3PXUA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
162
structure length
159
Chain Sequence
SMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 63
structure length 159
sequence length 162
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3pxuA00
4EG1A 5KHAA 2TS1A 1N2OA 1TYDE 1XNHA 3Q10A 4MWCA 3C8ZA 2I1LA 1J70A 2Z3VA 2QUJA 2WQ6A 4EG6A 1TFUA 4I6GA 4CDMA 4L2IB 1NUPA 1OWPA 4ZT6A 5J58A 3A04A 3CLUD 2A86A 3P52A 1MJHA 5JBNA 2E21A 5DEOA 4DDMA 1IRXA 2X3FA 1NZJA 1M8FA 1ZH6A 1N3LA 3NV7A 1H3FA 1TYAE 3QE4A 2J09A 2A1TS 3FHJA 3TZLA 4MW6A 4NATA 1KP2A 3F3MA 1PFWA 2QTRA 4DJAA 2PXHA 3INNA 4CT0A 2CV1A 2DXIA 1O94C 3P0HA 1OWMA 1O96A 1V47A 3RBAA 1JIKA 4XFDA 4ZCTA 3IH5A 2AZXA 3Q4GA 3N2YA 2QUKA 3FDXA 2ZP1A 3ISJA 2CV2A 2H29A 3FY4A 3IVGA 1V8FA 1JIJA 1O95C 1QRTA 1PFYA 1K4KA 4MUNA 4UZFA 1D2RA 3KFLA 1F7UA 4YP7A 2YY5A 4R0NA 5TGTA 5HG0A 1WXEA 2A1UB 4JXXA 2D5BA 2AG6A 3DO8A 3FETA 3NBAA 5FNZA 2DERA 3MUEA 4I6EA 3K32A 3TQIA 1O97D 2CYAA 4PBSA 4KR9A 1Q15A 4G5YA 4MLPA 2X0KA 1N78A 2JA2A 3X1JA 3IMEA 3RFFA 2DPLA 1S4MA 1G59A 3ZGZA 2CYBA 2WB2A 1MAWA 3CLSD 4ZT4A 1F7VA 1VBNA 1WXIA 3CLUC 5K0TA 1GLNA 4MWEA 1WJGA 1YI8A 3FOCA 4MW5A 1TQ8A 1EE1A 3CVYA 2XRZA 3AG5A 3RHSA 2BYTA 3DV2A 1N2JA 1U7DA 2PZ8A 3X1KA 3PRHA 4DLPA 3IMCA 4DDKA 4DDHA 3GMIA 4ZT7A 2Z08A 4YBRA 1PG2A 5J5AA 2J08A 1EFVB 4MUIA 1KQNA 2WSIA 1PFUA 4ZCPA 1G8FA 4KPUB 1NUTA 1N77A 1KKUA 4NAUA 5KCMA 1NUSA 1O94D 5KWVA 3RK0A 3H99A 2O5RA 3P0JA 3NBKA 3IOBA 2JANA 4FZJA 3GUZA 2QTNA 3X1MA 2RD2A 3AG6A 2IJGX 4QBTA 4MUEA 1O95D 3LOQA 1OWOA 1HYBA 3A4IA 1OD6A 3HL4A 1VLHA 1RQGA 3OP1A 1NUUA 1OWNA 2DETA 1O97C 5H16A 3SZ3A 5LLTA 2B7LA 3HGMA 1KAMA 1J1ZA 4NZPA 1NI5A 3SEQA 1T9GR 4PBRA 1TYCA 1BS2A 1YULA 2A7XA 1U3DA 2PFSA 3CLSC 1EFPA 3FIUA 3TS1A 2J07A 3KT6A 1QU2A 4RPIA 3IUEA 1R6UA 2X1MA 1YUMA 2A4MA 4DNXA 4MVWA 2HGZA 3M5WA 3LCJA 4EG3A 1JILA 2OQ2A 3AIIA 1U7XA 4KR6A 4MVXA 3IDFA 1Q11A 2QJTA 1DNPA 4YMIA 3BL5A 3CR8A 1QJCA 4TS1A 4AQ7A 3DPIA 1QQTA 1N75A 3IOEA 4L2IA 1LW7A 3COVA 1GTRA 3H05A 1GZUA 1WQ3A 4EG8A 4YP6A 4Q16A 1FYDA 3H97A 2HZ7A 4MW7A 2X1LA 1WZ2A 1EJ2A 3GLVA 4HK4A 3E27A 1YUNA 4H3SA 5LFAA 1M8GA 2GOYA 4MUGA 4U7JA 1KP3A 1VBMA 3CVUA 4MUHA 3PNVA 2DEUA 4A91A 3CA8A 4UZEA 1J09A 2XRYA 3ZXSA 1O6BA 3RK1A 4MW2A 1MOPA 3ZIUA 1NP7A 2HMAA 2IELA 4HJXA 3ZXIA 3IUBA 1MC1A 2A1UA 3H9CA 1MAUA 4Q93A 3A2KA 3ND6A 1KQPA 3FI0A 3ELBA 2CFOA 3P0IA 4ZT5A 3JXEA 2DLCX 2AKEA 2O8VA 1A8HA 1Q19A 2DR2A 2DUMA 1N2EA 1OWLA 2E0IA 4ARIA 3PNYA 1QRSA 3UMVA 2YWBA 3COWA 1WQ4A 3D6UA 3ZJUA 4U8HA 4KR7A 3A05A 1K92A 1NURA 2R5WA 1JZSA 2J5BA 1XNJA 4EG7A 3AKZA 2NZ2A 1T6YA 5DB4A 3ZJVA 1IVSA 2OV4A 1JEEA 3RJZA 5TEVA 3FH0A 3ZJTA 1J1UA 1WKBA 1I6MA 2VTBB 1T6XA 4ARCA 2CT8A 3MLBA 4OUDB 1WXFA 1JEDA 1F9AA 5F23A 4MUFA 2E18A 2CUZA 1KORA 2H2AA 1I6LA 4KPUA 5DK4A 4EFKA 3U1VA 2V0GA 1CT9A 1QU3A 3SZGA 3UOWA 4J76A 3KT0A 2QJFA 3UY4A 3KT3A 2QTMA 5J59A 1N1DA 4ZT2A 4DE5A 1IH8A 1R6XA 1SURA 1WXGA 1M1ZA 1KH2A 1N2BA 3HFJA 3IVCA 3IVXA 5IHXA 1QTQA 4E1AA 3PXUA 3G6KA 3COYA 1PG0A 3LE8A 4QRDA 1EUQA 3AL0C 4MWBA 4MUKA 3CLRC 4S1OA 1TYBE 3SDBA 1K97A 1IQRA 2D13A 4AS1A 4MW0A 4ND7A 1M8KA 3K9WA 1JHDA 3QTBA 1EXDA 1M8PA 4WSOA 4MW9A 4MAFA 4NX2A 2ZUFA 4MVCA 2A84A 2CYCA 1LI7A 2J4DA 3FWKA 4OJMX 1B6TA 4ZCSA 3HZRA 3ZUGA 1IQUA 1MBZA 1MB9A 1P7PA 5EKDA 4U63A 1QRUA 1G8GA 2GKSA 5DASA 1JZQA 3UC5A 1O96B 3S3TA 1VL2A 5FO1A 2Z09A 4MVYA 1FFYA 2PZAA 3CLTD 1NUQA 1JECA 1WY5A 2PZBA 2QUHA 3HV0A 4RUKA 4XSVA 3FNRA 4R2LA 2E89A 1EUYA 1PFVA 3H9BA 4ND6A 2A1TR 3SEZA 3TNJA 1GAXA 2PIDA 1MRZA 5AHWA 4ZCQA 2IP1A 3L93A 2CSXA 1KR2A 1IFXA 1KH1A 5TEWA 1UFVA 4MW4A 5K0SA 1YIDA 2BTEA 3MXTA 1N2HA 3G5AA 3ND5A 3TQOA 3I05A 2WQ7A 4MULA 2EJCA 1N2IA 1I2DA 2PG3A 4ZCRA 2QJOA 3VU8A 4P2BA 2NSYA 1WOYA 1NYLA 4G5FA 3UK2A 1ZJWA 5HUHA 1Q77A 3IODA 1ILEA 2C5SA 1JIIA 2RE8A 3N05A 3CLRD 1NSYA 4QREA 3FG9A 3QTTA 4MWDA 4HPWA 4WNYA 4NAHA 4XFJA 3ILVA 2D54A 1O0BA 4GU5A 1YIAA 3ND7A 4MQ6A 1COZA 4MW1A 1T6ZA 4I6JA 1U0BB 4EGAA 2YWCA 1MB2A 3IOCA 1H1TA 4R2MA 1X6VA 1I6KA 1OBCA 1JMVA 1VBKA 5BNZA 5FO0A 1IHOA 3VRHA 4F3RA 2GM3A 3SP1A 4EG5A 1QNFA 3COZA 3G59A 3N8HA 4G6ZA 3SYTA 4JYZA 2QUIA 3CLTC 3IMGA 1O5TA 3CVWA 1M8JA 1U3CA 2VXOA 1ZUNA 4K0RA 1ZH0A 1O0CA 2CV0A 2YXNA 5HUJA 1GTSA 1J20A 1IQ0A 4CQNA 4NDAA 1KH3A 1N2GA 2V0CA 3PNBA 4BWVA 1EFVA 1KQOA 3MLAA 3L92A 1F4LA 1H3NA 4EG4A 4HJRA 3N9IA 3AFHA 2A88A 1GN8A 4K03A 1GPMA 1X8XA 1M83A 4JFAA 1T9GS 1H3EA 4ZT3A 1TEZA 1Y42X 4PBTA 1K4MA 2JAXA 3VGJA 4KKVA 4F4HA 4EF6A 1R6TA 3TZEA 3Q12A 3CVVA 1J21A 1JGTA 1EFPB 1WXHA 4JXZA 3HMQA 2VTBA 2EL7A 3OTWA 2G36A 3DLAA 1LI5A 3MMXA 4JZYA 5LM3A 1XNGA 1KAQA 4OUDA 4CDNA 1OBHA 2ZUEA 1G8HA 5IJXA 3D6VA 4GRIA 4PY2A 4X0EA 4YP5A 1ULHA 4J75A 4MUJA 5TS2A 3CVXA 1XJQA 3KT8A 5H7XA
chains in the Genus database with same CATH superfamily
1Z6XA 2QRLA 1AZTA 5LNK1 2VI5A 1X9IA 2EFYA 3OFNA 1XPJA 4R16A 5K8LA 3I2KA 1WBJB 3EMDA 3ZU5A 1I3LA 1R74A 1YB4A 2CHFA 2R84A 4JP5A 2O4UX 3DEYX 1A4IA 2B8EA 1UJCA 3FJOA 1M1YB 2E9SA 4K3UA 2YMQA 2DTEA 3HSYA 4M60A 5EWJB 5LYJA 1N57A 4I6GA 4COKA 5EHZA 4G81A 1R64A 4EX7A 2MYUA 4ND8B 4W5OA 1OWPA 2P6MA 2L69A 2QNRA 4I4TA 4U6QA 4M1MA 4D99A 2YQZA 1UJNA 2EG5A 4F92B 3TZHA 2W8BB 4QBGB 2PA0A 3OCVA 1TCUA 2XA2A 3R2JA 4RANA 4I5GA 3RS0A 3EXIB 3KELA 1PSDA 2J45A 4UHBA 3FMIA 3UH1A 3WWCA 3VR6D 4TM8A 4Z2AA 4WOPA 3HADA 2C0PA 3GUUA 2JHGA 2ZQ5A 3CEAA 3AXSA 2ZUSA 3G88A 2AJ8A 5AJWA 3SK0A 3DFUA 4RDIA 4UFPA 6NULA 4OP1A 3IPRA 4WXMA 1B8PA 5DBIA 2I4OA 5DPMA 3DMTC 2RBEA 4ZAZA 3GGCA 3RVOA 1OIVA 4JR0A 2BI8A 4MIEA 2BMJA 3EMBA 3Q4GA 4EVQA 4IO0A 3EPJA 4PYRA 5FBZA 2XMBA 2VJMA 4RJKA 2FZWA 4KITB 1DAEA 5JFOA 2GSDA 3V5NA 4ID3A 4TMFA 4IQ0A 1IB0A 1Y7PA 4BNWA 1X7DA 3LHSA 3NOQA 1SCUA 4RENA 3I64A 1E0DA 1G21A 5ALMA 2ZJ2A 3REGA 5ALHA 2XWBF 1RU3A 3LVBA 2FFBA 2NAFA 4OBBA 2G6BA 4XM1A 3VYRB 1BJKA 1YC5A 3RYCA 2Y1OA 4WKGA 4MYHA 4QOIA 1E92A 4IDFA 1J33A 2FTKE 4PFJA 1I2CA 2M98A 4ZVQA 4BX9A 4DIOA 2F1IA 3OM8A 4IF6A 4MGYR 5D01A 4F1WA 1JFTA 3S29A 1X3LA 1FMTA 1T2DA 2QLFA 2W6NA 1I1HA 4I7EA 4ZAWA 5CAEB 3WNQA 4PG4A 2JA2A 4FYVA 1XWWA 4CM4B 1SJ9A 2Q45A 2CJPA 5M5BA 2NM0A 4JL5A 2J6CA 5DGDA 3ZLVA 1CQJA 5EJ6A 5CVVA 1MIHA 1MAWA 3DL2A 3K9NA 1ICEA 3W5AA 2EBWA 1VBNA 3CX4A 2C7VA 3X44A 1CNFA 1WZNA 5K0TA 2OGWA 2XB4A 3WLJA 1RS0A 2DTXA 4JJIA 1PEYA 1S1CA 4AJ1A 1N4DA 1KF0A 2QPAA 3RIMA 1JJFA 2CY0A 2R7LA 2WIKA 4HF7A 2CF6A 5JAMA 4JP2A 1GRQA 3JU3A 2E48A 3ELUA 5B2ZA 1B16A 1CETA 3WLOA 2IH2A 2OGZA 3OJWA 2ZT7A 1Z63A 2O3RA 2VHZA 5DHRA 2AJLI 2B98A 4QELA 1HX7A 1PJZA 1V37A 1CG6A 3Q5GA 1KZ6A 1HSOA 3MK31 4TYQA 5T64A 1O94A 3T7DA 4CDRA 3Q7EA 5IZCC 3WIUA 4FMCF 2VF8A 4LN1A 5LXTB 1QH9A 2D4HA 2SKEA 5TY0A 5LDHA 3KLNA 4QNNA 4LK2A 2FEOA 1L7BA 4I14A 2JGLA 4DMGA 4ZTUB 1KEPA 4E11A 3P9ZA 3A6FA 3MTEA 4FXOA 1I4WA 3TIXB 1BOOA 3V4FA 3PS9A 4B87A 1G8SA 3HDTA 4IUDS 4RKRA 4WLEA 3Q1LA 5D6NA 5HIAA 1NHWA 4JT8A 3V80A 3HKBB 1PQUA 3OKAA 4RPLA 1QHNA 4A8HA 5BV0A 3LVQE 1I13A 3F5MA 1JJ7A 4PLZA 1ZS9A 5JECA 2YXBA 4GLFA 3ROFA 2O8BA 3ABIA 4YBZA 4C0BA 4FIDA 4XLLA 4IG4A 3RC2A 4R1NA 1NRJB 2J3KA 2YFHA 4Z7JA 3VR5D 5ADVA 1NNEA 3EISA 2IZ7A 2RKWA 1II8A 3I01A 1FC0A 1FDWA 3AUYA 5ALRA 1UDCA 4IKOA 3ZWVA 5GQSA 5ES4B 1I24A 3UW3A 2NPOA 4KL8S 3SEQA 2FF7A 5C4MA 1SWVA 5LBUA 2HREA 3MAGA 1AXRA 4G1UC 5EFOA 4DV1B 1FP4B 2WU8A 1T8TA 2ZULA 4QAJA 1YULA 1TVEA 1X19A 1AVTA 3RJ9A 1OB2A 2PFSA 3LGXA 1EFPA 4BX3A 1EHIA 3WHKA 1GUBA 3UV7A 2I4MA 2JZOA 2ZG6A 3ZW9A 2PWZA 4XKJA 2CBZA 3O75A 1H6BA 5JXWA 2V65A 4PYOA 5JDIA 4NFYA 5L7WA 5ICSA 3WS7A 2EFCB 1QHIA 2QSJA 3G2NA 2E82A 2WHPA 1TJPB 3EOZA 4QGFA 2JLZA 4CKCA 2B1JA 5D3MA 2XDAA 1NMQA 3LDAA 3EVEA 1G5HA 1IBCA 2OZLA 5HFNA 5K6RA 3PHHA 4KR6A 4HDNA 5BSUA 2X77A 3SKXA 2GNPA 3HHPA 2EKDA 3EIHA 3P96A 3JASB 3DFIA 2JEOA 3CR8A 3JZDA 2W6ZA 1E98A 1L5HB 3ONNA 5JCOA 1QJCA 3Q0EA 5FPQA 2X42A 3NM6B 4B5KA 3I32A 1VYHA 1JYEA 5U4QA 1RJGA 2EWWA 4Q3DA 2W2KB 3FA2A 3JQGB 1YB6A 3OUZA 1N75A 5KIAA 3AF4A 1RLOA 2XQFA 4YAOA 3ZX5A 2AWOA 3BK7A 1Z4KA 4XQGA 3COVA 2NQ2C 2X8JA 3E7DA 2DVMA 1ARZA 2HSEA 3B3FA 3KKZA 4P80A 4K6GA 4EJ0A 1SWWA 1P7VA 3AQIA 3SE7A 4A1OA 2LIPA 3AKDA 4FGUA 3RDPA 5C8ZA 4HDKB 5KI6A 3JD3A 4YFVA 3I39X 3QPDA 4MW7A 1GLGA 2HZ7A 3KAKA 4DSTA 3KUXA 1K8QA 1D0IA 1B6SA 2ZQYA 4MV1A 4ZQHA 1L7RA 3QOYA 1ADGA 2XGOA 5HZKA 5JU6A 3UMMA 4TZTA 1N6PA 2QA5A 1QHSA 2ZKLA 5EE5B 4F9FA 4AUEA 2XTAA 2RAVA 4JOQA 1RWMA 2PVSA 4PO9A 4F6RA 2WOOA 3HU3A 2C2ZA 3IXMA 3JWHA 5EESA 3EIUA 3QLJA 4Q34A 4M53A 1OPRA 4LXIA 4P0QB 3R7LA 1T36A 3CZ5A 4NCBA 1IG0A 3FYUA 1J8DA 1VPVA 2G70A 2TSYB 4LI0A 5ER6A 4EKNB 1GDDA 4GGPA 2V45A 3ZDRA 3TQQA 2YJNA 1CUXA 3TFQA 1T3ZA 2ZU0C 1SXJE 2VDWA 4LECA 2BV3A 4F8JA 5B58C 1WEKA 1E2LA 1PUIA 3CX6A 3RVMA 1QFJA 4LEIA 3OM0A 1AV7A 1MFPA 3OU6A 4KI7A 1T9CA 5IVIA 3TSCA 5BMOA 3D1VA 3FUXA 4OMDA 3ZXIA 1H8EA 3S8EA 2JJ1A 1XJ5A 1MAUA 3A1CA 1LDYA 3D4BA 1ZJJA 3B2QA 2UVPB 3FVVA 5DN6A 3ELBA 1CF2O 4LVCA 5LP6B 1FTYA 3S2SA 1KY2A 4CR6A 3NWEA 4NBWA 2P5TB 1DQYA 1U1EA 3L8HA 4CHGA 4FWTA 1Q19A 2R2AA 3Q85A 5KNDD 3GQBB 2PH3A 2XUAA 3CMCO 3EFOA 3AHDA 4R5HA 4I9UA 5F5LA 3NNSA 1OWLA 3DZJA 2E0IA 1BKYA 2XZTA 1N9GA 2PKQO 3JWGA 3DYVA 3QW2A 4NC9A 3T4UA 1CHNA 4G4JA 1CZKA 4EEKA 3BJZA 5J43A 4PZCA 4X24A 3HSSA 2F00A 3M9XA 3CY6A 2OBLA 1NNSA 1Z8FA 2JVJA 3SR4A 1BH2A 1E6EA 3A05A 4B44A 3AR3A 4IH9A 5G1NA 2EZTA 2W6OA 4R9NA 3JQBC 1SHZA 2O2GA 1VP3A 1NX9A 4YJFA 2AQIA 1HOTA 5ALZA 2XTZA 2XOKD 3H1TA 3K0AA 1DKNA 1E2DA 1Q21A 2ZETA 4L4ZA 1USWA 3SR0A 3DT8A 4URWR 5HBRA 3BRWA 5IBPA 4AECA 5J4YA 1U3VA 2EYUA 2HFKA 4LK3A 5DW0A 1XSEA 1Z5GA 4L5IA 1PUJA 4EHKA 1IBMB 3G6WA 1Y3DE 3SF8A 4ZYLA 3SOZA 4K6HA 5F1KA 5CH3A 5I7OA 2WC1A 4B6JA 2Q3EA 1KETA 5CA0A 2PLRA 2Q9UA 4EA8A 3LQFA 4KEAA 3KALA 5H70A 3RGWS 5BR4A 3FFAA 4G36A 4IILA 4WNAB 1QIGA 4YLGA 1BA3A 5C1IA 1W6UA 1RVV1 2NN3C 2O1EA 2QRNA 3V8RA 3RUPA 2NXCA 3NR2A 2Q4EA 4LE1A 5FH9A 1RE0A 3BCUA 3HWX1 3KQVA 1A5SB 1M76A 1DO0A 3HR7A 3AESA 4POOA 2A2ZA 1N1DA 3UJDA 1IH8A 2EW8A 1UXOA 4B43A 1DMSA 4PG7A 1M1ZA 1GR0A 1KH2A 1Z0KA 3Q41A 4P7BA 3VJLA 1HDIA 4MYUA 3DAOA 4LKOA 3LXUX 1TE2A 4WUTA 1RWPA 4H1WA 1PG0A 5CNMA 3RVRA 1PNOA 5GM2A 5GJVC 1Y5MA 2CNOA 2XADA 4MWBA 2OSVA 4MUKA 1R15A 2JFWA 1H2ZA 4E7OA 2IDMA 5FOXA 3AM4A 4RLFA 1LFDB 2XRFA 1JHZA 1NQOA 1D4AA 1E2MA 4XLZA 4BLQA 4NX2A 4C4XA 5BR8B 3DUFB 2EBUA 2V6FA 4NBNA 1SZDA 2J4DA 3HEAA 3L18A 1LDGA 1ESMA 3SQLA 1C50A 3ETLA 1VLMA 1NULA 1H22A 5AKJA 3B78A 3D4NA 3BHMA 5COBA 2Z4RA 5JPIA 1QRUA 2HSDA 3UHPA 2EBFX 5NULA 4RVSA 3VXKA 3FF1A 1ISJA 4WZ6A 5C8VA 4GR4A 4Q9HA 4N40A 2JLSA 4AN0A 2VT7A 1VLVA 4QLOA 3T7TA 1CR0A 4EHAA 5GIPE 1A9YA 1F06A 2VK2A 2ZSJA 3AHIA 4GSYA 4MVYA 3VC7A 4B3MB 1TTPB 4LXXA 3SDZA 2HPAA 4L5CA 4LJYA 4RJLA 4XQ9A 3ESAA 2B3DA 4E5SA 3KKMA 3G5TA 4HQLA 4A0RA 4C30A 5KTTA 1U1GA 2E89A 4CKBB 1KAHA 4EJFA 2PUBA 3BMOA 1CQWA 2X9GA 1EQAA 3HXOA 5BVHB 3CN9A 5J63A 2H4JA 3L77A 1MRZA 2INGX 4G84A 4QVGA 1W0JD 4CQLA 2HK6A 1H1LB 1WMDA 4X94A 3KPUA 4XQ0A 2RHRA 1NE7A 1CSEE 2DMRA 2FR1A 4HGZA 4HTFB 4R8VA 4UBNA 4RABA 2ZRKA 1YIDA 3HUEA 3MAJA 1N2HA 2XSZA 4R3WA 3SJBA 2E1PA 3KQWA 4MRPA 3TLXA 1CUVA 4QOFA 4QM7A 1V0JA 1Z33A 2O48X 1NR7A 1X8KA 3MRTA 1JLLA 5K45A 5E1BA 5J5VA 2FSHA 4V0MA 3A4MA 3VJMA 3H2HA 4BO5A 1OAOA 1A82A 5I3ZA 3GD7A 1XZJA 1JW9B 2BMFA 5GJCA 5ECYA 2GZSA 2D0PB 4JLMA 1HYEA 3ZKWA 4F2HA 4D9JA 3QFHA 3O2JA 2CHGA 1CS4C 4R8SA 3V4ZA 1JIIA 2IHJA 3H5AA 3PGVA 3QBEA 4YUAA 1NSYA 1Z6PA 4NICA 5GOZA 3KHKA 2CLMB 3C5CA 4KUEA 1EAMA 5F7ZA 3N2GB 3SC3A 5DNEA 3W6UA 1H69A 3B82A 3JW8A 4A4DA 2CVOA 3I5YA 3PEYA 4JEMA 3DOOA 2LP4Y 4MS1B 3W2HA 4XQEA 3IP7A 5AI8A 4CKWA 4BJ1A 1KI7A 3L7MA 4FGZA 4I3GA 4JU9A 1KXZA 3OIDA 3CF4G 3PQ7A 2Q6LA 4QT4A 2MU1A 1RQXA 3ZVMA 1M9NA 3H4MA 2P3OA 5C8YF 1U7OA 5C35A 2ZWAA 3AEXA 2PGIA 1OKKD 3NHSA 4B3JA 4GVPA 1HEUA 3CVWA 1U3CA 3E4DA 3DE6X 3KZVA 3TLEA 1KZYC 4RYDA 3ZHVA 1YDMA 4TSFD 2W90A 4GAEA 1E2BA 1YS6A 3BA1A 2XE7A 3EHEA 2UAGA 3SGLA 4BV9A 1IQ0A 3HXPA 4QGGA 3IAFA 4BNKA 5IMSA 4DFDA 1SCQA 1A27A 3E2MA 2X76A 3IJEB 3W77A 5EQTA 1QBGA 1SB9A 2RGYA 3RYFB 4LZZA 4F3NA 1JBKA 3K16A 1WS6A 2W2XA 5AW3A 2JASA 3U81A 2FPPA 2Y1WA 4GWKA 3TVTA 5AVUA 2QDXA 4HAUA 2FPIA 3CG0A 4I4IA 5ER9A 4JFAA 4X1KA 1T9GS 2D0OB 4PZLA 1MRNA 3CRMA 4NLLA 5DTMA 1VP9A 3JATA 2IHBA 4H7HA 3HLYA 3T41A 1QGYA 4RMGA 3ZY4A 2ZBGA 1B4DA 2X0JA 3N28A 2ZI9A 1ZM7A 2GAFA 4KWIA 7AT1A 2LCFA 1G7RA 3FUCA 1O9GA 4NFLA 3H6KA 4TWAA 4F5DA 5AW6A 5JJIA 1QQBA 1JGTA 3FB1A 3HR4A 1BG6A 4GLBA 4IX1A 3TH5A 4B3IA 2JLCA 2Q4DA 3GEPA 5CNKA 2W0MA 4AZ3A 1J0AA 1X1TA 1C8LA 4RM2A 1KSFX 1BKSB 2FG7C 2FPOA 3LKBA 4JDPA 1G1AA 1F8UA 1IDN1 2H52A 5I47A 2WFAA 1E9FA 2PGOA 3E0QA 3VNBA 1RJWA 4KAAA 4Q3EA 2OLEA 4AKTA 1J0DA 1SXJD 3JQFA 5EPUA 1U2PA 3F6EX 4ZI2A 1XJQA 2A92A 1Q95A 4Q9NA 1DBQA 3W1VA 4D9BA 3A70A 5EE9A 3RU3A 10MHA 1PVVA 1XNHA 3GDHA 1W88B 4LYAA 1XZAA 6PFKA 5K8IA 1NXXA 1PR9A 4HGRA 1VI5A 4G25A 3N70A 1J70A 4TLMB 4HN4B 4ZZ3A 1SVSA 1ECJA 1T1SA 1OJLA 3QLTA 2I1VB 1WHTA 1PDVA 1T13A 4HGNA 4E4RA 5HJEA 4L2IB 3U9TA 1U2DA 1EP2B 2ZRBA 3NPAA 5ES3A 1NRIA 1LS1A 3IYLW 3K3PA 3L6OO 3Q0TA 4HXEB 3TJRA 1W4RA 3OCYA 4ZO7A 3VTAA 1MJHA 2RH4A 2Y0CA 1OX6A 2P9EA 2XXJA 4GC9A 5JI3E 1JAXA 1ULZA 1V6SA 2ZR8A 3F6SA 3JD2A 4G63A 3MHPA 4NNPA 2B1GA 4OFWA 5E7IA 3WLTA 1T3GA 2FPMA 5FBVB 1E1RD 1DJPA 1SZPA 5CFQA 2FHPA 1AUPA 1ZLXA 2G7ZA 2OMEA 4NATA 1CR6A 1TMOA 3JAWA 4XB6B 2ZWVA 3UJ6A 1U4OA 4PLWA 2O7VA 1SXHA 2YQ5A 1X7YA 2PXHA 4IYRA 2OPBA 4PZ0A 4I19A 4Q9LA 4BVHA 1FMFA 4N5LA 1KAOA 1FTWA 3L0SA 2JIDA 1HLPA 1U1DA 2AFIB 3IIMA 3S2ZA 5D1HA 1EDOA 4J8PA 1NLFA 1XTTA 1UM8A 2Z58A 4PAQA 4PZYA 1NY6A 3PK0A 5KJ1A 2AZXA 1GL6A 2JRLA 3RT7A 3A25A 3AQ4A 2I33A 3WBBA 4B3FX 2K2WA 2PT7A 2R87A 3T4XA 3Q6IA 4BJ6A 1WIWA 1QMGA 2VRNA 3RROA 1O95C 1YOVB 4KIWA 5CDGA 2G4VA 2A0XA 5E2IA 5LQKA 1RBYA 3CRRA 1SRQA 2TMKA 5E1OA 2XI4A 8AT1A 5JRJA 3T5AA 2GAOA 1Z15A 4IIEA 4FSXA 4B40A 1PLJA 2O57A 2ZBFA 4I5EA 1FBTA 2NSLA 1ZIXA 3AB7A 2H4WA 3KPJA 4TWRA 5D5PA 5EXEA 2BMWA 2A1UB 4DCUA 5FNZA 3K6RA 2CUNA 1C3OB 2D62A 2WJYA 1MGPA 3ZV5A 1HT0A 3L1HA 4AZ0B 1JXMA 3HB4X 2A3RA 1W25A 2VKTA 5FUXA 5J3JA 2GPBA 3W5UA 1APBA 4BQPA 2RHBA 3R74A 2PUGA 4KHPB 1TKAA 1T9HA 4JQCA 4BKPA 3U4QA 1R8JA 4GKBA 1MG5A 1A88A 2RKBA 4MJXA 4OXRA 2QIPA 1UZUA 3DDCA 4DLBA 3QP9A 4DXDA 4G2NA 1PDWA 2WB2A 3L7JA 2PLNA 2FPRA 2ZLBA 3D0KA 1T4CB 1CY6A 2HF7A 3C5EA 4G4SO 1RWNA 4M0MA 4LZPA 4OHCA 4CF5A 1UJ6A 3MTQA 3NIWA 1Z3CA 5DGXA 1TQ8A 5DN9A 1EE1A 1I3MA 5U4XA 4BNDB 2JHCA 3TGPA 1AK9A 2GWHA 2ZRJA 4Q1VA 3VU9A 4X60A 2F62A 2OZPA 3OI7A 3TPFA 2YH2A 4IMJB 4PLFA 4MDFA 1CDDA 3OFKA 4ENQA 4PHCA 5JSFA 3W06A 4HDRB 3VTKA 4TTJA 4CMCA 1L5LA 5JIBA 1PFQA 5KYUA 4JGGA 3WOHA 5B37A 2XUJA 3E3AA 4JUDX 2WHRA 1FPQA 4L7QA 2A35A 1DP4A 1MP0A 5EA2A 4PYMA 5IASA 4QXOA 1NUTA 2QG6A 2YHUA 2NYUA 1RAGA 2Z2KA 4Z9BA 5C7YA 1NUSA 2G72A 3EFEA 1P77A 2FEAA 4I9GA 3LECA 3AVOA 1QGZA 3V4VB 1LK0A 1VECA 3WGYA 2CJWB 5DHPA 2QTNA 1XT6A 2OG1A 4UHFA 1V6AA 1S3SA 4WK4B 1OB5A 4G8BA 2BM0A 3NGXA 3P9YA 3EWAA 3QLVC 1UR5A 4UQLA 2V9PA 2P68A 4MUEA 4O1HA 2G1PA 5DE3A 2ZJYA 4OYYA 3GA7A 2WQZA 1HYBA 1WY7A 3C6MA 1OD6A 1ILWA 3PB3A 3W8FA 1CRZA 4PG5A 4ZO4A 1N5OX 3ET4A 5JEEA 1CYEA 3P4XA 4QXRA 3BRQA 3E84A 3LRPA 3LYUA 2D2IA 1O97C 2W7TA 1QCCA 4HDSB 2BEKA 5J2TF 3TGLA 2OHGA 4LF7B 1YNSA 3NJ8A 1WA5A 2YVUA 5EHGA 1F20A 1QAOA 2EQBA 4OHBA 3RYIB 3QVWA 1L8LA 1KJQA 1XAHA 1XU4A 5L51A 1W75A 3LM8A 4U5QA 4LMPA 3AP1A 1SIOA 1FRNA 3HCRA 5BN1A 4X64B 1NF9A 1AKUA 1L7EA 3IR6A 4L72A 3CX7A 4MLZA 1M0SA 3WFIA 1JWLA 2PV7A 221PA 1HORA 4IGEA 3TNDA 4DQDA 3O7WA 5C1PA 1ZQ9A 2JIZD 2V74B 4MRMA 2G77B 5FOQA 2OB1A 5A7HA 3RTCA 5DYTA 2NGRA 2B5VA 1QS0B 2X8AA 4RK1A 1S8OA 4K9NA 2RG1A 3ITNA 4XGIA 2GN4A 2O8DB 4LRSB 1E18A 2VATA 2Q2QA 3R0VA 4OQXA 4HWOA 4NZNA 2CSUA 1U0TA 1GHTA 1NF3A 3MINA 1GIAA 2A9QA 2JCGA 2ZJBA 3DXFA 4FBMA 4GMFA 1X3SA 5JMTA 2PGLA 3LY7A 4QDXA 1K5HA 2P2CA 3D7KA 1M2EA 3ZN2A 5DK6A 5BRNA 2EX1A 4TS1A 3C8DA 4JT2A 3W5VA 2XA9A 1M1YA 4GOOD 1QQTA 5EWJA 2C2KA 2AD1A 1Z3IX 3FCSB 1I2BA 4OAPA 2ZB2A 4DANA 3U5ZB 1GTMA 3IOEA 4LCBA 2FSUA 1Y3AA 1JS1X 4L07A 4ND8A 4ETNA 1U5BB 1E2JA 2AK2A 3IV9A 4HY3A 4C0SA 2ZYAA 2VXYA 3BH7A 5B4VA 3H8VA 2PWBA 1WQ3A 2WWTA 2AZTA 3I3SR 4LWPA 1KGSA 3V4OA 3RVLA 2W8BA 4AYWA 5EEGA 1PNVA 4JJGA 3B5IA 4L1KA 2L19A 4RIFA 4BLRA 3GFGA 1BEUB 3DKVA 3EXIA 5I7AA 2IS6A 3WLFA 3UWMA 3K0EA 1W85B 4DBVO 4B48A 2BKVA 4D57A 3RIYA 3HJHA 2WAOA 4CETA 2Q5FA 4ER5A 5CFZA 3L5OA 4B73A 3PFFA 4U9HS 3GLTA 4DZRA 4KK3A 2IOFK 4TMXA 2Z9BA 5FOWA 3F4BA 3TCXB 3MSCA 3TZKA 2WT9A 3C97A 3DWFA 1D6JA 4TZKA 5F76A 4L4SA 3WV4A 3HA5A 4B6OA 4RPJA 1ZD4A 2GBLC 1CY4A 3WLIA 2A5YB 4YR7A 4BLPA 3G17A 2H2IA 1JR4A 4TN5A 3FLBA 4BGUA 5JW6A 3JQAB 4QX6A 5FLKA 3I12A 3RUIA 1JJVA 4TV8B 3U48A 5HK9A 2HNKA 3JSAA 5AKHA 3ZJ5A 3OTQA 1DADA 3I1IA 4M9QA 2NLOA 4FYHA 1VLZA 4PSAA 4B4KA 2AN9A 3LFHA 1GGJA 1TJ3A 2F8SA 5CP8A 2KX7A 1SBCA 3I04M 1YK0A 4IV5A 1I8TA 1QFMA 2PBFA 4GMXA 4NJOA 4FLFA 3W05A 6AT1A 5BSWA 3EB9A 4G41A 2CFOA 1OI2A 1Q6ZA 1T1IA 2CK3D 3IGFA 2FSPA 4DT1B 5BN5A 5M2QA 3MHTA 4C3UA 2DR2A 1XZIA 4Q1BA 2VYNA 5CAEA 4CM4A 1N2EA 3UGKA 3EGDB 3KVOA 3TVYA 4ENSA 3KWLA 3VZCA 4ARIA 1NUHA 2Y1KA 4UCXA 4US2R 2FLVA 2YWBA 2XNSA 1VDZA 2NUPB 2ZJ8A 1E89A 2XUZA 2ZJOA 1D4FA 4PFQA 3ZPXA 4DBZA 2DECA 1XX6A 3LWZA 3BKWA 3BTVA 1V3VA 1S3GA 4C03A 4OREX 2B4AA 4W8OA 3EGWA 4DIFA 2XX3A 2IOQA 1YKGA 4HNUA 4WK2B 2AN4A 4RJ2A 3IMKA 5JXHA 1TADA 3ZJVA 3UT0A 5BMVB 4LA4A 3A7DA 4UE2A 3HLTA 5LIPA 4QQKA 1YR2A 4IOJA 2DLNA 4KMMA 1GSOA 4P6VF 4ZJUA 3FCXA 4IFTA 4M99A 4W7HA 4RS4A 1BNCA 4QBFA 3T61A 1SXJB 5LXTA 4LJ5A 4B3SB 3I6QA 3NHPA 2O2HA 3NBQA 4PPGA 2YWFA 5BPHA 2I22A 1LRLA 4JJ4A 3LNCA 1QFSA 2H1HA 3NIDB 4E2XA 2SNIE 2KLHA 3BN3A 4A26A 2BFEB 2BY4A 3ESYA 2JFUA 2O7SA 1RM4A 3I9FA 3R75A 3SC2B 2WIAA 2XNDD 4LYGA 3UJCA 2CLIB 4YP1A 3ICVA 2ZYRA 3DEJA 1XTUA 1ENPA 4Q01A 4UAVA 3HKBA 4BE9A 1BCSB 2FPKA 4QXMA 1B93A 4FZ5A 3QUSA 4AY6A 2E49A 4JYAB 5G1OA 4BZPA 2FR0A 1XELA 3EVTA 4LCJA 3VO9A 4RW0A 1OT3A 1H2YA 2HHJA 1KKLA 4JJAA 3LE8A 2HLNA 4YV1A 4PINA 5I4KA 5JI2E 1SIBE 4WZBB 1V4NA 2SHKA 3LWDA 3M9WA 3ROEA 4G8DA 4PCLA 2XA1A 4FNMA 4Y9DA 3JQ8B 1VG9B 4L9SA 4E21A 2RGCA 3PHIA 3PWSA 4BUCA 4D02A 1C9KA 3LK7A 1QF7A 1H2WA 2A0UA 1FP4A 2PPLA 3R3YA 2IYXA 2AUNA 1RHMA 2I6FA 2BDEA 1NG1A 3RVQA 1STOA 1X1QA 3GAFA 4R84A 5HSGA 1AE1A 2AYZA 3RC7A 1B6TA 3DYIA 1H2RS 2RJ3A 3HEMA 4LOIA 5CPFA 5IM4A 4G0WA 3LKVA 3FOWA 4TQ9A 5FULA 1U28A 3JQ9C 2YOHA 2P6OA 1S4QA 2IZ0A 3BWDD 3PC8C 1WMEA 4HDQB 4BTLA 3K15A 3VR6H 3ZCQA 3F6CA 4WECA 1MAHA 2YXPX 3KLPX 4HZUB 3AEYA 2JLVA 2QTCA 5C7IO 2YRXA 3QYFA 4LXUA 2HA0A 1MNAA 5ECDA 4CT5A 3FB4A 4C2TA 3O84A 1OOEA 1VIMA 3JASA 5FFFA 2GCNA 4I1SA 1L5HA 4DWJA 2DRIA 3EA4A 1XPRA 1X8LA 3GLGB 2FP3A 1I7NA 3AVWA 4IO1A 1PFVA 3CU5A 2W2KA 3JQGA 1C9NA 2V3WA 4CNBA 1YBAA 3SEZA 2HN9A 1EM8B 2EWVA 3A11A 1MH9A 1IN6A 3IQEA 4DJDC 5B64A 1JBEA 1SY7A 1ACMA 2O2CA 1NDQA 3NTOA 1SC1A 3ZHUA 4E0BA 4D8YA 4G0UA 1KH1A 4TZ0A 3QEKA 1UFVA 1Z5NA 3E8XA 1Z88A 2XYPA 3EEYA 2KPOA 3KR9A 3PG5A 3IS3A 2GPJA 3R3WA 4YDHB 1BKDR 3DEAA 3HP1A 1BEEA 3LMKA 1L8XA 2DX7A 4N12A 4MULA 3GJXC 4RZHA 3JD0A 4HDKA 3QEBZ 5H3LA 2BBSA 2FMXA 3NP7A 3BPSA 4RZSA 1FNMA 1PWYE 3LO8A 3U7EB 3U7QB 2F3TA 3ECCA 4J7CA 4Q7JB 1U7TA 3VU8A 5CYGA 4DJFC 4V2UA 4XGRA 1E58A 1VHDA 1K3UB 1P3DA 2ZIXB 1V1RB 4FLEA 4HKTA 5DVZA 1GFWA 4FEYA 3NBXX 5MGNA 1R0KA 2VJOA 4EHBA 3ACBA 2WWHA 1DAOA 2ZUWA 1VL6A 1U9JA 4S05A 2VZLA 3AJRA 3C3CA 2XYQA 3O5AA 1X77A 1GO2A 2YRFA 2AEJA 4PNEA 1HRDA 2P0AA 2PE5A 1QK4A 3MMSA 1J6UA 1RXIA 2WMDA 2H5EA 2YBEA 3E2PA 3E3OA 2YW2A 2D54A 3D8HA 4JBNA 1X1SA 5AVRA 1A77A 4L76A 4M1TA 5K6AA 3ND7A 2J33A 2GVDC 4I55B 1PX0A 4MO2A 4UATA 2HK9A 3ABSB 4R68A 1FIUA 3O8LA 3V32A 3TWOA 3N0RA 4N47A 1B8NA 3AXTA 3L0PA 2VDUE 3R9XB 4XYLA 4Z4EA 1S2LA 1T9AA 3ZK8A 3R3HA 1YFJA 2SKCA 3VC3A 4H9GA 5LQMA 2UVPA 3EXHB 1GITA 4LBWA 1CYDA 4B4WA 5EAIA 5LP6A 2N75A 3DLCA 2R0QC 5A05A 2UZAA 3R3VA 4NG5A 1BQ3A 4YRQA 5K0CA 3DMHA 3GQBA 1P75A 3R0ZA 4WTOA 3QUTA 4UVIA 4EAQA 4R5MA 5IABA 1H5UA 1D2MA 2C96A 2XCTB 5EE1A 1RM5A 2AJCA 5C9ZA 4WQMA 5NLLA 4AZTA 1ISGA 2W58A 2AFVA 5B7QA 1A9QA 1FFEA 1B8VA 1RPJA 4JOSA 4LG1A 2HMWA 3GEGA 4K03A 3I9NA 4TWBA 1B42A 4ZT3A 1TEZA 5D5HA 4AG6A 1MAVA 1TF2A 3NPMA 1DX6A 4PF1A 2QV0A 4JSRA 4QPNA 3VR5H 2R1TB 1C4KA 2OLJA 1N3IA 4D26A 3GLIE 2V7XA 4GP6A 1DL5A 1TU0A 5BNTA 3N5KA 5IK2A 2DWCA 1JDZA 3BWEA 3PDWA 1A9ZA 1W9HA 3GGDA 4DSZA 3UQZA 1QH1B 1RCFA 1WXHA 4QOGA 1HGXA 2JKZA 1XKQA 1LQUA 1QO0A 2J7PD 4YH1A 1U8TA 2GHQA 4ES6A 1YTUA 3GN2A 5CX4A 5LM3A 4JEHA 4KQ9A 4F86A 2OA0A 1QG2A 2HEIA 1SPBS 1MX3A 1DC6A 2OD2A 2ZRAA 3QRWA 4NXNB 1G8HA 4K2HA 4WNAA 4PZAA 3T5MA 1ZO8A 4CU2A 2J67A 2YJ6A 3K70D 1V9LA 4BC0A 5I7UA 3PPIA 1ULHA 3AR8A 2X6TA 2Y67A 5CHYA 3D4LA 3LCRA 3OOEA 3GAAA 2X7JA 3LUKA 2CXTA 3WNCA 4F7DA 2ZM5A 3WLKX 1FSPA 4P31A 5CA1A 2XMGA 2VHXA 3JQQA 4IGAA 1B76A 1W2WB 4L8GA 4AMZA 5KHOC 1JLRA 1NE2A 1SK9A 1ZI8A 3GU3A 1Z73A 2QUJA 1KY5A 4PPFA 1DVRA 3HN7A 5HFAA 1ESDA 4YCBA 3K53A 1R2QA 1E9BA 4JHXA 4JKIA 4F2DA 2Q2NA 4BNIA 5EIEA 3Q3CA 1KS9A 3TQHA 1N8KA 5KOJB 1OZHA 2I62A 3AF2A 1T26A 3CLUD 3E1KA 1WTCA 2JCBA 4W9NC 1KJNA 3HSKA 2V0NA 3THOA 2YV2A 2QL7A 4E5KA 3WY9A 1ODTC 4CZ2A 1A5AB 4DIMA 3VH1A 3TTVA 4JJ6A 3DUFA 4ZVTA 1J7JA 1ZN9A 3PEFA 5AKXA 1AQLA 3QHQA 4R1PA 2VJQA 5DO9A 2WJ3A 3M5DA 4NU6A 2WYUA 1BHO1 2H5IA 2YN4A 1CY8A 4KWEA 3WIVA 1RHUA 2DHRA 2ACEA 3UJ7A 2JFYA 9ABPA 3HDVA 4TRJA 1U8AA 2N42A 2BHTA 2PKCA 5AIBA 1NN3A 3ABQB 1MEJA 3N58A 1NI3A 3LIIA 2V7TA 4EB6B 1XVUA 3P2JA 2RGUA 1XCPA 4PTYA 1F2VA 2GPAA 5DX8A 1ZKDA 2WSSA 4CNQA 2ZE5A 3Q5DA 3ZV4A 4Z4CA 3LCMA 3FY4A 3LRXA 1E4EB 3EX7C 2E6KA 4YRGA 4ZVLA 5IANA 2QX6A 3CV3A 3GUVA 4H35A 3WWPA 3DE2X 2OV2A 1FYEA 4CKBA 3QHPA 2QTTA 1KYQA 3ANMA 3I2JA 3O1IC 5EFZA 5EHIA 1E3TA 5BVHA 1NONA 4MGZR 3C8UA 1U7HA 1Q20A 4JUAA 1GFSA 1H1LA 1YRHA 3ONVA 1J0XO 2OVFA 4B8ZA 2ID9A 2B1RA 4L3WA 1L1RA 5FTWA 3ZWDA 4HTFA 1UQRA 3BQMB 4JJEA 1DU4A 3A1TA 2YC2C 3THWB 4FUQA 2QQ5A 4D41A 5EJ8A 1PR0A 2FVXA 3OZAA 4D5EA 5I8WA 4A6EA 5K0EA 3SXJA 3M7IA 1PD1A 2IPLA 2D6FA 3ZDFA 1IONA 4PZPA 3ZDZB 3WBFA 2GYVA 2VUSA 2CNDA 2HD4A 4KE7A 5HZMA 1GA4A 3MXOA 2CYBA 3PE3A 5FF9A 2JS7A 4FHEA 4MDEA 2AJBA 4QJ3A 5KNDH 1GCGA 4IJUA 5F78A 1F7VA 2PGXA 4DVGA 1AU9A 2DHCA 3OX2A 4Q39A 2AKAB 2H7CA 4MWEA 2X9QA 3U40A 4CT4B 3WK7A 2WYOA 1YKFA 3AHHA 1EGAA 2ODAA 1XZ8A 4IGKA 3HU2A 4Q82A 1V43A 5IBQA 3SZMA 5KQLA 4Z4GA 5CLQA 2W00A 2OXFA 4J0JA 2XJ9A 2NO6A 2PZ8A 1RYHA 3GVXA 3N2GA 2GWRA 2IIVA 4FCCA 4FT4A 5FI5A 3W8DA 5KOHB 3EDMA 2VPIA 7MDHA 1W36B 2BGRA 3SQOA 1NMXA 4MS1A 4BZZA 4AF6A 3E23A 5EERA 1U5CA 1P80A 3OQNA 3T4EA 1HT3A 5IKMA 1X8JA 1D2AA 3H2KA 3KYBA 1CULC 5LOVB 1BVRA 1M5UA 2IZ5A 5HRAA 4BQEA 4RTNA 3UWKA 2NIPA 2WJ4A 5IP5A 4A8PA 2R47A 8MHTA 2Q8PA 2Q5CA 3T12A 2C42A 4FGWA 2CVPA 1AUQA 3ZHTA 4DMFA 1QK5A 5JLJA 4P9NA 4JFRA 3RHZA 2IVZA 1NLZA 4F2WA 2JANA 1E2EA 3GUZA 5DM0A 3SEFA 3FCAA 1GGMA 2VFAA 2QK4A 3ENQA 4YJ2B 4YX9A 3E2IA 3S27A 3SLKA 3EHDA 4ZQCB 3MNFA 1AZSC 3O21A 4FNOA 4EYSA 4PAWA 1HE8B 3RYFA 3A4IA 1IM8A 1NBME 1X7ZB 2DQZA 1EAYA 3PNOA 2BEVB 1F8XA 4LOHA 2D2FA 3MWYW 4XPZA 5LUAA 2Q2VA 2R8PA 4PS1A 4I1IA 1CEQA 1K7CA 4GKVA 4FOPA 1H65A 4XX1A 5GPBA 5LLTA 5DHQA 3H2IA 2CUTA 2FQYA 3D0RA 2Q5JA 4QU5A 4EY4A 3D4OA 2RONA 5MN6A 1JPVA 1HMYA 1L5SA 3FGPA 4ZJZA 4AWBA 3PWZA 3CC8A 5A5EA 5KHLB 4A2PA 4C4ZA 1LBIA 2CD9A 4YASA 1Z0ZA 2G0TA 3EH2A 1U9IA 3CLSC 3E9NA 4NNJA 3PQCA 3L9XA 4DQUA 1V8DA 1ODFA 3MJSA 2Q8QA 2YVLA 1LVGA 3JZFA 4F71A 1IOVA 2JHPA 1U1CA 2YMPA 2IVFA 3PKIA 4OQQA 3RLIA 1Q0UA 4DNXA 3KK0A 3A3NA 2JRCA 3OPQA 4CFSA 2HLPA 1EVEA 2VP4A 3FJYA 1CR4A 1MQAA 1P9OA 3AFMA 4MCAA 4QWMA 4US0R 5KJEA 2MCFA 3T5CA 1AUOA 2R85A 3QNUA 4JB2A 4X6XA 1EIZA 3TD2A 1RWBA 1MF7A 3WLMA 3ZE2B 4ARAA 3AONB 3PR2B 1W88A 4AY2A 4YJ3F 4KFUA 3CM0A 3KOXA 4BRZA 2QW8A 4DOMA 2AG8A 3P4YA 2KJQA 3SVLA 3MFYA 3B3QA 2HQSA 4LPKA 3CNNA 3Q88A 2QXYA 4LGMA 3V8PA 3HYSA 4UAGA 4D4LA 5HXAA 4CGYA 1M7HA 4H7IA 4GZ3A 4MLDA 4L2IA 5SV2A 3KYIB 1Y6JA 2Q9BA 2CLHB 3O38A 5DI9A 3H05A 3VH3A 2ZQZA 3Q40A 3Q9NA 4DUPA 2DPHA 4Q9AA 3VR3A 5FR1A 5KJFA 5LYJF 3P32A 4HZIA 3OOSA 4QASA 1K75A 2XBMA 1Y4AE 4TMZA 1E2FA 5T41A 1LLCA 5BUZA 4RTQA 1C2YA 2BFWA 2R44A 1OXUA 1WKVA 1Y6FA 5DMXA 3L40A 4MGHA 4DV3B 3VVCA 3O8CA 4LAFA 1AMUA 4MKFA 4JI7B 4DBLC 1D1QA 4G85A 2OCYC 2PX5A 3NNNA 1CY1A 1DOHA 5FHQA 2VDJA 1CEXA 4KIGA 3RASA 4YMUA 2RHWA 3W4IA 3WGTA 4U39A 5C80A 5IUNC 2GCIA 4AKGA 3FZNA 1T25A 3GLHE 4BVJA 4RKYA 5H0IA 1HT2E 2AFIA 1NQVA 2P6PA 4RHTA 3TMYA 1XZCA 3FPFA 3T1OA 5JYBA 4WXYB 4LJ4A 1EXMA 1YZQA 2QYTA 4D3SA 1NDUA 2PT9A 1L4FA 1Y5RA 2P3QA 3I92A 2O3TA 3BWMA 3IQFA 4M6WB 5KX5B 3T3PB 2RAPA 1TPZA 1YOVA 3N8KA 3NJRA 1O6BA 5I45A 3MB5A 4R6XA 2BDUA 5LMUB 1Z6ZA 2QTZA 2H17A 3A1SA 2IPAB 3UK6A 1GCAA 2VZ0A 2W6IA 1KC1A 4YQZA 1M6EX 4KE9A 1BW9B 3V8NA 2VLIA 2HMAA 5B57C 2XIQA 2ANBA 3OZDA 2IV7A 4R3UC 3BB1A 3IUBA 4NPAA 2A1UA 5H9VA 3A2KA 1H4SA 5JSQA 3K30A 1C3OA 2H1LA 4QPPA 4TUYB 1Z26A 5C5DA 1ZBDA 2P4UA 1MZVA 2HU5A 1L7QA 3GFSA 4JBHA 3JXEA 4KE6A 4AZ0A 2C4WA 2D5AA 5JS1A 4QUKA 2DUMA 1YVPA 4LPSA 2FZVA 4XRRA 4J90A 1EM6A 4HHEA 3E82A 2X2FA 4OK3A 4YRTA 5REQB 5JS7A 3T5PA 1T9BA 3OJ0A 4A0QA 1FNSA 2PXAA 1QBKC 3BSYA 4K40A 3FPSA 4PZDA 5EP1A 4MI3A 3COWA 4CFYA 3D6UA 4DLWA 5AQEA 3O8BA 3WGUA 4KQEA 1T4CA 1LF0A 2EW2A 3I42A 3WZLA 5I51A 1SC4A 1C7RA 3DVQX 2RG7A 4UFOA 5CM8B 3VSAA 1V6CA 1WNTA 2J9YB 3W7AA 3AKZA 2RMKA 4ME6A 3FCEA 3UJ3X 1Y1LA 1YZTA 4A2CA 2Q5HA 2GFIA 2C31A 4FMBB 1W2HA 4BGIA 2XVYA 5JD6A 1LSUA 1RXEA 2Y8EA 1MOSA 1TAUA 5CLJA 3QENA 4GR5A 2PUCA 3K70B 1E64A 1AN0A 1C7FA 3AZPA 4HDRA 4ON9A 4M1YA 3QG5A 2ECQA 121PA 4EX6A 4PWYA 3UEOA 1CTQA 2CT8A 3NALA 4JOCA 5FBQB 1EWKA 1RYBA 2OHJA 2HDWA 2R5FA 2ZIUB 4O25A 1E7QA 4OJTA 4RSGA 3KQLA 2PAFA 2VCHA 5F1OA 1V16B 1NTRA 3OE4A 3USZA 1YI0A 3QKUA 4KXYA 3ZK7A 721PA 3EASA 4RQAA 1ICIA 1T0HB 2P7IA 4R05A 1R16A 4PQEA 4QUHA 1QIDA 1WUHS 3BD6A 4NOJA 3KD3A 3EIOA 4IV0A 2ZCUA 4ZT2A 4B3CA 5EMMA 4A2QA 1C3XA 3HFJA 5HS6A 4MMZB 2E87A 4MRRA 4YB8A 3X1XA 1KYYA 1NMYA 4CJXA 4MIOA 3G6KA 4IQ4A 1CB0A 1QPGA 1M67A 4L22A 1P73A 4MS3B 2Z30A 3ABOB 3DQZA 1IATA 1HLFA 2I6GA 4DXHA 4N0QA 5DBGA 1JPNA 1K97A 2HADA 2PTHA 4Y2YA 3ILXA 4HDSA 5TQVA 3GWZA 4OK5A 4CMHA 1LRKA 1A3CA 2XMZA 4LTNA 1KC3A 3DG9A 5T3YA 2R7AA 2CKMA 2M6SA 1GZSA 3L46A 5FXMA 3QX7A 2YV5A 4LMRA 1T8WA 2PR2A 2VDVE 1YZLA 1I30A 3K4PA 3K9HA 3QBTA 4BECA 3QBVA 4BBZA 5LJLA 1SFRA 1QHGA 4GECA 2GBPA 3AHJA 3TFWA 3M4YA 4KNYA 1TT7A 1ZEJA 3R0XA 3T3MB 1QVWA 4CL2A 2Z57A 2ZRHA 2G1AA 4CEJB 3DQPA 3C14C 3QKIA 3OBIA 5AXDA 4U63A 2HBYA 4H0CA 1FYWA 1QS0A 4HYEA 3ZY3A 1IN1A 3X2SA 4UC0A 5K8CA 1FLAA 1C9YA 4AJKA 3GK3A 2FW6A 4ZYYA 1YQ9A 4FX5A 5B53A 1W19A 1U6JA 1GPDG 3IUJA 5P21A 4EYEA 2O8DA 3IA2A 1P33A 3QQ5A 3M3PA 5JCPA 1EFCA 3G0DA 3PF9A 3BCHA 4CI9A 1JKXA 4G65A 2FA9A 3H18A 4X41A 2VHQA 1W0JA 4MVJE 3TLYA 1NUQA 3O73A 4RVNA 4BNTA 2PZBA 3H1EA 1FLDA 3LUFA 2PKYX 4KQGA 3KL4A 4NAVA 1WBDA 3TZBA 2JLAA 3PDUA 4DCSA 3OZSA 4DQLA 4EY3A 3ZGOA 5TXGA 5BSGA 4AJLA 3WAGA 2IS2A 4DIBA 4ND6A 2BI4A 3CUYA 2PIDA 2FKNA 4FINA 4CF6A 3CCFA 2JJ2A 1IZYA 4X90A 5ILGA 1U5BA 2F8TA 1A95A 4NS1A 3ROZA 3P2YA 5E0OA 3NC4A 1MJFA 1M7BA 4AYXA 1DAPA 1JR2A 4GSLA 5EZYB 1E5DA 4P82A 3V8MA 2EJCA 5JYCA 3IALA 1SHKA 3B8EA 5LD2B 2FXIA 2OXEA 2BAGA 1NBMD 1W85A 2I2BA 4O2AB 1JKJB 1RI2A 1AGRA 1DAIA 2XVAA 1QZTA 4AZWA 1ADJA 1DCKA 4M1OA 1NP3A 3KRTA 1DBRA 2ZJ4A 4RHCA 1L4HA 2RH5A 3DF9A 4ZV7A 1JHVA 3B6IA 4RLQA 4K6OA 3NHZA 1M66A 2V6JA 3V46A 2ODNA 3HDHA 4CMAA 3P1JA 3IPYA 2DT8A 1L1FA 1RWWA 1QDLB 2I3BA 3DL0A 4IJVA 4C4RA 1M2WA 5A4FS 4HEQA 3RF7A 4FBLA 1XDDA 1WULS 4NS4A 3JQAA 2XUIA 5HKLA 4GEGA 4TV8A 1U8XX 4MW1A 2WRZA 1G8YA 1P2TA 2NZJA 2XQKA 4HLQB 4Q1CA 1FJGB 1EVYA 5TT1A 1Q0HA 1U0BB 4BAZA 3VR4A 5F98A 2R4TA 4IIVA 4TSFA 4JC4A 4IAOA 2WEKA 1NXQA 4I1OA 4JVMA 1YDFA 1YA4A 1EDBA 2QN1A 4L02A 3RRZA 1E6LA 4ZZ1A 1CCWA 4DT1A 2PGAA 5CTJA 1JHXA 1QPBA 4TTIA 2XGJA 4QLBA 4PN3A 1FUEA 5KEIA 1N25A 2CHVA 4DIKA 2IOFA 1ZH0A 4DUGD 2VBIA 1O4WA 1YB2A 3EGDA 1OH6A 3R4VA 4URYR 4KSBA 2G1JA 2A9JA 4IHAA 4WLVA 3ZBTA 4URVR 1IB6A 1OR8A 2YMMA 3V4SA 2PT5A 2H4HA 5ALYA 3D5TA 2NUPA 3BH6A 4PRZA 1G9XA 2XF2A 3FAZA 1JQDA 1P5RA 1NV8A 4JLDA 1KDPA 2ZCJA 2C82A 3FRJA 4YUYA 1Z29A 3L8ZA 1THMA 2ONKA 4IM7A 3S99A 4D8UA 2EX4A 2IYTA 4BCDA 5CDSA 2BJVA 2Q29A 3N0TA 1KI6B 3WB1A 4Y1RB 1Q50A 2VSFA 1QKIA 2NVBA 3WRXA 1GTG1 5BMVA 1TJ4A 2CWDA 3PA8A 1I7SB 4FHCA 2QM7A 1DELA 2ZR0A 4X66B 1XPOA 2XNJA 1EJ6A 3CVVA 4X61A 1AQIA 2HRQA 4MQBA 1KDVA 1KXJA 1NY5A 1DUSA 2Q7XA 2ZSDA 3SX4A 4LX8A 4N65A 4MPRA 5JC1A 2AVDA 3LD9A 4N76A 4JZYA 2UUOA 4AQDA 5BSMA 1QAQA 5DV9A 3CH6A 1OBHA 2A30A 3KOWA 1SHLA 3QM1A 3PFCA 4GW3A 2XIJA 3FDIA 4S24A 3TD6A 4NKRA 1KPHA 1DEHA 4K9QA 3BD7A 2BFEA 5AJHA 3SE0A 5KYWB 3SC2A 2AOWA 3OQMA 3CLVA 5IVKA 3ZY6A 2IXEA 4W7IA 4ARUA 1UM9B 1D6SA 3KT8A 3MRVA 4FYJA 4YFYA 4ZKEA 5T8KC 2R3SA 4G9GA 3AKCA 3BICA 1WDTA 3VZSA 1BCSA 1IY2A 1J8VA 3LZDA 1KDOA 4IMIB 4ZQEA 5G1PA 2QW0X 3C8ZA 2BFDB 3UWPA 2I34A 4WE3A 2FPGB 4ZFNA 3AEZA 4LNHA 3JWPA 3KLOA 2RC6A 1GL7A 3FWNA 2FQ1A 4S1TA 1YHNA 1TMKA 1SNYA 1Z36A 2AI1A 4JBGA 1WUIS 4WZBA 3STYA 2HF2A 1KO4A 1Z7BA 1Y8QB 3E48A 2AL7A 1MW8X 3JQ8A 3M6LA 2WJ6A 1YD7A 5JBNA 3R5TA 4J0QA 4BPBA 2XH8A 3CBGA 5F7XA 2ZAIA 1HL3A 3IAS6 3UCXA 4BGEA 3AUFA 4FB4A 2X3FA 1M8FA 2I29A 1QO7A 3F67A 1DC8A 1H3FA 1RQ2A 2FXVA 3COPA 1K66A 4NZZA 5EP2A 1X7WB 9ATCA 2CVQA 3SVTA 4MW6A 2C5BA 3F71A 1P4AA 2ET6A 1IK4A 5T57A 4KBFA 4R0VA 5LBTA 1OHHA 1ZIOA 4ZU1X 4DJAA 1RXCA 1H2HA 2H2GA 2XDYA 4ECEA 2X2PA 5C8YB 2OBYA 2XGGA 2X19A 3JZMA 5ILQA 5L6LB 3U61B 5FBWB 1VE9A 1X9HA 1XZFA 3BL8A 4CW7A 4ZCTA 4KACA 5CT9A 1OE0A 4JITA 3DWGA 4FN4A 4LKRA 3HJGA 3GRUA 1VKJA 4U2DA 2PKXA 4DEXA 1RQRA 5D7NA 5EUMA 1JQJC 1LPBB 1QRTA 3BT7A 1J90A 2EC5A 4R2JA 3S7ZA 4Z2YA 3GLGA 5IYZB 2VPXA 1J24A 4W1SA 2VH5R 3EAFA 1AKEA 7GPBA 5DLPA 1NZFA 2V5AA 5DGCA 1EM8A 4B2PA 1NJ1A 3I2YX 2VF5X 4GZMA 1X70A 1H0HA 2ZTLA 4NU8X 4AROA 3C74A 4BUZA 2CMKA 1TZMA 5GMOA 5T6BA 4M2LA 4JYPA 5CBKA 3BE6A 4GVLA 4J9UE 5A0FA 2C2HA 2J0VA 5JZ9A 1B0AA 4JUBA 2CJXA 3DCJA 5BN4B 5IX8A 4YMGA 3IBCA 5KTYA 1DC3A 2Z5VA 4KAXA 5JALA 3U7QA 1SUBA 1O9BA 2D2VA 4MYDA 3IXLA 4YDQA 4OOEA 4TVSA 1FTQA 4R1UA 4DJJA 1H6AA 2YN0A 4EOGA 4ZT4A 2ZIXA 3FCYA 1BD3A 3OX4A 1V1RA 1W52X 1Q0RA 2Y71A 1R4NB 1SOVA 2PX2A 3GMTA 3GZJA 5YASA 3VKVA 4BN4A 3UICA 1KDTA 2AC7A 1HZZC 1K4YA 2XE6A 4XE5A 3KLMX 5IF9A 1G17A 2BJHA 3MGCA 4IX9A 2WY2D 3RIXA 4F8EA 1A9SA 3CVYA 4RKEA 3R8XA 3C6YA 2PS3A 3EF1A 3LW7A 3RJ5A 5B1EA 3FOZA 5E6UB 4GOND 2A1IA 3F5QA 2QN9A 1CUCA 4O0MA 1SG9A 2P2DA 1Z0SA 2I4NA 3DTNA 1PGNA 2B21A 4KLCA 1RBQA 4ZXFA 4C9BA 4AM8A 2OSBA 3TO5A 1AKWA 3GB9A 4YAKA 4I55A 16PKA 4BKRA 5K03A 5FBKA 1YBHA 2JCVA 1O3YA 1C4WA 5EHXA 4KH0A 4HWSA 1KFKB 4QG7A 3ESCA 3THSA 3R9XA 2CKDA 5B3AA 4DC9A 4AI6A 1UH5A 3U0BA 2OOSA 4ZCPA 2FWNA 1E4VA 1FP6A 1DEXA 1T5HX 1OLSB 3IUQA 5LMZA 3J81A 1KZ7B 4MVJD 2O1XA 1SQGA 3C41J 3EXHA 5DP1A 5C37A 4F9TA 2YV4A 3FWZA 1VLJA 1AT1A 4IKEA 4IRUB 4G4GA 3I8XA 1J49A 2XQJA 2GEFA 1ZSYA 4MJ3A 4EI9A 5BRJA 1L5WA 2AZMA 2RD2A 3K4QA 5BSFA 1DAKA 2YHIB 4KOEC 2MSNA 2B2XA 2FWMX 1MVOA 3P9CA 2P1ZA 3DNPA 3NQ41 3HYLA 2JAPA 3F4KA 1WD7A 1QX3A 5FBRB 3D6FA 5GONB 4RXUA 4JB3A 1E3MA 1XEWY 1JR3D 3HDGA 1VCOA 2PRSA 3C45A 3HL4A 3I6MA 3QIAA 3EZ7A 4YCJA 4A1FA 1SKMA 5JD3A 4KMSA 3BZWA 5AKZA 5JNSA 1Q7CA 2YXEA 4GPBA 5FCDA 5AUQA 3BMQB 3SZ3A 3TZCA 3V00A 2DH6A 2I5PO 3EVBA 3N86A 1GSIA 3ORFA 4K6KA 1JDPA 3UBTA 3KOZA 2R1TA 3B85A 5ALTA 3S0JA 2ZW9A 1U0SY 3TQRA 5JXGA 3L82B 4WFKA 3R5JA 2BZSA 3KXKA 3RVDA 4H4EA 1UK8A 1CLUA 1YRBA 1QH1A 4TTPA 2AVNA 4P3XA 5GZ6A 3AOEA 3OG9A 3DXXA 1ZNZA 5FUYA 3KT6A 1TC1A 1B6RA 2OO5C 1QYRA 4DPKA 4HC4A 3V42A 1NG9A 3F9CA 1RI5A 1UEXC 1SCKA 2JFOA 2WU1A 3IPXA 3JSXA 4GT1A 4OJYA 4R9RA 4RO0A 2OHIA 4PICA 4LJLA 1Q1BA 4J0HA 5EXSA 2YV1A 3PZRA 2LDXA 2VRCA 4CTMA 4JA2A 4R9SA 4BEWA 1DG1G 3IP9A 3WK9A 1AS3A 3G7UA 3B1KA 1G8KA 3GRFA 3GT3A 3EOAI 3L84A 4RMJA 3A3PA 1XN4A 1QO9A 1T2CA 2P69A 1M7GA 3GJSA 1RQNA 3K9FC 2DQSA 5E8RA 3H2BA 4R31A 1NVMB 5L7TA 2AR9A 1HEYA 1U3FA 1XD9A 3DONA 2H2HA 3KAQA 4HNQA 4NG4A 4UDOA 4UUNA 4EVIA 1P0IA 4QUGA 4P08A 2HK7A 1E9AA 1GUAA 1M1NB 1GRVA 1UPUA 2HUNA 1LK7A 4FLMA 4ZPXA 2Z4TA 4AFNA 4JU8A 5KOJA 2PX3A 3GUYA 1E2NA 3HA2A 4KXWA 4Q7LA 2QWXA 5AHXA 3RSOA 1DOAA 5KTRA 1I3NA 4L5AA 4F91B 2WIGA 4RD3A 4TRRA 1SBQA 3PU6A 1G3MA 1OFTA 2ERXA 2ZBPA 3LTNC 3STVA 2FPWA 1ABEA 3JX9A 2B99A 3QUCA 1T1GA 4W8HA 1WZ2A 3G9UA 4UHHA 1RAEA 4PX3A 1ZY2A 3ZE0B 1ZHOA 2A0YA 5FUVA 1SHJA 2WA1A 4M0UA 5FV7A 3G1WA 4MUGA 4D0LB 4FFRA 1UPFA 1H85A 4Y9RA 4HNRA 3OIGA 4EB6A 5LR6A 2FG6C 4Q24A 4QTTB 2LCQA 4XPIB 2PZFA 1IOZA 3OZFA 5F2KA 4GMDA 4DSNA 4G09A 4FNGA 1W59A 3MMPA 2JGIA 4MYTA 5TRTA 1E4EA 3S2GA 2G1KA 3NI2A 2UYQA 2VEDA 3MGGA 3PYXA 4IH1A 4MV6A 4OHUA 4PLPA 3TTWA 1D9XA 2CCKA 2HRBA 4LOJA 2CFCA 5KQGA 1JJAA 4R4JA 4C0WA 2FUKA 3DVRX 2GSWA 1X0VA 1R8QA 1V96A 3ZIUA 4CM5A 1O54A 1NP7A 4E94A 4L75A 4JEIA 4DCNA 4JBWA 3MT8A 2P8JA 2CW5A 2HRZA 2D06A 3AGQA 3NOOA 4YP9A 3ONDA 2RGNA 4F93B 3NHMA 1F5SA 2QI9F 3F3SA 2XPCA 5CK4A 3T35A 5A3VA 1HLDA 4U00A 3D2BA 4LXQA 3THWA 5EQJB 3BB4A 1DJLA 1A8HA 1JEQB 2JFPA 4FE4A 5LKAA 1J2TA 3FLAA 1PKEA 4LTMA 4M21A 3QSYA 1JI0A 4B32A 1FZTA 1P6UA 3PNYA 1TU3A 4MZXA 1F60A 2GJAA 4WPGA 5DWVA 2LE0A 5K0JA 3MUFA 3E0XA 3COJA 3IV7A 2PT6A 3VZRA 3PL1A 4HGPA 4IEFB 2G06A 4ENRA 3V55A 3GLHB 1N2SA 4GI1A 3FR8A 4OHXA 1UPTA 4RCVA 5ESWA 2QZPA 3AH8A 4JWKA 1PTKA 3ODPA 1Y81A 3PCXA 1FU8A 3AJEA 4TTAA 5KOHA 2XODA 1D0SA 2PIAA 2VDNB 2WBLC 2DSTA 1SIWA 4D9NA 2AMJA 1K6IA 2NXWA 2IE8A 3CSUA 4WVLA 5CM9C 1R37A 1JFRA 2Q6KA 2XNDA 3UHFA 4KO3S 1KFJB 2QLLA 2Q1SA 3EY4A 2RI6A 5LOVA 1SQ6A 3AU8A 3UATA 1F9AA 4CLHA 3QKWA 1MMFB 4HEA1 1KORA 1P1FA 5DX0A 4EHLA 4ZOCA 1U2GA 1L7MA 3LNTA 2TMDA 2ZVQX 2MYNA 3M6XA 3WQSB 4B74A 4HX2A 3OCZA 3KT0A 4RVDA 4PAMA 3HCAA 4DAOA 2R25B 3QH4A 4NU5A 4S1PA 4ZOLF 4YJ2A 4KBGA 1ZMBA 3GRZA 5GJBA 4ALIA 3OTOB 3Q15C 4NQZA 4IRMA 2VPZA 1IJEA 2QORA 1IQPA 1XQWA 2OXRA 4US1R 4WUVA 2YNMA 4D4HA 3KSUA 1KK1A 1SU7A 1X7ZA 2XEXA 2XB9A 4E6EA 2ZK7A 2PUDA 2BEVA 3SLRA 1TYBE 4XWTA 5EZQA 3STXA 2I2XB 2IHYA 2UYOA 5AVXA 1EWRA 2GK7A 4QM6A 3C24A 3VYWA 4L4UA 4M0LA 1PJBA 4RJIA 5FAXA 5HMLA 4BRUA 3QTBA 5CHEA 1F1BA 2BFPA 2Q9CA 4HS4A 2Q49A 4U3JB 3NAMA 4MW9A 4XSHA 4BYGA 3PX7A 3WGMA 5EKXA 4DC1A 5CDFE 2GK6A 6GPBA 3GVHA 4D82A 2BUCA 1MO5A 2Y1EA 2MYPA 3LCVB 2OYCA 5AM3A 3KQKA 1BAPA 3QQPA 3VVMA 2NTJA 4MWOA 3BF7A 3UOGA 3QXXA 4CM7A 3QGMA 3IILA 3H9GA 1RM0A 2ZU6A 1FNDA 1HTWA 1GZVA 1X7GA 3UXHA 3QKSB 5I7SA 4ZMSA 1MPTA 4MEBA 3ENZA 1IAQA 1XB2A 1UDXA 3DOHA 3UV6A 2P91A 1TI7A 1PT5A 2BSQA 2N3ZA 4FTWA 1FUKA 1GXSB 2OZEA 2GZ1A 2QG9A 3N74A 4RL4A 3SG0A 3UAOA 2Y76A 4ZICA 1LSOA 3PXBA 2H54A 1Q84A 1GYQA 2VZ9A 4JP1A 4F4FA 2VAWA 3RBZA 3OJCA 2PZAA 3T95A 4TL7A 4RHEA 2R6GA 3E81A 1B41A 1HSZA 1V5FA 4TTVA 3U3DA 1KK2A 2FX2A 5DCUA 5I9BA 3WMXA 3HV0A 1YCGA 4LE2A 4RLHA 3ZCVA 3U16A 4RUKA 1Y7HA 2VWHA 3GPCA 2OXCA 1USVA 4M0DA 1M75A 1ZYUA 5D5QA 3TW8B 1WHSB 4R8MA 4OMUA 5HF6A 1JJBA 1FQJA 4BFUA 4H27A 1KI3A 1NIPA 5JJKA 3IHKA 1DJQA 1NVGA 4EJ2A 3D0QA 4O3MA 3AFIA 2CNKA 3OMXA 2QTWB 5E38A 2HSZA 5E3IA 1LBSA 2C5HA 4WLOA 3CXRA 3QPCA 4RQTA 3C6ZA 4C4TA 4BY9E 1E6UA 1T43A 2YMLA 3HVKA 4DG8A 5LQAA 4MA0A 2WVGA 4ERNA 3VPSA 2UYGA 2VG8A 9LDTA 3CJRA 2OAGA 3I9V6 2D5IA 1LD3A 4JEUA 3MT7A 1QYIA 4FOLA 2Q7DA 3GT0A 4GBED 4ND5A 3KJNA 1E62A 1TA9A 3QOWA 2WJIA 4WX2B 2O7RA 1Z74A 1U8YA 3CRQA 2IPOA 2JKVA 2C5SA 3ANLA 4GOJA 1K89A 4Q00A 1UBUS 5C7OO 1C7EA 2C5FA 1DO8A 3NYWA 1BU5A 4Y0VA 3AVUA 1P0MA 2J3QA 2AWNA 1N5KA 2Z5GA 5H1YA 3LWBA 3DLHA 1I36A 4M6WA 1E5XA 1GQYA 1XRPA 3OEED 1N3BA 3ADBA 3AF6A 3WLNA 4ZQGA 2BFBB 5EQFA 4UQOA 1Q6YA 1JHRA 4RV4A 1BW9A 1MB2A 3IOCA 3MQ4A 4EFMA 5J4KA 4TQAA 4KXQA 3DBLB 1OBCA 3H0KA 3I09A 2B8WA 4QAQA 1CS0B 3V7NA 1TKBA 5I9LA 2G3YA 1P8JA 4TUYA 1THTA 3TSYA 4WBNB 4QTXA 1EMDA 5AK4A 1QFYA 2ROQA 3X2FA 5FT9A 3IBYA 4QYMA 2IUFA 3RHFA 4ISCA 4B6SA 5AFSA 3CUVA 2YXNA 2CV0A 4AWAA 3NT5A 3DFMA 2XVMA 5REQA 4BMNA 1UBNA 1U6KA 4RV9A 4EJSC 1V48A 3AP2A 4OLFA 4C87A 4BWVA 2IL1A 1NYTA 2IEGA 2I67A 3CXUA 3ROGA 1A4RA 1VE5A 2OHXA 3FPAA 2V8OA 1P62B 3BD8A 1E8MA 3PHCA 3N9IA 3T3EA 4QIHA 2HX1A 4DLSA 2PZMA 1IY0A 3H2YA 3O4FA 3PNQA 3HO1A 2ATVA 2Y2VA 4RPKA 5HYVA 2X40A 3WHLA 3QI7A 3ULKA 2BFNA 4FFVA 3U4DA 4OKIA 3IDSA 4O4IF 1EK6A 4RGVA 3MMNA 4Q1AA 5KSPA 2AZDA 4LXTA 3PUXA 5I01A 2YASA 2QMQA 2ZIGA 1EKXA 1YSCA 5BO5A 2HNBA 1M6YA 3PD0A 4Z8XA 1QF9A 2P5YA 2YY6A 4EGCB 3B1ZA 3I5XA 4BO9A 1NBEA 1VL0A 1RKUA 3IO5A 5CVEA 5JY1A 2ATXA 4D8VA 1PK7A 3NRCA 2WILA 5EN4A 7YASA 1OH5A 4LJAA 4ZCLA 2GTHA 1V16A 5LXTF 3ICCA 3EW9A 5CT8A 5H82A 3C1TA 2OC4A 1FW6A 4I1UA 4J75A 3GGGA 3IBFA 4DMHA 2J6IA 3KX2A 1DIRA 1UWVA 2ZCVA 1UWKA 2A59A 4LHWA 1P0FA 3B1VA 5H7XA 1Q57A 4RXMA 4EFKA 1UFQA 5JWRA 5LDDC 3W1EA 4M1EA 4AL4A 3Q10A 4B83A 1DRJA 3AUJB 3I6BA 1OLOA 5I7VA 2I1LA 3BFKA 1YASA 1KYXA 1QRAA 3GO4A 2CMHA 4MS3A 1GV1A 1W5EA 3NDPA 1KMNA 1SGWA 2PZJA 4MEJA 1GNLA 5B7PA 1P4HA 4X5OA 4EQZA 2I87A 3GEHA 4NBTA 4AJPA 1QDUA 1RRVA 1Y37A 1ZGCA 5J58A 2XVXA 2WG1A 2RHTA 3MWEB 3P0FA 5CIQA 5CCXA 2HMYB 1JKMA 2CDAA 2P6UA 5TGDA 3VOSA 4BE7B 4ND3A 2GEJA 2YJ3A 2P9CA 2J0SA 2N46A 1VSUA 5BYJA 1IRXA 2ZIWB 2UZ4A 3EZGA 1S5PA 3ZBQA 1OU0A 2AI2A 1I4OA 1PT9A 1ZFNA 5C53B 2IBMA 1Z2OX 3AU9A 1Q7GA 1ZITA 2NO4A 3CO0S 4CKEB 4BP1A 3LUAA 4J03A 1XTZA 5KSWB 1ZZGA 2FV8A 4RPCA 4N5HX 2W2LA 4CEJA 2PYIA 2ZBRA 3P5SA 4PR3A 2WU0A 3LUHA 4HAVA 1ZXXA 5EP4A 3UJNA 1O1YA 4DB4A 1XMVA 5BQXA 3N5CA 4KFTA 2ARKA 1J5XA 4DNQA 1NIJA 3Q11A 4G1CA 5AK6A 4EO7A 3FDXA 2GFQA 3UAWA 2GLXA 4B71A 3VPGA 3PHJA 3K0BA 1NASA 4GIBA 4EY8A 3HM2A 4U7DA 4HX5A 3AIMA 4PWZA 1EEHA 2AEEA 4LVOA 1YAJA 3EY9A 4PN7A 2VAXA 4K3VA 1ADCA 2D59A 4OQPA 1EQ2A 2F90A 3EC7A 4OXYA 5THQA 5JYDA 5IT0A 3L7CA 3RC3A 1EWQA 3O3OB 2GUWA 2TRSB 2ZRLA 4UVHA 1Z37A 3CW2A 2VP6A 2QT1A 4KSYA 2QLNA 3LUJA 1VSVA 2OAEA 4OGLA 4LSGA 4B45A 5H9WA 3JCZA 4I6EA 4JI4B 3TQIA 3FWPA 5BP7A 3FF4A 4I4CA 4D97A 3FKQA 3GEEA 2B6NA 3CEHA 5EZYA 3FVQA 1W4CA 2BGTA 3P4UA 4OJKA 1ZN8A 4O2AA 1JKJA 1MHPA 4M0FA 5BW5A 2XTJA 3ZGZA 1JT2A 4IHKA 3DDWA 2C99A 2WIFA 1U7PA 1FTGA 3JZAA 2O5CA 4HS9A 1ZX1A 2OXIA 2KSQA 3FOEC 1G42A 3FUVA 4HYTA 1FF9A 1Q1EA 3C1OA 1QZZA 4FYXA 1GLNA 4Z7OB 1P81A 5FL3A 1N9KA 1G60A 4XARA 5CB0A 4Z86A 1OBOA 4GWLA 3UYKA 2X0EA 1N8NA 4O4LB 4DLNA 5CGZA 1HDGO 3QPWA 3TIVA 2CZQA 3BSFA 3CLHA 3CR7A 4ML3A 2QJWA 3JVIA 4OFZA 4CPDA 3ZZ0A 4COOA 3VKWA 4E5MA 1BX1A 4Q1FA 5DI3B 4TYMA 4GLLA 1BTOA 4KV7A 1TW2A 1E1LA 2Q1UA 2PNFA 5AHOA 5G3YA 3A3YA 3IMFA 1V5WA 4BNJA 1PJ8A 3GIDA 2VT3A 3OC6A 3B2NA 3IAM1 4UM8B 4BKMA 3C3KA 4BDTA 2ZJZA 1KKUA 3RM3A 4I9FA 4HMOA 3K09C 3ZU2A 1P60A 5AXAA 4DPMA 3KUCA 2XKJE 3N07A 4FYMA 5EMKA 2CHQA 2F2TA 5C18A 1QE3A 5GWXA 4N9WA 5LP6F 2GCGA 4Q3OA 2WJPA 2XLBA 3HXKA 4EZBA 4D9EA 4IVRA 3UUEA 1O95D 4QPCA 1QB8A 4DMMA 4DA4A 1U99A 1UODA 3JVDA 1LJUA 3QKTA 1R0BA 2AA3A 1ZP6A 3DBOB 1FU4A 3ZDQA 1O5OA 2ZSKA 4FBGA 3DMYA 5JSHA 5DNCA 1EGQA 2ZSHA 4CEIB 4NZPA 2GK3A 2QN6A 2W0SA 4Y1RA 3RLFA 4CDGA 1R66A 4U2BA 4X97A 5DTQA 3DR5A 3GH3A 1UXHA 3IKVA 3CKKA 3DJYA 1MOQA 4BL5A 1XBTA 1G21E 2BE9A 2PSFA 1GZ6A 4OBWA 4UVGA 2AFHE 2O2XA 2VIIA 2BKEA 1TM7E 2DKNA 3H7IA 3LQKA 4MK4A 4R83A 4C0JA 4E07A 3BGSA 1L7OA 1Q16A 2VDRB 4FEEA 1RKXA 3GXOA 3PKJA 4OFXA 4DHWA 4TKUB 4DLAA 1SCJA 1YDGA 2A9KA 2O0MA 4JV5B 4GX0A 1B2RA 4X7MA 2H65A 4Y2JA 4Y3UA 5JMPA 2FFHA 5FI0B 2E4YA 2PX6A 4PLYA 1QSGA 3UVEA 4LHXA 1SKYE 5KYWA 5EKSA 3MUOA 2O9JA 1SEPA 1WSBA 4TLDA 5F3RA 1WWKA 1UM9A 3RSCA 3U6KA 4AG5A 3QYAA 4XM0A 2JGDB 5A0VA 3CZAA 4YMIA 2HBZA 1GY8A 1BO6A 2BFDA 2GCOB 5AW0A 3FMPB 4ENPA 2FPGA 2FSSA 3FNIA 3QVVA 2AXEA 3PQ4A 2YJZA 2JI6A 1CP3A 1JDNA 5F52A 7MHTA 1UJMA 3R6WA 5C3MA 1TNDA 1P2SA 1ZR4A 1G3RA 1GTVA 3O9MA 5TIIA 5HKKD 4P81A 3HWSA 1Y8QA 1G8AA 2OR3A 3F47A 1EHCA 1Y6RA 2IXTA 4GPD1 4HAXA 4WN9B 4WA8A 2WD9A 1HYHA 2MHCA 5A6SB 2VOJA 4DR4B 1J9EA 2EP7A 4AZSA 5ELLA 4L6AA 3FE2A 2ZEJA 4ENUA 2ZBQA 1QMPA 4OFBA 1QGAA 5JG7A 1KQGA 1JV2B 1R0LA 1X7WA 2HC9A 3PZBA 4GF5A 2W4MA 2FW9A 4KXLA 4LOAA 2VAPA 5ICGA 4KPYA 4H3SA 3LLSA 1NWCA 2GOYA 1QE5A 4H1TA 5C8YA 5KVVA 3WWZA 2DWQA 4RAQA 3B5JA 5TQJA 4CMEC 2EZ9A 3GD5A 5HM6A 2CE2X 4XWGA 1OA0A 1S3IA 4RDXA 2GFHA 4OHWA 5LP1A 3ITKA 3AVVA 3HJRA 4PG8A 5E3JA 5JJCA 2D1YA 2ZI4A 2A9PA 3OOYA 1A7KA 3FPJA 1EFLA 3PJRA 3FGNA 3GLKA 2O2YA 1REQB 4XWYA 3F2IA 1UEJA 4ZI7F 2VQ6A 3EIXA 5IKPA 3ERCA 4CMIB 3TXYA 5IYZA 4JBXA 4O5AA 3NW9A 4C6SA 1G4UR 1V26A 3DT9A 5JY6A 1XCGB 2ETXA 2WE8A 4Y8VA 3FOBA 1IE3A 4P4TA 1DTWB 1U31A 2OUIA 4C7MA 2COUA 3H9CA 3RT9A 3BM5A 3QFSA 3WLHA 2UYCA 2J0QA 2IH4A 1A98A 3R6GA 3P0IA 4DA8A 3CRVA 1NJ8A 3FTDA 3K0HA 3L0OA 2E6UX 2WA2A 5AT1A 4EHJA 3BWVA 4CF7A 2GCPA 4MYCA 2DLCX 3F7TA 3I23A 5BN4A 1J7KA 4CMGA 4DLUA 1D7AA 2R751 3HO6A 1E9RA 2R8YA 2XNHA 3LPMA 4LYFA 4URUR 3VPCA 3QWHA 3TFOA 4TYYA 5LWHA 1XZBA 2OWDA 4HRVA 2GLTA 4XJSA 3IKMB 3LO5A 4XGQA 4B3DA 1R4NA 1ATZA 4UTRA 5ERGB 2HWYA 4FEGA 1CUWA 2C3YA 4FILA 4Y2PA 2PY6A 4UPVA 4HQ0A 3CUTA 4RVCA 2FQWA 2HJSA 5JAQA 2A14A 4ITUA 1T6YA 1UBHS 2G7MC 4HNVA 2JLXA 5E6UA 3AOGA 2JHFA 1FYXA 2UZIR 5TPZA 3F49S 1LBQA 2V3VA 1EESA 1II0A 2E4VA 1CEYA 2FB9A 3OOJA 4DXAA 3HL0A 4N3CA 3T3NA 2JCSA 3MPOA 1LSSA 1RKVA 4JSTA 4ZJPA 4RK4A 1AJEA 4ARCA 4YR9A 4RZQA 4RWZA 5A5DA 3MLBA 3RD5A 1XVTA 1ZRMA 1W5SA 3N2NA 4P38A 4BATA 2CUZA 4I1PA 1OLSA 5K3FB 3H5TA 2ECFA 3ZCRA 1VL5A 3U1VA