1IZ8A

Re-refinement of the structure of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
b'LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE, LINB
molecule tags Hydrolase
source organism Sphingomonas paucimobilis
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
total genus 116
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iz8A00
3FCYA 2WJ6A 3WKAA 2V97A 3D2CA 1Q83A 2HA3A 2PM8A 4XVCA 4W1QA 2B61A 1EVEA 1CUJA 1XLUA 3HI4A 4AMZA 4QZVA 1CUHA 3OTQA 4N8EA 5HF8A 4KE6A 4KAAA 4Y2SA 3WI7A 3X3HA 1ZOIA 2XMDA 4U2FA 4AO7A 1EDDA 3WZLA 4EBBA 1HLGA 2HA2A 1FJ2A 3WWPA 5ALYA 4Q05A 1E66A 1MNAA 3C6BA 2OPHA 5FUMA 1X2BA 1CUEA 2O2GA 4JYPA 4L3WA 4DMFA 3C45A 5HQ3A 3O0DA 4C4XA 4Q82A 4MYSA 4M0EA 2XLBA 3IA2A 4J7AA 4X90A 3PDCA 4EA6A 3O9VA 1G66A 5IVIA 5EHZA 1Y7HA 1DX4A 1MAAA 5JAPA 4G8BA 1YSCA 2XMRA 2R8BA 4YPVA 5AM4A 2AJDA 1GPKA 2ZYHA 4IH1A 3IULA 5IVKA 1QZ3A 3ZLUA 1UKBA 3WJ1A 5HF5A 1TKRA 2HL6A 4UBJA 3WZMA 3G9TA 5E4TA 3EQ7A 2Z3ZA 4GI1A 3EIOA 4IHAA 2AJLI 3BXPA 4FKBA 2DHEA 2XQGA 5AHXA 1R3DA 4W1SA 1N1MA 4WCVA 3IB3A 4LIPD 2GYVA 1QIJA 4I3FA 1H2YA 3G0IA 1HBJA 1XZLA 3F97A 2VJAA 5EIEA 1EB9A 4LKOA 5LZ4A 4WFJA 2WHRA 3BIWA 1QIFA 4FBMA 1ZGCA 4HS9A 1Q0RA 1R50A 5HF9A 1SFRA 3WKDA 5C7YA 1GT6A 4N5IX 3WL6A 3QMWA 3SWWA 2WQZA 1BEEA 4CG3A 5HFAA 2FJ0A 1IZ7A 1UOOA 4EB0A 4QDTA 2OLEA 1IUOA 1ORVA 2LIPA 3RKSA 5FP0A 5SYNA 4WJLA 1BRTA 5AKEA 2OAEA 5CT8A 5FLKA 1P0MA 1J1IA 4Y7DA 4MYDA 3OM8A 4QWWA 1XZJA 3RK4A 4X3CA 6YASA 1FFAA 1Q84A 3AILA 2QKYA 1YAHA 4AXBA 2O2HA 2OCKA 4WDQA 2HA4A 3WK7A 1TIBA 2XUFA 4EY8A 3LCRA 2VF2A 1ETHA 4FFVA 5A7FA 2WFLB 3WL8A 5CT5A 4D9JA 4UHHA 2C0QA 2G4LA 4PV7A 3DOHA 1QIKA 1U2EA 1VJ5A 1EK1A 3AZQA 4B7ZA 1RYYA 2DSNA 4J0CA 4OUKX 2PKYX 3NOXA 4ITVA 3PF9A 2EEPA 4BE9A 3ESBA 2IITA 2DFPA 5FOQA 5LKAA 1DQZA 1JFRA 1EDEA 5CRIA 1FFCA 5ALRA 3ZLVA 3P2MA 1JU4A 5AI9A 5JAUA 3PUHA 4BAUA 4C87A 1GGVA 2BCEA 1LGYA 5FPPA 3U0VA 4G4IA 1QTRA 2OGTA 4FLFA 1YS2X 4LHEA 2PBLA 1A7UA 4XX1A 2HHAA 3S2ZA 3EQ9A 4U2DA 1LLFA 5AKLA 2XMCA 1MPXA 2WHQA 4GHWA 3VXKA 2FJPA 5AO9A 3VJMA 4G4JA 1XFDA 1QIIA 2V96A 3H17A 4Y2QA 1USWA 1XZEA 1H2XA 4Q3OA 4INZA 5HF6A 4H0CA 2WTMA 5HKAA 4WFIA 1H22A 1BU8A 1UWCA 4C89A 2QS9A 2RHWA 5JALA 4AQDA 1CUWA 3K9BA 1XZKA 5CXXA 4GBGA 4H7EA 3UMJA 3STTA 2C58A 2NW6A 3E1GA 3IUQA 3QM1A 3D3NA 1XRRA 1CUGA 2HDWA 3H04A 1AX9A 1CUDA 1XZBA 2GBIA 4ZWNA 1HL7A 3PICA 3TGLA 1GQRA 1R9MA 3DEAA 1FFBA 1XZDA 4LYDA 1B6GA 1QOZA 3N2ZB 5JADA 4O08A 2XUJA 4GXNA 3F8SA 3KWFA 5ALOA 1W52X 1L7RA 3I2JA 3FSGA 4K5QA 3ZWQA 4X85A 2RGUA 2H7YA 1EA5A 1QIGA 1HQDA 5FPQA 3UUFA 3LIIA 3EQ8A 2VTVA 1RP1A 1UK9A 3HJUA 5DTJA 3DDUA 5ALIA 4OB6A 2PU5A 1XQYA 5ALXA 3BF7A 1GXSA 2XE4A 4C6HA 1BEZA 3R3VA 3IBTA 1CUAA 5AKKA 4JNCA 3WIOA 4YK7A 4C4YA 5D7BA 1EB8A 5DWDA 3A2LA 4Z49A 3FVRA 3HSSA 2WIJA 1MO2A 4Q34A 5AKIA 4H18A 2J4CA 4P93A 4GEGA 4IO0A 5ALHA 5DTIA 5LP1A 4BCCA 2C5FA 2XMBA 3U1TA 2W6CX 4N5HX 1MU0A 1UXOA 1IZ8A 4B0OA 5ALQA 2PL5A 4UFOA 1JU3A 3WKBA 1CUXA 4J03A 2V98A 1Q0ZA 3H2HA 3HC7A 3STUA 3I1IA 1WHSA 2PUHA 4XJVA 1TCCA 3I2IA 2DCMA 5E4YA 1EVQA 3DOIA 4JH0A 5T4FA 2CUTA 2C4HA 5LLSA 1WOMA 2QJRA 1PJAA 5AM2A 1C4XA 1QFMA 1JMYA 2Y2UA 4H7KA 4PSDA 2QVBA 4PSUA 2GZRA 1G4HA 4QE3A 3BF8A 2JGKA 5AKGA 1SCKA 2GBFA 1XKLA 1W4LA 3GELA 3WQHA 2HU7A 5AOCA 2H7CA 3G9XA 4DMHA 3F96A 5HFNA 5FRDA 1NX9A 4N8DA 2Z5GA 5K3DA 2ZSHA 1KU6A 2JGLA 5CT4A 4J0HA 4GLBA 5AI0A 1D07A 4DGQA 4Y9SA 4P08A 2YXPX 3QYJA 1CRLA 1LPPA 3FNBA 2GBCA 1TCAA 4ARBA 4Q3KA 3RM3A 2VT7A 3C43A 4X91A 1VZ3A 5ALGA 2G5TA 3G0GA 3LS2A 5AK5A 3NUZA 1QO9A 4BRSA 4BCBA 5D3KA 4X92A 5JZSA 3N0TA 3VKFA 2ROQA 5CH3A 1CEXA 2XQFA 2H9YA 4W1PA 1MT3A 3W2TA 4X7BA 4FBLA 2DQYA 3BL8A 1GPLA 2OXEA 2WJ3A 3FLAA 2C0PA 5LYYA 4AO6A 3MUNA 3AJAA 1R1DA 2C7BA 4BVJA 3KD2A 3TJMA 4B83A 4QNNA 1ODTC 3MUOA 1XLWA 2E3JA 3V1MA 4E46A 4DM7A 5CTAA 3WWEA 4HZGA 3ZLTA 2XMQA 1SCQA 4QEKA 3HACA 3PUIA 4AB1A 4X97A 5AKJA 2GYUA 5HK8A 2VT6A 3WK9A 4J0DA 4Y2RA 3TRDA 4MWSA 2DQZA 4Y2YA 5ALLA 4ZREA 1EH5A 3CCCA 4J0JA 3M82A 3V1NA 1DWQA 1ZD5A 3K6KA 2IX9A 3A2NA 1K63A 1GQSA 4V2IA 3WKEA 4DMKA 1LZKA 4BDSA 3ANTA 1ACJA 3WWOA 4TPKA 4BB0A 1J07A 1E89A 4X71A 4I4CA 2RHTA 3QPDA 1E5TA 1DINA 1P0PA 4WFKA 5AK6A 4I19A 5HZGA 4BATA 4MQLA 1A8UA 1CUFA 1N5RA 3PFBA 4DNPA 1T4MA 1U4NA 4X94A 4X00A 4AMYA 3WKCA 1ZD4A 4K6KA 3I28A 1AURA 4BCDA 4Y2PA 2VEOA 4J0KA 4WY5A 4FNMA 5C81A 1MAHA 3QBJA 4E14A 4A5SA 3QITA 3GUUA 1XKTA 2BUAA 2ACKA 2VJDA 5JAOA 4NVRA 3D2BA 5FXMA 2CMFA 2PVSA 3C87A 1XZIA 5KWIA 4KE8A 4ZV9A 4C4ZA 3IURA 1ZI8A 1JI3A 2VAXA 5AOAA 1BE0A 1TAHA 5F4ZA 5BOVA 3ZI7A 4U2GA 2WFMA 4PF1A 4BVKA 1LNSA 1DU4A 5SYMA 4FFWA 5BWCA 4BP9A 1QONA 4OPMA 3HEAA 1VE6A 3PE6A 4EZIA 1MX1A 4NS4A 4Q1VA 3A2MA 1CUIA 2OCIA 3IIIA 4EY6A 4HRYA 2J4FA 5E2IA 5KBYA 5AM5A 3WK5A 2ES4A 2HA6A 3R3YA 3FYUA 4PO3X 3STXA 4X95A 3I2FA 1BN6A 2OG1A 4ETWA 3AZOA 4KYVA 4DNOA 3G8YA 3DNMA 1NU6A 2WKWA 4M0FA 2RONA 5AKXA 4KE7A 2O7RA 2GYWA 3NGMA 5DYWA 5JANA 3M83A 4K6GA 2WG0A 4RE6A 2G63A 3VJKA 3W05A 4J3JA 3ESDA 4BTLA 1U8EA 5IVHA 1XRQA 3A6ZA 3WK4A 2JF0A 1UKCA 2FX5A 1U65A 3MGAA 2ZJ7A 1TRHA 4BDTA 3C8HA 2OGZA 3HYSA 4X6XA 2WFLA 4CFSA 4KAFA 3M3DA 1CLEA 2JGMA 5ISMA 1QIDA 4OB8A 2W22A 2ZJFA 3DS8A 5CMLA 1QIHA 2D5LA 2WHPA 5HKBA 1Z68A 1ZGBA 2WTNA 1ODSA 1XRNA 3R41A 5ALFA 2WJ4A 3OPMA 2AJBA 5CT9A 3W04A 3T52A 3R0VA 3E3AA 1WB5A 1L7AA 5DYYA 3I6ZA 5C8XA 1UK8A 1DWPA 4KE9A 1CUCA 1A88A 2QXUA 3L1HA 1IVYA 2PSDA 1WM1A 4UPDA 1A8QA 2XQIA 5K3CA 3I6MA 1VA4A 4Y2UA 3M81A 5E4JA 4H7DA 1L7QA 2HRRA 3FVTA 1EI9A 1DT3A 1E8MA 3SX4A 2RI6A 3G9UA 4E15A 3DQZA 4ZV7A 3VJLA 2ZYRA 1XZHA 3OC0A 4Y2JA 1TQHA 3GA7A 1J2EA 3FYUB 4EHBA 1MNQA 4OCZA 1W6RA 2VAVA 2IIVA 4G5XA 5ALNA 4UBLA 1LPMA 1CR6A 5ALMA 1UZAA 5JZBA 4OD0A 3GZJA 5FDFA 4ZGBA 4F21A 4UHFA 4DTCA 1K4YA 2B9VA 1H2ZA 2WG2A 3STWA 1F8UA 2Q0XA 5BWBA 3W9BA 2QT9A 5I9IA 1UKAA 3WIBA 5LZ5A 1J06A 1AC5A 4AX4A 3AUKA 2X76A 5LZ7A 2XDWA 4U2EA 5EGNA 1AKNA 1CFJA 1JMKC 3WMRA 4PW0A 5CBKA 3FYTA 3ZV7A 2JGFA 2VJBA 4H77A 3O4JA 4HXFB 4QA9A 1XRMA 1AQLA 3PF8A 1UK6A 4UHBA 4FMPA 4FHZA 3I1YA 1K8QA 4B80A 4AN0A 4B85A 1QO7A 2I3DA 2P8SA 2CEKA 1IUNA 3DCNA 2Y6UA 1EK2A 5ALVA 3FYUC 1CQZA 1E8DA 1HPLA 3G0BA 4UFPA 2PUJA 1LBTA 3KSRA 5CH8A 2Z8XA 2CJPA 5AM0A 5K3FA 5JARA 3GFFA 4BVLA 3E4DA 2C5GA 2OCLA 3H2JA 4UBNA 4UBIA 1X2EA 1B41A 3QMVA 5H3HA 1MX9A 1UT6A 2O2IA 5AICA 4F5ZA 2XUHA 3R3WA 2WIKA 3C70A 2QOEA 1OCEA 3DL7A 3OG9A 1XZGA 1JKMA 3C5WP 3G9ZA 3H1AA 1UFOA 3G0DA 1ISPA 4RPCA 5JAHA 2B4KA 3AIKA 5LZ8A 3FCXA 1GKKA 5AI5A 5ALDA 3CXUA 1ZJ4A 4Y2XA 4WY8A 2OQIA 5A6VA 2PSFA 3H2IA 3KDAA 1VKHA 3AFIA 3DYVA 4G8DA 5ALZA 2XUKA 3E0XA 5BV7A 3FBWA 3IDAA 2ECFA 5CXUA 3D7RA 1EX9A 4DSZA 3PI6A 4N8SA 2WUGA 1GZ7A 3CN7A 3QH4A 1H2WA 4CI9A 4EY5A 4G9EA 1TK3A 3C6ZA 1O6FA 3B5EA 4J0GA 2WG1A 1MN6A 2BKLA 1OXMA 2VJCA 2O7VA 3VISA 4A23A 3DJYA 4DNQA 1JJIA 3WL7A 1E8NA 1BCRA 4MQMA 5K3EA 1AMNA 3C6XA 1XQXA 3CCBA 4FNGA 1CUVA 3VDXA 1JT2A 3RARA 4CCWA 3UUEA 5DJ5A 5JZ9A 5YASA 1VA5A 5CURA 3DKKA 1PV1A 2ZVDA 4B84A 4B9EA 5AKZA 3HABA 2XLCA 4B0PA 1I6WA 4MXDA 3BDVA 1EDBA 3D0KA 2YASA 4HAIA 4LXGA 1GPNA 2QR5A 4CCYA 1ORWA 2K2QB 5I7UA 2WUEA 3V1LA 4UHCA 3K2IA 4IH4A 1YAJA 1XQVA 1CUZA 1SCIA 3IVMA 3Q0TA 1FFDA 1WHTA 1QJ4A 2VQ6A 1QIMA 3HXKA 4L9AA 3EBLA 2HADA 3LP5A 3I2KA 3ANSA 1ZJ5A 1IMJA 1QIEA 1ACLA 3EF3A 1Y37A 1YB7A 5EIHA 4BZWA 1VLQA 5T4HA 4XIIA 1CUBA 4H35A 5ESRA 4DIUA 3H2GA 2Y6VA 1ZIYA 5LZ9A 1QTIA 2QXTA 3I6YA 1WB4A 4K2AA 2WIDA 4BYMA 3D2AA 2XUGA 5EHQA 2XUIA 2PSHA 4DSAA 1C7JA 1K5PA 1XRLA 3NWOA 2CBGA 3WYDA 3OOSA 3BJRA 4JYMA 3R3UA 2VSQA 5IH7A 2QRUA 3O4IA 2DHDA 2ZYIA 1BCSA 1BROA 1YA8A 3WA7A 2XUDA 2PSEA 4X6UA 5JATA 3H18A 5K3BA 1XZCA 2WFZA 1HDEA 3HRHA 3D59A 1QE3A 3ESCA 4BTVA 1CPYA 5D6OA 4Q3LA 5EFZA 1JJFA 1W75A 4G4GA 3PFCA 2H7XA 2R11A 3RLIA 1IUPA 3BIXA 2HU5A 4B6GA 4CCYB 1W76A 5K3AA 1XZAA 3LIPA 1QFSA 4KACA 2HFJA 3H0CA 4DLNA 1XZFA 1XZMA 3QZUA 5ALJA 4BE4A 2DHCA 1THTA 4FWBA 3F67A 3VVMA 4Y2VA 4H7FA 1YCDA 2OAGA 2QTBA 4NZZA 1FFEA 2JGIA 4AZ0A 2Z8ZA 4JUIA 4ROTA 5AKYA 1JJBA 5JYCA 1G42A 4AZ3A 1W1IA 2YH2A 4FTWA 3AZPA 1F0PA 1QGED 3FOBA 3A70A 4GDMA 1O6GA 4KJXA 1LZLA 4MEAA 4QDZA 1P0QA 5IVDA 3BJMA 2WM2A 4W1RA 4J0IA 5HCUA 5DNUA 3WA6A 3OURA 2ZJ6A 3W06A 3WLAA 3G7NA 4CIBA 4G1FA 2JIDA 4ZXFA 3C6YA 3STVA 3L1JA 1CV2A 2H1IA 5HK9A 1LPSA 3JYHA 4YX9A 5ALUA 2ORYA 4XWGA 2WU4A 5I8PA 2HA5A 1CUYA 2GBGA 4FOLA 3IUNA 5CH5A 1XLVA 4C01A 2XI4A 4NMWA 5EHNA 5AI6A 5C8VA 1A8SA 1DX6A 2BGRA 4GWLA 2Y2VA 1VE7A 4CG2A 5AK3A 5K5EA 4CG1A 2XUOA 3SK0A 3C5VA 2CB9A 3TEJA 3G0CA 3JWEA 3V1KA 3AINA 2RIPA 4DMCA 4BZZA 1DT5A 3FLBA 1BS9A 4GW3A 4BC0A 3F9CA 4UFNA 5JD5A 2XUPA 3KWJA 1ZI6A 4OU5A 4QLAA 2WSLA 1P0IA 2WIFA 2HU8A 4DNFA 2D0DA 2QMQA 3AIMA 1R9NA 4X93A 2JEZA 1LPNA 1AZWA 5DNVA 2HA7A 1EINA 4PQEA 3BDIA 5AJHA 2XQKA 2ACEA 3WK8A 4ZI5A 4CIAA 1LBSA 5T4BA 2OCGA 4EY7A 3H19A 2BJHA 5ALPA 1XROA 3ICWA 3BWXA 4HXGA 5ALTA 2BAGA 5DYTA 1M33A 4DYHA 3R40A 5AKHA 1XRPA 5DNWA 4L72A 2WILA 4UHDA 5LIPA 2WLSA 2X8BA 4K6HA 4HVTA 3DYIA 3R3XA 1WB6A 2ONCA 2ZYSA 4Y2TA 2HA0A 5C8ZA 2HFKA 4FLEA 1UOQA 5ALWA 3L1IA 2AJCA 3B12A 4B82A 3S8YA 1F0NA 1DQYA 1H23A 5A62A 4KR0A 5JD4A 4MWTA 1TCBA 1KEZA 4P92A 3ZPXA 4BRZA 3C8DA 1ZD3A 1X70A 2BUBA 3B3QA 4UUQA 5A2GA 4GECA 3AIOA 1K6EA 4F0JA 2FUKA 2J3QA 3DKRA 4W9RA 3QPAA 1GKLA 1VXOA 4HTAA 1G5FA 1LPAB 1QLWA 2XT0A 3O4HA 4KEAA 1WCYA 3VVLA 5D3ZA 3STYA 1VZ2A 4S0XA 1R88A 4U2BA 5HQ3B 2OGSA 3O95A 3SC2A 1SC9A 2OQVA 3V48A 4RGYA 5AM3A 3MVEA 4KRYA 3GROA 1YB6A 1YS1X 1BN7A 1CUSA 1HKHA 5AI8A 2RAUA 5DLPA 5EHXA 2WU3A 2JGJA 3ILSA 2QUBA 3KXPA 2PU7A 3ICVA 5AP9A 2HRQA 4AN1A 2VA9A 3Q8WA 2G5PA 2XUQA 1ZICA 2GZSA 1CIJA 2EDCA 4H7JA 4P9NA 4MEBA 3W9UA 1NU8A 1AUOA 2XUAA 5ALSA 4QDXA 1N5MA 4G8CA 1YA4A 1ZI9A 1UK7A 2WHPB 5FV4A 5LZ2A 1PFQA 1SOMA 4FLMA 4UBMA 2HIHA 2I78A 2DR0A 2CKMA 2HM7A 5IKXA 4M0MA 1AGYA 1WPRA 2I3ZA 4C88A 4JEIA 4LXIA 3I2GA 3QMMA 4MJ3A 4F60A 2XMGA 3WK6A 2WIGA 4QLOA 1LPOA 4IH9A 1FSSA 4QDOA 3YASA 2JEYA 1VXRA 4BBZA 1E3QA 4HRXA 1EHYA 2X5XA 3WWCA 4BC1A 3JW8A 2Y1KA 4EUSA 3BE8A 5AK4A 4TVKA 1CVLA 2Z3WA 5JIBA 2VATA 2XQJA 3G02A 1MJ5A 5AIBA 4A16A 4UBKA 5CW2A 2JBWA 1CUUA 3ESAA 2QUAA 2WUFA 3ED1A 3F98A 2CZQA 4PSCA 3DL4A 2PSJA 1KU0A 4ZRDA 5ALEA 4X6YA 3GBSA 4BAGA 4OSEA 1MTZA 4QDUA 4BAZA 5A7HA 5EIAA 5AIAA 4G9GA 1YASA 3FAKA 3DD5A 1WPXA 5J3JA 3O9MA 5K3FB 1DTEA 1YR2A 4TGLA 3D4LA 2AXEA 3WJ2A 1RWQA 3LLCA 4FDMA 2B20A 2V9ZA 5AI4A 3I2HA 1F6WA 2QM0A 4H7IA 2XMSA 1ZIXA 1S8OA 4QWMA 1N8SA 1OILA 4RE5A 4OB7A 4AO8A 4EY4A 1Y7IA 4PNZA 5AM1A 2EDAA 3IUJA 2YYSA 2AJ8A 1CQWA 2XMZA 1DWOA 3FSGD 4B9AA 7YASA 4KRXA 4OU4A 3V9AA 5A71A 2BUCA 3HZOA 4UBOA 3WL5A 3T4UA 1MX5A 4UHEA 4HXEB 4LYEA 3H1BA 3O4GA 4YASA 4KAJA 5CT6A 1ZD2P 2WUDA 4E11A 2I03A 2JGEA 5A7GA 2ZSIA 2XB6A 5AOBA 3KOOA 4L0CA 5KWJA 3QVMA 5EI5A 1THGA 5JD6A 1ODCA 5T4EA 2PPLA 3FLEA 1T2NA 2PX6A 4H7HA 5FKJA 3H2KA 3DLTA 3FWHA 5LKRA 4IQ4A 1EXWA 3IUMA 2QZPA 2BFNA 1LPBB 5KREA 1UOPA 3R3ZA 4BP8A 1VOTA 4ARAA 2BGNA 1C7IA 1R4ZA 4OYLA 3WYNA 4U2CA 4RNCA 4W63A 3WWDA 1XQWA 3D5EA 4B81A 2UZ0A 4WDRA 4OYYA 3QPCA 5JASA 5ALKA 2J3DA 3CN9A 5AH0A 4LXHA 3HLKA 2QJWA
chains in the Genus database with same CATH superfamily
1DIOB 2UVPB 3FPHA 2ZRKA 2IUYA 5C31A 3WKAA 1OJLA 3FPLA 4CHGA 3NORA 1C7EA 2F3TA 3HP1A 1DLIA 2NQ2C 3CH7A 2J9XB 3LX5A 7GPBA 1HTTA 3L8EA 2POQX 4M99A 3QKIA 2H1RA 4DPKA 1KI1A 1Z29A 3DB1A 3DNFA 3II6X 3W7VA 4AROA 1QZUA 1ZMBA 1YQUA 1TTQB 4RVNA 2QYHA 3S8MA 4AMZA 4GDFA 3FRHA 2H3HA 2GMWA 1NN5A 1V8BA 3INNA 3PLNA 4LJSA 4Q21A 1H85A 1M8JA 1T6BY 1ID1A 5HF8A 3HR8A 3KBOA 3KQOA 2HYDA 2WR8A 1R4NA 4ZN6A 4YO8A 3DQQA 3EVBA 4J91A 2VYNA 2W6JD 5F7ZA 1UT5A 5BYJA 2B8EA 3OIWA 4WOKA 3WI7A 1EUCB 2P68A 4IJUA 3OLCX 3ZWPA 2NVUB 3OTIA 3CRMA 1S96A 3QVGB 1FNCA 1GYRA 4PXYA 1XALA 1PZFA 1W30A 3OETA 4A6XA 3WZLA 3OWXA 3T7EA 2M6SA 2J46A 4GYWA 4X1YA 3EZYA 1W0CA 4U7TB 2OZLA 1HLGA 2ZWMA 3PHLA 4FT2A 4ACAA 4EBBA 5ILOA 2QTLA 3ZU4A 2B1IA 3HI6A 4MYCA 1Z33A 2PLWA 3H05A 4IIXA 5TGTA 1X1SA 1XAGA 2X0KA 2C20A 1G7SA 1MKYA 1BXRB 4QUGA 3AUSA 1MNAA 1E3EA 1U7XA 2OPHA 4Y1EA 3CA8A 1A5TA 4PRKA 1TEXA 2D8AA 3UV6A 1X2BA 2QP9X 1TT7A 3CC8A 3KJFA 3ND7A 4HQRA 3TAHA 3N76A 1C29B 1GDHA 1DG1G 1PL6A 2PZGA 1D2HA 2X8AA 2DOKA 3BFVA 3MQFA 4XUDA 1HFEL 1A9YA 4IPTA 4JC5A 1CETA 3S2SA 1IQUA 1YI1A 3UGTA 4URFA 5H83A 5BNWA 3U1BA 4B4KA 5K0ZA 2AEMA 2XA1A 4KRGA 2JFGA 4M0EA 1QQ6A 5DBHX 5HZMA 1VQ1A 2FQXA 5JAMA 1KDTA 1TEVA 3KFLA 2H85A 5JNTA 3EPPA 3TRHA 1A4IA 3OKAA 4I1RA 1KGSA 1Q20A 3KM0A 5C1OA 2RHHA 1REQA 4MGIR 4HZUB 3KUDA 1TJPB 1F4PA 1AK9A 4IGEA 5IM5A 3QKTA 1W1WA 3IMKA 3P9RA 1H3EA 1XEWX 4B40A 1GLNA 3H5AA 3K8QA 3L06A 3SLGA 3QLUA 5IVIA 3GZNB 1Y7HA 1T34A 2OV4A 3F4BA 2ZT7A 1KVUA 1TQ8A 3QIVA 1OAKA 4BE7B 2SCUB 3HYCA 2WYUA 3EZXA 1E7YA 2J85A 5BN5A 2R8BA 1ZR2A 1CIPA 1K3FA 4EHDA 1GGJA 3IAS1 1Z22A 3FUWA 3KJQA 5AJTA 4C21A 1YDMA 2RI1A 1IE3A 3GAZA 4D9KA 2WSSD 4C6TB 5CVCA 4H59A 2VWPA 3DEFA 3WYGA 2P1DA 4U7GA 2IYZA 3IHLA 5EXXA 1AQJA 1ACMA 1L1RA 1H9AA 1XXLA 4FGJA 3OBBA 1E7MA 1RMYA 1RADA 4NNPA 2O2SA 3L6DA 3KWLA 3D4PA 3SR4A 1WSBA 2P9QA 1M66A 3WJ1A 5HF5A 2AOTA 4UU0A 4C3VA 4E5KA 3HJAA 2ZE6A 2PT9A 3JQFC 3QA9A 4WJZA 3EA0A 4TWAA 4Z3DA 5HQTA 4OAOA 1QHHA 1T8RA 4PVDA 5JU6A 1JJ7A 4ZDKA 4GI1A 3TPCA 1USGA 4RFVA 5A9SA 4IHAA 1R0LA 2P3OA 3QW2A 2XVMA 1M2EA 3LXMA 5COBA 1WU7A 5E6UA 4FKBA 3A9VA 3JQQA 4MPJA 4W6ZA 5KX5B 1PV4A 3BGSA 1Q22A 3CUVA 2FPLA 2DHEA 1XVTA 2C5SA 3UWMA 1EGVB 2CUNA 3ZK9A 3K1JA 2BHTA 3PC4A 4WCVA 2NU7B 4WAUA 3UHFA 2R6R1 3I8OA 1TLLA 5JCJA 1JF8A 2QN6A 1PRYA 4QHSA 1A9QA 1QIJA 1ZM3A 3G0IA 5D86A 3SQDA 5LU9A 5DM1A 1M7BA 3L4JA 4AJIA 2JAUA 3RG2A 1SOWA 1D2RA 5IULC 2DH6A 1YC2A 4ZTZB 3D3WB 2VJAA 4IXMA 5HBRA 4ZARA 3VTZA 5TEWA 3R6LA 4YA6A 1CNMA 5CFOA 4LKOA 5DB4A 2IUEA 4D8XA 5LZ4A 5TY0A 2ZJ5A 3H1PA 4LYJA 4A5OA 3LM8A 1YQDA 4IXTA 4C7KA 3BIWA 4BNGA 5IEJA 4D99A 1II8A 1SCDA 5K99A 1SK8A 3I9FA 4NDAA 3CLRC 4E15A 4QUHA 2JLXA 3NP7A 3UT6A 1GDTA 1XTVA 1UAAA 1DJLA 2F1HA 4FMCF 4C1BA 2XH8A 5F77A 5CTJA 1ZMRA 5HF9A 1C3OA 3GWGA 4PAMA 3BFJA 3WKDA 5A4AA 3HBNA 3DO5A 4N5IX 4FYXA 2JANA 4ARZA 3EIWA 4YAIA 1EXVA 4C7MA 1XTRA 4DQXA 5KTTA 1Z7YA 1I7QB 2FZWA 2PMDA 2WQZA 4ZTBA 1OBCA 1FVHA 1GAJA 1BEEA 3G8CA 3PD0A 4GOXA 3IALA 4G0NA 4M98A 4WXMA 1DCMA 1SUSA 3LE8A 5DHFA 3OY2A 5ADHA 3IA7A 1NI5A 4JJAA 3ZW8A 5KTNA 1FF9A 4FOTA 2GRJA 4EB0A 4DV6B 2YYZA 4H27A 3EE6A 3RKSA 4ZCSA 3ZX4A 3VKUA 4ND4A 3KR2A 3OZCA 2PJDA 5F2EA 1QRRA 4V3CA 3SZRA 3LJKA 4WACA 1BRMA 2VBIA 2IP2A 4BRWA 3NBUA 1G1AA 4LJ5A 1NN0A 2HO4A 2VI5A 2MWMA 5LB4A 2DXIA 4X9XA 2ERXA 4JLKA 2C8KA 2QPAA 2LD4A 1XZJA 3TUZC 3WMFA 2DWUA 3HB7A 4UCXA 1LF0A 3IBGA 4FDUA 4YRPA 3E53A 3SJCA 4ZZ3A 1GUDA 2F43B 2QL5A 1FFAA 1T6ZA 3SJBA 1Q84A 3ZCXA 3AILA 4KQKA 3BORA 2GZHA 3OX2A 4JMLA 2H8KA 2QT1A 2BH2A 2I7VA 2O2HA 2Q2OA 2BHRA 4IIEA 4MKXA 5DTRA 5GJCA 3STHA 3ZHYA 2HA4A 2QZ9A 1HX7A 4DZTA 1OI3A 1B2RA 1KOJA 4DJJA 3E2MA 1HGXA 2ID9A 2NXWA 1CXZA 1OJ7A 3NBXX 4MRMA 2GERA 1FXWF 2QVCA 4M1TA 5ENDA 5CYGA 3N8DA 3T3IA 3P9XA 4WOJA 5CT5A 4MA0A 2BCJQ 3DE1X 4FKZA 5L45A 3T1HB 5EA2A 2Q41A 2C2GA 1HDCA 2R6GA 2G4LA 2WWGA 3FJYA 4PLGA 1DAGA 3WP1B 3VZCA 1HO3A 2PMEA 3VR1A 3N8KA 1QIKA 3PQFA 1DRWA 5B1EA 3PP8A 2ORWA 3SKXA 1XKXA 3KIPA 2FHPA 2FZLA 2IHKA 4KDRA 3UB4A 4W5NA 2GSDA 3UK7A 1RYYA 2DSNA 3HJRA 3L40A 4KSCA 1I4LD 1J97A 1E1KA 3B6JA 3Q7QA 1S4QA 4M38A 4N12A 1I3OA 1EFTA 1IHXA 1R9GA 1RRFA 2IBMA 2P91A 2JFXA 2WLTA 1RXYA 3LFHA 2WAXA 3NOXA 3OWHA 5GM2A 3H9EO 4KFCA 1GCGA 3WMGA 1JIQA 2CLMB 3GLVA 4OAPA 3QFCA 1G4AE 5I7HA 1UOEA 3PV0A 5A9RA 5KSOA 1NUAA 5EJ2A 3TR0A 5LN1A 2G07A 1ZN2A 2IEYA 2CJFA 3FYCA 5AK0A 1P1KA 1DDIA 1IOZA 2WF9A 3ZX5A 3OX3A 3OQBA 3UT5B 3ZBUA 1K3UB 7REQB 1Z45A 3H6KA 1M7HA 1AS0A 4O2AB 4PVCA 4DHWA 1DFGA 2J08A 4LMPA 1BX0A 1HE8B 3DPUA 1GGVA 1Q77A 5EKDA 4LQCA 4P2BA 1GZHB 2G28A 4BJ1A 2I6UA 2LRHA 3W3AA 1O4VA 2BCEA 3D31A 3KTAB 1H1LA 4EPRA 2F9LA 3U0VA 1B7GO 2FPKA 3ZWDA 4OXNA 2HV8A 2OGTA 1I2DA 1MDFA 1V25A 3VYRB 2FMXA 2K87A 3DZIA 4J0EA 5MN4A 2C7RA 1YS2X 2QN3A 5CX1A 5FLEX 3HXMA 3MBKA 1UM8A 1V9CA 2W2PA 4R1SA 4XX1A 2HHAA 4LHWA 3S2ZA 1EP1B 4R9RA 4V0KA 1LLFA 3OO1A 4DJAA 1U8FO 5H80A 3NLLA 1GVHA 9MHTA 1W7AA 1MO6A 3P97A 2GFQA 3VHXB 2CJWA 1KY5A 4L4SA 3OD5A 3LUCA 2QD3A 3ZE0B 2VUIB 3RCBA 2W6ID 1B76A 4BLUA 2FJPA 3TQTA 5AO9A 3S4YA 4WKPA 2BFEB 4BQFA 1SKBA 1XFDA 5G0WA 3ZQ6A 4FB4A 3LOQA 1N6IA 3TOSA 1QIIA 5IJ9A 4XLTA 1ZOSA 1OR8A 4MW1A 1JEYB 2BTQB 1XZEA 1H2XA 3DHEA 4INZA 2JJ1A 3HCRA 2A9KA 4DT1A 2Q0HA 3PEEA 2WTMA 5JCJD 1U80A 4GVPA 4RK1A 4MNTA 2XIQA 2XCOA 4G8JA 4II2A 4OQFA 4E03A 2XVAA 4Q4JB 2ZM5A 4LXQA 3BGVA 3ONNA 2AHOA 2DGDA 4RQBA 1ZUD1 4PS0A 2MJLA 2QS9A 2YWEA 3BRQA 4LOKA 2EQBA 3NETA 2RC5A 2HTFA 4YRJA 5JALA 3Q5GA 4RCYA 4ZAXA 2C04A 3BX1A 5K0LA 1ODIA 1FFHA 2C1ZA 2Z56A 3V8RA 4EITA 2V5AA 3LA6A 1NP6A 5CXXA 1WXIA 4MR9B 2HMAA 1GG5A 3PKIA 3AW9A 2FMHA 4H7EA 4WNIA 3OESA 3TRFA 3T06B 4EUHA 2I2XB 4CN8A 2NW6A 2QD4A 1Q7BA 4N03A 3LRPA 4C0QC 3L0PA 2V5UA 4LOJA 4RDXA 5JXIA 1X1CA 3D3NA 2LDXA 2XUZA 4J2OA 5FUXA 1DXYA 3KZMA 4E2YA 5LJLA 4BVBA 4DY4A 4C06A 1NF8A 1I3MA 4RTQA 3DG9A 1UMCB 1DC4A 1QX3A 1XZBA 3CG0A 4EPWA 5JI2E 1YZQA 3B3GA 3CGWA 3FOCA 3RJ5A 3PWZA 3TI9A 3WLMA 1N1GA 5JSQA 5KNBD 3L7AA 1XD8A 3VZSA 1FFBA 3RIXA 4G0VA 1ZK3A 4HSGA 3JQRA 4FX2A 5CNMA 3T7AA 4LYDA 3ZWKA 1B6GA 1QOZA 3IVAA 3G1TA 2EBHX 4NBWA 3QMPA 5I4KA 1QV7A 4GXNA 5THKA 5B3JC 2HYIC 2GPAA 4B8WA 1AKEA 1NQTA 3F8SA 4C3UA 2LGJA 1DIAA 4PIMA 3F7TA 5JVDB 1W0KA 1YDGA 2QF7A 1A5ZA 1NYRA 4NF2A 3L9XA 4YI5A 1SIUA 1Z34A 4P4SB 4WXYB 3USZA 721PA 2UXDB 4NPAA 4ABYA 1KORA 4QOGA 4WJKB 4Q12A 4NWIA 1Y5IA 3U16A 4K5QA 3HS3A 1AU9A 4AS3A 1E4EB 5EE9A 2HPZA 2QUKA 4FK8A 2I4TA 3KEMA 3EXIA 3P27A 4BQSA 4OREX 4X85A 3C48A 1SZCA 2OPBA 2RGUA 3BKWA 3M6XA 3RASA 3EHDA 4ZT4A 1QIGA 4ZK6A 1WSAA 4DQLA 3RIEA 3M8KA 3O92A 4KYUA 3BSYA 4JXXA 1MEEA 1YZGA 4WNAA 3GMSA 1UEIA 2XDQB 3HP7A 3AVVA 1ID8A 1NKSA 4CMHA 2QTRA 1C41A 3N59A 3KQUA 1LV8A 1BNCA 1UDXA 1WUTA 4EH1A 2WZBA 5LSAA 2ZJ0A 1Y4DE 3EQ8A 4M6WA 5LJIA 5MDHA 3L4EA 1Y9AA 4R0NA 3C24A 3LDUA 1IM5A 1KEWA 1QM5A 1YFLA 1E3SA 1EUZA 5ESWA 5ALIA 1CE8B 1JAIA 1R4NB 4OB6A 3TUIC 4Z2AA 5CA0B 6LDHA 1Z5UA 1O2DA 2ECPA 2Q3JA 4HNSA 2E4AA 1IXSB 3AR8A 3BF7A 3F3YA 4IDAA 4N5NA 4P33A 4X6LA 3ZZMA 4QQ8A 2QSZA 4Q1BA 1UZUA 1OLSB 1Z2CA 1BU5A 5AVTA 2VQ3A 1YQ9A 1X92A 2IHBA 3RYHA 1BEZA 5TGDA 4DA6A 1Z25A 4UNPA 3RQIA 1KAOA 1OH5A 5CBPB 3L92A 4JNCA 4LXUA 1SC3A 4L08A 2G36A 1OLXB 4X20A 3R7FA 3HJNA 2WIBA 2XCLA 4D8VA 2BR5A 1R6XA 3A27A 4PSVA 1CZNA 3BMXA 4MHOA 5DWDA 3ZCUA 1TC1A 3A2LA 4R0VA 4Z49A 3BRCA 4RBNA 3SIPA 4YV1A 3I9V1 3PX2A 1V5GA 4RIFA 1ES9A 3GBVA 3W1VA 3EVAA 2CD9A 3FFXA 3WTBA 4EG0A 3BXFA 1CJVC 3A6GA 4M0LA 1HE2A 2WMOB 4FR0A 4P93A 4ADSG 4OFWA 3ROFA 4L6AA 4TTPA 4L9RA 3H42B 5K2MA 5ALHA 2RMKA 1QCDA 3NP9A 3T5AA 2YQZA 1GZ4A 2A86A 2B4QA 2CC2A 2O07A 1ML3A 1YOVA 4G5FA 4AY5A 2C5FA 3ABIA 3GLIA 2J5KA 1GLVA 3H0KA 4LJ7A 1Q19A 4WASA 2AOWA 4HKTA 3KZCA 4MCAA 4PNPA 2FG5A 3R8CA 3KLNA 1X9GA 5BQ3A 4L3OA 5GJWC 1ZS9A 2GHTA 3A3OA 1OZ0A 1R8YA 2H1CA 4GUAA 1MU0A 4RJLA 4YMHA 3DMNA 1IZ8A 5HNKA 4WOCA 1H2AS 4LC1A 5SICE 2BISA 2GBPA 2YJZA 2ZULA 5ALQA 3UPDA 3PGJA 4W5TA 3ZBQA 2D4AA 3CF2A 3WKBA 2AOXA 1H2BA 4J03A 1HH4A 2CFCA 2V98A 4HMPA 1Q0ZA 2P2YA 4N3AA 3PWTA 1DC8A 5BSWA 3HC7A 3NAZA 3EEIA 2V7QD 1EAMA 2B5OA 1CRWG 1ZVMA 3BQ9A 4M7RA 3AEQB 2AFIB 4N0PA 1VGRA 3SHQA 3TTUA 1OX4B 1WHSA 4IIHA 1E0AA 2PKEA 1IBRA 4V2UA 3ILYA 2GBLA 2H08A 3EISA 4FJ0A 3PPIA 4D82A 4Z8XA 1BJTA 1ZINA 1TLTA 3SSNA 1JP7A 2QPLA 1T26A 3M9XA 2H17A 1KFBB 3TX6A 2IEIA 3O90A 4PQRA 5JSHA 4A36A 1WKCA 2VK2A 2R6AA 5LLSA 2FRXA 4IV5A 4U1RA 1L3IA 3ZY2A 1AQ6A 1YU6A 3K30A 3LO5A 2FETA 2W11A 4GQAA 1FFYA 1VKOA 2Y1CA 5J47A 1CG6A 2ASEA 1ZK1A 5TMBA 1KI6B 1GSAA 1HT3A 1EYZA 5FV7A 3OZVA 3LQYA 1EAYA 1YJ8A 2FPWA 4PSDA 2GZRA 2MTBA 3FZNA 1GZDA 4K1LA 4QE3A 2G9RA 1E5VA 1KO8A 1TF5A 3LQQA 4IS2A 1R64A 4U9UA 4MIKA 4MW5A 1IWBB 3ABOB 3MRSA 4S05A 4UNNA 4US1R 4C0LA 3ICOA 1XN4A 4IUYA 1SCKA 5KVCA 1EFPA 2ZKIA 1RWNA 2GZAA 4GVLA 5ES4B 3CX3A 4Y67A 1A72A 1H6BA 2G3YA 1U9IA 1P2FA 3GELA 3NQ41 3TL6A 3WQHA 2DR2A 5AOCA 1HDGO 2C42A 3TQIA 4EUFA 4GZ5A 5TE9A 1NXSA 4DMHA 3H0EA 2YZMA 3VPFA 3JQDA 1RC0A 2AYYA 2W6QA 4C7VA 1ZGHA 1U28C 4ITUA 2I1QA 3BL6A 1KVTA 3I9KA 3P4YA 1A9OA 1LQTA 1KU6A 2ZSHA 3KNZA 4KH0A 3GH3A 4MI6A 3VU9A 1KI8A 4NL4H 4ES6A 4FDVA 5CT4A 4J0HA 4L16A 4NBNA 3NMUF 4GRDA 2J30A 4GLBA 2QYOA 4MKZA 1GNVA 3CSUA 3L5KA 3V7WA 1PS9A 5AI0A 3LNTA 3RD5A 1L7BA 4JBGA 4GOOD 4XB6B 4Y9SA 5H1YA 2IEAA 5B37A 1DJPA 1II8B 5T64A 1CRLA 1VJGA 3NHSA 4GZ6A 3RTBA 1Z37A 2DY0A 4L5YA 2EFGA 4B6JA 1KDZA 2ZRNA 1LU9A 1UM9B 4I50F 1ZR4A 1F6DA 1JYSA 3BMNA 2Q3DA 3OF3A 2OCPA 3MGKA 3H3JA 4G63A 3GGDA 3EDQA 3W6NA 4OI0A 4DV1B 2WMDA 3HEBA 4G0ZA 1FS6A 4KWEA 4JLBA 1WSDA 3A3KA 2QN8A 2R8PA 4I1VA 4INPA 4RK0A 4CM4B 1HQKA 4LC9A 5FUWA 1DRKA 3OF2A 1QP4A 4KPYA 5TS2A 5J4HA 2XKJE 3C43A 1CS0A 2FWBA 4MCJA 1T1JA 5G0VA 4CF4A 1P8AA 1O6CA 1FEZA 1E20A 2GPYA 2MINB 3G0GA 4BNFA 4EGSA 1OGJA 1N2HA 1BKDR 4MP3A 2X6RA 4QD3A 4RL6A 1KI4A 4L5JA 4ND1A 3AC0A 1C9DB 5GP1A 1JEOA 5CB8A 4AMBA 4A6DA 1C7QA 3D43A 4TKLA 5KX5A 3G2MA 4LRUA 3EF0A 2C95A 2ROQA 1G5PA 3KAJA 4MH0R 3WGQA 3AUUA 3COSA 4RVCA 4XCVA 2GA9A 2C57A 1MT3A 3W2TA 4A1OA 2DQYA 3QXXA 5B57C 4LMRA 2OXEA 5AXDA 1Q7RA 2C0PA 5AD1A 5FBQB 1SKAA 3GHYA 3AJAA 3TNJA 2C7BA 4BKPA 4S1VA 1UAGA 2FOIA 3Q7EA 3QHAA 3EXHC 4Y9RA 2X1HA 4K1XA 5G53C 3U4HA 1TGVA 3D3WA 3VH4A 2I3AA 4E5MA 4P0TA 4J7XA 5DMXA 2ZRLA 1Q16A 2E3JA 1D6SA 4Q9HA 4JJEA 1T9GR 2ZRQA 3ECAA 3MYYA 4WFQA 1ESZA 3WDKA 4CIXA 3ER8A 1UWVA 4TYYA 1Y4ZA 4HZGA 3M4NA 2QMOA 2XMQA 1P1CA 1UIRA 3SG0A 1W5SA 3NIDB 4V0RA 5F3WB 1VG1A 4GSKA 3TLGB 4PGFA 2NV2B 5CVDA 3HACA 4AB1A 5E9QA 1W5EA 2IEDA 5FIUA 1KEPA 2A57A 2LCFA 3GCWA 1WW3A 1RWPA 2X8LA 2YHBA 2NUBA 4PX9A 2B82A 4NU6A 2X3UA 3WK9A 2APJA 3P4XA 1U7DA 4J0DA 3UMBA 3IODA 3FY4A 4NBKA 2YIVX 4J7CA 2CXTA 2DQZA 3IGFA 3IUPA 3FNQA 4Y2YA 1P91A 1VE1A 1VJDA 3ZC3A 2IPMA 5ALLA 4RD2A 2DE0X 2P4UA 3WNQA 4HAWA 2FFQA 3M82A 4FONA 3T5BA 3K6KA 3TJZA 3RK1A 4C0SA 3OCCA 4XPIA 5EZYB 4TM8A 5DRYA 2CMHA 1K63A 2R7KA 3E7FA 3UGKA 1GQSA 1YUMA 4UVIA 4Z7JA 5HIAA 4M8NE 4V2IA 4DMKA 2FSHA 3DWGA 2VH2A 4UTXA 3AGQA 3F3SA 1QF9A 2BKAA 2O2XA 3ZHBA 4FI3C 1LZKA 4MMYB 5IC5A 2X0EA 4BDSA 3PTLA 3L4SO 1DDGA 1O3YA 3ZXIA 2C5LA 3ANNA 4JLAA 1G21A 3L01A 4AX8A 2FUEA 1U3DA 2AEFA 2XDAA 4FR2A 3DE5X 3NRJA 4IINA 4CLOA 5FPKA 1R3UA 2BE7A 1BZYA 3OQMA 3EDYA 4H9GA 3LSYA 4ZOQI 2D62A 2P5SA 3VR4D 2YQ4A 3C8ZA 4I8XA 4NYMR 1WUKS 1ADBA 4IS3A 1RHRA 5F73A 3T34A 5BN3B 5HZGA 5LQDA 3L8ZA 4MQLA 3G85A 4RPJA 5FBKA 3AR6A 1IN4A 3F9RA 1FPMA 1M76A 3OA0A 4DNPA 1VG9B 5KMGB 3DEHA 2BM1A 3SXJA 2QIPA 1VCMA 3P9NA 1XHEA 1BDHA 5IUJC 2WAYA 4EAAA 3WADA 3WKCA 2BYTA 4Y7CA 3K6SB 2EW1A 1T5TA 2ZYGA 4K6KA 2ET6A 3WRWA 1II9A 1K6XA 3T61A 1I24A 1NFRA 1XF9A 1RBZA 4FNMA 4LY0A 2NADA 4I2VA 4N6GA 2WPNA 2R5NA 4RGVA 4E14A 4A5SA 5BRJA 4M8IA 1X80A 2ZSKA 121PA 3K09C 1DC6A 3CEMA 4L7VA 4TXHA 1D9XA 4OHFA 3PI7A 3ISVA 4C29A 4R1OA 1XKTA 2V74B 1M8FA 3BJEA 3GCZA 4HDNB 4MUNA 3OOEA 2ATVA 5JISA 10MHA 4GBJA 1EE2A 3NBQA 1F8XA 3MS7A 2VJDA 4TV8F 1Z56C 4P4LA 1E3JA 4NVRA 2EJVA 3VO8A 3D2BA 3GRVA 4XJTA 3ROXA 4GO1A 4PCLA 1VKJA 3DBVO 1N1EA 1NT4A 2NYAA 3GGGA 3L5OA 1ZCFA 1XZIA 1VBFA 1X1BA 4G5RA 3CVWA 2PUWA 4FGLA 4OXKA 2JS7A 5A3QA 1B8OA 3OFJA 4IMJB 3OC6A 1ZUWA 4FYJA 3SQLA 3A58B 4G3XA 1NUUA 2O2DA 3KTAA 4MCIA 3K4PA 4XRRA 1YRAA 4BUZA 1GT91 1IU9A 2BP7B 3LK7A 4KXNA 2EFYA 3USES 2ZRPA 1V8OA 4X7RA 5AOAA 3GMIA 1QAQA 3LL7A 2VHZA 4JDUA 3LXRA 1G9XA 4G1CA 2BHLA 4O4IF 2QL6A 4NTZA 4KQCA 1M6EX 4TMVA 3QLTA 1TPZA 3WWYA 4DWVA 2I4NA 4U9HS 3T9BA 3WHKA 2YR0A 2VUTA 3NIBA 5J5VA 4BP9A 4BVAA 2NTNA 4AU1A 3CRNA 3F7OA 1X13A 2WNHA 1WXWA 3HEAA 2PMFA 2NGRA 3HDJA 3LX4A 4FEEA 3AI3A 3IBCA 5E0KB 5IH3A 3RVNA 4EZIA 1MX1A 2RG1A 3ZD7A 3QE2A 1WV0A 2XITA 3QNWA 4NS4A 4UCFA 1TM1E 4HPJB 4A1FA 1YVUA 3PRYA 3RC7A 3I9OA 2OCIA 3C3PA 2E2WA 1IXYA 3I61A 4DLXA 1ONPA 1Y80A 3HNPA 3Q5EA 4HRYA 2BM9A 3WWZA 2J4FA 5E2IA 2PGJA 3VU3A 1L5YA 3GRKA 2VDNB 3JWGA 1KSGA 1MOPA 1ORDA 1DMSA 1Q17A 2J3LA 1OASA 3K9CA 5LQCA 1P19A 3U0BA 3L05A 4M54A 3JVDA 3RANA 4IZHA 1FRFS 1WD5A 5EP1A 2B4AA 3G7UA 3JR7A 4NABA 1ADCA 3UXEA 4ETWA 2QYSA 3C3YA 3OPVA 2GLUA 5HDQA 1Z63A 2MYUA 3ED5A 1JN0A 1TJ4A 1E5XA 3I5AA 1CY8A 3FGZA 3KV1A 3SYLA 5JAQA 3VTFA 1OLSA 4M0FA 1B26A 4D25A 1MJGM 4D57A 3CE9A 3R3HA 4Z4IA 2QPTA 4RZQA 1Y0BA 4Z7QB 2ZVQX 2E4YA 2GNAA 3HU3A 3TZ6A 1J2RA 4OKNA 2QTVA 1W88A 2O7RA 2A3NA 4LDQA 4IAOA 3P2YA 2B92A 4ZKEA 2Q49A 3SHOA 2NXEA 3GVXA 2YS7A 1FP4B 2PV7A 3BKXA 3BWVA 3LY9A 1VB5A 1I80A 3AY0A 3QEOA 4RH3A 3JCZA 3K35A 3W05A 4B2YA 4E30A 5BSFA 5AVRA 3P96A 2CNWD 1HTBA 1IQPA 1HEYA 4I1PA 2JIRA 8OHMA 2BDUA 2DBRA 1LC3A 4J2HA 2FAXA 5T41A 5JVDA 3SF0A 5DYNA 3ORQA 5E6SB 1DO0A 3OPYA 2B6HA 3WK4A 4Z4HA 2R6ZA 3DFIA 4MPTA 4LZJA 4RTNA 5EVCA 1CZLA 3QFRA 3R75A 4MZXA 3RSHA 2F00A 2FX5A 5K05A 3VNVA 3AF3A 1SIBE 1I6LA 4JLPA 4ASUA 1EUDA 2ZIFA 4YMVA 3MGAA 1U81A 1WBBA 4FWTA 3QYAA 3U3OA 2GF9A 3HVHA 3TM5A 1LLUA 4X6XA 1W25A 2OKCA 3PB3A 3GQVA 1WR8A 2WFLA 3TTTA 2BRUA 5IAEA 1H65A 1W36D 1V4NA 3MBOA 4O8ZA 1Z15A 4G0MA 2OXFA 1LC0A 2W22A 3SJ7A 3H5TA 3W5VA 2G06A 4U7JA 4E1VA 2G83A 2REBA 3DS8A 4JODA 3NEAA 1L4YA 1G16A 5DISB 3LDAA 2OV2A 3NG1A 2NXNA 1KDYA 1F6BA 2WOJA 5KYXA 2WF7A 1XMQB 3TB4A 3QXGA 4INOA 5CA0A 1GFSA 4EHLA 5HKBA 4WHMA 3Q3CA 1N5OX 3H84A 2WTNA 1ODSA 4KPUA 3PXBA 4OQQA 4PYQA 1DSSG 1MQ9A 1KQ3A 2GN0A 2WJ4A 5ALFA 2UZ4A 2PEYA 3OPMA 2WQ6A 1XDWA 3GUYA 4QASA 2ORIA 3R4VA 3C8MA 4FJ2A 3I62A 2P9EA 1ZW1A 1SU7A 4NEGA 1SR8A 1KFKB 3NBMA 4A8JB 1WBJB 3UUGA 2PKWA 5JTTA 3VPDA 3EMBA 4MWZA 3AI2A 3CVJA 2RJNA 4CKYA 2G76A 2Q5JA 3EXG2 3ICPA 4MGYR 1PLKA 5AFSA 1XU4A 1Z16A 1A88A 1YONA 2GXUA 4QVKA 1PWEA 3GRCA 2ZKLA 3P5BA 3PIRA 2VKQA 1JKJB 2Q0SA 4GRAA 1U4SA 2A58A 4H6WA 5A9TA 3U9LA 4R68A 2AE2A 2QR2A 3G8AA 4BL5A 3BIFA 1WM1A 1US8B 2C1XA 4JVNA 2CNBA 2FWPA 2I71A 4OGKA 1E1YA 2FE1A 1A1VA 4B3HA 4OKIA 5CFMA 5K3CA 5SV2A 3LUJA 3I6MA 1GZ3A 1RAFA 5FOVA 3EMKA 4LBWA 1VJTA 5TVGA 2QIOA 1O5OA 2G7ZA 4MW0A 3BE6A 4KLAA 1VRVA 2D2VA 2RJOA 2AJTA 4R8LA 4Y2UA 5I7AA 5G3ZA 4R0MA 5TARA 2ZK7A 4H7DA 5KNBH 4Q9KA 3DCJA 2HZBA 3W3AH 1UBGA 1XZPA 4P3XA 4RV9A 1FXSA 1QCCA 2ODNA 3O8LA 1GEGA 3GEGA 3SX4A 5JCXA 1IZYA 3A6KA 4L73A 1JQAA 4MQ6A 3R5JA 4AN4A 1BCRB 4IIUA 4P3NA 3BB3A 3KK0A 3OC0A 4RANA 1IXKA 4CV0A 1V3VA 3PUYA 4KTTE 1V41E 3H2YA 3CW8X 1W6RA 1UDWA 4X54A 1AG9A 4EYQA 3CB4A 3PKZA 1G3QA 3Q7RA 1U2RA 3O8OB 1L0BA 4G5XA 4BY9E 3AUJB 1OX6A 2XB9A 1T2VA 3FMFA 4MA4A 4RPKA 3EPJA 5C8YB 4WTOA 2ONJA 5J2UA 2VNKA 1WRBA 2X2EA 3EJ6A 2J7PD 3DLCA 2YX1A 4HNAA 1N1DA 3EVDA 4PZCA 2YWHA 1C1DB 1RM4A 5JZBA 3OTOB 4F2PA 3CVUA 4JSYA 2GJKA 5TVKA 4NJMB 4Y1GA 1W34A 4NFLA 5BVHB 4UHFA 1L4BA 4DTCA 1AE1A 1NZDA 2GCEA 2YVUA 3VAAA 4CM4A 2OORC 5I9SA 2UXBB 3AI7A 4KU4A 3H5WA 4KNWA 1PDVA 5TLSA 4YGYA 1TVKA 2G80A 4F1JA 1SPBS 2HK7A 1G20A 2QRPA 3EGDA 3UFXB 3STWA 4XFDA 1N6KA 3S2IA 4DV3B 1R4AA 1NW3A 3KP1A 1NQOA 1DQPA 4MRMB 1KO1A 2R68A 4J1QA 1DQSA 2FW1A 3O8BA 1UKAA 3URMA 1PZHA 2YNMA 4BTEA 3JAWA 2Q9BA 4M9UA 1X14A 5EZ6B 4AT1A 3HKEA 4HYTA 3I37X 3KYCB 3VNQA 4K40A 4AW9A 4R1LA 2X41A 3ZS8A 2X76A 2XDWA 4NCIA 4U2EA 5EGNA 3SJZA 2IRWA 2FPSA 2W8ZA 3TNYA 3EC2A 1NVWQ 4LDRA 1EM6A 5FOSA 1CFJA 1Q7TA 3MB5A 3IC5A 5TNXA 1JMKC 3UMFA 4KFUA 1MA0A 3GRAA 4IIDA 5KUTA 2XGJA 4HP8A 1MIOB 3K5PA 1E77A 1OFGA 3MMPA 1A8HA 2HWYA 3OFNA 5LWHA 2QAJA 1EIZA 3FYTA 2C2ZA 3TAUA 2BDTA 5BRAA 2FNAA 4W9MC 3O4JA 2OZPA 1JB9A 4LF5B 4C6SA 1XRMA 2JZOA 1V39A 2CD7A 4DBLC 1L7EA 4FMPA 4RD1A 1CJTC 3CV3A 1YRWA 2OBNA 1TD9A 3I1YA 4U3JA 3RVOA 3G0HA 1F8YA 3NPAA 1A9XB 4B80A 4UU1A 2G1AA 4FIDA 1CB0A 2D8MA 1HORA 1H0KA 2WAOA 3KKZA 5DGXA 5LQKA 1WBDA 2VP2A 5FYQA 4O02B 4Q1DA 3ROGA 1BVRA 2I3DA 2VH5R 4NU8X 1J22A 1XFAA 2OSBA 2CEKA 2PH1A 2P8SA 3RVPA 3ZW7A 4EYOA 1JEDA 3UOGA 2ZRJA 4YCBA 2IKQA 3IOCA 3PTZA 4F56A 1GTSA 1RQ2A 2RB5A 1MB9A 4HV4A 2JZCA 1PS8A 4BFXA 1SAYA 1CQZA 4RSMA 4H17A 5HA5A 1O1YA 4JLMA 1NY5A 1F9EA 2HLDD 2PUJA 2H2FA 4WECA 5EWLA 4OQMA 4KWTA 1NNSA 3IAM1 5J5CA 3T54A 4DLYA 1ST2A 2L18A 4FI3F 4KXUA 3NNDA 1XG5A 5CH8A 2R1VA 2W2VA 2Z8XA 3ASUA 1XHFA 2R97A 2A67A 3VOBA 4MV5A 3GZTB 3I05A 5CHYA 4ZCMA 5DXAA 4DIKA 3QJGA 1RWBA 4C2BA 2W0MA 4JJ6A 3GFGA 3NWBA 4MV4A 4YONB 4ALNA 1LW6E 1F0YA 4PXAA 2WAMA 1TUBA 3GOQA 3NPMA 2BJVA 3DV2A 4UBIA 3LF1A 2GJ8A 3WAGA 2PS0A 5FI3A 4AC9A 3FDIA 4AF6A 5IXSA 3DE0X 4ENRA 1ZU5A 2O2IA 2YBEA 2LWIA 2GT1A 3CM0A 5AICA 3JY6A 4HDSB 3ZNPA 3FGPA 1GG9A 1RCTE 1T0JB 2PMBA 4NBVA 2WIKA 4PG4A 5E95A 2QBYB 2YICA 1OCEA 4CLDA 1L4EA 1NVTA 3ER9A 4NX2A 3OG9A 1XZGA 3N74A 4NENB 4YLGA 1D1TA 1W5FA 2DBVO 1FUKA 5B58C 2LV8A 4NXMB 2X9QA 2QBYA 4CDNA 1FRQA 2J9FA 1C3EA 1R0RE 4RJKA 5GGYA 3I73A 4N47A 4C0WA 3WGYA 2FUG6 1MO4A 2H18A 3C4VA 2GPBA 2QI9F 4WH0A 5CFLA 1WEHA 3CXUA 3GVPA 5AW3A 2DLDA 1G5RA 3K6RA 1BD3A 1KZ9A 1OE0A 3IQIX 3L79A 3NV9A 4PR0A 1SEVA 4L8VA 3GX1A 3ZDQA 2AOUB 4URWR 1R8XA 2HQOA 2HMUA 3BMQB 3N0RA 4JI7B 3LYHA 3D3QA 1I13A 1S3FA 1X3LA 3WGTA 3BA1A 3EXFA 3KKKA 2GUWA 1J00A 3HKBA 5KVAA 2JJ2A 1CY7A 3E0XA 4QXRA 2OYCA 3FBWA 5BV7A 3UIEA 2EGUA 4X1KA 3TI7A 1U5AA 3ENNA 1GFIA 4UOQA 4B6OA 3IDAA 2ECFA 4J75A 3ZN2A 4LOHA 2JH8A 1CRZA 1EX9A 2QNIA 3F47A 2C9DA 4RJIA 4L74A 3V4SA 2ZTSA 1BDMA 3JTMA 1HETA 4BQPA 3ZYCA 1WNTA 3CN7A 1PR4A 4UDYX 5EWMB 1PJ4A 3H87A 4EY5A 1KTIA 1TK3A 4AJ1A 3UJCA 4NNJA 4RA9A 3S5UA 4F2GA 1ZONA 2VK1A 3I64A 1KZ7B 2RAPA 3UW1A 1JEQB 1ZXBA 5JYDA 5HOQA 2I2CA 3ZU2A 2XDQA 1CJBA 2XNSA 3ETDA 3GJXC 3JWPA 4IUCS 2XZTA 3L7YA 1OGYA 3FB4A 1AKMA 2ZR9A 3LW8A 3NWEA 4PAQA 2HF9A 3DQPA 2FWAA 3CVYA 4HUQA 4JGIA 4ZI3A 4ESEA 1TJ3A 5K8JB 1PG2A 4KXYA 4J4HA 4PICA 1KZHA 3AM1A 2VJCA 4JX9A 5HE8A 3WAKA 4WINA 1UDAA 2O20A 2ZJ8A 3A3YA 1RE1A 3IHTA 3MUFA 4W5HA 4WWHA 1DKOA 3DJYA 3LQKA 4Q15A 3MT0A 2MYNA 2ZDGA 3ZGYA 4ASUD 3X1ZA 5EIXA 2CLLB 3VPGA 3ZZ1A 3K16A 1T0HB 1E3MA 3ETLA 2ARKA 2O4UX 2QG4A 1F38A 1KSJA 2WOOA 2IF2A 3ZGXA 1KVSA 1MGPA 3INRA 1IFXA 1Q92A 1KOFA 3UAWA 3R6DA 3EULA 3RK0A 5KQRA 2BBSA 4H3HB 4QUJA 3VVBA 4A0FA 3E15A 1X0VA 3CF6R 1JT2A 3MGCA 4ZTUB 1H05A 4HX9A 4REQB 1S7GA 1N2XA 4EW2A 2X4LA 1G0OA 3REQA 4CCWA 3LYUA 4IQ0A 1E6CA 1UPFA 3ZI4A 5YASA 2VK4A 2PGNA 1X1EA 1IONA 2Y0BA 3EUAA 3QVXA 1PV1A 4K46A 4R41A 3HABA 4KGDA 4YCAA 4B0PA 4EPVA 4N5MA 3T7DA 3MCWA 5F23A 2GK3A 1W88B 3AR4A 5DZSA 2ON6A 1EDBA 1KFCB 1Z4LA 2X22A 2F2TA 2V54A 4WX2B 4HAIA 3Q3IA 1UZLA 4LXGA 2V6JA 4ME6A 1PT9A 2I65A 3W2GA 4CCYA 3F0TA 2N46A 3CF4G 3OJFA 4QRIA 2JFPA 2VBFA 1WP9A 1E2EA 1ZC4A 4BMNA 3BIJA 1TQ6A 4OGLA 3TL3A 3V1LA 3OCYA 3F3KA 3DTVA 1ZVJA 4EQ6B 4JI4B 4EZBA 1ICIA 3K2IA 4FPXA 1G5TA 2GAAA 5DH9A 2ZYWX 1G8JA 2ZTMA 1LS6A 4XEHA 2VZEA 1QFJA 5EJIA 3IVMA 1N5DA 2J3EA 3W5UA 2HBZA 4DV5B 3DOCA 1JPJA 3B6EA 5ETJA 1GGKA 1QB8A 1QJ4A 2QY9A 2VQ6A 2Z30A 3H86A 4LHXA 4M1SA 4QFDA 4A91A 3LKVA 2XCTB 4DV4B 3RS8A 2HADA 5F35A 4BLVA 3LP5A 4X1YB 4B46A 1E7RA 2X7XA 1P4JA 1FSGA 3TRKA 2XNJA 1Y9EA 1ZJ5A 2Z43A 4HDAA 4RPGA 3CNQS 3OTHA 5A5FA 3RVDA 3V2HA 3Q3VA 4HEQA 4CKXA 1Y37A 1ZA2A 4H4EA 4RFSB 1DPGA 1VCOA 2JAWA 5C1DA 2FK7A 4QBGB 4HNGA 5FPSA 5D85A 2GASA 2IXBA 3FOWA 4O4LF 4PU0A 2O7SA 1CQIB 3RREA 2O2EA 5DYGA 4IXDA 3HJFA 3VGPA 5I9BA 3JQBC 1R74A 3ZEAA 1B73A 1M0WA 3DHWC 1XYYA 3KL2A 4H35A 4A15A 1FZTA 2ZSAA 4M1KA 1NYQA 4TMKA 3EG5A 3CUSA 1VYHA 2JJMA 3R6WA 1QTIA 1XU7A 2QXTA 3DAGA 4IJVA 3I6YA 5LZ9A 5EXTA 3QIAA 3CUTA 2WYIA 3DMDA 4EL5A 5L7WA 1ZHOA 5AWFC 4R1PA 1NQAO 2C2BA 3ACDA 3N39C 3CZPA 2WRZA 5CLLA 3D2AA 1HXHA 1DVRA 5BOSB 1NL3A 3M1AA 3I2YX 3KDSE 3KYBA 3ILXA 1BEUB 5F7XA 3K71B 1XRSB 3LLMA 1ZH4A 1XHLA 4GM1A 1SVIA 2HT6A 2PX0A 2XUIA 3EZNA 3QVSA 4MYHA 4DF3A 4U63A 1PYDA 1K5PA 1XRLA 2EJUA 4IEIA 2D59A 2ZE8A 4UAGA 1MAWA 1YXMA 2CBGA 3FNRA 3NS7A 4ZVRA 4B2PA 3OFVA 4WCFC 4CFYA 2KB0A 3DONA 4CR8A 1NE7A 4DA9A 1NZJA 1I30A 3R3UA 3RYIA 3MLAA 2C5HA 5E6SA 1R16A 1JXOA 2GA8A 3MWYW 1TCUA 3EX7C 4ZQGA 1WO8A 4QJBA 1FK8A 4P6VF 3T7IA 1M8GA 3WV5A 5MFPA 1CDOA 1P1RA 1U5BB 1PQWA 4HR7A 2VP5A 5IXYA 4AG6A 2BFCB 4TL6A 1P7ZA 1VGQA 2I4LA 4GGPA 4XCXA 3ZY6A 4EI8A 2A6PA 3WHLA 1BROA 2IY8A 3GPDG 1JXAA 1YA8A 2AGVA 1XCPA 5HR5A 3WA7A 5E7IA 2PSEA 5JATA 3B6MA 3L2OB 1B8UA 2UYCA 621PA 3CH6A 3G82C 3UG7A 4GU5A 4HQFA 4MMZB 1PFYA 4E2FA 3ZU3A 5C2JB 1J0XO 2W6ZA 3CY6A 3NHLA 4H6VA 5F1KA 2DT5A 4IWXA 5K3BA 2JFUA 4ZKDA 3IOMA 3COPA 2WFZA 4AZVA 4V39A 4MYTA 4IFIA 4JS0A 2W6NA 3CX7A 3HUUA 4MP6A 4D56A 1NW6A 3H13A 3QF4A 3H8WA 4YCJA 1JHDA 3WNDA 5C37A 1C9JA 1NXVA 1Y7TA 1LDGA 3KAPA 1E9RA 2BCGY 3R5SA 1JXMA 5D6OA 1O96B 3E9EA 1PWXA 2P27A 4MWDA 5EYPB 1W75A 5GOZA 2AMYA 3F5DA 4BO2A 5I7SA 1EM8B 1Q2XA 1DO2A 2PRJA 3VAYA 3RQSA 1KBOA 4IDHA 3VJRA 5DHSA 5EYPA 2R11A 1RU3A 5IAKA 3KXIA 4A8JA 4HH3C 2HSZA 4MI1A 1DBRA 2FCAA 3A25A 3R0ZA 2HU5A 2A94A 2FN9A 5KC9A 1CDZA 5K3AA 1C0PA 1A4RA 1QFSA 2Q5EA 3WLQA 4IJ5A 1G2OA 2NU9B 1KY3A 4A10A 4A0RA 1KP9A 1XZFA 5ALJA 4BE4A 4BNJA 4ZDJA 2DHCA 1THTA 3ZIAA 4FWBA 1VKRA 4G26A 4LJ4A 4BMZA 3AG6A 1Y98A 3DDSA 4R1TA 4D3YA 4YUXA 2Q8QA 1NYTA 1PEDA 2GWHA 4NZZA 2HF2A 2JGIA 3PJEA 3EODA 4M21A 2DTXA 3KUKA 5ARDA 2Q5HA 4WLUA 5DK4A 1J2YA 4AZ0A 3L8YA 2Z8ZA 4ZVLA 3TVYA 1E4YA 1JG6A 3OSZA 3AI1A 3QVWA 5JYCA 4QGBA 1KDPA 4EPXA 2JHGA 1VPDA 2VF4X 2REOA 2P6OA 4GR9A 5FWDA 5JE8A 3SY8A 2LUOA 2NPOA 2G9UA 5TMEA 2AZTA 4DAOA 3IXQA 4YJ2B 4BZXA 5K45A 2QG6A 2IOHA 3OF5A 1FP1D 3DWIA 3EJWA 4DKJA 1I33A 3AUXA 4IDNA 3T3DA 3RWMB 1DZ3A 1PJQA 2G5CA 4O2AA 3A70A 4OQZA 4UEJA 3MJHA 2QROA 2CDCA 4HLUC 3ZNNA 3GV0A 4YUZA 4K2HA 2HQSA 3RGGA 2H7VA 2QTMA 3BH0A 2JKVA 1DAMA 2EFHB 4QOEA 2IDMA 3AL0C 1MHPA 2GAJA 3OZ7A 5IVDA 3OHPA 1KOGA 4M36A 5J63A 2DPMA 5HBGA 1LXCA 4HUTA 4AECA 1T3SA 5F9HA 2JI9A 4JP3A 5CW1A 4UCQA 4JBIA 5AUPB 4O0LA 2YZGA 3HWWA 4G36A 1HQCA 3DBRB 4YROA 2KE5A 4CU2A 1VE9A 1MUUA 4EATA 4DWJA 1ESEA 2FHSA 3D6FA 3ZHOA 3E7PA 3F6BX 2NPFA 1WB9A 3V4VB 1ETUA 2OHJA 2HXYA 5EUBA 1HM5A 2OAP1 2VKTA 4HAXA 1SOAA 3WLAA 4ZVMA 4UASA 2GESA 4GXRA 5EWLB 4NHEA 3V55A 4YJ2F 3HXOA 4MIOA 5AOVA 4QJIA 3UH0A 1IOVA 4AUNA 5KMGA 3ZR4B 1KC3A 1WXDA 4L5AA 1X19A 3TSCA 3EN0A 3WGHA 1B6TA 5AW5A 3JAWB 4R2XA 1E2IA 2I1WA 3QJ5A 2ZITA 1U98A 4G4SO 5HK9A 1WJGA 2IVFA 4RAOA 1IIBA 3AR3A 4PN7A 1WUHS 2Z6VA 5IFLA 1N8NA 3HP4A 5KYUB 4O2BB 1KSHA 3KTFA 4EG3A 1G0NA 5ALUA 2CZGA 2QTZA 2XHEA 4RHCA 2NZ8A 1PNOA 2BELA 3F49S 2OCDA 2F62A 2YJNA 4H0NA 3TRIA 4XWGA 2NU8A 4BPBA 1KAEA 3H4TA 5LOVA 5I8PA 1TADA 4XUGB 1NPTO 1J09A 2HA5A 4KDCA 2EV9A 1JPVA 2Z9CA 5JY1A 1JJAA 3JU3A 4RESA 3GNQA 3KO8A 5DX0A 4LGYA 5LOVB 1ZCZA 4TKVA 1XLVA 2XEDA 1Z2NX 2FZKA 2OFOA 3EZ7A 3ILHA 3W8DA 5JXHA 1BD4A 3OPYI 4PY2A 1NBEA 3D3EA 1K8ZB 3O83A 4XM0A 1WTCA 4NMWA 4YFVA 1EZ4A 5BSHA 1D9ZA 1OLUA 3LBHA 3O2NA 1A8SA 2DWOA 3AFNA 1JHUA 1ZITA 1DX6A 2BGRA 1SIOA 2O57A 2ZAOA 4PYNA 4MGKR 4PHHA 3R5KA 3DCIA 4KO8A 1ODKA 5JXGA 1ZFNA 4WD3A 3ZV6A 5KTYA 3PHIA 5KEIA 1N2IA 4DLVA 3KVYA 3MOGA 1LNQA 3KYIB 1ZX1A 4MRPA 4GI7A 4NCJA 1RQ7A 2GEFA 1A2QA 1NV9A 1XJ5A 4HS4A 5DBEX 2CJWB 2Q2NA 4CW7A 5CFPA 1G64A 3N2IA 3VX3A 2F4NA 2PL1A 3UM9A 3NHPA 1NBME 2HLHA 1NASA 1JBKA 4CMIB 2X2PA 3C97A 4MW4A 1L7NA 1ZPDA 5TPWB 2WZQA 2VF8A 2YUTA 3ONVA 4WKOA 1AUPA 3V1KA 2IPNA 4BFSA 3AINA 3JQBA 2HT1A 2C8LA 1Q12A 3SM3A 4BB9A 1V1RA 3F4LA 3FLBA 3ACCA 2E48A 4M55A 4BC0A 4LUCA 1SHZA 4RJTA 5JD5A 3FPCA 2XUPA 4IUDS 4EY3A 2W43A 1MW8X 5IDYA 2DPHA 3CKLA 1D8TA 4RHYA 3IEMA 2R1ZA 1XD2A 5BSKA 2WIFA 2HU8A 2VXOA 3AVXA 1KARA 3TTYA 2QMQA 5JJ5A 4PZ9A 4XM2A 4RIGA 5J58A 2XAAA 3I45A 4LDZA 3TAXA 1GZVA 2C92A 4MR9A 2GVDC 4UREA 5SY4A 3ADCA 5EXSA 1BDJA 3D3JA 5HVNA 2HA7A 4PZDA 3TL2A 2QN2A 4PG8A 2R6DA 5J4KA 4TXNA 1MT0A 1MH1A 1Z75A 3BK1A 1SBYA 3E8XA 3V80A 1GSOA 4E88A 3PNSA 1LBSA 2CLCX 1GGMA 2B8JA 1ILEA 3X1WA 1HG0A 4D4HA 4EY7A 3BILA 4FD2A 5LM3A 2F8SA 1XROA 1I6KA 1YS7A 2QTTA 2ZFUA 3B38A 3SR0A 5CBPA 1VIYA 4UAJA 3HJGA 2HZ7A 1IEWA 1OLXA 5A05A 1XLTC 2XYHA 4F4JA 3U9SA 1EP2B 4WXEA 1N7HA 2HKIA 1I2ZA 4YP5A 1P1HA 4RORA 3HNOA 1XRPA 1TK9A 1X7HA 2WJHA 3DLPX 2F9FA 2JGRA 2Z1NA 5CR9A 3F74A 2CVQA 4HWTA 3MTBA 3DYIA 3AKZA 3ZLBA 3S81A 5JMTA 1V96A 1WB6A 1WMFA 2BGIA 2AN9A 2EARA 1ESMA 1CZOA 1W2GA 1WWKA 3EXFB 5B58T 3VI3B 3VR6A 3VR5A 2OD7A 1G5IA 4LYYA 4KGVA 3WIUA 3OAAD 3ESXA 4JJFA 3AHIA 1J23A 2RGGA 3AVQA 3DM5A 3OA2A 3OVMA 4LNHA 4P3KA 2Q2QA 3SI7A 3UICA 1KFEB 2ECKA 1N5KA 1GQFA 1EFRA 2E6KA 2X1VA 4FGWA 3IEUA 1EUDB 1URPA 3JD3A 5ALWA 2IIPA 3A11A 4BS9A 1XDZA 3MQ4A 1ORIA 2HIGA 1VCHA 2OVFA 3OH8A 4GE3A 4I9GA 2AJCA 4XVRA 2F64A 2PZMA 1XA3A 4IICA 3P5SA 4B82A 3SZOA 2FRDA 3W8FA 3QU2A 3T38A 1DIBA 2EKDA 2PGAA 4M6WB 2C3UA 3H2ZA 4KR0A 1LDEA 2FH5B 1PQ4A 3WNVA 4D9CA 1PTKA 2O2ZA 3AEQA 4L28A 4MRVA 3B78A 1SRQA 2BMJA 4Q4LA 2I62A 3ZPXA 2GO7A 1QVRA 3GJ3A 5C32A 3ORSA 3O82A 4D4IA 4JOCA 1R6BX 5CB6A 1F2UA 4KXQA 5A2GA 2J9RA 2B3TA 1N6NA 3MRXA 2B1QA 3PGVA 1TUEA 1KSFX 3GJYA 1U9ZA 2XIJA 5ELLA 1R0WA 3QWIA 3LBFA 4BPRA 3GAAA 2GM5A 3T3MB 3R74A 4ZD6A 4RYLA 4XYGA 3NVMB 4QTYA 2CYAA 3DKRA 1XN1A 1VPLA 4XVHA 1NATA 2ZB4A 2P7HA 1E1NA 2B4RO 4FQ7A 5JHHB 3OCVA 2FSGA 4YP0A 4OHBA 2C3MA 1M8KA 4LRXA 4QPDA 5CM2Z 4D44A 1VXOA 2HREA 3QX7A 1JIUA 3CH4B 4KR7A 4FNAA 4HRVA 2FPOA 2PNJA 2D4HA 2HOQA 4NK5A 3F5SA 4TS3A 3LXUX 4TXJA 3T0IA 3FF1A 5D3ZA 1VZ2A 3STYA 5BN4B 3H5OA 3FPBA 4D0NA 3MINB 4TSFD 3RFXA 1T3ZA 4R5MA 1XA0A 4CL0A 5KCMA 3V1UA 4EYKA 1KF0A 2OGSA 5JLJA 1F2DA 5TPZD 1TF2A 1SELA 4IOJA 5KQPA 1C7RA 4NCXA 4XWOA 1ZNZA 3MPUA 5D6NA 2YXNA 3LC0A 3HUTA 2EW8A 2N3ZA 2VBCA 3V48A 3N5CA 3D8TA 3TG8A 1NC1A 1S3SA 1OZHA 4RGYA 2QMHA 2W2MA 3FKQA 4H1WA 5AW4A 1JR3A 2D5AA 3MVEA 3C3DA 1JB1A 4I14A 4DRXA 4C20A 1UODA 1FFXA 4UM7A 3R1IA 3QE3A 2Q8PA 2VHUA 1OREA 3DZ8A 5JCOC 1R0KA 2PS3A 2PBRA 2RAUA 2XVYA 2TMDA 3M9LA 3WHIA 4BEWA 5EHXA 2WU3A 2R6CA 2JGJA 2CFTA 2XNDA 3KXPA 3I30X 4DRXB 4LF6B 4HSEA 3FKSD 1P9LA 4ZJYA 1ENZA 1GN9A 1L7DA 3AM3A 2P35A 3HYLA 4LBZA 5JYBA 2BTEA 3MM4A 1RI2A 1NI4B 4AY4A 1P3JA 1PO7A 3B9QA 4CBVA 4O1MA 1MMFB 1Y8RA 3W4KA 1QO0D 4OA5A 4RO0A 1WG8A 1JR3E 4KGZA 2PUTA 5GONA 5B2FA 3FBGA 1ZM4A 1ZHFA 2PPVA 3GF4A 1FYEA 4YI3A 2QLJA 3A4VA 5JW6A 2PX5A 4JN6B 1GCUA 3GQBB 4X8MA 4QDJA 4DRYA 1T13A 4BO7A 4RF2A 2KX7A 2WSYB 3BZWA 3LECA 3OIYA 4K9DA 3W9UA 2X13A 1JQ3A 3NXSA 1JLSA 4R01A 1U2PA 5K51A 2C84A 2HQ1A 3RS3A 1T10A 1EG2A 2XUAA 3GO4A 4LBVA 5B3LA 3Q7PA 4BNIA 3SHWA 4CM8B 1NUHA 2VNSA 1YA4A 1ZI9A 2WHPB 3T3GA 1ENOA 3T5GA 5ESDA 1HNWB 1SVKA 3M89A 3H4VA 1HV8A 2IUSA 2NSJA 3PJGA 4EJ6A 1JA1A 1O94A 1MXHA 1YFKA 4MLDA 5LUBA 5IABA 4D46A 1SOMA 4LS3A 3MHPA 4QYXA 1C3LA 1C0EA 4BYGA 3TQQA 2FQYA 2ZWVA 4DW8A 4UBMA 2HIHA 2XWJI 1HYQA 2RAFA 1WF6A 4BX2A 5DNCA 2XA9A 2HM7A 2NU6B 2NZXA 2JG3A 1M2HA 1ISIA 1H9BA 2GNOA 1YS9A 4YPFA 5M2QA 5IKXA 2ZSDA 3EZ6A 2I3ZA 2IJGX 1T24A 2P7IA 2O1SA 1F0KA 2ZRAA 1LRKA 1ZOLA 3CZMA 4UULA 4BO9A 2VXYA 3JSXA 2FI1A 4JENA 3QOXA 3QU7A 1B42A 4JWKA 3OP4A 3NHUA 2QLMA 4BO1A 1E1RD 1UBFA 2XMGA 4X44A 3ANLA 3WK6A 3ZE9A 1BDIA 2FPMA 3CLKA 3JASA 3OOYA 2XKKA 4OLBA 2IPXA 1AN0A 3SEQA 3HFJA 4WN9A 3YASA 3VR6D 5IVPA 1X77A 1E3QA 1WMAA 2YFKA 1NP7A 4YJGA 4CM6A 4N18A 2CFOA 2YZ7A 3C74A 3EAFA 4BFCA 4HRXA 1EHYA 3S44A 4AJJA 1RW4A 3TTXA 3PQ4A 4BC1A 1UZMA 4EJ0A 2QL9A 4OX9B 3JW8A 3JD1A 1U3FA 4QRHA 2ZZKA 1YZTA 2D2EA 4MJ7A 2UV8A 1B8NA 2FZCA 3BD8A 2GKGA 1L5FA 2BFCA 3PQCA 1CVLA 2FZ5A 3A9RA 1KDOA 1I7PA 1E2UA 1WZCA 3OCXA 2OBXA 2X6TA 1QBKC 2J6HA 5THXA 5F9MA 3UJNA 2QVGA 5JS6A 2P65A 4OGGA 3D6NB 2MINA 1IZ0A 4A16A 4YP7A 4A8JC 3RUDA 4LGMA 3SEFA 2C94A 1X3SA 1QHNA 4FN5A 3QUBA 4LOIA 3V1TC 2Q5IA 3FOZA 5IC4A 3N5KA 4RKEA 4BNLA 3U1VA 4X45A 5KREA 5F98A 4TZ6A 4R16A 2PCLA 3LCMA 4LTDA 2Q9UA 2V0NA 2XMPA 5KZMB 3V32A 5HW0A 4Q3BA 3SSAA 3VDMA 2CNDA 3R0XA 5HEKA 4DANA 4E21A 5ALEA 3B82A 4BP8A 1UXIA 4CQLB 1ZMXA 2CJYA 2NAFA 1BFUA 3NHFA 4OIFA 3BWDD 1VMKA 3IQHX 3F5MA 4Q1CA 3TBHA 3H65A 3Q88A 4LXXA 5DHPA 2I4MA 3U09A 1MTZA 3ZV3A 5KOJB 1AGNA 5CA1F 3TZCA 2GN9A 3HYTA 3IS3A 3VKVA 5B4VA 1CR0A 1PVVA 3K0SA 3DXFA 1TUBB 5A7HA 5I7EA 5BN3A 1G55A 5AIAA 5EIAA 1M0EA 4JFRA 3CINA 2RGNA 2P67A 1KO5A 3TCNA 3BTOA 5E0OA 4CV3A 3AJ8A 4HXYA 4XGQA 2H8GA 1PEKE 1YDHA 1Q3KA 1E9AA 1JSCA 5DLYA 3K32A 3UOAB 5K3FB 1SKYB 4D0RA 2BGKA 2BF7A 4TOIA 1DTEA 4G1BA 1EJBA 1YR2A 2YHIB 4MB2A 2VPQA 2W71A 1NRWA 3E35A 4KG7A 4FINA 2C2HA 6REQA 1NBHA 1PI3A 2FVYA 4DR2B 1UBKS 2FLKA 4FDMA 4XDZA 2FPRA 1SBQA 4TL8A 2XY4A 4KN8A 4BWGA 1I94B 1YJ5A 4YUAA 2BC9A 1KHTA 1L4NA 1X8LA 1YQWA 2IZZA 3BL5A 4FXPA 5HKOA 2OOSA 1MLDA 2I80A 2P9GA 3LA8A 4EMUA 1RAEA 2YDXA 2IELA 4M0CA 3E9MA 3EDMA 5LDHA 4ZRMA 1QG2A 2XMSA 3DEYX 4KOAA 1S8OA 1ZK4A 1HA3A 2ZI6A 4QWMA 4Y6OA 5C5DA 5K0JA 3AVYA 4HFNA 3VUFA 3HFSA 5L51A 3IPRA 4CT4B 1P9NA 3THYB 1QPGA 1SQ5A 3PR1A 1KEEB 1W0JA 4R8MA 5CYPA 5CLQA 2W2QA 3QX9A 3W3ZB 1N7JA 5HS6A 3Q9UA 3LVRE 4NFHA 3HGQA 3BRSA 3MMZA 4AY2A 3UVEA 1AJEA 2YYSA 1Z38A 2AJ8A 2Y67A 3TNLA 1I3NA 1Y1RA 2YNMD 4KMOA 3B1WA 1VIVA 4DAEA 2H1FA 1RYZA 1TYZA 3DZKA 3TVTA 2FV8A 4KRXA 4OU4A 5EKXA 2ZXFA 3V9AA 4NLLA 2AZDA 7YASA 3RBXA 2D6FA 1H0SA 5A71A 3GLGA 2CSXA 1XCOA 5ECYA 3UAGA 1VPVA 5A1JA 4UBOA 5DGDA 3ZK7A 3OE4A 2B94A 2ECQA 3O91A 5LP6B 2BM0A 2ATXA 1K4KA 3WL5A 4YAUA 5CNKA 3DPSA 3GLGB 1C0KA 1O95C 4M8KA 5FFMA 3EXEB 4UHEA 3SNKA 3CGGA 1A97A 4DGSA 4IVRA 5AXBA 3O4GA 4E08A 1C8LA 1OXXK 1NIPA 2WUDA 2X5JO 4XIFA 2AMVA 2O3QA 4E11A 2KYRA 4ANFA 1J2UA 3JQ8A 5J4LA 2C1EA 3HJBA 5EHGA 2JGEA 3TCKA 2C9ZA 4YRKA 3D6TB 3JTEA 1Q0HA 4AKHA 5AOBA 5K8IA 4URUR 2YJ3A 4M1YA 2ADOA 3TFOA 4HPWA 2CK3D 5CDFA 1DTWB 4H4CA 1IXRC