1IZ8A

Re-refinement of the structure of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE, LINB
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 116
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iz8A00
1QIMA 4N5HX 1MNAA 1QFMA 4AN0A 1THGA 1R1DA 5BV7A 1ZI6A 2G5TA 2Y6UA 1XZKA 3WYNA 1P0MA 1YR2A 3WJ1A 1MTZA 1L7QA 2PL5A 4Q34A 2HRRA 2Z3WA 4EBBA 3D59A 4E46A 3E3AA 1LBSA 3WL5A 1W4LA 1XRNA 4N8SA 4K6GA 5ALFA 2WFMA 4HVTA 1CEXA 1GZ7A 4X00A 3H0CA 5ALKA 2QRUA 2Z3ZA 3BJMA 2BJHA 4MYDA 2QJRA 5AKLA 1CUVA 4EY5A 2Z8ZA 1FFDA 5ALPA 3SK0A 2QUAA 5CT5A 3BJRA 1X2BA 4G4GA 3BDVA 2XQIA 4EHBA 2I3DA 3R40A 3HI4A 1VA5A 2OG1A 1A7UA 1QZ3A 2LIPA 4KEAA 2OCGA 5K3EA 5LYYA 5ISMA 1WPRA 4C87A 5KWJA 3QYJA 2DQYA 1PFQA 1Q0RA 3VJLA 1MAAA 3WLAA 4E15A 1CUEA 3LIPA 3O95A 1XLUA 3A6ZA 1ZIXA 4CG3A 3WWEA 3AINA 3WL7A 2VSQA 3RK4A 2QM0A 2OCKA 4QLAA 5ALGA 1EVQA 4B0PA 2OCIA 2B61A 3C6XA 2OGSA 4B84A 1BROA 3DLTA 4EA6A 4B9AA 1H2ZA 4PV7A 2WFLA 1CUFA 3BL8A 4H0CA 3SWWA 3I6MA 4FFVA 2QVBA 3RKSA 2JGMA 1TRHA 4Y2XA 3WWCA 4W1SA 2QXTA 5I8PA 1WHSA 4UHBA 1TQHA 2XUKA 3R3VA 4DM7A 5LP1A 5H3HA 1WPXA 5CH8A 3WYDA 3OPMA 5HK8A 3QVMA 1UKAA 2O2GA 3BF7A 2B4KA 4PNZA 3S8YA 5JANA 4BAGA 4QDZA 4FLMA 2VQ6A 1N5RA 5K3DA 2WHPB 2D0DA 5EI5A 1JU3A 1R4ZA 4C4XA 5LLSA 1QIIA 1FFAA 1UK9A 3S2ZA 2GYWA 1GPLA 5A7FA 5FLKA 4Y2RA 1N8SA 1LPNA 3Q0TA 1TK3A 1GKKA 4BZWA 2IIVA 2XMRA 5FXMA 3G0CA 5JATA 5ALSA 4B85A 1SC9A 1XZFA 4L9AA 2ECFA 3DQZA 4H7IA 5AIBA 3MVEA 1RYYA 4B82A 4Y2VA 5HKAA 3DL7A 5LZ9A 2G5PA 4C88A 1J06A 3QMMA 5CH5A 1XLVA 1CUHA 3ESCA 2J3DA 3R3ZA 1BRTA 4HS9A 2C5GA 3WWPA 3N2ZB 5I9IA 1BN6A 1SCIA 1YA8A 1UK7A 3RARA 4C01A 1LPOA 1T4MA 2HA2A 2QT9A 3DDUA 4P9NA 4BE4A 1VJ5A 2VT6A 3CN7A 4Y2UA 4I19A 3O4HA 1J1IA 3QM1A 2XT0A 1SCQA 3SC2A 5T4FA 4RPCA 4Y7DA 5CT9A 2XE4A 2DFPA 3GZJA 4MYSA 4XX1A 4CIAA 3JYHA 3V48A 2I03A 4FHZA 4L72A 3OTQA 3DOIA 5EIAA 4MWSA 2AJ8A 3DKRA 2YYSA 4X95A 2W22A 1ZGCA 5LZ2A 2C7BA 3A2NA 4X6UA 5FOQA 3C6ZA 2JEYA 1BCRA 2NW6A 4LXGA 3U0VA 3KWJA 3QPCA 4W63A 3ANSA 1CUGA 3PUHA 2CBGA 2H1IA 5C8ZA 1H2XA 4OB8A 5ALNA 3T52A 5JAOA 3AZOA 1G4HA 2C4HA 1N1MA 4UHHA 3B5EA 5ALJA 5DWDA 4ZRDA 3M81A 1LLFA 4PW0A 4BZZA 5EGNA 1YASA 4AMZA 3ICWA 1NX9A 2WSLA 4G4JA 3H04A 5ALVA 1LZLA 5HFAA 1IMJA 3V1MA 4DTCA 2ZYRA 2V98A 2PSJA 2J3QA 4L3WA 2XUOA 3C6BA 2ZSIA 2BUCA 5FV4A 3AIOA 1CPYA 1CVLA 2JGIA 3IVMA 5FKJA 1XQYA 1XRRA 1BEZA 1E8MA 4HRXA 4KE6A 4W9RA 1KU0A 5K3CA 4BE9A 4TGLA 5AOBA 5HK9A 1JKMA 2XMSA 3G9UA 3W05A 4G5XA 1YB7A 3H17A 1XZHA 1WB4A 2B20A 2DCMA 4NS4A 3HACA 5FUMA 4P92A 1VE7A 4O08A 5AK3A 1EA5A 2ROQA 1MJ5A 4GBGA 4JYPA 1J2EA 3NOXA 3AILA 1QONA 3AZQA 1XLWA 3WL6A 2JGLA 2ZJ7A 1XZAA 2PSEA 4U2DA 3FVTA 2BKLA 5A2GA 1ACJA 5CBKA 5ALMA 4BC1A 2EDAA 4H35A 3BE8A 5ALOA 2PPLA 3I2IA 2XUAA 1XKTA 3EF3A 3I2FA 3F97A 3H2GA 5AOCA 3O4JA 4B80A 1OXMA 4HTAA 3G7NA 3ZWQA 4OB7A 1E8NA 3EIOA 1KEZA 5YASA 3ANTA 2GZSA 5AM5A 3FSGA 4LKOA 4UBJA 4UHCA 4D9JA 1VA4A 3VJKA 3WK7A 4Q1VA 2IX9A 1ZIYA 4BATA 4H7HA 3WWOA 4G1FA 4WFIA 1ODSA 3DCNA 1P0QA 3IUQA 3WA6A 4FBMA 2HA6A 5I7UA 3MUOA 5DJ5A 2XQJA 3C70A 2PBLA 2XUJA 3WWDA 2R11A 1Z68A 2O7RA 3DJYA 5D3ZA 4ZGBA 3H19A 3H2JA 1G42A 4C89A 2ES4A 3I28A 4ARBA 4IH4A 2PSHA 5A71A 4AO7A 3RLIA 4J7AA 1VOTA 4Y2YA 3R3WA 1W6RA 1EINA 3WKAA 1ZGBA 4W1PA 5AOAA 1ZI9A 3AFIA 5AK6A 1IUNA 2WG2A 2HA3A 1LPMA 1LGYA 3D5EA 1FFCA 4X94A 1QIFA 4QDUA 4GECA 1YB6A 4Y2QA 2PUHA 2XMBA 3A2LA 1DX6A 1CUZA 4RE6A 5HF6A 3ESDA 2WIFA 1L7RA 1VLQA 2PKYX 3D2AA 4EB0A 1Q83A 2XLBA 4Q3OA 1CR6A 2OGZA 3QMVA 4MWTA 3KD2A 5ESRA 4NZZA 4PSCA 3C5VA 3STVA 3K2IA 3LIIA 1TCBA 4B7ZA 3AIMA 3KSRA 4AN1A 5FPPA 1CUJA 5C81A 5JD5A 2QKYA 1K5PA 3ED1A 3VJMA 2BUBA 5D6OA 3VDXA 2VJCA 4RNCA 1MT3A 2Z5GA 4H7EA 1CUBA 1ZI8A 3HC7A 2BUAA 5SYNA 4BCBA 2HM7A 1LZKA 3CXUA 3F98A 3HLKA 1WM1A 2WHPA 4E14A 5K3BA 2HU7A 3L1IA 4Q3KA 1BE0A 2DHEA 4UHDA 4MJ3A 5CT4A 1FJ2A 3GROA 1NU8A 1N5MA 2BGRA 3H2KA 2VF2A 2Y1KA 3OOSA 3GBSA 2OLEA 2EDCA 5CTAA 4OCZA 2WQZA 3R3UA 1BS9A 1QIKA 3DNMA 5JAHA 2H7CA 3PF8A 2YXPX 1CV2A 5C8VA 4BTVA 5J3JA 4QNNA 4MQMA 2WG1A 1B6GA 5ALZA 1QIJA 3R0VA 3C6YA 1ETHA 4B81A 1XFDA 3ZI7A 2HFJA 4J0JA 4J0CA 1DWOA 2BFNA 3FLAA 1C4XA 3I6YA 4CIBA 4WY8A 1L7AA 3W2TA 4KE8A 1MO2A 4FBLA 3HZOA 4DYHA 2HU5A 4WFKA 4AQDA 3FYUC 5KBYA 2CKMA 5AK4A 1MNQA 4QWMA 4HRYA 4K6HA 5JAUA 4F0JA 2XQKA 2I78A 1MN6A 5JYCA 4GHWA 1AKNA 4AZ0A 4J03A 3E4DA 5JZSA 1E89A 1HDEA 5AHXA 1ZD5A 4NMWA 5AKHA 2H9YA 5ALUA 4WY5A 5AICA 4EY8A 2XUHA 1A8SA 1E5TA 1BU8A 3FAKA 2PSDA 3DYVA 3T4UA 2WHRA 1XQWA 5CT8A 2ZJFA 4HXFB 3OM8A 2BCEA 1EDEA 4W1QA 3NGMA 4OU5A 4KRYA 2GYUA 2HA4A 3KWFA 4QLOA 1XZEA 2WG0A 2XB6A 3A2MA 4RE5A 1X2EA 4MEBA 3PF9A 2RHTA 1QGED 3WZLA 3WK9A 1YA4A 2V96A 3G0GA 4X6YA 3Q8WA 4L0CA 1TAHA 3STXA 1PV1A 5LZ4A 1O6FA 5IVKA 4X97A 3R3YA 1FFEA 4FMPA 3ZLVA 4BDTA 1SCKA 2WUEA 4BP9A 1UKCA 5HF9A 3I2GA 1DINA 3AZPA 3LCRA 4UBMA 5DTJA 5C8XA 4PSDA 5A7GA 5A62A 1U2EA 3ICVA 5HFNA 3B3QA 5KREA 3ZPXA 1AUOA 3IULA 2XI4A 2XQFA 3DS8A 4BDSA 1ZD4A 4UFNA 1UOOA 1QFSA 1XRLA 3OURA 1XQVA 4OU4A 3UMJA 1EDBA 2WUFA 2AJDA 2C5FA 4U2GA 4U2EA 2Y2VA 2EEPA 2HRQA 2J4CA 1OILA 3HEAA 3LP5A 1QIEA 2QS9A 3WMRA 1F8UA 4KACA 5AP9A 1DWQA 1LPSA 3G8YA 2CJPA 1THTA 1E3QA 1O6GA 4FTWA 3G9TA 5DYWA 3FLEA 3QITA 4BAUA 1K4YA 1XZMA 4BYMA 5HQ3B 3PICA 2QJWA 4WDQA 1XZLA 1FFBA 1DX4A 2VAXA 1VZ3A 1LNSA 3PFCA 5DNUA 4UBNA 2XUGA 2Z8XA 3DD5A 2JGKA 1A8QA 5LIPA 2ACEA 2PUJA 4GW3A 3W04A 4BC0A 1LBTA 4DMCA 5E4TA 4FWBA 4H18A 2VTVA 1JMYA 2VAVA 4I3FA 1IUPA 1JJBA 5AI8A 3CN9A 4DMHA 4EZIA 4GXNA 4H7KA 4LYEA 3IBTA 5ALLA 3V1NA 4Q05A 2CEKA 1EHYA 5HF8A 3STUA 2DHCA 3GA7A 5AJHA 5D3KA 3EQ9A 2VJBA 3FSGD 5K5EA 1CQZA 4ZWNA 1XQXA 4I4CA 4IQ4A 4X3CA 5IVDA 1EH5A 5CT6A 2AJLI 5JZ9A 4UPDA 3SX4A 4C4ZA 4PSUA 2WTNA 2AJCA 3IUJA 1MX5A 1UWCA 5AKZA 2WJ6A 1ORVA 5LZ7A 4NVRA 3NWOA 3WK5A 4H7JA 4PQEA 1X70A 2RAUA 3PE6A 2WKWA 2DR0A 3IUNA 1UXOA 2OPHA 5A6VA 3EQ7A 1PJAA 2OQVA 3D2CA 2ACKA 4EUSA 5BWCA 4U2FA 3B12A 2FJ0A 1XZCA 5AO9A 4UBLA 1ODTC 5AKYA 2WILA 4GDMA 3FOBA 4DNFA 1QOZA 5JALA 3FYUB 4G8CA 5AKEA 4HZGA 4KE7A 1SFRA 2RGUA 5IKXA 4FLEA 1H22A 2AXEA 2ORYA 1IZ8A 2PU7A 2PVSA 2YASA 1YAJA 3H2IA 1XRPA 3L1HA 4LIPD 1EB9A 4QDTA 1VE6A 3YASA 3UUFA 1OCEA 3GUUA 1MX1A 2CB9A 2XUQA 3HABA 2XMCA 4UBIA 4U2CA 4LHEA 1R9NA 3CCCA 3H1AA 1DT3A 4B0OA 3IA2A 5HCUA 3R3XA 3WK8A 1CUDA 4KRXA 2DSNA 2OGTA 1FSSA 3FCXA 1Q84A 5BWBA 2WJ4A 2K2QB 1CUWA 5AKKA 3TEJA 1UFOA 1GT6A 3IDAA 3G9XA 1ODCA 3ILSA 4ZXFA 4DNQA 2WTMA 4FFWA 4KAFA 1DT5A 2HIHA 2JF0A 5LKAA 5AIAA 1QE3A 3C87A 1HBJA 5LZ8A 4U2BA 2AJBA 4OUKX 5AM1A 5JD6A 3D3NA 1BN7A 3O9VA 5JZBA 4FNGA 1EVEA 1U8EA 2DHDA 5JARA 2VA9A 1LPAB 4X90A 4X91A 1WOMA 3KXPA 4EY6A 1DQYA 1U65A 5E4JA 4DMFA 1AC5A 2OAEA 4Y9SA 1EDDA 2HL6A 4FOLA 5AK5A 1GGVA 2WIDA 5AKGA 4KAAA 4WDRA 5K3FB 1UZAA 4LXIA 5T4BA 1XZDA 4FNMA 5IVHA 2XMDA 3DYIA 1QIGA 1QIDA 3ESBA 1AMNA 1ZOIA 5EHZA 3BXPA 2CUTA 3F96A 4N8DA 1R88A 2WUGA 2YH2A 3D4LA 2FX5A 2CMFA 1ACLA 3PDCA 5C7YA 1W1IA 3JW8A 2JGFA 4IH1A 4AX4A 5AM3A 5T4HA 1CUAA 1Y7HA 5CXUA 4EY7A 2WUDA 4LYDA 4CFSA 4W1RA 2ZYSA 1HPLA 2QR5A 3PUIA 3FCYA 1J07A 1GXSA 3F67A 4Y2PA 4JNCA 4KJXA 3IUMA 1EI9A 4B6GA 4K2AA 4YASA 1K6EA 2BGNA 3OC0A 2OCLA 3E1GA 2PX6A 3STYA 4E11A 4QA9A 5CMLA 5DLPA 4QE3A 2Y2UA 4UBKA 1E66A 2R8BA 5JIBA 5KWIA 5AM0A 3ESAA 2ZSHA 1XZGA 1JT2A 4X71A 2ZYHA 3HYSA 4JEIA 1UT6A 3G9ZA 4RGYA 5ALXA 4WFJA 4M0FA 2G4LA 2RI6A 3QH4A 2WU3A 2HU8A 4K6KA 3WQHA 1BCSA 4Y2TA 3WI7A 3I1IA 3IURA 2JGJA 4ITVA 5BOVA 3AIKA 4PF1A 3O4IA 3WKDA 4UHFA 3AUKA 5T4EA 5EIHA 4AB1A 2QXUA 1UOPA 4Q3LA 3DKKA 4B83A 1EK1A 1LPBB 5FDFA 3D0KA 3PI6A 4TVKA 4BB0A 5IVIA 4KYVA 5CXXA 4OYLA 4BVKA 3GELA 2RIPA 5ALWA 4CI9A 4FLFA 1CQWA 3BIWA 1H2YA 1UOQA 2GBFA 2UZ0A 1ZD2P 1VZ2A 5FP0A 5HQ3A 3HRHA 2XQGA 4Y2JA 1MAHA 2WM2A 4UFOA 1CUUA 3C45A 3HXKA 4AO8A 4GWLA 4C6HA 4G9GA 4KAJA 1CUXA 4LXHA 1XKLA 3WIBA 4M0MA 1QJ4A 2JGEA 2B9VA 4ETWA 2OQIA 3I1YA 5E2IA 4M0EA 1WB6A 3N0TA 2RONA 3IB3A 1DU4A 4MQLA 4J0HA 2E3JA 3WA7A 3RM3A 5ALEA 5AKXA 1A8UA 4H77A 1ZJ4A 1Q0ZA 4QDOA 1IVYA 2C0QA 3WK4A 4UUQA 4CCYB 4WJLA 2QOEA 4AO6A 1NU6A 2HHAA 4XVCA 4UBOA 1F0NA 1G66A 4N8EA 2GBIA 5JASA 1ISPA 5CRIA 4HAIA 4YPVA 3VVMA 3UUEA 4H7FA 2HA0A 3HJUA 1XZBA 5EHQA 3I2JA 3KOOA 1ZICA 1H2WA 3JWEA 3FNBA 4IHAA 3P2MA 4YK7A 4CCWA 3I6ZA 2XMZA 4G4IA 1IUOA 1GKLA 5A7HA 4JH0A 1TCCA 2D5LA 1XZJA 1DQZA 4J0IA 3TJMA 3WKBA 5AI5A 1C7JA 5D7BA 1A88A 3EQ8A 4A5SA 4EY4A 5DNWA 2GYVA 1W52X 5JD4A 4GLBA 1HLGA 4F5ZA 1IZ7A 7YASA 4C4YA 5EHXA 4A16A 3WKCA 3BF8A 3V1KA 2G63A 2WHQA 2HFKA 1XROA 3FYUA 3W9BA 5EFZA 4DMKA 3ZLTA 2H7YA 3A70A 2WIKA 5F4ZA 5HKBA 3VXKA 3X3HA 1ZJ5A 4BRSA 3QPDA 2X5XA 1DTEA 1R9MA 3FYTA 5CURA 1TKRA 3C43A 2WIJA 1CUIA 2JIDA 1SOMA 4XWGA 3K6KA 2V9ZA 2XUDA 4UHEA 4DSZA 4OD0A 3F9CA 4IH9A 4AXBA 3BDIA 4P93A 2IITA 4BCDA 3MGAA 3M3DA 2VATA 1CIJA 2QMQA 3AJAA 2WU4A 5JAPA 1YAHA 1WB5A 3O9MA 3ZV7A 1MPXA 1R3DA 4TPKA 4V2IA 3QZUA 1QTRA 5AKIA 3DOHA 4QDXA 2QUBA 5ALDA 3ZLUA 4F60A 3CCBA 1TCAA 1EXWA 1CFJA 2HA7A 4H7DA 4FKBA 2X76A 2ZYIA 3QPAA 3KDAA 4XIIA 3WZMA 1T2NA 4GEGA 4X6XA 5DTIA 1AZWA 2OAGA 3TGLA 1W76A 4J3JA 1GPKA 3WJ2A 4MXDA 1YS1X 6YASA 1EX9A 1GPNA 5JADA 3BIXA 2O7VA 3STWA 5CW2A 2DQZA 4QZVA 5ALIA 2FUKA 4KE9A 2VJAA 3V9AA 1CRLA 2JEZA 2WFLB 4OYYA 3PFBA 5AI6A 5DNVA 1GQRA 1Y37A 3DL4A 5DYTA 3MUNA 4GI1A 4DNPA 1H23A 3F8SA 3FBWA 5K3FA 5EIEA 4MEAA 1YCDA 1HKHA 4Z49A 2J4FA 3W9UA 2W6CX 5CH3A 2HADA 4JUIA 1F6WA 4S0XA 1LPPA 4F21A 4OSEA 2WIGA 5IH7A 5AH0A 1ZD3A 1QIHA 2HA5A 4DGQA 1AGYA 4Y2SA 1JI3A 2ZVDA 3EBLA 1VXRA 1C7IA 3M83A 5EHNA 1YS2X 2ZJ6A 1MX9A 4HXEB 4J0KA 4DLNA 2FJPA 4CG2A 5AM2A 5ALTA 1UK6A 4BVLA 3D2BA 4ZV7A 2C58A 3U1TA 3C8HA 1UK8A 4BP8A 4FDMA 3WIOA 4YX9A 4BCCA 2QTBA 3I2KA 1RWQA 1XZIA 2GBGA 5AI4A 1EK2A 2I3ZA 4BAZA 5HZGA 4ZREA 3QMWA 4BRZA 5ALHA 4OPMA 1P0PA 3WKEA 4DNOA 2XUIA 3VKFA 2WJ3A 1M33A 1QLWA 5ALQA 4X93A 1DWPA 1JJIA 5AKJA 1P0IA 5AI0A 5SYMA 3D7RA 2ONCA 1YSCA 3VVLA 4QWWA 1CLEA 1HL7A 1BEEA 2Q0XA 2V97A 4X85A 1QTIA 1JU4A 1Y7IA 4ZV9A 1D07A 2PSFA 4HXGA 5LKRA 4WCVA 4QEKA 3K9BA 1UKBA 4XJVA 4ROTA 4ARAA 1AX9A 2X8BA 4X92A 4INZA 4BBZA 2VEOA 5AM4A 3DEAA 3LLCA 4CG1A 5K3AA 4P08A 4BTLA 2O2IA 1JJFA 3C5WP 1QO7A 1HQDA 1F0PA 1RP1A 3NUZA 2H7XA 4X7BA 2VJDA 1W75A 4G8DA 4IO0A 5FRDA 2WFZA 1EB8A 1I6WA 3IIIA 1VKHA 4UFPA 5HF5A 3H2HA 3I2HA 3G02A 4J0DA 2RHWA 1XRQA 4Q82A 3GFFA 1WCYA 5LZ5A 1K8QA 1JFRA 3WL8A 4KR0A 3W06A 5DYYA 1XRMA 2OXEA 2C0PA 4ZI5A 2VT7A 1WHTA 1MU0A 4AZ3A 3G0IA 2XUFA 4JYMA 4G8BA 2XMGA 3E0XA 4A23A 2QZPA 4AMYA 2XMQA 3O0DA 4B9EA 5E4YA 2BAGA 1B41A 1U4NA 5ALRA 3STTA 2XUPA 2WLSA 3V1LA 1AQLA 4OB6A 3H1BA 4CCYA 1CUSA 1AURA 2JBWA 4J0GA 1QO9A 4G9EA 3FWHA 1GQSA 1E8DA 4K5QA 1CUYA 3M82A 3WK6A 2P8SA 3C8DA 1ORWA 5FPQA 3QBJA 2GZRA 2XDWA 2CZQA 3VISA 2PU5A 3FLBA 2O2HA 4DIUA 1K63A 2XLCA 3G0DA 3G0BA 2HDWA 3OG9A 3O4GA 2GBCA 3BWXA 3R41A 3HSSA 1S8OA 4PO3X 3FVRA 1G5FA 4BVJA 4DSAA 1USWA 2PM8A 2Y6VA 5ALYA 1R50A 3L1JA 3H18A 3TRDA 1JMKC 1TIBA 3LS2A 4N5IX 1VXOA 1CUCA 1KU6A 5AI9A
chains in the Genus database with same CATH superfamily
2YJ5A 1QIMA 5FI0B 1LLQA 1KNXA 1R15A 4IILA 4LN1A 4AN0A 1YL5A 2JGRA 1UKZA 1THGA 4TVBA 5BV7A 4M0CA 1SUBA 2OR3A 4NBLA 2Y6UA 4FOSA 1TYBE 3MRSA 1XZKA 2R85A 2CWDA 3IQZA 5F9FA 3DJFA 3FTNA 3KL4A 5AW8A 3PEUA 5KJFA 4AY4A 5BVGA 1P0MA 1FRVA 2EATA 2DAPA 5FOTA 3WJ1A 4MRVA 4MKHA 2Q1UA 3FKQA 3U62A 2P2DA 2GXQA 1KDTA 4Q34A 8ABPA 2R6FA 3SZLA 2XAUA 5TC4A 5HZHA 2FWRA 5JXIA 4E46A 1DQPA 2WIBA 3SCZA 1XTIA 5B1YA 4PRZA 1E98A 1ULZA 4MVJD 2I3AA 4R2XA 1W4LA 3UGKA 5LCXA 4EZBA 4X65B 3OIVA 4G25A 4HVTA 1E6EA 2Q3BA 5AVUA 1I0ZA 2P4SA 4DA6A 1ILEA 2O8FA 4DV1B 3L7CA 4FHGA 1PF7E 3H0CA 4M8SA 3VTZA 2YZNA 5CYGA 2G0AA 3IL2A 1IXSB 1Y98A 1GD1O 3L8FA 1C7RA 1JQJC 4B6SA 5JCZA 3DQPA 3GARA 1GYPA 3LXRA 4MYDA 5IUKC 3OEWA 1Z8HA 2A4KA 3SVZA 4ZQIA 2JIOA 1SR8A 3L7YA 3ROFA 4DDVA 2FXIA 4A6PA 5IZ4A 1A7KA 2D8MA 4N03A 1HDCA 4R68A 4K3VA 4F2WA 2HEGA 4RVUA 2YJNA 4UATA 4F2GA 1XMQB 4G2TA 1VRVA 1M1NB 1FFDA 4FONA 2B1IA 3KYBA 2FEXA 1WMFA 3T3EA 5JI2E 1NM5A 4LCJA 4GXQA 1PR5A 1RE1A 1O0SA 2WWHA 4C5AA 3BDVA 5A3QA 4QUIA 1XSEA 1T2VA 4EHBA 2O19A 2I3DA 3CZ4A 3R40A 3HI4A 5BSHA 1C1XA 1T5SA 2CLCX 1VA5A 2H17A 5TARA 1EE9A 3I9JA 2BE9A 2OG1A 3O6VA 1T91A 1L8QA 3KAPA 5DASA 1V47A 1X77A 3F9RA 1G8SA 5IFLA 1D3AA 2LIPA 4KEAA 3MAJA 4MTCA 4GICA 2W98A 3NHWA 3PPWA 2SCUB 1R2QA 3CE9A 4L4RA 3MW8A 4RPIA 5EEHA 5LSAA 4D8UA 4MHTA 1BG6A 3PDJA 3TEFA 2EVWX 2IEAA 2ORWA 5BN5A 3BKXA 1P9OA 3L6UA 2DQYA 4J0FA 4GPAA 1PFQA 2IH5A 5FL3A 1UWKA 4ESEA 4KWHA 1NSFA 2ADMA 4C3UA 3BTSA 4KR7A 2DERA 2NZUG 2Q3CA 5FUQA 2XNDD 1U2GC 3LIPA 4AP9A 4AJ9A 3LG2A 2ZAOA 3QEMA 1XLUA 4QC2A 2CL5A 3UMSA 1SPXA 3AINA 3WL7A 2A9PA 4Z7OB 5A02A 2XCTB 4BXOA 1FW8A 2D5AA 3GN1A 3WSWA 2HT1A 5IDWA 3AR8A 4AZTA 3BSYA 4ZVVA 5T64A 1I7NA 2VBCA 3E9NA 4GT1A 4F6RB 2WJPA 3TXAA 3EDCA 4RPKA 3SX2A 2GHQA 4W4TA 2Z4SA 1M1YE 1S8AA 3A4NA 4AIIA 3G13A 3BOSA 4RD0A 3G88A 4F96A 2IS2A 3AU8A 4KKVA 1G5IA 3RYHB 3PPXA 4EMSA 3UBTA 4O4HF 1A9TA 1L4FA 1RM3A 3VVBA 1AGRA 2OCIA 3ANXA 4C0KA 4QULA 2CXRA 2JCSA 4KWTA 1KO8A 3IXMA 2R1VB 1GDHA 2FU5C 1NFFA 2YVUA 3ZNNA 3LV8A 4RK1A 3RC3A 1QG6A 4EHJA 1Q92A 3FOCA 3K2BA 4I1RA 3DLTA 4DLPA 3LQYA 4TS9A 1VL6A 1XXHA 2QW8A 3LNCA 4BVGA 4QQKA 2RG1A 4PV7A 2O2EA 3BL8A 3TB4A 1DMSA 3M6UA 3SWWA 2PUDA 2EOAA 2BGKA 1AS3A 2C9BA 4BZPA 4FFVA 1XJQA 4YI5A 4YDSA 2W6JA 4B74A 1LSOA 3PVSA 5E1OA 2JCXA 1PR4A 2FR0A 3AEKB 5JQWA 1XQ1A 3ERCA 1SU7A 2C57A 2C7QA 2B94A 3KE8A 4XCQA 1KDYA 2BYTA 1U7HA 2WD7A 2X3UA 2UYGA 3C7TA 4DT1B 4D9EA 1P9NA 1J00A 1OBHA 1ZGHA 1TQHA 2PR2A 2VI5A 5DO9A 3F1KA 3QHAA 2J4DA 1F5NA 2Q99A 3DZFA 3QUQA 1N9ZA 4IXNA 5LP1A 2HX1A 4CEIA 1WPXA 4J16A 1VL1A 4KUEA 4K03A 5KYVA 3R9KA 3GR6A 4JUFA 3W9YA 3WYDA 2IGTA 1OLOA 2ETXA 3ZHTA 1AMUA 1FBNA 1NBWB 4BQIA 1TA4A 5FWXB 2PX8A 4XIGS 3HA5A 4M37A 4C7XA 3ZKWA 2O2GA 5CLIA 1LBHA 1GYRA 5DM4A 1FMJA 2P2YA 3GFBA 5JANA 3RLFA 3CEPB 3T12A 3W5UA 1QPBA 1JXMA 4JK3A 4Q00A 1C1DA 1R66A 1N5RA 2G1PA 1V16B 3ZWBA 3G82C 4XLLA 2XEDA 4CU5A 3SD7A 1W88A 3MUEA 3U56A 4GKJB 2HYIC 1JU3A 1A76A 2CXOA 2X42A 3SJUA 4L3VA 1BGXT 3ETLA 4WIAA 2HQSA 3GWZA 3RSZA 3ZDFA 3I6BA 3BK2A 1WVMA 2VP3A 3N70A 3T1TA 2JBHA 3KELA 4OQDA 1GPLA 1UUFA 4RGQA 5FO0A 5JH7F 5HE8A 3NTOA 1GUBA 4U9HS 2NPFA 3ZNQA 1E2JA 1X7XB 2YXLA 1EWKA 3VH2A 3WRYA 4WKCA 1LPNA 1CJBA 5HJEA 1FX1A 1KYVA 3N76A 4X1KB 3LOUA 4AF6A 4Q24A 5FXMA 4ZIRB 3ACBA 2GBLA 4RK7A 3ZGOA 4DCMA 5JATA 2JLSA 3DUFB 5ALSA 3RHZA 2QP4A 4D8VA 2WHXA 3OFSA 1SM4A 3FOWA 4B85A 3D3QA 3MJRA 1XZFA 1E6UA 3IMKA 3P94A 1O1YA 1IY2A 4WXYB 1NOKA 3PR1A 521PA 2DE0X 4K6OA 4D9HA 3BHJA 4KYIB 2GPBA 4B17A 5AIBA 5EJ4A 1JFTA 2D1FA 1NUPA 2DPMA 3CZCA 4Y2VA 4YRFA 2NXWA 4WW0A 4RIFA 5G2OA 2W9XA 2W2QA 1IM2A 2O06A 4IIGA 4N49A 3AVWA 1MORA 2PWBA 2OMEA 3PD0A 1TA9A 4B3BA 2GCEA 2NSHA 4NJMB 1WULS 3DL7A 3WMWA 4I55F 1NW4A 1KJYA 1W85B 1KNQA 2FSIA 5I3CA 5NULA 3BG5A 1J06A 3PQFA 4JC8A 1JNXX 1XJ5A 4M38A 4MMXB 1YO6A 3P9SA 4TL8A 3AKYA 3QMMA 4MGHA 6PFKA 3CZAA 3P19A 5BW5A 5KQRA 3PEWA 3AHFA 1LB1B 2CL7X 4OJNA 1TUBB 3PPVA 4LRQA 4MV3A 2BGWA 3DFMA 1Q3TA 4R9VA 1QHGA 1KI7A 2E4ZA 2ONYA 3JQQA 1JSCA 2TSYB 3IHKA 3QFRA 4HS9A 4HWKA 4OGGA 4EGCB 1BN6A 3UJNA 3HN2A 2HF8A 4ZALA 3U9TA 1EFAA 4TXLA 3ZGYA 3ENNA 3RU9A 2QT9A 5BUZA 2NX2A 5I7FA 1U3WA 3WBKA 4RULA 3WP0A 4BE4A 4DRZA 1ZONA 3A05A 3K94A 7ADHA 3MOSA 1TZCA 2EF1A 4HMOA 1M0EA 4YRTA 5JJCA 3CN7A 1F7VA 2YC4C 1A95A 3EK2A 5EWLA 4IRMA 3RTCA 3IVXA 2CV2A 2L2QA 3B3AA 1UMCA 1EE2A 3K0HA 4FP9A 4RJKA 3ZHSA 1KKLA 1OFHA 1V8ZA 4LJ9A 1RXEA 3BJZA 5TS2A 3VYTB 2DZDA 4B3JA 4F71A 1H6CA 2XOKD 3JVEA 3IELA 4DQDA 2DUWA 2HJRA 2QMHA 3BORA 1EU1A 4M55A 3WHIA 4P0TA 1H66A 4OXYA 4PYIA 5ITWA 2ZI3A 1DEOA 1R8QA 5AW6A 2G3YA 3QY9A 2O5EA 1PG0A 1KI1A 1W0JA 5SYAA 3QFSA 2XE4A 5CT9A 2GZDA 3SDSA 3VZQA 1I6MA 2EP5A 3DBLA 4INJA 5G3ZA 1Z5VA 2VAPA 4U7WA 2OYCA 3G6KA 1V2HE 3OF3A 1RHRA 3OTQA 4N5DA 3VR3A 1VKJA 2I5PO 2IEIA 1BYUA 2MSWA 3GGSA 1C3LA 1CRWG 2SKEA 1RYFA 1A9OA 1II0A 2DFLA 4RZSA 5A5VA 3DHEA 1T10A 1JYFA 3AVOA 3B20A 4IMJB 3GRKA 1QRTA 2RH8A 4WEOA 3EOBI 4X95A 3PXXA 4JFRA 2JNWA 3OQJA 1UBCA 4FWIB 4D8XA 5KNBD 2AFIA 1JQ5A 3M33A 4KGVA 4W5NA 4PS0A 3F3MA 4RL4A 3S2EA 4CETA 5HHTA 3C1UA 3D8NA 2HC9A 3WGYA 4F5DA 1NZJA 2AFHA 2RDMA 3H9QA 4HDRB 4QPDA 3T3MB 3QPCA 3HKDA 1XA0A 3OLQA 1XHFA 4YUXA 5AW0A 1GKYA 1X7ZB 2ZJ0A 4MW9A 5FWDA 2RKWA 3OHMA 3PIIA 1ND6A 4WOJA 3HJGA 4BO1A 4J9UE 4KNYA 1MC8A 2CBGA 3F49S 1JHUA 4YRCA 5G02A 2PRIA 4BO0A 1XVLA 2AR9A 3BVPA 3NT4A 3C0KA 2VF4X 2IEBA 1RM0A 4OB8A 5ALNA 4NECA 3F4LA 4ZKEA 3VYUB 1QR2A 4OQXA 1P1RA 3BFPA 3FTCA 4IVPA 4KXYA 3IPAA 3TK1A 3M8KA 3WX0A 5KTKA 4QRIA 5SZHB 1G4HA 4WI1A 3MTQA 1B8PA 1RPJA 5CCEA 5KCMA 1Z6ZA 2EFHB 4UHHA 1QQAA 2UUOA 1O95D 4X1IB 4HL6A 2C2XA 3M81A 3LWZA 4WK4B 3EDMA 5DIZA 4WT7A 4BYGA 2ZJBA 3WLQA 2GEKA 1LLFA 4DQXA 4LDZA 4JLJA 2H9AA 2I67A 4DY4A 4F11A 4DAOA 1U1IA 4N9WA 4Z2YA 5FBRB 2Y1WA 1YZLA 3DLAA 3T9BA 3WRWA 2QJTA 1K8ZB 4G4JA 4C1BA 5LWHA 4MUEA 5B1IA 2M32A 4BJ3A 3BB1A 3AUAA 3UHOA 4EELA 5ALVA 4XWKA 4EA8A 3EDQA 1Y42X 4NIMA 4GOMD 1LZLA 2CD9A 3FWYA 1AV6A 2WNIA 3NI2A 1TTHA 3Q9SA 3PFKA 4FSDA 3HVHA 4KQKA 3DKPA 4LQ4A 1JR3D 4N5NA 2UUBB 1T6ZA 1PW5A 1AK1A 2H31A 2B7LA 3P45A 3QLUC 1DIHA 1NC3A 2VRCD 5K8VA 1ZCFA 3GLQA 3QTBA 4ZVMA 2ZCVA 3OIYA 3VDRA 3C6BA 3V9PA 3IQHX 4HEHA 3IP9A 4CWAA 3W3AA 1U99A 2H2FA 4IF4A 3A1NA 3DMTC 2BI7A 4PLYA 2A9QA 1XMPA 3HCWA 1NRWA 1Z18A 3LBAA 4FR2A 3IPXA 4GR5A 4P3NA 3LHKA 3ZY2A 3ZDYB 1I7LA 4J4HA 1OPRA 3JPYA 3L4KA 2W5UA 2RARA 2RHCA 3REOA 4IMIB 3W1VA 3SF0A 2E48A 2OVFA 2ZE8A 4QDJA 4I5IA 5D5PA 5FKJA 4A9AA 1XQYA 1XRRA 4RSRA 5JO9A 1BEZA 2J7KA 2ZUTA 4CM8A 1C80A 4I6EA 2JJYA 1SD1A 3OQIB 1B00A 1JF8A 4HQLA 2N3ZA 3CUWA 3F0TA 4KE6A 4BASA 4BPRA 1SXJA 3GF4A 3OIGA 3ETNA 3VU3A 4BE9A 1K89A 4TGLA 5CVDA 2PHZA 1ZNYA 4V3BA 1KPGA 2QAGC 2YHUA 3PTLA 3USZA 1O96A 2WJGA 4ICIA 3VHXA 1FSGA 3X1ZA 4DM3A 4MCIA 1JKMA 1HSOA 3W05A 4G5XA 5ES3A 1OX5A 1VPLA 3AP2A 5TSDA 4UPVA 1SKAA 2V0CA 5IU6A 3IXQA 5LWQA 4RWZA 4C7BA 1EM6A 4X61A 2Q0QA 1K3UB 1NXWA 4E22A 2B5VA 4IJ5A 3H17A 4QVIA 2VTBB 2JI8A 3EXAA 3E9YA 4X1OA 3TW0A 5LQCA 4MQBA 3TTTA 3H99A 1XZHA 2B20A 4NS4A 2DCMA 5EP4A 3IT3A 1R5NA 2PUTA 3HACA 4RXUA 4LF9B 5FUMA 2ZR8A 4GGPA 5CCXA 5GMOA 3EF1A 2WQ7A 2ERXA 3UMGA 2EBWA 4AP5A 4JKYA 1EA5A 2IZ6A 4CCSA 3W4IA 4I8XA 3KR9A 4HG2A 1J2EA 5D86A 5KTRA 3AILA 1HZZA 3AZQA 3U4QB 4RU1A 3H1PA 3ONEA 1TM4E 1L7EA 2XB8A 1N75A 4X1YB 1F4PA 1B8NA 1VJRA 2ZJ7A 4UVDA 3RVMA 2PX2A 3UCFA 1XZAA 1NPDA 3UOAB 5F3RA 2P6NA 2ZKLA 4ENTA 4HV4A 1YNSA 1A7JA 1UM8A 2PSEA 3H9GA 4U2DA 5H3CA 5FEUA 5CFZA 1R18A 2J31A 1EAMA 1KP9A 3QU4A 5I4KA 2MCFA 2MYTA 4OXKA 1ACJA 1DSSG 1HFKA 4FXOA 1ZNWA 3ZY6A 4B3MB 3MB8A 4FDAA 3ER8A 2XODA 3QKIA 4M6WA 4NR0A 4UE3S 2NLOA 2C4VA 5JRZA 1Q0PA 2GCOB 2ICAA 3K35A 3O1LA 3I5XA 3ANMA 5FTJA 5KX5F 3BE8A 1FMFA 3ZI0A 4IDNA 1Q50A 2FHSA 5ALOA 4A36A 1JHXA 4YJ2F 3COSA 2PPLA 3P2JA 2QA5A 5FFFA 4JC0A 3FF4A 4HWGA 4L27A 2YYYA 2WKRA 1D8AA 1UJCA 3AUSA 1NYLA 2R62A 2H1VA 4HGPA 4BP1A 4RNDB 5IPFA 4HSGA 2OGWA 1EVIA 3A1FA 5DNEA 5DISB 2EZTA 2FSFA 1K4KA 2HTFA 5L3RA 3NEAA 4Z0NA 2PUCA 1TFUA 3BGVA 1W30A 1OXMA 3Q3HA 4D74A 3ZWQA 3ZIAA 1E8NA 2BFEB 3EIOA 4MJ7A 1KEZA 3VSDA 1J22A 3B53X 3EIXA 5YASA 5KAMA 1GZVA 3AF5A 4K1LA 4TUYB 4MHSA 4WUTA 2PJDA 4CV2A 1BDHA 1XN1A 4ZAXA 1CK4A 1XG5A 1XC7A 2YMQA 4RPJA 5AM5A 1AKRA 2ZYDA 1NF9A 3EARA 3ONVA 1WVIA 2IYAA 4TZ0A 2CHVA 3OZEA 3ZCRA 3HJFA 3PGVA 1GWNA 1BW9B 1J0CA 2AMVA 4PQYA 3ILXA 4UBJA 3EG9B 4NEGA 3KZXA 4BQOA 1BRMA 1VA4A 3A9SA 3E61A 1KI6B 3JU3A 4LE1A 1MV5A 4EEXA 1AU9A 3SBOA 3DEJA 1R8XA 5JJBA 1RI2A 5E2BA 1E7SA 2Q7OE 3V4ZA 1CNMA 3UMCA 1XHLA 4EUEA 3B78A 5LQNA 1M1NA 1P0QA 1ZUHA 2DY0A 2ZYGA 4ZKDA 3BFJA 2V6BA 1WXXA 3M6IA 3FX2A 1SKBA 4YDHB 3W5SA 4NXNB 2G0TA 1RNLA 5I7UA 2RHBA 4UPEA 4AECA 2YIJA 3H75A 1G59A 2UU9B 4F45A 2XUJA 3W6NA 3IR6A 5IAGA 4C9BA 1QHYA 3F7NA 3DJYA 4RHEA 5M04A 1RKVA 5A4DA 1JVBA 2OFWA 1RRGA 5BW4A 1OTHA 1XU9A 3GLTA 4IDAA 3HU5A 4NLLA 1VHTA 9ABPA 5L40A 3E7WA 4TLCA 3U44B 3RJ5A 2H4WA 1WIWA 2SCUA 4CDMA 2H8GA 1JR2A 2GAOA 3D31A 3E48A 2IHNA 2I0FA 2LDXA 1PT9A 1TM3E 2VUHB 2OV6A 5CB4F 1O9BA 3IDQA 5F4BA 5GQSA 2ZAMA 2GRUA 3B1YA 3TAHA 4Z1MA 4AO7A 4GL2A 3ON5A 5EE9A 4UXHA 2GYYA 3GJZA 1QAOA 3O47A 4Y2YA 3HPQA 3QFCA 2N47A 3KOUA 5HIMA 4W1PA 3QF4B 1ZI9A 3MTEA 5KEIA 4G63A 1IUNA 2ZBQA 3VNRA 1LGYA 2QSYA 4IJQA 4RGBA 4D57A 1MRNA 1RWBA 1YGYA 3O8QB 3TLBA 1DCTA 1EFTA 3O2QB 2OBXA 3GAMA 5JSKA 4DA8A 2ASEA 1E32A 4H3SA 4F6RA 4IMPA 4QDUA 3T7SA 3CR3C 4AROA 1ZRMA 1DZ3A 1JWLA 2PRJA 4R40A 2ZK7A 2PLWA 1ZX1A 2OEPA 3SZMA 2PUHA 1KETA 3RYHA 4BV8A 4YMLA 1QDLB 1Z0JA 2E82A 3OPVA 2CZCA 4FYVA 2Z6UA 1KXZA 1CUZA 2CW5A 2R1VA 3HKEB 4PZAA 4QXAA 2Q21A 2Q7DA 4UNNA 1L7RA 3EVNA 4B6QA 4DLWA 2PKYX 2GWRA 4CTMA 4EB0A 5CNKA 1L5YA 2QGFA 4QJ3A 2XLBA 1E5DA 1V4VA 1CR6A 4Q3OA 3DBOB 4D0SA 4ZTZB 4WLVA 3QMVA 4MWTA 2BMWA 3H8SA 1HY3A 1WUJS 3DA8A 1BE6A 1DO2A 3L2OB 1P0FA 3IAS6 3KUXA 4IJKA 4PSCA 1QQBA 3C5VA 1TAUA 4JUDX 2JFYA 2PSSA 2JGNA 1T1SA 1NLUA 3K2IA 3G59A 3LC0A 5E1MA 3IIJA 2JDIA 1MV8A 1OIXA 1UQTA 4U0KA 2C4TA 3AEKA 3B52X 3CRW1 3DEZA 3CX6A 1KYIA 1FXWF 4XXHA 3GP8A 3O8OB 1TCBA 3AFGA 1MC4A 1KJIA 3AGPA 1D6JA 2P8JA 4OQZA 4DT1A 1XMIA 3A8TA 4AN1A 2H2DA 3UHFA 1DB3A 2RH4A 1CR0A 5DGCA 5F5LA 2ZTLA 1UC5B 2OFOA 1TA0A 1M7BA 1QKKA 2Z5LA 3IBSA 1P4AA 4KXQA 1BKDR 3OM1A 4JT2A 1HT0A 1R0KA 1WLSA 2BUBA 3VJMA 2BT4A 4KWIA 2GSWA 2HAEA 3Q1KA 1QV9A 4LYYA 4P3OA 1E59A 5FWXA 4G0WA 1MT3A 5AFSA 5DBOA 4WOPA 2ETVA 4TLLB 1Y5MA 2E4VA 1ZI8A 4QL3A 3UBMA 4UU0A 4KOAA 2A3NA 3D6HA 5ABPA 4D44A 5KNCD 4ZO6A 1THMA 3IPCA 4M22A 3PRHA 4MA5A 5CYPA 2D13A 4W5TA 4Z53A 4KBFA 4KN9S 1WXFA 4Y0VA 4BCBA 2H11A 2YVKA 4DBLC 5AW2A 5IKPA 1V16A 1N33B 4PTZA 4AU1A 1FFXB 3DE3X 4RVDA 4JZYA 3TDNA 1WR8A 4E14A 1F2UB 1YRAA 3JQEA 2PKQP 1FW6A 3LC7O 1SC1A 2K87A 1BE0A 3OCXA 4HB0A 2FQ1A 3P9CA 3CVJA 4MJ3A 5T8KC 6CHYA 2DQ4A 2F8TA 4P54A 4YALA 2BGRA 2XVYA 3H2KA 5CCBA 4D4HA 5JHGB 1P5ZB 2UVPB 1Y63A 2QQ0A 2OLEA 3GBSA 3LVBA 1X7XA 2EDCA 2WM9B 4NBNA 4NK4A 2BKVA 5CTAA 4BBPA 2B36A 2X0FA 5K6AC 4AS1A 1KAOA 4X1KA 2A5FA 2ZRBA 3EPPA 5LMCA 4P31A 4BOYA 5IVPA 2Z30A 4L8LA 2NZWA 3DUFA 1YB1A 1JFLA 4ML3A 4NZMA 4RO0A 4Z8XA 4D8YA 4HUTA 1JAXA 2GILA 2QYTA 2X8WA 3BMOB 3PF8A 2D4AA 1NUAA 3H3FA 4FCVA 1YFZA 4EG1A 1JEYB 4RLFA 5C8VA 5BMVB 4BTVA 4QNNA 3AY7A 3I3SR 3LHFA 4W5WA 4WXPA 4HLUA 1KFEB 1QIJA 3UW3A 3ZZ0A 4UTZA 3WWZA 4ALKA 4ZT5A 4LVOA 1Z0UA 1KS2A 2QJOA 4B81A 3N28A 3AOEA 4IFEA 1XR3A 4NJMA 4QTXA 4YYEA 1GZ6A 2HFJA 3B5IA 1EVJA 1V8BA 4MAMA 4RJLA 4AP6A 3KJFA 1W85A 4G5SA 4YVFA 3GJ4A 4J0CA 4DDKA 3I6YA 3G2JA 3FOAA 4XZ3A 1CVIA 1DIAA 4TV9F 2O59A 3U7GA 1HFJA 1L7AA 3BT7A 1NI5A 2XKJE 1N25A 2CNKA 2RHGB 3R77A 1PBTA 1TUBA 3IBFA 5JS6A 3PRYA 2WT4A 2FPIB 1VM6A 3ONWA 1AQYA 3MHTA 3EFBA 2IP4A 2DCUA 2UZ1B 2YIVX 3ORYA 4TTRA 4AQDA 2GCGA 5JZOA 4Q03A 3EZNA 5KBYA 3T4EA 2GK4A 3JD2A 3ZWNA 2QX9A 4KO2S 1ZN9A 5FCDA 2F3SA 4UDXX 4QWMA 4AWXA 2XH8A 4HRYA 2VO1A 4CLEA 4F0JA 2C8JA 2EZUA 2WU8A 1QHSA 2GPSA 1BGVA 4NXMB 2QYOA 4YV1A 1MN6A 1XTVA 3UCXA 4BGVA 4BNVA 1Z0KA 4ID3A 1SKYE 5JZSA 3LDFA 5FI5A 3LZ6A 1E89A 2L42A 4LRTB 5D1HA 3UGTA 4UM9B 4IZHA 4XCVA 4NMWA 2C8VA 5B1SA 3PYMA 2O14A 3VR3D 2H9YA 4K0KB 5B1HA 2ZM6B 2FF5A 2O9JA 3E22B 1W44A 3GMDA 3FKJA 3NNNA 4I4TF 1LRLA 1H69A 1IG0A 3VZRA 4AF8A 1E5TA 2EHJA 4L9SA 4IG4A 1AA9A 3E23A 4J4TA 2FUNB 2YMPA 4WKPA 3T4UA 4ALIA 4A8JB 4HDOB 1XQWA 2FG6C 4K81B 1SC3A 4HXFB 1GRQA 4OJQA 4PHCA 5FOSA 1BHSA 1GTVA 3LJKA 1U0JA 3QSGA 2ZT5A 1Q7RA 1X1CA 3MS2A 2X1HA 3F2VA 4NYMQ 1L5KA 3VPDA 3J7TA 4KRYA 1XD2B 1Z7WA 1T8YA 2GYUA 1WV1A 4FMCB 2HA4A 3RI3A 2ZXFA 1FQJA 2B98A 4ZYVA 3ZOZA 4K8RB 2RCNA 2FWMX 1OV4A 4ZVRA 3NC1C 3HK2A 2W6OA 3RRNA 1N6IA 4GRAA 3M0EA 1YCHA 2OK7A 2WG0A 3OO0A 4J75A 4PCVA 5THKA 1PZMA 1SHTX 1N6HA 1X2EA 1WY7A 2XGGA 4HDRA 3G2OA 1KVTA 2RHTA 3ROPA 2Q4RA 1MENA 1QGED 3I4LA 1EA7A 1YA4A 3K2QA 3KZOA 4DLUA 3HEBA 3DF7A 4O1HA 4XM0A 4HWTA 3U48A 4D42A 2Z2XA 4BKQA 3DLBA 1X7ZA 1CZNA 1W34A 4X6YA 1DG1G 5CDFE 4CTKA 1NOJA 2H4YA 3R7LA 3RH0A 3Q8XB 1WMDA 1J2JA 3ES9A 2W93A 5BSRA 3ZWCA 1TAHA 1EVKA 3STXA 2BMFA 4XVRA 3VV3A 2NT3A 5JYEA 4CV0A 1O6FA 5JDIC 1EZ4A 1ZHFA 3T7TA 2YX1A 4R1SA 1DAHA 3ZTWA 5F1KA 3NHUA 2OO7A 4BDTA 2PJUA 2WUEA 4UDOA 4UCXA 4BP9A 2XF8A 1UKCA 1DAPA 4AJ2A 5FAXA 4X1IA 4YRSA 2FEMA 2CXSA 3HJRA 3R0QA 1UBMS 4HZIA 2YIMA 2JAHA 4R8KA 5JWHA 3IP3A 4PCLA 5C4GB 3TX6A 1JG7A 4J2TA 4ZT4A 4Y0AA 3QPUA 3LL7A 1NVGA 3HR8A 4Q1DA 3Q6MA 2QX8A 1ONSA 4OG2A 3HBNA 4RVHA 3O8LA 1E4EB 1CS4C 1GPUA 1LKZA 2IHKA 4QGSA 3AF6A 4NF2A 1ISGA 1UBSB 3BD7A 2DXIA 5F23A 1AUOA 3K1AB 1Y8AA 3IULA 1IHPA 3ESYA 3U40A 2BFWA 3W3AD 1WKBA 3DXYA 5SV2A 4KSYA 4C43A 3K0CC 3D1LA 1ZD4A 4DR1B 2VNJA 2BDEA 1A2OA 5IHXA 1G6Q1 1OI3A 1BHJA 4PLTA 2ZRQA 4OU4A 4S12A 3U3JA 3UMJA 4IF6A 1EDBA 1FSZA 4TVOA 3RU3A 3DMRA 1RWXA 1QFXA 2NYAA 2C5FA 2RHOA 3LA8A 1G2QA 4BJ6A 4CN9A 4WBNF 3MD9A 3QE4A 4FDVA 3TAUA 1KK1A 3K5WA 4MB0A 3CQ9A 5DX1A 4A8PA 5JY1A 1UBEA 4OFZA 2EU8A 1OILA 1DFIA 2FMHA 2IYSA 4GLLA 4MTLA 5GJBA 3HEAA 3BDAA 1EWYA 1QQ5A 4UDNA 2OD7A 2QS9A 2QN3A 2X5NA 2PKEA 2OE2A 4KACA 3L0CA 3B13B 1DWQA 1O6CA 4RTSA 1LPSA 4Q4HB 4G1UC 1CVRA 2QTTA 1THTA 3KKKA 1TUIA 2OT3B 2CLMB 5EZYB 4PE5B 1O0BA 4KREA 4MUXA 3WHLA 3BIJA 3HLYA 4HHEA 3HHEA 4AL4A 4FTWA 5LB4A 4N41A 3IAHA 4ZGWA 4PX5A 3MZ0A 4Q66C 1MT0A 1XD9A 2C4WA 2YVQA 4O2BB 1QWSA 3QITA 3QU2A 2VF8A 4EO7A 1NWHA 2Y4NA 3RUAA 4K8OA 1BTOA 1N6KA 2VTBA 2BFAA 3U7HB 1XT6A 1JJVA 3ZCTA 3DWFA 2X0RA 5EE0A 2M6LA 3BXZA 5FPKA 1SBCA 1JA1A 1C9MA 1SWWA 2H0AA 4HFRA 3AK4A 5H3LA 3VZDA 5DWVA 2P9TA 3QFHA 2VAXA 3RS5A 4B3FX 4MULA 4CXMA 1SZJG 7REQB 1T8PA 1OFIA 2GMWA 5EJ7A 1J5EB 4G26A 2OB1A 3JQBA 5ADVA 3B2EA 4R2KA 1DZIA 1H2HA 3IAFA 2WKSA 1P2GA 2GN2A 7AT1A 4MGEA 3U4QA 2QN9A 5TIIA 1U3GA 2XQVA 4WZZA 4B6FA 2J5QA 3GJ7A 3LFUA 4X1YA 1NRIA 1Z4KA 2R1ZA 3IKLA 1NUUA 1FYVA 5FA6A 1KMNA 1LBTA 2C2HA 4YHHB 3CM0A 3KTOA 3TSAA 4DMCA 3ME5A 1N5JA 1T8WA 4M60A 3GRCA 5DBIA 1EFPB 1OWOA 3U4HA 3UMYA 3O82A 4AAYA 1C7ZA 1V8OA 4H18A 1G2PA 3ICEA 4K7JA 2ZCUA 1OZHA 1Z88A 4PANA 4KMOA 1IY9A 4OHVA 1KZ9A 4HLCA 3L8DA 2GCOA 5AI8A 2P65A 2O0HA 1A9PA 3OVMA 3QFTA 5DTMA 1P17A 2IDJA 5K51A 3V8MA 4DRXB 1QRSA 3MT7A 2J3HA 4HGRA 1Y4ZA 1U8AA 4GXNA 4H7KA 4HGNA 3RUDA 4LYEA 3IBTA 4QTYA 4BN0A 1GARA 3R3JA 4JLKA 1U6KA 2YWEA 1EHYA 3ZIAD 2QRMA 2FW8A 3O7MA 2DUMA 4KB5A 1MMFB 4OYHA 2R86A 3H1EA 4PZ0A 1R6VA 1IU9A 2ODNA 5FIUA 1R0RE 1Y4UA 3OMXA 1YH3A 5FUVA 2E4YA 2PDAA 2VTDA 3HCOA 5JXHA 3UB4A 3A31A 4EFKA 2P5YA 1Y1SA 5C4IA 3LI2A 3J7AC 4JP3A 1XZPA 1BH6A 2A7XA 5CFOA 4DIDA 3ILHA 3OTGA 1E3EA 4GPD1 3TOCA 3PT5A 4IX9A 2BFEA 2PV7A 4IV0A 2WQ6A 5CLQA 2CBZA 3LAWA 1AKUA 4JR1A 4XVQA 2JVIA 1PL8A 3RGWS 1EH5A 3IAS1 2ZIXB 1O87A 1FYEA 1SURA 2AW5A 4TUYA 2V6GA 3C5CA 1F8FA 3CTMA 3NQ41 2GAAA 3KB6A 4YUZA 5JZ9A 1KH1A 1QB8A 2DUNA 4DLZA 2QPLA 2DLNA 3AKZA 4PSUA 4R7TA 2HMUA 1J24A 4CN8A 1T1EA 2XYRA 1BW9A 2XZTA 2WTNA 1G5TA 2AJCA 3EG9A 3EJWA 2VHTA 3OC6A 4GH5A 5F7ZA 1KI6A 1YWGO 4D4JA 2GM9A 2GPJA 2VYFA 5CVUA 4ZV4A 4DLLA 1ORVA 4K40A 4L5IA 4P83A 1JW9B 3E2IA 1G9TA 1I10A 5FPHA 2RAUA 4BNLA 2ASVA 1NMQA 2PMCA 4L16A 4MB6A 4Y6RA 5JAQA 4H1WA 3NBQA 2DR0A 1PD0A 4P7KA 1UXOA 2D74A 2ZT7A 1QGZA 3QBDA 1KMHB 2OPHA 1G55A 4DLRA 5A6VA 1ODIA 1H6AA 4ENVA 3QWIA 2ZRNA 2XA2A 2BEWB 4FR0A 4G5QA 4WA7A 4BPBA 1VE5A 2AWNA 5AD1A 1SZPA 3OPNA 3NVAA 3RSSA 2C8KA 3B12A 3KOMA 4UHJA 2FJ0A 3QVKA 3V7YA 2CK3A 3TI9A 1IXRC 3X44A 1G2OA 5AVTA 1XZCA 3Q2OA 2G04A 1NF2A 1G20B 4Z8YA 3U44A 4EY3A 4PAOA 2WWVD 4XGQA 3TSWA 4L8YA 4Q7KA 5ICEA 4BNGA 3AJEA 1QRAA 2C78A 1QOZA 1CT9A 3VOAA 2N9UA 4IIBA 2R7MA 3KJIA 3FYUB 4KLRA 3DT6A 1M74A 4MYUA 5TR9A 4C30A 3TTSA 3ITNA 5AKEA 5THQA 3RODA 4PM4A 3ZS9A 1U2DC 2CMDA 2M98A 5C34B 1ZHOA 3VUFA 2B69A 1I6KA 3EBPA 3QF4A 1ANKA 2X8AA 1U3CA 4V03A 5IKXA 2F48A 4RH3A 5FD8A 4J3NA 3VKGA 2ZE5A 5EIOA 3ZR4B 4C6RA 4XFKA 2AXEA 2FW9A 3H5NA 4RIEA 2FVYA 1S2IA 2AZDA 2PL3A 3BWBA 4J1QA 4EHKA 3THXB 1IZ8A 1H1DA 3O8QA 3ONDA 5TRTA 1T5TA 2YASA 5CVEA 1SIUA 3H3JA 2PZFA 4ZOLF 3V2IA 1YJBA 1PR0A 3ASYA 1BJTA 5F78A 1XP5A 1UMBB 3ENQA 3GEMA 1Y3AA 3KLBA 4QDTA 5JECA 1TGVA 2YJ3A 2AOXA 1NVMB 2CXXA 4L5BA 4L9WA 4BMVA 5EMJA 2A0WA 3UUFA 1R64A 3JQ8B 1P2SA 2PT5A 3NV9A 1M2VB 1GPDG 4NBTA 4M9QA 3HKEA 1M8KA 5HG0A 8GPBA 1R6TA 2YUIA 1T8SA 3SIRA 3HABA 2QGNA 3SDZA 4EGJA 1MGOA 3EC7A 3G9QA 4R71A 5JPCA 3P0HA 1UXIA 1E2QA 1V96A 2XMCA 3I83A 4N7MA 4R1NA 4R41A 1O95C 4RJIA 4UBIA 5EPUA 5REQB 1Z2OX 2N0SA 4LHEA 1X86B 1Z25A 3CCCA 3QVXA 2JIPA 3LGSA 1WABA 3FRJA 3PQ3A 2O5RA 3SZUA 4Q6WA 3TRJA 4BRUA 4CUKA 1JP7A 1W4RA 2ZT8A 1NTOA 1P33A 4PZ9A 4X7PA 3O93A 5EJGA 2JZOA 4HZUB 3EE6A 3FMFA 1OOEA 3DOEA 1GFZA 5EAIA 4D9NA 5TMPA 1RMQA 5HCUA 4NATA 4KRXA 3T34A 3O8OA 1B6TA 1GTL1 1EP2B 2VPYA 4H3KB 3IJPA 2OGTA 3E7XA 2BHLA 4QQ8A 1ZLYA 3PWSA 2YJZA 4D0NA 5L95A 4BN4A 2PAAA 2AZTA 2C5HA 4MSUA 1OVGA 5HZMA 2K2QB 5T3UA 1O03A 3D6NB 7MDHA 4B3SB 1UFOA 5K45A 1GT6A 2R44A 2XUZA 3GT3A 4J76A 3UO8B 2NYVA 3CR8A 3D8HA 2HHJA 1QHNA 3BN3A 4X8OA 2C88A 4FFWA 1DAGA 1DT5A 4QHSA 3X1WA 3ZJVA 2Q1SA 2OCDA 2P2NA 3BRWA 3F6YA 1DEAA 1G3QA 1XDBA 3JAMA 2R8OA 1CZOA 2B25A 3GRZA 3L8EA 4F92B 2BBWA 5LKAA 1AH2A 1J0AA 3SYLA 1QE3A 1FFXA 2QG4A 1RJDA 4IWNA 1J20A 4K1XA 4JOSA 3A3YA 1QP4A 3W7BA 3ABOB 1F2UA 2GKGA 2R7LA 5FI1B 1BWPA 5LZ8A 1H8HD 5E38A 2V45A 4P2BA 4TM7A 5CA1B 4GOND 2QYSA 2ZRDA 2XDYA 4HX2A 5KB3A 2AYYA 1PT8A 5AUNB 1IEQA 1HC7A 4C3OB 1PVOA 5GZ1A 3QMPA 3PVCA 1KC3A 4FGSA 2ZRJA 2DHDA 2QUJA 2UVPA 2VA9A 3I9FA 1PG5A 3E2PA 2P2LA 1LPAB 3PUZA 4BJ5A 2BF4A 5EQDA 821PA 1NNSA 1HMPA 5A9TA 3TQHA 2DUUA 2FMXA 1ZO8A 2ZI9A 1NBIA 1SVKA 4EY6A 4XDZA 3B70A 3MQ2A 4KLAA 1U65A 2GD2A 4RF4A 5E4JA 3OKPA 4A4DA 2YZGA 1AC5A 2POQX 1GN9A 3L7LA 3BMOA 2LD4A 2OAEA 4R51A 2B4QA 5B57C 4FOLA 5DCYA 2WICA 4V0SA 2KLHA 1YZFA 2WIDA 4X60A 2QZ4A 2MYUA 5BMVA 5JNLA 2FFJA 3UZUA 3HO6A 3EIQA 3SBEA 4ZYZA 1YI0A 1I3MA 4M8IA 3K3PA 1I1QB 4KAAA 4WDRA 4TSRA 4C03A 1FRQA 1JAHA 4LXIA 1PFGA 3EASA 5TS3A 5CJJA 3E9MA 3UYKA 3CTPA 2WABA 4FNMA 3SS8A 4YRRA 4EYKA 4Z4CA 3LQ4A 1NY6A 4IDFA 2FK8A 2A88A 4X7MA 4RTMA 3MLEA 4R1TA 4I1YA 2H4FA 1V26A 3JTMA 4IVRA 1U0SY 2I22A 2XMDA 3AL0C 3PIRA 1CD5A 5DX8A 1QIGA 2KPOA 1QIDA 3ESBA 2C9MA 2E37A 1Z6TA 3EXFB 2ZDQA 3I9V6 1U7DA 2GM3A 4BMYA 3IIKA 2UZ1A 3KB1A 3GVXA 3SYMA 1B2RA 4QM7A 3I1FA 4A82A 2PZBA 3ZCVA 2OCPA 1UANA 4JLAA 4RHUA 1YZGA 3JVIA 4ASUA 2CUTA 3KJEA 1RABA 2EJUA 4N8DA 2Q5HA 2PNJA 3RAPR 4YN3A 4B73A 2W2VA 1YC2A 2FMKA 4JOBA 4MAFA 3G2NA 2ZBDA 4IHJB 4J7CA 1DKLA 5IM4F 4QVKA 3JW8A 1MBZA 3RC8A 2I62A 2DPXA 2YWBA 2BCGY 4IH1A 4CKWB 5B12A 3DE2X 3VVCA 1CUAA 2WYUA 5FO1A 4LRUA 1Y7HA 1ZK3A 4JJEA 4LMPA 4QTZA 3JYOA 4CDGA 4EY7A 1JV2B 3LKVA 1E9VA 3E22A 3AEYA 3EWSA 3Q41A 4JITA 3WYGA 5HUJA 5MFPA 2LW7A 2I55A 4XLTA 1M73E 4XX0B 2NO0A 4W1RA 2ZYSA 3A4TA 2ZPAA 2IY9A 3PUIA 2C95A 4A8JA 3FCYA 3BICA 2HV8A 1XVVA 4ZVSA 3R8XA 3F67A 4Y2PA 3C15C 1RRFA 2R5FA 4MIYA 2OYSA 1KFCB 3PJFA 4B6GA 2WSSD 4K2AA 3OI7A 4KI7A 3VGPA 3LT4A 1JXAA 4L15A 4LZJA 1A4RA 3MRXA 4ZI2A 4ARVA 1XD2A 4KBGA 1SY7A 3JS5A 5G1PA 4KI0A 3STYA 4E11A 3E9QA 4TRJA 2WAOA 3B3FA 3CF2A 3AVTA 4QE3A 1NM5C 2C59A 4HJXA 3K6SB 4MW7A 1E4VA 1NIJA 3PA6A 5LR6A 2W6MA 4DTIA 3W4JA 4N65A 3ZVMA 2VDWB 4PXSA 3LSTA 1NN3A 2XWPA 4LSGA 1SB9A 3DUWA 5AM0A 4BMZA 4YAKA 4HDNB 4QYSA 1SOUA 2W6PA 2AC2A 3KPVA 1KI4A 3CNOA 3NKVA 1FU8A 4DJAA 3R7DA 1JT2A 3EA5A 3HUFA 5E7IA 1Y4AE 1P5HA 2P1ZA 3I0NA 3JRXA 1V3TA 3F8TA 5LBTA 4KBYA 4NYIQ 3TRHA 4MI9A 4EGQA 5DXAA 4Q15A 1FSPA 3RVDA 2E1RA 5DCUA 4ETIA 2YWGA 3B8HA 2PD4A 4FHEA 4LX8A 4REOA 4ON9A 3E1SA 4IV8A 2PBRA 3V4PB 4N47A 3GOQA 4I2VA 1FLAA 3HNOA 4GI7A 4HY3A 4KQGA 4K6KA 4NNPA 1CG6A 2W2LD 3OU7A 4Y2TA 3ROQA 5A5FA 5LMUB 3N5CA 3I1IA 3IURA 2JGJA 3LC2O 3SHQA 4FOTA 4L8WB 2CLSA 3MFYA 5KYTA 4HH4A 2R7AA 3TMAA 1E4EA 3DTYA 4IKPA 2YQ5A 2DFVA 4TTSA 1GFSA 5FAKA 4G0XA 4UVGA 1GGNA 1XNJA 4UHFA 4C04A 1JPUA 1VGRA 2ODTX 4O4LF 3LGXA 1Q15A 3ODGA 1AQJA 4UEWA 3CW8X 3K1AA 2Q9UA 3KP1A 2Q1TA 4AY6A 1ACMA 1GA6A 1K66A 1PX0A 4J49A 4YRBA 2EWMA 4HFMA 4JJGA 4Q3EA 5CCDA 4EPWA 5FT9A 1UOPA 1YMUA 1T2CA 4PBRA 4EKNB 1W94A 1Q7EA 4FD2A 1VDMA 4V02A 1QZUA 4Q48A 4B83A 3PQDA 2FP4A 2CXUA 3M6VA 4DJEC 1L1FA 3TNDA 4PGMA 4NE2A 2YCBA 1RQPA 4URYR 3Q6IA 5F7JA 3IKTA 5JVDF 2I1WA 3COZA 1GOTA 3OKAA 2YYZA 2AGVA 4I5DA 4XE5A 5DTQA 3MSCA 3JQ7B 3OZVA 2P5UA 5LYJF 2G80A 1XWWA 1HI9A 2PRSA 5D5HA 1Z2NX 5CYOA 1M0TA 3RS7A 4EENA 3TLCA 5IVIA 5E8JA 3MRTA 1NV9A 2EWWA 4L4UA 3UAVA 4Y0NA 4EKYA 4N7RA 4QICA 2ZUBA 1UEXC 4D43A 4AW9A 3H2ZA 7GPBA 4D02A 2DBVO 2IUSA 3CT4A 5CPFA 3O38A 2HQBA 4Q4HA 5ALWA 5E7QA 5T3YA 2HNBA 4BBJA 4FLFA 1NYTA 1VL0A 5K4GA 3TQTA 2R66A 1Q1EA 2NZ2A 3T3GA 4CBVA 5EZYA 5ICSA 1VLHA 4J16C 1J8YF 5IN4A 3P9IA 1CQWA 3H9UA 3BIWA 6GPBA 4KIWA 3ZCPA 1QAMA 2CLDX 4YECA 4F12A 1TADA 2QQFA 4O2BA 2DKFA 1TAQA 5FP0A 3QWFA 4B3GA 3HRHA 3VMMA 3AVYA 1ZVQA 2G72A 2WJYA 3NALA 4N9QA 2WTXA 5DX0A 2V7UA 2ZBVA 2PQ6A 1K97A 1MAHA 3D6TB 2IYFA 4RMGA 4UFOA 4P7FA 2DH6A 4BUZA 1LF0A 3F74A 4EW2A 1Y5NA 3HKCB 1OX4B 5IJ0B 4LFBB 1QYIA 1UEJA 2O8VA 7REQA 1Y9JA 1W4ZA 4ZGBA 3GC6A 4GWLA 3ADKA 1C50A 4C6HA 3KVOA 2Y05A 4KU4A 1YA6A 1P62B 4D45A 1YB2A 4DC0A 2OHGA 1FSFA 1IEXA 1WHTB 3R0JA 2B9VA 3AHHA 2XB9A 4JA2A 2GDZA 2ZI5A 3KPWA 3VO2A 5E2IA 1WB6A 1MVOA 3N0TA 4IEEA 3FW1A 1ZOLA 4L78A 3WRYC 3BGIA 1E9DA 2V58A 2VDUE 5JQGB 3KFLA 2E3JA 3E82A 2WPNA 1EFPA 5FL7D 3TNYA 4FU0A 2GBLC 2HHLA 4ZHQF 3GHHA 1G8HA 5ALEA 1NFQA 1GT91 4PPNA 1LS6A 1U1GA 3ZWVA 3DWGA 1YOVB 2R4UA 5GOZA 1PR3A 1R8JA 5DM60 1CDZA 5H82A 3LQQA 4A3SA 3KTFA 4Z9AA 2C54A 1PWYE 3GNLA 3HLTA 4OREX 2FDRA 2F4NA 4DRXA 3HCEA 5KYNA 3EX7C 2YWHA 1FQKA 2WYHA 3K0AB 1JR6A 1IVYA 1Q57A 1TU4A 2C0QA 2JD1A 5AVRA 3I01M 3TYXA 1RLJA 3F71A 2VUSA 2GLXA 4Q19A 4CL2A 5B3AA 5HOEA 1L8LA 5H5JA 2QOEA 2VP6A 3NHFA 4QUHA 1W4CA 1Y8CA 1U2RA 1OGJA 3KTAB 1A9RA 1NU6A 2BMVA 4NCAA 4MS3B 4LF6B 1RKXA 1IYZA 2ZULA 4FSHA 1IJEA 1OXTA 1EHCA 1KI3A 3RV4A 1AGPA 2QNRA 2GCNA 2NM0A 2GBIA 3DONA 3W9SA 4B8WA 2PYZA 5JASA 2WF5A 3HWWA 4ZT2A 3B7WA 4X6LA 3ASZA 4HAIA 2WV7A 2NUBA 3VVMA 5E6RA 4H7FA 3UUEA 5C32A 2HA0A 1QG0A 1BKSB 5KKAA 3DR3A 1WP4A 3MPOA 2ZRAA 1MOSA 5MN6A 1X8LA 1MC1A 1NP7A 1I4OA 2EQAA 3DEFA 3B1KA 3SZGA 2FPUA 5CR9A 4BMOB 4HWPA 1XN4A 3GGOA 5TMEA 3IAM1 4LV6A 4KRFA 4BFZA 1PYOA 2R87A 1E3WB 5TPZD 5BYBA 4JS0A 4CCWA 2XMZA 2AEMA 4KIJA 3L0OA 2FSVA 4F4JA 1O57A 2C97A 3O94A 1N1DA 1QB7A 1SXHA 2O48X 5B7PA 2Q28A 4PU0A 1KBZA 2J9GA 3I01A 3ZBQA 3RANA 4D92A 1S3FA 2X13A 4EGFA 5CAEB 3AHCA 1IAVA 1KMHA 5K6TA 5TQ0B 4QXMA 2HDNB 4Y18A 1AHPA 3RYCB 2ZRKA 2BEWA 2CUNA 2X6QA 4TTQA 3PHCA 1C7JA 5D7BA 1A88A 3EQ8A 4OTZA 2XCOA 4A5SA 4EPRA 1RPZA 3W4KA 4ZYXA 5HRUA 2GYVA 1Z08A 1SQ5A 1MABA 3GFTA 4IIVA 4WGFA 1G20A 2CLIB 3FDXA 1F38A 3CUVA 4KQ1A 4UNQA 3HMQA 4TKLA 2ZB3A 5EHXA 3BRCA 1H42A 4D46A 1OI7A 1WOYA 4H3HB 1TJ3A 4EO4A 2GHTA 3PXUA 1H4SA 3SQNA 2HRZA 1Y8ZA 3KEMA 4JUBA 3VBEA 4EG6A 4D56A 2CJFA 3M4JA 3MYYA 2WHQA 1XROA 4JSYA 1WZCA 3OLXA 5DGHA 1BWSA 3FYUA 4NP6A 3E70C 3LTNC 1E3DA 1IWBB 4MW4A 3I2YX 1NKTA 2DBRA 3EXG1 4BNYA 2EIXA 3PJRA 1NR7A 4Z3OA 5GZ6A 3ZLTA 2H7YA 4EX6A 3UH1A 1YRYE 1WDWB 1N2HA 2B0CA 2WIKA 5F4ZA 5K8CA 4GKBA 2OXFA 1SBYA 1OBFO 3HXTA 3AFOA 4MUAA 3THXA 1UL1X 3K9HA 1P5RA 1YVDA 5IJZA 1ZU4A 2X5XA 4RIIA 4ALNA 2OSBA 1QCYA 3CURA 3P97A 3GLIB 1GPH1 1UMBA 1NHGA 2HBZA 4V39A 3O3CA 3VYVA 2A5GA 4YAUA 1LW7A 2PTGA 4UDYX 3V1YA 5J4VA 1XTQA 5EIFA 3JQ8A 3PIDA 2MIIA 2WIJA 1V3UA 1M2VA 3CEJA 1W2WB 5I4CA 1U0HC 2VDQB 3HCFA 5DM2A 1ECBA 3KZVA 1HNNA 1XHEA 2ZWMA 2H0RA 3VHLB 1IY0A 4E09A 1JXQA 4WZAE 4YJ3B 3VC2A 2C9OA 1CEYA 5REQA 2ZR7A 3CH4B 4ETNA 3JQPA 4ZI7F 3PT9A 4IH9A 4CKEB 3H9CA 2X3FA 5E6SB 4BIIA 1KPHA 1GG5A 2IITA 1C3VA 3M89A 2YBEA 3QVWA 5EE5B 2BWJA 2P4HX 3KKMA 4XWTA 1M5TA 1CNEA 4HZUA 5KOHB 2VATA 1A5SB 1CIJA 1TF7A 2QMQA 5EG5A 4CMEA 2AHOA 2C92A 2EP8A 1H4VB 3IPLA 3S2UA 3VH4A 3EYAA 1GSAA 3O3NB 1E1QA 1I32A 1ONBA 3TRKA 2VT2A 3ZV7A 3QUBA 2HIMA 2ZSBA 421PA 3ZWXA 2FUEA 4BB6A 5JNSA 1JDBB 3VHQA 3GZNB 3PD1A 1HFEL 3QZUA 4QBGB 4CR6A 3NOQA 1C0LA 1AHHA 4EVRA 3UKJA 4ABYA 4MOWA 1ISFA 2QQEA 2OV2A 1JLKA 3CCBA 5I4BA 1IY1A 3HRIA 1JBQA 1HEUA 3BK7A 1VDZA 3PQ4A 4JUCA 4TS3A 1R0WA 4H7DA 2QL7A 1GRCA 1B8VA 1PK8A 2GEUA 1SXJC 2IHYA 1VYVA 4O2LA 4NENB 4WZBE 1J0BA 2GUWA 3WZMA 3RFVA 2VDKB 3HVKA 4ZO9A 2JANA 3QELB 1JU9A 2GN4A 4EGAA 1MJFA 2CE2X 2PX3A 3HCCA 1C30B 3ITEA 3LO8A 1FYWA 4MNTA 4YDRA 3CW2A 3RHFA 4UCQA 2DECA 3NHJA 1V71A 2LIVA 4QBHA 3H5RA 4RLQA 4D2IA 3ICOA 2XMPA 5CA1A 4XQGA 1TZJA 4PG5A 3RVRA 3LQ2A 3SJ7A 4CMIB 3WJ2A 3H9BA 4WQMA 1Z2PX 6YASA 4WOBA 4P5PA 4TKMA 3GZTB 4KVAA 3ZHVA 2VR1A 3GPDG 3GHYA 3UGJA 5K01A 1RWVA 4FNAA 4TLDA 2X0NA 1O0CA 2WSMA 1ZLXA 4NNOA 4E4RA 3PGXA 2IF2A 5BQFA 5KYGA 4Z9BA 3MTJA 5DM1A 5KQMA 3DE6X 1KOGA 2DG2A 5DSTA 3UJAA 1HZZC 3GT4A 2JASA 1UFVA 2ORED 4ZEMA 4MKZA 4BLTA 1L5OA 3R8FA 3FFTA 3FMVA 1Y37A 1YJ5A 3KE9A 1D7OA 3MUNA 1Z5GA 3H0EA 4G5RA 4DNPA 5L3QB 1RXUA 1QCZA 1EX6A 3STHA 3TUZC 3AV3A 4H27A 4MGZR 3LDAA 4MEAA 4KLCA 2E55A 4PRYA 5HQJA 1YCDA 4GMXA 2I4MA 4Z49A 5AVVA 1LFAA 4OI1A 3ADDA 2PLRA 1TJPB 3QG5A 4IKEA 3W9UA 2GTIA 5J4HA 3P9XA 1NKVA 2WF8A 3PUXA 4ASUD 3AR3A 1HURA 1O5IA 2A5DA 4L7VA 2Z1DA 3N59A 2C7PA 1WUTA 1YD7A 2R7KA 4P6VF 4QKQA 5JXGA 1KIAA 5FOWA 3LT0A 2P9BA 1DARA 2QD3A 2WVGA 2WT9A 1F6WA 3GPLA 4S0XA 1LPPA 3GGJA 5EZ5A 1PR9A 3EXFA 2ZWAA 2XWQA 5I48A 3GLSA 3HH8A 4IDQA 5THXA 5AH0A 1ZD3A 2JFPA 2RH9B 4YRKA 3ED5A 3G1UA 2VWGA 1RXVA 2XADA 4UM9D 4DGQA 2D3WA 3HA7A 1TT7A 2ZJZA 4HQRA 4JJFA 2VL7A 5F1OA 1VE1A 1KRXA 1L5VA 3P71T 3IBCA 1YE3A 3SNHA 4HBZA 3FPCA 2WJWA 2HQRA 1GRNA 4H2DA 3QOWA 3KK0A 4WBSA 4Y2SA 4IHJA 1MW9X 3I34X 2ZVDA 3OZUA 4NV1A 3AVQA 3C8UA 3RKRA 1K2VN 5CFNA 1A5ZA 3AI7A 1VXRA 3K8YA 4EDFA 4CKWA 4WXEA 2O8BB 3AY6A 2I6FA 4JFAA 3Q0IA 3RSOA 4DCJA 5B6PA 1XVTA 3MYRA 4BMXA 4RVSA 1I4DD 4IMRA 1X1SA 4KMSA 1E2EA 5INTA 1GAEO 4HGYA 3HWRA 4P58A 2IW1A 3MBOA 3OM9A 4S24A 1H1TA 2ZJ6A 4Q5IA 5D3QA 2UDPA 2GPAA 4XX0A 4BB5A 2HXYA 2R48A 4RM3A 4CG2A 3DE4X 3T5MA 4DLNA 1NUSA 1Z4OA 1YDGA 2R96A 1DDIA 5ICGA 1KORA 5I7AA 4YCJA 1GKUB 3U1TA 4LJKA 4NYJR 2XGSA 1M1XB 3LKZA 5JTUA 2EJBA 2RGGA 4DA9A 2ISCA 4LJSA 4BP8A 4JBYA 2EXXA 3F4BA 1TX4B 2RJNA 4YX9A 2WAYA 1Z0DA 4BCCA 1T5OA 2FTKE 3PBKA 3QWBA 2P68A 1KKMA 3ELYA 2TMDA 3G23A 4HPJB 1KO7A 1XEWX 2WVAA 4KH1A 3K6SA 2GBGA 2PAFA 1OYWA 1V3VA 3HVRA 4F8EA 1EQAA 3DDWA 5B4UA 2ZE7A 5HILA 1Z5ZA 5E1DA 2I3ZA 4XB6B 4BAZA 4FN4A 2VDWA 1P18A 3EULA 1Y6ZA 3HDTA 3OE1A 4CDRA 2WZDA 3GLIE 4KNVA 4ZREA 4C0LA 1OWLA 4HDNA 3V8BA 4WJKB 3MWLA 2VHEA 3WLSA 1X7DA 4UW9A 2XKKA 5ALHA 1EQ2A 3ICPA 4LHZA 1VKRA 3TRIA 3KSBC 1QNLA 3S1SA 3LQFA 1US8B 2GEDA 2OQRA 4EFMA 2AOUB 5TY0A 1CB0A 4X93A 1DWPA 1L5HB 4MWBA 1JJIA 3JR3A 3V1TC 5L6MB 1X39A 2X2EA 4M53A 2WM3A 1Q14A 2R00A 4FGLA 1DHTA 2I2AA 4S3MA 2VHVA 4YV2A 2OWDA 5SYMA 1MA3A 4JLSA 2VZ8A 1UMKA 1VYUA 2AMFA 4QWWA 1CLEA 3OJCA 3MB5A 4NICA 1N2CB 3L43A 2Q0XA 3OBBA 4J0QA 4B3RB 2ZJYA 2R8PA 2VYCA 2WOJA 5KWEA 4RPHA 2XYVA 3HY3A 4PYLA 2NOAA 1DKRA 2ZQ5A 1VLMA 3O75A 2VF5X 4HXGA 1USKA 3DZDA 1IXYA 2W83A 3DM5A 1ZVKA 3EA0A 3K9BA 4W6ZA 5AHWA 2AFVA 3VFDA 4B6OA 5CFLA 3KYCB 1CQIB 1UKBA 4HRVA 4PG6A 1OH5A 2G8NA 5TE9A 1IBSA 4GZ6A 5JTTA 3DNPA 1J70A 2EQ5A 1N2BA 3GUZA 3DFUA 3W2FA 1E2HA 2ZRIA 2X8BA 2YNMA 5DOZA 4M87A 2WTAA 2DX7A 5C1DA 4TYYA 2VCEA 1NW7A 1W5SA 3LLCA 5SY6A 1H4QA 1G64A 4OLHA 3V4RA 4KXVA 1K6MA 2GRAA 1DP4A 1SD2A 4D3XA 1EDOA 2VQEB 4YYZA 2FUG6 5K3AA 1DG9A 5IAAA 3JYNA 1UFQA 5LUBA 2Z95A 3TMYA 3H5LA 3JQ7A 3NHKA 4QECA 5CLLA 5CX4A 3ZJTA 2O2IA 5LXTF 4C4SA 3C5WP 1BVUA 1YJQA 2CCJA 1MHTA 1HQDA 1ST3A 3PR3A 3OIFA 4YRLA 1YQQA 2JAXA 1SUPA 1ZN2A 3ROEA 3I3OA 1LH0A 1BCRB 4MPRA 2EAUA 2H57A 3ZNPA 4DBZA 3PUWA 1W75A 4N48A 1HFWA 4AI6A 4DW8A 1J49A 4AYTA 1X7WB 4DIEA 3DOFA 1MA0A 2BDUA 2FPGA 5T67A 1SRRA 4YDQA 4BVEA 2ID9A 1MRZA 5FRDA 1EB8A 3RF7A 3F7OA 1PJCA 1YQWA 4L07A 3G1WA 2XVMA 3OZDA 4TSFD 2IHUA 3I64A 4HAOA 3H2HA 4F4HA 3I2HA 3G02A 4JJAA 3FHJA 1LC0A 4C2TA 4JI3B 1BX0A 2FZVA 2BFFA 2L18A 2BHSA 1S9DA 4BFLA 2M6SA 1XRQA 1HO3A 5FNVF 5KSPA 3S2FA 3ZV4A 4Q82A 2ZSJA 4XR9A 1NZDA 4BNIA 2OHHA 3OWHA 3TLYA 2GKSA 2GCIA 2R7NA 3FFXA 3NHLA 5IJ0A 3HKCA 1OX4A 3UK0A 4YCDA 5K0ZA 3PXBA 4KR0A 3W06A 2ZRGA 4YA6A 1D9ZA 3R5TA 5BT8A 4KR6A 1LJUA 5M5BA 1FDTA 3SBXA 3ZDRA 4EZEA 3JQFA 1OYVA 2VPPA 4MR9B 2C0PA 4W5OA 3K8OE 1UBFA 3AR4A 5B58T 1S0UA 2PGAA 1WHTA 1MU0A 1P7CA 4D9IA 1KWKA 3WAGA 1UZUA 2C94A 4CM7A 3U26A 2Z8YA 5GINE 4GM4A 1A04A 1YU6A 1KY5A 1IVSA 5H81A 1YS4A 4JYMA 5IAEA 5JQGA 2RGRA 3FHCB 5DHPA 2EARA 5LPNA 1X74A 3T7DA 1G5QA 3PK0A 4NZYA 1M8FA 3KYDB 3M6XA 3AMVA 3O0DA 4AMYA 2A57A 4DPLA 1H94A 2WM8A 2BAGA 3BCRA 1B41A 4P5DA 1YOVA 1QYRA 1OVMA 3VR6D 3ZVKA 1EP9A 1Q1QA 2XYPA 3C3PA 1FDRA 1SUEA 4PIPA 3S8MA 2C9ZA 4EEKA 2Q8NA 3QKTA 4UE2A 4L2IB 4A73A 3K0AA 5I8WA 2AL7A 1ISIA 2EW1A 3AOEC 4O59O 1EGHA 1YMQA 2JFNA 2VS1A 2VUIB 4DSTA 3UHPA 3H1BA 3V8RA 1F17A 2FMIA 1V1MB 4ZT6A 1FVOA 2Z0MA 4MP6A 3UMFA 2IF0A 4HS4A 3A4VA 3KTAA 2I7DA 2VYVD 3I0MA 1BDBA 3TRFA 5IKEA 3Q15C 4MS3A 2J9YB 3P9QA 3A3KA 3TQQA 1JTEA 4E12A 4CGZA 1TZKA 4KDEA 2E18A 3DT9A 5JW6A 4BGUA 4ZU6X 5EJ9A 2PK3A 4DCTA 3PQEA 3GLHE 3CH5A 4KX3A 1W4AA 3Q8LA 3SF8B 4Z4HA 3N6VA 2QE7A 2ZXEA 3I62A 1G41A 4JROA 1AZLA 2IYTA 3VISA 2WI8A 1A98A 1V1RB 2I3BA 4LMBA 4R69A 2XLCA 2QAIA 3W78A 3G0BA 3OEYA 4D6PA