3CCFA

Crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
238
Chain Sequence
FVWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSGAEVLGTDNAATMIEKARQNYPHLHFDVADARNFRVDKPLDAVFSNAMLHWVKEPEAAIASIHQALKSGGRFVAEFGGKGNIKYILEALYNALETLGIHNPQALNPWYFPSIGEYVNILEKQGFDVTYAALFNRPTTLAEGEFGMANWIQMFASAFLVGLTPDQQVQLIRKVEATLQDKLYHQESWTADYRRIRIVSIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclopropane-fatty-acyl-phospholipid synthase
publication title Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Transferase
total genus 74
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.144: Trans-aconitate 2-methyltransferase.
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ccfA00
3HM2A 1NW8A 2C7PA 3CVOA 3C3PA 1SQFA 3R0QA 3O4FA 3P2IA 3X0DA 2GA9A 2GB4A 4E2XA 3LKZA 3TM5A 1RJGA 4KIFA 4PCLA 4YV1A 1R8XA 3A7DA 4QTUB 4DCGA 4E32A 4YMHA 3I53A 4FS8A 3CJTA 3ELWA 3FPFA 4FSXA 5H02A 3VC2A 5CD1A 3TMAA 2ZBQA 3EVCA 4RVHA 3EVBA 1G38A 1G8AA 1N7IA 4UOEA 3AJDA 4C4AA 4GOOD 4RTNA 2JG3A 2V74B 1VBFA 2QE6A 2B25A 3G7UA 5K0CA 4GBED 2ZWAA 2HTEA 5K03A 3CKKA 3TFWA 2AOWA 1H1DA 1BC5A 1I1NA 2NXNA 1TW3A 1G6Q1 3OZSA 4PYOA 4OQEA 4PYLA 3SSNA 2QRVB 4PYJA 1RI1A 2G72A 5FTWA 2IBTA 2NP7A 1WS6A 3Q87B 2YXLA 3BWYA 3ELUA 5K0NA 4RVFA 3MGGA 4RV9A 3GRVA 3KR0A 1JQDA 1DCTA 1DUSA 4GF5A 3A26A 4X1OA 1RI2A 2PJDA 3EGIA 2IH2A 4DA4A 2IH4A 1D2CA 4EK9A 3NDIA 1NW5A 2B3TA 5K0GA 3KPWA 5KS2A 1AF7A 3EVGA 3JWGA 3T7SA 3L8DA 4P7KA 2ZZMA 3TR6A 1P1CA 4U7TB 5G02A 4EVIA 3ER8A 2AR0A 3ORHA 5HIIA 3SMQA 1V39A 1SQGA 2XVMA 2IPXA 3IHTA 5E8RA 4F85A 4RSRA 5T6BA 2C7OA 1FP2A 2DULA 3HA3A 5CCXA 5DXAA 2AOTB 2FYTA 1IXKA 3LCUA 4C08A 1RJDA 2XYRA 2OZVA 1QANA 5DRTA 5F2NA 10MHA 3FTEA 1HMYA 4R6WA 2ZZNA 1ZQ9A 3DLIA 3HCBA 3OFKA 4HTFB 2NXCA 4IWNA 3TKAA 5FWAA 1FPQA 4QDKA 4PIMA 2FK7A 5K05A 3EEOA 3LX6A 4F86A 3P71T 3SSMA 2N47A 1XXLA 3BXOA 2YQZA 5MHTA 1M6YA 1FP1D 3LCCA 4ER5A 3DUWA 3O31A 1HNNA 2GLUA 1JQ3A 3B89A 5CVDA 5DPMA 3FPGA 4XCXA 2CMHA 4C05A 1R18A 3UJBA 1Z3CA 7MHTA 1O9GA 2O57A 3T0IA 1N2XA 1KYZA 1XVAA 1XDUA 4MQ4A 2Y1WA 3P9NA 1B42A 4KVZA 3KPYA 4DF3A 5FUBA 4QDJA 3SGLA 4LWOA 2HMYB 4GEKA 2OO3A 5EKXA 3UJDA 4PCAA 4Y30A 4PNEA 1WG8A 3M6XA 5EC8A 1O54A 2PT9A 2ZWVA 5GM2A 4R8RA 4DMGA 4CXMA 2EJTA 3CJRA 4PYQA 3M4XA 2G8NA 4QPNA 3FTDA 2C7QA 4YUXA 3LBFA 4CTJA 4RTQA 5LQJA 3CC8A 2AVNA 2PXCA 4OA8A 3FRIA 4HSGA 1U2ZA 3NWEA 3FPHA 2NNWB 5DTRA 3OE4A 4F84A 1MJFA 2B9EA 1TPYA 5HEKA 2B2CA 2ZBPA 3A4TA 4OBXA 4RTKA 4YMGA 5IKMA 3ID6C 2ERCA 5EKUA 2FPOA 3GCZA 1NV9A 1RI4A 3DR5A 3E05A 3QOXA 5LSAA 1WXXA 2YX1A 3OE5A 2YUIA 4A6EA 1M6EX 3A27A 3MQ2A 5K0EA 3HNRA 4ER3A 3S68A 4X41A 2ESRA 5FA5A 5LQUA 3DTNA 1G8SA 3SR4A 4B17A 1L1EA 4ER0A 3C0KA 2NYUA 1ZHFA 3BGIA 3JWHA 2OKCA 3GDHA 3UA3A 3OPNA 4C06A 2G70A 2LD4A 3GGDA 3MERA 3GXOA 3HVHA 5BW4A 3B3JA 3IYLW 2AS0A 2XYVA 3AY0A 2QYOA 3BGVA 3KQVA 3KQWA 5CVVA 5E9JA 4QQNA 4QVGA 3MHTA 9MHTA 3M6WA 4QTTB 5DSXA 3BGDA 2BM9A 2PV0A 2I6GA 5E1MA 1EAMA 2H11A 1VL5A 3P9KA 1RJFA 2H1RA 5EG5A 5HIJA 3SM3A 1SVUA 5FQOA 3FUVA 1X1CA 1RI5A 1VQ1A 2FK8A 2DPMA 2P35A 2PXXA 3EVEA 3DXXA 3R24A 4KDCA 3THRA 3RW9A 3O7WA 1JG2A 3EGVA 3MTIA 2PWYA 5KQRA 2H00A 2ONYA 2AOUA 5EMLA 1ORIA 1ZGAA 3MCTA 3LDUA 2OB1A 3G8AA 1L3IA 2ZW9A 4KRGA 5DX8A 4YV2A 2PXAA 3G2OA 2IDJA 2EFJA 1EJ0A 3MB5A 1NBIA 2ZIGA 3LHDA 5EMJA 1XDSA 1FJXA 2AN3A 4NECA 2G1PA 1XCJA 2ZZKA 3NDJA 4WXHA 3NVMB 5EZQA 1I9GA 4OX9Y 3FUTA 3HA5A 3B7PA 5DTQA 3IV6A 2O0LA 1N7JA 3DXYA 3GU3A 4FSDA 4BP1A 4PGHA 4GOLD 1ORHA 4BP3A 2C7RA 1M0EA 3CCFA 5DWQA 1IY9A 2BM8A 5K8VA 3KQMA 3G8BA 3KPVA 3LCVB 1P1BA 3C6MA 2NP6A 5EMMA 2O06A 2V7EA 2ZIEA 4AZSA 4RVGA 3BKXA 2I7CA 3MCZA 3SX0A 3C3YA 4GOND 2R3SA 3KKZA 3CJQA 4P7JA 2OBFA 1QYRA 1NT2A 3R3HA 5EVJA 2XBMA 5C1IA 3OZTA 3FUXA 3M70A 3KPJA 1MHTA 1AV6A 3B3GA 1F3LA 3TQSA 3DLCA 5C0OE 1SUSA 1QZZA 2PX4A 3G5TA 4AX8A 2VDVE 2P8JA 3FPJA 5HFJA 3PTAA 3NJRA 4KIGA 1D2HA 1NBHA 2GAFA 3HA7A 2NXJA 3LL7A 4RWZA 3BZBA 1YFJA 4V0RA 5DM0A 4DZRA 1KHHA 3M6VA 4YUYA 2AOXA 1UFKA 2B78A 2NXEA 2PWPA 2XVAA 5D1HA 5ERGB 3MTEA 5DX1A 3TM4A 4C07A 3TPZA 2PT6A 5E2BA 4H0NA 5K0FA 3PFHA 4P7GA 5EZSA 3OU7A 4HRAA 5ICFA 2ZVJA 4CKBA 5IH3A 3KQTA 3PX2A 3PVCA 1X1DA 4LG1A 1BOOA 2JH8A 3G89A 5DM2A 2Q41A 5FADA 3PFGA 3UJ7A 4E70A 1VPTA 2VZ9A 2BH2A 1WZNA 5T67A 2P40A 2UYHA 3GNLA 3AWIA 2PBFA 1QAMA 2Z6QA 1EQAA 3KU1A 4FR0A 3UBTA 3C6KA 3KR2A 1JG1A 1NE2A 4E2WA 4C04A 5E8JA 5BW5A 2PVCA 2P7IA 3BT7A 3NMUF 3G2MA 3HCDA 2IH5A 5GIPE 3F4KA 4CWAA 3ER9A 4XUCA 4M37A 3UJ9A 1X1BA 3PX3A 5E9QA 2JHPA 3T7TA 1Q0SA 1RI3A 3OFJA 3P2KA 4KW7A 2AVDA 5M5BA 4OQDA 3BUSA 5CM2Z 3I64A 5LQRA 3E8SA 1PJZA 5GOZA 3FUUA 3EVAA 5CVEA 3VYWA 2IGTA 4AZTA 3NW9A 1T43A 4O29A 2JHCA 3BKWA 5U4XA 2VDWA 3TRKA 3EVDA 3GIWA 4AZVA 3HCEA 1D2GA 1RJEA 2QRVA 1XCLA 4PYNA 5EGSA 4DCMA 5K09A 4QVKA 1ZKDA 2P7HA 3HCCA 3ELYA 4LWPA 4DQ0A 5KVAA 2Z6UA 5GM1A 5ICEA 1XTPA 3BWBA 4M7RA 5EQJB 3A7EA 4YUVA 3UJ6A 4EMSA 4POOA 2FCAA 3FRHA 4RYLA 2E5WA 3NTVA 2PX8A 1L3CA 3GJYA 3KQOA 4ER6A 2YXDA 5LQCA 3M33A 2BZGA 4AUKA 1R74A 3HVJA 2WA1A 5HOQA 3BWMA 3UJ8A 4RTMA 2EX4A 2HR1A 1JQEA 2IIPA 5EIFA 3ELDA 8MHTA 1NKVA 3DULA 3G5LA 1L9KA 3FPEA 4X61A 3UJAA 1SKMA 3KQQA 1Y8CA 3NVKI 2PY6A 2ZFUA 4M38A 4BLWA 4IKPA 1VLMA 5KQSA 4P7FA 5E1BA 4KDRA 4EQZA 5K0JA 4CTKA 1VE3A 2GS9A 3T7RA 1NW7A 3P2EA 2OXTA 4CKCA 5K0LA 4RTPA 3NWBA 3EEYA 4HGYA 3UZUA 1VIDA 2PX2A 5K0BA 4PINA 4R6XA 3P8ZA 4QPPA 3EMBA 4HTFA 2KW5A 5E9WA 2YVLA 2O05A 5BP7A 3KR1A 5GWXA 3QV2A 1X19A 5ICCA 2ONZA 1P39A 1DL5A 2QM3A 2BR3A 5DM4A 3KPUA 5CUQA 5B1SA 3LKDA 5GIOE 3DXZA 1SG9A 2WA2A 2Y1XA 2YTZA 3G2PA 1BKYA 5CVUA 2I9KA 2VDUE 2O07A 2ADMA 3E23A 3LGAA 1UIRA 3I58A 1FBNA 3JWJA 4L7VA 1NW3A 1EIZA 3FZGA 3P9IA 4MTLA 2JH9A 3UWPA 5LR6A 5LQKA 2I62A 3A25A 1YUBA 1JSZA 1JTEA 2OY0A 1JTFA 3RODA 1QAQA 3EMDA 4BLVA 4E31A 5JUWA 1KIAA 3REOA 2ZBRA 4GQBA 3TOSA 3CGGA 4ZTBA 4RTLA 5E1DA 4RX1A 4DM3A 2UYOA 5EHGA 5LQNA 4V0QA 2UYCA 4HGZA 4X63A 1UWVA 3P97A 3AXTA 1EG2A 2PGXA 3LPMA 4RTSA 4PYMA 3PS9A 4Z2YA 5T64A 3V97A 4E2YA 2K4MA 4WVLA 4E30A 3WSTA 2QY6A 4FT2A 2P3QA 4DKJA 4M36A 4MHTA 5CVJA 3SSOA 4OA5A 5ICGA 3DMFA 4XUEA 3VC1A 2CL5A 5DXJA 1Q0TA 5JR3A 1KYWA 4RVDA 4YV0A 2CKDA 3DH0A 3GRUA 4PONA 3RIEA 3I5UA 5E2AA 5DRYA 1WY7A 1NV8A 1WXWA 1P91A 1XJ5A 2GPYA 1G60A 3ANXA 3H2BA 5FULA 5P8WA 1I4WA 3DMHA 2F8LA 1ZG3A 3FTFA 2HNKA 3G88A 4HG2A 4IV0A 2CWWA 3FYCA 3GO4A 4PYKA 3ERCA 5EIWA 4G56A 3HTXA 3EGEA 3LDFA 4Y2HA 4HH4A 2G71A 3B5IA 3I9FA 2UYQA 1INLA 4KWCA 1JR4A 3JWIA 3R9XB 1L3BA 5GINE 1KR5A 2FHPA 2GH1A 4PGGA 2ZIFA 3THSA 3KHKA 3D2LA 4JXJA 3SVZA 1KPGA 2HWKA 2R6ZA 2AN4A 4FP9A 3FTCA 4CKEA 5F2KA 3GRRA 4MWZA 2ZULA 5DT2A 3UA4A 3PLAE 4PIPA 3HEMA 3LBYA 1OR8A 3QOWA 5EOVA 5GP1A 4A6DA 4C03A 4YUZA 3HCFA 1KPIA 3HCAA 4E2ZA 3PB3A 2OPBA 2JHAA 3OU2A 1F38A 3AXSA 5F2OA 5K01A 1KXZA 1TW2A 2BR5A 3UJCA 3VSEA 1KP9A 2CMGA 1G55A 2IFTA 3KR9A 5CIYA 3DMGA 3OU6A 4RTJA 4RTRA 3B3FA 3HP7A 3KQPA 4P58A 4YUWA 2AN5A 3E7PA 3P9CA 2YXEA 4GUAA 2IP2A 4X60A 2AOUB 3IEIA 1AQIA 1YZ3A 3EPPA 5FA8A 3UFBA 2P3OA 5FQNA 3LECA 3TKYA 2OB2A 5EEHA 4XUDA 5E1OA 2ZTHA 5EMKA 4OBWA 4FT4A 4E33A 3CBGA 3EVZA 1XDZA 5EHIA 2ORED 4U7PB 1YB2A 3OCJA 1X1AA 2JJQA 1R8YA 2WK1A 3KQSA 4FZVA 4EKIA 5HZMA 5HIKA 3MAGA 2ZCJA 5D1NA 3R6TA 4GOMD 2P3LA 2AZTA 1JG4A 2AOVA 1JSXA 3K6RA 3Q7EA 3PT9A 3GRZA 5FHQA 2VS1A 2FRXA 2OYRA 4ISCA 3HVIA 3TLJA 2P1DA 4R05A 3BWCA 1NW6A 3DOUA 1AQJA 1JG3A 3KQYA 5FWDA 5DX0A 2PSSA 2IDKA 3OZRA 4R8SA 2P41A 5DTMA 2ZLBA 4BLUA 1R00A 3HVKA 2EG5A 4GC5A 5EEGA 5HILA 2HV9A 2EJUA 3ME5A 3G2QA 5FHRA 4ER7A 1R6AA 2Z6AA 4EKGA 5KYGA 1O9HA 3GRYA 2PX5A 4QQKA 5CCBA 1BHJA 3LSTA 2ZSUA 3M6UA 5EPEA 4K6MA 1ZGJA 2AOTA 3U81A 4RTOA 1YF3A 1QAOA 2PKWA 3GWZA 2A14A 5DLYA 3V8VA 4ATNA 1VP3A 3K0BA 5BXYA 2UZ4A 3EVFA 2YR0A 1EJ6A 4PYIA 5HIMA 3FUWA 1IM8A 1SUIA 3LDGA 4HC4A 5DM1A 4IV8A 3FYDA 5C9ZA 4MIKA 3SXJA 1KPHA 1YFLA 3DP7A 5DSTA 2PLWA 4PWYA 1YZHA 4AZWA 5LQAA 4LECA 1VP9A 2BR4A 5FCDA 4BY9E 1PRYA 2VP3A 2IBSA 4GC9A 4FGZA 2XYQA
chains in the Genus database with same CATH superfamily
3CWCA 3IIIA 1U3DA 3MJVA 2DLNA 4OKSA 3NIWA 4V24A 3AI7A 1NI4A 4GX2A 1EB9A 1B15A 1QHXA 1QVAA 2ZRBA 1G5TA 3F9CA 3TDKA 2RARA 3G0BA 3ZWMA 4DA6A 2CZGA 1MABA 1SH7A 2GPAA 5G4KA 3KLMX 4JC5A 4MW9A 4XPIA 1H8ED 1L5KA 5BYKA 5IZ4A 3ZW9A 3I4FA 7AT1A 3DPSA 1YHYA 4EFLA 5IRCD 1GZ6A 2XWBF 2QD3A 4EARA 4XD2A 1MVLA 4TWBA 2BFDB 3EVCA 1YFKA 3SKXA 3I2YX 2BLLA 5HHTA 3MOGA 2HJRA 1VG9B 3DFKA 4MPDA 4IWXA 1H4TA 4RMIA 1OLSA 1FDUA 3IIJA 2WU0A 1Z5PA 3KOUA 4N5DA 1E4EB 1G20E 2ZPUA 4JWTA 1EPUA 4PLHA 2ZWAA 1MJ5A 4MYCA 1N77A 4ZVOA 2I2XB 2VOJA 3BK2A 5DGHA 2ZRIA 4R2MA 4FEYA 5ETJA 5AK3A 3FHLA 3VOSA 5EJ8A 5K8JB 1QE5A 2HDNB 2RC5A 4DLXA 4KQJA 1D1TA 2FI1A 1MENA 1FDSA 4Y6LA 4OJYA 2DH6A 3OKPA 2I4TA 2DWUA 3RFXA 3RNOA 5A5FA 2JI6A 2PJDA 1JZQA 1FXSA 3ILYA 2C2OA 2CLEB 5HOEA 1IY1A 1Y4SA 2B6HA 2EGUA 4LOAA 3RSQA 3TJMA 1KEZA 4JS0A 4JLBA 5CHYA 1ETHA 5ALMA 4CL3A 1ZJYA 1Y5MA 3DLHA 3ZLJA 4JI7B 2HMTA 3WXMA 3ZD9A 1QQBA 3WAJA 1SC3A 1U7ZA 2K6GA 2Q3HA 1U7HA 4JQZA 3SQDA 4G1FA 4O02B 3MEQA 4QUGA 4RYDA 3WL5A 4ZZ3A 3S0JA 5BR8B 3QEAZ 3K2EA 5E8RA 1ZUNB 1RTKA 1T8TA 3G82C 3A1NA 3G7SA 4IVQA 2VYNA 3TXYA 4H1HA 4U5XA 1FP2A 4FFOA 3GLFE 3K9CA 4F2GA 2YW9A 4Q9HA 1ENZA 1B0AA 3JALB 4MVJH 5AW2A 1L7RA 5DGXA 1T5HX 3WMRA 3FDZA 3GEIA 4BJHB 2X42A 1SCIA 4M8SA 2NXCA 5DK6A 3JU3A 2P90A 1T1RA 3GMSA 2A6PA 3K30A 1K5GA 3H9QA 5DIFA 1A1VA 2WW8A 3GW8A 4XWKA 4LJ5A 4C4PA 3TZCA 1M6YA 2ZYGA 5JDIC 2WKQA 1QUEA 3P5BA 4WK4B 3RTGA 3AL3A 1BMQA 1DPGA 2IYYA 1N4AA 4EGSA 4YBZA 1AZWA 4PLFA 4Q5IA 2Z09A 1LJ8A 3CRMA 3HCPA 2QZJA 3V7YA 4YK7A 3W4IA 3LFUA 1XOIA 2AA3A 2DZDA 3IOMA 1OB2A 3QVOA 1DIGA 4PS1A 4F45A 3THXB 7MHTA 3OZXA 4QOFA 3UAXA 4C0BA 5JNRA 3GDGA 1D4OA 2NU6A 1M2VA 4YQYA 2NV2B 5DNVA 2QM8A 2RE8A 4EUEA 2R6FA 3JQ7A 2Q62A 2AZXA 1VKJA 1CRLA 3OF3A 7GPBA 4C87A 3T8YA 5L3SB 1KL7A 2GEUA 2R8EA 1Y5IA 3H4IA 3ZXXA 4GEKA 3OTOB 3C45A 3DZBA 4PF1A 2M1XA 3QVLA 1NG9A 1PS9A 1R9NA 3O1HB 1LZLA 1O54A 2JBHA 3C1AA 3WGZA 4INAA 2EJTA 2AEFA 1NIPA 4PYQA 1ZBQA 4N0DA 2GVDC 3C5EA 5TJ9A 4OCZA 5F33A 3KCQA 3LH5A 3PKJA 3DCJA 3BEOA 3AZOA 4R1TA 2DJIA 2FEPA 3HI4A 3PWTA 5ESDA 3UMGA 1U2ZA 3X43A 1X0XA 3HUEA 3COZA 2R87A 2VAPA 1QIMA 1U7UA 1QK4A 1YS1X 5AUOB 5I7EA 3DUFA 1KSJA 1IK6A 2H1FA 3ZXSA 4ABYA 2BKVA 1DJOA 2RG1A 5KOHB 3VRHA 1LVGA 3AETA 5DLDA 2HXGA 2R96A 4HAWA 4OSOA 4F4JA 4A2WA 1ZINA 1D7AA 1SZJG 4EUFA 2Y93A 4DJ5X 1CR1A 3DT9A 1WETA 1FMFA 3HNRA 1JE1A 1NJ1A 3HBMA 1LH0A 3M49A 4NOMA 1JFLA 1G0NA 1KAHA 1PR4A 2QAGA 1E59A 3JCZA 3AFGA 3IAEA 4P80A 1HTWA 5CMLA 4GH5A 4D6PA 5CP8A 3TLZA 1CZNA 4U0KA 5CB8A 1GG2A 2I34A 3KZXA 1YS9A 3OPNA 3PXDA 2G70A 4J1QA 3JARA 3L8HA 3MERA 3GXOA 4TROA 3EWAA 5FBQB 4JY7A 2ZB8A 3D7NA 5CH8A 3W2IA 1NXOA 2XA9A 5D85A 5TF0A 9MHTA 2FSGA 2B37A 3BDAA 5ADHA 1RKXA 2ZSAA 3D7SA 4OVKA 1HDYA 3F6CA 3JW8A 3FRJA 1EEHA 3IT1A 1VJGA 4ZKDA 1H8HA 2X6RA 4LY3A 1ZVMA 3WYNA 3P9KA 1L6RA 4ZVQA 3PI7A 4A7PA 1IN4A 5DP1A 2D1RA 3WWZA 4MCJA 4ON9A 4R2XA 3TYXA 3ZV6A 2CLHB 5IH7A 2Q3FA 3MUOA 4D9JA 2PRSA 1KBOA 4KK4A 1CUZA 4RGYA 4DREA 3JASB 4LTMA 4JC4A 3KLBA 2VTDA 3KYDB 4PC7A 4G0UA 4WN9B 9ATCA 1CHNA 2DFTA 3IJEB 3PE3A 3R4VA 2QP9X 2XA2A 4KN9S 4MV6A 4ZHSA 3WJAA 3BMNB 3EGWA 3SQNA 1FUYB 1J90A 5ALSA 3GA0A 1GPBA 4LHYA 2AC2A 4FHEA 4LY0A 4CI9A 3FSGA 1HK7A 4FONA 4QODA 3KL2A 4EPXA 3IV6A 4OJNA 4BCBA 5FTLA 1P80A 3GRCA 2DR0A 1MQ8B 4ALLA 2ISQA 5LD2B 1M0EA 4HFJA 5DWQA 4P7BA 5FPKA 4DYHA 4OK3A 4UTPA 3QYPA 3SPXA 2Z2XA 3KIPA 5T6MA 3I2FA 1MX1A 3JQAA 3PWKA 4NNOA 1I2AA 4FEAA 1THGA 5FOWA 5ALTA 5BVHB 4CKWA 2FP4B 4MP6A 3QYJA 3DO6A 2F43A 4I6GA 1VMAA 4XIYA 1RZVA 1UDRA 3AEKB 3FUXA 2OGUA 4KBFA 1U7OA 2XECA 3OZFA 4BVGA 5ER9A 1GITA 2YWGA 4NBUA 1EXWA 3MELA 5DP2A 3TSZA 3UOGA 5B3LA 5CBKA 4GZLA 5IM4F 3GOHA 4LMAA 5I7HA 4RF5A 4MVJF 4F7WA 3GG2A 3OX3A 3WZMA 1TTPB 4MGZR 3RIHA 3P32A 1KY2A 1TDJA 3EH1A 4K6KA 2OHVA 3ADKA 2VZLA 1UBLS 3HA7A 1D6JA 3BD6A 3JD4A 4MUEA 4PRKA 1BS2A 1RLJA 4U9IS 2ZYRA 5IZCC 5JMOA 2HCRA 5HQ3A 2ACVA 3OJFA 1RAAA 4J1TC 2JIPA 3QYFA 1PT7A 3KVVA 3AIIA 1DXQA 2IELA 3K0CC 4TMXA 3RKRA 3RARA 1I36A 1JPVA 3A6GA 4ERNA 3GLGA 4MMYB 3QEMA 2UXBB 1NUAA 4EOGA 2R4UA 1MC1A 1CLEA 2ZVJA 3IPRA 3ZGZA 1N6RA 1P73A 4TWAA 4N03A 1ZHOA 3ZU6A 4OHWA 5KTPA 3UENA 3QXXA 1GTRA 4U3JB 3E27A 1Y6ZA 2NACA 3BDVA 4KQCA 5JG7A 4JX9A 3D3QA 3I01M 1CRWG 2PVCA 3PE4A 4Q3KA 2DXIA 1ZH4A 3F4KA 2VYND 5JJIA 3UJ9A 3PJGA 2PSFA 1FYDA 5AVVA 2Q2WA 2H7CA 5F77A 3ZXIA 3D7KA 1RI3A 4OK5A 4UFOA 5AUNB 4LK2A 1X7GA 1B74A 3D6MA 1DQPA 5CNMA 2YN0A 4BNNA 3M5DA 3H1EA 2DR2A 3FCOA 2DWPA 2G1UA 3CURA 3R3ZA 1F2VA 1UF9A 3I8OA 2R1TB 4OOEA 1KO7A 4Y8VA 1YZQA 1IQRA 3WRYA 4DV6B 4BMSA 1LC0A 2QRVA 3RAEC 2CVPA 5IT9A 4A26A 3PNSA 1IPHA 3JR3A 3ELYA 3JZMA 1CUFA 4D0RA 2J9RA 2OCBA 3CH5A 5LB2A 2UVPB 1Z8DA 3NBAA 4MVJM 3AB7A 2OV3A 2PGDA 3WBFA 4G9EA 3UJ6A 1IVSA 2QX9A 4GPEA 1UC5B 3HS3A 2E5WA 3KEMA 3GJYA 4MYHA 5TQ2B 3W6OA 5KX5B 5CD9A 4LRXA 3NETA 2HRQA 3VI4B 4M1MA 2WOJA 3WMFA 4AUKA 5A3QA 3K20A 3EARA 4WBSA 5TMEA 1DV1A 4HH3C 2XXBA 4HV4A 2YQ5A 2QTLA 1KOLA 5J4VA 3BERA 3AV0B 2W2TA 4N5LA 5B37A 3EVNA 1L5LA 2QAIA 5GVSA 2XRYA 1E2NA 2ZFUA 2HL6A 2VNAA 1L1FA 1G3QA 1L5HA 3D4OA 4ZDJA 1D8TA 1RHMA 2NZYA 4CM3A 4MQUA 4FFBA 5KDOA 1NF9A 1DV2A 5ENZA 1ML3A 3R3JA 4YRFA 1F48A 1L5GB 3TQTA 1TZMA 3V55A 1QCDA 1N5JA 1R2QA 3OLQA 2IY8A 4WJKB 1J8YF 4Z8XA 1ODKA 3FLEA 4KSCA 3WHKA 5ICCA 1P39A 1AY0A 2GZ3A 3FOBA 3WBBA 5DM4A 3RS5A 3DKKA 4GGPA 1TRHA 5JI3E 3L7YA 4Q18A 1BKYA 3PC4A 3W0LB 4C4SA 3CZCA 2BTOA 3ED5A 3LX5A 4F6RB 3EXHB 1N6LA 1Q6ZA 1XEWY 2A1IA 2HRDA 4GQAA 3I58A 5JATA 3JWJA 4JT4A 2PYZA 3RJMA 2BI4A 4FDLA 3ZJUA 4LJ8A 5BWBA 1EK6A 3CNEA 3ZLTA 1KC1A 1QF6A 4XM2A 3EMDA 1A88A 4Q6WA 1J5PA 1L7OA 3I76A 4BIIA 2APJA 3CSUA 5HBGA 4DG8A 1GTSA 5HK8A 1NQXA 4JXXA 3WGVA 2UYCA 4AUEA 4GL2A 3CM0A 1VKHA 2ZSKA 5SY9A 1JHAA 3ITDA 2CV0A 5YASA 2R48A 1WM1A 3RDPA 5MF6A 4PYMA 1D1PA 2XOEA 3IOBA 2AIRA 5GV7A 1GPKA 4EGCB 5ISMA 1H8HD 4GGMX 2QY6A 4FLFA 4QDTA 4MJLA 2JLZA 4JYMA 4M36A 2PGIA 4S2UA 1KU6A 3GL9A 4OB6A 3TIFA 3ZZ0A 1MLDA 3ITNA 2XNCA 2GN9A 2JIMA 2P4SA 4IZHA 2QPTA 3WK5A 1BXRA 4I1UA 2W0SA 2W22A 3W5SA 2OZEA 1L5NA 1C30A 4EO7A 1HQKA 1S2NA 3A6FA 3QZUA 3OFVA 3EZ6A 4MH0R 4TYYA 4R1NA 1CF4A 2X2OA 3H17A 1NVEA 4NICA 4QYXA 2C2BA 5DTEA 3PEEA 1Q7CA 4QHYA 4WKPA 2X6QA 4KRXA 3GT0A 4OFBA 4QBFA 3FSGD 4BGIA 4BQQA 3FOFC 4Z1MA 4MW7A 4QBIA 5EUCA 4DHWA 4ESOA 1T0JB 1L3BA 3QQPA 1Y6FA 4ODIA 4CM4A 2Q5JA 1YS6A 3ZK8A 1H3FA 1YI8A 2RJ3A 4ZQCB 4IDOA 4AKGA 1ZNWA 4WLOA 5DNUA 2WT9A 2KMLA 1NI3A 4B82A 5E3HA 2FOXA 3ZHUA 1J33A 1VJ0A 3QW2A 3AU8A 3HU5A 5H9VA 2AYXA 3JQBC 2V4ZA 1G21B 4YREA 2ZI3A 2H06A 1PT6A 3HDJA 2FZCA 3PHIA 4H4EA 4DY4A 1IN8A 1V16A 1N2OA 1NVWQ 4NPAA 3QUQA 1RYNA 3WMEA 1G18A 3QLEA 1F38A 3AXSA 1MOQA 3SZUA 2X41A 5AW8A 3ZHTA 3KR9A 3GFPA 2HCTA 3O4GA 1Z6AA 2XUKA 1PTKA 1QHHB 1GQOA 4P58A 3HXPA 3ZHZA 3R6LA 4WASA 3RYCB 1DZIA 3I5AA 3RTCA 1GQRA 2G5TA 3I1FA 4X60A 3WB2A 1ZJ4A 1YZ3A 1DKMA 3AKYA 4BKOA 1U3WA 3IXQA 3JV7A 3OT1A 2IYQA 2A35A 2UYGA 3BJZA 5E95A 1UJ5A 1XKLA 1ORWA 3ET5A 4K9KA 4CCYB 4LGVA 4XUDA 5C81A 2GN1A 2Y27A 3U39A 2FG7C 3G23A 4JGBA 2F1IA 1S9HA 4N76A 2XCIA 3FI9A 4EB6A 2WZCA 2VHCA 5JBQA 1W76A 2V7GA 2C4HA 3LUBA 1MFZA 3OZAA 2ZCJA 3S27A 2VHWA 3NZEA 1JSXA 1A7AA 2GZMA 3AG6A 4XOIA 4NZNA 3EWSA 3WGTA 2BKLA 2CN1A 2DFVA 3A4MA 1TM1E 1D6MA 1F60A 4GE0A 4LZZA 1A9SA 1CNMA 4YPVA 3A10A 1WO8A 1NBAA 1GTVA 3BK7A 3GVCA 4RZQA 1Z35A 3ZGOA 2GESA 3GC6A 4BCDA 5DTMA 3HN6A 3QFCA 5BNTA 4LC9A 1AKEA 3WQQA 1UIMA 2G6BA 2I6SA 4UHDA 3FIUA 4Q3EA 3EXEB 3WOHA 1KQNA 3QJYA 4EKGA 3U7EB 3GRYA 5KNBH 1K8RA 2HW8A 3LA6A 2YXNA 2ZGVA 2RD2A 3HY4A 3Q15C 1H5NA 2X1VA 4KIJA 3KYJB 3NCTA 1H22A 3EVFA 1TO1E 3T7EA 3CT6A 1UXKA 3RRZA 5B2ZA 4TQ9A 4D0SA 2BGLA 2YVKA 2V7PA 4BBAA 4HBZA 3PYXA 2CVFA 2WP8J 3QK7A 3THYB 2B4YA 2BBWA 1CUHA 2QD5A 1NX9A 2OM6A 3EC2A 1EK0A 4JSYA 5KREA 5KYNA 2WC1A 3QEJA 5AW9A 2OZLA 3LOUA 1EHCA 2PAFA 3FFWA 5AKGA 3AKCA 3RYHB 4AJOA 1FIUA 2XBLA 2H9IA 2W2KA 3UXEA 3VVBA 1P4AA 1E1RA 3FGZA 1TCCA 1RHQA 3USES 1WA5A 4FQ7A 1Y5NA 4KE6A 1FDVA 5FR2A 4FGJA 1XC7A 4F46A 5BT8A 2YY5A 1OD6A 1N3BA 1RQ7A 3LIIA 3EFOA 2YQ4A 3KCNA 3FPSA 3WLKX 4OAQA 3NBKA 5LMUB 1YMUA 4EFDA 4HX9A 2CL7X 3LNCA 4R41A 1A77A 3UIEA 1JJVA 3ITKA 4MUHA 2YV3A 2ZRMA 1E4YA 3U7JA 2FPKA 2P9TA 3B7WA 1G38A 3QY9A 2Z83A 2FGJA 1FFWA 1FDIA 3EOBI 3P45A 2CDNA 3OPYA 2HJHA 3PDUA 3WJ1A 4F2PA 2PCJA 3F2VA 5KWVA 3K0AA 4GBED 1UPCA 3X1JA 1WZ2A 1I1NA 2VDLB 1XELA 3CV3A 3GUVA 2POQX 3EYAA 1SQSA 2I3BA 3BD7A 4KYVA 5EQDA 2XX3A 1BKSB 2F48A 4FIDA 2C9BA 4OXXA 1LQ2A 3C41J 2A5FA 3F6EX 3PIIA 2A1UB 3R20A 3ESDA 1GRQA 4A0QA 5BWLA 2NXWA 5ITZA 4ABTA 2X22A 2H1VA 3Q5GA 3H18A 2LZ0A 1K9SA 4B80A 2XI4A 3L7IA 1VSTA 3B70A 3DEAA 1J8MF 2VAWA 1XYYA 2XUHA 4UBNA 1YR2A 2J1LA 5T4BA 3Q8KA 4LKOA 3CLUD 1M83A 3VO1A 1SKQA 3AJ8A 4QT0A 5G0VA 4CG3A 3HO1A 3G0HA 3ZDQA 5J5CA 1TYBE 4D8VA 2B36A 3L1VA 3LY9A 2OPHA 1HZJA 3GPIA 4LJ6A 4TSKA 2YVQA 3E3LA 1P9RA 2NSJA 3MXTA 4HEJA 4MV1A 5NULA 1EXMA 5KDLA 5K45A 5DXAA 2FYTA 4N3GA 2I8AA 1OLXA 4XB6B 1UMCA 3HUTA 1TT5A 2FN4A 4IW3B 1RBYA 1WKCA 1CYDA 4KL8S 3VYUB 5JHHB 5KJCA 1ZGHA 3KSZO 2EHJA 2NTYC 1GU1A 3DLIA 1XVIA 3NT2A 4EG0A 2G08A 2I22A 1NR7A 2J5QA 3GFVA 4LYJA 4MVJP 4QHSA 5C3UA 3G9UA 4ZMBA 4LHZA 3OF2A 5TEVA 3IAUA 3O3OB 2P4EA 1U8CB 3R0JA 4QOJA 2AG1A 3RHSA 5A7FA 4W1SA 3W5DA 3LC2O 1E3WB 2ID9A 3PWZA 4KQ2A 2Q4OA 3QVWA 1NRJB 2VK2A 3AESB 4IL5A 4NDNE 4QLOA 2OCIA 4YQEA 2QTRA 4RV4A 4TN1A 4AX4A 2SECE 5IAEA 1JJFA 2VP0A 3L4EA 5KOYA 2BFEB 2H5JA 2VDQB 3EW7A 3MILA 3NU1A 4NQZA 4AZ3B 4JSTA 3GEBA 2X9QA 4GXTA 1HE1C 3AL2A 5BSWA 2Q8PA 4JOQA 3O21A 4KVZA 5TQJA 2EV9A 5FUBA 1DTWA 4PAMA 3H7AA 2G77B 3NP9A 1C7QA 4J1TA 4KUHA 2X9GA 5IW8A 3P20A 1VI2A 3ADDA 2OO3A 3GHHA 4JT8A 1GIAA 4MUKA 4RZUA 1E3DA 1VFNA 1V8FA 4TTTS 4YRMA 3QSYA 3R74A 1X3LA 3T9FA 5FOQA 2C5HA 2Z0MA 4PQYA 3WY9A 1O5TA 3CA8A 3LL4A 1BMTA 1R12A 1SVNA 3LBFA 1NXQA 3D7MA 3IULA 2HK6A 1P2FA 3CC8A 5JNVA 5M2QA 3FDFA 4LJLA 4MA5A 1DAMA 3UJPA 2FN3A 4DR7B 1FPMA 2B9EA 2R68A 4CCAA 4YAKA 5LZ9A 1D04A 1I7LA 2C4KA 4ND4A 3TQHA 1HKHA 5IKMA 4ARZA 2O5VA 1CUSA 5EKUA 3C5WP 3RC3A 3VX3A 3DZFA 1KY4A 1DARA 5DBOA 2WSSD 2PLAA 1XZEA 2FQXA 3GMDA 4W82A 1XRPA 4NEHB 4EFMA 1J2RA 3DM5A 5KNDA 1HNXB 5FNVA 1S1CA 3N7TA 5AUPB 3OC6A 1TVMA 1L1EA 3V8NA 4HNSA 2P4QA 2PPVA 4QUDA 4TMFA 4A2QA 3EZNA 4EJSB 4YMLA 2VT2A 4Q01A 2W83A 4IIYA 1C0IA 2C9YA 3UO8B 5KPJA 1IBCA 1F51E 4GX1A 2DUNA 2EQ5A 3IPAA 3N2KB 1OU0A 5CAEB 5BW4A 2XYVA 4OKNA 1Y80A 4QQNA 1V5WA 3BICA 3OA0A 1PEAA 2IDMA 2YC4C 1V4BA 2FPWA 2ZRLA 1VMDA 3K96A 6ABPA 1CY4A 3L7CA 7YASA 2I6GA 1CUYA 4YH1A 1OY1A 2D4AA 1JDJA 2FFBA 3I92A 3IPLA 3LT5A 4F3KA 2V6MA 1NONA 1OGJA 2YNMD 1RJFA 1OV6A 2ATCA 2H1RA 4P84A 3ZCRA 2JF0A 4ONEA 1FSSA 1YI1A 4FJ2A 1GXSB 1UWLA 5DB4A 2CXUA 1RFLA 2PXXA 3H1TA 1HE3A 4ZAVA 4HNAA 5FOSA 1TKCA 2ONYA 1DRKA 4WEOA 4GMXA 4AXXA 1SM4A 2Z8XA 3B20A 4HGQA 3G8AA 4EP1A 2HHJA 4TYQA 5JNUA 3K70B 1HC7A 2PXAA 4EY8A 2Z9CA 3R7WB 1MHPA 2V0NA 1JPUA 3IDOA 4X20A 1VIMA 3VHQA 3KELA 2OGTA 2VQSA 1OWOA 5FBZA 4B9EA 4EYGA 5LA6B 1AXEA 3F3KA 4DV2B 3MLBA 3N0VA 3OEYA 1PK8A 2ZAGA 1H4VB 5CYOA 1V1JA 2RJOA 1Y8AA 5DTQA 2Y4NA 4OHPA 4TTQA 1G64A 5BNWA 3A6EA 3U13A 1QBKC 1IY9A 5K8VA 1DADA 5LMZA 1W4BA 4BEWA 4OI0A 2CVQA 2IYZA 3AO0B 2WUWE 1BQEA 2RGXA 5JE8A 1OXXK 3SDZA 1Z88A 3LQQA 4XM1A 5D6NA 4EHKA 3H9CA 3JVIA 2DSTA 2QX8A 1YZKA 4GKKB 3VR0A 1GYRA 2Y76A 2V6GA 4WJZA 5DHTA 6NULA 4HR7A 1UBCA 1R27A 3AUXA 1QRSA 2VDVE 1UC8A 1CUBA 1VIAA 3CRVA 1YVEI 4OREX 2L2QA 4YRNA 1YOVA 1W4ZA 2E55A 2KBEA 4QDXA 5LDGA 5AESA 1FZQA 1WCIB 3EF0A 3IAHA 1FTQA 1VE5A 3AY6A 4UFPA 3JZFA 1FDWA 1MPTA 5AVRA 5GY7A 3AINA 5CBPA 2ZRKA 6GPBA 2YL2A 4G1UC 2P6NA 4GDFA 1GPMA 4FMPA 1R0SA 1NVTA 1P2SA 1ZESA 4OLJA 1SKAA 1TYZA 1TKBA 5DH9A 3VKFA 3UK6A 3O8RA 4OYRA 4HDNA 3EA0A 3TIGA 5SZHB 5MN6A 2IEBA 4CWAA 4UHHA 3D0QA 3QBVA 1SKBA 2WTAA 3DWGA 3LPCA 3UBMA 4X64B 5ALWA 4YR7A 2AQIA 1QH1B 2C94A 1TCUA 1GT91 5JRJA 1RC1A 2VH1A 4QSHA 3ZTWA 2C54A 4WBNB 4E2WA 1H9AA 3BHMA 3EULA 1G19A 1JEQA 1HKUA 2ZI7A 1SUWA 3HCDA 1QKKA 1Q95A 3H9UA 4XTCS 3L2OB 5JSUA 5GV8A 3NHUA 3R3UA 4RD3A 3W4KA 2H4XA 2GILA 2PWZA 4JUCA 1U9IA 3FH0A 3PC2A 1Q0SA 1H2BA 4IDDA 4JBIA 5HDQA 2AVDA 1MVNA 2VR1A 3CZ9A 4HUTA 4YGYA 5M5BA 4ZTZB 4KO2S 1OC2A 2ADFA 2EU8A 5E6RB 4FGKA 1DMSA 1YV9A 1YB4A 2J5BA 3CONA 4G5XA 5AKJA 4K88A 4NS4A 1N8NA 3BYZA 4U0JA 5EP1A 1E9SA 1JR3D 5H7XA 3ZWXA 2ZIUB 3ND9A 2QV7A 1R4MA 2QW1A 6ADHA 2ZJ5A 1HYGA 2YJGA 2QP3A 1G3MA 3SIWA 1E5LA 2BFBA 3Q1LA 5FD8A 1XTPA 5BPHA 3TAUA 2IYAA 3DEFA 5D5PA 4UBKA 4I9UA 3RYIB 4KE9A 3AEUB 5B4UA 3OKAA 5ED0A 1C3JA 1DO0A 1F8XA 2G4LA 5D86A 2O48X 1LSOA 2VZ0A 3W2FA 4QASA 2J31A 1FW6A 5C7OO 3VO2A 3SY8A 1MB0A 3T7JA 3SWWA 3KUDA 3CF4A 1QV7A 2P5YA 3FVRA 4J0QA 1QCZA 5EZ6B 3CLSC 3FFBA 4KDFA 5KQSA 3FPBA 3OQ6A 4KDRA 3PNVA 3AERB 4D97A 1YAHA 3E5RA 3G0IA 1JYSA 3L0YA 1P1HA 3PLRA 4UU1A 4KG7A 4Y3UA 2XB6A 1VLHA 3TUJC 4BNHA 1QQ5A 3P4UA 1JILA 2GLXA 4R9RA 1PFVA 3O8OA 2FAXA 5GJWC 4E6PA 2AG5A 1S5PA 1ONBA 1YONA 3UGTA 5BWNA 3NWBA 1OWNA 4HDSA 1J5EB 3G1TA 1K97A 2KW5A 2VT7A 4XSVA 3QV2A 5EL0A 2FB9A 2CVHA 4D74A 2GPJA 4MV8A 2I80A 3IMEA 3L5OA 4WNAB 1FNBA 2OVBA 3Q1KA 1PJBA 1UODA 4MP3A 4FC7A 1XP8A 4AY2A 3KU4A 1WSDA 3E9RA 4CMBA 1QQTA 1XYGA 2OQRA 1OH7A 4BPRA 1R5NA 5JSZB 5KNDD 4BO5A 1J00A 5EIEA 1W49A 1CP3A 1M7BA 4M55A 1FSPA 3NXSA 1H2FA 4L73A 3LZCA 1OXUA 3THOA 4DMFA 4LBYA 1XZKA 3OOWA 3SDSA 1MO6A 2CCGA 3KRTA 5DMXA 3V8MA 4M9QA 1SCJA 5I9BA 1BO6A 3R9KA 3RADC 2D7JA 3A14A 4FNOA 1C9EA 1EA5A 1XXHA 4DMLA 1JBQA 2GFHA 1W47A 5A62A 3LUKA 5M04A 2ZS8A 3GFTA 4IIGA 2V4MA 3GUZA 1N2JA 2YV1A 5M29A 2WVGA 5A1JA 1UDCA 2JGNA 4CR8A 4MPTA 2I76A 3HSKA 1MQAA 1Z12A 2KJQA 3ES9A 2NZVG 4BO8A 5I9IA 5A3RA 4AN1A 1R0ZA 3N7AA 4CQLA 1QQAA 1YIAA 2BH9A 2QJRA 4XGIA 4ALMA 1JFSA 5CLFA 1WY7A 3A6LA 1NVBA 3C3WA 3HJCA 1IJFA 4EYQA 1GKUB 3KZOA 1KA9H 4XD7A 1O03A 1Y8ZA 1J22A 4YQFA 1ZU4A 2QUJA 3JSXA 5ER6A 1BDJA 4TS4A 3RVDA 5J4HA 2GCGA 1M8JA 1UKYA 3PKIA 3S2FA 2P6UA 3RIGA 4KWCA 1KP2A 2ZT7A 3JWIA 3WGNA 2CHEA 1SCBA 2A92A 5IAGA 4D9CA 2W6ID 3GRAA 1ZM2A 1U0BB 2QRQA 1V6SA 2HOQA 3KHKA 2OC9A 1IPEA 4IJVA 4OXRA 4B7ZA 1SVSA 4D98A 1UOEA 1GZ3A 4FWTA 1BQ3A 2C0QA 5D7NA 1TGYA 1S2IA 1UDXA 1CUJA 4KQWA 4UM5A 5TX7A 2DCMA 1MIOB 1U0FA 3H9BA 3RCBA 3A6PC 2VWPA 2WRZA 5GMOA 1YZLA 1TD1A 3PL5A 1N3YA 3VSAA 4NSNA 3I6BA 1ADBA 2B3DA 2CXOA 2WM2A 1VMEA 2QJFA 3L7LA 2L0XA 4U7JA 5L40A 3PB3A 5EIOA 2JHAA 1GOTA 3JVEA 1AD2A 3BA6A 4M0MA 1LRJA 1TTHA 1TW2A 1LBIA 1ZN9A 3OOYA 3PC7A 4QBHA 3MVEA 5E7MA 1KMMA 1Z6XA 1DOZA 1Z63A 5SY6A 2FMUA 3VH3A 3KXIA 3VDNB 1CHDA 2IS2A 5F1YA 5KNCA 3OQVA 3ZBPA 2GSDA 2Q1YA 3W3ZB 2HUNA 4C14A 1X42A 1C50A 4IGAA 1OSNA 2UU9B 1UBTS 3DZ8A 3VBEA 1KI1A 2RJNA 3S81A 5BT9A 1MO4A 1HDRA 3E0QA 4FD3A 5ES3A 4B46A 3AI1A 4EHLA 2I9PA 1XDZA 1CIPA 3CXUA 3PXAA 1J7KA 1DCFA 4JJ7A 1XPJA 3OCJA 3ET4A 1NJSA 1X1AA 2QTAA 4ZJUA 1L4NA 3GJ8A 2EVWX 3KWLA 4OL9A 1CUDA 1WVIA 2D2FA 4C6RA 1A50B 2YIMA 3AFMA 3CR8A 2CGEA 4WLUA 2VTBB 1L4BA 4K9QA 1TVCA 1XIVA 4QGBA 2GXQA 1SWVA 2OYRA 3NUZA 4MVWA 1FFAA 4TTJA 1N6NA 2YRFA 3AZPA 4EYEA 1XVVA 1N2IA 1Y9JA 1CQWA 1GAEO 1L7DA 3FAZA 1IEQA 1OFVA 4CCWA 1FFCA 2TRSB 4Q4JB 5FWDA 5T4FA 1TVKA 1JE0A 3AR5A 3O95A 1GJRA 4LNHA 5HUHA 1JJIA 2CLOB 4UZEA 1DPFA 1CBUA 2O3JA 3TX6A 4D9FA 3PPXA 1OC4A 4FX5A 2YWBA 5A7HA 4Y6SA 4CV1A 2JIRA 4LJ4A 3T5AA 2XE4A 3BDIA 4PTYA 3RTDA 4I2NA 1MRSA 1VCNA 3RPEA 5L4LA 5DLYA 3FPCA 1T2NA 2QY9A 4UEQA 5EMHA 1EJ6A 2HCFA 3C6YA 2H1IA 4RL4A 5FIUA 2BEVB 2RSLA 3KDSE 1BFKA 4WY8A 1KWKA 1R0YA 2XCLA 5JZVA 4AZWA 3RREA 2C3UA 4MA0A 2PMCA 4CIBA 2GZAA 1PRYA 4DR5B 3BFJA 3Q2OA 2IBSA 3K6JA 2C5LA 2I4RA 2I7DA 1G5RA 3AJRA 2FPGB 4UE2A 4YCDA 5GONB 2OYSA 4DVGA 4MQEB 2ZREA 1EU1A 4L4RA 1SUPA 3B1ZA 4H7JA 1U9YA 5KWJA 3RB8A 2W2QA 4M8NE 1Z83A 4E2XA 1LB1B 3FBWA 2Y71A 4IIFA 4V02A 4YRBA 4KIFA 1XMVA 3A6DA 1HEYA 3DAHA 3NYRA 2W6ZA 4JQYA 3HJFA 3ZW7A 3I53A 1Q77A 1Z73A 3ELWA 1JR3E 1SNYA 1I1HA 1MBZA 3KTFA 3P0IA 1DIOB 4LYAA 4RA9A 3VV3A 4N41A 3IQXA 2GJAA 5AVOA 3EBPA 3HCWA 2JFQA 3N39C 3IR6A 4Q7JB 4F56A 1BHSA 4CM1A 1VBFA 3HYNA 5JANA 2HTEA 1WMEA 2QIPA 4KO1S 3T0FA 4CR6A 3M7IA 2JK1A 4BNDB 1TW3A 1CIJA 2ZR9A 3LO8A 4PYLA 4ASUD 5CIQA 4JL5A 1NGSA 1OFGA 1WWKA 1T24A 1E2DA 2AFIA 2YRWA 1SU7A 4BNVA 1NXPA 1KKMA 3A4NA 2REQB 5FORA 2VTEA 5K0NA 5SYMA 1SHLA 4RV9A 4D3FA 2UXCB 1W5FA 3QUBA 4UBOA 1D1QA 1R9JA 3EGIA 4IKOA 3MIIA 3NDIA 4Z9BA 4P35A 4P38A 4Q48A 3RUFA 1BDHA 3UW1A 4KNYA 2HQRA 1T5IA 1D4ZA 2C0CA 2OP0A 3F7OA 3VM6A 2YXPX 4JA2A 5BSHA 4WOCA 2CWDA 3SEFA 4L5AA 1V39A 3IT0A 2JVIA 1SQGA 3O8DA 2IPXA 4MIEA 2O2EA 1N2CE 4DW8A 1H4QA 3PA6A 1EBBA 4HN2A 1KY5A 3ZWQA 4GMKA 5JXHA 2VDPB 2ZJ6A 3GWGA 4RIHA 1IRIA 3M4YA 2HDWA 2JGFA 5F2NA 1S3SA 2DFLA 5D8DA 1EFPA 3D3EA 1N2SA 4IWNA 3AM3A 1Z7YA 4XQEA 4NJMA 2BFAA 1SVWA 4AP5A 4ECAA 1C8BA 3V7UA 4O3FA 2JLYA 3ASZA 2Y6UA 3I9LA 4QIHA 2FU5C 2IQ5A 1Z7BA 1A9ZA 4B79A 1WDWB 4C21A 4DOMA 2UUAB 1DJLA 1VYVA 1CUUA 3H87A 5IXYA 2O2IA 5D5QA 2OBMA 4KXQA 4X85A 3C87A 3DM9B 4IOJA 1RYBA 4XIJA 4YJFB 1NXSA 1JQ3A 5ESWA 4B3FX 3G8CA 2C2WA 3K5HA 5CK5A 3U3KA 2IKSA 1JMKC 2OAGA 3IVMA 3S7ZA 4JU8A 2D2VA 3OCZA 3HM9A 2BGWA 3PJEA 5HUJA 3G5MA 5IANA 3AHJA 4G1MB 3PFKA 1AKVA 1CUIA 4MQ4A 3UMBA 4RHUA 3ACDA 2O2HA 3KOZA 4LRTB 3ZDXB 1IAVA 1QF7A 1WW3A 2P9JA 2PO7A 3KPYA 4UVDA 3H11B 3FYHA 2J5RA 2WHPA 3NGLA 4U2FA 1KJZA 3AMVA 5HF8A 1L5YA 3NRBA 2ROQA 5DN9A 4LE2A 2V5VA 4GICA 5EC8A 4BYGA 2O8BA 3N8DA 4KVGA 4R8RA 4ALJA 3K6SA 4DLAA 3STXA 3ZE1B 1QE0A 1ADYA 2CDBA 2ODNA 4CEHB 5AM1A 5CJ2A 1IZ7A 3NBYC 2WF9A 2XNKA 1YI0A 4NV1A 5HNKA 1SHZA 2NNWB 5JMWA 2KWIA 2YWCA 4TKMA 2J08A 1OI7A 1TPYA 3EG9A 421PA 2XB4A 1NE7A 2W4QA 4YECA 4AMYA 5AW0A 1P45A 4K9MA 4HWOA 5HTOA 2WE8A 5JZ9A 4EX7A 4I3GA 5J47A 3H5IA 3QOXA 4OATA 2ZJ1A 1PVOA 2YUIA 1S2LA 4A6EA 5HQJA 4RQBA 1N7HA 3AF2A 1PBTA 4KSBA 4Y9DA 5CT4A 2J0SA 1R3UA 3EQ6A 1AUOA 1P9WA 1T2EA 2R7MA 2ZRFA 4WKBA 5B36A 3PT5A 2QI9C 4NJEB 1CQJB 3C1UA 4NDZA 3LO5A 1B6SA 3SDBA 1OGYA 3BF7A 3PCXA 3T9EA 3QH4A 4F1KA 3LWNA 3VDXA 1AK1A 1HI9A 1Q20A 1RPJA 3E1KA 4J43A 4S05A 3KQVA 1C8LA 5EJGA 3DOCA 3BS4A 2WYVA 4G24A 1N5RA 1TQ4A 4Z4IA 2BM9A 5EESA 3CPEA 5DYWA 4JN6B 4BJ5A 3DV0B 1DG9A 2KI5A 4EITA 2JZOA 4XLZA 4HLCA 4HEA1 5HIJA 4BFVA 3VGPA 3HBLA 5FQOA 2C5FA 1DX6A 1HQYE 2QOEA 2VNHA 1JHDA 5COBA 1YRAA 2QZSA 5DLEA 5HCNA 1QIDA 2XF2A 4ZQGA 2G82A 5ENVA 4M1YA 3CVVA 1V8BA 2OD7A 5BSUA 2OC4A 1BXGA 2H00A 4H17A 4R3WA 2B4KA 4KRGA 2ZW9A 1T1SA 1G20B 4RUKA 3ZDAA 2DBVO 4JC0A 4LJYA 1GZVA 5I4BA 2TSYB 3W7VA 2GPTA 3AUJB 4FGWA 2IOFK 4KREA 3FDJA 3W9SA 1Z22A 3GH3A 1H2RS 1PX2A 1XCJA 2OV4A 2V7XA 1V2HE 1TOAA 3HA5A 1EFVB 4OX9Y 3EJ6A 3GU3A 1N7JA 1U94A 3OTQA 5EFZA 4BP1A 4HVAA 4US1R 3FMVA 4ERXA 1M8PA 4IGEA 5K8UA 2DQKA 2CXQA 5KNDH 3IKTA 2E82A 4QOEA 3UFXA 1Q0ZA 2BM8A 4ITUA 2ZEJA 3DVRX 1RE1A 1UINA 3CU5A 4FUQA 3TLKA 1W6UA 4LXIA 4CLEA 3VKGA 3TTSA 1ABFA 2PYDA 2JFNA 4LCBA 4LTNA 4Q9NA 2R8OA 3MLAA 5DGCA 2ZVPX 4Z1OA 3JYPA 4FXOA 3M70A 4PO8A 2J6IA 3S5UA 3AUTA 4QX6A 1E92A 1E4VA 2OQ2A 2ZB2A 2H0QA 1P29A 5FL7D 5FPYA 2EFHB 1IHYA 4MW4A 1QZZA 4YMSA 1HO3A 3UXMA 3NDBB 3RFTA 3BJEA 2PZ8A 2VAMA 3FPJA 1HSOA 1ZH8A 1D2HA 2GAFA 3K2IA 4L5JA 2IC5A 3ZW8A 1A5BB 1XTZA 1GILA 4RWZA 1MC5A 1TM3E 3RK4A 3IPCA 3VU8A 5K5EA 4OBEA 1D2AA 2GHRA 3C7AA 4S0XA 4YUYA 5EJEA 1XMPA 4CI0B 2VT3A 5ERYA 5TLSA 1XPRA 2KLBA 4RZHA 1Z4OA 1L7AA 1QTIA 3L7BA 3VH4A 5TV2A 1QJ4A 3GFOA 4MZDA 3WIEA 4PRYA 1E7MA 1Q57A 1AKMA 5ICFA 4O2RA 3OAAA 2BF7A 4HDKB 5IH3A 4O4LA 1U6KA 4MYSA 3EIFA 2BH2A 3RTBA 5HQTA 1QCCA 4NLLA 3OJLA 4JSRA 2FZVA 3DL4A 3N5KA 4GU5A 4YRAA 5IC4A 4WNYA 3UBTA 4IJQA 1C7RA 5BW5A 2HAEA 2EERA 2WILA 1NXVA 1ZFNA 1X7DA 4G3XA 1VRVA 2VG8A 3G2MA 4K9LA 1T4GA 2CE7A 2ZRCA 2C42A 2GCOA 3HXTA 5KSPA 3L6RA 4XUCA 2YS6A 4G8BA 1PHPA 3KXDA 2AEJA 3WNQA 1M1YB 4BBZA 3FFTA 4L8LA 1YXMA 2JFVA 3EXIB 4DWOA 3TAXA 3P2KA 4F4DA 3WLPA 3BHIA 1F2DA 1T0BA 2ZSFA 4IXDA 2DFPA 3CS3A 2OWEA 2IOHA 3OIUA 1NJ8A 3SC2A 4BUJA 1XD9A 9ABPA 3DMTC 3O8QA 2PSDA 4I9NA 4AC9A 2G1KA 1Z39A 2HNBA 1D2EA 3SF8B 2AG8A 2I8LA 1GYPA 2V96A 1KVUA 3AEZA 2C9DA 3GFFA 3L7OA 4LJ9A 4MS3B 1B23P 1DLJA 3VKHA 4B3SB 3H16A 1WNTA 3A2LA 4OGWA 4A6PA 3P2OA 3PF9A 4FOSA 2FRDC 4QC2A 1IN7A 1XU4A 1Q0HA 2R4QA 3PQDA 1G8HA 1OVMA 2CXSA 4YRKA 5EXXA 4WJLA 5HZGA 2WJ6A 3NHKA 5ALDA 2GKGA 2QT1A 1X1QA 4MPJA 1KDVA 1I7NA 1OAOC 2KQUA 2BZGA 5AKZA 3JXEA 3RRXA 5DSZA 2MSEB 5JAZA 2J7PA 1J6UA 2PS0A 3CR7A 5LYYA 3L02A 4QDOA 3ADCA 4AY3A 2HR1A 3ZWVA 3B36A 1EA7A 1NKVA 1W9HA 2QN6A 4OF4A 2Z3ZA 1R5OA 4Q4AA 2B61A 3KQQA 3UJAA 4BLWA 5AWFC 1TU0A 1SUDA 3IP9A 4MYTA 2Z2YA 2DUWA 4YRIA 2P4HX 3WB1A 3B6JA 4TKUB 1H2ZA 4ZCPA 1VE3A 3VHLB 5K6AA 4MSUA 2ZRPA 2GCPA 2ZTVA 1BW9B 1B1AA 2ZCVA 5CFPA 4CIWA 2QLFA 3KT3A 4Y2TA 4OUDB 1ZNYA 4PINA 3EMBA 1NVFA 3CH6A 2WJYA 4ZOEA 1EZ1A 1JKIA 5JLJA 1Z0UA 5KC9A 1ZR2A 1QHGA 3BOSA 3VDMA 4AB1A 4OFZA 3OZUA 5CUQA 3O4RA 1X92A 1ECGA 3GZ4A 1DAGA 4EF5A 5B30A 4RE5A 2ADMA 3QX7A 5FH9A 2VNSA 4J3FA 4KXWA 4BQPA 5D5HA 1VCHA 4WOBA 5A6SB 4MTLA 2OCXA 2ZR8A 3A25A 1JSZA 3SEZA 4YN3A 1WHSB 3V1NA 4V1CI 1HH4A 3LF1A 1E0SA 4ZP1A 3CGGA 4ZTBA 1OBOA 1RPTA 2NUBA 3HDTA 4RX1A 4DM3A 2JLXA 4P2GA 1EWKA 7REQA 2R47A 5FNVF 4R71A 3BRQA 4I55A 1ULBA 1KH3A 1OXKB 1GDDA 4I46A 4X63A 2VUHB 4CM8A 8ATCA 2VCHA 1X1RA 4ETWA 2WIJA 3L3BA 1IQ0A 4MGHA 1FTYA 4Z2YA 2I91A 2GOYA 5JW6A 4HNHA 3UGQA 4F9FA 4XQCA 4MHTA 1Y8RB 3BJIC 4GVLA 3GGOA 1AGNA 2HN9A 3DMFA 4P4UA 1E1CB 4OQMA 2UAGA 3LUAA 1VBNA 4YV0A 4IHJA 5AJUA 3LW7A 5L9AA 1YU9A 4FGUA 4I1RA 3OQBA 2XUDA 4ND1A 2VPIA 4X95A 1Y7IA 1YS2X 1YQDA 3I5UA 4OSPA 4PGMA 2R1VB 1SVLA 4TTRA 4YCMA 1LF5A 2I7TA 5INTA 1D3AA 4BNLA 1NKSA 3OMLA 3H4TA 2OL4A 5ALVA 3WMGA 2XYPA 4HKTA 3GO4A 3GA5A 4K2HA 5IC6A 2ZT6A 1SJ9A 3BVPA 1PFUA 2PGLA 4QO8A 4YACA 1E3IA 1W1IA 3A70A 3ENVA 4BV2A 2QQGA 2UYQA 5BOSB 1JR4A 5BWCA 1RFGE 5FKJA 2I67A 2MR6A 1BG6A 3C7TA 3Q11A 4HGOA 2V7BA 1V5EA 3MGKA 1M34A 3KYCA 1YR3A 3V2IA 3N6VA 1BD3A 4UASA 5H16A 3T3PB 4BNIA 3G59A 4FCWA 4HXGA 1EFAA 3IUJA 3OT4A 1IQUA 4RF4A 1Y34E 4DIFA 3IL2A 3P2MA 3UA4A 3V2HA 5AVTA 4BO2A 3NV9A 4RFVA 5IEBA 1OFUX 1AG9A 3HCFA 3BMXA 1QIHA 1F5SA 1KPIA 4NU6A 5FF9A 2BHTA 2A0KA 3FMPB 4E2ZA 2J3DA 3E9MA 1R8JA 3TQOA 3VSEA 2QTZA 4C9BA 1NQOA 2E5LB 1N5MA 1E64A 3ICQB 1FMJA 5EINA 4PLYA 3HP7A 3GN1A 4Q9DA 5E9AA 2EW1A 4KPEC 1FVFA 4ZT3A 1YQWA 1DUVG 3RASA 4B7AA 2Q4BA 5JI2E 1O6FA 5FA8A 1FP4A 2A5DA 2D2XA 3MINA 1WU7A 1X80B 5EYPB 5EI5A 4QGSA 2NO9A 2P9YA 5EWLA 1PJRA 4ZU3A 2FPPB 4R69A 2OBLA 4ACBA 4D02A 4EA8A 5I7SA 4IF6A 2ORED 2BEUA 1ONPA 2KE5A 3G1WA 1RBQA 3TSYA 3OCUA 5HZMA 1Z4MA 1MG0A 1CY2A 2B4AA 2GN0A 2JCXA 2C3OA 1YZVA 2DBYA 4JI1B 1PNTA 1KK1A 4WLEA 4YAIA 2WYHA 4OQFA 3VDQA 2FW6A 2Y1FA 3SVTA 1LI5A 3N87A 4ISCA 1SXHA 3U16A 4LAFA 4DJTA 2H4JA 3BWCA 4Q7KA 2IEGA 2MINA 3SYRA 1AM4D 4GZ3A 5E0KB 4A10A 3OURA 5DO9A 3U3XA 1K66A 1FRNA 3KQYA 3TLCA 2JGDA 1JFTA 4MR7B 4ZCQA 3LFTA 4QGHA 4IH9A 4DNFA 1KVRA 4TLLB 3I2KA 1DKUA 1VCIA 2W70A 1RHUA 3IDQA 1QC5A 3JPYA 5AK6A 3U81A 1N0HA 1KEKA 5CCBA 3U7FB 2IEZA 3FVQA 1QAOA 3E18A 1TI7A 4DS3A 2DKFA 1V48A 1PVVA 3A58B 3SLKA 3X1YA 4CUJA 4DANA 4YLGA 4M1ZA 3RUPA 3E4CA 2IHKA 1Z74A 4PYIA 5FPHA 3T7KA 4CR7A 5KNCH 4MVCA 5IT5A 2JLAA 3LPDA 1SXJC 3KD3A 4MIKA 1F6DA 4HAZA 3ABOB 3FB4A 1F0YA 4TZ0A 1RRFA 1JKXA 1JZSA 2AJCA 4V3CA 521PA 1SG6A 2BR4A 2ZITA 1T5SA 2WLSA 3C3BA 2G09A 3F8TA 3HBFA 3HL0A 4M76B 3OPVA 4CMIB 1NAHA 2G17A 4KQGA 2ZRJA 3G85A 3RVKA 1UPFA 1SY7A 2HGSA 2QZ9A 3HM2A 2E9SA 4ZYZA 2X14A 4LN1A 3Q10A 4ACAA 1ULUA 2EL7A 3MGBA 4YR9A 3FHJA 1F9AA 4ND3A 3ZZ1A 5KQPA 4WZAE 2BYTA 3P0EA 1YR9A 3C8DA 4K5QA 1OZHA 1JZTA 3G7NA 2R6JA 3ILXA 1DXOA 3PWSA 1JEDA 2Q1XA 2X0EA 2FWPA 2C0PA 4N0EA 1K7EB 2A30A 3DVLA 2QDKA 4YP9A 3CH7A 2BJVA 2CLKB 1VXOA 1VPVA 2R5NA 4ZHQB 3G8YA 1YBVA 3AOEA 4CLXA 3D6AA 4WCDA 1U31A 2A88A 4J1SA 1N7IA 1KKUA 2Y92A 3LTEA 5ALGA 4C4TA 3DVAB 4RZXA 5BV8A 1NMSA 2R2AA 2VKQA 2H17A 2FDCA 1SA0A 4HQNA 3RIXA 3N70A 2Y3IA 4L2IA 4X93A 1QCYA 3TTUA 1YQXA 2YHBA 3T54A 3ACBA 3AFOA 2J6HA 3MTDA 4MRMA 3J7TA 4TKZA 2RFLA 1PNVA 4PYJA 1RXVA 1FRVA 2VNKA 4HEA6 4FI3C 3WLHA 3B5EA 1WS6A 3CF4G 3NHSA 2YXLA 4MR9B 4EPVA 2PSEA 2FR0A 3QLJA 1RAIA 2XGGA 1AQNA 2Y6VA 3QRWA 1S89A 4MCIA 2QUBA 1TMOA 3ABZA 4IXTA 4ZGWA 1MC4A 3FZEA 1C3EA 1PQPA 1ZIOA 3H0KA 3PUZA 4FDTA 2ZBFA 3AHGA 3O03A 4JLSA 3KUUA 4KQKA 1HT1E 5EHNA 3RIMA 4DWJA 1QZ3A 1JR6A 4YDSA 2XB9A 2JA2A 3EVGA 1BVYF 1V6CA 2RK6A 3MUEA 1P1CA 2D62A 3E9CA 1G5QA 3N8KA 3LUDA 5TPZA 3I9MA 2RDMA 4L8WB 3BMOA 1DQYA 4ZC8A 3WYBA 4EUKA 4IDBA 4DMUB 3ASUA 1MZVA 3H99A 1PI3A 2DHDA 3QE2A 1PE0A 4LYEA 3RT7A 4C08A 3K1AA 2HDOA 1FTSA 3K53A 4G5YA 1PNOA 1E89A 5A5VA 3OFKA 2H63A 1I9CA 2ZSJA 5JYDA 3UG6A 5BSMA 3DBLB 1PHRA 4A36A 1ADCA 1IG3A 2PD4A 1XCGB 2IXEA 3HB0A 2HSGA 2BJHA 5COAA 3WO0A 2IHJA 4M54A 3ZY2A 3WK6A 3G0OA 1FP1D 1EK5A 5E7IA 5JHGB 2W5UA 2B8TA 3GFBA 4RCYA 5IAJA 1V8OA 4NPCA 4OG2A 2IU6A 1WB6A 4GP7A 1LBHA 1NI4B 3FPGA 5DPMA 3V1TC 5I7VA 3R5TA 5FUXA 2YH2A 1UPBA 4MJ3A 3ZEIA 1QM5A 4N18A 1IEWA 2QRGA 2JLQA 5G4KB 3T1OA 4HQOA 3Q3EA 4L28A 1T1GA 3VR6A 3ESAA 2GN4A 3K8QA 1XEXA 1S8OA 1XDUA 4IVNA 5IUNC 1XJWA 2J85A 4J1NA 4MV7A 3TB4A 1DKPA 2C2HA 4MLCA 1PV1A 4TVSA 3P9NA 1G66A 5TMPA 1NM5C 5H8WA 1O8CA 1XWIA 2WU3A 3OIDA 3DHEA 1TKRA 2BHNA 1T6BY 3VR5A 2AXNA 4QGGA 1AS0A 1QP8A 2NTJA 4F5ZA 1AUVA 1UM9A 1WG8A 3NORA 1I3NA 4OQ4A 3ZV5A 5IS2A 2QMQA 2ZWVA 2R0QC 2AEEA 1SKYB 4WLNA 5DYTA 1KZYC 3GNTA 3CZ5A 4YUXA 4CTJA 2HH9A 4PV7A 3A9UA 2IY7A 2AHOA 4CG1A 4B3XA 5TVKA 4UCXA 4MGYR 5JSKA 3T9BA 1V11A 2KPOA 3S8YA 3T1TA 3I04A 1CU1A 2IXBA 3OZCA 3PG5A 2VF8A 4QAQA 4R1LA 2WJGA 2LVBA 4ZI5A 1P4SA 1B1CA 1J06A 4I50A 1PEDA 4URFA 4D3SA 5C7LO 3BIXA 2PUCA 1RI4A 3DR5A 1U8ZA 4Q3LA 1BEEA 2LR0A 4F4HA 4KPUA 3H5OA 5A9TA 2RC6A 4RA6B 2AX4A 1DQZA 2WIFA 2WWGA 1O95C 1SD2A 1PJTA 4L5IA 4OHXA 2FZKA 5KJEA 5AW4A 5K0EA 2F00A 2FSFA 3V4ZA 4IGFA 3CMCO 2NVUA 2ZXFA 2Q2NA 2FEXA 3MBOA 3UM9A 4HNTA 5A9SB 1M0TA 1R15A 4BLSA 4R0MA 2OKCA 4FMDB 1M0SA 4IV5A 4S1OA 4MQFB 4LZOA 2AN9A 4BO9A 3IYLW 1XK6A 5IF9A 1ZR4A 3RWMB 1CRQA 3KJFA 4V39A 2FSUA 3RG8A 4A3SA 4NCKA 4BU1A 5JDCC 3RVSA 1SOWA 3H2SA 2ACWA 4Q66C 2FUKA 4XPZA 2FGKA 2YZKA 2VHUA 3VFDA 2JD0A 1NTRA 1KQPA 1U5AA 2IUEA 3D6VA 3LA8A 4F8YA 2BGGA 4YJGA 2OHJA 2W6JA 4C7BA 2D00A 1WXDA 1FU4A 1XG5A 2C20A 1RI5A 4X3OA 1M3SA 4D6YA 3B6EA 1EFKA 2W2XA 2O1XA 3S2YA 3O7WA 1J1UA 2AKEA 3W05A 1MAUA 2JGKA 2OB1A 2VP2A 1L5RA 4RV5A 2NUPA 1G2IA 5F9FA 3MQFA 1LLCA 1T36A 3S1AB 2AH5A 5J2TB 3Q3GE 5TF4A 3CH4B 2XIJA 1P6XA 2NU6B 4P82A 5EZQA 4YHHB 1O94D 3I05A 4LCEA 1SVMA 4TTVA 2NM0A 4PHCA 2ZUSA 1ORHA 1XD2A 1Q7GA 1ZONA 1H69A 5AM5A 3KQMA 5BUQA 2XMGA 2RGGA 4KN5A 4CDMA 2GA8A 3WLTA 4DABA 2R3SA 1QGED 2GM4A 4Y2XA 3W7AA 1V1RB 2I1VB 3A32A 3P7MA 4JYCA 4CKYA 5C8DA 4F93B 2CJYA 3VVCA 3CIFA 3EXHC 1NMQA 2BFFA 2JAPA 3B3GA 3M3DA 3FETA 3WKEA 2HPZA 1IUPA 1KO5A 4RLQA 1R6UA 1OYWA 1OX4A 2C77A 4D25A 3BMCB 5F3RA 3RBVA 3CEHA 1W59A 4FC6A 3MK31 1AK9A 5B3JC 1P0PA 4J76A 4B48A 5KSYA 1IQPA 2R44A 1Y9AA 4DLNA 2JRCA 1LBTA 3AETB 5B2FA 1EZ4A 2EIHA 3JYQA 3OLWA 4LIPD 1X7XA 4NFSA 3V1YA 1KMHB 3MA0A 4HZGA 4FSHA 4P3XA 1U1IA 2IHVA 1RCUA 5HXAA 3JD1A 1AURA 1Y98A 3D54D 2XUPA 4B8YA 2JVJA 3IUQA 2CLMB 5HCIA 3KBBA 4XARA 4D81A 5K0FA 3TGPA 4TL6A 5FEMA 2WBLC 3BHNA 3QLUC 4K1XA 1XZJA 4BO4A 1JEYB 4JT9A 4WRRA 2OO5C 2O50A 4I1VA 4TKVB 3UGJA 3JARB 3VR3A 2WWWA 4URZR 2J6CA 3KALA 2A59A 3IQIX 4LC0A 4NBTA 4AMGA 4HN9A 1CCWA 1EGAA 2RGBA 1JEOA 3NYIA 5F4BA 3AWIA 4UEOA 1QAMA 3IS3A 4J0DA 1EQAA 2YMMA 5ABPA 1CERA 1C81A 3M3PA 5TPZD 2BELA 2CMKA 4LZNA 2PQ0A 3TW8A 4UCWA 3WGYA 4ZJZA 1FLNA 3E9ZA 3EASA 3KT6A 5HDBB 2QUZA 3TDMA 3AZQA 2PX0A 2WOOA 2ZYUX 1NJGA 3QWHA 5B58C 2P9BA 3ONVA 1PWHA 2PBLA 3OF5A 4AS1A 1AQUA 3ZGLA 1E3SA 3M2PA 4KW7A 3DVSX 4OY3A 2AFRA 3OWXA 4M1KA 2YV2A 1DEOA 2H2FA 1GO2A 4G4SO 5CFZA 3FUUA 1E5QA 1F17A 2PZMA 2ZU6A 4O29A 2J09A 3M6FA 1YB5A 1G63A 5AO9A 5JQGB 1E9CA 1BE0A 5LP1A 1LV7A 3EVDA 2EZ4A 3CTPA 2P91A 5ALKA 3S2SA 1CS0A 3X2SA 3H2JA 4PYNA 4QVKA 3DEIA 4PS0A 2XKKA 2NUAA 5EKSA 2FKAA 4M7RA 4UM8B 2CHUA 1N1GA 2QL9A 3QVGB 1WQ1R 2FTKE 2GEKA 4AMUA 4EMSA 4DUZB 2J3HA 2V7TA 3IQEA 4BLTA 2OFOA 1YH3A 3SFVA 5FDFA 1IHXA 1UBMS 4YAJA 3OM1A 3SC6A 3E7DA 1OBVA 4BAZA 2F43B 5F98A 4ZDKA 1ZUD1 1ZC3A 3SQMA 4HQ6A 5B7QA 3T15A 2ORIA 2PRJA 2O2SA 5IJZA 3R9WA 3VR5D 2FQ1A 3DULA 3G5LA 4GRDA 3HU1A 2Y0CA 4R8KA 3NVKI 3X2FA 4JOBA 4OHVA 1IEXA 4ROSA 4X7BA 4BX0A 3K4QA 1PGPA 1WVGA 4ZRDA 4MW5A 1ZUNA 2FVYA 2PD6A 3HMKA 3N2EA 4TRRA 1PFWA 3W6PA 4C43A 1YR7A 2JI8A 1MTZA 1D0SA 4YJ2A 4Z9XA 3W78A 1SB8A 2QKYA 1T9HA 3DWEX 3JALA 5ITVA 3W8RA 2RHCA 1GCOA 2VYCA 1GGHA 1Y37A 3MJRA 4UUAA 4MDFA 4B3RB 5KPDA 3Q12A 1PSWA 1W85A 1TVEA 2EQBA 2QAJA 1YVRA 4OMCA 2D5IA 4B81A 3AU9A 4V38A 2C4VA 2CDAA 4KQFA 5IK2A 4MICA 4ZYXA 3VKWA 2WMOB 2G4CA 2RK4A 2JI4A 1HYHA 3E23A 3TEMA 5AHWA 1TUIA 5IABA 3K9FC 2EYUA 2R6GA 4QATA 1WMBA 5J40A 5JALA 3BIOA 3N6RA 1OOEA 4PHFA 4Z0HO 1I01A 3P9IA 2JH9A 4HDAA 5A4MS 1MW9X 1ORRA 1JTEA 2IA5A 2O3QA 3QIVA 4EZEA 2CCJA 3C3XA 4IAOA 4TWJA 4BRZA 3SR0A 4RTLA 1TGVA 1UP7A 2E4ZA 3SX4A 4EGQA 4IO1A 4RU1A 4RACA 3SE0A 4WAUA 2Y0EA 2PDAA 1RQPA 2A94A 3HKBA 2O2GA 4TLCA 5AI9A 4C6HA 5A6VA 3GCWA 2JI7A 3PQ6A 2ZI6A 4GM4A 1P2TA 1Q0QA 2A57A 4I4TB 4UVEA 3SBXA 1SULA 1UT8A 2GAOA 3CTMA 5IXJA 3IPXA 2GZ1A 3DL7A 5CVJA 3ZJ5A 3KHTA 5EIBD 3SSOA 1V7CA 4OA5A 4ZCIA 4JI0B 1JHZA 3ITEA 3WKCA 3Q3JB 5F7XA 4E3WA 2DPGA 3K4PA 4PONA 4F97A 2HA5A 2BGMA 2DSNA 3KZMA 3W5VA 4B0PA 3V8PA 1JDVA 1EBFA 1IHUA 3HDYA 3ZBTA 4A0FA 3QBJA 2EKBA 3ANXA 1L0BA 2NPFA 2BBTA 2HRRA 2RGYA 3OMXA 2JCBA 2YKGA 4ZYYA 5LOVB 4B7UA 4FB4A 4DDUA 5F4ZA 4B5LA 3PC8A 3LZ6A 2CWWA 5KOHA 4PYKA 4CM9A 1OH5A 5F52A 1TIBA 5A04A 4J49A 3ZK9A 1RR6A 2AXPA 3OTHA 2G71A 1XFAA 3B85A 2GF2A 2PL9A 4HWSA 2D54A 2O7SA 5H3LA 4LY6A 3AVTA 3EDYA 5EUMA 4PBTA 1H94A 2MU1A 3WSVA 4G09A 4C76A 4JZYA 5I45A 4A0GA 3C98A 2BUBA 2HWKA 2RMKA 3GJXC 1ISSA 3F6YA 5EJ2A 5IKOA 2MCFA 3TEJA 121PA 1L4LA 2O2XA 3CPJB 3TIIA 1T9GS 4JAVC 3IAXA 4UDYX 5DLPA 2JW5A 3D5TA 3QOWA 3DAYA 1PUJA 2P4UA 4PFKA 5DKFA 3T7CA 2PKQP 4XGRA 4QFMA 1KFJB 4MAFA 3DO8A 2EATA 5HSGA 1ZM9A 1JVBA 2Z3VA 2CMGA 2IFTA 3ROTA 3ZU3A 3PPYA 4L0MA 2CXRA 3UMCA 4L16A 2WM9B 2PUDA 4E22A 2WYIA 1ENYA 3N2GA 4FDAA 4J2HA 4EW2A 1GL7A 2VHVA 5K6RA 3JASA 2I3GA 1HDOA 1ZH6A 1BXZA 3NG1A 2IV2X 4B6JA 4WN9A 1U8YA 4DB2A 1B8VA 1EDEA 1N6OA 1RXEA 1O97D 5EMKA 4OBWA 1ULSA 1UZNA 2Y05A 3BMNA 1L8XA 3LK7A 1NLZA 3DBHA 4F3YA 4M6WA 1DUIA 2I3ZA 3BSSA 4GBMA 1HZZA 4QPZA 4G0QA 5K2MA 2CB9A 1VGVA 3BIJA 3TS1A 4YX9A 3NH6A 3Q7EA 2PXHA 4AKTA 2F1RA 1II9A 2H8KA 2C04A 5FBWB 2XUGA 2VPYA 3LCRA 2VS1A 1BWRA 3K9BA 4WXPA 4TT3A 3UV3A 3FHCB 1XRQA 4GVXA 5BVHA 3O1IC 3EIHA 3C8ZA 2Q8NA 2OV6A 2DUJA 3GT4A 1OT3A 5U4QA 1N57A 2DYKA 2GEVA 1Z2PX 1BXRB 5KOJB 4G89A 4OM7A 1DCKA 2RCYA 4GMFA 1F2TB 3WWDA 4E51A 1ZGGA 1C30B 3SYKA 1IZZA 5CH5A 4J94A 4EHJA 3G2QA 4RQUA 1R6AA 4KYUA 2ZWOA 3G79A 3KWMA 5HVNA 4TVKA 2WDZA 5TEWA 4RTOA 1CXZA 1OROA 3HG7A 2HXSA 1Z6ZA 2C3YA 3C5HA 4EG4A 2A9PA 5KSOA 1I6KA 3OC0A 5SZIA 1MEJA 1IM8A 2CNWD 3QBDA 4AJKA 1DX4A 3RANA 5C35A 5KWEA 1XLVA 4HVLA 1MA3A 1YZHA 3D59A 3ROKA 4C88A 5IYZA 4W5WA 1C7ZA 2QPLA 1SOMA 5D3KA 1Y8QB 5A4AA 3LT1A 1GTG1 4UTXA 3QU2A 5JXJA 3F3YA 3QVKA 5AVSA 4P4NA 1ZOOA 5JARA 4S04A 4ZA2A 1U0NA 2VXBA 3OPXA 3QMMA 3X1ZA 1WP9A 5JYBA 3KSBC 5JS1A 4I0WB 1J9EA 3P2IA 1LD3A 1VM6A 2G7MC 1PDWA 4Q03A 5F5LA 3WQSB 1RXCA 4X91A 5TDHA 5HG0A 3IR5A 4CMCA 2E6KA 4CU5A 2B83A 2WFZA 3H7IA 4PCLA 1J2UA 1JI3A 4IJMA 3RVPA 2AYZA 3H8WA 4FILA 3NM4A 4DCGA 2A7QA 1QHIA 2QM0A 1HL3A 2QTMA 3CJTA 4P33A 3H75A 1K0FA 5H02A 4ZXFA 5IBCA 1XV5A 4FW9A 4H4CA 2PUGA 2YCBA 2QLNA 1O95A 3SHQA 5C5CA 4DYVA 4WMLA 3CO0S 5J4YA 1QHFA 2PFKA 3U56A 1AC5A 3BB3A 3OT1B 1KH2A 4EJSC 3HR8A 3EQ7A 5KVCA 4X54A 5K03A 1RKVA 2WHQA 4X6LA 3T5TA 2AG0A 4EM6A 4AY4A 4AKHA 3ZE6A 5IK2D 1R8QA 3OZSA 1IATA 3LHFA 2GBFA 5JZOA 2J9FA 4KLNA 3W8EA 5ILQA 5JDCA 3L1KA 3QE4A 4TL9A 1KVQA 1FJ2A 1C1HA 4L8GA 4LYYA 1RJ9A 4R51A 4S12A 5EA2A 2UVPA 4TVBA 2MSWA 4TYPA 1UJ6A 2YINC 3AFHA 3TE6A 3HADA 3L05A 1Z4PX 5TQ2A 4E14A 4V0SA 4YXWD 1UJNA 4NE7A 5LLSA 2AFHA 3HPQA 3RSOA 3ZHOA 3KPWA 1FVHA 5HM6A 1T4MA 2C1EA 3WHIA 3JWGA 5AQEA 1EVQA 1PJ8A 5JSQA 3G2LA 5TPWB 2H2HA 1T9AA 3FSEA 2GEDA 4INOA 1JHQA 4ZVPA 3WNVA 2V1UA 4U2KA 4PYRA 4AM8A 4AU1A 2W98A 1TTTA 3CNNA 4KK3A 3O9ZA 5LUBA 1SOUA 4I55F 3JX9A 4RE6A 1Q15A 4PLZA 4Z4CA 3MJTA 1W2HA 2X0RA 2ID8A 3VUEA 2C78A 3IQFA 4OKIA 4AD8A 1VJ1A 3Q6IA 4NCJA 3FTEA 1DC5A 3ZQ4A 2FZ5A 1EESA 2YYSA 4QARA 1CYEA 2JIZA 3HWWA 3M82A 1I4EB 5L6MB 1CJMA 1S2DA 3VH1A 4PXAA 2OCLA 1O7JA 3LT4A 1RABA 4IHJF 2O8EA 1E60A 3OX1A 5EJ9A 5CJJA 2IGBA 1LDNA 1ZXXA 4G0NA 4JH0A 1TCVA 1MRZA 2ZYSA 2C99A 5B3KA 3R6DA 2OZLB 2EWMA 4F6RA 1ADJA 1L7VC 2OSBA 5BXQC 1J0DA 2H54A 3T99A 1VBMA 2E37A 4JGGA 4C20A 2W6PA 4UPDA 1MUUA 1ZI6A 4GBGA 2X3UA 1KE1A 4TRNA 3V6MA 4LXXA 4YMVA 1QUFA 2B8JA 1XQ6A 4BGEA 1MO5A 2WF8A 3TZHA 1YIDA 5F7OA 3U5TA 1XVAA 2XYHA 4FFNA 4L8YA 4M87A 3H0EA 4XH9B 5DHAA 5KTOA 1K2WA 4WKGA 2ECFA 3DJYA 1DT3A 1J0EA 4UPEA 4FYYA 1EJBA 2GN6A 4KQ6A 3GIDA 1OF1A 1R0KA 2X2PA 1CDZA 2IOYA 4JC8A 5C1OA 2EFEB 1XMOB 3LTNC 1ZSVA 5FTKA 4G0XA 3OPYB 4Q4HB 1Y4ZA 1OREA 3QLUA 2PRIA 2XXAB 2OO5A 2VI5A 1EFTA 3IVXA 1TTQB 4P4SB 3ICVA 4DDWA 2PKCA 1N0VC 2OQIA 3F2IA 3K9QO 3LQ2A 3OFSA 4HHEA 3TGWA 3UC9A 4E12A 4UUMA 1V2GA 3FJYA 5EKDA 5DCWA 4ALNA 4OMFG 1R4NB 3FPHA 4XQ9A 2TMDA 3OICA 4B6GA 3OJCA 3BQNB 5KYYA 4F1WA 2YWRA 1Q84A 2QMEA 3HNOA 2FFQA 3BJRA 4NZMA 5FUYA 1OWMA 1T9CA 1ZGBA 3MYRA 3Q7RA 3E7WA 4N6NA 4CDRA 4LJ7A 2OV2A 4TXJA 1WZUA 5CT9A 4F92B 3IO3A 3V4VB 1TM2A 1JFVA 1WSWA 3OE5A 3STYA 2E21A 4Q1AA 3JPWA 3QI2A 5IXSA 1SC6A 3OEEA 1NZFA 1UEJA 5DXFA 1C9YA 2EGHA 5DNCA 1E1YA 5IHXA 3DTNA 3RG2A 2HX1A 3C0KA 1MAAA 3M9XA 3QKTA 1Y1KE 1OYVA 1I30A 2HLDA 4LS3A 4M8KA