSJA 3LHKA 1DKOA 5AO9A 2A9RA 4CIVA 4GQBA 3SHTA 3EGDB 3UFXA 2XOXA 4OK6A 4HAYA 3L6CA 1UM9B 3CNEA 5L3QA 3KOZA 3PF8A 1ZNXA 3JATA 3I4LA 1KYYA 4YRJA 3QPUA 4XFJA 3RU3A 4UARA 4LSWA 1S2NA 1FFBA 2F1RA 3CIOA 4YRCA 3WMFA 5HPYB 2IHKA 2VHEA 3ABIA 2ZBEA 3AR5A 3KQTA 4PLCA 4RKRA 1FMJA 4JY7A 5GOTA 3M9LA 5EP3A 1HL3A 3MWGA 1DBPA 2NU9A 2ZYTX 3MGGA 4YI3A 1VHJA 4KN6A 4S1NA 4RUKA 3GEHA 3USES 4XDYA 5K3OA 5LDHA 5G1PA 5HUHA 5TE9A 3E3MA 2AUTA 4HRYA 3FJ1A 1AHNA 1X7GA 3TCNA 3UGJA 2VJBA 2FI1A 1CP3A 4RE6A 5GINE 5K8CA 4ZJZA 3Q7SA 1FYVA 1S7GA 1YCGA 4FMCF 2OZPA 1JDPA 5AQ1A 4TLDA 1R8SA 2B36A 4WZAE 4Y9RA 1DAPA 3MT7A 3S5JA 1DKMA 4D81A 5JPDA 5KU7A 4CLOB 2B6HA 4L3OA 1KYIA 1SKYE 1XRMA 2G17A 2Y76A 4H1UA 621PA 9GPBA 3RM3A 1Z6XA 3S1LA 5IT0A 1TT7A 3F8SA 3DBRA 4MSUA 2RHLA 2REQB 2QX4A 4L2IA 3RUAA 4L3VA 4JELA 1PVVA 2X8JA 1UANA 3D4PA 1MV5A 3GLHA 4CNBA 5BV0A 1JRLA 5F9FA 4KXUA 3K1AA 4MIEA 1FFCA 3SQMA 1CY4A 5J5VA 1GGNA 2ACEA 2RGUA 4IS2A 3JVEA 3EPKA 2HIMA 1ACLA 2OSVA 3OQVA 2YVKA 3H9BA 3VNQA 2JLVA 4L8FA 4RO0A 3P9YA 4IXTA 4R98A 4YY3B 1PT6A 3K9HA 5LC1A 2BMEA 3BS4A 2H65A 4YDQA 4EITA 5JANA 4S05A 2IBMA 5IP5A 1KDRA 2BD0A 2P9YA 2ERYA 1ZR2A 4V1CI 1HC7A 1I3OA 1VB5A 3DAFA 3L7JA 1KYTA 1RLMA 1GL6A 2J3QA 1JTFA 1NQWA 1V8OA 5EL0A 3ZHRA 2JJQA 4HUJA 5HKLA 4Z9AA 3UK7A 3T5PA 3USCS 2E1RA 3HUUA 1VE5A 3ROFA 1N5MA 4GBJA 3JVDA 1XTVA 3WWCA 2A58A 3H6GA 3O2QB 2M6RA 1G3RA 1E9BA 2IYYA 2QZ4A 1CQPA 1NYLA 4ROTA 2H54A 3V8BA 1Y7HA 1DIBA 3M2PA 3EVDA 4NBUA 1OLUA 2BZGA 3CVJA 1K08A 4FQ5A 3HRKA 4KXXA 5JEDA 2UVPB 3I72A 4UQPA 1Z0JA 1G8KA 1NI4B 3EEYA 4O4IF 3SZGA 3IVCA 3FPLA 3JXEA 4FMPA 3O3OB 1EFVB 2O7RA 2IX9A 3GUCA 3JAKB 3DZGA 4A6DA 4H0NA 1N8NA 2VQEB 3CB2A 3GEIA 3PFHA 5EFZA 4G26A 1EXDA 3L8YA 3FPAA 3IAS1 1VM6A 3LCRA 4QARA 1Y3IA 3WLJA 1RACA 4F60A 5B4UA 3R4VA 1E1DA 5JCZA 5MDHA 2FUKA 4TXMA 1NUPA 5K0GA 5JNLA 5JT1A 3VDMA 3ZWMA 4KK3A 1HXHA 2JIZD 4AX4A 4EGCB 1RHUA 1WNFA 4JUAA 4WLUA 4M99A 2ZI5A 3DUFA 4RTPA 1PSZA 4UDOA 1CJVC 5TS3A 1CC1S 3UXMA 3FTFA 3EIFA 2PXXA 3P0EA 4KAXA 5DNYB 4OPMA 4W1SA 3EA0A 3KCQA 3JVVA 4DUPA 4IV0A 1K63A 1PEKE 1Z7WA 1A95A 3ZWVA 4LKOA 2VPIA 3PIDA 2DHRA 1M1UA 1VFPA 1Q1EA 2FYTA 4H9GA 4BP1A 5JZSA 3B48A 2NXEA 1GFWA 4MVJP 5B2FA 5FNVB 1YT5A 3HCRA 4B6FA 2X6RA 4P5DA 2QP3A 1Y9AA 2WBLC 4TXJA 2BR4A 3M3HA 2IHVA 1CLEA 2IUEA 4LAFA 2XZDA 5F7OA 1NF9A 4A36A 3D2LA 3IJPA 2FSUA 2YV3A 3RVRA 2P6NA 4DR1B 2CV0A 4YR9A 4MVCA 4PLYA 1E0AA 1TZ2A 1GYPA 1GPKA 3CPJB 3K9WA 1I6MA 4QYWA 4GL2A 1M8FA 1SD2A 1Y1QA 2GHIA 4JASB 4HK4A 3V3TA 6LDHA 5CCDA 5JARA 4B83A 3ZHBA 3H0EA 3GJ3A 4Z2YA 1FYFA 1CVIA 4EX6A 4RYLA 4CU2A 2IXTA 2FQYA 3BWCA 2JD1A 3GT4A 2AOTA 4N0MA 3UUWA 3UOAB 2Q3DA 2G9RA 4KACA 5DGDA 1HTBA 4CMJA 3PEWA 4RZSA 3KXLA 4G4SP 2WAYA 3NC4A 3G9QA 7ABPA 3ZV3A 4MZDA 1QQBA 4MGZR 1E2GA 1AK2A 4FSHA 2Q8PA 3BE5A 1NXSA 3PQ3A 1AH2A 3E3AA 2PGLA 2NZXA 4JB0A 4OGKA 4JVSB 3R5KA 4FGLA 4GVPA 4D41A 3CZPA 1KY4A 2D54A 3WO1A 4YIHA 2HF8A 3K4HA 1SG6A 4EIWA 1FDOA 3GLTA 1IEXA 3CSSA 2RMKA 3STWA 2PBZA 3L4KA 5DN9A 1DAHA 4I1IA 4DCUA 4Q4CA 3ER9A 1NHWA 2GEUA 2ZU6A 3FAZA 1X2BA 3R0QA 4CMCA 4DXHA 3MTIA 3TG2A 3GJ5A 1MNQA 2XECA 5ER6A 3L4EA 5CBPB 3TQCA 1Y6QA 4XSHA 1NQ5A 4MR8B 4YDSA 4BB9A 3ZVRA 4DV2B 4K9LA 5ALDA 4Q16A 1XF9A 3WBFA 1E98A 1F38A 3HBNA 5EJAA 5CT4A 2C1ZA 1TM5E 1NI3A 4FBMA 2Q0HA 2NU7A 3D6NB 4HX2A 4L5IA 3ZWCA 4DSZA 2OZVA 4ZEMA 5KX5F 3FYCA 1RPTA 1B6GA 1T13A 5LBTA 3IV9A 1UT6A 4N7RA 5CD1A 2XOKD 1JHDA 3N7TA 2ERXA 2PU7A 2RK6A 1VLMA 4FINA 4YGYA 3R76A 2VDUE 4OM8A 1J2YA 1O9GA 2P3QA 1ZJWA 1PK9A 5K4HA 2FMIA 2A5LA 3L84A 1IHOA 2WOJA 2ZR7A 5A4AA 1EBBA 1NXTA 1U3TA 2WFLB 1MRZA 3PC4A 4IQ0A 5KCMA 1P2BA 1GYRA 4C0BA 3T94A 2FWNA 2HCBA 4AZSA 1T9HA 3D6TB 3EC7A 1Z7EA 121PA 2ZP1A 1M34B 2IYLD 2G36A 3UH1A 1V8PA 2AFIE 4PZZA 4E1VA 1YQDA 4WESA 3OZVA 5BPHA 2B4RO 3QW4B 4UPDA 4R8MA 3GB9A 5ILQA 1E1CB 1F2TB 3TIVA 3ZGOA 2BGJA 2GF9A 4QEZA 1UJMA 5EWJA 3S81A 2JFOA 2XBUA 1RCFA 2C59A 3PHHA 2HRZA 2F3SA 2V9CA 3E3NA 3T5AA 4OHZA 4ZMBA 2D3WA 1I7QB 2WUVA 1GV0A 3QI2A 3GRZA 3AUXA 4D8TA 4URWR 4DRXB 4YAWA 1CJBA 3N8KA 4YV0A 1O0BA 3OZAA 1FW6A 1IXZA 1CJUC 4I55A 2OQRA 4OHKA 3NBAA 3UKOA 5I9BA 1R0XA 2G4LA 1XCOA 4KXLA 3ZCPA 1QHNA 5C5IA 3AU9A 1QIEA 1KZYC 2ZJYA 5BOSA 4MH0R 2A4MA 1J7KA 1QHEA 3R9XB 1Z9BA 2NV2B 2O0KA 4HSGA 1TNDA 3SYNA 4AMBA 2Y6UA 3I9V1 1O2DA 1YE5A 1FNNA 1XRNA 2GHRA 3NH6A 3ICWA 4FOTA 4UBKA 2XIQA 3ADPA 4YUAA 1N6NA 4DQKA 4QGSA 5FUQA 1G21E 3M4JA 4HAVA 4X95A 4IH4A 1Q11A 5IAJA 4Q19A 1PU2A 1EUZA 2C5LA 1QE5A 1CZHA 3L0CA 1I0ZA 3M70A 1I4DD 2W11A 5E9JA 2O8EB </