1IZ8A

Re-refinement of the structure of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE, LINB
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 116
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iz8A00
2Y1KA 3OC0A 4J0DA 1CUDA 3V48A 1H22A 5AM4A 4EY5A 4KAJA 1TAHA 1E89A 5CTAA 4CIBA 4FTWA 1BEZA 3SK0A 4QE3A 3HRHA 4UBOA 4WY8A 5ALKA 1EDBA 2Y6VA 4AMYA 1T2NA 4G8CA 2ZSIA 1VXRA 2HL6A 2HADA 3RM3A 4WFIA 3FBWA 2C0PA 2YH2A 5AM3A 4Q05A 4UFPA 1LPMA 2WTNA 1CEXA 2BGNA 4RPCA 4UHCA 4W1PA 2FX5A 2BUBA 3BF7A 2EEPA 5C81A 3Q8WA 5K3FA 3C43A 5EIEA 4RGYA 2ZYRA 2J3QA 1K6EA 2QOEA 4X94A 2HFJA 4FBMA 5AK5A 5CH5A 4DTCA 4XJVA 3ILSA 2GBIA 4IH1A 3LCRA 1WPXA 1XZIA 2HIHA 2PPLA 4B83A 1BCSA 3R3XA 1J1IA 1E5TA 1N5RA 2ROQA 3C8HA 1CLEA 4G5XA 4BB0A 1QIIA 3STVA 1XZHA 1WHTA 1S8OA 4BRSA 5JASA 2WFZA 3R3VA 4X93A 3MVEA 4UPDA 3O9MA 4DNPA 1X70A 1W4LA 3R3YA 2QKYA 3CXUA 3B12A 4U2CA 1ZD5A 3PDCA 1JKMA 2DHDA 3DL4A 3H19A 2GYVA 3RK4A 1YR2A 3RLIA 3BIWA 1VXOA 2PU5A 1EX9A 4RNCA 4GWLA 4BAGA 1Y7IA 1Q0ZA 2PKYX 2BUCA 4DMHA 3AIMA 1XRLA 4IO0A 2RAUA 3WKCA 4EUSA 2W6CX 2HRQA 5ALZA 2JEYA 4FFVA 2V9ZA 5K3EA 4LIPD 2O2GA 2XMQA 4ZV9A 2CJPA 2PSFA 2Z8ZA 1WOMA 1HDEA 1CUGA 1E8DA 4H7JA 1W52X 5ALWA 3PICA 5K3CA 1QE3A 1EK1A 2WIKA 5JD6A 3FCXA 4ZWNA 2ORYA 5ALDA 5IVDA 4S0XA 4E14A 2OGZA 1XQXA 4ETWA 4XIIA 4B80A 1F0NA 1BU8A 1A8SA 3R3WA 2OXEA 3WLAA 2Y2VA 3T52A 4K6HA 5C8VA 1QO7A 4AO8A 2HA7A 3KD2A 4LYDA 5ALLA 3WKEA 3BDVA 4A5SA 1YS2X 4N5IX 2ECFA 1QLWA 5HF6A 1L7QA 2RI6A 3FSGA 3I1YA 5AP9A 5AI8A 4KJXA 1TRHA 5CT6A 3DJYA 4Y2VA 2X76A 2O7VA 4G4IA 2XQIA 3V1MA 3ZLVA 2JF0A 4QDZA 4X3CA 4W9RA 1JFRA 4QNNA 3GZJA 4JH0A 4BATA 1UKAA 1KU6A 2QS9A 5KWIA 1ISPA 2XMRA 2WG0A 2VA9A 2B4KA 3CCBA 1HLGA 3DLTA 1N1MA 4OPMA 5D3KA 4FFWA 5SYMA 1LPNA 3F8SA 1FFBA 1MO2A 5AHXA 2HA5A 3M83A 3G9ZA 4Y2PA 5AKKA 2H9YA 1YA4A 1E3QA 3AZOA 2RGUA 1RYYA 4W1SA 1UKCA 4TVKA 1QGED 1R4ZA 3CCCA 4EY4A 1CUIA 5FV4A 4BBZA 2XQKA 2BCEA 4GDMA 5EGNA 3V1LA 1F0PA 3WL8A 4BP9A 4BC1A 2R11A 4CG3A 1ZJ5A 2H1IA 1YB7A 2CUTA 3A2LA 1GPNA 5ALNA 1G66A 5CBKA 1MX1A 5JZBA 1IZ8A 5ALGA 3GBSA 5HFNA 5LKAA 4EZIA 5HF5A 3STXA 2O7RA 2OAGA 4WY5A 5A7HA 2CKMA 3WYDA 5BWCA 3AZPA 4DMKA 5JAOA 2PSDA 3C45A 2XE4A 1J2EA 4UHEA 4B9AA 1NU8A 2VQ6A 4RE5A 4PF1A 2Z3WA 4LXGA 1P0IA 1UK8A 1XQYA 1TQHA 5HQ3B 2XUKA 2D5LA 4GXNA 2I3DA 3FYTA 1UFOA 2RHWA 2WHRA 3G9UA 3IDAA 4DIUA 1HBJA 5DNUA 1WM1A 4HZGA 3O9VA 3PFBA 2R8BA 2WG1A 2V97A 3C6ZA 3WKAA 4Q3LA 2X5XA 1U65A 2WFLB 1JMKC 4YASA 1RP1A 1DX6A 4L3WA 4BTLA 4OCZA 3RARA 2PUHA 3ZWQA 3I2JA 4DYHA 2XUAA 2WFLA 5ALJA 5LZ9A 4MWSA 4JUIA 5C8XA 1USWA 2QXUA 1H23A 3WKDA 3DYIA 1IUNA 1E8MA 2ZVDA 1UT6A 1N5MA 2OGSA 1MN6A 1TCAA 2I3ZA 4O08A 2GYWA 4BCCA 5AM2A 2QZPA 4Q1VA 1GPLA 2XQJA 4ARBA 1QZ3A 1VJ5A 3OPMA 2AJLI 1WB4A 5ALEA 4AXBA 2GZSA 2VAXA 4EY6A 5JYCA 3DKKA 2Z5GA 1XZKA 3PUIA 4CCWA 5D3ZA 4PSUA 5DNWA 4NZZA 5FXMA 4HRYA 1D07A 1ZJ4A 1ZIYA 3D5EA 1VKHA 1XRQA 2BFNA 3FLBA 3HXKA 4GEGA 5LZ4A 5FLKA 2YASA 5C8ZA 1YCDA 3JWEA 4X6UA 5JD4A 3ZLUA 4EY7A 3KWJA 5KBYA 5CT8A 4K6KA 5E4TA 3DD5A 5AJHA 4Q34A 1DQZA 2BKLA 5K3DA 4BDSA 4FNMA 1DT3A 4A23A 2WUFA 2O2HA 3ESAA 1FFEA 3LP5A 4AB1A 5FKJA 2AJ8A 1GXSA 3LS2A 2WQZA 4BCBA 3SX4A 2XUHA 1ACJA 1LBSA 3HSSA 5C7YA 3BXPA 3VISA 4AO7A 4C4ZA 2WU3A 3I6ZA 4MEAA 4C89A 5AK3A 4DNOA 1CR6A 2VJCA 2LIPA 4KE6A 5SYNA 4JYPA 5DTIA 2HFKA 2XMSA 5ALIA 4RE6A 2WJ6A 3SWWA 1WPRA 5AIAA 2Z3ZA 4BC0A 3ICWA 5ALUA 1QIFA 4B0PA 4AX4A 5CXXA 2OLEA 3AINA 4HXFB 4B84A 1ODCA 5LIPA 3AJAA 3F67A 1X2BA 4BRZA 1XRPA 4BYMA 5LYYA 4JEIA 4UFOA 1WB5A 5ALHA 1U8EA 3WK9A 3H18A 2ZJ6A 5D6OA 4FHZA 1FJ2A 1CV2A 2QUAA 4G4GA 1T4MA 2AJBA 1QTIA 3G0CA 4OU4A 2WHPB 5CT9A 3D7RA 5JAUA 3L1JA 3EQ7A 1CUWA 1XFDA 3O4HA 3R0VA 1QIGA 1QJ4A 2JEZA 1ZI6A 1EH5A 2XUPA 4BVLA 3C5WP 1HQDA 3C6XA 4X90A 1Z68A 4Y2RA 1UK9A 2XUFA 1JMYA 1MX5A 5HZGA 4Q82A 4X97A 3PFCA 1ZI8A 1EA5A 4DNQA 4ARAA 3D2AA 3WK5A 4TPKA 2C4HA 4AO6A 5AH0A 1JT2A 3BJMA 4ZREA 3HC7A 3IUJA 1JJFA 4WDRA 4J0CA 4XWGA 4CG2A 1J06A 5HFAA 3IB3A 4EY8A 1ZD4A 3D59A 1UK7A 1LPOA 3O4IA 4N8SA 2PM8A 3OTQA 1FFDA 2JGMA 3WA6A 3STYA 3W9UA 4W1QA 1GPKA 1UZAA 1CVLA 3I2KA 3QPCA 4OB8A 3BL8A 4C4XA 5K3BA 5JALA 1XZCA 4MQMA 4GECA 4I3FA 2BUAA 5AI5A 3O4GA 3H1BA 2WSLA 3D0KA 2QMQA 3HYSA 1CUYA 2GYUA 4FLFA 1W6RA 4NVRA 2RIPA 1X2EA 1DQYA 3R3ZA 4J7AA 4GW3A 4D9JA 4OYLA 2FJ0A 3AIOA 3H2HA 1ZI9A 2VSQA 3WL7A 1K63A 2B20A 2JIDA 2XQGA 3U1TA 4J0IA 1DWOA 4Y2TA 2H7YA 4J3JA 4A16A 1TCCA 4K5QA 5E4YA 1W76A 5FOQA 3M81A 1MJ5A 2PVSA 3C87A 4BDTA 3BIXA 1GQRA 1XZJA 4L72A 4H7FA 1WB6A 2OAEA 5A6VA 4UHDA 4EA6A 3TEJA 3FYUB 2AJCA 4C4YA 2JBWA 4OB6A 5HKAA 1ORWA 1IUOA 1IVYA 2VEOA 2XUOA 4LYEA 4QEKA 5JIBA 5DNVA 1YASA 2WUDA 3QITA 2DQZA 1MPXA 3G0GA 1ODSA 1SCIA 5ALQA 5AM0A 2HA0A 3VKFA 4Y2XA 4OYYA 1UWCA 3CN7A 3X3HA 1XZLA 4DSAA 1DU4A 4B0OA 2HA6A 4MWTA 4BAZA 4Y2SA 5IVKA 3KOOA 4K6GA 2OGTA 3TJMA 3I6MA 1O6FA 1I6WA 3A2MA 2WUEA 1PFQA 2HHAA 2VT6A 1P0PA 4LXHA 1G5FA 5DLPA 3DOIA 4N8DA 5JZSA 3DL7A 3DOHA 2OCGA 2PUJA 5JD5A 2PSEA 4J0GA 1UOQA 1C4XA 3LIPA 1YAHA 3QMVA 3IUMA 5K3AA 5JANA 4QLAA 4FBLA 2C58A 4YPVA 3W05A 4WDQA 2K2QB 3M3DA 4G8BA 2OG1A 4M0FA 1QIMA 4EB0A 4J03A 5JZ9A 3STUA 3L1HA 2RONA 2VT7A 1AKNA 3TGLA 1XZDA 4FNGA 2VJBA 5AK4A 1AQLA 1ZD3A 3C5VA 5T4BA 5EI5A 5ALRA 1BE0A 4OD0A 1K4YA 1LBTA 3MUNA 1QFSA 3DEAA 3VJMA 1Y37A 5AIBA 1FFCA 4PSDA 3L1IA 4DLNA 1AGYA 5JATA 5EFZA 3WL6A 5ALVA 3C70A 2H7CA 1W1IA 2QTBA 3QVMA 3E3AA 5CH8A 3F96A 3ESBA 5AKHA 1LZKA 3G02A 2XUIA 3LIIA 4X6XA 3SC2A 1DWQA 4H7HA 3I2HA 2GBFA 4XVCA 1YA8A 1XLVA 1Q0RA 3WL5A 2JGJA 2HA3A 3V9AA 5FUMA 5LZ5A 5EIHA 2WG2A 5AKYA 3GUUA 1ODTC 4QA9A 4EHBA 3E1GA 2W22A 4U2DA 4MQLA 3H17A 2YXPX 5LKRA 1GKLA 4KAFA 1YB6A 1CUFA 3WZLA 1XQWA 1CFJA 3WIOA 3PF8A 5A7GA 4X95A 1THGA 1CUZA 1VZ2A 2CZQA 4UHFA 1QIKA 3W2TA 1AC5A 4WFKA 5CXUA 2VJDA 5H3HA 3OM8A 5HK9A 4Y2YA 5HQ3A 4BVJA 2CB9A 1DX4A 1GGVA 4NMWA 4PQEA 1CUJA 2HDWA 1VE7A 1XLUA 4KE8A 3DDUA 4AZ0A 2BGRA 1P0QA 1AUOA 3QPDA 2BAGA 3I2FA 1A7UA 2VAVA 1C7JA 4H7DA 4BCDA 1CUAA 5FPQA 3ZV7A 4LKOA 4PNZA 4Y2UA 1AX9A 4G4JA 5EHQA 3E4DA 3P2MA 5ALPA 5CT5A 3E0XA 3NWOA 3HI4A 1BN6A 2XQFA 1CQZA 5AK6A 2J3DA 2XT0A 4B6GA 1MX9A 4UBNA 5DYWA 3FLEA 3ZPXA 1QONA 3T4UA 4N5HX 4C88A 4MXDA 1CPYA 1E66A 4E46A 3H1AA 5AI9A 4B81A 2DQYA 2XUJA 2GZRA 3FYUC 4YX9A 4H0CA 2WUGA 4FWBA 3WMRA 2IITA 2WILA 3R41A 4I4CA 4CFSA 3WWPA 1JU4A 2VF2A 1XZMA 3WJ2A 3OOSA 1A88A 2PSHA 5DYTA 2XMDA 4UBMA 4H18A 3GELA 1SC9A 3PI6A 2J4CA 3GROA 4HAIA 3MGAA 3STTA 4OSEA 4JYMA 4WJLA 3WZMA 4CCYB 1ETHA 2C5FA 5T4EA 5YASA 1CUEA 2E3JA 4P08A 1OXMA 4UUQA 5AO9A 3LLCA 1QO9A 3NUZA 3QBJA 1NU6A 5F4ZA 1CQWA 1ZOIA 3QMMA 1PV1A 5FP0A 3K6KA 5FRDA 1BCRA 3B3QA 4DMCA 1QIJA 3KWFA 4K2AA 4X91A 2DHCA 4KE7A 4BTVA 1YAJA 3AZQA 2V96A 3R3UA 3WWDA 5AI6A 1GT6A 2Z8XA 5AOBA 4UBLA 1E8NA 2NW6A 5CT4A 3HZOA 4Y9SA 1B6GA 4QDOA 3K2IA 1CUXA 1TK3A 4H7EA 3D2CA 5AKEA 5HKBA 4X92A 1G4HA 5AKLA 3F98A 4UBKA 2RHTA 4DSZA 5EHZA 3I2IA 1K5PA 2Q0XA 1FFAA 2P8SA 4ITVA 1JJBA 3BWXA 1M33A 5A2GA 1LPSA 1GZ7A 5AICA 1SOMA 1XLWA 3O95A 1WHSA 1YSCA 7YASA 4BVKA 3D3NA 3EF3A 4F5ZA 4PV7A 1MNQA 3G9TA 5AKXA 1XZFA 2WHQA 4GLBA 5AKIA 3YASA 3GA7A 2WHPA 1MU0A 1MTZA 4G1FA 1QIHA 5IVHA 3W06A 4QWWA 3ICVA 4AN1A 5LZ8A 2ACEA 4BE9A 4V2IA 4KRXA 3ESCA 2HU5A 5ALOA 4KR0A 4QDTA 3JW8A 4W1RA 4AQDA 5KREA 4JNCA 4CI9A 4OUKX 5I9IA 4GBGA 1ACLA 5AKGA 5I8PA 3EQ8A 2HA2A 2XLBA 3AFIA 2V98A 3HABA 3I28A 5ALSA 1R9NA 2QR5A 4WFJA 3NOXA 4BE4A 3FWHA 2PL5A 4GHWA 5JARA 4H35A 5FPPA 4G9EA 2ZYSA 3C6BA 1UXOA 5CURA 1BRTA 3VVMA 4FOLA 3BDIA 1XRNA 2VJAA 5K3FB 1EXWA 2WTMA 4HS9A 3RKSA 4KAAA 3HJUA 1XRRA 5ESRA 1CIJA 5IVIA 4IHAA 5HF9A 1ZGBA 3HACA 3WK7A 1AMNA 4QZVA 2PX6A 4F0JA 2XMBA 2HA4A 5ISMA 2PSJA 1AURA 3KDAA 1XROA 3V1KA 5A62A 4FLEA 4U2GA 4KEAA 3G9XA 1WCYA 1EVEA 2WLSA 4H77A 1CRLA 1SFRA 4DMFA 2XMZA 2DSNA 2WJ3A 1GQSA 4EBBA 3WI7A 2HU8A 4XX1A 2ZSHA 4YK7A 3IVMA 2YYSA 3FOBA 1XQVA 4WCVA 2OPHA 4AN0A 3O0DA 5CMLA 3BJRA 4P92A 5AI4A 3B5EA 5AI0A 5JADA 1N8SA 4FLMA 4H7KA 1U4NA 5AKZA 4P93A 2WU4A 4DGQA 2G63A 3STWA 1KEZA 1CUVA 1C7IA 2H7XA 2EDCA 2XB6A 5LZ7A 5ALTA 3N0TA 4KACA 3FNBA 4B82A 2I78A 2DCMA 3WIBA 4PSCA 3IUNA 5E2IA 3I1IA 5KWJA 3FYUA 5DTJA 1IZ7A 1PJAA 1ZD2P 4PW0A 2Y6UA 4B9EA 1XKLA 1DWPA 5BWBA 4C01A 5LLSA 1LPAB 1SCKA 5HK8A 4J0KA 2EDAA 3FCYA 1XZAA 2QVBA 5AKJA 2ZJFA 1H2XA 4CG1A 4OU5A 3QMWA 1HKHA 5I7UA 1YS1X 4G9GA 4Z49A 1XKTA 3FLAA 5CW2A 6YASA 4Q3OA 4IQ4A 1QOZA 3ZI7A 2ZYIA 4IH4A 1K8QA 1TIBA 3HLKA 5LZ2A 2WIDA 5IKXA 4X6YA 2HRRA 4TGLA 2C7BA 1UKBA 3ZLTA 1R3DA 4X7BA 2C5GA 4B7ZA 4U2EA 3IURA 4W63A 4LHEA 4KYVA 4UBJA 4ZGBA 5A7FA 2QJWA 3IIIA 3WK8A 1VA4A 3MUOA 3FVRA 1UK6A 5CH3A 2PBLA 1G42A 3F97A 1FSSA 1MT3A 4B85A 1CUSA 4I19A 1JJIA 4OB7A 5DWDA 3BF8A 3ANSA 3H2JA 4Q3KA 4X71A 4HXEB 2WFMA 3WWCA 2XUQA 5EIAA 1R88A 4M0EA 4QLOA 4QDUA 3M82A 2QJRA 1Q84A 3VJLA 1KU0A 1MNAA 1B41A 5HF8A 3PUHA 4KRYA 1EDEA 2OCKA 3DNMA 3FSGD 3V1NA 4CIAA 3VXKA 3ANTA 1RWQA 5BOVA 4M0MA 3AIKA 5EHXA 4ROTA 2FUKA 1XZGA 4UHBA 1VLQA 4E11A 1P0MA 1TKRA 1XZBA 4BAUA 4BZZA 5A71A 2VTVA 2DFPA 1F8UA 2G4LA 2QUBA 4U2BA 1AZWA 4PO3X 3UUFA 5J3JA 3IUQA 4BZWA 3ED1A 5T4FA 1LGYA 4MEBA 3U0VA 1ZGCA 1L7AA 4U2FA 1CUCA 2WKWA 4J0HA 2G5TA 2HU7A 1A8QA 2DR0A 3DKRA 5IH7A 4F60A 5AM5A 2GBCA 4AMZA 1EINA 3PF9A 1XZEA 1QIDA 3G0BA 1JU3A 4Y2JA 1J07A 4GI1A 1IUPA 3KSRA 2WIGA 3PE6A 2C0QA 1EK2A 3WYNA 4KE9A 3A70A 2XLCA 4IH9A 1OILA 3KXPA 4INZA 3F9CA 1EDDA 4N8EA 5AM1A 4NS4A 1DT5A 3H04A 4BP8A 3UUEA 1BROA 1U2EA 2CBGA 3S2ZA 1GKKA 3JYHA 3NGMA 2OQIA 4G8DA 2AJDA 2XDWA 4P9NA 1BS9A 1LNSA 1A8UA 3FVTA 1NX9A 1XRMA 2HM7A 3D4LA 4FKBA 3DQZA 3IBTA 2OQVA 4QWMA 2QM0A 3IA2A 2UZ0A 5ALXA 2WM2A 1TCBA 3I2GA 1QFMA 4X85A 3BE8A 5E4JA 3FAKA 3WWOA 3G0IA 4HVTA 3VDXA 2DHEA 4Y2QA 3G8YA 3DCNA 3QYJA 2WIFA 5DJ5A 3W9BA 1CUBA 3D2BA 3AILA 1O6GA 2JGFA 1HL7A 1LZLA 2GBGA 3I6YA 1F6WA 4LXIA 2G5PA 3GFFA 1R50A 2JGEA 3VJKA 3QM1A 3EQ9A 2AXEA 1LLFA 1CUHA 1BEEA 5D7BA 1CUUA 3G0DA 3H2IA 3VVLA 3WJ1A 3G7NA 1VZ3A 3DS8A 1JI3A 3R40A 3ESDA 3O4JA 2QXTA 1ZIXA 1EB8A 4MJ3A 2JGIA 4HTAA 2QRUA 3H2GA 2BJHA 4ZXFA 4UFNA 3IULA 5K5EA 5HCUA 3WK6A 3OG9A 4AZ3A 1R1DA 5JAHA 1ORVA 5LP1A 2JGKA 3C8DA 3K9BA 5ALMA 4UHHA 2ES4A 2XUGA 2XI4A 2WIJA 3A6ZA 4CCYA 2Y2UA 4DM7A 2X8BA 2ZJ7A 3W04A 4X00A 4MYDA 1DTEA 5FDFA 2ONCA 2ACKA 2QT9A 2VATA 3WWEA 3OURA 1VA5A 1ZICA 2XMGA 1MAAA 1R9MA 5BV7A 3QPAA 2JGLA 5ALYA 1EVQA 3UMJA 4E15A 5DYYA 3Q0TA 2XMCA 3EIOA 4Y7DA 4UBIA 1LPBB 4C87A 3DYVA 4MYSA 4H7IA 1EB9A 3S8YA 1H2YA 4FDMA 4ZI5A 1IMJA 1VOTA 3AUKA 3QH4A 3CN9A 4ZRDA 2CMFA 3H2KA 3N2ZB 2PU7A 1H2WA 4L9AA 1HPLA 2I03A 2XUDA 3TRDA 3WKBA 2CEKA 1W75A 3WA7A 4J0JA 5AOAA 2IIVA 2O2IA 3WK4A 3C6YA 2IX9A 1SCQA 5T4HA 3HEAA 3A2NA 1LPPA 1UOOA 2OCLA 1MAHA 1OCEA 4C6HA 5CRIA 1QIEA 2WJ4A 1UOPA 1BN7A 4F21A 4HXGA 4DNFA 1H2ZA 1Y7HA 1QTRA 2J4FA 2FJPA 3EBLA 2D0DA 4HRXA 1Q83A 4QDXA 2ZYHA 3H0CA 1L7RA 2OCIA 1EHYA 1DINA 1THTA 4FMPA 3QZUA 5AOCA 2B61A 1VE6A 2B9VA 4L0CA 5ALFA 5JAPA 1EI9A 4ZV7A 3WQHA 5EHNA
chains in the Genus database with same CATH superfamily
2NSJA 3E0QA 3OC0A 2W2KA 1L1FA 5AVKA 4Y6LA 1MEJA 1L1RA 1Y33E 1E7QA 1WCIB 3K2BA 1YDMA 1ZOOA 2OC9A 3P2YA 4QOJA 3V48A 1AN0A 1H22A 1IYZA 1NT2A 2EW2A 1XFAA 2ZYAA 3O74A 5AXBA 4EY5A 4PN7A 1LSUA 4KAJA 1GV1A 1GEEA 3I30X 5CTAA 2W5UA 2QX8A 4EI7A 1N7HA 1Y8AA 3RVOA 3LVRE 3WQBA 2XSZD 2NM0A 4F3KA 1F2TA 1M5UA 1T9AA 4ZCMA 4UBOA 1I5OA 5FADA 2Y1XA 1JFSA 3FF1A 1NT4A 3GT4A 1U02A 3V3KA 1D8TA 1T8YA 2BFFB 1E69A 3B1KA 1ODIA 5GPBA 1X13A 4Q9NA 3B51X 2C3UA 2ZSFA 3DPUA 3HWWA 4G8CA 4JQOA 4QYIA 4L7QA 2HL6A 3PB3A 3CRVA 2BKAA 1TVEA 3L0CA 4GMGA 1VRWA 2PMKA 3FPJA 4LJ7A 1K5DA 3OX2A 1V37A 1A9ZA 2B4TO 2G0TA 4Q3DA 4NCNA 3T1HB 1PUXA 4FR5A 5JMTA 4HJXA 1OIVA 1M0WA 1R5JA 1FA9A 4Y1RB 3CX3A 4OO3A 1XYVA 3HSYA 1ZCFA 1S4QA 2WJJA 4N5MA 3MB5A 3AKZA 4B3TB 1CEXA 2Y1DA 1UPCA 2BGNA 4RPCA 5KYVA 1WCXA 4UHCA 2OV1A 3H7IA 3BF7A 2EEPA 2R3SA 4N3CA 2R8PA 3SCZA 4NDNE 2WA1A 2QE7D 2I7TA 5HM6A 5COQA 2ZB3A 2E4AA 3DO8A 3HDVA 3BHIA 4OFXA 3NHLA 3MMNA 3LT4A 3ROKA 1HEUA 4PYOA 5I7WA 1E18A 3EGDB 4FBMA 5M29A 4RTOA 4HFMA 2BHNA 1FFXA 1W9MA 2DUWA 3FBGA 3IMGA 5F3RA 2WHEA 4HLUA 1XZIA 3QMPA 5HVNA 3EH1A 3P96A 2NU8B 4FGZA 4B83A 1ZMXA 4EA8A 4DCOA 5F9FA 1VSQA 5K7SA 1O95C 2QAIA 3LUBA 2BH9A 2QQEA 2RH8A 3AQIA 2RGWA 3R3XA 1I1OA 5LXTB 5D5PA 1IY9A 3LHFA 3MBIA 1Y9AA 4NYJQ 3KOMA 4P7KA 4RDHA 1VCMA 2WVJA 4URZR 2WY2D 4EJSA 1NBHA 1QGUB 5F1OA 3R7WB 4LOKA 3RFUA 5D51S 5I51A 2IPLA 4TM8A 2Q1XA 1AKYA 1P5JA 1PBTA 1ZRSA 4UDYX 3KTAB 4C4PA 1Z7WA 4G5XA 3B5JA 2PUBA 1OVMA 2SKEA 1ZISA 4HWRA 3STVA 2IDMA 1ESNA 2HJRA 2A9QA 2I29A 1Q50A 4IWNA 3QUCA 1WHTA 4R0VA 4AFNA 1UZLA 4BRSA 3RYCA 3BMCA 1GDDA 2ZM5A 3UATA 1BJTA 2WFZA 4N3NA 3DFIA 2WJAA 1FP7A 3IHLA 2FMTA 1I2CA 2ZRKA 3L41A 3CF0A 1YDFA 2A0WA 2A67A 2XYRA 3P5SA 1RKUA 4A6XA 2UYHA 3QI7A 2AC2A 1EFPA 2ZUVA 3BTVA 3G49A 5C3UA 2EG5A 2P9EA 2QKYA 1HYQA 1AQIA 2WUWE 3CRZA 4M54A 3DP9A 4OQYA 5C5EA 1E9SA 1BHJA 3CXUA 2HSWA 2IWRA 5ERGB 3CRQA 3JQ7A 1J0DA 1W30A 3C5HA 4JUDX 4KWTA 4QU0A 1LV8A 1SHKA 4HUQB 4WOJA 2R6GA 3LUJA 3REQA 3PDCA 4QUGA 3OT4A 4XR9A 1D6JA 2FN3A 3O2NA 1RXVA 3QUAA 2BHRA 5D3MB 5CFZA 1ORIA 1NJGA 4CIWA 2A9PA 1JQLB 1CDEA 4GE3A 4MVJP 1AKQA 4QIHA 5KOHA 3RWOA 3V46A 3WP0A 3O90A 3UTCA 1XEXB 2K2WA 1OUMA 3BWYA 5A4KA 2VWQA 1XQ9A 3I37X 1ZNYA 1N3YA 2PU5A 4ZHQA 4JYAB 1O5OA 2PKEA 4GMXA 1ESCA 1IPEA 2PN1A 3M1AA 2XZOA 3HO6A 4L50A 1USKA 1Z5NA 4AL4A 1RI1A 2QAGB 2VI5A 3AIMA 2FDXA 1CNFA 3D2LA 4FGSA 1DFHA 4IO0A 3RU3A 1PX2A 4WEOA 2JC3A 3LECA 2A88A 3MWFA 3T3EA 3G8BA 1IH8A 1M2HA 1SXIA 3IQEA 2P2NA 1DKNA 1V71A 2V9ZA 1I36A 3AUAA 3FR8A 5K3EA 1FL9A 2YWRA 3KCQA 1R0SA 1WNTA 4LIPD 1GZUA 1OWLA 2HY7A 2KQUA 5GONA 3WLHA 5EWJA 4CEHB 3TCNA 1P0FA 2CJPA 3C16C 4M1QA 4AZTA 2FU5C 1A8IA 4RGBA 2PSFA 2IUTA 3L1UA 4V3BA 2WV7A 1OMOA 1E96A 5KOIA 1WOMA 1R4NB 4I55A 3OFKA 2FPXA 3IERA 4JLMA 1T4GA 4TWIA 3U39A 3KTFA 2SCUB 3LKBA 1JDBC 2QVYX 4GMDA 4ZRMA 5KDOA 1W52X 3RIMA 2IPNA 3OEHA 3DOUA 1FMTA 1ZM9A 2IYNA 4KXLA 3ZV5A 5FTLA 3T3NA 2WSIA 2OYRA 3BICA 3RWBA 3VR3A 4K3VA 4L2IB 3BAZA 1K5GA 4ZWNA 1X1RA 3ZHOA 4E5PA 4IMPA 5F33A 3TZBA 2X2OA 4LYAA 4D3FA 4WHMA 2ONZA 3ZCQA 1MIOB 2XD4A 4OQLA 4E14A 1QH8B 3RVQA 4AUMA 1DPGA 3VYWA 2O2XA 3G8DA 2P8JA 3S5UA 3M0EA 3T1OA 4XIIA 3G5MA 4REQB 1QFXA 4RAOA 1GSAA 1QHFA 1YACA 3EC2A 2REQA 2IUYA 4EGQA 1NKSA 3W2EA 1TM3E 3O5AA 5F4BA 4C6RA 1A8SA 4IGFA 3IR7A 1N75A 3OPNA 5EYPA 4EYEA 3PIDA 3WLAA 2R7NA 4G2NA 3DFUA 1P2DA 2E5FA 1QO7A 4U7WA 3MD0A 4UAJA 3OPYB 1RWVA 4TXNA 3WGGA 4AQ7A 3Q0EA 1VSBA 4LYDA 5ALLA 5L4SA 1QVVA 1QFYA 3KQTA 4X64B 2PV7A 2B82A 3EDMA 3AY7A 4L74A 2VNJA 4G9BA 3R9KA 3I61A 1M1UA 1N5JA 1F1BA 5J2TA 5HF6A 2EP7A 4UNIA 4RTLA 1E9VA 3FSGA 2OP1A 3LQQA 4CGZA 3ENZA 3MJ4A 4GE0A 3KYDA 4DDHA 2PQMA 1UEIA 2O7VA 3FDXA 1BNCA 3A6FA 3AKYA 4Q4HA 1NXVA 3HCRA 4TYPA 3OUZA 3KPJA 3N75A 1TYBE 4X3CA 2FFRA 4UE2A 2PZAA 2ZDGA 1SZPA 3UHPA 2X41A 1E0AA 3EGIA 4D9IA 1SXJB 2XYHA 4L8WB 3F90A 1EFKA 1OFGA 5P8WA 3L6UA 1DPFA 2ENWA 3KDPA 3M1IA 4AUEA 1BZYA 3OJEA 1UF9A 4DPMA 2NUTB 3CXRA 4CM1A 2PQ2A 4FC6A 2Q9CA 1VIYA 4A0SA 1UBMS 4EECA 3NIBA 2DECA 3KJHA 4II3A 5KQLA 4CLXA 3UKJA 3ZDCA 4Y9TA 1LC0A 3RAFC 2QRVB 1C3XA 2R1VA 3A58B 3KTDA 4QODA 3JZAA 2H18A 3DMHA 2BDTA 5D3KA 2DP4E 3S27A 5CA1B 4M9QA 5SICE 1U7XA 1MO2A 4FDLA 4Z2YA 2YZKA 2I9PA 2WVHA 2NU7A 1SU4A 3DO5A 5E1BA 4W5QA 1S7CA 1GFWA 4C5AA 2XRMA 1ZM7A 3DAGA 4CTKA 2XADA 5E7JA 4EYGA 1V1RB 5J4KA 1BMDA 2C88A 2W90A 2MYPA 4RVGA 3RVLA 1SXJD 4IIYA 1U0FA 5BSEA 1VJ1A 2BCGY 4WN9B 4Y2PA 4LZZA 3GG9A 1KYIA 1NLMA 3LDGA 3ZWYA 1Z36A 3HKBA 2ATXA 1XF1A 3E5NA 3NT2A 3AZOA 1L7BA 2RGUA 4W1SA 3VU8A 2EBHX 5HXAA 2W4QA 1JKFA 5EMHA 1E94E 3QHAA 1XEWY 2NAPA 3NBMA 1LB1B 5BN4B 1A98A 2ZTUA 4LHYA 4YGXB 1Z2NX 1YVUA 3HCEA 3KV1A 4BBZA 2XQKA 2CJWA 2VHJA 2ZIAA 4YJ3A 1KVRA 3O0TA 5L6LB 2P78A 1HDXA 5LOVF 3MHTA 5FL7D 4RMJA 3TL2A 2H1OA 2ETXA 3VKUA 3TZ6A 2ZWPA 3DCYA 3V1LA 1F0PA 1U1DA 2WV9A 1KK1A 1H69A 1N4DA 2WYHA 3GJ6A 4NH0A 3TQHA 1TK9A 2R11A 4K3UA 3KYCB 3T5CA 2IXBA 3CPEA 3LYHA 5LYJA 4D0RA 4ZZ1A 1LEHA 4XWAA 5KX5A 5F51A 5KKAA 3U3MA 1Z45A 1U9YA 1X6VA 4QRIA 4YRTA 1JJ7A 1DI0A 2CUTA 2WB2A 3K0CC 1SK8A 1AXRA 1QZXA 2NSHA 4BFSA 3M9LA 2Q45A 2LNDA 1CY2A 2AG0A 2NU6B 3DMTC 4L5BA 3RYFA 3I34X 5JZBA 1H8HD 1RM5A 4MV4A 2PK3A 2VQ3A 1DEXA 5HFNA 3VR1A 5KWEA 3IEUA 2XF2A 5LKAA 2P9BA 3LW8A 3LL4A 4A7PA 1UXGA 2NACA 4ND3A 1K1EA 4O2BF 2FA9A 3HYCA 2CKMA 5A9SA 2AFIB 5H82A 2B99A 2EP8A 3PDJA 4I9NA 3N7AA 3HPQA 1H4TA 4G5GA 3TLEA 2WSBA 1SUDA 3ZQ6A 5B1EA 1J2EA 3PEWA 3VX3A 2CKDA 3KKKA 5CDUA 2VHXA 4NL4H 4QGGA 2Z3VA 1OFIA 3PD0A 4HB2A 2Z3WA 1PNVA 3P0HA 3KFLA 1P8AA 1I7LA 1M8GA 1ZINA 3MM4A 1Y3CE 2HI0A 3AR3A 3VAYA 4AS3A 3K96A 1TQHA 4WLEA 1X86B 5BRNA 1DC4A 2XUKA 2UDPA 2I3DA 4FGUA 1TA0A 4PNHA 2QRGA 4OHPA 1N6NA 3J80A 3DBRA 3IDAA 3R0QA 4DY4A 3CWZA 1SG0A 2QN6A 2V7PA 2G5GX 1N0IA 2QMZA 1C9MA 3VDQA 1T5IA 2P4QA 3ISJA 5IAOA 3M5WA 1B23P 4D1YA 2YUTA 2XW6A 3O9VA 3PFBA 3QNMA 2R8BA 5JQGF 4YQZA 2NNWB 1QB8A 3R23A 4M1MA 3IB6A 1IY0A 2PD6A 4K0RA 1EFUA 3UBMA 1RJEA 1TJ3A 4PONA 3WKAA 4DWOA 1B74A 4EEZA 3PRJA 2X5XA 1Z8NA 3AERA 4LVOA 3CGGA 4ALIA 3NHAA 3ELBA 1U65A 4JB3A 1Y6JA 4AY4A 5FAKA 1JSLA 4M7PA 2ARKA 2ZDQA 1T5SA 4IDDA 1X1DA 5FEMA 3GGSA 1AU9A 3EG9B 3SNHA 1E60A 2QSZA 1AV6A 3LCJA 2PUHA 3QU7A 4I9FA 4MIOA 5DW0A 3RARA 3ZWQA 4CMAA 4YR9A 1Z6AA 5C9ZA 2II6A 5ALJA 4MWSA 5EERA 3TLZA 5C8XA 5JROA 2GCGA 2AC4A 3IUSA 3RVDA 1VE9A 4EARA 1XOIA 2VHWA 4CM9A 4PSKA 1OAOA 1L7NA 1E8MA 2HK7A 1WD7A 2QU8A 3CG0A 3CW2A 3D3WA 4G5SA 4OQ4A 4Z8YA 1UT6A 4F8YA 1ZAKA 3QFFA 5JFTA 1JB1A 1L1EA 3B2QA 1MN6A 3TOCA 5HZKA 5ECYA 1KS9A 2E7ZA 2OK8A 3NYQA 3W1VA 4D3XA 2XB8A 1TCAA 5HQTA 1U8TA 1E0KA 3LTNC 5F3WB 1L7MA 3KKPA 2WSMA 4I9HA 4MJXA 2P4EA 3QOYA 2EJUA 4BCCA 3IQXA 3OLYA 3K6SA 4KWCA 2ICAA 3PNKA 4KBFA 4M0UA 5G3ZA 1F5NA 1UC9A 4Q9DA 3V00A 5LMUB 5L3SB 4DILA 1V5WA 4ARBA 3KZKA 5G0VA 1WXDA 1ZMOA 3CKLA 4MRMB 5BYKA 2ATCA 5KSPA 3SKVA 1NNI1 4DUYB 5BT9A 5ULLA 5J43A 1PJ8A 4CM3A 2IU6A 3JXEA 1HM5A 3DB2A 4ZICA 5IFKA 1ODLA 4OSOA 3FAZA 2GZSA 2Q9UA 3C6MA 2ORIA 5F2EA 4AK9A 4BNVA 1JA0A 2YXEA 4GOND 2V5UA 1M9NA 5B1IA 4ENTA 4EY6A 5JYCA 1PG5A 5LVAA 1UMBB 3KQUA 4D4LA 1A2KC 3MC1A 4Q16A 3BD6A 1HDRA 2QAGC 3SS7X 2A4MA 4R7GA 4D80A 2GERA 1PL6A 1Z83A 2O4CA 2YYAA 4OQZA 5D3ZA 4CCWA 4Z2AA 4OI0A 5LQNA 3AF6A 1UQUA 3PX3A 1V9CA 2CHFA 1VKOA 2J3LA 3OD5A 5LQCA 1NXPA 3TR6A 5TT0A 2HJGA 3CKKA 1D07A 2J85A 1EUQA 5IS2A 1ZIYA 1DEHA 2PMWB 5TGZA 4EHAA 4TQ9A 3D5EA 4NPCA 2ZDHA 2BFNA 3RU2A 2FZWA 3QE9Y 4KLRA 2L18A 5CK4A 3VNSA 1CR4A 2FWIA 3FLBA 1M2GA 3C14C 4Q19A 2IYTA 3P9KA 4HLDA 2J0VA 4MWGA 5GAJA 2O7SA 4DS3A 2B30A 3LHIA 5JBNA 1JDVA 2PT6A 3A3PA 4B44A 1N2OA 4IEFB 4NBTA 5LLDA 1FTQA 5LU9A 1E2EA 2HR1A 5IJXA 2A94A 1KXJA 5LBTA 1T8SA 1SU8A 2FP3A 3QP9A 4RMGA 2FK7A 5BOSB 1POXA 1GV0A 2CLDX 4WZ6A 5CM8B 1MFPA 1T2UA 1Z0JA 3HJBA 3JYLA 2VDMB 3N8IA 2VJOA 4G0ZA 4PO1A 5DHUA 3WYAA 4EY7A 4Q48A 1AGNA 4QPPA 1L4EA 1OIWA 1VB5A 2XWQA 4Q7KA 2VYVD 4DJTA 2PUFA 1EU1A 3EXG2 2JAPA 5CT8A 2GETA 3DBLA 3I58A 1TLLA 1U0BB 2X5KO 1X87A 2J0UA 3LC2O 1YKSA 2O2DA 3OKFA 2W9XA 4Q34A 4PHFA 1NUAA 3MWEA 3QXCA 3LA6A 3CLSD 5K3DA 4C5BA 4E51A 1KP3A 2AI1A 3WLSA 3EDYA 3TE7A 2I66A 3DV2A 1BCRB 4FNMA 4BDSA 4FQ7A 1E9BA 3H5NA 2F64A 1JHOA 1GCOA 3AEXA 2WUFA 2Y0CA 1B43A 2WFAA 5JV5A 4KN8A 1OAKA 3IV7A 4LK3A 1K7FB 3ESAA 3E1SA 2I76A 4XQ9A 5BYBA 3ZZTA 5FKJA 2AK2A 4KDFA 1GXSA 2V7UA 3HCOA 1P4JA 3L79A 4AB1A 5BMVF 2O57A 4BCBA 4PXSA 3SX4A 1XEFA 3D7KA 1NVUQ 1P6QA 3DZ8A 3G17A 3DF7A 3HP4A 3D3QA 4PX2A 5FTJA 5J1TB 3RUEA 2VZEA 3L7AA 1XN4A 2V9PA 3QUSA 1R8SA 4PFQA 3E3LA 3VISA 1XP8A 4BNDA 4ZEMA 1ZBQA 4IVNA 1QK4A 4TT3A 2I1WA 3JSAA 5AK3A 3AUTA 2VJCA 5DIZA 2MMGA 4R54A 1FQOA 4JJIA 4KE6A 5BQOA 5SYNA 1JH9A 5EE5B 4N0QA 3F6CA 3ITDA 4US1R 2WF5A 2XMSA 3X0DA 2E18A 3X43A 4B46A 2NV2B 4YFVA 4KWIA 3H5VA 3SBEA 1F4LA 2JHPA 1JW9B 5BY2A 4K1LA 1NMSA 2AQ8A 3ICWA 1JF8A 1HRKA 1UKEA 1SBYA 2DBYA 4IXNA 4MPPA 4I2VA 1KI2A 1SXJC 2IDJA 1PSWA 3EISA 3LX6A 3FPHA 4KGDA 4XQEA 2V6FA 3TM4A 4CM5A 1YFKA 4AX4A 3D0OA 4PWYA 4FD2A 2D54A 4YV2A 3LUHA 3CLTC 4XB2A 5H0IA 2CLLB 2F9FA 4CMIA 4Z4HA 4MA0A 1CR0A 1FS4A 5LIPA 3F67A 1E6UA 2H00A 3HJNA 5JD3A 3NBQA 5TE9A 4CF6A 1WRBA 1X2BA 4IEIA 3VU0A 3DXYA 3RR2A 3EB9A 1MA3A 2J9FB 4ZT2A 3M6AA 3NFRA 2IOHA 4ZAZA 5F1KA 5LYYA 4EELA 5KMGB 4UASA 1WHSB 4JEIA 4Q1DA 5KOJA 1VJ0A 4E09A 3ZWMA 5KAMA 3UC9A 1THMA 2XIQA 2VJQA 3P9CA 3HB4X 4LZJA 1ZW1A 1TYCA 4UAGA 1KE2A 2DCUA 4P4GA 4EW1A 2P2YA 3UV6A 1XU7A 1FJ2A 1CV2A 3JQ6A 3KOWA 2HMTA 3Q15C 4XVHA 1CDOA 5B30A 1PZEA 1HFEL 2ZXEA 1MD9A 4AMVA 5ED4A 1R74A 1UBKS 3OESA 4A27A 4AM8A 5KSWB 1QTIA 1XVLA 2JCYA 3OEYA 4C4RA 4OU4A 4YBZA 3RS4A 5EUCA 3ZV4A 2ZQZA 1QHIA 1XBTA 5EQFA 4G0NA 4JKOA 2DKNA 3V8PA 3EQ7A 5JAUA 4DIDA 2PUTA 2C2XA 2REOA 4RL6A 4J4BA 3U61B 3AL0C 1K8RA 1LX6A 4M9XA 1W34A 1KKUA 1YI8A 3AR8A 2WW8A 4L6AA 3GJQA 4LA4A 4QYXA 4MKHA 2MSDB 4L73A 4M8SA 4O4LF 2ZBGA 3ORQA 3W5VA 1UJBA 2I91A 2YZNA 3E8MA 4B17A 1FMLA 1Y7PA 3CF4A 1FUIA 1P3JA 2L2QA 3EIHA 1EGVB 1HQDA 3U7IA 2GZDA 2M1XA 3W6OA 1PK9A 2TMGA 3S6JA 3TPZA 5B37A 2OO3A 4QOIA 4CM7A 5D1HA 4ZK6A 5CFRA 3K0AB 3THXB 2LDBA 3B38A 2OBMA 3VR5A 4EGSA 1PTJC 5FV7A 4Q82A 1ZU5A 4QXMA 1XKXA 4FB5A 2BEUA 1PR4A 3PFCA 1URPA 4R31A 1M6YA 1EA5A 2D1FA 2GBPA 2Z2YA 3BERA 2GWRA 2QQFA 5TQ0A 4ARAA 4DYDA 3A6LA 5CEEA 3LFTA 3WHLA 1Q6YA 4DM4A 3V7YA 16PKA 3DONA 3GFRA 2VDWA 2QRKA 3L0SA 2GCEA 2BKVA 4AO6A 4EI2A 1I4LD 3E3OA 3P26A 1ZJYA 3BBLA 3L9XA 1T3LA 2IDKA 1X3SA 3DAHA 2QORA 1M2KA 2ERXA 5LDGA 4PAMA 3U9TA 2C7RA 4WDRA 1UAYA 1HDGO 2OENG 3PUXA 4G26A 1EM8A 1RPZA 5KQSA 2D7CA 3H5TA 3EPJA 2XVZA 4CG2A 4GPD1 5EXDA 4U9HS 5ITZB 1MW8X 3BMOB 3KSBC 3BTOA 1G9XA 1WMAA 1B2LA 3BORA 4MS4A 3D59A 3O4IA 3LYLA 3ZW9A 3UGQA 1CQPA 3FUCA 4AYTA 4QUJA 5KNBH 4H4CA 4KMOA 1A5SB 3OKPA 3TLKA 5K4HA 3KXIA 2XOKA 2IH4A 1MAWA 2Z4SA 2PD4A 1X80B 3HFGA 3ZZ1A 2ZG6A 3N05A 4MUAA 1JHXA 4UUAA 4C0XA 1U9IC 3PPYA 1H2HA 4WZBB 2QYOA 3NT5A 4H27A 3WSVA 2Z57A 2Z9CA 4YLYA 4EKNB 2CYAA 3GRVA 4H3VA 4OB8A 4U02A 3TOSA 2AFHA 2VC2B 4N3BA 1X7ZB 4B71A 1YZHA 1VKJA 1NQTA 1U3CA 1YR8A 2VAPA 2I6XA 3PTZA 4RWZA 1VQ1A 3U1VA 2XCTB 3NTXA 3OU7A 1XZCA 3U3KA 1FSPA 1JBQA 2R68A 2RKOA 5DCUA 2XB2A 3WXBA 2P30A 2PA0A 3O3MB 4GECA 5DNEA 1SOWA 1X7XA 1XTQA 2YQZA 3LWDA 3VR2D 4D3DA 4I3FA 2BEWB 2BUAA 3E27A 3L1KA 3LA8A 4XLTA 4Q6BA 1IHOA 1KYVA 3VTFA 1NBEA 4AJPA 5SY4A 2VFAA 2XPCA 4Z9AA 5H59A 1KO4A 4MAAA 2JLXA 2GCIA 2ZWIA 4PTZA 5TVGA 2DPMA 1CRQA 2H16A 2GYUA 1CHNA 2ACVA 2ZUBA 3KZVA 3F9IA 4XDGA 1N9KA 3THYA 2XBLA 4FLFA 1WSWA 3CIOA 4NQRA 5GVRA 5TMEA 2POCA 2Y8EA 3EASA 3IS3A 1PGPA 4LV8B 1XCMA 1IN1A 1ULHA 4MB6A 1QTQA 3OZWA 3H0KA 3LVFO 5I3CA 4LWZA 4U0KA 3R3ZA 4MUMA 5TXGA 3LSTA 3URKA 1OXUA 2HD4A 4ZO7A 3V4SA 2VYNA 1GG2A 1ZH4A 5KTPA 2FJ0A 3BB3A 1FZTA 1J8YF 1ZI9A 2P27A 3KFXA 5HW0A 1Y80A 4KVZA 5J4YA 3N2KA 4JLPA 1X0VA 5D00A 4HWPA 3GLGB 2VSQA 3WL7A 5CCEA 1K6IA 1X9IA 2DLDA 2DU8A 2GTIA 1H2RS 4AT1A 2B20A 1VHJA 2ADOA 2EYUA 1Z47A 3G2MA 2XQGA 4L3VA 4N6NA 4YECA 4AG3A 1OE0A 1G8KA 2HQBA 4BWYA 4CDMA 1DBSA 5A9RA 2CVPA 1N8TA 1DWOA 1RRVA 3UWDA 4IRMA 4QX6A 4M87A 3DVSX 5AQEA 3DSRA 2QNIA 3AVTA 5BW4A 4HCJA 4MNTA 3S81A 2BM0A 4CHGA 1RMYA 1BTOA 3KLPX 3PGVA 3TZLA 4L9RA 2YRXA 3LKZA 3LI2A 2ONKA 4MMXB 1CRPA 3ANXA 5K20A 3E22B 1MJ5A 4NBRA 2BHSA 1P1BA 3NHPA 4L85A 5EJIA 4BGEA 3C87A 3RTAA 4BDTA 4RY0A 2FWBA 1ATIA 1BYUA 2X5JO 2EKQA 1XZJA 2PGOA 3QRWA 1O89A 3MS4A 3PQ2A 8ATCA 1S3IA 2VG8A 5TX7A 5A6VA 1D0VA 2YN2A 2FPUA 1DC8A 3KKEA 1BMQA 1NLYA 4UNQA 3H16A 1X1BA 1Q1ZA 4UFPA 4ZAGA 3PNYA 1Z3IX 1Q0PA 2Y3IA 4QKQA 4I5DA 4ER5A 1UXKA 1KH3A 2AJCA 3BXFA 3M6XA 5KHOC 2C2KA 5EUQB 2BGJA 2JBWA 3CJQA 3A7EA 3CLSC 4G8JA 4P6VF 3T3MB 4YAOA 4QU5A 4OB6A 5J1SB 2LRHA 1ZJWA 3ECCA 1IVYA 1HEYA 1YBFA 1BFUA 2PRYA 2ATIA 2VEOA 4YTEA 4DQXA 4ENQA 4DR1B 2XUOA 5EUMA 3KEGA 1NQ5A 3SC3A 2IOFA 2WP8J 2IODA 2PYDA 4RD2A 5DNVA 3MD9A 1PQUA 4HDRA 1BGWA 3C98A 1QPBA 1NJFA 3NHYA 2F00A 3F6RA 3PD7A 5DGCA 1Z6PA 3N58A 2QW8A 4GBED 3IP7A 3NRJA 3V7NA 4CBVA 4HR7A 1KMHA 5I47A 1SCIA 4M0LA 1Z3CA 3JSXA 3O1HB 5ALQA 4CG0A 4M8IA 2G77B 1DKUA 2XOEA 2XWBF 3LQYA 4WWHA 4Y2XA 3TDNA 2R6DA 1N5IA 3WJ7A 5GOTA 3X3HA 2CXRA 3IP8A 4B0OA 1YOBA 5DM60 3C3JA 4CKBB 4B7XA 2DULA 2JEOA 3BWVA 3T41A 3QQPA 4GKBA 5L3QB 1BRMA 1EUZA 2OECA 2HBZA 3QKUA 5EJ2A 3VX4A 2X2EA 3F6PA 1MT0A 3WRYA 4RZIA 3ABRB 4B7CA 2V6JA 3AX6A 3GT3A 2Y1FA 4CV2A 1FRZA 2PS0A 2ZP1A 3GGCA 4N48A 3PJFA 1I1QB 2BTQB 5KTSA 1I6LA 3SYRA 1JFLA 1V26A 1IG0A 1E7WA 2E4UA 1XD9A 4KU4A 5KNCH 2QHXA 4IR7A 2PKQO 2VT6A 2JVKA 1MENA 4LXHA 4KO4S 3OP1A 4QXPA 1CQIB 3SXJA 2WJVA 4OQMA 2FPKA 3DL7A 1VIAA 3DF9A 2PUJA 2P9YA 3UYLA 1KARA 2VHUA 3T9EA 2X4IA 3VYUB 1XJWA 3X1JA 4J0GA 4RA9B 3RTGA 1C4XA 2O7NA 2JK1A 3B7GA 1U6KA 4DYVA 2C95A 1NJ2A 4F96A 4RPHA 2ZM6B 3IUMA 1RDFA 2NO0A 4C76A 2J3IA 3CRW1 4H31A 2X0FA 4F38A 4XUCA 3PS9A 2Q2QA 1IB0A 3AC0A 3W2FA 1U0HC 2C58A 4YT4A 3JAWB 3P7MA 3SBDA 4RD3A 3WSTA 1XTVA 3T7IA 5K0CA 1M10A 4KMRA 4UTZA 1J00A 1WD5A 1RLTA 2HMVA 2O14A 1ITZA 2VP0A 3A6GA 3BE5A 2QLTA 4HEA1 4G8BA 3EPRA 2OG1A 5CVVA 1SOAA 1L8LA 5JO9A 2BRUC 4IDPA 4D98A 1F3OA 2IEGA 2RCNA 3UTDA 1EP9A 1BQEA 4HZUB 4M0FA 2QZSA 4J03A 5J2UA 5JZ9A 5K4AA 3WBFA 5FO0A 4QUKA 2RONA 5LQSA 2ECKA 2ZR7A 5JSZA 2E4YA 3C74A 1U7TA 2OFOA 3CSDA 2NMVA 1XZDA 2CF5A 4URHA 1V45E 3T7TA 3SYMA 1AQLA 2DPXA 1ZD3A 4OM7A 2BDUA 2EOAA 3E3MA 4G07A 2AVNA 1LRLA 3SIWA 1U7WA 4JZKA 4GVXA 4QXRA 3TMKA 3ZHCA 3GIWA 5TJ9A 2IEAA 5AD1A 1NF2A 5EI5A 5ALRA 6GPBA 5F35A 5HE9A 5HZHA 1BE0A 2OFFA 4NBKA 4HI0E 4OD0A 1L5RA 2QB5A 4E1BA 1X1TA 5CDTA 4ENPA 5A5FA 4P84A 3SC4A 1QFSA 4OQEA 3OIWA 1AQNA 3F5MA 2R1UA 4MUXA 3UMRA 4LF4B 5BSWA 3S29A 3UICA 4XJSA 5CNIA 2BI4A 3W9YA 1BDHA 3AOGA 1F4PA 1WVMA 4FXPA 3TCXB 5I8WA 3I04A 1ISRA 1G8JA 5JRJA 3GRKA 5EFZA 4REOA 3TXAA 5L6MB 2WU1A 1JYEA 4Y1EA 1RNLA 4IDCA 3QFTA 1XAJA 3BREA 4OY3A 4QJ3A 1YZNA 1WIWA 3UB3A 1HSZA 1FP6A 2AEMA 2HLHA 2ZBUA 2QTBA 2WAMA 3K5WA 4GUDA 3T5MA 5EJ8A 3WDKA 1UJ6A 4QREA 2J6CA 2LWIA 2AV6A 4ZYUA 4OA5A 3VGJA 2QRLA 3REFA 4DZZA 1A1VA 1JEYB 4M1SA 2K87A 3KUCA 2WWGA 1D1QA 3EWAA 4NAUA 4O5AA 1QE5A 3S2SA 4WY2A 4JELA 2C04A 1FTSA 1DXYA 2IEBA 5JMPA 2Q07A 1YGYA 3BILA 4MVXA 3W3AH 4IIVA 2J31A 5ECGC 2R5FA 1CFZA 3G02A 3Q2OA 1CZKA 3AEQB 1YVDA 1BIFA 3SC2A 1G3RA 1C1HA 2Z8YA 3BGIA 4H7HA 1GNSA 1OYVA 4KXFB 1HKUA 2C31A 1YA8A 4PGHA 1Q0RA 4HEQA 4NMXB 2CMKA 4UTVA 2VJKA 3IUBA 3PHGA 2D3WA 4G41A 4AIRA 4NYMR 2VRBA 5D87A 4YAGA 3QXHA 4GI5A 1N2SA 1FBNA 3Q2IA 3V9AA 1FYVA 5FUMA 4TWAA 4D45A 1QDUA 3DAYA 3IBCA 3BC1A 1BFDA 2Q4BA 2JA2A 1FNSA 3C1AA 3EGVA 1CVRA 1E2HA 1JPVA 2JFQA 2QSYA 4Q4DA 3X2FA 3GUUA 3K53A 4FD3A 4P7JA 1ODTC 1P9WA 4QA9A 4R8MA 4KXNA 4TV9A 3RVJA 4WK2B 2BONA 1C9NA 3EN0A 2JATA 2VL7A 4FZVA 3OQHA 4PG6A 4WXPA 5BNTA 2CNOA 4DWWA 4ME6A 2PJRA 4MHTA 1YH3A 1BWPA 1ORHA 4MQLA 3H17A 5D86A 3BH0A 4MQ4A 2ZSUA 3TOXA 3A0RB 1EHIA 1YK0A 3LUAA 4DJAA 5A3JA 1IQRA 4MYHA 1ZAYA 3HB1A 3VV3A 4ZRNA 4I46A 4YV0A 2DWCA 3GEHA 3WGOA 2JCSA 3RS5A 1YB6A 2DH5A 2VBCA 2C3OA 4N18A 4AXXA 4EDFA 1T1IA 3T3OA 1FNDA 3O2QB 5DVZA 3UC5A 2YV5A 3IAEA 3PC8A 4X95A 5A7GA 2WJZB 3RWMB 4F06A 5IT4A 4JX8A 5JSHA 1DEKA 1VJRA 1DO2A 4X1IB 3IFSA 2QP3A 3TO5A 1VZ2A 4R1MA 2Z6QA 4OHYA 1TNDA 1QIKA 2AMFA 3LWBA 4UHFA 3V1TC 1AC5A 5E38A 1LS6A 3VR4A 4ZHQB 4DMMA 3WGQA 5CPFA 2HNBA 3CU5A 4CNQA 3E9EA 5JH7A 2OMKA 3SVLA 4CL3A 5LOVB 1GFZA 1SCBA 4RTKA 4E2ZA 4WE3A 3TLGB 2HDHA 4CFZA 1XTZA 4IX1A 3M49A 4TYNA 4FYHA 3LPNA 1P17A 2YMLA 1DX4A 3W8RA 4IIJA 1KP2A 2VP6A 4QAJA 4ZDIA 1NM5A 5DULA 3VM6A 2A0FA 2ZJZA 1OV4A 2VAMA 2VDVE 2V7GA 1EESA 4TSFA 1E9EA 4NMWA 1XLUA 3PNLA 1BXGA 5IM4F 3S2EA 2VZ0A 4AZ0A 3DDSA 3UMGA 1P0QA 1H9AA 1GKIA 1PT9A 4QM7A 1BAPA 2BAGA 1WDTA 1DJPA 3FUXA 3I2FA 1HNXB 4R6WA 1BD4A 2J3EA 3WRWA 2VP5A 3CJTA 3UMFA 1XTRA 4ZPJA 1RLJA 1G8FA 3BTUA 3I39X 1B8OA 4LKOA 3PJEA 1M6HA 2HQSA 4O2BB 3FG9A 3AEUB 1NY5A 1SVKA 2QN3A 3O8DA 4Y2UA 3H9GA 5K09A 3IMFA 3RG2A 3RT7A 3K70B 3BYZA 1XWWA 3FE2A 3FNEA 4KO2S 5SZHB 3V9PA 2DJ5A 4MP3A 4BPBA 5BV8A 2WD7A 3EC7A 3NQ41 5F78A 1UWKA 1D6SA 2CVFA 3KU4A 3BQ9A 3HI4A 3V6MA 3F3MA 1L8XA 1W47A 2HHLA 1Q1NA 2P91A 5AK6A 2J3DA 1JBEA 1FP1D 1SZCA 2CXTA 2XGSA 1OLXB 1LK0A 1W9HA 4PQGA 4BGDA 2EFEB 2HV8A 2QVZX 2N46A 3W0LB 1U5CA 3OJ0A 1H0RA 3RSQA 1KZ6A 2ZWMA 5JZVA 1NP6A 4GSKA 3EF1A 2VQEB 3T4UA 1ECCA 4QNMA 1SC1A 1TI7A 1LS1A 2C59A 2F3TA 2ET6A 1FX0A 2PRJA 3I5MA 4MXDA 2C3MA 5FUQA 1X74A 1AO0A 4KNYA 3VJRA 3VPXA 1KMCA 3R1IA 2ZE8A 3PITA 1BOOA 4MIYA 4DUPA 2P3LA 2P62A 2Q2OA 4MUFA 1KE1A 3TPCA 2XUJA 3QIVA 3K70D 3LUPA 1WSBA 1NI4B 4G1MB 4II7A 1TKBA 1YB5A 1NVMB 5BNWA 1E7YA 3MERA 4BO3A 1FS5A 1ZH6A 3ECAA 4IDAA 2WILA 2QF7A 3BE6A 4JLBA 4KRGA 3IEVA 1VHTA 1QAMA 2BOVA 1J23A 2RG7A 1CW2B 4ND4A 4UPEA 3ODPA 1Z33A 5JRDS 5GZ6A 2PMCA 3WWPA 4CQMB 1VI5A 5K0EA 1QQ7A 1ELOA 3GRYA 1M74A 5TMPA 2I33A 2QK4A 3H65A 4G36A 3VHLB 1YQ9A 5FI5A 8MHTA 1KEEB 2PO7A 5D01A 5CFMA 3OOSA 1GHTA 1CF2O 1J4AA 2Q3MA 3LPAA 3BS4A 3PCRB 3NATA 4HMOA 2JAUA 5KYUA 1DQPA 1UC8A 1E4EB 1SC9A 3H84A 3GROA 4CYMA 3IBGA 3P2EA 3MGAA 4N6GA 4YC7A 4OSEA 2HLNA 5ENVA 2NVBA 3HMKA 3ROFA 3B6JA 2YL2A 1ENZA 4WJLA 5B1YA 3WZMA 3RIYA 3RNLA 3TR5A 3VVBA 4D9EA 4JA0A 1CJBA 1PP4A 2QGZA 2QTGA 4K6MA 1E3MA 3RF7A 1Y5MA 5YASA 2N47A 1F3LA 1T2FA 4DZRA 3BWMA 2E6KA 5FUWA 5C8YA 1WO8A 3W6NA 5C1BA 1N36B 3JD4A 5FQNA 1GQ2A 3LLCA 5CNKA 4MR8B 1JHYA 2I1QA 3GT0A 4UMVA 1PV4A 4J0QA 1JQEA 4CQMD 3WV4A 3GQVA 3PHJA 1J7KA 1TU4A 6ADHA 3GCXA 5F4ZA 2ZT5A 3O38A 1IQPA 4ZQFA 1I2ZA 1KH2A 1SJ9A 3MJEA 3KZNA 1NVDA 3R0ZA 3FOAA 2BGIA 3ANMA 5D2CA 3ZTTA 2FOLA 4Z4CA 1Y5RA 2VNKA 5D5HA 1SVMA 2WAYA 2RI1A 1BHO1 4WCDA 2BKXA 3RYTC 2I7VA 3FUVA 1VHLA 3LUFA 3W1EA 4BBAA 1Q3HA 3NHMA 5JDIC 2DG2A 3ZY3A 2HEGA 4UXIA 1ODFA 4HTFB 1Z74A 1ZHHA 5DISB 4Y8VA 3KEMA 1SO8A 4K9OA 1HNWB 3AEZA 3WNVA 1VLZA 4FYVA 4BE7B 3B36A 4XASA 5DXJA 2B7LA 2P3QA 3KWFA 4BN4A 2O8CA 1C0EA 4E4YA 4W6QA 1JEQA 2ZBDA 4OMUA 3RUAA 2V96A 4NULA 4RIIA 3JARA 3TQQA 5B58C 4HFRA 4A0RA 2WOOA 2WTUA 2W42A 4GUAA 1WJGA 4KN6A 2XB9A 2B78A 4B3JA 3EWSA 5AI6A 1DCMA 1LQTA 4L6IA 2PZGA 4UBLA 3VUEA 4WQMA 4G6ZA 1FDTA 4HXYA 4UUPA 2BTOA 5JZMA 4KPUB 2QBYB 4DVGA 1U0LA 3ORSA 4OXQA 4PRKA 1UMDB 1Z26A 2VDOB 5DBEX 4Q1AA 2AN5A 3OO1A 3K5PA 1B6GA 4Y9SA 4EGAA 3JZFA 2Z4RA 4KX5A 3V8MA 1MO5A 4MQBA 3ZCVA 4EX6A 4MITA 2QJFA 1TK3A 1ZHFA 3D2CA 4H7EA 4N4AA 2VZLA 2HBRA 3GLFA 4X92A 2FVYA 1G4HA 2E37A 4FZ5A 1PL8A 4UNRA 4KW7A 1WS6A 3QLUA 2FLWA 2RHTA 3OEEA 1ZD8A 1P2VA 3EDRA 4UARA 4DHWA 3SOPA 2B1RA 1K5PA 4ZAWA 4CN9A 5MGNA 2YJZA 2CNWD 3OE5A 2EAUA 2WP0A 3NMUF 3AEYA 5E8JA 3A1UA 2P8SA 2H63A 1C3OA 1JJBA 4I1SA 3ML1A 2QLMA 1M33A 4MYRA 1LC3A 4BO5A 4DKXA 5BMVB 1ZJJA 4RCZA 3U44B 4Z0HO 4D9GA 3WYGA 1JAIA 2NXEA 2V4MA 1Z5OA 3ICPA 1KDYA 2QLFA 4C7XA 2FHPA 1FYWA 4BVFA 1T6ZA 3OJLA 4L3OA 3O95A 1XTPA 3KHSA 1YSCA 3IV9A 5F12A 5B5SA 4XTCS 3U0BA 1MQ9A 2NQ2C 2VPWA 1Z34A 2P79A 4IUBS 3GJ3A 1GYQA 3I09A 1T36B 4Z4FA 2K5UA 2QMOA 4PV7A 3THSA 3ZDFA 2OWEA 3SS8A 2EC5A 3OHSX 4KIUA 3ZV6A 3PXGA 2JFWA 2HMSA 3LHSA 5I3ZA 1H2AS 1T25A 2R2AA 5NULA 1E32A 2JJ2A 3QE2A 1DJOA 2ZS7A 1JMVA 1XI2A 1MU0A 4Y6QA 2VOEA 4JJFA 4MR7B 4ZAYA 4BJ1A 2HRCA 4GLLA 1NVFA 4G1FA 1UP6A 3HXTA 4FCCA 1QIHA 4DUGD 2PUEA 3CZPA 2FWMX 4KQ9A 2E87A 4QSHA 1A96A 1JPJA 1REQB 4BXOA 1NFFA 3Q11A 2RGDA 3R6GA 3N8HA 4OJMX 5DMXA 3RHZA 5B6IA 1W0JA 4KRXA 1D7AA 1SKAA 4EG1A 4Q7EA 2QM8A 3R09A 3OHPA 4B75A 3SHWA 3DLCA 3ESCA 4DLKA 4EATA 1YBVA 3H11B 3ROQA 4F45A 1UL1X 4Q9AA 5KJCA 4BFUA 4JKYA 3HR7A 5EJ9A 2NO5A 3DMGA 3IR5A 3CUYA 4F3TA 4CKEB 3NRBA 1TF2A 1R8XA 3X1ZA 2PZMA 4HQNA 2G1PA 3T3HA 4DV0B 2O1XA 3BRWA 3FNGA 2MSCB 2AEEA 4MRPA 3R0JA 1IZ9A 1EK0A 4GZLA 2LCIA 3ORRA 1RQLA 1KBOA 3C3PA 5SZKB 2ZR8A 3GJ5A 4KAXA 3LQFA 4LWQA 3AJRA 3SXUB 3R8XA 4C4SA 4OP2A 5I8PA 1RHJA 4GKVA 5CVDA 3EQ8A 5GOZA 4RK6A 3VMFA 2XLBA 3KVVA 1SC4A 1A77A 2J9RA 1ABEA 3LQRA 4RPKA 1LLUA 2B6HA 2JIBA 1VCOA 2OV6A 2EFJA 3E82A 2UZAA 1H1LB 4EHJA 1M7HA 2P11A 3AXTA 3H5AA 2Y0DA 2ASVA 1W5EA 5EUBA 1R64A 2HUPA 2OO5C 2ZSAA 3H9BA 4FFSA 3KAQA 4RENA 3H1FA 4O0LA 1H8EA 2FPIB 4KUEA 121PA 4WFJA 4C0SA 4DLUA 4G4SO 4PBTA 1Y9JA 2FEOA 2IVFA 4FT4A 4ER0A 4DSUA 2I80A 4IZHA 2M98A 4XPIB 5CFOA 2ZAGA 1JALA 2R8EA 1FVHA 1T9GS 2PL5A 2ZU6A 3THWA 4ICIA 4C1BA 3W90A 5FPPA 2C4UA 4O4LB 1E1CA 2AGVA 1JTEA 2YN0A 3VDMA 2ZYSA 2R86A 3NNSA 3A26A 5DCLA 1BRTA 4M98A 5KINB 2AIRA 1Q77A 3AHHA 3VVMA 3BDIA 4JI4B 4D9BA 3WS7A 2VJAA 4C05A 1SKQA 5CAEA 3RASA 3JQAA 5K3FB 3HRKA 4FEAA 3FNQA 2N42A 5LBUA 5LQKA 4KAAA 1DEOA 1M1NA 1JECA 4OMDA 1U1CA 4YP9A 3HJUA 3SKYA 5K51A 5KC8A 4R2KA 1G9SA 1JQBA 2G4CA 5AHRA 3UK2A 2NP6A 3HJGA 3QJGA 4JV5B 3NWPA 3LDFA 4URUR 4D4GA 2BTEA 1DRWA 4OJYA 5K0TA 4N6OA 4IQ0A 4AJIA 4E5KA 3GJSA 1WWKA 1QM5A 5HF9A 3WK7A 3G7SA 4CU5A 2ID4A 4XAQA 4F0JA 2PX2A 4B3MB 2IK8A 1F06A 2XMBA 4AY3A 4B3HA 2AHOA 1SURA 3TK1A 2C99A 3K70C 1ZGGA 1IOWA 2GK4A 1ZSVA 2G9VA 4OKNA 1NQVA 5ISMA 5G1NA 1XROA 2DWPA 1X7HA 1YBHA 1IDOA 2JFXA 3CLVA 3UO8B 3JQFA 2Q8QA 3C6QA 2Q9AA 4TZKA 2WPNA 2Z1DA 3BMNB 2ODNA 4ZA2A 5GONF 4RD1A 1P2FA 2NPOA 2A9VA 1KWGA 2WEKA 4OFBA 1OXKB 4RLFA 1D1PA 2PFKA 2XWJI 2GHQA 3FIJA 5HDBB 2R6FA 3ETLA 4NZPA 3M8KA 4DCCA 4PG4A 1M8KA 2WJ3A 5DX0A 3ZJYA 3GZTB 3TI9A 4JJZA 3KKOA 3HM2A 3OZVA 3T5TA 1I33A 2XITA 4NE2A 4WGGA 3UK6A 3WI7A 1CNEA 1RCFA 3HY6A 1P31A 1ZEMA 2ZSHA 3LT2A 4DAEA 3NNNA 5HGJA 5TF4A 2YYSA 3QXJA 1XQVA 3BRQA 1ZJ6A 4FC7A 4WCVA 2OPHA 1YZQA 1II8B 4CM4B 1N78A 4UOZA 5CMLA 3B9PA 4EWLA 5KB3A 3NYWA 4WKGA 2HEIA 5AI0A 5KYXA 2C8VA 1XCLA 3ND8A 1C2YA 1NBMA 2I7DA 3KT3A 4Q7LA 1NSYA 1J99A 4G01B 2JH9A 3PR2B 2I2WA 1L7XA 2XNCA 3MOGA 4ZHSA 4RA6A 3LP6A 1VG0B 1ZGJA 2WU4A 3IO3A 3MNFA 2X9GA 2YS6A 4JKIA 4BLVA 1AQJA 2G63A 3ITNA 1UT8A 2LTAA 3AM1A 4LNUA 5FTNA 3K9GA 3L0DA 1JA1A 2G9UA 5KNCD 1M2VA 2E82A 1N9GB 2P2CA 3BKWA 4KR6A 1EFVB 1KAOA 4V39A 2FG7C 3H42B 3N6RA 2F3QA 4R8RA 1ULBA 4GBJA 1W4BA 4QUDA 4EG7A 2W43A 3PJRA 1IBCA 4JVOA 3VU9A 5KVVA 4CEIA 1OB2A 4QBKA 4KDRA 4G5YA 4B9EA 5HUQA 1PWZA 4BJ3A 3ACDA 2EZUA 1XKLA 4Z5XA 2VRWA 3DDNA 1DWPA 1UODA 1J70A 2I6GA 3A1WA 5LWQA 2HX1A 1Y0BA 3NVAA 2B9EA 5HK8A 4J0KA 5IT5A 2OTCA 4ZEWA 3VDNB 4DQUA 1AB6A 4Z0PA 5ICCA 3UMCA 5JNLA 1ZO8A 4QM6A 3QWBA 2O0LA 3LE8A 3DFKA 3EVFA 1SZJG 3GZNB 1HKHA 4Y6GB 1V3VA 4LSZA 3PXUA 9ABPA 4ZU6X 3FLAA 2E0IA 3G9QA 3FOCA 3OZGA 3ZI7A 1MB2A 4HUJA 1FC0A 1JVSA 2YHBA 1K8QA 1JWAB 1TIBA 3HLKA 3E5HA 4JJKA 1TJYA 4K9NA 4O4IF 5JSKA 5CB6A 4G56A 1W5FA 2WDPA 4X6YA 4R9VA 2HRRA 2YHIB 1Q0LA 3F5QA 2C7BA 3OMXA 4OI1A 2ENUA 3BWEA 3EVEA 3UPTA 5EGSA 1HG1A 1R3DA 1RACA 2HO4A 3CZCA 1HNNA 3QPUA 4Q00A 3WGTA 1N0HA 4RTMA 2JGNA 3I0MA 4W63A 2ZJOA 4Z0NA 5BQXA 5LQJA 4HNAA 1VPLA 3F8WA 4HGRA 4UBJA 5L53A 3PXAA 5DYIA 4ZGBA 5A7FA 2DQKA 5H8WA 5JJIA 3HKCB 1KDVA 3W2GA 1FYXA 1TZMA 3K09C 1ISMA 3FIUA 4RS4A 1TM7E 2UVDA 3ZE6A 1RAGA 2EBUA 3F2IA 5TNXA 5CB4F 1DIBA 1U7HA 4RZHA 1GPUA 2QPLA 3BOSA 4P31A 3IXQA 1PR1A 2BFDB 3GLFE 1XHFA 1R8QA 2H1WA 4F2PA 1B8NA 4P5DA 6ABPA 3EY4A 2VDNB 1MABA 4R0MA 2TMDA 2QROA 5CLLA 5E0KB 2PBLA 4BCDA 5EKDA 4DV6B 5ELXA 2DFTA 5JVDB 1HI9A 1Q1BA 5DF1A 5BUCA 1QS0A 3QU2A 2H5IA 3F97A 4Z1OA 2ZI4A 5BR4A 3O7MA 4M1YA 2JDIA 2MT9A 3KR0A 3RD5A 4GRAA 2VSNA 3O73A 3SJAA 5KQRA 4HDQB 1VMAA 3ZNNA 1ESEA 3BF8A 5DWDA 1PG0A 2ZPAA 4A9AA 3H2JA 1M8PA 2R1ZA 3GPCA 4X71A 1Z2EA 4YJ3F 1DLJA 3LXXA 3QW4B 4HXEB 3BFPA 3AF1A 3OWOA 3EZYA 5IDWA 2W8BA 3L9WA 2D8AA 2PNJA 4FSHA 1Z4IA 1ISFA 2P6OA 3IAM6 2AHRA 5E1OA 4C7MA 2RD2A 2G8LA 1U90A 3PRHA 3QPVA 4X5OA 4FGKA 4UAVA 1G19A 2D1RA 3M82A 4PX9A 1Q84A 1YNOA 4G5FA 1DAEA 5F77A 1KU0A 1MNAA 4XI9A 5B6PA 5D6NA 3OTWA 1QRDA 3PUHA 2PGLA 3SYLA 2OCKA 1AB5A 4NMLA 2ERYA 2PZKA 1CG6A 1KZYC 2C83A 4FDVA 5HKLA 2ODAA 4JEMA 1Z56C 3MRXA 2EFDB 2V7VA 3TL3A 4D79A 1DG9A 1RQGA 1NDUA 2UVPA 3JQ9A 1XNJA 2IUFA 2QG4A 2X15A 5BOVA 1AGPA 1E2GA 1GPBA 5KJEA 4V3CA 2PXAA 3AIKA 2VNAA 1PR3A 1FDUA 1NMEA 2GJAA 4AMBA 3LO8A 1WF3A 3ELYA 3VKVA 3WRXA 4YLEA 1B1CA 3CVJA 1XNRB 1VL8A 3CNBA 5FWYB 5JDCC 1N2CA 2XZTA 3JQQA 3NDJA 2ZEJA 5EIBD 3MWYW 2F1HA 4BZZA 2UXCB 1CE8A 2VTVA 3AJDA 3F6YA 4G3XA 3B78A 4H15A 3V1YA 1GLGA 1UXJA 3NDPA 2E5WA 1AZWA 1P2UA 4MR9B 2X3UA 4PO3X 4QPJC 2NZXA 3UUFA 1U2SA 4G89A 4JL5A 5JCOA 3SQDA 3DLPX 3JATA 2YMQA 1LGYA 4C6TB 3M6LA 4E88A 5JADA 1PQWA 4R1UA 2IYXA 4MEBA 2XAAA 4GKKB 4PC1A 1VCNA 1ZGCA 1RKXA 1ULTA 3ZVLA 4FYIA 3KJZA 1NSFA 1X77A 2XDQB 2GA8A 4N47A 1IPFA 1HSOA 1ULZA 4I4TA 4UMEA 3L8EA 4RJ2A 2O3UA 3G2PA 4QUEA 4XLZA 4F12A 1RC0A 4WXHA 3M5DA 2P9ZA 4BL5A 1SOVA 1A2BA 2OFWA 1UJMA 2VK2A 4JY7A 4V0RA 4K6OA 4BLRA 3PRKE 1XK6A 3EFOB 4F60A 2BF7A 1CB0A 3B1XA 4Q4JB 3U19A 5ECDA 3FPKA 2PMEA 2A5DA 5ENDA 3VPCA 4ZI7A 3OPVA 1PTKA 4G1EB 2GXUA 2PGAA 2ETVA 3F7OA 2CLCX 5DWQA 4Z9XA 5JFOA 1QIDA 3Q12A 3FD8A 1JU3A 3DEKA 5BXYA 4B5KA 1XMOB 5EXXA 2C9YA 3EGWA 4KVGA 1J07A 4XSGA 4S12A 1J2TA 3MAGA 1IY2A 2FEMA 2QUKA 4F3NA 5BVHB 3WTBA 2Y1WA 1U3VA 4J8PA 1T9KA 1NYLA 4U9IS 2YHUA 3I8OA 3WYNA 5ILGA 1KFEB 3ZN2A 3A4LA 4BX3A 5AXCA 1XK7A 4RORA 2OOSA 4AJJA 1OILA 1C3VA 2A0YA 2ZRLA 3KXPA 2A30A 3NANA 4I8IA 3RYIA 4INZA 1ZP6A 3F9CA 2ZBQA 3LQ4A 2IS6A 4MB2A 4YWHA 4EPWA 3PA6A 2QUZA 4P36A 4UREA 3AWIA 4XSVA 3D43A 4DDWA 2RG1A 4INOA 2ZJ2A 9LDTA 2HV9A 2SBTA 4ZOLA 3KB2A 1A9XA 3U3XA 1BROA 2GFHA 2WUVA 4G2TA 1V7ZA 4PYMA 3ZHQA 2WDZA 4GG1A 3D7MA 4EW6A 4KTVE 3GBVA 4EIWA 1K7EB 3Q3GE 1FQJA 5K6AC 3E9NA 1E5XA 2GM9A 3M2TA 3RS7A 4S2EA 4XEUA 1C9EA 1DXOA 1LBQA 3OX3A 4RV4A 4OJKA 4MH0R 3EZ7A 1L3IA 1WA5A 2RI0A 3IOEA 1KY2A 2C1ZA 2Y27A 5E6UA 5U4XA 1ZD9A 3IKTA 3RBAA 1BKSB 1T24A 1WDWB 2N0SA 2C92A 2WK1A 4GL2A 1ULSA 1YU6A 3GRZA 4ON9A 2HM7A 4IO1A 1XN1A 3LCVB 2NVUA 3B1WA 2HCBA 1M2JA 2GF0A 4M9ZA 2IHKA 3D4LA 1BS1A 2NYUA 4ARZA 2PS1A 3DQZA 1ZKMA 2QUIA 3R77A 1AKRA 3IA2A 3JASB 3VC2A 1IOLA 5ALXA 5H83A 2I6FA 2QL9A 3PUKA 5DIFA 4BNFA 3Q3EA 5CFNA 3G2NA 1TCBA 1UPXA 1MHTA 2Q7OE 1NBME 1Z6XA 4MDYA 2AE1A 4S04A 2H48A 2XV1A 3OCJA 4X85A 1JR4A 5G0TA 3TQIA 4UNSA 2CJXA 3NAQA 4YRAA 5HCNA 1WQ1R 2COKA 3ED5A 3FDZB 1RZVA 1KS2A 4WZAE 3CZMA 3G0HA 3BEDA 3G0IA 1M2OB 2KS6A 1U8XX 2PL9A 1XR3A 4OEHA 3SN6A 4MCHA 3VDXA 1FTWA 2DHEA 2QR2A 5G02A 1PSDA 2CDRA 1N34B 1SM4A 3DCNA 3RTBA 1OKKD 4TOIA 3DMYA 5PNTA 4BLTA 1BXRA 5HFJA 3E7FA 4NCHA 5DI9A 2FEWB 2ZJYA 4CMHA 4CUZA 3OZCA 2KE5A 1Z73A 4ZMSA 4RBNA 3HKEB 3MCAA 3KALA 3DKVA 3OZRA 4BBJA 2OILA 3A06A 3AILA 3EFEA 3I12A 5CLQA 1RWMA 1LZLA 4RANA 1PGNA 1I2AA 1PU2A 1U0RA 4R51A 2IZ5A 2FK8A 2AOUA 2FV8A 2G7MC 3I45A 4LXIA 1WU7A 1TC2A 2IZZA 2WABA 5DHPA 1EE1A 4YAWA 5J5AA 2PWPA 2FRVA 1W36B 1R50A 1U1IA 3CINA 4YRDA 4K9PA 2H9AA 4FFNA 2AXEA 4PZPA 1LLFA 2QI9F 1CUHA 3JD2A 4RVNA 1XTKA 2O1EA 4XFJA 3ZNOA 3O31A 3SJ7A 4YV7A 2B3DA 4RVDA 5D7BA 1J39A 2IYAA 5EE3A 3VKGA 1RIIA 1EFLA 3BQMB 3NV9A 1TPZA 3NW9A 3SY8A 5IF9A 1RQXA 2VPPA 3G0DA 3H4MA 3GAFA 4R8LA 3BHJA 3OLVA 1I1NA 2XA1A 1UDRA 3BE4A 3IOCA 2OHJA 5EEGA 3W77A 5B6JA 4URYR 6REQB 3P9SA 4BN0A 5C4GB 3G7NA 1XEWX 1VZ3A 1GZ6A 4JU8A 3V8BA 3INRA 3ZBQA 1JI3A 3GLIB 4S3MA 3TQRA 1RPAA 2D6FA 3IPAA 3E18A 3IPXA 1AKUA 4TTAA 1HE4A 1V11B 2JHCA 3CPHA 1EB8A 3LBNA 4QJIA 1UEXC 4MJ3A 4K6FA 3H2GA 1VJDA 3HJRA 1U2DC 1S3GA 4JWKA 4ZANA 2H5JA 3RW9A 1WBDA 1E3DA 2D1YA 2KB0A 1JDNA 4A2WA 5E6SB 4FU0A 5KHAA 2YWEA 3QKIA 5TPWA 4PR0A 4BUCA 4D99A 4GOXA 4XGKA 5E2AA 2R6AA 3EHEA 3O4VA 4YRLA 1AY0A 1M7GA 1ZA2A 2WNHA 1IXZA 1FTYA 1Z4OA 3EW7A 1ORVA 1SVNA 1R27A 3PC4A 4YXFA 3MSXA 4HYTA 2ZITA 3UV7A 1TEHA 3K9BA 3HCDA 5ALMA 4BFTA 2ES4A 4Y7CA 4EO9A 1QQBA 1DG1G 2ZYTX 4UNPA 5DN6D 5U9CA 4INJA 3GPIA 3TSCA 4TSRA 1P6XA 4BASA 1QKKA 2EGHA 3ZUPA 4AJ9A 1XO1A 2O48X 3K15A 1H1DA 3I01A 3L7BA 1PT8A 1YO6A 2ZJ7A 3OUUA 4G1BA 3RS8A 4CLHA 3ZHSA 4RTQA 2Q4EA 2PLAA 1O9HA 1I4EB 1SWWA 2Y66A 3L02A 3UGKA 4DEVA 4EENA 4LZOA 5BPHA 2FR1A 4AJEA 4NMHA 1S4MA 2ACKA 4TMFA 3Q6MA 2VBGA 2QT9A 3KB8A 2R47A 4EFNA 1TT5B 2V5VA 2VATA 1LDBA 1T0UA 2WHXA 3JZIA 4DV2B 1VA5A 1ZICA 2Z9BA 2ZRHA 2XMGA 3GLHA 4N7MA 4H17A 2RCYA 1R9MA 2QZ4A 1AOXA 2CBXA 4MCAA 2BY4A 4BX0A 3A9SA 2FMIA 2JGLA 3AKCA 1L5VA 1QG2A 1Z4NA 3LD9A 4U5QA 5FUBA 1KOFA 3RHSA 1YTLA 2YVQA 3FMOB 3TL6A 5KPDA 1N57A 1O8CA 2OV2A 2PYZA 1EE2A 4G24A 4HAXA 4LMPA 1CD5A 1LPBB 1JE0A 1IE3A 1NC1A 1TFUA 2Q9BA 3QW2A 4LF6B 2ZIGA 3BXGA 3Q40A 5KWSA 4CLDA 4XQGA 2GEVA 3S8YA 1H2YA 1D03A 3U7QA 3LZCA 4ZI5A 4JYBA 4YCJA 1VOTA 3KJXA 4GM0A 3D6UA 1GTRA 4MB0A 3TXXA 4LVUA 4KIFA 2WKRA 1OB5A 2O7QA 2JAXA 5K03A 2QAJA 4ZRDA 1JIQA 2PUAA 4LMBA 3H2KA 3WYBA 1TVKB 3DHEA 4B32A 1N2HA 4L9AA 3WAGA 4JUBA 4MO2A 2C5BA 3GX1A 3H8WA 4PZLA 4EPRA 5EIBC 2M6LA 3USCS 3R6WA 1J24A 3TRDA 3G2JA 4ZOBA 3WKBA 2VQDA 4RF2A 1JHUA 5BV0A 2FPRA 2PEYA 3I4CA 4NK4A 1IY1A 1Z0DA 3X2EA 3PLAE 3PLNA 1GP2A 4W9MC 4MA4A 1Y6QA 3AG5A 5BP7A 3U40A 4NHOA 4DREA 2WPDD 5AOAA 3NG1A 1OAAA 1S0UA 2Q46A 4TS9A 5KSZA 1N2CE 4IJUA 3LFUA 1P0CA 1FNMA 1H0HA 1TPYA 3THOA 5BN3B 4CL2A 3TR0A 1E2FA 1DL5A 3AEKA 5KAPA 2IX9A 1LF0A 3VSEA 1ECFA 4CL0A 3RDPA 4YMLA 3SQOA 3HEAA 3EFBA 4QEZA 4Y0VA 4KH1A 4UATA 1KQNA 1MAHA 1KAQA 2GVZC 1HEIA 4MI9A 2PT7A 2DQSA 2AOWA 4HGNA 1WXFA 4XVUA 2VDKB 3DNFA 2UZ4A 2BFBA 5A4MS 5HTKA 1K88A 1BN7A 2IEZA 4HXGA 4DEYA 1RYNA 1ZUD1 2BVNA 2QY6A 3KO8A 1B0ZA 4XDZA 3OX1A 5G4KA 1H2ZA 1OVGA 1DRJA 3GGPA 1NN3A 1QTRA 2ZR9A 4WTOA 1S1CA 3DC7A 4OSPA 3BEOA 3A3YA 3O6VA 3R75A 4QARA 1GYPA 3FR7A 1RMQA 2FJPA 2XGOA 5IK2D 2P9TA 2JFBA 1S96A 2YFHA 2V7EA 1ZGAA