3PXUA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
162
structure length
159
Chain Sequence
SMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 63
structure length 159
sequence length 162
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3pxuA00
4MW7A 3BL5A 5J59A 1R6XA 2GM3A 1WKBA 3M5WA 3A2KA 4RPIA 2A4MA 1N77A 5TEVA 4ZCSA 4CDNA 3N9IA 3QTBA 1MRZA 1VL2A 1WXEA 1RQGA 1JECA 3NV7A 2IELA 1A8HA 1JEDA 3U1VA 1EJ2A 4MW6A 4ZCPA 5HUHA 1QQTA 2CT8A 4YBRA 1JZQA 5J5AA 1I6MA 3SYTA 3IMEA 4K0RA 4MULA 4MVWA 4MWBA 4MWEA 5LFAA 4QRDA 1O5TA 1OBCA 3FI0A 1LW7A 4EG7A 1K92A 3TNJA 4OJMX 4MUGA 3UY4A 3ZXSA 4MUJA 2TS1A 1R6TA 1J1ZA 1N2OA 2PIDA 3AG5A 3GUZA 2YXNA 4MUFA 2CYCA 4KPUA 1YIDA 3PRHA 3IVCA 1HYBA 1I6LA 1ZH6A 3H9CA 3LCJA 1J70A 3HL4A 4ARIA 1SURA 1N78A 2R5WA 3KFLA 3CLTD 3COYA 5DASA 2D5BA 3CLSC 4MQ6A 1H3FA 4MW5A 1MB2A 1OWNA 1N2EA 4RUKA 1O97C 4MVYA 3COVA 1JIIA 1WXFA 3KT0A 3Q10A 4MUEA 4GRIA 5F23A 2A1UB 1G59A 2QTRA 1J09A 3ZJTA 4DJAA 3GLVA 2A88A 4F3RA 1QU2A 2A7XA 5HUJA 2GOYA 2H2AA 3LE8A 4I6JA 2HGZA 2Z09A 3GMIA 2AKEA 1N2IA 1H1TA 1M8JA 2O8VA 4EG6A 3N8HA 2NZ2A 3DV2A 4NAHA 2CV2A 2X1MA 1T9GS 1TYDE 5BNZA 3FWKA 4YP5A 3AKZA 3S3TA 1T9GR 1F9AA 3RK0A 1K97A 1H3NA 1O0BA 1XNGA 3NBKA 3D6UA 4J76A 2A84A 3UMVA 2EL7A 3CLUD 3MLBA 1M8PA 3TZEA 4EF6A 1GAXA 4EGAA 1GLNA 3H9BA 5K0SA 4DDHA 3SZGA 5HG0A 4PY2A 2G36A 2H29A 2A1UA 5DB4A 1KQOA 3JXEA 1ZUNA 3K32A 1WZ2A 1IH8A 4U7JA 1H3EA 3OP1A 1D2RA 3MLAA 4MWDA 3ND6A 3RFFA 4MAFA 1KAMA 1O6BA 3LOQA 1QTQA 4MW1A 2Z08A 1EFVA 1MOPA 1JGTA 2A86A 3COZA 3X1KA 5JBNA 1VLHA 3CLRC 5TEWA 1G8HA 3NBAA 1XJQA 2ZUEA 4ND7A 3TZLA 2RD2A 1TFUA 4MWCA 1VBNA 3I05A 2NSYA 4K03A 4JZYA 4MUNA 1F7UA 3P0JA 4NAUA 1NUUA 2D54A 4YP6A 4G5FA 3PNYA 1GTRA 2J08A 1UFVA 1Y42X 5FNZA 4I6EA 2PG3A 2IP1A 1O97D 1J20A 3ELBA 1MAWA 4HK4A 4MW9A 3AL0C 4OUDB 3COWA 3IVXA 4GU5A 1N1DA 4EFKA 1LI7A 4Q16A 4Q93A 5TGTA 1O94D 3IMCA 3IUEA 3RBAA 4R0NA 1TQ8A 4MW4A 1ZJWA 3ZGZA 1O95D 1YUMA 4DDKA 1GZUA 3RJZA 3IOEA 3G6KA 1NUSA 4TS1A 1IFXA 5TS2A 5EKDA 1EFPB 1X8XA 1ZH0A 2RE8A 3P52A 4S1OA 3IOCA 3FH0A 4AQ7A 3L93A 3CR8A 2HZ7A 2OV4A 2QUKA 3FY4A 4EG4A 5H7XA 2CUZA 1M8FA 2BYTA 1Q19A 1KH3A 4H3SA 4MUKA 3SEZA 1LI5A 4KKVA 3FETA 1IQUA 1QRSA 4U63A 1IQ0A 2Z3VA 4WNYA 2WB2A 4XSVA 4UZEA 1N2JA 2AG6A 1KAQA 3VU8A 3UK2A 4EG5A 1T6ZA 3IH5A 1TEZA 2B7LA 3F3MA 4DE5A 3A4IA 2V0GA 1PFVA 4OUDA 1M8KA 3MMXA 2CSXA 3FOCA 1IRXA 3FIUA 3SP1A 4A91A 1ILEA 1IQRA 1KP3A 1MBZA 2WQ7A 3DO8A 3AFHA 3UOWA 1FYDA 2DPLA 1JILA 2J09A 2OQ2A 1Q77A 3DLAA 1MB9A 3P0IA 4NATA 5KHAA 4DLPA 2C5SA 2BTEA 1N2GA 3ND5A 3PNBA 2DEUA 2DXIA 4QREA 1EFPA 4XFDA 4JXZA 1KKUA 4ZT6A 1U0BB 3KT8A 2O5RA 1M8GA 1YIAA 3SZ3A 4HJRA 3CVYA 4KR9A 3IOBA 3HV0A 4J75A 1WQ4A 1WXHA 1PFUA 2GKSA 4BWVA 2CV0A 2X3FA 3INNA 1F7VA 3N2YA 1JEEA 1OWOA 1Q11A 1OWMA 1YUNA 2E21A 2QUHA 4JYZA 1IHOA 5AHWA 4QBTA 1O96B 4U8HA 3UC5A 1VBMA 2IJGX 1NI5A 3DPIA 1TYBE 4EG3A 1JIKA 1I2DA 1F4LA 4MUIA 5H16A 4CQNA 4HJXA 4L2IB 4YP7A 1EUQA 2DETA 1K4MA 3H05A 5IHXA 3CVVA 1PG2A 3CVXA 4EG8A 1COZA 4CDMA 1TYCA 3A05A 3H99A 1V8FA 2VTBB 4UZFA 2D13A 4KR6A 4MVCA 3Q4GA 3D6VA 4CT0A 3OTWA 1MC1A 1KH2A 2EJCA 1B6TA 3X1JA 1VBKA 3FG9A 2I1LA 1OWPA 2WSIA 4ZCQA 4YMIA 3TQIA 3X1MA 2ZP1A 1NYLA 1XNJA 3MXTA 3CLSD 3IDFA 4G6ZA 1NURA 2ZUFA 4XFJA 1KR2A 2PZBA 1I6KA 1GPMA 1O96A 2DLCX 3ZIUA 5DK4A 3PNVA 4NDAA 3CA8A 4P2BA 4L2IA 1T6XA 4R2MA 1Q15A 4ZT7A 2J07A 4AS1A 1IVSA 1JZSA 3E27A 3RHSA 2CFOA 1WJGA 3Q12A 1CT9A 4PBTA 3CLUC 1KP2A 4HPWA 3SDBA 2VTBA 1DNPA 1KQPA 4FZJA 1G8FA 1N3LA 1MJHA 3VRHA 3C8ZA 1NZJA 4F4HA 1OBHA 2PZAA 1QRTA 3ZJVA 1M1ZA 1PG0A 3P0HA 4MUHA 4X0EA 3L92A 2PXHA 3ISJA 2DR2A 5K0TA 3IMGA 2QTNA 1EUYA 2YWBA 2QJFA 2E89A 3KT6A 4ARCA 1JIJA 2A1TS 4R2LA 1KQNA 4NX2A 3HFJA 3HMQA 4ND6A 3KT3A 1WXGA 4MVXA 1QJCA 2PZ8A 1P7PA 1OD6A 1U7DA 2A1TR 2HMAA 1PFYA 2VXOA 2J4DA 3CVWA 2QJTA 1YI8A 1QRUA 5DEOA 3VGJA 1U7XA 4ZT4A 1XNHA 1N2HA 3PXUA 4JXXA 3ZJUA 1U3CA 3MUEA 5KCMA 1WQ3A 1OWLA 3CLRD 2CYBA 1NUPA 2JAXA 1FFYA 4MW2A 1BS2A 1WY5A 3ILVA 2DUMA 4DDMA 3IVGA 1JHDA 1M83A 3AG6A 1T6YA 2YY5A 4WSOA 2XRYA 1R6UA 3FDXA 3ND7A 1JMVA 1O94C 3ZXIA 1NP7A 4KR7A 1KH1A 2CYAA 3IODA 1EFVB 1EE1A 3ZUGA 1O95C 2QJOA 3RK1A 1K4KA 1G8GA 4MLPA 1MAUA 1NUTA 4DNXA 4G5YA 1J1UA 1N2BA 4I6GA 3SEQA 3N05A 2QUIA 2X1LA 2WQ6A 3QTTA 1ULHA 1GTSA 1NSYA 3TQOA 3K9WA 2QUJA 3HZRA 1O0CA 4PBRA 3TS1A 1WXIA 2PFSA 2DERA 3AIIA 1QNFA 3H97A 4ZCTA 1QU3A 5IJXA 3CLTC 4EG1A 1TYAE 4ZCRA 1PFWA 4NZPA 2JA2A 2V0CA 2JANA 3FNRA 2CV1A 2AZXA 1NUQA 1S4MA 2E18A 2XRZA 1V47A 5J58A 3IUBA 2E0IA 1GN8A 2YWCA 3A04A 5LLTA 3G59A 1N75A 4MW0A 2X0KA 1J21A 3HGMA 3QE4A 1KORA 4JFAA 3G5AA 5FO0A 3FHJA 5KWVA 1EXDA 4ZT3A 3CVUA 1X6VA 4E1AA 4PBSA 1YULA 1U3DA 4ZT5A 4KPUB 2QTMA 2J5BA 5FO1A 5LM3A 4ZT2A 1WOYA
chains in the Genus database with same CATH superfamily
3U7QB 3PUWA 5FBZA 1URPA 3M6XA 5LOVB 5FPQA 1Z75A 4RV9A 3WDMA 2BBOA 1G18A 1JHYA 2PH5A 2BJVA 3K20A 5F64A 3U80A 1HQCA 4B6RA 2XUFA 1I51A 4RA6A 1JAHA 2ZWOA 4G81A 4RS4A 3KQYA 2JI7A 2PH3A 4BMDA 2PKYX 3ASYA 1O58A 4KREA 1YU6A 4ARZB 3Q7EA 4IRMA 5B2EA 4TMKA 2NU7B 4XLZA 1I4OA 1XAIA 1Z62A 3BPSA 1WXEA 2JCVA 2GNAA 4C7BA 3P9PA 4OHCA 4IDOA 3BWYA 3OKFA 2QG9A 1GITA 2Y71A 4LX0A 2IV3A 4ARBA 1QQTA 3HZZA 4H4DA 4QQRA 3VQTA 2JRCA 3ZE1B 2DXIA 3Q7RA 5ALNA 5A71A 3M6IA 4GM4A 1QX4A 2PWAA 3TTYA 4TYYA 5JSKA 4MWBA 3MGKA 5H82A 4KPYA 1F60A 3TW4A 1NU6A 2QNIA 1G7RA 1W29A 2MDTA 2PLWA 4PO8A 1MNQA 2Y1FA 2FSVC 3DMTC 3PITA 4PHTA 5TPWA 4NYJQ 4RDHA 3KC2A 5JXIA 4E08A 5IF9A 4U1RA 3QPWA 1T9CA 3AINA 5JEDA 2RGCA 5AHKA 2CCJA 1KFKB 2XVYA 3F2VA 4WJZA 5HNKA 1TD1A 2VPIA 2A0WA 3FOAA 4D96A 1NVXQ 2M32A 3KLBA 2AX4A 3STHA 4O2LA 4LW8A 2BP7A 4TZTA 3TBKA 4WASA 1ETUA 4GLOA 4R9SA 1MABB 3ROXA 1J8FA 2HRZA 5BQXA 1TNDA 4LN1A 2IYSA 2OBYA 4MYTA 3IP1A 2ILVA 1U5BB 2NSDA 2AG0A 3QXGA 4WECA 3RM3A 3WFZA 4D9FA 1N6LA 2VLIA 1MB2A 5AW5A 1WM1A 3L1KA 5LP1A 1R4NB 1R37A 1BZYA 3NKVA 3WRYC 4WZZA 5C34B 1GCUA 1XD2B 4FFVA 2F3QA 4JQCA 1W88B 4KIUA 3LPAA 2XXAB 3ZBQA 4CI9A 1BCSB 3CX6A 3K8YA 2HU2A 1AS2A 1RQ7A 2B4TO 4XJXA 1IXRC 2ZBEA 4F6RB 1WAMA 2D0DA 2FWRA 3DE4X 1N57A 2NUTA 2XEDA 4GL2A 3WYEA 2XYHA 2BEWB 1M7HA 1JFTA 3S0JA 2H08A 1HR0B 1I3MA 3SMQA 2HIHA 5FNVB 2XWSA 5B3AA 3OJLA 2FEAA 1YRYE 4W6ZA 2O4CA 2M6KA 3LXUX 1VHLA 2VJMA 3FNFA 3P94A 3MUFA 3DXFA 4O1IA 5AI0A 1ODIA 2IZ5A 2X1MA 3ZLBA 5A1JA 2DQ4A 4P1ZA 5I7UA 2ATEA 3WLJA 1XPOA 1I2ZA 1NX9A 2HA6A 2QPOA 3FCOA 4U8GA 2RGRA 1EB8A 1PL6A 2DSTA 4OPMA 5HDQA 3EEOA 3LQFA 2H5EA 3D8TA 3BXHA 1MIOB 3FDJA 5K0BA 1YO6A 1PJZA 1BWSA 2FWBA 2VAVA 2A0KA 4GXRA 2YCLA 3JQAA 2ZBUA 1YBVA 4LYJA 2DWPA 4FMDF 1FX1A 1Y3DE 3F7NA 3T1HB 1K5GA 4GX2A 4Z53A 2NU9B 5KPDA 2LE0A 4BTEA 2FZ5A 4WT7A 2F62A 1GLNA 4L5AA 5FUYA 2EG5A 4DV3B 3CW9A 3BRQA 1Y4DE 3I53A 1JJBA 3RSCA 3T4EA 4C04A 4IYRA 4RFSA 3ML1A 4HDOB 1ZR4A 4HR7A 5JG7A 1BCRA 5DB4A 1AX9A 1AB5A 5IKXA 2MMCA 2QL7A 4JOQA 3BREA 5LSAA 3TFOA 3WLLA 3ZV4A 3BE5A 1LDMA 3P9QA 1ZXXA 3R20A 1ECLA 2C2YA 2VAMA 4KXXA 1MU0A 1NJGA 1YNOA 1NBEA 2PCJA 4P4UA 4MS3B 5JO0A 1JLKA 5FLXA 1GTG1 4QOIA 1VPWA 1CB7A 2A86A 3EODA 4Q9LA 3LRXA 3V1MA 5FHQA 4EKEA 1AQLA 4RHUA 1WHSA 5J5VA 1DG3A 2D2VA 4U7HA 5IJ0A 1UBGA 1O8CA 4KFUA 4GI1A 4Q3NA 2IIBA 4RZSA 3C5VA 4GYJA 2A9OA 1NQXA 1SBIA 3FPAA 4WLNA 4DT1B 1JQLB 3WYAA 2CLSA 2HBQA 1YK1A 1J22A 2ZIFA 5BNFA 4IF4A 5C3UA 4NY1A 1P6UA 2NXEA 2JJYA 4CR6A 1ZRHA 1UFVA 5DN9A 2OCBA 4M38A 5BN5A 5JTTA 2IP1A 3QYAA 3JS5A 7REQA 3NCHA 3Q40A 1S2DA 4Z86A 4HFMA 4YJFA 2A0FA 1E59A 2PSHA 4FYIA 5TF0A 1PNRA 1SBNE 4EJFA 1SUEA 1ABBA 3EGDA 1RBQA 2XODA 5JJKA 5JECA 1CQZA 3OBBA 3Q3IA 5H0IA 1O94D 4HDSA 2RC6A 2VH1A 3H9UA 5D7NA 4BP8A 5IMSA 1RC8A 1FB5A 1Q0UA 1Q57A 2A35A 4QXAA 3FMGA 2H65A 5LQMA 2I2XB 1IN4A 1IXSB 2CXOA 3EH1A 4P4SA 4CQMB 4DUGA 5FBVB 5K09A 3LWDA 1WQ1R 2C58A 5D3KA 1KY4A 1Y5LA 3CTMA 3KKZA 3T7IA 3AI7A 5E3HA 4F3CA 1G42A 3FOBA 3A1DA 4BKPA 1YQEA 4ENWA 2DCMA 3M4JA 5C1DA 3BORA 4RZHA 5L51A 4C5AA 3TDNA 4YCLA 2YC4C 4D8WA 2QUKA 4OHMA 1QRAA 4XLLA 4ZCIA 5AUNB 2CHGA 2LXNA 1CHNA 2OCYC 4LRXA 4JA2A 3WL5A 3O1LA 1A5BB 3I92A 2CEKA 4LYDA 4QDOA 1OAKA 1PKXA 3O75A 3DZIA 5L3RA 4UVDA 2FSHA 4UFPA 4QU5A 4RENA 1B14A 2WB2A 1YF3A 3GZJA 5K4AA 1NQUA 4TMYA 4XSVA 3AJAA 1FDSA 2DWCA 3H2YA 3ZWCA 4HN9A 1KGDA 2IUEA 4E30A 4IXMA 2VKQA 5AJWA 3MTEA 1TEZA 1YFZA 1C29B 4HNAA 3WC4A 2IP4A 3TE6A 4YUAA 1II0A 1H5QA 2F48A 3NM4A 1E6MA 1MO6A 1OA0A 2PLRA 1W6UA 2ZT6A 2C8KA 3FWHA 2R7NA 3NH6A 3L0PA 5T5QA 3LAWA 4RQUA 4U9HS 4DCGA 2CSXA 1PNOA 3CUSA 5BN4A 1KHHA 4UM7A 2PKQP 2WG0A 1BJKA 3GDWA 4QOHA 5FDFA 3RUIA 3TL6A 2HEIA 3C8UA 3KWLA 3Q72A 1FYDA 2V65A 5KS2A 4AKEA 1AGXA 3HVHA 2PX0A 3G68A 1T25A 1JDNA 3DXYA 1ESMA 5B37A 2IXTA 4Q4HB 3M2TA 2FMUA 1QHEA 3PC3A 5IVDA 1EFPA 5C51B 1UBMS 2OMKA 4KWHA 2PUJA 3F2IA 2RG1A 1SKAA 4ERNA 2XF2A 1ZH2A 3J81k 3WTCA 1U4NA 3UPTA 1CZOA 4MPTA 4S35A 4EYEA 4XVUA 4WK6A 2P7IA 2YJNA 4AZ0B 3ZJ4A 4UQLA 3DZGA 1LLDA 4ZAZA 2OYSA 2QM3A 4TRMA 5T6MA 2PMEA 1JHRA 4C43A 2H06A 3D1LA 3HJGA 1XU4A 4TN5A 2WWTA 5AVSA 1E1RD 4MVJF 4C2BA 1OWMA 5JZBA 2HI0A 2E21A 2HQOA 4IDHA 4JUCA 4KXWA 3W9YA 4E33A 4MUYA 1EXWA 1U3UA 1C4KA 1NNSA 2AEMA 2ALJA 3W0LB 4ETNA 1YAJA 4FU0A 4JLDA 1FC0A 1CUZA 1QNLA 1X86B 1ZOPA 3SLRA 3ADCA 3DC7A 1U4OA 4DA8A 2O0KA 1JIVA 2WHPB 2YVKA 5CFQA 2G0TA 3FJ1A 3PTLA 5AVUA 3C6XA 4C76A 1AUVA 3EOZA 3U4IA 3W2FA 1TEVA 4I36A 3KTFA 4CXMA 4N6GA 2Y4OA 1FSPA 2OD9A 1COZA 3MEQA 2NZYA 1RMTA 5SZIA 1QTNA 4Y2PA 3H99A 1MTZA 3EASA 4F97A 3OZGA 2ZRQA 3B51X 3E61A 4YUZA 4D26A 3GGCA 1ISMA 3P32A 3UJNA 2E49A 1GPJA 1R6VA 2BN4A 3GJZA 4MMYB 1R0YA 2RJOA 1CJCA 3L8DA 3O8OA 1P0QA 1KJZA 1PV2A 2AXEA 3N3AC 1DWQA 2JLBA 3A9WA 4OQPA 4Q3LA 1DC3A 1YGYA 1T5HX 3D8SA 4K6HA 3DOOA 1ZXBA 1AKYA 3BF8A 2CUTA 3BB4A 4LRYA 4PS0A 1OI4A 3T61A 3WADA 5K0CA 4IUCS 1L7AA 2CJXA 2WSIA 3I83A 5LXTB 2NMVA 4M1WA 4Z0TA 4GOLD 1UR5A 1M1YA 2QTHA 4XX1A 4JR1A 4IUBS 4IWXA 2H1OA 3I62A 3O4GA 5LWHA 1SU7A 2Q3DA 1GA1A 4L15A 4Q19A 4ON9A 4O4HB 3HPRA 4RL6A 2WY2D 3WXBA 1YVUA 2ONYA 4DSTA 3K7EA 1EDZA 3GGOA 1NBIA 1SGWA 2E9SA 3E15A 3F5DA 2ZROA 5AW7A 1QRTA 4DEYA 3THWA 5HGXA 1P6QA 2XCLA 3W4JA 1YONA 1ZH4A 4NG5A 4N82A 3HLYA 4R8RA 4YHBA 1D9ZA 1JYSA 2I6TA 4IFTA 1BE6A 1F8FA 1RWPA 4LV6A 2JAPA 3OEHA 3PUZA 4FQ5A 4R2MA 5AKXA 3STXA 3BIOA 3UTCA 4OQNA 3WMRA 1Z2DA 1OZ0A 3OCZA 4IY1A 2HYDA 4RQTA 4CLXA 2X7XA 1WJGA 3V33A 4BVAA 3HFRA 1T35A 5CEJA 2RHWA 4RWEA 3MBIA 2ICAA 1KI1A 2FK7A 2H9YA 3NAQA 2XUJA 4I8XA 4TTPA 3RROA 2VRNA 2OFWA 5H3CA 2MINB 2QB5A 2IXAA 3HYRA 1D0SA 4HQLA 4J16C 3BULA 1ZHOA 1E1CB 5CXUA 1WABA 4LDZA 1VKRA 2VEOA 2ZTVA 2AW3A 5JYEA 4YB8A 4ZVSA 2R62A 5LQNA 6ABPA 1ISIA 2BGLA 1TYZA 2ZI9A 4C08A 3LLSA 2RKOA 3OUZA 4E11A 5AVJA 1H0KA 4D4JA 2JD0A 3FCAA 1HYEA 2QBYA 3KQVA 4EW1A 3KQNA 1IVYA 4Q3EA 3OIFA 3H3JA 3D4NA 4EKIA 4EG4A 4LG1A 2C9YA 1W2GA 3KWFA 4I9HA 1KQNA 1Z26A 4PZ9A 5HHTA 2Q8NA 1L3IA 3V2GA 4PQGA 5F7JA 1QVWA 4IX9A 3T7EA 1EM8B 2FLKA 1KFJB 3JR7A 3RC9A 5JH7F 4X7PA 2A1TR 1EK2A 1U7DA 2HMAA 2ODNA 2GR9A 1A82A 2BKUA 2H7YA 2GBFA 2QJTA 1X7GA 2IUSA 4JLVA 5DO9A 3VNBA 1FFXA 5JQGA 3RARA 1H6DA 3E58A 4XWWA 2PL1A 3IUNA 3UXEA 1AA9A 1R12A 1VPVA 2EERA 3C7CB 5DYWA 4FCTA 1N7HA 4WLEA 3E8SA 5D6NA 1W85A 621PA 1DAPA 5JD4A 2FFRA 5EWJB 3UJPA 4Z9FA 2WZCA 4WZ6A 4S1WA 4CCYB 2P2CA 3WOVA 4EJMA 2X23A 1XZNA 3N0XA 1TJYA 3OOEA 1KSGA 3KYJB 3PE3A 4CMBA 1RU3A 4EW2A 1ADCA 2GYUA 4CR7A 3U60B 1Q2XA 2H4FA 4G0MA 3L01A 4PLZA 4AJPA 4TTSA 1UBFA 2FUG6 2ZZNA 1T6YA 2BH2A 3ETEA 1P2GA 4D3FA 3ZEIA 2JBAA 2J9FA 5KIAA 1QGYA 2HH9A 1JMVA 5K8LA 5GZ1A 4W1PA 2W2QA 1H2AS 4YRIA 5ADHA 3O93A 3E70C 2Y6UA 3UMJA 421PA 1VSQA 2Q2OA 3QUBA 5FA8A 1ZVMA 3EVZA 1HNNA 1BHJA 5T57A 3ROMA 5KQLA 2YHIB 5HMLA 4ZEOA 4C6TB 3LUDA 2LDBA 2EP7A 2OCAA 5B58T 4NCKA 2QUIA 4EUHA 1IG3A 1LNZA 2BVNA 1ORWA 2C1EA 2D3TA 2HXGA 2R6R1 2DJ5A 2GBGA 2H48A 1XRPA 2PQ2A 3PDHA 3MD9A 5H9VA 4RNCA 3T5AA 1UP4A 4UDOA 3KKLA 1KOLA 2G9ZA 5B6IA 1A9ZA 2WM3A 3C6QA 1CF4A 1VFNA 4QECA 1FRVA 1WF6A 1Z2NX 2Q5HA 2QRHA 3WQHA 1QNFA 3D8HA 5U4XA 5IS2A 2PMCA 1OGYA 3ONWA 3QMPA 4JJAA 4DYHA 1M2VB 4EVRA 3F73A 1QU3A 4MVJA 4OB8A 1M5RA 1ATIA 3W8RA 4QOFA 1T8WA 2GBLA 2XQJA 2WVJA 3OA2A 4DOMA 2J67A 3TG8A 4LJ4A 1GQFA 1HT0A 1IEXA 4DLRA 1KI4A 4BV9A 2IDKA 3M5DA 1YHYA 4I3GA 2VYVA 3O0DA 4QUBA 4GKKB 1G2QA 4N3NA 1L5SA 3UK7A 3KNZA 4ZHQA 4HT3B 3DEZA 3KALA 2P62A 3S4YA 4EF5A 4P4GA 4BFXA 1UK6A 1V41E 1ZBQA 3BFVA 1VI5A 4PZPA 3LWZA 3AJDA 3V55A 4CUZA 4FSXA 5DH9A 3FHJA 2RHCA 1NR5A 1U02A 2RG7A 1XP8A 1J8QA 2WSSD 4BVBA 4RTNA 1Z35A 2R47A 4LV8B 3TXYA 3RYIA 4LISA 4BJ3A 2IHKA 3FCXA 5E2BA 5JAQA 2FZCA 4OI2A 1WSDA 1U9IC 3H5AA 5KTSA 2ADMA 2C2XA 2P2GA 2D2EA 2DPXA 2VAXA 3SFTA 3A1FA 4Z3OA 5JWHA 1FXUA 2NAPA 1H9AA 3AB3A 4K5QA 3IURA 4LBYA 1BJTA 2HA0A 3LMKA 4QHTA 4IW3B 3TKYA 5CG1A 5C8YB 5FWNA 2IQ5A 5JRDS 1QJ4A 3DW3X 4MR9A 4BZXA 3N6VA 3U4AA 1JG3A 3R3HA 5B4UA 1ZY2A 5B7PA 3IDOA 2GZHA 2C3PA 5KSOA 3B8HA 2IELA 2ZJ7A 1ZJ6A 1GUDA 4KSBA 4MW6A 3C3AA 4D7AA 3OF5A 2BEVA 1N0IA 1Y9AA 3OX4A 4ZRDA 5J5AA 3UWSA 5LQCA 4V0RA 3GPDG 1TAHA 4O4IB 5ENZA 5ALWA 3AJRA 2B8WA 3X44A 3JVVA 3GG9A 4J3FA 3EGOA 4FMPA 4LQDA 5GVSA 4PX3A 4QRDA 3RO7A 3BMOA 4DMGA 2NT3A 4TLCA 2IH5A 2AS0A 2M6LA 4E1VA 1I33A 2NLOA 5K0JA 2FPGB 1IZ0A 1SUIA 1FU7A 1K92A 1YDFA 1Z9BA 1PJLA 2ONCA 2QIOA 3F3KA 3N8GA 4MUGA 4OHBA 1KYQA 4EQ6A 2QRVA 1XWIA 3MQFA 5TMDA 2XNKA 4G1UC 1GVNB 1ZL2A 2B20A 3GCWA 4C0JA 1UZAA 3NVKI 3EAGA 3RRNA 4FYWA 1HBJA 1IHPA 1Y33E 1FMLA 2SCUA 3GAZA 2OCXA 2QTFA 2NU6B 4J8PA 4MUFA 1R3UA 2ZYGA 2CF5A 1VGVA 1XA0A 3MRVA 4OQYA 1JXAA 1KRXA 3HKEB 3RNOA 1UODA 4GPZA 3T4UA 3JY6A 2R65A 4IINA 4JK3A 4PYOA 1QG2A 1QZ3A 1B15A 4MZXA 4ZWNA 3TNLA 3UAXA 2ADFA 3BB1A 2HHCA 3F6RA 3A1SA 3D6FA 3S99A 3Q8MA 3QJ5A 4Q4JB 4BJHB 3HA5A 3EHDA 4DW8A 2FUCA 3CRQA 3E84A 2QX9A 3ET4A 3Q10A 2Q1WA 3UWDA 3UXYA 5C31A 4EENA 4LWQA 2QYTA 3IS3A 5EHNA 1MC8A 1DV2A 5JH7A 1JHUA 1J09A 1ZVVA 2OHXA 4UD6A 3SHOA 1ZD8A 3L1IA 1E2BA 1FMJA 4Y2SA 1AKUA 4WOKA 4BV3A 4W1RA 1ZEJA 4HEA6 1FFSA 1IY1A 1JDPA 1DADA 1Y89A 4G0NA 3IQEA 1JG6A 3VMMA 4MLZA 4AL4A 1CE8A 4OQ4A 3ENWA 3FIJA 4KK4A 1CC1S 4JJFA 2Z6AA 3LLVA 5CDHA 5TSDA 1WBJB 3OM8A 1FFDA 3WYFA 4AURA 1G0NA 3OWXA 1FF9A 1Y8CA 2PT5A 3GJ5A 4I1UA 5JLJA 4YGXB 4ARVA 3WVNA 1HPLA 3TX2A 1R66A 2VTDA 1JDUA 4UU7A 3UWMA 3EJWA 4C1BA 5J2UF 5J2TB 4LGVA 3CH5A 4H6VA 2GNPA 3HJBA 3NHWA 2KLHA 5HF8A 2A59A 3VA7A 1I3KA 2BE9A 2FX2A 1RE0A 3BMQB 3OZAA 4RIFA 4XX0A 3NALA 1PTJC 1Y5RA 2OLJA 1K66A 4W5RA 3IE0A 1F4VA 4ITUA 2HSGA 2EFDB 3E1SA 4G1BA 3TZEA 1FOEB 1OIVA 4YRRA 1YCGA 1OLXB 1LSSA 1X39A 3QVUA 3NDPA 4RPKA 1FS5A 1XQYA 3KETA 1EFCA 4YPFA 3OAAA 2R2GA 3EF1A 2LVBA 1Q1QA 3ODPA 1RZUA 4ZTBA 4D9IA 3G0HA 2A1UA 1Q1GA 3DEHA 1UZLA 3K32A 3OZ7A 3S1AA 4F4DA 5KOIA 4U7JA 2FWAA 3GGJA 5K0FA 4NZNA 5FPTA 4C4PA 2NAFA 2OA0A 2F9MA 4WBNA 1DC5A 3MS4A 1DCKA 2ZK7A 3LUKA 2CXTA 3O6VA 4HGNA 1S5PA 4ND5A 2FW6A 4TSKA 5DISB 4B7CA 1P4RA 1ZM9A 3NEAA 1PK7A 1M2EA 2FJPA 2GS9A 1K8ZB 1PQWA 2DJIA 2Z2KA 1XJQA 3CLRC 5IVIA 1K5HA 1R16A 2QVGA 3V1YA 1Z0UA 1J39A 2I1QA 3ZTTA 1MLDA 4GUDA 2YYYA 3D6HA 1VBNA 3KXPA 1N5IA 4UBMA 4OJYA 1Z5GA 2VHWA 4W5WA 4RD0A 2C4WA 2HUPA 4QJ5A 3VOAA 1C9KA 5FQNA 3GJSA 2ZIVB 1WZNA 3D4BA 1Z73A 10MHA 4MCHA 4US0R 1LSOA 3OLYA 4ZOAA 2P9TA 2OKCA 2IZ1A 4R7ZA 2DLNA 4ZQIA 3MGGA 2O0HA 4BVKA 3RYHB 1Y42X 4KL8S 5FNZA 4YAUA 5IYZF 4KQIA 3K1YA 4UKDA 1C3EA 4UOZA 4LAFA 1IJBA 1R27A 3D3QA 1A4XA 3WAJA 1Q3TA 1J5EB 1XU7A 3ELBA 1RHRA 3TF5A 3PHIA 4RXMA 1QWSA 1ABFA 1C30B 2CXXA 3E5MA 3O8DA 4XYEA 1G5HA 1RAEA 4BO2A 5TGTA 3M70A 3WLQA 5CYPA 2JGEA 1NX6A 1UBTS 2V7GA 3K2IA 4N3AA 3A0RB 1PIWA 4IDEA 1CZRA 1YZTA 1DJMA 2CZQA 1WTCA 3KE9A 4G85A 1GZUA 2PH7A 3DXXA 4X3OA 2F8MA 3RJZA 3UJ3X 3GPLA 4NMLA 1B76A 3KZ1E 3RYCB 2UUCB 3DDZX 2V1XA 3C3BA 3WO0A 5JAUA 4LJ6A 2ZB4A 4LYYA 5JNLA 1UKZA 3EBPA 4LRTB 3C3XA 2C0QA 4AXBA 5TV2A 4DN6A 3PGMA 3GCDA 4IQ4A 4R1PA 3VZSA 1GQRA 1EVJA 4WCFA 4P7GA 1R6AA 1W5BA 3D0KA 3K70D 4A9AA 4MQ5A 4N48A 4LC9A 3ZWQA 1L7MA 4GMHA 3ROEA 1U2QA 4EY5A 1PZHA 1I5RA 3OC0A 4B3FX 5A2GA 2JPDA 2WYOA 4N6NA 3V4ZA 4BQFA 1UM9A 3ABSB 2FR8C 3IH5A 4IFBA 3NR2A 1PLJA 3IJ5A 4BS9A 1QZZA 5ILOA 1FS4A 3QE9Y 2QP4A 4KN9S 1ZUD1 1OH6A 4BFVA 3H2KA 2EZUA 4X3CA 4EJSB 4UHCA 4NPHA 1TVEA 2I87A 3NHYA 4EUFA 4D3XA 3DZDA 2PKCA 4REQB 1KP3A 1D09A 3STWA 2AT1A 2DKOA 1LC0A 3R6LA 3KOZA 2CHFA 1SXJA 1RRMA 4IHAA 2YDYA 1WW2A 3D31A 1F2DA 1SXIA 1XEXA 1VCOA 2DPLA 2W00A 1D2HA 3OT1B 4MKXA 2BTEA 4O0MA 2LWIA 3QNWA 4DLVA 4CV1A 2P4EA 2C8VA 3IV9A 1AMNA 1A8QA 4QREA 1M0SA 1BKSB 1ORTA 3MB8A 1QRRA 3R0JA 5BSRA 3EFOA 2UDPA 3RC3A 5LQUA 2G4VA 1SUFA 1O77A 3KT8A 3ULKA 1GU7A 1P4HA 1I4EB 1PJTA 4FSHA 4IL5A 3U5TA 2RB4A 2I22A 2OE2A 3NTLA 4B6FA 1CDEA 4LJLA 3LRTA 3NUQA 1YZUA 1QRDA 5A5EA 1RPAA 1IXZA 2WB4A 1OWOA 1TCUA 2ISSD 2Q1YA 3H5WA 4XQ0A 4YRKA 3JZFA 2BMAA 2YZ2A 3JASB 1TA0A 4OL9A 4EA8A 3GY0A 3PPIA 3QKRA 3ZBPA 1Z88A 5JU6A 5KTMA 4XD7A 2WTNA 4B17A 2B4RO 2QG6A 4RD3A 5JJCA 4LDNA 5HKKA 5LIPA 2UUBB 1TYBE 1SBYA 3QKSA 3ORHA 3TTVA 2VSOA 3O7WA 1OXXK 3BQ9A 4OGGA 4QFBA 3WMXA 3D0RA 2ZIXA 3NBQA 5H16A 2R6FA 1X8KA 4YP7A 2H8KA 4E22A 1CRWG 1GPH1 3B78A 3GRKA 4PPNA 4GGPA 3FPFA 5J2UA 2G40A 4HBZA 2J0UB 3I28A 4RA6B 1E0KA 1H0HA 3A4VA 3R3JA 2G06A 2QD4A 3PHLA 3PWKA 4QUHA 4RLQA 3RWMB 3WLNA 1NVBA 3ER6A 1D1QA 2DU8A 4RAOA 4W5OA 3KXLA 3OQIA 3GLIA 5FOSA 4J0EA 3CE6A 1Q7GA 2HT6A 4AY3A 5EMHA 1U7OA 1VIDA 1N2XA 1V8FA 2PAFA 2SKDA 3B6JA 3AY0A 3IFSA 1DJOA 1R5NA 4IDBA 4C0XA 1IMOA 1IPFA 2PVCA 3KB1A 3M5PA 4OM7A 4OP3A 1NRIA 3ELDA 4OHOA 4YRPA 4HH0A 1UXJA 1Y37A 3ZV5A 3QFFA 3CNLA 3TEJA 2HNKA 2JIOA 2Q8PA 3L4BC 5JFGA 3K94A 1WW3A 3UH1A 3RQIA 2AKYA 3EG9B 4JOSA 5ERYA 4EZEA 1UMDA 3O2QB 4MQ4A 1ITZA 3TD6A 1C2YA 1UZUA 3TQIA 3ILYA 4BLVA 4ZYYA 1M6YA 2GZDA 1T6NA 2O3QA 2F64A 2D1FA 3GNSA 4KE9A 5AFSA 1Y8RA 4PTLA 4MCIA 4P3NA 4U7GA 1DQSA 4AYTA 3ZXUB 3F6SA 5DK4A 4B8WA 1DQZA 1I9CA 3FVRA 3CCBA 3I52A 3PNVA 1BVYF 2PZMA 3CA8A 2RHBA 3PXCX 4FLEA 1H22A 4G63A 5D3ZA 4KE6A 4D9NA 3LF2A 2DG2A 1QYIA 2O7NA 3KHUA 4KMOA 1VECA 1GRRA 2ODBA 3PEEA 2H1WA 4F4FA 1Q15A 2ZVDA 521PA 4D9MA 1UPAA 4QRIA 2AC7A 2IKQA 4JGGA 4GZ3A 3TB4A 5IWAB 1CIVA 4V38A 4WERA 4Q7JB 1MXHA 2GF9A 5DNCA 2PO7A 4CLDA 2FPXA 1GR1A 1NW4A 2HX1A 2J48A 2YJZA 3BH6A 3C74A 4CKEA 1RQLA 3FPGA 4Y6SA 2EP8A 3ZVMA 4AJ9A 4HNQA 2HQRA 2YJ6A 1G1MA 1KOFA 2CF6A 2H85A 3PDUA 2QRUA 2VSNA 4K9DA 4TSRA 3T5MA 1NXTA 1HXHA 3UATA 4E2WA 3C8ZA 3NH9A 4MVJD 2VSXA 4NCIA 1DKRA 1Y9DA 3N8KA 2LCFA 4P7FA 2P69A 2PZAA 2PZEA 4C1NA 1Z2PX 3T3HA 8ADHA 5K6AC 4FYPA 5CM9C 4Q01A 2VUUA 3IT0A 1TM5E 2W22A 1HG1A 2DR2A 4YRLA 1F8GA 1KBZA 1LWNA 5U1PA 4OMFG 2DFNA 2ILTA 2VJMB 2D1TA 1INLA 3IMGA 4O29A 4OKNA 1R88A 1C7ZA 1Z6PA 2K6GA 1XTSA 3GH3A 1YZLA 4QM7A 3OMWA 4BVEA 1E96A 1KK2A 3HFJA 5KWIA 1KJYA 4BWGA 1T15A 5EKSA 3VC1A 1PP4A 4P33A 2Q3MA 5BSGA 4A5SA 5K3OA 3PV0A 3TX6A 3ZDRA 5JDIC 2E2WA 3V4OA 1R9NA 2G1JA 1OLOA 3RJ9A 3BVPA 1C4OA 3MWYW 4F4IA 1GQOA 2VHTA 3FSGA 3FSEA 1AXGA 2RHTA 5IKPA 4YCBA 3JQBC 2WMNB 3N74A 2ZYWX 5FWXB 4GVPA 1O5OA 2CL5A 1PYOA 5SZHB 1MC4A 2OGTA 2J9YB 3IGFA 2GJ4A 4MW2A 2ZJ8A 1SCJA 5ESXA 4WBSA 4RM3A 3G9ZA 4DDMA 3EUAA 2VG8A 2JH8A 1NMQA 1M83A 4RFSB 4WK4B 4NYIR 3MG9A 1VPLA 3QF4A 4BASA 1GZ5A 1CFZA 2AOUA 4WSOA 2IS4A 5CX1B 2QRJA 1QVZA 3OU6A 3SAJA 4BPRA 1T26A 2HAEA 4OB7A 5FUQA 1DJPA 3KK0A 5IEJA 2NVUA 3TOCA 3TSAA 3VPSA 1HC7A 3IHTA 5AUOB 2DC1A 1Z4PX 4L85A 2CCKA 2CYAA 2UZ1A 1S8OA 1VHJA 3IP5A 3F3SA 5FB3A 2BIFA 3RK1A 1CQIB 1D5WA 4PLFA 1AIPA 1CJMA 1G8GA 4OYHA 1L5ZA 2JIZA 4PG7A 5IJ0B 1Z68A 4NPAA 5C5EA 3QKWA 4JT2A 4JLWA 1RRKA 4V1CA 2J30A 5K3AA 3KKOA 3NG1A 3VBCA 4II2A 4UUPA 2GYWA 4HWPA 5I9MA 1D8AA 1HG0A 3ND9A 1FTSA 5JNVA 1G8KA 2F1KA 5EJGA 1Z39A 3DDCA 2IX3A 2XVZA 5DTIA 2GD0A 1OFHA 1WULS 3OZTA 2H7CA 2OOKA 2P0YA 3PI7A 4GSLA 3S2SA 4JBHA 3PIDA 4D1YA 1GXSB 3H97A 3LQ2A 4F7DA 4HN2A 7REQB 3PTZA 1GEEA 4ZQCB 2XT0A 5KB3A 2ZQZA 4OBWA 2VN8A 1M7BA 5BT9A 3JWIA 5AI5A 2E5LB 4A2QA 1BN7A 2VP0A 3CRZA 4JODA 3KEGA 4NHEA 3EGDB 3NT5A 2P5YA 4IO0A 1V2HE 2QL5A 5DHSA 3FNRA 4HDSB 1N7GA 1CUBA 1KI7A 3TBFA 5IH7A 1M73E 1OBFO 4KUEA 2FE1A 2EFEB 3NXKA 1KR5A 4RH3A 1B2LA 1PQPA 2JS7A 1LPAB 3DE7X 4KACA 4LNAA 1XFDA 3LS2A 5F5NA 3SQNA 3NU1A 2KI5A 3WHPA 1Y3CE 3VC2A 1I94B 1JV2B 5AK6A 3KD3A 1C7FA 1TEHA 1FTYA 2EOAA 2F00A 3VZCA 3ZHXA 4DB4A 4IIJA 4AO7A 3OQBA 1QE3A 1VKZA 1EXDA 1Y1SA 3R3XA 5IAJA 2O8NA 1NY5A 2ZYVX 4ZT3A 1X6VA 3P0EA 6GPBA 3FHTA 1JTFA 5I8WA 1TCAA 3A3KA 1ISRA 1YS9A 2QTMA 2ERCA 2VDQB 3FNEA 1E3WA 4GLJA 4KPUB 3SR0A 3K0FB 1YRBA 2UXDB 1UKEA 3WHLA 3VDNB 1Q12A 4QAQA 3TLEA 4J2TA 2H1HA 1TPZA 3PL5A 5SYNA 3WQQA 3U17A 4YMLA 3TLBA 1SZDA 1YQ9A 3AB7A 1GGKA 4CTMA 2WTEA 3QNUA 1A9TA 1NKTA 4UXJA 3GJ6A 1RBZA 4PSCA 4TKUA 4CDNA 5KSWB 2ZS7A 1NW3A 3ABRB 2IU4A 4UU8A 3QXXA 4X5OA 2ODWA 4PYIA 4NOJA 2RIRA 2D8MA 2VTVA 4Y2QA 2H3HA 3PWTA 4ZXFA 1OFTA 4DIBA 5LR6A 1N33B 1HRDA 5CAEA 1P9LA 1RBYA 2FPSA 3QELB 3DYIA 2WJZB 5HOQA 4I5DA 4BP3A 4F85A 3AH8A 3TUZC 1U63A 2ZRPA 5CW1A 3N28A 2NXNA 3NW9A 2JLZA 1HRKA 3SYTA 3WWCA 4ZZ0A 2QL9A 3IMEA 1WMDA 2JHCA 4NV3A 3ZWXA 2AJDA 1AKNA 5TB5A 3TG2A 1NLZA 3EIFA 2DPHA 2HQSA 2AKAB 4AJEA 5LDHA 2XYQA 4JDUA 5BN3A 4M1EA 3PYMA 2AK2A 4KV9A 4A16A 3U6KA 3O8RA 1II8A 3HJUA 3FOZA 4OLFA 2WWXA 3JZDA 4JIMA 1RXCA 1MB0A 1L5OA 1M0WA 2TSYB 3NTQA 3AVUA 3HUTA 3B2EA 1BGVA 4AK9A 1YB4A 1I1NA 3K92A 3IUMA 4G0VA 4ZOEA 1C9MA 2C96A 2XOEA 4RVNA 3T0IA 2XH8A 1I5OA 3VC3A 3VPAA 1SKMA 3LCJA 4IJUA 2CNDA 3IBGA 3RS9A 2PUBA 1N8SA 3AF6A 1Z82A 1EP3B 3D3JA 2AFHE 2WWGA 5L6MB 4UTNA 4JBIA 1L4NA 3HGQA 2AMFA 3KQLA 4DV0B 2B25A 3F90A 3HEAA 1EFLA 2VJAA 2OCKA 3AKDA 3GIDA 4ZAWA 3TCNA 4DREA 3MAGA 2PUDA 3ODGA 3CGGA 2J9RA 2HCTA 4MRAA 3CSSA 1DI0A 4DJDC 1Z0ZA 3AUKA 2JFBA 3E9RA 1MD9A 4UAGA 3G0DA 1NJ6A 1CVRA 3I5AA 3ZCUA 3ON5A 1ZVJA 4MV4A 3W7VA 2G25A 4NWIA 2HA2A 2BFMA 2HDOA 1YZYA 2GOYA 4ZAVA 5F3RA 1SVMA 4EA6A 3GO4A 4EUSA 3K70B 2OHIA 4FMDB 2PSJA 5M04A 1SPXA 2IH2A 1QG0A 2QZZA 3EYAA 4G9GA 3N59A 1QXSA 3PF8A 1ECPA 1VIMA 3PC8C 1CS4C 3UK1A 2HJRA 3FJOA 3E48A 5CA0A 5I4KA 1TYDE 1W36D 5DM4A 2W4IA 2EW2A 1KPIA 1M2GA 3RVPA 1YTUA 1JR6A 4HVLA 1VXOA 1IDOA 2WA1A 4HEQA 4N18A 4IDFA 2YYSA 3K96A 4NQRA 5C8ZA 3AKZA 3BWVA 1F9AA 1M1YB 4MWGA 4DMKA 5ABPA 5IXYA 3BQNB 3IEVA 4AQYB 3NBKA 4RDCA 2IHYA 1UWVA 5EPUA 2GPWA 1B0UA 3NRJA 5F2EA 1B6SA 2LCIA 4AJIA 5KQSA 2PUAA 2B34A 4GPTA 2NP7A 3VMFA 1CDZA 4ABTA 1II9A 1Q1EA 2FQXA 5FI3A 4B4UA 2VI5A 2VPYA 3BFJA 3M33A 4QNMA 2FW9A 1YU9A 3FYHA 1PL8A 4ZXPA 4H4EA 3QMMA 2B1IA 4KYTA 2QD2A 5D00A 3DDWA 5JS8A 5DIFA 5IARA 1BE8A 3P9SA 4CRWB 3BK7A 4MJ7A 1QTIA 3C0KA 3W5SA 3HKCB 1KAMA 2B8JA 3ETNA 4KH1A 4X8MA 5BUZA 2IPOA 4KHZA 5EJ4A 2FW8A 3E9ZA 2V45A 4Y0AA 1RQPA 1HQYE 4RD1A 4ZOLA 3D6NB 3ABOB 3BDVA 3ENZA 3GT0A 3PFBA 3SC4A 1SD5A 4PLVA 1YQXA 1O2DA 4W5JA 2VK2A 2HMUA 4B3HA 3TZLA 5LIRA 1FW6A 2NPIA 4B4WA 4MWSA 1U80A 5ICGA 4UASA 1K9VF 2XW6A 3CLHA 4UXIA 2XSZD 1RM5A 3RASA 4CV3A 3FTPA 4DQKA 1NUUA 5JS2A 1KOGA 1Z0IA 2WJYA 2EWWA 4N8DA 4MRSA 2F59A 5COBA 4ED9A 4F1JA 2Q4OA 4X95A 1UANA 4UOEA 1V11A 4S24A 5HIMA 1W5EA 4TLAA 1JFRA 4ENVA 1M66A 4RF3A 3VH3A 5JXHA 2H1LA 3DHYA 4XCQA 4BEWA 1C5KA 1V3VA 3L06A 4ND2A 2O8DA 1NBMA 4NPCA 1SC9A 5I9NA 5DWDA 3BGSA 3D54D 5E4TA 5CITA 2W2OA 4NBNA 4A6EA 1QE0A 4C03A 4UPVA 2IZ6A 3H5TA 3IUEA 4XD7D 1PTKA 5LQDA 1GPDG 1W85B 2FPWA 1DX9A 3OIYA 3RJTA 1V9LA 3B1KA 4LXYA 4R98A 4JDPA 4DCSA 1F2UB 3TRIA 4BMXA 1OZHA 3PYXA 3B3QA 3P9YA 1LK0A 4FNOA 1KJ9A 1PX2A 5DDIP 3M9LA 1Q7RA 1RSZA 1OR8A 3UZUA 1NJ8A 3ZHRA 5M2QA 1YR8A 1ZH0A 3GLSA 3L7KA 1OYVA 3W04A 1XCJA 2Z2JA 4Q9HA 3SIWA 1QZXA 2F3UA 3CR8A 2J9FB 2XE4A 5JJ5A 3OQMA 1H94A 4LXTA 5DOVA 2GDJA 1TM7E 5IBPA 4H3SA 3KR2A 4DWVA 1KRHA 1BO6A 2O2GA 3A3PA 5T8KA 4GL4A 2Z4RA 4CEHB 4QICA 4F2PA 4C7OB 3JVEA 2ZZMA 2QAGA 1CDOA 4QPDA 1T3ZA 2BCGY 2P75A 2Y93A 2CMDA 1WPGA 3R9KA 5HW0A 1IJFA 1X1AA 4OMDA 1DEHA 1U9YA 5FOWA 3GLTA 4AW9A 2FX3A 2WWFA 2XOXA 3ZI7A 2HF7A 3VJRA 4BO9A 4NBTA 2DGDA 5ALJA 4CMIA 1QHHB 1WU8A 5IXSA 2C92A 4MS4A 5JI3E 1Q3HA 4LDRA 3I8SA 1G2OA 2PFGA 1OROA 2WTBA 4YDRA 4QC2A 3TQFA 2BFBA 1AHNA 2IXFA 1DEKA 2RH4A 4TS9A 1H05A 5CK5A 4ER7A 4F72A 2ZUWA 1H8EA 4ZQEA 2O7QA 1QF9A 3NHJA 2BZ1A 1RDFA 2ZW9A 1IQRA 4NVRA 3ZIAA 1VE9A 3P4YA 2XUIA 3E3AA 2CNBA 2CLMB 3UOWA 2WKWA 2ZR0A 1VTKA 3B6EA 5BSUA 1NI3A 2OQ2A 3A4NA 3BSFA 1ND6A 2F3RA 3LBAA 3PKZA 1TO1E 1WXDA 5LCXA 1XTTA 1N0VC 1Z45A 3UXMA 3VKFA 4LFAB 2J46A 4MS1B 2D62A 2ZTMA 5FI5A 5TJ9A 1S9HA 3PA6A 2HK9A 1R0LA 3H6KA 5FIUA 1PBTA 3EXHB 2YZKA 4WKBA 4YP1A 4N7BA 1C9DB 3KZKA 1TJ4A 1YUBA 3SZ3A 1MF7A 5JZ9A 3AOEC 3Q15C 1LU9A 4X1IA 1RXEA 4BNMA 3FYCA 1R50A 3DCIA 1YQUA 3AEXA 1DBWA 1ULBA 1XPJA 4GZLA 4XUDA 4Y9RA 4LXGA 3DHEA 1I80A 1JEEA 3KHKA 1G7SA 4UZSA 2QUHA 4NBUA 2SKEA 3LHIA 5HIAA 1R0KA 2H0QA 1RHQA 1OT3A 3HU3A 1TDJA 2VKTA 4WXYB 4FM9A 3DPIA 3N58A 2X14A 4KYIB 2FZGA 2V7BA 4I08A 1NVVQ 4HGPA 4IEIA 3BXFA 3E22A 3HDHA 2OBXA 5ECGC 2RAVA 1Y81A 4AIRA 1H65A 5HTOA 4P5PA 2BMFA 1E8NA 2KSQA 1ULTA 3KEFA 5K8UA 3CNNA 2DUNA 1E1DA 2JGFA 3PD0A 1CEEA 1IZYA 3U56A 3RKSA 1XCPA 2CVZA 3FFWA 4FQ8A 1ZNQO 5DTRA 2FETA 3R0VA 1U4SA 2D0OB 4PLPA 2WBLC 4FR2A 3JR3A 3QBTA 4MR9B 1JBKA 2VJLA 3HR8A 4FYKA 5HCIA 5IRCD 3QBEA 2XD4A 4BAZA 2Y2VA 3IAS1 3FSGD 3B7WA 4UZFA 3DMNA 3QEKA 5NULA 3LX4A 4M3NA 2BEVB 4XDYA 2Z8YM 3NXSA 1WCIA 1WDWB 3C39A 5J4HA 2QVXX 3CZMA 5TE9A 1OGIA 1CETA 1YZQA 4DNFA 2BRUC 1UOPA 4PHHA 5BUSA 2VNKA 3DNFA 5AVZA 1E6LA 2ZYDA 2JIDA 4UNIA 1X7YB 4KQ6A 1ZPDA 1ADFA 1TVKB 3ITEA 2M1XA 2H5JA 3BMOB 3FKJA 3L07A 4MVJH 3TZKA 1JEQB 1RYMA 4KI0A 4L9AA 2BFOA 2AEFA 1SK8A 1X0XA 4HYYA 3DQQA 4EQ6B 5LMNB 5AVTA 4QE3A 1Q0RA 2FRXA 1T3TA 1HE5A 1BN6A 1I5EA 4ND1A 1KOJA 5HE8A 5EIEA 4QIHA 1DB3A 3WLTA 1ZD1A 3HDVA 2H5LA 2OCLA 2SCUB 3TZBA 2IEIA 3L0BA 1PFQA 3D5QA 2D4AA 1KDOA 3EQ9A 1C0PA 2XB9A 2JIZD 4RHCA 2VJYA 3HB4X 5H1YA 4DXAA 4HNHA 4LSZA 5AW0A 3B36A 1DINA 2ES4A 5BWOA 2EKDA 1JZSA 1ES9A 1MJGM 4GOMD 2VXBA 3KPYA 3V8QA 1G20E 3TPZA 3GJQA 3Q12A 3IBCA 4K86A 3MWEB 5CT6A 1ZK0A 5MFPA 1UKBA 2BFDB 2X8AA 1JWBB 3VXKA 3V3KA 2QSYA 2N47A 4LHWA 3W7AA 5I4BA 2DH5A 4YRDA 4LRUA 3G7NA 3OTQA 1R6DA 5IDYA 2VA9A 4BN5A 4YLYA 2G1UA 5ITWA 3IUQA 5JH7B 4FFBA 1ZLYA 2REQA 5IFKA 1TK3A 1CUAA 2Z6VA 3NJ4A 4BKUA 2ZKLA 3UOGA 2GRAA 4J7UA 1IDN1 4C2AA 1KXJA 4GOND 5F4BA 2IVFA 3O9ZA 4IMJB 1L5NA 1L6IA 3GR6A 4B48A 2DKNA 2EGGA 3SU8A 5CDSA 3AHDA 5GAJA 3RVDA 4LF9B 3JQEA 2NUAA 3B89A 4J6EA 3E9QA 1RPTA 2J41A 4BQRA 4KNVA 4M9SA 3FAKA 4JVNA 1I8TA 2B82A 4Y2VA 3J81A 3KZVA 4R8LA 3F6EX 5L6LB 4YYEA 1CY0A 3DL4A 4C06A 1T4MA 3A58B 2JRLA 3FDIA 4KGDA 2QLFA 4EBFA 3HR7A 1ELOA 4DR4B 1FXWF 3HA3A 3UJHA 3AHJA 4D5EA 1CRPA 3BE8A 4QJBA 4ETIA 4P6VF 2XBUA 3WOHA 4ZYTA 1QG6A 5IUJC 1E66A 5IN5A 2D5LA 4R41A 1P9OA 1U3GA 3BS4A 4J29A 4ZC8A 4D8TA 2Z2YA 4DLZA 4POOA 2BM0A 2XNDD 1XZQA 3IDQA 3MIZA 5BMVF 1W8DA 3PR2B 1FK8A 3MTBA 2YHUA 1J2YA 4GM1A 2GK6A 1MFPA 2QP3A 1O6CA 4U00A 2AUMA 2OYRA 1JMKC 1VMKA 1VQ1A 1ZGHA 2OCDA 3DV0A 3IXLA 1E0JA 1QWOA 1SK9A 1X1QA 1X9GA 2C5GA 3IXMA 2A0YA 1DARA 1TAGA 2QMOA 3S1AB 1EI9A 3WIOA 1C3XA 4CF6A 4MP8A 3VU9B 4JC4A 1UKVY 2Q21A 4M55A 3UC9A 3CF4G 4EZIA 4GRAA 4K9PA 4QEDA 3X0DA 1O94C 3MTQA 2O06A 4ANFA 4E5PA 3C16C 2Q6TA 4XH9B 3EG5A 5F33A 1KH1A 3GMSA 3ZUGA 5I7EA 2DPMA 3T1NA 5F35A 5J23A 1JEOA 2BKVA 1MAUA 3AY7A 2QAJA 2ONJA 1YGPA 5JDCA 2ZQYA 2FFQA 3P19A 3F5QA 1AQYA 4EY8A 1SOVA 4RVCA 1XLVA 3QTTA 3I61A 2GASA 3K0CA 4B4KA 1CXZA 4XVQA 4IGKA 3K9WA 4FOOA 4PINA 4FW9A 1CEQA 2RBEA 1A9QA 3X3HA 3UB3A 1VFPA 2NTVA 3TS1A 2PFSA 5I6DA 2ETVA 5FUXA 1M6VA 3DR5A 1UAGA 1E9RA 3PFCA 4PC6A 4XB6B 1BMFD 2CY0A 2NPFA 1YKFA 2R44A 3DQZA 4HXGA 2QLJA 3ETHA 4MLDA 4Y9UA 4ZANA 4MDHA 2C2KA 3S44A 4HPXB 3KJXA 3I0ZA 1D2CA 4CMHA 1UAYA 3O4HA 2C7PA 1Z5VA 4FT2A 1VKJA 2VYNA 5J4VA 1OI2A 4QDTA 1F1JA 1JSLA 2V0CA 1MIHA 3KU4A 4E21A 3D0OA 1CZLA 1NLUA 3Q41A 2PEYA 2XDYA 2VXCA 1IUOA 3E9NA 3KUUA 2E18A 2YIJA 4HCJA 4I46A 5B5SA 4UHHA 3B1YA 3IUBA 3OPNA 4RTSA 2B98A 1K75A 1W36B 2J8ZA 4FZRA 4OXIA 1V96A 1T6BY 1RWXA 4GQIA 3GHHA 4JXJA 3AVXA 1EG2A 4YN3A 2QTCA 3HQ4O 3OOSA 1A8UA 2FI1A 4IOLA 5CFZA 2OK8A 3OIUA 5A5VA 3QVGA 4Z7NB 2DRIA 2I34A 4YQZA 4E1AA 1YZVA 4QNNA 2CDNA 3NAMA 1P62B 1U3DA 2B78A 1HL7A 4PYLA 4B47A 1OV4A 2F8LA 1WMAA 3L1UA 4DABA 5L4LA 1T9DA 3JU3A 1LF5A 1PV4A 4G5XA 2E4ZA 1XZAA 3NX4A 3C41J 3JYNA 4PX2A 3RABA 5JZOA 1T2EA 3ZW9A 1PYDA 3IALA 2YV5A 3U3XA 1FZQA 1NQWA 1E18A 1OTYA 1OXVA 2Q6KA 3EXG2 3JAWA 3BA6A 3OLXA 3AF2A 3ZHVA 5B3JC 4L8VA 5T4BA 5CFMA 4WW0A 5ITZA 4K8RB 1GV1A 1Z2OX 4QHYA 3NFYA 4OXKA 4MI9A 1G4HA 1X9HA 5JTUA 3AI2A 3E81A 4IJKA 3RIXA 4W9RA 2D2IA 2WUGA 1SVUA 3ZY4A 5EP1A 1EJ2A 3LQYA 4ZCPA 2ZJBA 2WMDA 5LKAA 4L0MA 4ZMRA 4H6XA 2ECFA 1AZLA 1I6MA 4C0HA 4ER0A 5JNRA 2GM5A 1JTEA 3GRRA 2O6LA 5KPJA 1XEXB 1W46A 2CW5A 5E7IA 3UUGA 3ZZ1A 2E1RA 3WGZA 7YASA 1U8YA 1ZVQA 4B3XA 5IK2D 3ADKA 2W2LD 4ERXA 3IPXA 5KYXB 4AUEA 5HRCA 3KD2A 4LGCA 1E63A 1I01A 4OEHA 4MEJA 2FZEA 5HIIA 5HMMA 2DZDA 1M34A 1N2OA 2G9VA 1VLZA 3DOUA 3GUZA 1NVAA 4EIWA 1PN3A 4P35A 4EK9A 1UOEA 2A7QA 1NULA 1KMIY 3VHQA 3I01A 2O8EB 3PRHA 4B45A 1WXWA 3FUUA 3P9NA 3IVCA 1WMFA 2BBTA 3ROPA 3VC7A 3SVTA 4V02A 1F48A 3SIPA 1YTLA 2OV2A 1VE1A 1CWUA 3VYWA 4D42A 1J70A 1R18A 4TT3A 1FP1D 1O08A 3JVIA 3E7DA 3LY8A 2ZRLA 3QKRB 3BDAA 1J90A 1TF2A 5CUQA 2HOQA 2H11A 4ZN6A 5E8RA 3QKSB 1NP6A 5JS6A 4OI1A 3COVA 1NMXA 2DULA 2ZIXB 4FPXA 4DJ5X 5IT0A 3A6LA 3VR3A 1BX0A 1ZGGA 2V3WA 5BR8B 4U5QA 3G9TA 3AHCA 5DHRA 5J2UB 2QTRA 1RJGA 3DJFA 1MZVA 3SZRA 3GLHE 3LIIA 4NDNE 4U02A 5A4FS 2V58A 3RUHA 1L7QA 1TC2A 1TMYA 1TT7A 1NBMD 1UJ5A 3I6BA 4TMFA 3GLIB 2I2BA 1T2NA 5DFAA 2HGZA 2O3UA 3EXFA 4X65B 5GONF 3GLGE 1CUGA 1N2IA 1SFRA 2V7VA 1H1TA 3EVDA 4HWRA 3ZE7A 1Y6ZA 5B2ZA 2R2AA 4IOKA 4EJSC 3M1AA 2TMGA 4FFNA 1UUFA 1JKJA 2GESA 5BMVA 4LYFA 2OXEA 3UNXA 3H5VA 2PMKA 1C3OA 3R9XA 2YFQA 3GCXA 4NK4A 3UGKA 1MVOA 4GIBA 1MG5A 5BPHA 5KSYA 1T8YA 2PWPA 1I7SB 5SZKB 3IR6A 3OE5A 3JV7A 2NWQA 4Y2JA 1ONSA 1BSVA 1Z28A 5AKZA 1AKTA 1IWOA 1K97A 5K8JB 3R6DA 5BV8A 4KLZA 2WLTA 3TYXA 2UXBB 4MWOA 3D6UA 4OXYA 2HHHB 3P8ZA 1WW8A 2LZ0A 4B2LA 1HNWB 3KLNA 1ST2A 1L1EA 4RGVA 4KYVA 3ZJ5A 4E5YA 1XDSA 1AGRA 2GWHA 4HUQB 2AC4A 3HL0A 5HQTA 3NPMA 3CSDA 2PA3A 5K0SA 1RRVA 1T1IA 1DDIA 1ECJA 2GVNA 4YAFA 1C3LA 1GNPA 1ND5A 3MWDA 1CZUA 3PXBA 4BQPA 3F7TA 4YV1A 1U2DA 4AY2A 2OBBA 1U5AA 4TXNA 5LLDA 3OP1A 4M8LA 1OAOC 3ND6A 2BHRA 1JHAA 5HYVA 4HAIA 4TLDA 2B4AA 5BQPA 5IYZB 4IFIA 2C3MA 4NI5A 2DWOA 3PUKA 3ICEA 2HU7A 4YALA 1H8ED 1VLHA 2X9VA 3DT6A 4X6LA 1ZGCA 4KSYA 2GAAA 4NH0A 3TLYA 3U9SA 2FJUA 4RIHA 4X93A 1V5EA 5J63A 4W9NA 3WLKX 5EWLA 4L1KA 2H54A 1RD4A 4C0KA 5K4GA 3TJRA 4YEDA 3B8EA 1UZMA 5FLYA 4ALLA 2PUGA 3LC1O 3M3DA 1OXMA 4LC0A 2D0PB 4DVJA 2D5AA 1NE2A 1CVLA 3FYDA 4OFWA 2XX3A 2L17A 3S7TA 4CLOA 4C6HA 1MRSA 2NVOA 4RZ2A 4RKRA 5G0TA 1B1CA 3AEKA 4NE9A 1T0JB 4NYMQ 4DA6A 2XDQB 4QOSA 2GYYA 1ZZGA 3ZY5A 3V8BA 2CN1A 2BR4A 3NJRA 3MQ4A 4Y7DA 4GW3A 1AKQA 3CS3A 4JNKA 4KXNA 2ZU6A 2V4MA 1C9JA 1HLPA 1WHTA 2EKBA 4RNDB 5JI2E 1Z3IX 1QV6A 5FYQA 4OUDB 3KOUA 3ELYA 4G86A 1L5GB 1EDOA 4RQBA 3STVA 2EG9A 5K4HA 2H00A 1UBSB 2D06A 4LXIA 4PX9A 4FKMA 1HDOA 5DCUA 4AO8A 4AZWA 4DIFA 2LBPA 3FYUA 2UKDA 3V5NA 3PNKA 3HB1A 2GWRA 5C1IA 3V6LA 1U31A 3WK8A 3UHJA 3FI9A 3O8CA 3IOEA 3GRAA 2XT9A 2PQ0A 4G4JA 4TS1A 3W6ZA 4DEXA 4X90A 3QKIA 1X8XA 3JX9A 1HORA 2E4WA 1W52X 2G09A 4RY0A 3TW8A 1R64A 5FAXA 4DL9A 4LKRA 2XYGA 2RGGA 2VSFA 3WA6A 1LLCA 1VB5A 2P6NA 3U4CA 2HV9A 2HZ7A 2WFLA 1I10A 3IVMA 1J24A 4H7KA 3T7DA 1N3BA 5CVCA 1R9GA 1N5JA 2HK7A 2IODA 4MKZA 2JIPA 3NO4A 3IT1A 3R09A 4DLAA 2O05A 4EOGA 2YHBA 4EQZA 3ZGVA 1CY2A 1M7GA 3L7LA 1OB5A 4AQDA 3S8MA 1SPBS 4QOGA 2Q8QA 2VJQA 3KX2A 5FPSA 3RVMA 3VU8A 1KC1A 3CY6A 1UL1X 5DXAA 4V1CB 4TQAA 3BF7A 3LD9A 4RH1A 5KOHB 3HRIA 1ZNWA 1MA3A 2FSVA 3DMTA 5KMGA 1RKXA 1ZHFA 2W98A 2FNAA 4UUQA 1M8KA 4HQ6A 2OZLB 2HV8A 5A3RA 1MGOA 5AJUA 2CJFA 2Y1KA 2AOTA 4QXOA 4UFOA 4ATNA 5BW8A 4IFEA 2W2KB 3BBLA 4ID9A 5E6UB 3EF3A 1ZJ4A 4MR7B 2F8SA 5DF1A 3F8SA 1JILA 4RJTA 1XTVA 3DMDA 4LMPA 1R6BX 2X0FA 2A58A 1KMCA 3VDMA 4PG8A 2RGNA 3D43A 5KO2A 2QXTA 2GJ9A 3DL2A 5T4FA 5CH3A 2DHDA 1KKUA 5DCYA 2Y1XA 1UJBA 3LYAA 5JD5A 1AURA 1HTBA 3AEUB 4KU4A 3VFDA 5FOVA 2Z9CA 1U0BB 3M82A 4HHEA 3OOJA 5CVEA 4N9WA 1KWKA 2IIQA 5AW6A 5CLJA 1HT3A 3PJFA 4O1MA 5KTYA 3IOBA 3CVYA 4G0UA 4Q82A 4ZZ1A 4GDFA 2D2FA 1UXOA 2AD5A 4UQPA 3B5EA 1U9CA 2O2CA 1BRTA 1P1RA 2O50A 1VRCA 3PZBA 4RU1A 5GP1A 1DMSA 1E5XA 1B00A 4IIXA 1EAYA 4N8SA 4P83A 4BGEA 3UC5A 1DDGA 3EULA 3G9UA 3ANLA 4AECA 3NTOA 2IJGX 1EUDB 4IIGA 2WJPA 4NK5A 2Q3CA 2OQVA 4D56A 2J9GA 1Z4KA 4WN3A 1FYWA 2ZRGA 3FTNA 5EGSA 4FXOA 4CQNA 4BBJA 1EBUA 4L2IB 4K8OA 4LNUA 3FYTA 5JCJA 3UV6A 4PN7A 4J7XA 2WUEA 4B3DA 4DAOA 2ZSDA 2J32A 1C7JA 2G0NA 3LHSA 1I3OA 2Z30A 4CFYA 1MDFA 3RU7A 4A15A 3D5TA 1U7PA 4X97A 3BSYA 3RRXA 1RTTA 1U98A 3X43A 1F1BA 1QF7A 2X8LA 4OYLA 5JPIA 1KTVA 4EF4A 5ICEA 1YKGA 2HBRA 3PHBE 4XIYA 1I4WA 3HN7A 3V4PB 3K8OE 1VMDA 3P9RA 5CAEB 3I58A 4B82A 3M9WA 2EX4A 3L8CA 3QVOA 2GAJA 4HLDA 4IIDA 4TV8F 3ZZNA 4F60A 5HUQA 1Z37A 4IJWA 1NJ5A 3M4XA 4P53A 5JVDF 4CE6A 2EJCA 1J2RA 3NBUA 3CN7A 4F5YA 1VBKA 2VP5A 1PX0A 5ALMA 2I6UA 4HB2A 5EIFA 3VR2A 3Q85A 5F9FA 3IQZA 1QH8A 2X8BA 3CLSD 1LKZA 5BN3B 2HJSA 4RLSA 1II8B 3QFRA 1COWA 3KTOA 1CP3A 2PZBA 4ZO6A 5H83A 5EIAA 1KTIA 5DYIA 4Y9DA 5AM1A 3PQEA 1D4OA 1Z6GA 1P4JA 2P78A 4W99A 3WJ2A 3ZIUA 1RP7A 2X6TA 3QJYA 3AF4A 3R9IA 1W6RA 5EHIA 2CUNA 2WYVA 2YN4A 2C2WA 4MCJA 3AKEA 5K9ZA 4O3MA 1NA5A 1I36A 1NQOA 5HJ5A 4JP1A 4CKXA 4S12A 5DP1A 2VSQA 3V2UA 2QTAA 3C1OA 4QUEA 4MKGA 3HCRA 3C6BA 4FYMA 2H7VA 1Z8FA 4KBGA 1RLIA 2F9LA 4L4YA 1A5TA 1CT9A 1K9SA 4LOKA 3U3JA 1WU7A 2DVMA 4PBTA 1NJ2A 1W5FA 1KP2A 4BEBA 2E55A 1KI6B 4LS3A 2DR3A 2PU5A 1QUFA 4CMKA 1IY2A 2GUGA 3E7PA 4BQSA 5CVTA 3MWKA 2GB4A 2YXDA 1ULAA 4YS6A 2WILA 1QKKA 3EHEA 3PNOA 1CU1A 3C3YA 5KAMA 4C4YA 5FPYA 4I1VA 2B3TA 4MQLA 4RF4A 3HU1A 4R0VA 4WXMA 1FYFA 5D84A 3BZUA 3W2TA 3QV2A 5IDQA 3AVVA 2FPKA 3IB3A 2C3UA 4MI3A 2ZJYA 1ZN2A 3NHZA 3NONA 1HFWA 1LB1B 2YWBA 2GTPA 5K2MA 4B33A 4MIKA 3WKDA 1MB3A 2FSIA 3EBLA 2V8OA 1N2CA 5BV0A 5AKJA 1C81A 4PVDA 4MPDA 5CFNA 2FXIA 2ODAA 4YI3A 4AP6A 4YCDA 1X7WB 1ZNYA 2XZTA 3OJFA 3E3LA 1IJEA 1E2HA 5DEOA 2JFGA 5I9IA 5JSZB 1C1HA 5KJFA 1E2DA 1IOZA 4AUKA 2OZVA 1L6RA 2HSJA 3GARA 1DOZA 3OIGA 4AJNA 1RZVA 3A2NA 3AGPA 2IY9A 1NOJA 3HKBB 3IPAA 5A0FA 4YR7A 3AVOA 4YX9A 5FLKA 2NQ2C 2XZDA 3U1BA 2QUZA 5A6SB 3MT0A 5J5CA 3WMGA 1QK5A 3A10A 4FJ2A 3T7TA 4ZZ2A 1CJTC 3I1JA 4NBKA 4B09A 4ZYLA 5AP9A 5F2OA 2OBMA 2YY5A 4MA5A 1GPKA 2IZ7A 2IY7A 2E87A 1THMA 4RPLA 4AX8A 5AIBA 2DQKA 4WKPA 1R6UA 4KV7A 4UMVA 1M33A 1P81A 3M1LA 4C01A 1GQ2A 3BMNB 2FN8A 3LWBA 5HCNA 4D9KA 4PE5B 5HA5A 4FT4A 2BFFA 4NZ9A 4FBLA 4MA0A 1PDWA 3CUEF 2DLDA 3IAUA 4MLPA 1NM5A 5GZ3A 4DR1B 1YT5A 4FMCF 4C05A 2ZAIA 5FTNA 1OZGA 4P3OA 3B3FA 4ARAA 2O8FB 5JAIA 1QK4A 1N6HA 4UUBA 2AG5A 2QVCA 1V71A 1T9KA 3GEGA 3LJKA 4BIIA 3U0BA 3O4IA 2FB9A 1SKYB 1RIFA 1TT5B 2A33A 5FKJA 3SJZA 4C7VA 3K70C 3BH0A 3TR0A 1CVIA 4HH1A 2QI9F 2Z98A 2VYCA 3ZCPA 4CTOA 4MDEA 1SRRA 3CZRA 1UBJS 2Z5LA 1YH3A 2PLFA 1I32A 4UBLA 5HZHA 5IJXA 3TXXA 1FRZA 5GOZA 4A2PA 2O8DB 2I8LA 2YWRA 2ZJ6A 4HN4B 1P2UA 3GMTA 4Z1OA 3SZUA 1UBUS 2Q27A 1HDYA 1DO0A 3L8MA 3MK31 4E4YA 4QVKA 3SNHA 3PDIA 4C0QC 1Z74A 3NI2A 4GSKA 1K2VN 1PW7A 2FEOA 3IP6A 1ZFNA 1VI2A 5LWQA 2CV1A 2PPLA 4TWIA 1YS6A 3RYTC 3A9RA 5D87A 4FYJA 2NNLD 1YRWA 2X0JA 4LDAA 1RYHA 1T5OA 1Y0BA 3KWMA 1RVDA 2WE7A 1VL6A 1KPGA 4DCUA 3ASUA 5EP2A 3WNDA 3FLMA 4EDHA 1QHYA 5BRNA 1XDDA 5A3JA 3LC7O 3FVTA 3M6LA 4EB6B 5BSMA 5CT8A 2B6NA 4FINA 4Q1DA 1XZEA 2GZ1A 5CLHA 1V7CA 4V0SA 2V6JA 3P26A 4GMKA 1ONPA 2OP0A 3BWXA 3LQRA 3ZCTA 4IZIA 1WOYA 4LC1A 5G0SA 3SCZA 3SS7X 4DQ0A 3BOSA 1V1JA 5ARBA 2ZIAA 1L4BA 2RHHA 3HG7A 4FHCA 3RDPA 3GFSA 5KU7A 4WZBA 2QAGB 1ULUA 1CY8A 3OFNA 1NC3A 1M1NA 5HR5A 2XXBA 4E09A 1DQYA 4X66B 1ANKA 3CQ9A 3FNQA 4EO9A 4F2GA 3SM3A 3V8PA 3A9CA 2AB0A 3LOPA 2OO5C 4KO1S 3U9LA 1MRZA 2W8BA 1KSFX 3RKRA 5AXCA 4CMIB 4G25A 1IULA 4EMUA 5TIIA 3UJCA 4D8UA 5BURA 3NV7A 1YBAA 3ZX4A 1V1RA 4LOJA 2ORWA 3BK2A 3PFIA 1W4ZA 1A8HA 1REQB 3TL2A 1UWCA 3B6IA 4DNOA 3LUJA 1ZN7A 1NXPA 4QARA 3K6SA 1V25A 1TKRA 2B8NA 3I1YA 3TCXB 4QXQA 4ARIA 3QWBA 1QVVA 1PK9A 3TW0A 5GGXA 3EPRA 4MWEA 3GZNB 3JRWA 3VV2A 5IWCA 4TWRA 5G0UA 1KFEB 3T06B 2IXDA 2QM0A 2BE7A 3OM9A 5FOXA 4EG7A 2YRXA 1K7XB 5KWEA 4BXOB 3IELA 2EX0A 2GHIA 5E7QA 3TIIA 3KTAB 2BFPA 2IE8A 2X5KO 2DFTA 4GYYA 4QDZA 4D74A 3MW8A 3E1KA 3N07A 4TSFA 4Z5XA 1ZZEA 2Y4NA 1V37A 3V00A 3TQCA 4KDRA 2HY7A 1A1SA 1K6JA 1SVLA 4X1IB 1MB4A 1RIIA 4Y6RA 1ULSA 1C8VB 4GVLA 1R5OA 4HEA1 5AK5A 5JPDA 4EPTA 4DLXA 1U1CA 2HO4A 2JLAA 3HYLA 2IL1A 3OZBA 4CKBA 3ENVA 5EQTA 1YR3A 1RZRD 4UOQA 2WYIA 3N87A 1RJWA 3OHSX 1BXGB 3CZ4A 3M34A 3NWOA 4FZ5A 4PZEA 1Q1AA 1Q7EA 1VCIA 4JQSA 5BWLA 1AN9A 3CMMA 1H1LA 4DQDA 1JDVA 5DGDA 4EECA 5A4MS 2RHMA 3BIWA 3THXB 4MVYA 1XTQA 1E77A 3KT0A 1TVCA 4PNHA 1JEAA 1J8VA 2FWIA 5CB8A 3S2IA 4YMWA 1PQUA 4TMXA 2CHQA 4BAUA 3N2GA 2HIAA 2RI0A 4XGIA 1OX4B 5E8JA 1T2VA 1LTQA 4JLPA 4LXXA 1DWOA 3RSZA 1V1MA 2Q1TA 3T9FA 2QPLA 3ZPXA 5IU6A 5LP6F 3T1TA 4ENPA 5F9HA 2PR7A 3LDUA 2Y1LA 3VKHA 2VXYA 4CEJA 3GGPA 2I91A 1AQIA 4FOPA 4NAHA 4RACA 3L6OO 4NCXA 4PX5A 4JEIA 4ZRMA 4CM8B 2CV2A 3WDLA 1W0KA 1MOQA 4Q5IA 5CDGA 3SSAA 3A2MA 3K9GA 3O3MB 1Z0FA 5LQJA 1PUIA 2X58A 1PDOA 2HSEA 1YCDA 5CA1A 1KJNA 3DBOB 3NIDB 2Z43A 4HYTA 4KK3A 4NHOA 4W9MC 3T35A 2E5FA 3OLWA 4EL5A 1Z36A 3Q6MA 3RSFA 3PENA 4J76A 5K2OA 3RBVA 1UMBA 1M9NA 1AKWA 3U4DA 4YMTA 2EBFX 2OAP1 3F46A 4JI8B 3LI2A 2JL1A 2NVWA 4RVUA 4P92A 3CPHA 5REQB 3EXHC 2C5FA 3BX1A 3U3RA 3NAZA 1Z38A 4HLUC 1NPTO 3P4UA 2QTBA 4FN4A 1U28A 4DG5A 2ERYA 3A14A 3IV6A 1ONNA 4A5OA 3RUPA 1KQOA 4WEOA 5EJMA 1U1FA 1YR7A 3BKWA 4MV3A 4NCHA 3ZU4A 1LX7A 2GXSA 3TLZA 4YV7A 2P68A 4DIOA 1VMEA 4FX5A 1RXYA 3U7IA 3MCTA 1RQRA 2MSLA 3UT5B 4HZUA 4NYIQ 3GLRA 1OGJA 4XUCA 3PLRA 3DSRA 4L8YA 2PKEA 2AG8A 4F91B 1C14A 4PNPA 1DAGA 4IDNA 1SEPA 3LP8A 2TECE 2C94A 4POAA 4C21A 1XPUA 5LBIA 3PJDA 2FK8A 4XUGB 4FFBB 1MUUA 5T67A 4DHEA 2REQB 2HU8A 4GLBA 2OL4A 4KDCA 4NYJR 4GMXA 3U37A 1PL7A 1P61B 2GAFA 2PBFA 3B7PA 4FC7A 5KSPA 5LZ4A 4B35A 3ELWA 4XGQA 3CN9A 1NBWB 3PQFA 1HZZC 1OUMA 3NOVA 3UMCA 2GBIA 1Z0SA 3PNYA 4B34A 1GTRA 4W1SA 2J08A 4N40A 4LHZA 4FLMA 4YJ2F 5K3BA 2XCQA 1E92A 4FDVA 3X1ZA 3FOFC 1YJAA 3EEYA 4KGXA 1U0TA 4ZRNA 5EMNA 2UUPA 3JQ7A 5AKHA 5EKXA 1X14A 4Q6WA 4BQEA 3EMDA 3UFXA 4FYXA 3FE2A 4MR8A 1JW9B 2CLEB 4XM0A 4ISBA 5DGIA 5BSWA 1U11A 3VOBA 3IT2A 1W5SA 3C70A 4W1QA 1OI7A 2NNWB 3IDAA 3UWOA 1PEAA 3OT5A 1CFJA 2RI6A 4TV9A 3WKBA 3MSXA 1FTGA 1LBIA 2Q0SA 2K7ZA 3G85A 3IAEA 4TWAA 1SXPA 4OLBA 2JLWA 4OB6A 4J2OA 1A8SA 1U9IA 1ZW6A 5FTWA 5TS2A 1XN4A 4UU0A 1E7YA 3UHFA 4X8LA 1AF4A 1NPYA 2VJBA 1P1IA 3BE4A 2JBHA 4QLAA 3GLHB 4V0OA 1NVFA 3O3OB 2AMJA 5FV4A 2FPIA 5DNEA 3L5KA 3V9PA 1CJBA 1TUBA 4UDYX 5EZYA 2CUZA 1TW3A 4M0MA 1VMAA 3OP4A 4A36A 1SVIA 1W1WA 2L2QA 4LJKA 4A8HA 1JIUA 3OLZA 1DEAA 4YAKA 3GLGB 2PWBA 3QU7A 4U63A 1QGED 2V03A 4BNFA 4HXYA 4CF4A 3TW6A 4LBWA 3H42B 4LHYA 3VR4A 4BHTA 4C4OA 1SVWA 5CH5A 3F5SA 3IP8A 3PNPA 4C0WA 1PGJA 4KQFA 1HLDA 2AE1A 5JSUA 2GXAA 4KXYA 5CXSA 2GI4A 2HLHA 1W94A 4ZEXA 5BQ5A 1IN6A 3EA4A 3CJQA 2YV4A 1U0JA 3FBGA 3G8DA 3VR2D 2HN9A 3MWJA 1XQVA 2PFKA 1P6XA 2G08A 3FD8A 2FP4B 1SU4A 2NADA 4I5EA 4RPCA 2HD4A 2Q5IA 4C0AC 1OILA 1PJ8A 3OJXA 5TX7A 1GUBA 2FZVA 4OMCA 1AQUA 1OU4A 1HI9A 3JQCA 4G1VA 1E3DA 2UZAA 3DM5A 4G8CA 5H4HA 1RKVA 3CU5A 1U9JA 1G8SA 2WP8J 4HDNB 1SHUX 4R2JA 1IHDA 3T54A 3WI7A 2XRMA 2ZIEA 4B7ZA 3SEFA 1DG1G 3S5JA 1U6KA 1N7JA 2ZI7A 4HX2A 4NDZA 4N0PA 5DBGA 1HQKA 2QMYA 4IUDS 2TMDA 5TPZD 4CLEA 5LYJF 5BVHB 3HDQA 1N6OA 1BDJA 6PFKA 4YWJA 4HJRA 3P9ZA 4M9CA 4MUMA 2XR1A 1J8DA 3ECSA 2G5PA 2VQ6A 5C46F 2GKSA 1T8UA 2HCJB 4GPEA 4UBJA 3T3IA 3INNA 3VR0A 2YHSA 3ZZ0A 5IM4F 3AVWA 1EGAA 2CJWB 2XMZA 5TQVA 5F7XA 2ZRDA 1R8JA 1HEYA 5E9AA 3WWDA 2JFFA 3E7FA 3FPCA 4DAEA 1LDNA 3BHNA 5B1IA 3ZLUA 1U1GA 4QXRA 3LYHA 3VYUB 2R7LA 3ID6C 1RYFA 2N3ZA 4JJGA 1FDVA 3W2HA 4E5UA 4WPGA 1K7FB 1YA6A 2ZANA 4ZDKA 1A5ZA 2P6UA 1FDWA 5IHXA 3HZHA 3CGWA 3DNPA 4JLOA 5JW6A 3GEHA 4Z7JA 3HBJA 4B0OA 5FCDA 1EWYA 1KA9H 1UC8A 2B2CA 4FILA 4GZMA 1MJFA 1QCYA 1QLWA 4Q3DA 3OY7A 3GVCA 3L0DA 4TKVA 5TGDA 4BDSA 3K4QA 1H2YA 1W47A 4DQXA 3B38A 4P3XA 4DM7A 4R9UC 3RRYA 2Q0QA 1H85A 1PTJA 4H2DA 4IMRA 5EXPA 4EI2A 1I3NA 4J0QA 3KHTA 4FEYA 4UPDA 1XQ1A 2J4FA 1G3RA 1JVNA 1TU4A 3G49A 1NPDA 4QT4A 1ZD5A 4LFBB 1CY1A 3SJAA 1M2OA 3UK0A 5IMBA 5SV2A 2IYLD 3W6NA 2IHVA 2B83A 1CHDA 3B3AA 1GFIA 5D7BA 3FDFA 4WA8A 3GV0A 1GSIA 1L7BA 3ICOA 1XXLA 5GQSA 4RVSA 3E4DA 4O1HA 5A4KA 1LLUA 3OY2A 3QEJA 4J3NA 5KDOA 1E2PA 5COQA 1J0EA 1A95A 4Q21A 2RK4A 5KJEA 2CXQA 1UMCA 1YR9A 1O96A 1P72A 1B8PA 2YQZA 3HLTA 2X3UA 4HLNA 4BNUA 2DLCX 4P5DA 2EARA 4E7PA 4GG1A 1G60A 2PXCA 5I9BA 1W36C 2PBRA 3D8RA 3TE7A 4K26A 2JI8A 4WK2B 4O6VA 1ZI9A 3VYTB 3EAFA 4FD3A 2CUKA 4O8ZA 3UWKA 4OKSA 1GYPA 3JD0A 5KYVA 4A0GA 5BVGA 5EXSA 2X0DA 4CZ2A 5FEUA 1EVKA 1QFSA 5EERA 2CD7A 2H8GA 1XMJA 4HPWA 4IG9A 1ZOLA 3SDBA 3UO8B 4RTMA 3OC6A 4A03A 5JS1A 3CW2A 2QVYX 3CRRA 3NM6B 2JGKA 1NXOA 4KC0A 1FTNA 2X4DA 3EWNA 3ZJVA 4BJ6A 1NN1A 3BXPA 1SCBA 2GJ8A 4FVTA 3KR1A 4LE2A 4V03A 4X20B 3TR5A 3W90A 4YRBA 1Q84A 3E53A 2FPMA 2ECPA 4JUFA 4WCVA 4ZOQI 5K0TA 5KVVA 2ZBDA 2QTNA 3EVBA 1JG7A 1J97A 2G83A 5BMVB 3C1TA 4KITB 5HZKA 7ADHA 1ZBDA 2GDZA 2A1TS 3VAZA 2BD0A 1C3OB 4EY6A 5G41A 1UXGA 3LHKA