3PXUA

Crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei bound to dephospho-coenzyme a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
162
structure length
159
Chain Sequence
b'SMVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRAKKPFFSLEERLKIANEVLGHYPNVKVMGFTGLLKDFVRANDARVIVRGLRAFEYEFQMAGMNRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLTEKVAAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 63
structure length 159
sequence length 162
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3pxuA00
1VL2A 1MOPA 1WXFA 5H16A 1R6UA 2J07A 1N2OA 4UZFA 4CDNA 1GAXA 3N2YA 1J1ZA 5BNZA 3IH5A 1QQTA 5J59A 1Q11A 4MUIA 4EG6A 2NSYA 1COZA 4RUKA 3H05A 5TGTA 3TQOA 2WQ6A 3INNA 3CLRC 4F4HA 4DJAA 3SEQA 4DDMA 3UMVA 1M8PA 1KAQA 5F23A 1R6TA 3S3TA 1YUNA 3A4IA 1WXEA 3CA8A 1G59A 1IHOA 4MW6A 4Q16A 2DUMA 2E89A 3G59A 4YP6A 2I1LA 5DASA 1M1ZA 2QTRA 4P2BA 4TS1A 5TEVA 2AG6A 1YIDA 4L2IB 1R6XA 3ZUGA 2ZUFA 1MAWA 2A7XA 4EF6A 3Q10A 1LW7A 3IUBA 3IVGA 3CLTD 3H99A 1MBZA 4PBSA 3MMXA 3P0IA 5TS2A 2CYAA 3AIIA 4XSVA 2E0IA 2EJCA 3IMCA 1O95D 1XNGA 2J08A 3X1KA 3K9WA 3FH0A 4KR7A 1EFVB 3A04A 1ZJWA 4J75A 4I6GA 2IJGX 1IQUA 2J09A 4HPWA 3DPIA 4MW2A 4ZT3A 4EGAA 1TEZA 1FFYA 1WQ4A 2AZXA 2DPLA 4R2MA 1M8KA 1NUQA 2B7LA 4U7JA 4YBRA 3COVA 3HV0A 1G8FA 3DO8A 2OV4A 1JEEA 4YP5A 1VLHA 3U1VA 4L2IA 1KORA 3COYA 4H3SA 1OBHA 4OJMX 4S1OA 1K4MA 1V8FA 4AS1A 2JANA 3VGJA 5KWVA 3AL0C 3IOEA 5J58A 2J5BA 1Q19A 2DR2A 1EFVA 1N78A 2XRYA 3AFHA 1JGTA 4J76A 1NSYA 1J1UA 1QU2A 2BTEA 1BS2A 1K4KA 2YY5A 3TNJA 4ZCSA 1XNHA 1T6XA 1O96B 2Z09A 4NAUA 3FIUA 4MW4A 3KFLA 3IVXA 1J21A 5TEWA 5K0SA 1QU3A 2D5BA 1JHDA 1NUUA 1CT9A 4Q93A 3Q4GA 3TZLA 4DLPA 4PBRA 2XRZA 4YP7A 3NBKA 1QNFA 1T6YA 1WXGA 2A1UB 3G5AA 1MC1A 1VBMA 1QRUA 3X1MA 2QJOA 2JAXA 4NAHA 5K0TA 1ZUNA 1EUYA 1EE1A 2QTMA 4NZPA 4ND6A 1MB2A 4ZT5A 1N3LA 5H7XA 3P0HA 1NUTA 1O5TA 4MUNA 1JEDA 4PBTA 2X1LA 1XJQA 3QTTA 1LI7A 3CLUD 2CV2A 1O96A 3TQIA 4EG5A 1M83A 1T6ZA 2CV1A 1J09A 3CLUC 3HZRA 1NUSA 4JYZA 1GTRA 4G6ZA 1OWNA 1KQPA 3E27A 1F7UA 5LLTA 3MLAA 2O5RA 2QTNA 1G8GA 2A1UA 3ZJUA 3VU8A 3CLRD 1U7DA 1O6BA 1YUMA 4MWDA 3IUEA 4CDMA 5FO0A 3TS1A 4CQNA 1U3CA 1PFYA 3HMQA 3RK1A 3RK0A 5IHXA 3OP1A 4QREA 2A1TR 1KQOA 1LI5A 3UOWA 4DDHA 2PXHA 1OWMA 1XNJA 1NZJA 2HZ7A 1O0BA 4MUKA 1NP7A 1M8JA 3UC5A 2E21A 1KAMA 1MB9A 4EFKA 3KT8A 3H9BA 1WQ3A 3IDFA 2H2AA 4MUGA 3UK2A 1N77A 2CYBA 1U0BB 2X1MA 4MVYA 3HL4A 3N9IA 4X0EA 4ZCPA 1KQNA 1TQ8A 1M8GA 1WOYA 4HJXA 3FNRA 4ZT7A 1O0CA 1TFUA 2AKEA 4MUFA 1K92A 3HFJA 4R0NA 1UFVA 3KT0A 1I6MA 3IMGA 1DNPA 3D6UA 1J20A 3PNYA 4ZCQA 1S4MA 2IP1A 3PRHA 2HMAA 1YI8A 1V47A 4GU5A 1GZUA 4MW5A 3BL5A 3IMEA 1JMVA 1N2EA 1KKUA 5J5AA 3LOQA 4ZT4A 1X6VA 3AG6A 3ZGZA 1KP2A 3SEZA 3LE8A 2CFOA 3ILVA 5DB4A 2QUIA 1JZQA 2A88A 5FO1A 2PFSA 2GOYA 4EG4A 2OQ2A 4NDAA 3CVVA 1PG0A 1U7XA 3I05A 2ZUEA 1OWPA 3AG5A 3PNVA 1O97C 3RJZA 3GLVA 1SURA 1EUQA 3K32A 4MLPA 2YWBA 1D2RA 4QBTA 1F7VA 4KPUB 1H3NA 3COZA 5JBNA 4MWCA 4ARIA 1H1TA 2ZP1A 2J4DA 4EG8A 4HJRA 4XFDA 1WZ2A 1WJGA 4UZEA 1IQ0A 2D13A 1N1DA 1TYAE 4MULA 5DEOA 4MWBA 2D54A 3GMIA 3KT6A 4ZCRA 2DLCX 1I6KA 2QJTA 3LCJA 2HGZA 4U8HA 1KH3A 1N2BA 3H9CA 4GRIA 3PNBA 2EL7A 1IRXA 2PZ8A 3RHSA 3FDXA 4WNYA 1WY5A 1J70A 1Y42X 4KPUA 1A8HA 1FYDA 5LFAA 4MW0A 4I6JA 4MW7A 2WSIA 2Z08A 1TYBE 5IJXA 2CSXA 1N2GA 4MUEA 2VTBA 5AHWA 3CVUA 2CYCA 3SZGA 1OBCA 3ISJA 4NX2A 1PG2A 2C5SA 3SZ3A 2PG3A 1O94C 4XFJA 1GTSA 4YMIA 5HUHA 1Q15A 2QUHA 1N75A 1M8FA 1Q77A 2V0CA 1EFPA 1IFXA 2RE8A 2X3FA 2V0GA 1KH1A 3KT3A 3N05A 4WSOA 3MLBA 3ZJTA 2TS1A 1PFVA 1QTQA 4MW9A 1HYBA 2WB2A 4QRDA 3FI0A 1I2DA 1OWLA 3QTBA 4NATA 3DLAA 3P52A 1QRSA 3N8HA 1T9GR 3F3MA 3CLSD 3FHJA 4MUJA 3RBAA 3ZXIA 4KR9A 2DXIA 2PIDA 1KR2A 2CV0A 3CLSC 3ZXSA 1N2JA 3UY4A 3PXUA 1IVSA 1JZSA 3X1JA 3P0JA 4DDKA 1QJCA 1YULA 3IODA 4F3RA 1ILEA 4ARCA 1KP3A 3A2KA 3L92A 4MQ6A 1OWOA 1EXDA 2VXOA 3GUZA 2RD2A 3NV7A 3SDBA 1GPMA 1OD6A 1RQGA 3SP1A 4ZT6A 2G36A 4DNXA 4KKVA 1MRZA 1JILA 1ZH6A 3IVCA 4FZJA 4EG7A 4G5FA 1IH8A 4HK4A 4MAFA 1U3DA 1NI5A 1WXHA 1WXIA 5HUJA 2DEUA 1JIIA 1K97A 1KH2A 5EKDA 1JECA 2BYTA 1YIAA 3FOCA 3CLTC 2GKSA 1B6TA 1O97D 4PY2A 3MXTA 3CVWA 4K03A 1O95C 3G6KA 1QRTA 3L93A 4ND7A 3ND7A 4AQ7A 4KR6A 2QJFA 2PZAA 4EG3A 3H97A 3ZJVA 3D6VA 1TYDE 4I6EA 1X8XA 4JZYA 4U63A 2QUKA 2X0KA 3IOBA 3IOCA 3CR8A 4ZT2A 4DE5A 2DETA 4OUDB 3SYTA 3Q12A 2E18A 1ZH0A 3A05A 4JFAA 2VTBB 4JXZA 1JIJA 4MVXA 1WKBA 1EJ2A 2R5WA 3CVYA 3QE4A 2JA2A 3ELBA 1JIKA 4ZCTA 2IELA 1F4LA 3FETA 2QUJA 2YXNA 3TZEA 3ND5A 3MUEA 1ULHA 1EFPB 5DK4A 1TYCA 3ND6A 4MWEA 1NYLA 2WQ7A 1MJHA 3DV2A 3AKZA 2H29A 1NUPA 5KHAA 2YWCA 2A4MA 1PFWA 2CT8A 5HG0A 5KCMA 4R2LA 3VRHA 4OUDA 3ZIUA 1P7PA 2DERA 4MVCA 4G5YA 4BWVA 1O94D 3CVXA 2Z3VA 1IQRA 1VBNA 3C8ZA 4CT0A 2A1TS 3M5WA 4MVWA 4K0RA 1H3EA 3FY4A 2NZ2A 3FWKA 1T9GS 2O8VA 4EG1A 1H3FA 1N2IA 4E1AA 2A84A 3OTWA 4RPIA 2PZBA 1PFUA 2CUZA 1GLNA 1I6LA 1MAUA 4MW1A 5LM3A 3HGMA 2GM3A 1VBKA 1G8HA 1N2HA 3FG9A 3JXEA 1GN8A 1F9AA 4JXXA 3NBAA 4MUHA 5FNZA 2A86A 3COWA 3RFFA 4A91A 1NURA
chains in the Genus database with same CATH superfamily
4M98A 1EFHA 4IWYA 1O6CA 4ARSA 1B2LA 3EZ6A 4TN1A 4R5HA 4JI8B 4HTFA 2I2WA 4KUGA 3ZHOA 1GG2A 2CL7X 2YIMA 2CXOA 3H04A 4YO7A 2YJTD 4CDNA 2G76A 3N2YA 5HFAA 4X60A 3VX3A 4DSOA 5EWJB 3IH5A 3TG2A 4R4JA 4WEQA 4OMCA 3A6LA 3H9GA 2F4VB 5MHTA 1EWYA 2FDRA 3KELA 2B4QA 1RM3A 1XT6A 1DAMA 4KQ1A 3KOZA 4BP1A 5BSEA 4BEWA 1W4ZA 5PNTA 1E0AA 4KQCA 1RQPA 4U2KA 5IWCA 1N0VC 2IWRA 3OTQA 3S2EA 5JFTA 3SHVA 4NBKA 4IJQA 4TZKA 3ESZA 4X54A 3I8SA 3NFYA 2XECA 1BYIA 3A4IA 3CA8A 4F6LA 1G59A 1W94A 1DU4A 3UGQA 3C70A 5FWDA 1P7VA 4IIXA 1RJDA 5LDDC 1HYEA 2FW7A 2PBRA 4OBXA 4JI3B 3T5DA 2IYNA 2H7XA 3RRBA 3ZGYA 1XAJA 2QENA 4TVKA 2BP7A 2R8EA 3L43A 2EKDA 4MX8A 1YB1A 2QL7A 3CEPB 2Z9BA 1G5IA 1A7KA 1UM9A 5DBHX 4EDFA 1DKOA 1M2OA 1RLIA 3H0CA 2BLNA 2FMHA 1XTJA 1ISHA 2VWPA 1XD2A 1EDOA 1F6BA 2ZPTX 4M36A 2J85A 4DKXA 3FSJX 2GBLC 1P19A 4PSDA 3MOIA 3QQPA 1ZJWA 3LMKA 1NQWA 1QRRA 2B8EA 4UMEA 4CTNA 1SXJB 3JD4A 3BJIC 1IQUA 1D2NA 2A8YA 4EB6A 4ZC8A 2BF4A 1JJAA 1R4ZA 2P41A 4HG2A 3LBIA 2IIPA 3MF4A 2ZPUA 5JH7F 3IP8A 4L3OA 1MPTA 1QWSA 3A1VA 3D8RA 3L8MA 2P0AA 4RA6A 4HEA1 4AD8A 3EDQA 4MHSA 4AP6A 2ZI7A 1XA0A 3RVRA 1RWKA 5L3QA 4Z51A 3D7RA 4ALKA 1XZCA 2OKCA 3NONA 3PHGA 3LECA 1W5BA 2XBLA 2FP4A 1KORA 5FL7D 1FFSA 5JMWA 4RULA 3AEQA 4M1ZA 1J8YF 3VU9A 1QZUA 3V6LA 4ALJA 2OA0A 3HP7A 3AQIA 5EQDA 2V3VA 4DEVA 4I4CA 1V8FA 2DZDA 2BFCB 4QC2A 3ZWVA 5DT9A 1SXPA 4L51A 1HETA 5CDUA 5KWVA 4TTVA 2FEOA 2EU8A 4KE7A 4M0DA 4B1FA 1K6EA 4EA9A 3R8FA 2CLHB 2Y1FA 4JB0A 3RC3A 3W6ZA 1J1UA 2GYWA 2MSEB 4LDZA 3OPVA 2VWQA 2BTEA 1ESMA 2E49A 3JATB 2HHJA 4W8OA 1NDUA 3DMHA 4MRVA 4WLVA 1BS9A 4CI0B 4G8CA 1XZQA 1SVNA 1Y5RA 1HQCA 4TKVA 2YZ2A 2X1HA 4Z3KA 3D8SA 3G13A 4ZI2A 1OB5A 1D6SA 3IXLA 2HA5A 1N6RA 3FMVA 1N36B 3UFXB 1E8NA 1P75A 1TK2A 3K0FB 1T0JB 2XMGA 3AYXB 3TSAA 1UH5A 2YV5A 3OLYA 1TM5E 4GI3A 3HJTA 1UXGA 4WWHA 2BGWA 4B32A 4DRXA 3VHQA 1PHPA 2JL1A 2YJ5A 2QGFA 1JDJA 3TQFA 3LSTA 1J5PA 1SWVA 4HN4B 4WZZA 3R77A 2FRDA 1WXGA 4TM8A 5JHHB 1IUNA 2AFRA 4LG1A 4Q9IA 5D5QA 5EJFA 3CW8X 3K9LA 1VZ2A 3MWDA 2C4KA 3EZNA 1YV9A 2WOJA 3D54D 3AM4A 2WU3A 1JVNA 2W48A 3B6MA 3OZVA 3HM9A 4ENVA 3SE0A 2F3SA 4BLQA 3QA9A 1NN5A 2G7MC 2NW6A 4HN9A 1EK2A 3AXSA 4F2GA 4BXOB 4OVKA 3VHRA 3ZHZA 3I3OA 3FUWA 4PTYA 2PGAA 3RJ9A 3Q9SA 4ZQEA 5HM6A 5A2GA 1Q16A 3PI7A 4R68A 1GZDA 3V80A 5ALVA 1YCHA 2H17A 2OZLB 2WR8A 5IKPA 1A69A 1WD7A 3H8JA 3CLUC 1COWA 1JPNA 3LT0A 3ZK7A 5CDHA 1Q0PA 1WNTA 3OBBA 2JA1A 2QTZA 4C07A 3GRCA 2Z2KA 3BUSA 4KQHA 3AXTA 2CGEA 4X24A 3EPPA 4ZVRA 5HCUA 4A8JB 4EF5A 5IKEA 2JJYA 1KAEA 1I3OA 4X84A 2WJYA 1OX6A 4ILKA 4EFLA 1VL5A 1FUYB 4Y6RA 4FWBA 3L4BA 3H1GA 4CKCA 1S2NA 1ZZGA 2UUOA 4K6OA 1J0EA 1DRUA 4PLPA 5HF8A 3I0ZA 3R7FA 1UFOA 1W73A 2P3OA 1VOTA 2JIZD 1FX0A 2WMOB 2WPDA 3FPEA 2HMWA 2H2FA 3F3SA 3IKVA 5A03A 1Q7EA 3AP3A 3OPYI 3C7TA 5IUKC 3R9WA 4G5HA 5SY6A 1NKVA 4LZJA 4N48A 5DMHA 1Q17A 2NX2A 1C3OA 1FXWA 1E3LA 2CD7A 1XJ0A 3IDFA 1E0JA 3K4PA 5AUOB 4QDOA 4B3SB 4Q7QA 3IIEA 1O1YA 3N9IA 1G8KA 4JLVA 3MSCA 3KZMA 3B3JA 2R7KA 2G5CA 2JHCA 2WMYA 4LRXA 3RVSA 1OYYA 3L0ZA 3NQ41 4HJXA 4WVFA 5C8ZA 2CNWD 4YPOA 3SJAA 4EAQA 3IA2A 4NZYA 2VYND 1ZMRA 2VAWA 3R09A 4URUR 3ASVA 4M4SA 3QF4A 4R0NA 3C1UA 3RFXA 3SKYA 3OZBA 4DLSA 4W1SA 5JEDA 1RXWA 4PO9A 5LJLA 1KJ9A 1SCQA 1DNPA 1KAOA 1PO7A 3C5CA 3GK3A 1HBJA 4TTTS 5DNCA 1YD7A 3MC1A 1SU6A 2HXYA 1UQTA 1T36A 4PW0A 1DC3A 2FN9A 3MWEA 3A1UA 1AS0A 4TKZA 4MW5A 3LA6A 5FD8A 3E5NA 2ZQZA 5J5VA 4L9WA 2WRZA 1FNDA 2XDYA 1E4OA 4WUTA 3VQTA 1ENYA 1NIJA 1YJQA 2CHVA 2WFAA 2ZROA 3MT0A 3OLCX 3WRXC 2NP6A 2P4SA 2H31A 3ZHVA 1D5CA 4BNZA 3QVSA 3UCEA 1KJWA 4NE9A 1DDGA 4MVJA 1JB9A 5FBQB 1QHNA 4MV1A 1OC2A 2B3DA 3QNUA 4ZMSA 2OECA 2PBFA 1CDOA 3FVTA 3L1HA 2GOYA 5FO1A 3DC7A 1PG0A 3FCAA 4HGQA 2X2EA 3H1TA 1G3MA 1SURA 2JAUA 5G1OA 5BOSA 3G8CA 1YNSA 4B45A 3IIIA 5D5PA 4V0KA 3STTA 4NFLA 1ZVJA 1HFJA 1NF9A 1JHPA 1C80A 5FOSA 2POCA 2Y68A 2QPOA 1W29A 1P1IA 3IMKA 4GPAA 4BVLA 4RTRA 2GAFA 3W4JA 7ABPA 2C5BA 4J43A 2OBMA 2HW8A 3EWAA 4UZEA 4B75A 2D13A 4DCMA 3E5RA 3A31A 1AGXA 3LF2A 4KXWA 1OFIA 1U1GA 4QQNA 4RGBA 3MG9A 1PK8A 1RYHA 5J63A 2YHUA 3G2IA 4QG3A 2PWAA 4NCHA 1XP5A 3LCJA 3ILHA 1GUAA 4L8LA 4XJVA 3BMCA 5H70A 1Y6JA 3VR4D 1QK5A 3G68A 1NBMA 3V2GA 1MEOA 2TMKA 3ZU3A 2W83A 4DLXA 5EYPB 3PEFA 3ZCQA 4MJLA 2QZSA 3HA5A 3ZLTA 1E92A 1WY5A 3BN3A 4BNTA 4D9HA 4KYTA 3F3YA 2A0UA 1H42A 1GPDG 2GEBA 2Y6UA 4FN5A 3KZXA 5GGYA 4E1BA 3N6RA 4O4IA 4W1PA 1XJWA 3QYFA 1X7XB 4MUEA 5D1NA 2B5VA 1RLOA 5AHWA 3DR3A 4LJSA 1JG7A 1G9XA 3QWHA 5LA6F 4BVKA 2FP3A 4C7XA 2DHEA 2BFPA 3TAHA 4BO6A 3T7KA 4DC1A 2VSQA 4W5NA 5AKXA 2C5SA 3C1OA 1UOEA 5C5DA 1MW8X 2BFDA 2PM8A 1L4YA 2JLSA 4H16A 2AJ8A 2BGJA 3H9JA 1G8MA 5MN6A 3R3HA 2NAPA 1GAWA 3NVKI 3DVQX 3AKDA 2GKOA 3ACBA 1UZLA 4GVXA 1LVGA 1WUJS 1BC5A 3FPAA 2IZZA 3UF0A 4WJLA 4F93B 4PZEA 5J4LA 4MCHA 1NTRA 3MLBA 3LQYA 1H4SA 5JCPA 2HV8A 4GO1A 1FE8A 2XJ9A 4MW9A 1FOEB 1KP9A 1DKQA 2F3QA 3IUPA 4IOMA 4URVR 1E94E 3V46A 4AP5A 1KI4A 1WLYA 3O83A 3LM8A 4KZKA 4YJFA 3BXOA 4B5LA 4QXPA 1P2SA 3ASYA 5B53A 3OLWA 4MJ7A 2GZ1A 2PL9A 2XUFA 3LUAA 3FHJA 4IXNA 4DGSA 3UWKA 4IXMA 1NW3A 5IBPA 5TQ2B 3LWBA 4HGOA 2FG7C 4CKEA 1KMHA 4K9KA 3TO5A 3CC8A 5DKFA 1NFFA 1P62B 4BFWA 2Y92A 4N03A 5IBRA 1QYWA 1CWUA 3FCSB 4MTLA 3A9UA 1IPEA 2L82A 4IBOA 1P3JA 2FG5A 3TSCA 4Y98A 4AZWA 3O8CA 1E2KA 3HJGA 4YMTA 3VUFA 4PNHA 4UAVA 3KG2A 1OWOA 4YRMA 4TZ6A 4ZEOA 2A3NA 3R0XA 1PDWA 3T5CA 1ZAKA 4ZP1A 4K86A 2GETA 4G24A 1SXHA 1QH8B 1P1KA 3QFFA 1AXRA 2X22A 4R8RA 1L4FA 3C6BA 3RUIA 3GEBA 3VZCA 1P9LA 1Z4QA 3TDMA 4QLOA 1RM0A 3O4HA 3BE8A 4YV2A 3W2FA 1SCBA 2A9FA 3E8SA 2R8OA 3B9QA 3GRZA 2V6GA 2XUZA 2WC1A 1DC4A 1AKMA 1SG9A 4G5FA 1FDOA 1W47A 1GR0A 1P4SA 2YHSA 4K9RA 1U3DA 4GBJA 1WXIA 2Q1SA 1IOWA 5FLKA 4DMHA 1KH2A 1A5SB 4XGQA 2DWQA 1VL0A 4QAJA 5G1PA 4JX9A 2PGJA 1Q0RA 2H7CA 4X6XA 4PY2A 1KOFA 3QZUA 3MRXA 3HJRA 1EU1A 4ZYUA 1ZBQA 3NKFA 5A71A 3NC0C 3A3KA 3JZMA 1QRTA 1FYVA 1J9ZA 1Z0UA 3ORRA 4OBEA 1BMTA 1DT3A 1OVMA 5DGDA 3RB8A 4AQ7A 1Q22A 1BCRA 3BS4A 3ZDBA 3BRCA 2DY0A 5JHGB 3LK6A 2QX9A 1AK9A 5LOVF 721PA 4I1UA 3BWCA 5DI9A 5HKAA 2Q6OA 4ZT2A 3H9EO 4UNSA 3LKBA 4OUDB 2RGDA 3EXHB 5DGIA 2ATEA 1R0WA 3DDZX 4PZAA 3ZNNA 4CLRB 3MCAA 2H5LA 2XA2A 2Y1OA 1W4CA 3I32A 4WH0A 3L7LA 1I0LA 1E9SA 1QO9A 3A9SA 4KGZA 1V2GA 5F3RA 2YL2A 2N1BA 4HFMA 3HKDB 5CW2A 1V7PC 3UJPA 4GDFA 1SUDA 1EX9A 2YYZA 3FTNA 1SY7A 4NYMR 3JQAD 1DC8A 3WB1A 5IYZB 1PHRA 4NJEA 2OD7A 3FETA 1I10A 3FLBA 3F5SA 4DRZA 5A5EA 1Y9AA 3RQSA 1WL8A 2XTJA 3AERB 2PNJA 1DO2A 3D7KA 3SI7A 2RGBA 4EJMA 4CMIA 3WQSB 1GLVA 4IL5A 1XTZA 4TVBA 2BGTA 2OP1A 4LXGA 2X7HA 1RPTA 5BV2P 5IF3A 3O73A 1I2CA 1AKWA 1R3DA 2R5NA 3DTTA 4QFDA 2A4MA 1XZEA 2QRJA 1Z73A 4HVTA 4RYLA 5AOBA 4LFCB 4H6XA 5IAOA 3TOVA 4A26A 2EVWX 2HHLA 4MGZR 4Q4DA 5LKAA 3T5MA 1OF1A 3UVEA 1YRWA 5IDQA 3CE6A 4J7UA 4N8EA 3T5BA 3PCTA 1B41A 1JEOA 3C7KA 1GU0A 3D6TB 4G89A 3CNQS 4JU9A 3WLLA 4B33A 5KKCA 2HN9A 4E5MA 2VPIA 3Q3VA 3K72B 2Q3LA 3KEFA 4W63A 4B85A 1NNI1 3PIRA 1G5FA 3ANMA 3U48A 5ALEA 1ZLXA 4F71A 2RH5A 4OXIA 5F2OA 3HQ4O 2B20A 3FRJA 3L82B 2ZRQA 3VR2A 1Z33A 2CUZA 5E0KB 3KB2A 3HGMA 1X19A 3OMWA 4IIVA 4HS4A 3OSZA 1H23A 4LC9A 2A2ZA 2GR9A 4IV0A 1SR8A 3OQIA 5FFFA 1GN8A 2NPOA 7AT1A 1ETHA 1G8YA 1NVUQ 1TQHA 2E5FA 4PX9A 4AYXA 3NAGA 1N2ZA 1UT8A 2P0EA 2UVQA 3GY0A 3IT3A 3NTVA 4JBWA 2G0NA 1EVLA 4MUHA 3DCIA 4EGJA 5FAKA 2FPPB 1E1DA 3HJCA 4M6WB 1O4WA 4YS6A 5DOZA 8AT1A 2ZZNA 2YXDA 2D2IA 2YV3A 5D3KA 3FHCB 4FMBB 3WRXA 5JQGF 4MWTA 1AO3A 1R0LA 3ROZA 3UH1A 4EI2A 3FCUB 1ZVQA 4FHGA 1VSBA 1ZNQO 3NC1C 4MO2A 4OQDA 4DWOA 4LJRA 4J16C 4MS3B 1FFHA 4LNHA 4LOJA 4UZFA 3WSWA 3ZOZA 3EA5A 4I1RA 1Q11A 4MUIA 3C24A 1FFBA 4BGVA 4EMSA 3W0LB 2LCFA 1C0KA 4HQ0A 4K8RB 1M10A 4MRAA 4V0SA 2JHAA 3AIOA 3O4GA 5EL0A 5IAKA 2NSDA 4GOJA 4O33A 4CR6A 2VHEA 1SQ0A 4OQXA 2HRRA 1B2RA 4PS1A 3DD5A 3LT1A 2QX7A 1FSSA 2Z4SA 5SICE 1TQ4A 4I55A 2CB0A 4UZSA 3GQBA 3RWOA 1VFNA 2WTNA 1E9BA 3BOSA 2OESA 5D6OA 2IK8A 3GEGA 1GFWA 2IEAA 5DRTA 3ZY2A 5BUQA 2VUSA 3I6QA 3LAWA 4CM9D 1T0IA 3V6MA 5ITVA 4YCMA 3W9SA 3UT6A 2IQIA 4X1YB 2QSJA 3CLTD 3F6CA 5EMKA 2FU5C 4PBSA 4WVLA 4ZU3A 5E6UB 1USVA 2QTBA 2PFGA 2XYHA 3B1FA 4MR7A 3UUWA 2IX3A 1CPYA 4QBGB 2ZVDA 3QF7A 2PYZA 3IP5A 3DDSA 1M6HA 4FMDF 3CO0S 2C4WA 2GLTA 1IXZA 2GWRA 3JWIA 1A9TA 1J8FA 2SKDA 5IUJC 5EZSA 4HPWA 1JMKC 5I9TA 4JCOA 1Z6YA 1WMEA 3IKTA 2GDZA 2P6RA 4LJYA 1FVHA 4LI3X 4ZEWA 1F2DA 1QTIA 4L9RA 3RYIA 3LL4A 3ZNOA 2OFWA 2E87A 3MWKA 4G07A 4OI2A 2OXCA 5F76A 4D0SA 4QOSA 2OV4A 4DG9A 3BWMA 5DGHA 1VB3A 3TNDA 5E1MA 4W5QA 2J67A 4OHKA 1Q1QA 3WLFA 2H2IA 1ZHOA 9LDTA 2CVHA 1I2BA 2RJNA 4INJA 4GLOA 4N0MA 4QD3A 4EX6A 3THXB 2LE0A 3GW8A 3P7MA 4DBZA 5L3RA 3EC2A 1IWBB 3PDUA 1FRVA 1JXAA 1HPLA 2IU6A 4K9NA 4F9GA 3BGIA 3DTYA 4W5TA 2ON6A 1L6RA 1W2HA 1DV2A 4MARA 3ZPXA 1LUAA 4NCXA 2AN3A 2BFEA 3SKVA 2Q07A 5BOVA 4ZO8A 4LWPA 1NG1A 5ALSA 2WIFA 3KCQA 2WICA 3L0SA 1PJ2A 5AJVB 2YYYA 3K6SB 2EGHA 1D04A 3IHLA 4JEMA 1XZBA 3MMSA 4PF1A 1NXVA 1YAJA 2BZSA 2WF6A 3DVSX 2OQRA 3N8GA 4Y2SA 3VZBA 5YASA 4BE4A 4ENSA 1XQ1A 3N2GB 3IAEA 4KH0A 3VBCA 2VO1A 1QP0A 4C2TA 2PZKA 5JY1A 2DFKB 2VHZA 3SD7A 2H57A 5JVDA 3RVNA 3VO1A 1JWLA 5CYGA 2JJQA 3JWPA 2AZDA 1JF8A 5AH0A 1UIMA 1GYPA 3UBTA 2HQBA 3DHEA 3I4LA 3QEMA 1XI2A 4N0DA 3OCUA 3ABRB 3OJWA 3CIOA 3RH0A 1LPOA 1XMVA 2BHTA 5DVZA 1P31A 4ANFA 1WP4A 1ADFA 5H5JA 4YP7A 3K1AA 4ZAZA 5EP3A 1CY0A 2DJ5A 2WJ6A 5K3EA 1SD1A 3JV7A 5HKLA 1YO6A 4NMLA 3X1MA 2JGEA 5ALQA 5IM5A 4BNDB 4Z2AA 4FT2A 4N7BA 1G5PA 2UXDB 2CUKA 3SZRA 2YWRA 1XK6A 3QLVA 4O29A 3X2EA 4CG3A 2VRCD 1UOPA 4CU2A 1N3LA 4OKSA 5H7XA 1T4BA 4WBXC 1M6WA 1QDUA 3QH4A 5F5XA 3ZH9B 2X1LA 4DZZA 4IW3B 3UHJA 1L6IA 2D3WA 5IBQA 1FTQA 3V48A 1A7AA 5G0VA 2GA9A 3RO7A 3EVNA 4ZK2A 1T6ZA 5I3CA 2P5YA 2E5LB 1SQSA 1A7UA 1NMEA 2O7NA 3LIPA 4B82A 5FOWA 4U6SA 3ZE8A 5C1PA 3ZWDA 1FNMA 2V7GA 1KQPA 5EWMA 4GWGA 3RS8A 3EUAA 1SXJD 3KR0A 3OQJA 1ZOIA 4CVNA 4YJ2F 4C0WA 3OT5A 3KAQA 4WDRA 4DRYA 1NRXA 2EG5A 3EMKA 2BM1A 4KWHA 3VU8A 1CIVA 3S2ZA 3ZTWA 1CD5A 2Y1EA 3H5AA 2H07A 3Q8XB 1X14A 3DNFA 5GAJA 3CVJA 4JQOA 3IUEA 2HRDA 3NKLA 4P0PB 3NTQA 5EKXA 4V1CA 2FPKA 1GNTA 2R6JA 2ECPA 1B73A 1LBQA 3LUGA 1TZMA 4FYHA 4LC0A 4L4RA 5F12A 3VR6A 1UZUA 1ZIOA 2VDKB 2WPNA 3OFNA 4OQEA 3N07A 4QOFA 1RYEA 1V8OA 2P6OA 3O4JA 1C9EA 4MUKA 5BW6B 3BRWD 2GH1A 2AUMA 4FP9A 5BSWA 1ENZA 3I9KA 4G56A 4TMWA 3BGOS 4QZVA 3NM6B 1HDXA 4RVOA 3W5DA 3W5CA 4LGMA 2QTGA 2CNDA 2XOKA 2XXJA 4TTIA 5LXTF 3H65A 4G25A 2WOOA 1IBLB 4F5DA 3HL4A 3AZPA 1KQNA 3PJRA 4UQLA 4G81A 5EIFA 4BLPA 3KIPA 4PCAA 2M9MA 4W5WA 2XBMA 3AIKA 3U56A 1NT2A 2W2PA 3HB1A 4LAFA 3ZCVA 1E9RA 1V16A 1ABFA 1R5JA 2GAIA 2IE0A 3AR7A 2IEZA 3DZDA 3N2IA 4TKLA 5DBFA 5AW5A 4DWWA 4WMLA 5CA0B 3LX4A 3HBFA 2JI6A 3J7AC 1V5IA 1T1RA 2AJTA 3ZX5A 3O1LA 4M0MA 1F51E 1B8OA 5H3LA 5F7OA 1DSSG 2I7TA 2QG6A 3BMNA 3EIEA 3PHBE 1KL7A 4GU5A 3KTOA 4MB2A 2GM4A 3OJFA 3ZY3A 2D5CA 4NZMA 4RLSA 2PRSA 2CBXA 1LF5A 5J5AA 3GRPA 7REQB 3NBQA 1Y6ZA 4U39A 2WWYA 3AHFA 4DB4A 3W78A 1IN8A 2NZWA 3AG6A 3R7SA 3CUWA 3L1UA 4H60A 3INYA 2HPHA 2BH2A 2B36A 4QT0A 4M3NA 2WE7A 5HJ2A 1G9TA 2BEWA 1IPFA 1W5SA 2QG4A 3LY9A 2J0QA 3JD1A 4X7PA 3ITKA 4RMNA 3KQSA 1YQUA 3KLMX 2CUNA 3CVVA 4B76A 1U7XA 4I9FA 1OWPA 3GPCA 4PLVA 1XMOB 3PNVA 3OAAA 2ERCA 3KDAA 4S0ZA 4XDYA 3ZU5A 5BRAA 3GLVA 1OFUX 5AW3A 2XYRA 1NBME 1CIPA 4BMVA 3KLBA 4RV5A 3UPTA 1H3NA 2AG8A 2C29D 5SZHB 2HCJB 4FNOA 4UHFA 2EXXA 2Y4NA 2PH3A 1U2TA 3PDHA 5HIAA 5LSAA 5KC9A 2K2QB 3QXCA 5I4KA 1D2HA 3ZBUA 2E4AA 1ZU4A 3AETA 1Y1SA 3DZKA 5DDIP 3DE3X 3IL2A 3W3ZB 4A6XA 4DCOA 8ABPA 3BWEA 1W93A 2AMVA 4DMRA 1H6BA 5DH9A 2ZRPA 1TYAE 1VIMA 3SHQA 2UUCB 2R4QA 3E82A 4IEFB 5B5SA 2R8BA 3HCAA 3L7OA 4JP3A 1UT6A 1VHJA 3KT6A 4KPFC 3JRXA 4C1NA 1XMQB 3ZE9A 4CETA 2G67A 2ZR8A 3P45A 4UPEA 4LCJA 3S1AA 2ZBPA 3MT7A 4KXLA 5DTJA 3RUAA 5KS2A 5L51A 1NW9B 2GO1A 4KDEA 3ORHA 1XCJA 4MZXA 4RIIA 5IJ0A 5JQGA 1BZYA 1MO2A 4PGAA 1PI3A 5HIMA 4HH1A 1FFEA 2ZT5A 5JNWA 4II2A 1V2HE 4P86A 4UM7A 1TZKA 5A5DA 1TJPB 5TT1A 2XDAA 3MYYA 3TEJA 4ALMA 2ONKA 4IX1A 1FP4B 3SQNA 3KSZO 3QMPA 3TUIC 4PRYA 1M6VB 3I6BA 3ADBA 2YOFA 5TNXA 3LC1O 2R25B 2R0QC 4J0KA 2E4VA 5EXPA 3CQ9A 2P2LA 4GPBA 1C9NA 3F6EX 1PL0A 2O59A 4MP8A 4GOND 3ESXA 2GILA 3SWWA 4RVUA 1QORA 4AYWA 3SQOA 3DPUA 5EZYB 5CT9A 4MV9A 3U4AA 4FUTA 5D8DA 3E53A 3V8EA 1QCZA 1TCUA 4B09A 5KX5F 2J4FA 4HWPA 4OI0A 1STOA 4R7ZA 2EFDB 3IULA 3Q98A 4KO4S 3QW4B 5FOXA 4B17A 3DR5A 3BE6A 1W25A 3UT0A 3P97A 2F9MA 1L2TA 1GTMA 2QT1A 1KNQA 1G63A 4JSYA 3FB4A 4KX5A 3FWHA 2ID4A 1QDEA 1FDUA 5EZQA 1GGFA 5AKZA 1J4AA 3QFCA 1Z0ZA 1W44A 2VPZA 2X0RA 4DSNA 4PSCA 1ZUD1 3G8BA 3ZV3A 3DXYA 3ZJTA 1E5QA 1PFVA 4JOQA 3HUUA 4H4CA 3A28A 2CZQA 3ECCA 2RHJA 5AXCA 4BLTA 2FN3A 1GCUA 4IXWA 1AQNA 1TDJA 2X6QA 4OXRA 3EVDA 5ED0A 2I29A 4S2UA 1XWFA 3HLYA 4JSTA 4A5OA 4DR6B 3L02A 1QRSA 2X6TA 2RGUA 4AUNA 2O1SA 1UJ6A 2ZVQX 4XD7A 4RC9A 1WDTA 3G5LA 1Z5OA 1E0DA 1EP1B 2QPLA 5JIBA 2I8AA 2OGZA 3GFSA 1DQPA 3RC1A 3WLRA 3SFVA 2PX0A 5DW0A 3F98A 5F52A 3ZXSA 4ZI7A 2RH9B 3HFGA 1CJTC 2GRUA 3AUAA 3F1KA 3QM1A 1CZHA 1G17A 3WKDA 5KTYA 4KVZA 1BYUA 5TR9A 3GI1A 4OL0A 3N53A 4KGXA 2BGUA 2ZT8A 4KXXA 4N6GA 2HH9A 1DI0A 3L92A 5IJAA 3ZV6A 3U4MA 2VDRB 1EUDB 2ZIFA 2GRJA 2G9VA 1C3EA 1JDBC 1ITZA 1FPQA 1V3VA 2EP5A 2Z2ZA 5DTMA 3UBMA 4DUGA 4MKRA 3CWCA 1KVSA 2A9VA 2WSBA 3FE2A 1W48A 3FHOA 3GLSA 2VNJA 3NV7A 4AJNA 5BV0A 3MERA 1H1LA 1U1FA 2G36A 4QELA 2R44A 1QK4A 4AO6A 2B30A 1NE7A 1QHXA 2Z8YM 4JR1A 2YN0A 4YO8A 3THSA 3GP5A 3Q0IA 2GJ8A 3SYMA 1QC5A 2XKBA 4Q1AA 1RHUA 4Y2JA 1I1QB 4TZTA 4HK4A 4FKMA 4BNVA 1OXKB 1NR7A 2QY9A 2WIJA 4LBWA 3PT5A 3WWOA 1YE8A 3EE6A 1YIAA 4RK0A 5E9JA 3PEWA 4HB2A 1F14A 4DMFA 4Z2YA 3GJSA 1FA9A 3JALA 4DARA 3TFOA 3HUDA 4BYMA 3WNCA 1SCNE 1G2QA 4NWIA 2ISSD 4RSGA 2C31A 2PQMA 1GEGA 3HYTA 1VA4A 1K98A 1NLMA 2IOHA 3L93A 4YJGA 4PPGA 1OFTA 1USUA 4I8IA 1FSFA 1KS9A 3R9XB 4EG3A 4QASA 2ZWPA 4YWHA 1UK8A 1X0XA 3REQB 1THTA 5B6IA 1P60A 4UDOA 4MV4A 3GU3A 4B7ZA 2ACWA 1EGAA 2ZWVA 3HCPA 4MA0A 3DEYX 4PLYA 4U63A 3V32A 4CM5A 3HDVA 3UK0A 1GGMA 2I4TA 4IVNA 2VSYA 1KO1A 2NGRA 4RHEA 1NVTA 2WFZA 5REQB 5KUTA 1LB1B 3IA7A 3IRVA 2DETA 1NW8A 1XR3A 2YW9A 3U62A 1Z0SA 2NQ2C 3HXTA 4RFSB 3SDZA 4TMTA 3SQLA 7ADHA 1BHSA 3A6PC 1EJ2A 5FA5A 5MN4A 2CJYA 3D2BA 4AAYA 4YUXA 4TX1A 4ECAA 3ELBA 1NVWQ 4DWJA 1I7NA 4NBLA 2QUJA 4LDQA 4RSRA 5DHFA 2AUTA 1YZLA 3IGFA 3ND6A 4TLLB 4N39A 4KQEA 2H3HA 4O2BA 5FI0B 3HY6A 4XYLA 3LUBA 2CT8A 2QJRA 5FX2A 1Q1EA 3V8QA 1VRWA 2QROA 1WO8A 2OGTA 5K3FB 1WHTB 1N25A 1S1MA 3QJ5A 3RVJA 4CHGA 4Q21A 3T3GA 4BFTA 5DJ5A 2CHFA 2DERA 1WMDA 3U0BA 1ZA1A 4G5YA 3EW7A 1FFDA 2XGOA 3MA0A 5TLSA 4D0RA 1EWKA 3MJTA 3NDRA 1KEEB 1NY6A 2IZ6A 4LBVA 4V0RA 1EP9A 1NKTA 4HB0A 2BRUA 2GTHA 1DT5A 2HV9A 1JT9A 2X77A 4QEZA 4WNCA 4CQLB 4DCTA 4DIEA 5JAZA 3CKMA 1Z5PA 1FXSA 3TVDA 5GJWC 5BSVA 4FNGA 4WQMA 1A5TA 2JPDA 4ZAXA 2O7QA 2GAOA 3AC0A 4F12A 1FDWA 2CMHA 4Q02A 2D1RA 3D0OA 2ZRKA 2ORYA 2R8PA 1SRRA 1Z4IA 3RKSA 2HD4A 4RDIA 4H7JA 1GL9B 3JXEA 2X0IA 4RHXA 1BH2A 1GTJ1 3JYHA 1RBZA 2ONYA 5FI1B 2WWIA 4LXTA 3TLBA 3GWGA 2OZPA 3IVMA 4EZIA 2D4AA 1POWA 2ZB8A 3SBEA 3W8DA 5F23A 5D85A 3WADA 4C05A 3BGSA 3X1YA 4R2IA 3HU2A 4AG5A 3AKYA 1KC3A 3STWA 5IULC 4AP9A 1H85A 4C87A 2Q5FA 2IU0A 2FW1A 5BQOA 5IDXA 3WAGA 2VIIA 3DAOA 3KQUA 1IBMB 4K0KB 3CV3A 4G4SO 4PGGA 3TD9A 4ZFNA 5BV7A 1M73E 4B43A 1Y7TA 3R2JA 4TXJA 5CPBA 1SB8A 1ST3A 2D7JA 1D0IA 2BH9A 4P82A 3CLRC 4ROSA 2GBFA 2IT1A 3NWJA 4KOEC 4C9BA 1KF0A 4EVQA 5CIYA 3SQWA 2XUOA 1EZ1A 4Q4JA 3OWXA 3E7PA 3CPSA 4D46A 1KDVA 4S1PA 1NI3A 1TF5A 4KHZA 5DNEA 3ZHQA 3TCKA 3O4RA 4ER0A 2NO0A 1OFHA 2YMMA 2IV7A 2OV6A 1GZ5A 4BJ3A 5BN4B 3TDNA 4AS3A 5HS4A 3FPKA 1K7EB 3WRYC 2Q8QA 1DXYA 1Y9DA 1WZNA 5K0JA 4J29A 3E35A 3GNTA 2QM8A 4LJLA 1YZNA 5GWXA 4MGIR 1ZVVA 4CCWA 4Z7NB 3ZUGA 1Y1RA 3LRTA 4KAJA 4MV6A 1GQFA 4OOEA 5GVRA 4PAGA 5BUZA 1T5TA 4I1OA 4QQFA 1MBZA 5LWQA 4WK6A 1KU6A 1UDXA 3MMXA 1KE1A 3SF8A 3UMGA 5ICFA 4PYRA 3EG5A 4NOJA 1JKJB 4RFVA 1XCPA 3VVMA 4OGFA 3B36A 4YJ3B 4BKPA 5BN5A 4KLAA 1NJ6A 3M8KA 5HRAA 4C4YA 3A04A 2WB4A 5KSOA 1I4WA 1W88A 4UEJA 4AQDA 3AFMA 3ANXA 2XDQB 1VKHA 3WB0A 3I0NA 5DGTA 2ADFA 1YJAA 4NI5A 4CLDA 1BKYA 5LYJF 2ZKLA 1KY5A 5A9TA 1H5UA 2FZGA 2Q5EA 1ESZA 3PC7A 4M0PA 1AHNA 2NXCA 3PE6A 5DBIA 3COVA 4PYQA 4XTRA 2JLVA 1X1SA 1C4KA 1Y8ZA 1QQ5A 3DOOA 1KERA 4XM1A 2ZSAA 1M67A 4MAMA 2ATCA 1NVXQ 1BCSA 1JTVA 1RXSA 2HRQA 3GIWA 4JLKA 4URFA 1UMCA 3KHSA 2JJ1D 1NBAA 1BHQ1 2AOTB 3BCUA 4KQWA 3VPCA 3IAS6 1SOWA 2UV8A 3IEPA 4H3KB 2JRCA 4BNUA 2EFEB 2G80A 3L6DA 3NIWA 3HRHA 3ECSA 2GSWA 2HU2A 1T43A 3ZVNA 3WV5A 1RYZA 3E5MA 3OCZA 5JALA 1XRLA 5KJFA 3VISA 2HWKA 2YWHA 2X5XA 3O38A 4Y9SA 2I54A 5K2OA 2HJ9A 1LWNA 3EW9A 4JLNA 5D3MB 3W1WA 1ZICA 1XNHA 1IJEA 1T6XA 1TGYA 5THXA 1ZCAA 4HXYA 3WLKX 3X44A 4CUKA 4EUEA 5AJZA 1CKEA 4S0XA 2A33A 1XMIA 1VRVA 2WHYA 3DL7A 3IVXA 3UTDA 4TSFD 1NU6A 2QNBA 4LMPA 2AZMA 3PNPA 3IP6A 1W6RA 4NLLA 3UAVA 3KSAC 3IMFA 2D5BA 4EIWA 4EITA 4PSVA 1MOSA 1AKTA 5E4YA 1NUUA 1ODCA 2LBPA 4BNKA 4PZLA 2R68A 2AC7A 3CTMA 4HTFB 1ZCJA 3ULKA 3E03A 4HZUB 4A8JC 1BDIA 2PUBA 2PZLA 4HAOA 3NBKA 1E6CA 4EHNA 1VBMA 1XDBA 1QRUA 4PVDA 4D3ZA 4WBNF 1PGPA 2IIQA 3AHHA 2MR5A 4NABA 3VAZA 1I3NA 4TQ9A 1GPLA 1A8QA 1KSFX 2IY9A 3FKQA 1OTHA 4IKPA 2XZLA 2XXBA 4O1IA 4QLAA 5DXAA 3V55A 1GKYA 2VHUA 1XIVA 4HNVA 5JZ9A 1Y1PA 1TJ5A 1GGNA 3KPVA 4PBTA 3KSMA 2PWZA 3KZ1E 4WA7A 4K1LA 3D5EA 3ZLVA 1KMNA 4FEYA 5FL3A 1SPBS 1M83A 5B3AA 1ZI9A 1D0SA 2FPXA 2I65A 3D4NA 4INPA 3F74A 5EJEA 1NI4A 3THWB 4Y7DA 3BQNB 1ZVMA 3KRTA 4HZGA 2Q2OA 2ATIA 3K2IA 1TA9A 5AVJA 3WGGA 1E1QD 5ICEA 3E27A 2G8LA 1XYYA 4LCBA 1ZGBA 2BFBA 4ZYXA 2OCLA 2WAYA 2A1UA 2YVUA 5GPBA 4HVAA 1UM9B 3SS7X 2O2JA 1L5MA 4AY5A 1U7DA 4EEZA 1M2OB 1FNBA 1OI7A 4C89A 4DY6A 3I1FA 3O9VA 4ZRDA 5FWYA 2IH4A 4WCVA 3VGPA 1DAGA 4NMMA 3ANLA 3TS1A 3GPIA 4PCLA 3DM5A 5GONF 4EKIA 5IXSA 1OLXB 3T0GA 1RQLA 4Q47A 4C7KA 4MQ5A 2C1EA 1G291 3LPLA 1POXA 3R8XA 1XZPA 3JYLA 4WOBA 2CD9A 3QYAA 4EB6B 3U3ZA 5DNUA 1NP7A 3UGTA 1L7EA 4KW7A 3HTXA 3VNVA 2XUPA 1ZJ4A 3T0FA 1DKMA 3HXMA 2PMKA 3WLAA 2VBFA 2KB0A 3BXZA 1PR9A 4UBOA 3GLTA 4D6PA 4CEHB 3NAZA 4H08A 1YCFA 4V3BA 1ZI8A 5I4BA 3HUTA 1ZJZA 4FIZA 1UM8A 2VS1A 3D6FA 2Q9AA 4OLJA 4UU7A 3YASA 3UA4A 2QD3A 1UBJS 3KSDO 3NEYA 4R2JA 5I9MA 4A0FA 4QOEA 2DWUA 1K6XA 1MABA 2GKGA 3HJFA 2FP4B 3ZDCA 1AQ6A 3AEQB 1FDIA 2HK6A 2NO6A 3KOUA 3Q7EA 3WB9A 3WL7A 2IGTA 4RDXA 3JQDA 4CTJA 8LDHA 3MINB 4N3CA 1SKAA 3ID6C 4EHFA 4ZA2A 2P4UA 2RAUA 2XTNA 4ZCMA 1QTNA 5CNMA 2BE7A 3IMGA 2OCPA 4FS3A 4FWTA 5EP2A 5F4BA 4PYJA 3PWZA 4U00A 3A2NA 4ZCQA 2IP1A 2ZPAA 1RZRD 1TCBA 2D1SA 3CF4G 4C0XA 5AQ1A 4OYHA 4XIJA 3AM1A 1WNFA 1KJZA 1G42A 4Q01A 5JI2E 2F8SA 2WWHA 3I37X 3F7TA 2Q46A 1XZIA 4TKVB 4UNQA 2OYRA 1YB2A 3S7ZA 3B6JA 3SEAA 3L7CA 4EK9A 4ZYYA 2WYVA 5JYCA 3TF5A 5ALDA 5DWVA 1AQUA 3BSSA 3LE8A 2C54A 2GPAA 2V3WA 2BKEA 2TRSB 4LV6A 2WHRA 3WXBA 4Q1DA 1FTWA 4X1KA 4ASUA 3E22A 4RJIA 4M8IA 2WIKA 4O5OA 3Q40A 1KI3A 3KYIB 5G3ZA 4B8YA 4BU1A 4PX3A 3RVBA 3OE7D 5KNCD 5K20A 5HUJA 1UMDA 4E12A 2C2MA 3FPBA 1UOOA 3R41A 4WXMA 5C34B 4CN8A 1L4UA 2AFIA 2WILA 1SZJG 1EVKA 1U4NA 2PEYA 3RJZA 4P32A 2XE7A 4LGYA 5FBKA 5ENZA 2DHDA 4GMHA 2SHKA 1WRBA 4KPUB 2H9YA 3RS5A 3VAAA 5LQRA 2NP7A 3EAFA 4ARIA 1BEUB 3HCOA 1ECGA 3GDOA 5ECGC 2ZWAA 3ZDEA 1GYRA 3RSGA 4K9SA 4BX8A 4YRIA 5C8VA 1S9HA 3DBHB 1KOGA 1BWQA 4RHYA 4Z9FA 1DAIA 3EXEB 3FDFA 4PTLA 1EXWA 1W36C 4NULA 3A9WA 5EHGA 4WPGA 5AK5A 4AO7A 1OIXA 4PO1A 1OTYA 1Q1NA 2AOVA 2HEGA 4E5UA 3MAGA 1H0RA 2PLFA 4MULA 2J9FA 3A27A 1XZMA 3OZGA 5ENVA 5FKJA 5CCBA 1HX7A 1TLFA 2VJYA 5H0IA 1ZJ6A 1T8PA 4MWOA 1Y5MA 4Y0AA 4Z9AA 4C06A 2EAUA 2FN8A 1MZVA 2H52A 1SOVA 5HUQA 4YB8A 4IICA 4P22A 2QV7A 3PFKA 4FYWA 4H7KA 1XAGA 2HWXA 2PZ8A 1J2YA 3A25A 5CT6A 2YVLA 2DFTA 3CH5A 4G36A 4KKXB 4LDJA 5FCDA 4F3YA 1RE1A 1Q1AA 5JLJA 3DBRA 4D9MA 4XPZA 2JFVA 1HLDA 3ZV7A 4E70A 1FX0B 3CJRA 3ZBQA 3GH3A 4NZNA 2KI5A 1QYRA 2Z08A 1Q0ZA 5EJ6A 3UMCA 4JBHA 1D0VA 5CH3A 2F67A 4UVHA 6LDHA 2I99A 1W1IA 2RB4A 1HQYE 4O02B 2GCEA 4ESOA 1M2EA 1OBCA 2ASEA 3QYPA 4KL8S 4DDWA 4I5DA 4OXNA 3WRYA 2DY1A 5C80A 4II7A 4BRUA 3SZ3A 3DLTA 2MINA 1LBHA 5SYAA 3LG2A 4EHIA 3U5TA 4F11A 2QQ0A 5C7OO 1HEIA 3BF7A 4WLFA 1ND5A 4AUEA 4Y2TA 1U6IA 1R27A 3FBTA 2W6QA 2VPPA 5L4LA 1K8QA 1QS0A 3AOEC 4R84A 5JXHA 1EINA 5L4NA 1KH1A 1ZPDA 2FMKA 3OQHA 4RH1A 3ZBTA 3Q7RA 3ES9A 5JPDA 4ZZ3A 4REQA 4EUHA 1E79A 3QF4B 5BWBA 3QNMA 1U0GA 3ED1A 4EM6A 1HE2A 3ER6A 1M0WA 1JIVA 2IBMA 3AI1A 2EW1A 3PGKA 3MELA 1JU4A 2PZMA 4GE3A 221PA 1P8JA 4YWJA 3GT0A 4O2AA 3S2IA 2CXPA 4JJ7A 3TXAA 4JROA 1L9KA 1RWWA 3OOJA 4XVUA 1C5KA 3DZ8A 3NJ4A 2WYUA 3ZDFA 3ZWKA 4X1IA 3S1SA 3D8NA 3ZXIA 3KQWA 3N2ZB 4F4UA 2AF4C 2XNSA 1L7RA 2VJMA 4EY4A 4Z9BA 2JAWA 1KR2A 3EUEA 5DLEA 3SNHA 1P61B 3GFRA 5B36A 3QFHA 3L9XA 1LI4A 2BKUA 4NZZA 4C6SA 5KQRA 2ANBA 4RZSA 4GLFA 3RSHA 3UCFA 3DOEA 4D4JA 4B48A 4HLNA 3ERCA 4M7WA 2LWIA 2CFRA 5CFRA 2DC1A 4L50A 4MHOA 4PR0A 3JRNA 1IJFA 3UKDA 1G21A 2PANA 5FADA 4IJKA 1GARA 1KEPA 3HRIA 1N3BA 2X76A 3EUWA 3ACDA 3CHYA 3GOHA 3LBYA 4RHTA 5JSYA 4WX2B 3OQMA 2DF8A 3PD1A 4KITB 3LVFO 5BOSB 3AR4A 3FIJA 4Y1RA 2ZJ8A 1R0XA 1AZWA 2Q5CA 4S05A 2QVZX 4BEVA 4UUQA 3ROQA 2JZOA 2CL6X 2RHGB 1S1CA 5JDCA 2LKCA 2XQVA 3LPNA 1SHLA 4NPAA 5F98A 4JC5A 1IB6A 3DTVA 4BP3A 5JCXA 4IVQA 2XLBA 3G2QA 1PX2A 4AJ2A 2H48A 3H42B 3JVEA 3R5HA 2R97A 3E9RA 3BORA 4H7PA 3HACA 3CNNA 5T41A 2MYNA 3QITA 1KARA 4LRYA 4D3YA 3KALA 5TXGA 5IX8A 5DFAA 5EY5B 4XB2A 1WXHA 4QEKA 1Z12A 1LBEA 2D5LA 4J0CA 4W6QA 1RU3A 3DEZA 3VDMA 3ZJ4A 4ZKDA 2G77B 4RCZA 5JEEA 3I5AA 4QUKA 1GCGA 1USKA 3PA8A 5BSUA 4A15A 4K6MA 3DDHA 3HVRA 3TIGA 3ZLJA 2O2EA 5CPFA 2Z2YA 3JRWA 2Q3JA 2ZYHA 3NTUA 3Q8WA 1VHLA 3VPGA 3EVAA 5CAEB 1MAHA 4K6FA 3A4NA 2IXGA 3WE7A 5A5GA 1HKUA 3KVVA 1RRVA 3DDWA 2D74A 2PZAA 3K30A 4EJFA 2BUBA 3Q1LA 3LCVB 2Y66A 3BGVA 4XFKA 3JY6A 3ONEA 4CU5A 4J4BA 4M9RA 4AKIA 2A67A 2QVYX 3TTXA 3IOCA 4YUAA 2ZU6A 2VUTA 3AO0B 1XF9A 2E18A 2X58A 1PJ4A 3AV3A 1S3GA 2V7UA 1JB1A 5HWSA 1K6JA 3PUIA 3A11A 1EEHA 4Q9NA 3WOHA 3O3CA 3LUFA 3GBSA 1MC8A 5IXYA 3U4QA 5K7SA 3V3KA 4LJ4A 4E07A 2ZGVA 3RTBA 1QGYA 2Q4DA 4OHPA 1RC0A 1ZUIA 1W52X 4WKNA 2R85A 2YXNA 4NXNB 2HIMA 4UMDA 1ULHA 4IMIB 4Y7CA 1WULS 1WBBA 3DAYA 3OM8A 2KYRA 5EWLA 2HKIA 2GMWA 2YWCA 3C1TA 1EVEA 2J6HA 3DMTA 4NMHA 3BT7A 4N5MA 1FMCA 3PKIA 1VI5A 3GFPA 4PLFA 4EG0A 5ALZA 1RBYA 5FTJA 3AJRA 4CW7A 1E2PA 5HG0A 3P4UA 4DC9A 4YJFB 3W7BA 1ZC4A 1P7PA 4CMEA 3E0XA 1ZWKA 4LSWA 2X5KO 4RD2A 4II3A 2Y1LA 5CW1A 3C8ZA 4IH4A 3QUTA 3DNMA 3W8RA 5HQ3A 5EXEA 2O50A 2JFWA 3R6LA 2VP4A 4MVWA 3K0SA 2VQEB 1M1YA 5LDHA 3OLQA 1M9NA 2O8VA 1CUDA 2OHJA 3PRYA 3RC7A 4CF7A 2PH5A 2QYTA 4WASA 5K4HA 1NJ2A 4J8PA 1HR0B 1N2IA 3L0BA 2VAMA 4ZOLF 4RPIA 4MICA 2ZM5A 3BDVA 3JYPA 3CM0A 1J1IA 2YW2A 4XCQA 3URMA 3THYA 1C3XA 3T52A 4Z1OA 4M22A 1UDAA 4L07A 5AUQA 4P54A 2QTHA 3WZ2A 1WPRA 2XUIA 1UBHS 2AX4A 3CEMA 2PO5A 2XWQA 3G79A 3W2TA 4WAUA 3WKAA 2UU9B 3NBAA 2X0JA 1VE7A 3EISA 1E99A 1T8YA 4RACA 3WWDA 3K9FC 4YMHA 2EZ4A 2VTDA 3NVMB 5EQFA 4BECA 1Z4KA 3P1JA 2I9KA 3P0RA 1G2IA 1CZNA 3I9V6 3T5AA 3B6EA 3GIDA 1WXFA 2ZT6A 4QM7A 2VNAA 1RXUA 1A9RA 4TYQA 1U65A 3CRZA 5EVJA 4ZVUA 1OZGA 5ILQA 2I34A 3RRFA 1T3GA 3F8WA 1USWA 2A1IA 2FJPA 5G0TA 1E9FA 1TI7A 1LEHA 3B1VA 3KVNA 4M21A 3KL2A 1E2NA 1HK7A 4OGKA 1FP7A 4AKEA 4X3PA 1XMPA 3L5KA 2CMGA 2VC2B 3BXEA 1M8PA 1EX1A 4ZIRA 1B43A 1JSLA 2BF7A 3OCXA 1LJLA 3P0FA 1LLCA 4MEJA 4L74A 4UU0A 4I5GA 1DX9A 4FBGA 2HJVA 4POOA 4KDRA 4U2FA 4DJDC 4FU0A 2XZOA 1BCRB 3SX0A 2I8CA 2EJVA 2CHGA 1JSRA 4IJ5A 2HA3A 1Q0QA 5K6RA 2CL5A 3TIXB 1XNRB 5B12A 4AKTA 1E6WA 1U0HC 2YIVX 1C8KA 3G88A 4TS1A 3BIWA 5SV2A 4PZPA 3DPSA 4D4KA 2J9XB 4G23A 4UCQA 3K31A 1J8VA 2AA3A 4KB5A 1RT9A 1JYFA 3P9XA 2DFNA 5EE9A 5DTEA 4D9KA 4UM9B 5LLDA 1YTLA 1FY2A 1PL8A 1XGKA 2ET6A 5TS2A 4AW9A 1Z29A 3NOXA 1BW9A 1GY8A 4R83A 4JA2A 3DOUA 1EG7A 2AN1A 3VJMA 1T4DA 1LF0A 2J0SA 2PRJA 3LA8A 2WJ4A 3MAJA 2DHQA 4EQ6A 4J75A 1V6AA 2ZRNA 3C3DA 2YN2A 2FZLA 4WOPA 2FI1A 1L8QA 1V71A 1XCLA 2HO5A 2BZ1A 1R0KA 2V7EA 1TEZA 4G2TA 4DTCA 2H0QA 2JLZA 5JFOA 4MI3A 2BBSA 1GL7A 2RSLA 4L27A 4YV7A 1P6QA 1NDHA 4XIIA 3KBBA 3DO8A 1H2HA 1Z62A 2Z30A 4B2YA 4B84A 5BXYA 1L7BA 3M9LA 1UQUA 2XX3A 3NI2A 3TFWA 1QF6A 4I4TA 2KPOA 2W11A 3IFSA 1N0UA 1TE2A 3LFTA 3LNTA 2JCSA 5TQ0B 1U0FA 2OP0A 3F2VA 5JSUA 5CJPA 1K4MA 4PSUA 1IB0A 4I8XA 3ZZTA 3DMPA 4UVIA 5C3UA 3Q7PA 3CZQA 4D8WA 2EZUA 3K8ZA 5BP7A 1PYOA 2FAXA 4DUZB 3DL2A 5HQTA 3FPHA 2XKKA 2DR2A 2QORA 5A2QA 1HH4A 3AFHA 4GHWA 1GO2A 1MRSA 1Y1QA 1OCEA 4AJJA 2J9GA 3O3MB 2NU8A 4Q03A 4K3VA 4UCXA 1Z06A 4OYRA 3LVBA 1EB9A 3O1IC 5TMEA 3T9BA 3WLHA 2HF9A 2AR0A 2WABA 2IHTA 2P4HX 4K26A 3RIHA 3TNJA 1Z6TA 3OQIB 2Y0CA 4ZCSA 4DANA 3AR9A 1T3ZA 1VPTA 3SCZA 3FIUA 3O1HB 4X92A 2GZ2A 1HQKA 1TUBA 3KFLA 2NQTA 3HGTA 4B7AA 3LQFA 3RAEC 3O92A 2AMJA 1QE0A 4IMRA 4JDPA 4W99A 3S70A 4AF6A 4BQNA 3LP6A 5K0SA 3HR4A 2C5AA 3NVAA 5CLIA 4B6FA 4GEGA 2F48A 2ZTHA 3H1PA 4BS9A 3O90A 2RGRA 4PSKA 2GCNA 5A06A 2PSEA 2GPBA 5L45A 2QP4A 3JQ8A 1GZ7A 1QHHB 4H0FA 3E9YA 3F4LA 2J7PA 4J4TA 3PEYA 1L5HB 2QYHA 1PN3A 3W7AA 2RONA 3D4LA 3WL5A 1LFDB 1R8JA 4NZPA 5CX1A 4OHUA 4DG5A 1H2AS 1LA2A 1VLJA 4PIMA 3D59A 3K8QA 3GJ8A 3OZSA 4I50F 4UUBA 2JBWA 2PD4A 2H63A 1D4OA 2ZRJA 1K6IA 3EZYA 4UM8B 1U1EA 1LI7A 2CLOB 2D8MA 3CO5A 1DWPA 4FFWA 2P9JA 3GQBB 4FLEA 3TUJC 5C8YA 3GXOA 3WDMA 5DU2A 5CB6A 1GV1A 1VSUA 3MTIA 2RMKA 2OZEA 2W6IA 1XD8A 1Y37A 3AR5A 3OJXA 4IFBA 3B2EA 4QBHA 2H1OA 1P0IA 1TF2A 4CLHA 1QBKC 2HL6A 1VLMA 2F43A 4D3XA 3UV7A 4QVKA 2WWXA 5AHXA 3QU2A 4PPFA 3R3ZA 1B8UA 4P2GA 5IFLA 1XAIA 4L15A 9GPBA 3U3MA 2ZYAA 1P4JA 4AFNA 3NANA 3EDMA 4MR7B 3WXMA 1ZXXA 4FLMA 4FONA 5J43A 1KQFA 3FCCA 3WA6A 3JWJA 3SFTA 1KEWA 2CXXA 1PFYA 2G0AA 3L1JA 1K88A 5F7JA 3W2EA 2Q6TA 4AUKA 1R16A 3ZE1B 2NSHA 3OD5A 2C97A 3CLHA 3ELWA 5E4FA 3ETEA 4B3JA 1SHJA 1RLMA 2OORC 3LW7A 3O4FA 4TKUA 1C1HA 2JBHA 2OO7A 3A4TA 4I36A 3N0TA 4XD2A 1MB9A 4XE5A 2HU5A 3C7AA 3L04A 1E5VA 1NA5A 1M2FA 3GOQA 4YR7A 3FYHA 3LI2A 4JBYA 3MJFA 2IDMA 4R1LA 3RYFA 4HX5A 5HXAA 3NATA 1F8YA 2BW0A 1ONPA 2YJ3A 4FIDA 4ZCPA 2IP4A 3LKVA 4G5SA 4Q3KA 5HA5A 1L5RA 3RKUA 5D3ZA 2XB2A 3OFKA 1FQWA 4LF7B 2GXAA 2QZ9A 4A6DA 1P0PA 3UJNA 4XOUA 4ZOCA 3TGPA 2ERYA 3P0EA 4MWSA 3AEKA 5LA6B 2X4IA 4LW8A 3B2NA 2YQ5A 4AROA 5HZKA 1JWBB 4I2VA 4PZ9A 1A97A 4RNDB 3MHTA 3WLQA 1GTL1 3FYCA 2VA9A 3LUPA 4YH1A 1W0CA 3OQVA 2AFIE 4TWBA 1ELOA 3PQ3A 4IF6A 2C0CA 1N5DA 4KHPB 1UJ4A 3TTYA 1YI8A 2V5UA 5ALIA 2W2LA 3LQRA 4W9MC 3CCFA 1YT5A 1SUSA 3NYIA 2O23A 3BK2A 1GRVA 1NQAO 3JAWB 4K1XA 1FMFA 1NVDA 4IRMA 2IOYA 5FEMA 4XB6B 1Q83A 2R1VA 3FYDA 3NG1A 4FLFA 4B3TB 2IPXA 4H7HA 3SM9A 4P6VF 2YQ4A 3SSAA 1D9XA 4NU5A 5EXDA 1YGPA 3G1WA 4FMPA 3O8OA 1NP6A 3FLMA 5CDFA 1NUHA 1K2VN 1RCUA 1SPXA 3A36A 3QEMB 1E7YA 4LZLA 4MUXA 4WINA 4BVJA 4ARVA 2I76A 3PNSA 2XD9A 5COAA 3SK0A 2H3EA 4DMUB 4NDAA 3F49S 2O2CA 3H3FA 2NT4A 2W6OA 5T8KC 3SX4A 5JZVA 1A9XA 3M6WA 5GMOA 5GADl 4YPFA 3WWZA 3CUUA 2Q9UA 1AV6A 2PJZA 1ACLA 1GL3A 4OA5A 4MIOA 3NIFB 3H4TA 4QPNA 2PUJA 1CJSA 1U8EA 1UBFA 2I55A 3NHPA 4MWCA 4G4JA 4B6EA 2O8EB 5BSFA 4KAFA 1MDFA 1U5AA 1GA6A 2G3YA 2J4DA 1RHKA 2OD9A 1P6XA 3O31A 1GPUA 1JE0A 3TIFA 3WTBA 3RUFA 3IS3A 1WJGA 2HJGA 4J6FA 4BKQA 3OQBA 1RKXA 1VXOA 2GUWA 4RM2A 5AJXA 5DP1A 1RWNA 1ORDA 1VHQA 4MWBA 5K05A 4UTRA 4QNNA 4N47A 2ISQA 5JOQA 1FVXA 2HRBA 1SG0A 1UBMS 4Q3LA 1DCKA 4E5DA 3KBOA 2VXCA 4QYTA 4LY0A 5A4AA 1NNLA 1KZ7B 3WJ7A 1KK0A 3C74A 3HC7A 3M7IA 1DRKA 1ID1A 1US8A 1D2GA 1AZSC 2CLDX 2DBYA 2PKYX 1D2EA 5CH5A 4HUQA 2G8NA 3ENWA 3K8YA 3GX1A 2FPGB 3LPMA 2OFFA 4MO9A 1LXCA 4LCEA 2AS0A 4MIEA 4LF5B 2FWIA 3GZTB 1P17A 2V55B 4CNQA 3VPAA 3LXXA 3M6MD 4FE4A 3QFTA 2Q3DA 1LVUA 2JDIA 1LC3A 3HL0A 4BZZA 1V8BA 4YJDA 3RWMB 2F9LA 8GPBA 5HVNA 1KSJA 1IM8A 1BG6A 5L4SA 2J5KA 3JVVA 1W2GA 4HFJA 1LFAA 1IUPA 3LUCA 3WYDA 4KTTE 3ND8A 4EL5A 2X9VA 2JJ8A 3EF3A 3EGCA 4ZV7A 2VDJA 4AJEA 1CV2A 2OFXA 2YXPX 4IUDS 4Q7JB 1AQIA 1GPJA 1MH9A 3BFVA 5JFGA 4GSYA 4HLDA 3K2QA 1ICIA 1B8VA 4M0CA 3PR1A 1R6VA 1Z34A 1ZRHA 2VJLA 2ZBGA 3U5ZB 1DCMA 4NX2A 4PG6A 5FI5A 2PMEA 2B1RA 3TNYA 1A2QA 5JAUA 3WNZA 1RHMA 2PXXA 1P81A 4TXMA 3RS9A 3T1YB 5T4BA 3VPFA 5LOVB 4KTVE 2VPYA 3H2JA 4RHCA 5EC8A 1DV1A 1M8FA 2OCDA 4KXVA 4GM0A 1EI9A 1YMUA 2BI4A 3ACCA 4JMPA 4PYMA 1JEYA 2I3BA 2H4WA 1ZGHA 4KU4A 4Q1BA 2UYGA 2ENWA 3UFBA 4DVJA 1U0TA 2P6UA 1P0CA 1X87A 1GNLA 2VBGA 2CNKA 1G21E 1YBHA 4WZ6A 1YSCA 2P5SA 2INGX 2QKYA 2E6KA 3ZGOA 1CK4A 5ALTA 4RZQA 4HHEA 2DUWA 4ER3A 1KIFA 5ICCA 3FNIA 1UBLS 2ODEA 4ZHQF 3OU2A 5J2TF 4H9GA 4F92B 3CY6A 5SYNA 3Q3HA 4KR9A 2DXIA 4JLDA 3PUJA 4PIPA 2PXCA 4P4UA 1BJKA 3CKYA 3PUKA 3Q5DA 1RE0A 2HQRA 2PN1A 4XDZA 5BW4A 3ICEA 3W3AA 1XVTA 2UYOA 3O94A 1M6EX 2NTNA 1FS4A 3MT9A 1YTUA 2BEWB 1E69A 1QJCA 1SZPA 2GQ0A 1J07A 2DJIA 3RD5A 2IPOA 1XXHA 5CT5A 2AT1A 1A50B 3UB4A 4E13A 1EAMA 1HOTA 3I2IA 3A6ZA 3KYCB 1APBA 3GUZA 4GUDA 1XN1A 2C2YA 5G4KB 1L5ZA 1QGDA 2Z4TA 4QPJC 3BIOA 5KYVA 3SDBA 3KPJA 3UT5A 1TUIA 2V0NA 3AHGA 1COWD 2MSDB 1G3UA 1LSJA 2XVYA 3EF1A 4IGEA 1J25A 1PEAA 2P2DA 3IIKA 3QRWA 5KOHA 5HW0A 3EPKA 5CMLA 2O9JA 3OF2A 3OM9A 4LGCA 3AETB 1PZGA 5I8WA 3AY6A 1JPJA 2YMPA 4QX6A 2CDCA 2I67A 4IDHA 1JWAB 1XHFA 2RJ3A 3I1IA 4TYMA 3BHMA 2WD8A 1V4VA 2FZ5A 4ML3A 3G9UA 4Y2GA 3QFSA 1UZAA 2OO5C 3KAKA 3OA0A 3B53X 1L4KA 2IOQA 3OUUA 4GM4A 4BN0A 2ONZA 1FJ2A 2VJCA 3BXFA 2W00A 2WA2A 2C98A 3COSA 5KVQA 3R7LA 3FOCA 3CLTC 3RHTA 1VLVA 2WPDD 3GRVA 1M2GA 1NPYA 1AUVA 4NESA 3UJBA 1YI0A 3S1AB 1R6BX 4F56A 1U02A 3CF0A 4LXIA 4N3GA 5C53B 5JQGB 3A2MA 1OMOA 3HN7A 2P78A 3ZEIA 1YJCA 3WO0A 5JS8A 2A94A 4LECA 4RMGA 2GPJA 5CVEA 4M46A 1WZCA 4LN1A 4J3NA 3QOWA 4Y2UA 3RT7A 2CXQA 1WWKA 2H6EA 3QI2A 3CUEF 1GD1O 5ETJA 3DEAA 2XCTB 1JDSA 1FFCA 4M1QA 5E9AA 3OTGA 1CB0A 2QN6A 1W85A 3IOBA 3PC6A 1T9HA 3PL5A 4GLBA 4DIKA 1N7IA 4Z0TA 2WD7A 2B83A 2PKXA 4GMGA 5FFNA 3EGWA 4OLFA 5F2NA 4MVXA 4JZKA 2RK6A 2EYUA 3SVZA 1HZZC 4EYSA 3HCWA 4A23A 1PEDA 2QM3A 3C1AA 1VSVA 5CA1F 4QJ3A 3CEHA 1NRIA 1NV9A 3E1SA 1A9YA 2IYQA 2ZS7A 3P20A 2PKRA 4KV7A 4QUIA 3X1XA 4AWXA 1MO4A 5J4KA 4OM7A 4ZEXA 2YKGA 2EX4A 1M1YE 3PC4A 2WTBA 1NOIA 1TO2E 2CNLA 3WSVA 4BTVA 1JEAA 4KZPA 4D6YA 5BY2A 2Q6IA 4GBED 2QGNA 3D3NA 3I01M 4TS9A 3SS9X 4AJ1A 5BNIA 1NUPA 4Q9KA 3I42A 1YFLA 4MA4A 1CU1A 4PFSA 4YNBA 4M54A 1ZN8A 2BMFA 4A2PA 2ID7A 3KDSE 2YVAA 1HI9A 5BSRA 5K8UA 2G4CA 1ZNYA 3CX3A 4Q15A 2PTGA 3L4EA 1N5OX 2I3DA 3LUJA 4QJBA 3S1LA 2XH8A 3HXLA 1XTRA 2VNKA 3VRHA 2J0UA 4GZMA 2QLFA 4FMDB 1HYQA 3D81A 4BWVA 3CVXA 1HSOA 3KOOA 3RVDA 3WA7A 4Y9RA 1ODIA 3OG9A 1LQ2A 1KYYA 2W6PA 2Z5FA 3DKIA 4MR8A 2PMFA 5ANRB 3TL6A 3ANYB 3GARA 1S6YA 3RSLA 3UJ7A 5LNK6 3ZCPA 2EQBA 1PUIA 2PQ2A 4IH1A 4OYYA 5GJCA 1T1IA 2R00A 2IF0A 4X97A 3GMTA 3SG0A 4S04A 1YQTA 2QYSA 5HTOA 1GLNA 1LDGA 2FZKA 4COKA 3R7WB 5LR6A 1M72A 3L8DA 4A8HA 3ESYA 1W1WA 3N7AA 2J9RA 2PL5A 2PUWA 3PPYA 1KA9H 3CT6A 1YZVA 1SKBA 4IZOA 2ZRIA 4JXXA 2V59A 5EQTA 1KXJA 1T9KA 2YV4A 3PENA 4KUHA 2R7MA 3EIFA 3DLHA 3H17A 2VP6A 1V1MA 1BD4A 2JZNA 4F84A 4GNRA 5CRIA 2Q6VA 1NBMD 1SU7A 3IT2A 1QC5B 2BHSA 1OH8A 4NJMB 4DZRA 1ZN7A 4F6CA 3AYZB 3KYJB 2V7BA 2QMUA 1CR6A 2ST1A 3E9DA 4B2LA 1KKMA 1SXJC 2HDNB 4KC0A 3AW8A 1U2DC 2EJBA 1AA9A 2W2QA 5HQJA 1WDLA 2YHBA 1Q0LA 2QN2A 3H4IA 3B78A 4L85A 1N8TA 3DV0A 5ALXA 5BMVA 4JP1A 1G19A 3QSGA 4FGJA 4WN3A 3JALB 2RFLA 1QFMA 2VSNA 4MXDA 1Z8NA 5D84A 5AVRA 1BE8A 4ZWNA 2HAEA 5B7QA 3MD0A 4YJGB 3SXJA 1Z7BA 2PBLA 3DHYA 1KZ1A 2GSDA 2FA9A 3HBAA 5E38A 3ME5A 3PTZA 1N92A 2B0JA 5B55A 2O1EA 3H4MA 1D7AA 4JI7B 4EYKA 2I1LA 4RV4A 5AJHA 5DASA 1M2VA 1B15A 1U81A 1C9DB 3GDGA 1X7GA 3W77A 1NIPA 5IM4A 3IALA 5BQXA 2M1XA 2Y2UA 4OFBA 4C1BA 2GZHA 3V4RA 1TX4B 2F3TA 3B7GA 1IM5A 2J3KA 1LW7A 3B1ZA 3IVGA 4RH0A 3RF6A 4YRDA 5A6VA 2WT8A 2P11A 2P3LA 4RPLA 4BCCA 1N3IA 3ISTA 2J3HA 3TK1A 2ZYGA 1DLIA 3HKBB 2O05A 3IMCA 1EZZA 1GXSA 2W6JA 2GPYA 3DBLA 3DQQA 2FEAA 1C2TA 4G01B 4GZ5A 4X8OA 4RCVA 3W5JA 2V96A 4FGZA 5FBVB 3H1FA 3FH0A 2H54A 7MHTA 3DUFA 1WUTA 1BU8A 4DCVA 3JS5A 4LTNA 4D1YA 5EFZA 2H9IA 2N3ZA 1UKYA 4YJ2B 1V1RB 4RTNA 1JYSA 2DGDA 5LQCA 4EGAA 5HCNA 2IQ5A 1YIOA 1Q7GA 3A6KA 4O2BB 5KKNB 5L6MB 2W22A 2XUQA 4R1NA 1NUQA 4U7JA 5E1DA 5A1TA 3EIUA 4LHXA 2YYAA 3NGXA 1ZY2A 5K45A 4EPRA 2C2WA 3RABA 2IYUA 4QQ8A 2XMRA 1YK0A 4G5XA 5ALUA 4N12A 1OI4A 2FN7A 4ZV9A 3AFGA 3QXHA 1OLSB 5A1JA 3V3TA 4R5MA 1EPUA 1JPVA 2WKPA 3AMVA 5ALLA 3FPLA 3VA7A 4MMYB 5I9BA 4EI9A 1B3RA 5TV2A 2P2SA 2BD0A 3FNFA 4M0KA 4FZVA 1KDTA 1Y3DE 3BTVA 1C7FA 2G40A 4G3XA 4W9NA 5J58A 2FSHA 2FUG6 3U44A 2BVNA 3R9KA 3M81A 4HDNB 3PXEA 4KYIB 4RJ2A 1T8SA 4OJNA 4IHAA 1NSYA 1CZRA 1WW8A 2DKNA 4MDFA 4MQEB 1UJBA 1PZEA 3GJ5A 5EIEA 4G0OA 5I4IA 3FHTA 5IAGA 4B34A 5K9ZA 6ABPA 2KBEA 3PNOA 4JMLA 1FQJA 4Z4FA 3FPCA 4MVJI 1DG9A 2GNPA 4MW4A 1C29B 1Z5UA 3ICWA 3CTPA 4RWZA 3WWEA 1CUFA 2B92A 3E3LA 5K0ZA 3WL4A 4EB0A 3JASA 4FFOA 1VJ5A 3RRNA 3WICA 1XHEA 1L7OA 2ZIWB 3UB3A 3FM9A 3LWNA 2AG0A 2WSSA 4GQIA 4Y67A 1RS0A 4R01A 2ZE7A 3U3OA 2XRZA 2O8CA 2WT9A 4GSLA 4KIWA 1P0QA 1XYGA 4B31A 1C9YA 2QN7A 4G8DA 3UJCA 1QH1A 4X85A 2LPMA 2KLBA 3I6IA 3OZEA 4MQLA 1JG6A 4NAHA 1QKJA 4YI5A 2OV1A 4LGVA 5AO9A 5CYFA 1QRAA 4I1YA 3AEUB 5GY7A 4NNOA 2LCQA 1AZTA 2CHQA 2KSQA 3AY3A 4Q4JB 1E20A 4BKUA 1XTIA 4KE6A 4W1QA 4WRRA 3A0UA 2P91A 4UM9D 3P4XA 2CSUA 1GYQA 2RHHA 3CLUD 4JP2A 4CL0A 1O96A 1N2XA 3CNOA 3TQIA 4EG5A 2P90A 2X4DA 3DUWA 4RFLA 3HPQA 4TRMA 2AOUA 5AI0A 4FDTA 3A1WA 5TQJA 4FS8A 3BIXA 1F06A 2JGNA 3JQFA 3L7DA 2ZKIA 4LC1A 3QPWA 3FMPB 4MVJG 4TV8A 4AN0A 1JHOA 3UK7A 1W1UA 1ZEMA 4L0DA 2GLUA 2FEWB 4TXLA 2NTVA 4XIYA 5CG2A 5KYXB 4PXSA 3RTEA 1ANKA 5ALJA 2IYEA 3DDCA 3H1AA 2NVUB 3VH3A 1A9SA 1G64A 1JNXX 3GRKA 4OU5A 1O6BA 1JR3A 3SF8B 4CFYA 4UPVA 1KTVA 4YLGA 1DEKA 1TW3A 4MWDA 1FP6A 2RHMA 3UO8B 3P9QA 4B71A 3DMFA 1G1MA 1RJ9B 1Q7CA 4NOLA 5EPOA 1XJCA 2JAQA 5F51A 4PN3A 1T3TA 3RK1A 1EWTA 5IHXA 1PZFA 1DS6A 1MIOA 2C57A 2ZI5A 3NXKA 4IHKA 2X3YA 3RGWS 1KQOA 5B7PA 3T34A 1ZONA 2WTEA 3GO4A 4Q7EA 3HXPA 2LUOA 3QENA 3AHDA 4QEDA 1YQXA 3HSSA 3N74A 4QATA 5FJIA 1P18A 3RIMA 4ER6A 2OENG 4YRFA 2ZBQA 1LY1A 2Y6VA 3DAGA 3MOSA 3FR7A 1QO7A 2ZBRA 3KT8A 3NKVA 4RLHA 3ZY4A 4HV4A 4BGDA 4CQMA 3R7BA 3ESRA 1JALA 5KNBH 3T3IA 3T3HA 4QYXA 2X1MA 4L08A 5JAIA 3SS8A 1K0FA 1C30B 1OIWA 4CLOA 1M8GA 1BCSB 4BC0A 3IPRA 4XM2A 5EMHA 3UJDA 5H1YA 1X7WB 4YACA 4PZCA 1KE2A 2XADA 3UH0A 1FMJA 3KOMA 2G9NA 3B13B 3QVUA 5CDFE 4A10A 4IGIA 2QQ5A 4AY3A 1EK5A 2AWNA 3MCVA 1ST2A 1YZTA 3N8NA 3T7EA 1JI0A 1MO5A 3L07A 2B7CA 3O0TA 1JP7A 4FWIB 4QVGA 2ERXA 1LSUA 4MRPA 4GR9A 4PICA 2JKZA 2AOWA 2W2TA 3T4EA 1PNRA 1QH9A 1PYGA 3PRHA 1R74A 2HMAA 1QHSA 3KTAB 4GQAA 4D92A 1Y3CE 2QAGA 3E3NA 2RBKA 2GTIA 3DO6A 4UDNA 1Y33E 2QLMA 1JQDA 3V34A 3DWGA 1D09A 3LY8A 4UW9A 1F2UA 1SIBE 1YBVA 2F7SA 1AN9A 1U0EA 2J46A 3SEZA 2BKAA 3IV6A 3L4SO 3IAHA 4NY1A 5KYWA 5FAXA 3IHWA 3PICA 2K2WA 4ZAWA 3SX2A 2NWQA 3VJLA 4L0QA 1VCOA 3TTUA 2O8DA 5C4MA 1M0SA 3S81A 4KN9S 5AHOA 1Q74A 1ORRA 2Y0PA 1II0A 1XRRA 4YAGA 1K7CA 3D4BA 2OWDA 2HJWA 2VL7A 3EMBA 3EQZA 1NW5A 1UBGA 2OL4A 4ZAYA 4E5SA 2WUFA 4UQPA 1TW2A 4OX9B 5FWXA 4FEEA 4HGYA 3E4DA 1ZIDA 2YWXA 4Z99A 1W34A 2G17A 2LV8A 2ZP1A 1WV1A 3H2HA 4WV3A 5KI6A 4LXYA 4C88A 3K1YA 1I8TA 5EJMA 4WUVA 3LYHA 4P7FA 4YGYA 1LRJA 1LH0A 3BTOA 3PFBA 2P9TA 2ACVA 1I7PA 1NXQA 4QICA 5TF4A 1XDSA 5BNFA 4FX5A 3ZYCA 4FSDA 5IEJA 3DZIA 4K9MA 1CHDA 4QPPA 1XKLA 3K70B 5K2MA 3UGJA 1I6KA 3NRJA 1E3IA 4Z1MD 1TAHA 4R9RA 2PT9A 5K0LA 1YK1A 4WKCA 2B9EA 4IIJA 3RYHA 3FWZA 5CG1A 2RGGA 2D06A 4ODIA 5CH8A 4XA8A 3NUGA 2Z43A 4K7JA 2EL7A 2RBEA 4OIFA 2FZVA 3U80A 1Z8DA 5CDYA 2AVDA 2GCOA 3IIJA 1VG8A 4HB4A 3S2YA 3KD3A 4ALLA 1FYDA 1HDOA 1TVKB 5KWIA 2O3UA 4LJ5A 3M83A 1EHYA 2R84A 1KZHA 1ZP6A 4M1EA 1TMGE 4DWVA 1E2IA 1GUYA 1JU3A 2DBZA 2FZEA 4UUPA 4ER7A 2C7PA 3HCDA 1YHNA 5HPYB 2IHJA 3F7MA 4PFJA 3D3KA 5ALFA 5ECYA 4ZVPA 4RV9A 2EWWA 4YLYA 3M3HA 3KEGA 5EHXA 1LTQA 4EJ0A 2BFWA 5ECWA 1PV1A 3FYTA 3KFVA 4WXYB 3IQZA 1MQSA 1WV0A 4M49A 2WMNB 4GMXA 2RHLA 2P9QA 1IUKA 3WFIA 3WIVA 1Q15A 4XGKA 4ZAFA 2PUGA 1WPQA 3DEJA 5CEFA 4Y6LA 3B60A 3NB0A 2VHCA 1UBCA 1TJNA 1ZW1A 3I6YA 4GYJA 5DLDA 2I91A 1L7PA 3B89A 2I6FA 1U5BB 4O4JA 3UKJA 3ABZA 4BZQA 2AD1A 4ZDIA 1XFDA 3TRHA 2RIRA 5I4CA 1XXHE 1Y1TA 4PZDA 2TMDA 5BQ5A 2H5JA 2Q5JA 3KQOA 3QG1A 3TN7A 1NMYA 1HG0A 1SELA 4PPQA 5A6SB 4ARBA 3A6DA 1X80B 3KQTA 3TLCA 5F5NA 5AOCA 1V6SA 4KXQA 3BA6A 5AVSA 3OX2A 4DV5B 3B9BA 4G8BA 1HT0A 1EWVA 3P94A 1ZH4A 5U4XA 5IK2A 2C2XA 5KREA 2JD1A 4K2AA 3NIBA 2P0YA 1B4DA 1RVDA 1S01A 3CLSC 4ZJZA 2VDWA 2WJAA