1DX9A

W57a apoflavodoxin from anabaena
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
168
Chain Sequence
KKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTANIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Energetics of the Apoflavodoxin-Fmn Complex
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Flavoprotein
molecule keywords FLAVODOXIN
total genus 59
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dx9A00
5LVAA 1AKQA 4YQEA 2FVXA 2V9CA 2FDXA 3F2VA 4QOFA 1B1CA 1I1OA 1AKTA 2XODA 4ESEA 4R81A 1SQSA 1FVXA 4LAFA 2HNAA 2Z98A 5B3LA 3W78A 1DXQA 3F6RA 1NNI1 2OHHA 1V4BA 1YCFA 1CZOA 5NLLA 1AZLA 1JA0A 1RLIA 2FX2A 3KAPA 2QX8A 1YCGA 4OXXA 4XDGA 4YAWA 2A5LA 4Y7CA 3W7AA 1XI2A 3B6KA 3OWHA 3RPEA 4J8PA 1CZUA 4C76A 3FX2A 2FLVA 5B3KA 4QOGA 1ZX1A 1DX9A 2R97A 2KQUA 2MOKA 1CZLA 2N1MA 3NHRA 3FW1A 1D04A 3QFCA 4ICIA 5EAIA 4ZVLA 2R96A 2F1OA 3HA2A 2Q62A 2HPVA 3KLBA 1BU5A 1E5DA 4BMOB 2V5VA 1FLNA 5LBTA 1YRHA 2B3DA 2KLBA 3NHJA 3O2NA 1AKUA 2BN4A 3OX2A 2FOXA 3OX1A 4ZVNA 3N39C 3NHKA 1SG0A 2QR2A 2QX6A 1T5BA 2M6RA 1ZWLA 2FZVA 3OJWA 3P0RA 4PU0A 5LJLA 4GR9A 3B6JA 4QOJA 2D5IA 3NHLA 1C7FA 1TIKA 4NULA 4LA4A 4N65A 5F4BA 3UXEA 2HNBA 3UXHA 3U7IA 1XYYA 4C0WA 5JROA 1AMOA 5LBUA 2QWXA 3GFSA 1J9GA 3GAMA 4S24A 5EA2A 5NULA 1XT6A 4Y9UA 3U7RA 3L9XA 1YCHA 3FVWA 4YAOA 2X2PA 1FLVA 1CZHA 2WC1A 1YDGA 1FX1A 2M6SA 4HEQA 4LTNA 2Q9UA 5F12A 5FUQA 2OHJA 4YAUA 2QMYA 4C0XA 5FA6A 2MWMA 3S2YA 1QRDA 4ZVKA 1OFVA 1TLLA 4DILA 2Z9BA 1DXOA 3ESXA 4D02A 4BMPB 4LTDA 4PTZA 1FLDA 3NHWA 3F90A 2OYSA 4H6PA 1RTTA 4FGKA 1AKRA 4QODA 2FZ5A 5LLDA 3NLLA 4ZVMA 2MT9A 3K20A 3D7NA 3F6SA 2BZSA 4M0CA 4YAFA 2ARKA 5F51A 3ESZA 1YOBA 1D03A 3OWXA 1QHEA 3EYWA 4QOHA 4U7HA 1H66A 4Y9RA 3GFQA 3L9WA 4PTYA 4CETA 1BVYF 4FGLA 4C14A 1AKWA 5LMCA 1OBVA 1QR2A 1VMEA 4U7GA 3QFRA 4DIKA 3W77A 1CZRA 2FAXA 4FX2A 4DY4A 1J9EA 1F4PA 2AMJA 2BMVA 2FCRA 2QX4A 1AKVA 1RCFA 3KAQA 4HS4A 4QOIA 4N9QA 4U7FA 3HLYA 1CZKA 1CZNA 1ZWKA 4GI5A 3B6MA 4LTMA 5FX2A 2W5UA 3B6IA 3NHPA 3FJOA 5TGZA 5ULLA 3NHSA 4YALA 1RLJA 4CF6A 3GFRA 5BUCA 3OJXA 2BPOA 4XDHA 3TZBA 1YKGA 3TEMA 5A4KA 3NHUA 3O73A 6NULA 5LJIA 3FNIA 2RG1A 2X2OA 3ES9A 3EDOA 2QX9A 1JA1A 2GSWA 3HR4A 3JSXA 3OX3A 1H69A 3G5MA 1KBOA 3LT5A 3K1YA 1J8QA 2OHIA 1FUEA 1QBGA 1WSBA 3NHYA 1T0IA 1AG9A 4N82A 3ZHOA 1GG5A 1FLAA 3NFRA 3OVMA 3LCMA 4H2DA 2Z9CA 1C7EA 1KBQA 3N3AC 3QE2A 1OBOA 2MTBA 5EMNA 4GQIA 3R6WA 4F8YA 3SVLA 2XOEA 1WSWA 2QMZA 1AHNA 1J9ZA 1X77A 3KEGA 4FGJA 2V5UA 2BF4A 3NHFA 1D4AA 4NLLA 1FTGA 3ESYA 3TE7A 2ZKIA 3W79A 2Z9DA 3N3BC 4QOEA 1XYVA
chains in the Genus database with same CATH superfamily
4FLEA 1OBHA 3RVRA 1CR4A 1OWNA 5BN5A 4XWAA 5KYYB 3DBRB 4IDBA 2RJ3A 2ST1A 1OX4B 2FE1A 3G68A 1X14A 1Z08A 4I5GA 4LRWA 3KVVA 3RSSA 1A9OA 3U48A 5KYGA 2CJFA 1CDOA 1HKUA 2XGSA 5H80A 3WDKA 3UA4A 5AHXA 3OEEA 4OXXA 4L22A 3H5RA 5HKKA 4CLOA 1VE1A 3BMQB 1K6XA 1ZIPA 4OFXA 3BTOA 3LDGA 2PMDA 2QSZA 1L7BA 1TK2A 3H2SA 4G0WA 2CMHA 2EJBA 1X42A 1Y7HA 2V6IA 3GEHA 4NBVA 4QDXA 3OE4A 2VDVE 1ZD5A 4E5KA 2FMIA 2VVTA 5F1PA 3L3BA 1XUOA 5K4GA 4OM8A 3ADDA 2HA3A 1G1AA 1ML3A 4K2HA 2C2XA 4UEOA 4I36A 2V59A 4AJHA 1QFZA 1VPLA 2GCGA 4F3TA 1DBQA 1OLSB 5AK4A 4ZT3A 5G40A 5JAMA 4MLZA 2J9YB 3RBAA 4DNPA 2YHSA 4OBXA 1YQ9A 5ECGC 4TV9A 3K05A 3CZCA 4PY2A 3VZRA 4B6RA 5KINB 2YWHA 4QSHA 1IBMB 2MDTA 4W8OA 1J5PA 2J07A 3PJRA 2G09A 2XGOA 3FPSA 1SWWA 1XG5A 4QBGB 2ZU0C 3NYRA 3LPAA 3EDCA 4Q18A 5THQA 3O4HA 3TB6A 3X44A 5MGNA 4GNKA 1NBMD 2R6FA 5AESA 1TO2E 3ANXA 5FBHA 1OWLA 2V7QA 3CRW1 4YTEA 3BMOB 5EGNA 3IJPA 3VC3A 2ZI5A 5IAAA 2XOXA 3FNEA 4PQGA 4Y98A 2GYUA 1EJ6A 2RI1A 4DGSA 4EY8A 1JB1A 1PNRA 2PRZA 2DB3A 2XUDA 3A70A 3AGQA 3QVGB 5EMKA 1IUNA 4QOHA 4EL0A 3THWA 1YZTA 4GXRA 4Q6WA 3WYBA 3SZOA 4S1NA 3RSQA 2F3PA 1XQ9A 2R6HA 4ZZIA 1WPXA 5JH7F 4I50B 3OPMA 5LQSA 1XZHA 2W9XA 5AXAA 4D92A 1U4SA 2AQIA 2VHXA 2AJTA 3MB5A 3QNWA 1OGJA 5K8LA 5HQJA 5JAIA 3IS3A 2ACWA 3LFHA 3BF7A 4WECA 1ZWKA 1Y37A 2I2DA 2J3JA 3VKGA 3MCVA 4MA0A 4WJZA 4CCYB 1RI2A 3HKDB 4FONA 5AP9A 2QNIA 5TT0A 2WWGA 2JI8A 1E60A 2CHVA 2Z8YM 3HCAA 2FX3A 3KDPA 1XXLA 3M6FA 3T61A 3WVNA 3GUZA 4QQNA 3J7AC 1IRIA 2HT6A 4KP7A 5K45A 1HDZA 1RRMA 3K9NA 3OESA 3TD2A 5H3HA 2YHBA 1PTJA 4TXMA 4PIMA 3UG7A 4RHEA 3SM3A 5KUTA 4QEZA 2XD9A 4I1SA 5LIPA 2W37A 3AG5A 1GPH1 4UW9A 5DWDA 3SC2B 4XVRA 4KZPA 1KI6B 4BKMA 4Q15A 4EP1A 1G20A 3SOPA 1QH0A 3OTGA 1AHNA 5IYZB 3GAFA 5LXTB 1Y6FA 1YJQA 2EZ8A 4PCAA 4U63A 3WGKA 2VBGA 1OQAA 1Y6ZA 4FR2A 1DZ3A 2AMFA 4NK5A 4O08A 2A35A 3E8XA 2QQ0A 3DZHA 1ENOA 1ETHA 2IYZA 5EESA 1ATZA 3DM5A 2DLDA 3KX2A 2AG0A 4N40A 4W5JA 3MSCA 3TQSA 5ICGA 5LXTA 4IJQA 2FOIA 1UBRS 3DOJA 5AW6A 1GTRA 4MGZR 3OTWA 8ATCA 4IQ8A 1QR6A 2WDZA 1QIKA 1DKOA 1WCWA 1NXWA 1RZUA 1TU4A 1E6UA 3S68A 2CMFA 4OAOA 2CLSA 1FTQA 3OIDA 4ZAYA 3UYKA 1G5IA 1O97C 4IH9A 4NBRA 3A1WA 4DDWA 5L7TA 4OXNA 1TT7A 2R5NA 4AKGA 2YS7A 3INTA 2NPFA 3KZVA 4M9CA 2HWXA 2YN0A 1DEKA 2OBMA 1B0PA 3FE2A 3R23A 3UJPA 1Q7BA 3FHJA 2KQUA 5J47A 2CF5A 1AUXA 4PFJA 2JGDA 4R98A 3T4UA 3T9AA 4HNTA 1NRWA 1TM5E 4JNKA 3EQZA 2GCPA 1D2NA 4LE0A 4AUKA 3AFOA 1TF5A 1BGXT 2QP3A 3OJWA 1W88B 2PIAA 3IGFA 4D8XA 1WXEA 3IEPA 3PQCA 3K9QO 1HQDA 2NU7B 3NHLA 1XIVA 4WUVA 3ZD7A 1ADCA 4BVFA 4DC0A 1QDLB 2Y0EA 5HDBB 3ZWOA 4DABA 5TIIA 3RT7A 3A58B 4MHOA 1CEQA 3GGGA 3I9V6 3TSZA 3EDRA 2QLFA 4MQBA 2FEKA 4RTMA 4KFRA 4DSOA 4LF6B 3ZBPA 4ZT5A 4O4LB 3MTDA 3ZE2B 1KP3A 3LO8A 4D3FA 2GVNA 3J81k 4G5RA 2YXDA 1DP4A 3LO5A 4G1VA 2FP4A 2XMZA 3W9YA 1ZNQO 3ZKAA 2A0YA 3EMDA 4FYMA 1SZPA 5LXTF 4FMBB 2WB2A 2J3LA 2UVDA 3R3JA 2XMBA 4UDOA 3S44A 3BDIA 2PSFA 3H1GA 3B1XA 3ZHSA 3OM0A 1VJCA 1BCSB 3BD9A 2W0SA 2PKWA 1I5OA 4ZVMA 1XF1A 1I5EA 3K9WA 3TR0A 1G59A 3E7FA 1E3WA 3IIMA 1MC8A 2O0JA 2OXRA 4YRNA 3AHHA 4WZAB 2QTRA 2R1UA 4LDZA 2PRJA 1VHTA 1GZ6A 4AUNA 3SNHA 2P9YA 3JASA 1YL7A 4WKGA 5EY5B 2D5AA 5F52A 4LHEA 1Q5PA 1WXQA 1OC2A 1P31A 3OA0A 4WJKB 2C83A 1REQA 4J9VA 1ZN9A 4WSOA 3U5TA 5JS8A 4NIMA 4LZNA 4QGSA 4AKSA 2R8PA 1A4IA 2QTWB 2R8RA 5KAMA 4UMVA 1M2EA 5D3ZA 5F98A 1MPXA 3CEPB 4MKXA 3DJYA 4ENVA 5KYYA 3QG5A 4G1FA 2F7SA 1M3SA 2WMDA 4MR8A 3EW9A 5E7JA 1AH2A 2CLDX 4W99A 1V6SA 3T7AA 4IQGA 3AKYA 3RVKA 2ZRFA 1U0HC 1L5HB 1G5HA 1KK3A 1CLUA 4OQXA 3WYNA 4IIVA 4XTCS 3RIXA 4G07A 1FQJA 2DQYA 1LPMA 1N0VC 1Z6PA 1G20B 1E1DA 1JKXA 2R25B 3NIGB 1KOJA 3NHFA 3ESYA 1Z6QA 4FHGA 1NOJA 2VT6A 2AZDA 1VMIA 2UAGA 2C3YA 2HJRA 3DWGA 4RGQA 2ZRMA 3A11A 3ZWNA 2Y0BA 3N1UA 4ESEA 2A9KA 2R0QC 2V7VA 3CZPA 3SSAA 5IVDA 1KI6A 5LN1A 1DQSA 1P81A 2PZBA 1E2DA 1D09A 2OXIA 2ZXEA 1GRCA 1XHLA 1BGVA 2BEUA 4B6FA 3L79A 3LHSA 1CJBA 2BMDA 2I6QA 2AFIB 1PJTA 2Y1XA 1T5SA 3PDIB 3QA3E 1TYZA 1Z4KA 4WL0A 3R9XA 4JV5B 1U8CB 4C76A 4IO0A 4BFXA 8LDHA 4D4IA 1EVJA 1KZ6A 3VXKA 4DTCA 1ZITA 3U0VA 5THXA 5K3CA 3HWX1 4EW2A 1KY5A 2Q62A 3H2HA 2GAAA 1ECCA 4LUCA 1V11A 2WP0A 5CDFE 2IYTA 4LVUA 4ALMA 1DFHA 2PUEA 5KSWB 4IVRA 4DJ5X 2H11A 4B3MB 2XQJA 5CDFA 3SIXA 1ZM2A 4MKIA 3KYJB 3CSSA 1YBFA 3MMZA 4NULA 4WI1A 5DH9A 5EJ6A 4HEA1 4M36A 1KGSA 2N47A 3PA8A 4LA4A 4NZYA 2FG6C 4R71A 1KP2A 4N5MA 1O94D 2YWXA 1J9GA 5BV1A 2ZIWB 4NCAA 9MHTA 1OVMA 4NY1A 3B1VA 1ZLXA 1USKA 4UFPA 5EOVA 1U2QA 2H31A 4K3VA 1F06A 2NV2B 2Z57A 4UPEA 4LW8A 2P3LA 1I8TA 2DWCA 1X92A 3U49A 2UUOA 3PWKA 3NUGA 1US8B 2DBVO 2JFGA 4WEOA 1DPFA 3CJTA 3GCXA 3REQB 4B7AA 3WV5A 3MMNA 4R1NA 1WZCA 2B3TA 5IBRA 3SZMA 2VDUE 2Y93A 1RXCA 2QN9A 3H5LA 1XZDA 4KQJA 3WXMA 2MYNA 3BCHA 2GGSA 4FBGA 4AMUA 5K3BA 4DT1A 1Y5RA 4Q4CA 4WMLA 1XDZA 2ID9A 1J2UA 3B78A 3OZDA 2DR0A 3FFWA 2AA3A 2AN3A 2VZ0A 4ZHQB 4RV9A 4AZ0A 3I5UA 2UYGA 3SAJA 2QTVB 3I8OA 5DTJA 5ECYA 3AEUB 1GAQA 3EH1A 1N4AA 2XB6A 3VH1A 4XVCA 4QTTB 5I47A 4FR0A 2X9GA 4V0KA 3WTCA 4X54A 4HDMB 3CUYA 4HRXA 4GOKA 4K9MA 1CQIA 3KQOA 1NVFA 2GILA 4YP0A 5HRUA 1H3EA 4UJ3A 4AZ3B 1KXJA 5DTEA 1E99A 4BO3A 2UYOA 5IDWA 3QK7A 3TL2A 1T4GA 3QBTA 5HKKD 2D3WA 1X2BA 1P4HA 1QS0A 2ZYSA 2BHNA 1WQ4A 1YJ8A 2WUFA 3K15A 3KR1A 4IAOA 2Q1XA 3EF1A 4JWTA 2FPIA 3OKPA 5BN5B 4N82A 5HHTA 1CCWA 1WDKA 3GT7A 3HJHA 1V16A 4G1BA 2XUOA 2AE2A 1DAFA 2FW1A 3JQBA 4BEVA 4D41A 4RLHA 4N7JA 5ALYA 5AHKA 3RUAA 2WP8J 3ZZMA 4BN5A 1X9IA 1O6CA 4ZMSA 3SVLA 4UUMA 4HAYA 1Y34E 2I99A 5E9AA 1QO0D 1RHQA 1PT5A 1WM1A 3KZ1E 4IQ0A 3SIWA 3ZCVA 1S3GA 2OHVA 2OBXA 4HNVA 5AM3A 3K6JA 1C0IA 4JCOA 5T6MA 3TBKA 1VHQA 1R27A 4D9MA 2PX2A 4YDHB 4PZDA 1FVXA 4WCFC 5B1SA 1C0PA 4JB2A 2OV3A 2F17A 3AJDA 1GUBA 3AWDA 3PUHA 4PNPA 2XKBA 2E4VA 2QRMA 1ZIDA 2I1QA 4Q82A 1K97A 3SEQA 1EZ1A 1PNOA 3NVAA 4ALKA 3I92A 3RLIA 1JXAA 3A10A 2HA2A 4BZXA 3FNGA 4JT4A 3PL5A 3DG9A 3TSAA 3Q5DA 3CCCA 2Q3LA 3OM1A 4M1YA 1M1UA 2GF2A 2OCXA 1M5TA 2NTEA 3L7AA 2OCDA 4JT8A 5CURA 5FPSA 2IP4A 2YFHA 5HIIA 4QO8A 1DWPA 3AEUA 1CRQA 2H5EA 3NHJA 2I6XA 5FB3A 3G8DA 1AMUA 1CJKC 1CUCA 2OXCA 2WPDD 4Q01A 1TCCA 2G40A 4ER0A 4PO1A 2Z6UA 3G8BA 5ENDA 4GR9A 1NP7A 2WM2A 3PD0A 4N7BA 5CNIA 3CF0A 3ZDYB 2C8KA 3L6OO 2B30A 5I7HA 3G0DA 4NAUA 3AF0A 3GZNB 3I23A 1PJ2A 4UTOA 2GCOA 4FE7A 1D6NA 1FXWA 3I1YA 1R5OA 2XQKA 1XQ6A 3RK1A 1Q0ZA 1CEEA 1P3Y1 1ICIA 2SKCA 5HTOA 1R8QA 2O4UX 4RAOA 4TTRA 3DCIA 2QK4A 4XUGB 1QFSA 3DV9A 5FPTA 2QMHA 4IOLA 4NJEB 3A31A 3UAYA 2AVDA 2GCOB 4G2TA 2O7VA 2XXJA 4E2YA 2PZEA 3O3NB 3T06B 3ACDA 3W3AD 4WFKA 4ZI2A 4AFNA 5B1EA 2NYRA 3OTOB 4TMYA 1X94A 4C3OB 1IJBA 2DH6A 2VZ8A 4HNQA 3TXYA 1P7YA 4CV1A 5JY6A 5K51A 3T9DA 1YC2A 2B4YA 2B6HA 2WV9A 4XJVA 5EJIA 4DG9A 4ZIRB 3JQAB 3IURA 4OAPA 5AOVA 1T3HA 3SN6A 1Y7IA 1S9HA 2YZ7A 4GRIA 2H52A 3OQIB 2FW8A 3T5CA 4MVXA 3ESZA 3I1JA 3LCCA 2V5AA 1RM4A 2OQRA 4P4NA 1VYTA 4X00A 3TN7A 3URKA 4MW7A 4BC0A 4YLEA 1LNSA 1TM1E 4A0SA 1HOTA 1QUEA 5EXDA 4P5DA 3D2AA 4YI5A 1B14A 3OZWA 1ACLA 1N6HA 1L8QA 1P1HA 1Q7GA 2CDBA 2AXPA 3L6DA 2JIDA 4KXXA 5DJ5A 4DNFA 2I65A 3B6MA 2DX7A 2A9OA 1HE3A 2VHTA 4JS0A 1TW3A 1QIEA 4PLVA 1CYEA 4E7PA 5FV4A 2YYSA 3E3LA 5ENVA 4IXMA 1U28C 2QROA 3DV2A 2YJ4A 4ZYZA 4MINA 3R7LA 2PJRA 2HMVA 4Q00A 2CBXA 3QYPA 3WGTA 1AXRA 2DY1A 3T12A 3VJMA 2CJPA 1OBOA 3EZ6A 5IJXA 2QTTA 3WRXA 2AH5A 3F71A 3TI9A 3U7QB 2EZ9A 4D5GA 3HMKA 1P7PA 3LZCA 3W2GA 3UHJA 1J0XO 1JDJA 3COSA 1AKMA 3NHAA 1R9NA 3FNBA 4IHQA 1Y1TA 2XE7A 4NBSA 1D5WA 4FNOA 4RTSA 2V6BA 1D7OA 5E6SA 1DL5A 2BZ0A 1RYEA 2FN8A 5ALDA 1SUAA 3GV0A 3AFIA 2FG7C 4QELA 1Z8FA 1DLJA 4KFCA 4FCCA 1PQWA 2E49A 5BN3B 3GLSA 3RQSA 3NATA 3ZWAA 1ENZA 4PG4A 1S96A 4WOJA 2ATVA 4JL6A 3DVLA 1U2GC 2FW6A 2ZYGA 3OUTA 1T3SA 1E1LA 2WHEA 3S7TA 3Q15C 4QM7A 1SCUA 3ZHZA 5AI9A 1XEXB 1L4YA 1PR6A 2M6LA 5EAIA 3RVSA 2JLXA 4V3CA 2YJ5A 3L7LA 3PQ8A 3KWJA 3OQ1A 4MPRA 4RKEA 2AJCA 1ORDA 4QGFA 1FX0B 3HB1A 4AL4A 1HT3A 3AIOA 4PYRA 5B3AA 1EFRA 1Y6QA 1ECFA 2BVNA 2V96A 3BERA 2B0JA 4IIXA 4A0FA 4AXBA 2WVGA 1MCZA 1MFPA 2I9PA 3LOUA 4GHWA 3V8BA 2QE7D 3HYTA 3OJFA 3PWTA 2PE5A 3MTJA 4KREA 4G0OA 2QTBA 5JQGF 4S12A 5L6MB 3MERA 1IDOA 1X1CA 3NKFA 5BWOA 2C94A 5JW6A 1GPWB 1R4NA 3GT3A 4HGYA 1MEEA 1J0DA 2R44A 1CSEE 3LDUA 3UAXA 3W8DA 2OO5A 3SS7X 3OKCA 4K5QA 4UBMA 3OPYI 4UHHA 1E0JA 5HCIA 3EPLA 4CE6A 4A0QA 3JD2A 1XCMA 4KAAA 4R16A 1UPXA 3EFOB 3GDWA 4PGMA 4RVHA 2FEMA 3M6VA 4J0FA 3PYXA 1NPDA 2YKGA 1JHAA 1YJBA 2FW7A 4EJFA 3UWMA 3G7NA 2G07A 4DV0B 4BRUA 1R6TA 1B26A 1OXSC 1ZL0A 1UKVY 1K06A 2QUKA 4JBYA 5LUAA 2R65A 3DNMA 2IEBA 2Q0HA 1CJUC 4AJ4A 7REQA 1I10A 2AWOA 2P62A 4RUKA 2BFAA 3D8HA 4CQNA 2O8CB 2HLNA 4GXNA 1EFDN 3I45A 5AMXA 1G5RA 2HLDA 4O2BF 1P75A 4YIHA 2NVUA 3LNCA 5D7NA 1PS9A 2ZSIA 3OAAA 1UBEA 2FWRA 4OMCA 5ER9A 4PYJA 2W6PA 2XXBA 3DL2A 1CHNA 1LSUA 4FTWA 2O0KA 5G3ZA 3K0AB 4LNHA 4N5DA 4W1RA 1GZ7A 3QBEA 2AQ8A 3PC2A 4Y6OA 3NTVA 1SVMA 3FYCA 1E3MA 3OU7A 4YRZA 1M1YE 1WQ3A 1GSOA 1YKFA 3A7EA 2JIQA 4I1OA 4HWGA 2Z0MA 3B53X 5F7ZA 2X2OA 1HI9A 1GRQA 1A5ZA 3W90A 1M1YA 4A7PA 2I91A 4JI4B 3ROFA 9GPBA 1AS3A 2VCYA 4LJ4A 4DJFC 3A6HA 1HX7A 3CPHA 5BYBA 3PGMA 2PR7A 2IY7A 4HB3A 3HY6A 1VSQA 2GCNA 2Z3ZA 1D0VA 2FY8A 4FN4A 4F4FA 2J5KA 2FPKA 2EGGA 2V0GA 2V6JA 1AF4A 2TYSB 4Y0AA 1SKQA 3U7QA 2FRVA 1GGKA 3DHWC 2P1ZA 2FFJA 2ZRQA 5C4MA 5M2QA 4W5RA 5TRTA 4HGOA 1VXOA 4YCDA 4ZQFA 2B0CA 2ZI6A 3OHPA 3N8DA 1TJNA 2XNJA 4L6AA 1SXJD 3PC3A 2PL5A 3T9FA 3UMSA 3UT5B 4CIDA 5G4LA 1F9AA 1JEDA 2QN2A 1SQSA 3CMCO 3RFUA 1P5HA 2GBGA 3SF0A 3FR7A 5DN9A 2GAIA 3V1LA 1U7PA 1EBBA 3HCWA 4Q12A 5GV7A 1JJ7A 1YUBA 2SNIE 3VX4A 5KPDA 3WL7A 4UKDA 5C8YA 4V3BA 3ZVKA 5JJ5A 5E1DA 3PICA 3TAXA 1IN5A 1GIAA 1CVRA 4BX2A 3VNVA 1C9JA 4D8WA 2KLHA 3PFBA 2C3PA 2WNIA 4P4GA 5K3FA 1TUGA 4BB9A 1GG9A 2OKCA 2PZJA 2XB8A 3GPIA 3UT0A 3EGIA 2O3RA 2BJHA 1U9ZA 2INGX 4GOOD 5KTRA 3MF4A 3OFJA 2BTEA 1JHDA 1G16A 1NF9A 2Y4OA 3T3OA 4AZWA 3ZHTA 4AG5A 1BWPA 2HOQA 5DN6D 1MFZA 1Y4UA 2VJOA 2DFLA 3WZMA 3DZGA 2GVDC 1T5BA 1W0KA 3FCYA 4UUBA 2R8EA 1JFFB 1U8TA 1KVUA 1XZJA 3NYIA 1WSDA 4LOIA 3KXDA 4I55A 1FXSA 2H1HA 4JB0A 4QQ8A 3ZUGA 1LPPA 1UL1X 2JFYA 3ANMA 1LC3A 3B5EA 4WT7A 4GOLD 3AVVA 5FP0A 3GFFA 2BP7A 3AUKA 4B7CA 5EJGA 4F5WA 1JALA 3RRXA 1II8A 1JXOA 3ANNA 4KYTA 4JWKA 2C00A 3DMYA 3LE8A 5AOCA 3UENA 1FLVA 1KJNA 2J5RA 2VRCD 1T1EA 3BB3A 2VHCA 1YBAA 4LX0A 3FTDA 3TWOA 4Z2AA 1V96A 3HGTA 2MWMA 1R6AA 4WBXC 4RKWA 5ILQA 4AMYA 3AIIA 4WA7A 4B3HA 1KWGA 3MHTA 1N5LA 5GVSA 2RK4A 3MC1A 4BNLA 3IP5A 5H5JA 5BQPA 1N2EA 2GN0A 4CLRA 4LQ4A 1C0KA 4KV9A 4W5TA 3O8QB 4MRAA 3LYUA 3D7NA 2PZFA 1Z5WA 4B80A 3BX1A 3E3MA 3T3NA 3LDHA 1YOBA 2WB4A 2Q46A 1XMQB 1VRVA 2OLEA 4GL4A 4DVGA 3NOVA 3LQRA 1IG0A 3U7EB 5B7NA 2F8MA 2QM7A 3TLCA 1ZIXA 2BUBA 1AKVA 3IEXA 1Q84A 3JQ8A 2LZ0A 2W6ZA 4PRLA 4H7KA 4Z0PA 5E0OA 3VNBA 2O07A 2CNWA 4KKVA 1GLGA 1O08A 1Y4AE 1C8LA 4D3YA 1DIBA 1WNTA 2C5EA 1H2FA 2HQ1A 2X0EA 3KR0A 2BPOA 2C95A 3BMQA 4GBJA 4Y6QA 2DTXA 4EPXA 4GMGA 1PJZA 1W35A 4YAEA 5AKGA 3T1NA 1ZC4A 2QX9A 3GG2A 4FHCA 4D74A 3EVDA 5EXXA 3QVJA 4LXXA 3WOHA 4CKWA 1KBOA 4ONEA 3N2NA 3CEAA 1FFSA 1PAUA 3NX4A 1X9HA 2EKLA 2VHYA 3U4IA 1GZSA 2MYPA 1XZEA 1YB1A 3ZHQA 2AOUB 4KQ2A 5EMNA 2UKDA 2ID4A 4G4SO 5LZ4A 2JKZA 4QARA 3CRNA 3IILA 5K03A 2PA3A 1UP4A 1XAIA 3EZ7A 1MJGM 3OTQA 1V8DA 3N2YA 4N0QA 5DNWA 2PCJA 2LKDA 2MINA 3AW8A 3C5VA 1KR5A 2QRQA 4RA9A 1VJGA 2ZIGA 4MUAA 2EKPA 5LDDC 4C03A 1Z5VA 2BFNA 4IMJB 2FMHA 3VYTB 4RIIA 2FSPA 1E64A 4MYCA 4W5NA 3A7DA 1JHVA 2WVJA 3ZHYA 3DW3X 2O5CA 2J31A 1Z7EA 3L4EA 4NICA 2A2ZA 3T7CA 1NWCA 4ZOLA 5JTTA 5MHTA 3JX9A 2JBWA 4JLMA 3C45A 4LWZA 4JJ8A 1SWVA 4WY8A 1YCFA 2XRMA 3DQQA 1G21A 1QHNA 1NYLA 3N0XA 4QVKA 4X94A 1SQ0A 4KR0A 4YUWA 1BS1A 4R5HA 1SOWA 2VT3A 1AE1A 3L46A 3Q9LA 1ZPDA 3BMCB 2R6AA 1H6AA 2FX5A 3HCPA 3NKLA 3CXRA 3SHOA 3P4XA 4CQMB 3UPTA 7ABPA 3C39A 4BO8A 2ZSAA 3NETA 4HQLA 1YASA 3RK4A 2IDZA 3C5EA 2BTQB 1RADA 3R0JA 4AKHA 4YA6A 1LWOA 4FFSA 1VL2A 5C81A 1JP7A 2ZYRA 4O4LF 5EJEA 2CXPA 3OU6A 1DT5A 5EJ2A 3IR7A 5H9VA 1ZR4A 4CEHA 1XTQA 5LR6A 4HWPA 2W6IA 3EXEB 3V1UA 4WRRA 3OHSX 4YJ2B 3N8HA 4CKEB 3FGOA 4I5IA 4B3DA 2IBSA 3OZFA 2B6NA 4PYNA 3NH6A 5E1OA 1CY4A 1GUFA 1L7XA 2GM9A 2G9RA 2Q3FA 2ZJZA 1HSZA 2YXPX 3I0MA 3K1JA 4W6QA 5D85A 4W7SA 1OLUA 2B1GA 4GBGA 3TRDA 2FGKA 4AT1A 3PCTA 1GL3A 1SBHA 5FI0B 3C6KA 4MVJG 3BD7A 4MGHA 1OLSA 1SIUA 1NE2A 1Z2CA 4N4AA 3NAMA 1UFKA 1VPVA 4QXOA 3RAJA 4TXJA 3PB3A 1O7JA 2IE0A 3FMPB 4RK0A 3ER9A 2CB9A 4NU8X 4K1XA 2GPSA 1V8OA 3GDHA 4CKCB 1V3QE 4CKXA 4N8SA 2DWQA 4BTVA 3GHYA 4YRSA 4EYEA 3WHIA 1K5HA 1YIAA 4CM8A 5CB4F 4IIHA 5DEOA 3B6ZA 4NNOA 4YRIA 2FPGA 3S0JA 1XFDA 1X7ZA 2J08A 2BTOA 3NUZA 1A9TA 3EIEA 3ONNA 3W7VA 4DMKA 2DJ5A 3A6DA 4HPJB 4Q48A 3CISA 2FSUA 2RK3A 2YW9A 2Z09A 3OCYA 5GWXA 5IU6A 4HLDA 1RM5A 1QVRA 1T3TA 3FY4A 5IDYA 3KL2A 4LG1A 4YALA 5SY6A 4CEIB 3ORFA 3ORRA 4GR5A 1LVHA 3IQDB 4O1IA 2H5JA 3VHXA 4Z4CA 2OZVA 5FX2A 2QG6A 1QIJA 3NTUA 4ACAA 4UMDA 2GFQA 2JA2A 4LECA 1OR8A 4ZEMA 1PW5A 4IKEA 3RJ5A 5LD2B 4L85A 5FNVB 4EF4A 1VGQA 1LTKA 2P2ZA 1H85A 1Z4LA 2WWHA 1NURA 4KDRA 4C2AA 4WXYB 3C3MA 2A9RA 3PX7A 4JKIA 3V97A 1HWYA 2O2EA 3R8XA 2OHIA 4ASUA 2MSDB 5ALGA 2G5GX 2VJLA 2ZBVA 3TH5A 3PEYA 2ATXA 4CDRA 3C3AA 4ND3A 4Y0NA 2HAEA 1A9YA 2R00C 2VTEA 2NWQA 3F5QA 1DWOA 4BB0A 2C7VA 3DV0A 1QH8B 2ZE8A 3DC7A 4F12A 3DLHA 4MKRA 1R8JA 1J8FA 1C3JA 1DCTA 2VAXA 4LWPA 4O4HB 5D8DA 3BSFA 3E0QA 1U8YA 3BRSA 3UV7A 1N5MA 3D2CA 4UNQA 4DSNA 2XODA 2JANA 1F0PA 4RV4A 3B60A 3D3JA 4ARIA 1T1SA 1GGHA 4JJAA 3NT4A 3NNNA 1JAYA 1X8XA 2XF2A 4KYVA 1DXQA 1BHO1 4H0FA 4JR1A 1YO6A 4RHCA 1JIIA 2YRWA 3USCS 4B7ZA 4E11A 3REGA 4H3SA 5E4FA 2EDAA 4FZ5A 3WB9A 1E3SA 1DC6A 1W6UA 4AD8A 3IQWA 4QOGA 4ADSG 1DAEA 3D54D 1GZUA 3KUXA 4CF7A 3IQXA 3QM1A 2QP4A 4GKBA 3VVCA 4WOPA 4Y1RA 4YI3A 3PFIA 4EHNA 5B57C 1XJ0A 5M7EA 2I2AA 3KOZA 2H4JA 4D42A 3B7PA 3L1IA 4IVNA 2WKWA 2ZTMA 4XOIA 2HD4A 1TAQA 2YWEA 4TV9F 3OF3A 1AA6A 4OCZA 4PU0A 1Z56C 3CNHA 4HNAB 5JYCA 4G9BA 4KIUA 4CQMD 2W2MA 4KTTE 4I50A 5TR9A 1N3LA 4PN3A 3OQOA 3HWRA 2O2IA 4M0LA 1OD6A 4B3IA 1XNQB 1FMFA 2P35A 3FF1A 3MTQA 1GPLA 1JJFA 2J59A 2BFBB 4NBWA 1C9EA 4YIKA 1Y80A 3AB3A 2ZUFA 2HNKA 3L8CA 4WLEA 3U9SA 1XT6A 3EOZA 1I30A 4L0MA 2F8TA 3AVOA 3IE2A 1G7TA 2JFNA 3H8VA 4AY4A 3U3OA 2BW0A 3HVIA 3WQBA 3GCGA 3HNOA 4UQPA 3BE8A 4F4HA 1Q2XA 3EARA 4I1RA 4NV0A 3W5DA 1IVSA 2P6RA 1Y7LA 3PLNA 3SU8A 4BNDB 5KSYA 2HMUA 5ERGB 4CTNA 1GU1A 5FUWA 1U65A 1A7JA 1HBJA 4KIJA 4YJ2F 1WWKA 4OGGA 4X1IB 4XWKA 3L7NA 3HR7A 3OC6A 3OLXA 1SVNA 2ZJBA 3F6EX 2IU4A 2JFZA 1KSHA 3B2NA 5CEEA 2IKSA 1PNTA 2J4CA 2ODBA 2R85A 3I3SR 2MT9A 4I66A 1GQYA 1SQ5A 4C1NA 2PKQO 2OOKA 2DEUA 3WJ2A 3GRYA 4TUYF 2X42A 1CF4A 2F9FA 2IKQA 3ZIDA 2QRHA 3EC7A 3LUAA 4BJ6A 3DAYA 1T0UA 5KYNA 3VNUA 3DXZA 2DMRA 2OHXA 1NUPA 1U1DA 1TM2A 4FX2A 2BKXA 3N7UA 2IK8A 2IEDA 3BDAA 4BNMA 4ZRNA 5DRTA 2C96A 4B71A 3JU3A 2I3AA 1Z0ZA 1A04A 4I4CA 2PLNA 3LJKA 5A5FA 3RKUA 5D7BA 3IAFA 1RFLA 1P1IA 1XDBA 3L41A 3RYFB 1QHFA 3EVEA 4E31A 3O93A 3V42A 2BFCA 1A95A 3KQYA 4KRFA 3KQLA 1ZOPA 1K8QA 1RIIA 4FIZA 2JJQA 4P5PA 2QENA 4Q93A 4UHCA 1SHUX 1WLSA 2QAGA 4J0QA 4MRVA 1CG6A 1MAUA 2C59A 1Y8RA 1QFXA 2VJYA 3PPVA 1TEHA 4TL6A 5GONB 2Z4SA 1MC1A 3HXLA 3VV2A 1CF2O 5IDVA 4CCSA 4MP6A 1ZBDA 4ARZA 2CXOA 4OK3A 2H0QA 2GA8A 5KTOA 5KVAA 4B6SA 1O58A 1U4NA 1RQ2A 2IYPA 2SBTA 2YHIB 3AHIA 5BR4A 2IE8A 2XT6A 4RM3A 4CIAA 3UFBA 4DNQA 4F5YA 5DHSA 3I05A 4HAOA 5T57A 2PS9A 4F6RB 1G8AA 2G9NA 4AS1A 1PRYA 4NPAA 1UWVA 1X38A 3T3DA 5DWVA 4MGKR 2FI1A 3SLRA 2XUIA 2GI4A 5AKYA 3S70A 2QYSA 3HWWA 1VHLA 2ZXUA 1OB2A 5LYJA 5H4GA 3JD1A 4ZOQI 1XXHA 2QRGA 3HCOA 4R8MA 3NTQA 2VDNB 3G9ZA 1CZOA 4JLPA 1I4EB 4MLDA 2VTBB 2WHPA 3URMA 3WGVA 1Q7TA 4RZ2A 3V6LA 4NC9A 1P29A 3NKVA 3BSWA 1JKFA 4BNYA 1COZA 1YB6A 2O2YA 1BH2A 1RABA 5SZJA 5TVGA 4DA4A 2A9JA 1TM7E 1SHTX 1IY2A 5L4NA 1U5AA 4H27A 4IWYA 2D2EA 4JP8A 2ZRDA 3GEDA 1TUEA 4JU9A 2ANBA 3X2FA 3ZHXA 5H1YA 1M6VB 1A96A 3OLVA 4R6XA 4RTNA 4NATA 1SG0A 1HH4A 3DPIA 3IMGA 1E4YA 1MMFB 5CK5A 4FNAA 4M0UA 2M2IA 2D5IA 2XHZA 4BXOA 5CAEA 3TKAA 4ETWA 2FSHA 4J0JA 3OIGA 3R5HA 4PM4A 1RI3A 2RBEA 3SJAA 4CIWA 4MV6A 1H4VB 4HQ0A 3H99A 1I51A 1L3BA 1Q0QA 3IPLA 3STHA 2XA9A 4ZYYA 1FXWF 5TLSA 4IOKA 5BSRA 1UADA 2HF8A 4NPCA 2V1UA 1LDEA 2CZQA 2EV9A 3GDGA 2GEDA 3ND9A 4TV9B 4ZCPA 3T15A 3T3GA 1M2KA 5AW5A 4DCOA 2YFYA 1YMVA 4MWDA 3F2IA 5IZ4A 4NCIA 2A5JA 4RKQA 3MIIA 4MR8B 1KFBB 2VH5R 4UU0A 1GA1A 4DUYB 1RWWA 5G3YA 3RVNA 3HZHA 1L4HA 2ONKA 2YICA 1SG6A 2BC9A 5ILOA 2BGNA 5JNLA 5ANRB 5DNAA 3JWIA 4TWBA 5F64A 1OCEA 1UC8A 1Z82A 3KQWA 5C5DA 2DPHA 1U0NA 4QQFA 1UEJA 4LJRA 2H48A 1FDTA 2EBFX 1Z5PA 4KLNA 4C0KA 3HDTA 3UTDA 4FLMA 5U1PA 3K1AA 5KTTA 3QX7A 5FTKA 4EUNA 4O0LA 4PHFA 4WKCA 5LLTA 1TPZA 1WKCA 2Q3MA 2RHDA 2JEYA 2CT8A 1R6XA 2P5UA 3D0RA 3TI7A 1KR2A 5A7FA 1OWPA 4ZKDA 2V4UA 4M7OA 5B6PA 4Q4JA 1X74A 2POCA 2BI4A 3HJCA 4U0JA 3G1UA 1NA5A 4K2AA 4MQEB 5DNYB 3ZNQA 2PGJA 1QOPB 5BRJA 4BQSA 1P7CA 3JQGB 1I0ZA 1UK8A 4X41A 1HTBA 5WRFA 3ZWYA 2F8SA 3CF2A 3L0CA 1RKBA 2FPMA 4KXYA 5H7XA 4WBNA 1J09A 3A9CA 4LK2A 3SR4A 3ZHOA 3Q3IA 2XMCA 4JLNA 3V1TC 2WIBA 4Q34A 4UUOA 3H5OA 1T35A 4QU0A 4ZMRA 2FWAA 4YP6A 3D4IA 3WS7A 1R0BA 3SJZA 4P4TA 4KXNA 4O29A 2ZIEA 4NYMQ 5AIBA 5KTYA 4NOJA 4EI7A 1V7QA 3R7WB 1FUKA 2DTDA 5JSZA 1PV1A 1Z2AA 4Q24A 2VUHB 4QEKA 5C3UA 3T3PB 3KYCB 1C9DB 5EQDA 1ZD2P 4H35A 4L3VA 1XTVA 2ZUVA 1Q57A 2C2OA 2V9CA 5IJ0A 1NKTA 1EUQA 1GKUB 3TTUA 3GOHA 2HY7A 5IAEA 2J30A 4L9WA 3TLXA 2O8BB 5SV2A 5I7VA 2A14A 3NCHA 2ZBFA 3CH4B 3UMFA 4EA9A 1U2PA 2I2CA 2I71A 3VJKA 2GYWA 4DC1A 1XDSA 3NEJA 3WA6A 4MX8A 1CE8A 1E58A 2CNLA 3GQBB 4XOUA 4K9OA 4KWEA 4ZICA 1S5PA 1UBKS 1U2GA 3CA8A 2Z8XA 4Y6LA 1LVUA 3W1VA 2IXEA 4PZ0A 1MU0A 1TYEB 1WOMA 2EOAA 1N32B 2CNWD 4ZOCA 5AKEA 2W42A 2O06A 3R5TA 4YUXA 3IDOA 3G0HA 5JC1A 1XXHB 2CMKA 2Y0DA 3FKSD 4H17A 4WASA 4DR2B 4EYOA 1YA8A 4QXMA 1QIGA 2FQYA 1CVIA 3U40A 5JADA 3UWDA 3GZJA 3DKRA 2XCSB 1JEYB 1XRMA 5JO9A 3I2HA 5CFLA 1GSHA 4B4DA 5IJZA 4ESHA 3KHKA 2E9SA 1ZH6A 3HCFA 2G36A 2I4LA 3THRA 2ETVA 4P3XA 1YQDA 1YAJA 1W0JD 4QREA 3O3OB 1UC9A 1XTIA 4GECA 4PPYA 1EUCB 1DKNA 5D3MA 4ARZB 1WUJS 3LT1A 1FFYA 1DQRA 4F9FA 1EMDA 4R7GA 3QIAA 4J4TA 2E5FA 4ENPA 4FZVA 1DKUA 3KEMA 3CG0A 3HKEB 2XDQB 5GP1A 1DJPA 1MH9A 3AUUA 3SFVA 4UHJA 1ZJ5A 1XZAA 4J7UA 5AKHA 1VYVA 1S02A 4NYIR 2PVSA 3BHNA 3QVUA 1CJVC 5AQEA 4EG4A 1I4OA 1HG1A 3IP7A 5DLPA 3IEVA 1Z0FA 3HBLA 3QHAA 1KDYA 3RW9A 3EAGA 1LI4A 5DPMA 1YH3A 2ZYTX 2BFPA 1B6TA 2EP8A 4H7HA 3EF3A 3OWXA 4RCZA 5IC4A 4S1WA 3RWOA 5B7QA 3ID6C 1M6EX 1RJFA 1ABFA 2YQ5A 2C2BA 3D6MA 3E22A 4XX0B 3RBZA 1P3DA 2QT0A 3RM3A 5IAKA 2ZIXB 1OHHA 1XKXA 3X1DA 3LRXA 3R4VA 4IJWA 1NY6A 5H9WA 3VR6H 2YJZA 4AWXA 3AR9A 5F5LA 1P60A 4IY1A 1A8PA 3I42A 3HXPA 4MVJM 1CNEA 3VO1A 3HRKA 3CH7A 1ZGAA 4G41A 2I4IA 3QE3A 3ONFA 3WMEA 4AQDA 1DBVO 1K4MA 4DMHA 2PX5A 2M32A 3D9QX 1VRCA 5A5EA 2QBYB 4DR7B 2RIPA 5BR7A 2IOYA 2OHGA 4EA8A 1FJGB 2EKZA 4MVWA 2YWBA 4PQFA 4TX1A 3DP9A 4IIJB 4M9QA 3DT9A 4X62B 1WSBA 2BGIA 3V2GA 2GNAA 4L72A 4J0CA 1C7EA 1EX6A 1T6BY 2NUAA 4PEVA 1NWHA 1UMCA 3AWIA 3VSEA 4DQ0A 1RHUA 3H2YA 1KMMA 1E9RA 1MP0A 1VGVA 4PNZA 3KD3A 5I4IA 1ORIA 4QUAA 1W34A 5FL7D 2JCGA 4DQLA 3DE0X 2R1TB 1PK8A 3I73A 3SFTA 1Z25A 1P9WA 3PRJA 4YJHA 3W4KA 2EJWA 1YMUA 1U90A 1UODA 2JFPA 4D56A 5JWOA 1N2SA 1O77A 1L6IA 1CR2A 3BF8A 3F98A 1ZD4A 1CPYA 1NMQA 3ADPA 3DDOA 1C3OA 2Q5IA 1QAOA 1T2VA 3YASA 4D43A 3NBMA 1EINA 2VRCA 3IEUA 1PS8A 5DCWA 2VS1A 5EKDA 3F6CA 4W4TA 3L1UA 3RADC 4G85A 4DXDA 4F6LA 2IW3A 3PPWA 4HXGA 4RPKA 2B8EA 4NCBA 4XUDA 2QI9C 4L28A 3E9DA 4QYMA 4DWVA 3WKCA 1MBZA 2POQX 3W06A 1MVLA 1XDDA 4CDGA 4EFKA 5JSHA 5C1PA 3E7PA 2BFDA 1G8KA 3H17A 3VKHA 5G02A 3IUJA 5KKAA 3JATB 1ADGA 2EZUA 1CRZA 1Y1LA 1KYTA 3F8TA 4TTSA 3U7GA 4YXWD 4CLDA 4KIFA 1RXIA 4QOJA 3TS1A 3UATA 1VCOA 3GBSA 2AFIE 2BUAA 2YW2A 1F60A 2O59A 1HEUA 2GEKA 4N6NA 3KETA 3PZRA 1MIHA 4CM3A 5BMVA 3N8IA 3OQJA 3N58A 3ZZTA 3ZCPA 4BZZA 4QWWA 4YRTA 4OTZA 4PLCA 1MRNA 3F4KA 2VNJA 3FMFA 4LHYA 2O1WA 5TPWB 5YASA 5JBIA 3GJQA 3KEOA 5EHXA 4K8OA 5EJ4A 4OKNA 4NE7A 4ZCSA 5KYKA 1TT5A 1KO4A 3IQEA 2PUAA 1GGMA 1K27A 1VE3A 3M83A 1R4ZA 3IALA 1HDCA 3EZXA 1YS4A 4YDQA 1L5RA 4KV7A 2XQFA 3A32A 4JLUA 1USVA 1BHJA 2B7BA 3AZQA 1EK0A 1FRVA 2BR5A 2YWFA 2FXVA 3IPCA 3V4SA 1S8AA 1NJ2A 1QTIA 2O2CA 1MZVA 3CEHA 3K20A 1GXSB 4TL7A 1UBJS 3S4YA 1Q77A 1KK1A 2OQ2A 2ERXA 1D03A 1W49A 4QBKA 3TW8B 3UPDA 2BHTA 1HNWB 1T9ZA 1N5DA 3GFQA 4LN1A 3O03A 1X1TA 4AWAA 4BNXA 2DJIA 2R6R1 3LZ6A 1XDUA 1EFRD 4N8DA 4POOA 3PNVA 2G06A 3LI2A 4JLBA 3A3PA 1TADA 4K46A 4ZHQF 4LXQA 5F1KA 3FHOA 4RC9A 1KFJB 5G1PA 2OYCA 3FUCA 1C7QA 1JQ5A 4RLSA 3W9SA 5BW8A 4E5PA 4Q9DA 1M6WA 2PKYX 4LRXA 4XJTA 4KHZA 4NEQA 3EEYA 4R2WA 2BF7A 3LD9A 1P45A 4G2NA 4NHOA 4U6SA 1QRSA 5CA1F 3D4NA 2FSVA 5EIBC 5BNZA 4NMMA 2YZKA 1K2VN 1RYFA 3K8QA 4BNTA 4BECA 1J2TA 2J0SA 2X9VA 5C1IA 2IRWA 1N1MA 4TT3A 3EPHA 4AG6A 3EY9A 4PS1A 3AB7A 3T7RA 3U1TA 1G9TA 2ASEA 2CUZA 3ZWVA 1O87A 1BC5A 4Y1EA 3PUYA 1A0OA 3NDRA 4G0QA 4JUBA 4IEFB 3RTEA 2ZZNA 4RCVA 3L0IB 2XMSA 3FCOA 1IHOA 1P2BA 4IUYA 3OIFA 5HKLA 1ZMXA 1PL0A 2W8BA 1XYVA 3CW2A 4OJTA 3VAZA 5JAPA 4UHFA 3E9QA 3DAGA 4L76A 1FUUA 4TYQA 1VM6A 1LLCA 4LSZA 1SA0A 5F4ZA 2JJ1A 3P9PA 2AYXA 1RPZA 5IKXA 5I4BA 2WDPA 2PYZA 2WA2A 5FADA 3Q4GA 4L73A 4WEQA 1E2IA 4REQB 4AZSA 3EUWA 4OFBA 1XTKA 1J97A 2YWCA 5HE8A 1QSGA 1BRMA 3RT9A 4OBEA 4P3NA 1ODJA 3SCZA 1GPMA 2C9MA 1WVMA 3DAPA 3Q40A 4M1QA 4BO5A 4MYHA 3FLBA 1JIKA 4BEJA 1OH5A 5CK4A 3T0GA 1X70A 2P6OA 2ZREA 1HY3A 3GPLA 1KH3A 2E1PA 3JVUA 4L8WB 4TQUS 4GC9A 4XIFA 1UWKA 5CVCA 5FTNA 3AIKA 4BRSA 1ADYA 1W46A 2QSYA 3HNPA 3NNSA 1PT6A 2GN2A 2J09A 2YUIA 4HTFA 2Z30A 3GLFB 4V0LA 4C3VA 1MB4A 1YS9A 2FFHA 2BE9A 2W98A 2GDJA 3D6NB 4MULA 5F3DA 2XKKA 1TTTA 2FV8A 1SZJG 2Q9AA 3CLHA 1IPHA 4BLSA 1Q95A 1D1SA 1OVGA 2B4KA 1MX5A 3BJIC 4CV2A 5IANA 3U80A 3A4MA 4EOGA 3QQ5A 3V4PB 5IFLA 3ZUPA 4ATNA 5IZCC 2YNMD 4RZUA 1RC0A 3GEGA 1U8EA 1E1RD 2B99A 1HURA 3CF6R 4X6YA 3ZCSA 3G8AA 4B6EA 4PONA 4MW9A 5HKBA 1NPYA 5EJ5A 1DV2A 5JPIA 4EKIA 1PBNA 3G2JA 1YK0A 4I14A 5HK8A 5AM4A 4J6FA 3W3AH 2I76A 3DKIA 3H5WA 5JD5A 4DLKA 1EH5A 4P2BA 4U7PB 5D1HA 2CL7X 2P2DA 1ECJA 1CU1A 1KNXA 2VL7A 4GBMA 4IRXA 1UZNA 3RRYA 4J29A 5JIBA 1HNZB 2H1OA 3OFVA 5DYYA 5LU9A 1J8YF 1SCKA 3F6SA 3PD7A 3WZLA 1RYBA 1V41E 1DKQA 1RI5A 4D0GA 5CEFA 3WJAA 3QX3A 2QORA 1RQRA 1T2EA 3CUKA 4HK4A 4PPNA 4YFVA 1JU9A 1VKRA 3U56A 3RIMA 3UK7A 2J4DA 2BCJQ 5CYFA 2DT5A 1Y3BE 1MXHA 1XVTA 3OG9A 2WLSA 1XC7A 2IDKA 4ZCQA 1EEHA 4EABA 3IQFA 3U44A 2HA7A 2PJDA 4H0CA 5JQGA 2IS6A 1A9SA 4IJ6A 4LOJA 4R3NA 5JZSA 2P6NA 4DGQA 3LW8A 4UUPA 3CM0A 3OJEA 4W82A 2Q1WA 2CHQA 1GNRA 1U28A 2R8OA 5BURA 4LPSA 1ZCFA 1XTJA 1FLAA 2R7MA 4TV8F 1X3SA 2A33A 4BLOA 1YULA 3A1VA 3AK4A 5K3DA 5K3SA 4BFSA 2JAWA 1AC5A 3OE7A 2BAGA 4HC4A 5EIWA 4IQFA 4DM3A 3ZLJA 4XB6B 3KJIA 3ZJVA 3BT7A 3CGWA 3DZCA 2XTAA 3S1AA 2HBRA 3F3KA 2KPOA 1JR3A 4CM6A 1JJAA 2FLWA 4GVXA 3ITNA 1T2UA 2ZE6A 3GQVA 3KLOA 3RNLA 3TL3A 3VU8A 2C7GA 4XA8A 3AKZA 5K8TA 1L6RA 4LGYA 5PNTA 1ULUA 4E09A 1ZSVA 2VAVA 1BVUA 2YMPA 3EVNA 3ZHUA 4FFBA 5IPFA 4KWHA 3AF2A 721PA 5HJ7A 3KIPA 4BUJA 3BXOA 3KZCA 1RXEA 4OD0A 5JARA 1U6JA 4TQ9A 4HTFB 5ERYA 4LY0A 5DHTA 4BBPA 1ZOIA 4CODB 1VL8A 1AZLA 1UBMS 3VX3A 1GVHA 1RRPA 3MAJA 1ZZGA 4MUXA 5DYWA 4S04A 4QDUA 1Z88A 2XYQA 3PDWA 1Q50A 1ZX1A 1RYMA 2H18A 2OCAA 4DR1B 3TQQA 2V7EA 5GOZA 4XWTA 3H7AA 3HJBA 1U1GA 1GL9B 2Q07A 4XWOA 3HA2A 3HGMA 4O5AA 1CUJA 5LP6A 2HM7A 1YZFA 3PQ3A 4YJFB 1B23P 4S2UA 1NNUA 3RBXA 3CKKA 2HDWA 3VBCA 5FEMA 4S0XA 4CI9A 4KQ1A 3G5UA 4QU9A 4F71A 2ZQZA 4TLCA 2BELA 1VG8A 3HUDA 2HGSA 2OSBA 4MVJI 4D9NA 3WLRA 3OY7A 4YS6A 5CBKA 2JFQA 3U7JA 1UXKA 4NJMB 2AF3C 3ZU5A 5ALMA 2Z2KA 4ZVRA 4LZWA 4BRWA 2I1VB 2WF7A 4UVEA 2OVBA 2OGSA 1DCMA 3PQ5A 4DJAA 4EKEA 3WLOA 1BKDR 2BRUC 3UK0A 4TMTA 5K01A 5AK6A 5B12A 4NJMA 4C0AC 5IK2A 3RS3A 4TV8B 2PT5A 2PZGA 2D1SA 2C84A 2QGFA 3ADCA 2CJWA 4Q1FA 4RZSA 3H4TA 2WYHA 1QRDA 2Z04A 3ANLA 2W2TA 2Z9BA 2QRPA 4JVMA 4ENWA 3ESXA 3R75A 3ZI7A 3FTCA 3I30X 5D84A 1NVKA 5CH3A 1SU6A 2FEOA 4I3GA 1CS0A 3UY4A 5JUWA 2OYSA 3PEWA 5EJMA 1E2BA 4IJUA 5TVKA 2HSZA 2IZ0A 4XQ9A 5F9MA 4BU1A 4EKYA 2ZIUB 2A1IA 4AQYB 1EK6A 3T4XA 1KK0A 5KPJA 1GPBA 1T1IA 3D1VA 4Q3LA 5DYIA 5FPPA 5I4KA 4JX9A 1N3BA 2BKUA 3ODGA 4U7GA 5EPEA 3AJRA 3NZEA 3KFVA 1SVUA 3ZV7A 5C5CA 1CTQA 3MELA 5KOYA 4Z3DA 3WYDA 1KZ4A 2JI7A 4E30A 3RV4A 4QLOA 3F3YA 7YASA 3KTFA 2IXDA 3CLTC 1NX6A 2PT6A 4PLTA 2RSLA 4K87A 4UXHA 3TW6A 4A8JA 4D0SA 4OLAA 1QC5B 3SMVA 1SOAA 3TZBA 1RU3A 2WA1A 1MOQA 4JJGA 1LF0A 1GAXA 3D6AA 4W5HA 4ZQBA 2J0VA 3TOXA 5BNFA 3U4AA 4PAOA 3ZV6A 4OQYA 1P19A 1R0WA 2D3TA 5KWVA 3EBOA 4RTJA 2JI4A 3GVXA 4TTTS 2DU8A 1XKTA 4B3GA 3NIFB 2FPPB 3DKVA 5IWAB 4HFNA 1XZCA 3A1TA 3FWNA 4JFAA 3QEAZ 1WCIB 4JVNA 2DZDA 2WAXA 1FNNA 4KYIB 1C0EA 3EXIB 3HY3A 3SQOA 4WXPA 2PU5A 3TCNA 4BNDA 5AI4A 1UDCA 3TQTA 3KB6A 4M0KA 2EATA 4X20B 3TQFA 3UMJA 3RS7A 3UA3A 3T1HB 2ANCA 1DIHA 3HBJA 5AVQA 1P2DA 1ES9A 3BD6A 1UFQA 4F04A 4N47A 1FF9A 3ORQA 2G9QA 2JPDA 2J8ZA 1BJTA 3NJ4A 4JC4A 4V2IA 1QTNA 4IRMA 1EKXA 3QJ5A 3UC9A 1ZIYA 2VR1A 2YOGA 4Z7QB 2E1RA 1HE4A 1XE3A 4XIJA 5E95A 4KVZA 3AI7A 3EIFA 2AG5A 1PK7A 5KQGA 4XSVA 4FXPA 5F5NA 3FMOB 5CVEA 5KYXA 3UT6A 1NJFA 4MI1A 1Z4PX 4UU8A 1JPNA 3KT0A 4ID9A 3EQ6A 2DLCX 5KNLA 4Z3OA 1D2CA 4FFMA 4RL6A 3VAYA 1HT1E 2EFCB 1FYXA 5TQ2B 3ZE1B 4C1BA 4YUYA 3A0RB 4TXNA 2WJIA 1KFCB 1UQTA 2FPRA 1Z74A 1H8HA 1X39A 5B58T 1EA7A 2A0UA 2WIJA 1NOIA 1USWA 2JHPA 1SVSA 4IL5A 1K8YB 4INAA 4DQVA 5KYXB 1VB3A 1OXTA 1Y8QA 3HU2A 3LA8A 4L07A 3Q7RA 5F35A 4EGSA 5LQDA 4I4NA 2XUAA 3GUVA 1RAAA 4U2FA 3INNA 5DFAA 3QIVA 5FWYA 1SHKA 1U0FA 4GZ5A 4PQRA 1HQYE 1YJAA 2VN8A 3WL8A 4AC9A 5DP1A 4M1SA 5EMMA 3TZ6A 4B1FA 4CMEA 4BZPA 2YDXA 1F3OA 2JD1A 3G2PA 3KAKA 3KM0A 3C8HA 1CS0B 4OYLA 2R6ZA 4NZMA 1CQZA 1MW9X 3UICA 1P1CA 1O9GA 2QAGB 2JHCA 3F73A 4JSRA 4YMIA 2GCIA 5CTAA 3O90A 5FA6A 1GPUA 3QYAA 5H70A 3F1KA 4A0RA 2DQSA 4MAAA 4BQPA 1WCIA 2GJSA 3WO1A 1LU9A 3UFXB 1IAQA 3BGVA 5JRZA 3FAKA 3DHNA 5A71A 3N0VA 4HLNA 1XQ1A 2Z1NA 4W9NC 4N03A 1CUHA 3T7TA 3UTCA 1GCUA 1Q0SA 3T99A 3GLFE 1PDVA 1G18A 1VTKA 5CUQA 3GGSA 1P8AA 5J2UB 3N6RA 2GUGA 2PSJA 5A3SA 3VDRA 4MDHA 1NQ5A 1TECE 2JW5A 2XADA 5LZ9A 1NBHA 1H1LB 1S9DA 2DF8A 2Z6AA 1CZRA 2L18A 2NZWA 3EC2A 3LVQE 3H11A 3CO5A 3W8NA 2IHZA 1E5TA 1XZ8A 3VVLA 2BGWA 1DHRA 1QIHA 1JQKA 1SJ9A 2WF9A 3LS2A 1CFJA 4LTMA 5LP6F 1EESA 4Q4JB 1Q0TA 1JLHA 1QZTA 2ATEA 1T8RA 2OCYC 3I34X 1SKUA 5FUXA 4E22A 2AZMA 3CG4A 3IX7A 4MVCA 3DXYA 3NONA 3BORA 2AW3A 2PKXA 1V48A 5DW3A 1U0BB 1NR1A 2GNOA 2B4TO 5TY0A 1TRKA 3ONWA 3WB2A 1J8QA 4ESOA 4UATA 1QQ5A 4YQYA 3TDNA 4D6PA 3DMNA 3LCMA 4XPZA 2YBEA 5KYUB 7MHTA 2YJ3A 3U4DA 2WSYB 4XGRA 2NU9B 3L7KA 4QDJA 2P9BA 5J63A 4GGOA 1SD1A 4K05A 1NI3A 4OEHA 1VB5A 1P6XA 2AXEA 1EE2A 1X7YB 3D5EA 4EEKA 5FFMA 4J3NA 3MWFA 3QOYA 1VJ5A 3LFTA 2A4KA 2IYWA 1MVNA 1VI5A 3CPJB 2D0DA 3VTFA 1B0UA 5K0JA 1B16A 1H0RA 3DKPA 3O91A 4IZ6A 1K4YA 3MYRA 2J5QA 1AKNA 2Y8EA 3OCVA 2PTHA 4OQMA 3RUDA 4DBLE 2BFBA 4RTKA 3PT5A 4B85A 4FHEA 4K81B 4CKEA 4YJ2A 5IDQA 4UXIA 1OZFA 1E69A 1HC7A 4MRPA 4RLQA 4RY8A 2LPMA 1N9GA 2BY4A 1RKQA 1CR0A 2O7NA 4YAWA 3U3KA 3U1VA 3WIUA 4F4CA 5LA6F 3ZY5A 1GGNA 2P79A 2PLWA 2PO5A 3AEYA 1CEYA 3UC5A 4X64B 1MB2A 2BTQA 1ULTA 3E7XA 2E89A 3F96A 3ZGNA 1LPOA 3PXXA 4CFZA 2R96A 3GDOA 3AEQA 5D01A 2CHGA 4C0LA 2ZCVA 2DUMA 2ET6A 3OMLA 1KMNA 4UZFA 4BVGA 1IZ0A 1TZMA 5CBPB 2AG8A 3CRMA 1J24A 1BYUA 3QUCA 2J87A 1KE1A 3ESQA 1DBSA 2YN4A 1PSWA 2XOKA 5I48A 2I4OA 2Q4TA 2R62A 3W5AA 2GHRA 4CTKA 2R6JA 4MDEA 2XYHA 1XPUA 2V3VA 2AX4A 4F5ZA 1EFKA 2VCEA 1BWRA 3C1TA 1B4DA 4IYRA 5K09A 2C42A 3EIOA 2WU3A 2GLTA 1YGPA 3TZLA 1TM4E 3TJRA 3VU3A 3X0DA 3NUQA 5FBKA 4YEDA 3RUEA 2GEVA 1XZLA 3ZBTA 4YCCA 1SU8A 5HVNA 5FDFA 3Q5EA 2ADFA 3O4FA 1NLUA 4RM2A 4I6EA 4I5EA 5DGDA 2O0MA 5IN5A 3K8YA 3F6PA 1GU7A 4Q0MA 2XA1A 1IHUA 1ZRSA 1ZM7A 2Z58A 2IZ5A 3L1JA 4LBYA 4ZI5A 1RQGA 1W30A 1RM0A 2WJ6A 4RA6B 5IS2A 3DMHA 3V5NA 4X6XA 3DE4X 1XELA 2FR0A 1QC5A 1I33A 2XW6A 3D0KA 1DWQA 4QPJC 3UANA 3JAWA 3KL4A 4ARVA 4HZGA 3VO2A 2OLKA 5FOSA 4ZEOA 5JCZA 4EAQA 4QFDA 1SQFA 1OW3B 3QPVA 5JOQA 2A9VA 2J3HA 2ECKA 1E1CB 1KO7A 4NXNB 3DTVB 4Y6RA 3C8DA 4M7PA 1NYRA 1BXGB 2V03A 3QELB 4RFLA 3BWDD 5FBRB 3W34A 4EM6A 1YF3A 1VMEA 2E6UX 2P4UA 3L7CA 1EFLA 1EX7A 5AR1A 5IT4A 3HKDA 1FP2A 2I4TA 2BMVA 3LDAA 4UEWA 4X91A 1K86A 3IIJA 4TZTA 5EP2A 4WHMA 4XRGA 3H9QA 5JH7B 2YIVX 5EKTA 1ODLA 3G7SA 5HKAA 1QAMA 4RJTA 1QVZA 1UP6A 2EQAA 4GEGA 2BUCA 2B25A 2QLNA 2R8ZA 2R86A 2V97A 4HR7A 1NJ5A 1I3KA 2Z83A 5CFZA 3TLEA 1EGVB 3W8EA 3O3MB 4MO2A 3GLGB 2VUSA 1JA1A 3LC7O 1JPUA 3IR6A 2XWQA 4B75A 1V5FA 2AI1A 1P33A 1GM5A 1OH8A 1PGNA 1O3YA 5KU1A 4XCVA 3NW9A 4MTCA 2VZLA 3SHQA 3X2EA 3ZWQA 4BVKA 3AYXB 5J59A 2RK6A 4TSFA 2FSIA 5EEGA 2PXAA 3A9UA 1CXZA 1FP6A 2CVQA 4I3HA 3W7BA 2F48A 4A8JB 3T7EA 3JAKA 3DAHA 3LUHA 4EZBA 2WC1A 3VZBA 1SKAA 2ZWMA 3GJ0A 1HGXA 2IFTA 2QZPA 2GDZA 1AGPA 5LOVB 1XCGB 5CAEB 1M1NB 1I24A 1E63A 1SU4A 3EQ2A 2HRDA 3JYPA 4DLLA 2DBZA 2V9ZA 1XWWA 2PKRA 1A7UA 1Y5LA 2ZIFA 5BY2A 4YDRA 5IF9A 5L7WA 5JATA 1YTUA 3CB4A 4P53A 2E21A 2HCTA 2X22A 3ESCA 4Q7MB 3TZHA 1ISPA 4BFCA 4JHLA 3I4LA 2EIHA 2V7GA 4COKA 2CDAA 2ECOA 4C9BA 3RU2A 4FYKA 2IYQA 4Z0TA 4JXZA 2GERA 3UKOA 4CT4B 1RE0A 1C1XA 1ZN8A 1R2QA 1QO9A 2WF8A 2N1MA 2H92A 2OBNA 3D7RA 2XMQA 3IMEA 2RHTA 3TLBA 1WU8A 2IIBA 4I9HA 3C5WP 5KZMB 4DMFA 4IFBA 3I6MA 3PHCA 3QKUA 2HRBA 3OM9A 3OZCA 3B13B 3ZU4A 5C37A 4P7GA 4N5IX 5IM5A 1BA3A 3RC8A 3CVXA 2CV0A 4L0QA 4XYEA 2VJBA 1B93A 1JJIA 2NLOA 4FMPA 4JX8A 1CFZA 1E1CA 2O3QA 3GLQA 3I52A 3KLMX 1HK7A 2BMFA 4EMTA 1QRAA 2P68A 3OPQA 1XLVA 3E1SA 1CIPA 4CF3A 1CQJA 3RS0A 1DG1G 1XRNA 1DCFA 4K28A 3D8BA 1LKZA 1O03A 2O2HA 4GC5A 5CT8A 3UT5A 3GJZA 4BMZA 4CKBB 3CE9A 4GZMA 3RYHA 3EY4A 3M70A 2YIJA 1RWBA 4RY2A 2C1ZA 3I64A 3EEFA 4TS1A 2PSHA 3LNTA 3WKEA 4RADA 4U2CA 1JSCA 1MO5A 2GNPA 1D4OA 1NXQA 4S35A 2HHHB 5GM2A 4E33A 2BM0A 2D1YA 5GIOE 4LWQA 3JR7A 5B53A 3WK6A 3ICWA 2Q50A 4GLFA 3CW9A 4KRXA 5C8XA 3JQBC 3BSYA 4P82A 1FYEA 1S1MA 1S8NA 2HRQA 3CTMA 3ETNA 5LQNA 5J58A 3KCNA 2VSXA 3S2SA 4HGRA 4L9AA 4LI0A 4U8HA 2GBLC 4HYTA 2GA9A 1O5TA 1O6ZA 2B5OA 2W2OA 5AM5A 1WA5A 4HX5A 1X86B 3IV7A 3OT4A 3Q3HA 4D8VA 3KZOA 3FTEA 1V26A 3ZCRA 4L6IA 5KKNB 4RKFA 3ZE7A 1EI9A 4JYBA 5M04A 4GE0A 1Y1QA 2GX6A 2UZIR 4AVYA 3OCCA 2G83A 4FHZA 1KFEB 2WUGA 4CIXA 1EXDA 2AOVA 3MRTA 2JFVA 4RMGA 1NVTA 1TCBA 2R8XA 3EUAA 2AZ4A 1G3UA 5KVSA 1PWEA 1YCDA 2B9VA 3PXEA 2GZMA 5IVPA 1DU4A 4WWHA 1EB9A 1N8TA 4NXMB 2FW9A 1YZQA 4RELA 2Q9BA 2W43A 4DLSA 5JCOA 5JS2A 1YRLA 4E14A 1LZKA 1WHSB 3R0ZA 1ZW6A 2G0AA 4HP8A 4ZXPA 4A2CA 3REFA 4L5BA 1PGOA 1D0SA 4BMVA 4MQ4A 4H3VA 3DDSA 1XGKA 3AU8A 3AI3A 1OXUA 1MNQA 1DBPA 4RSRA 4ZI7A 1JW9B 2Q5LA 3EFEA 2ZKIA 1E94E 3OIWA 2EBHX 4GM1A 1SVIA 4IDCA 1QX4A 3EVZA 2XNSA 4WERA 1NIPA 3QEKA 2CUTA 3WRWA 4DSUA 1JEEA 2YJNA 3RUIA 3M3HA 4FSHA 3A9WA 4PANA 2GS9A 5TPWA 1UMBB 1OU0A 2OCPA 2HJWA 2NUPA 2FXIA 1F0KA 5IRCD 3E8MA 4GI7A 4TYPA 3WO0A 1CEXA 3F74A 4EI9A 5CG1A 2IS1A 1GITA 1V47A 1Z0JA 3E58A 4DJDC 2X0IA 1WDMA 2OUKA 5G0VA 1A4XA 2R4TA 1JFFA 4J6EA 3QY0A 2G9UA 3RSOA 1PUXA 2Q4EA 1IQUA 1W52X 2OK8A 1GG8A 4M76B 2ZWOA 2PBFA 1ODCA 4BLWA 2C4WA 2OV2A 3AR4A 3VR2D 2W4QA 3CZ4A 3K70C 4AUMA 1FSPA 1KO5A 2JIMA 4ZVLA 5CCXA 2NUTA 4HDCA 1JQDA 1T0HB 2I9KA 4BDTA 1JLMA 2ERYA 2NTYC 4URHA 2IBTA 5KI6A 4AP9A 5JECA 1JT9A 5A5DA 4QG3A 1UDBA 2HTEA 1CUUA 2L17A 4PRYA 3V33A 2QX6A 2DPGA 3QKSB 1TIBA 3S5JA 2R1VA 2VPTA 4ZVOA 3P2EA 2Y77A 3E22B 2R4UA 1W94A 1HYHA 4NYJR 4YONB 1VDMA 1H05A 1T9GS 5KNCD 2DQ4A 2VA9A 2PSEA 2QD1A 3UXEA 2WYVA 1NJGA 2D5CA 5FWAA 1GLVA 2C82A 4BFWA 3G9QA 2CL0X 4CN9A 4HFMA 3B1ZA 5BWLA 2XI4A 3SQDA 4GOND 4WD3A 2FOLA 2NSHA 2PPLA 4BC1A 4C22A 5L3QA 5C0OE 4ZQIA 5TJHA 2P4SA 4EJ0A 3KLNA 5AK5A 3LMKA 4BLUA 1VFNA 2KBEA 4BPBA 1NLFA 3THSA 2BFFA 1EBUA 2VPPA 1QZUA 3BXEA 4IWNA 3F46A 5DMXA 1K5DA 1ZLYA 2LWIA 5KOHA 1AGYA 3OF5A 5KX5F 4TWJA 1NV8A 2O2SA 2YWRA 3B9QA 1O95A 1JH9A 3HSSA 4HG2A 1NHWA 3AY0A 1WKBA 1JGTA 1GVNB 4LNAA 1Q0PA 2WIFA 4U5XA 3THYB 1CERA 5TV2A 4RMJA 2ZYDA 3UAVA 4QOIA 1TJ4A 2CGEA 3LY7A 1WZUA 5FBLB 5FTJA 4BASA 3QRWA 4IV0A 3GEEA 3OPXA 4MK4A 1VKNA 1I2ZA 4REOA 4GUAA 3ZOKA 4MWTA 1XP8A 2V74B 4RK5A 2W6CX 5LYJB 3M1AA 5GAJA 3EZYA 3NP7A 4P3PA 3V2HA 3W0LB 4C3ZA 3ZW7A 3TIXB 4BFVA 3WYEA 2MMCA 5E8RA 1GQRA 2I29A 3Q3CA 2D2FA 3GLKA 5CLHA 3LT5A 5DU2A 3DPSA 3GUYA 4OAQA 2IZOA 4FOOA 1RRVA 4KAFA 4FB4A 1UBUS 4M9XA 3GRAA 5AW8A 1WUKS 1YIOA 4ZREA 3RROA 1EWRA 2PZKA 2QYTA 1J1UA 1Y9JA 2AR0A 3D4LA 2V8BA 2H8GA 1W5BA 2Z5GA 1SPXA 4Y6GB 5LZ2A 5B3JC 4FGUA 5FWDA 3ZQ6A 2I87A 4E1VA 3RU7A 4P7BA 1E5QA 1OAAA 4ILKA 1MJ5A 2J9ZB 4C20A 1KTIA 2BFOA 2NZVG 4AO8A 4OP3A 4KC0A 5IKMA 1RTKA 3OQHA 4YYZA 2PX6A 4MV9A 4RE6A 1IG3A 3PFHA 1G3QA 2VNKA 1D2EA 3FYDA 2F55A 4Z4GA 2NG1A 3RFXA 1QGUB 1Z15A 3JSAA 4MS4B 4F56A 3TVYA 5KNCH 3TECE 4E6PA 4JOBA 1RP7A 1JN0A 1TMOA 3ICPA 1Z83A 4PLGA 3HXKA 2WJAA 2RGDA 3DMGA 1XROA 3OLYA 3NTXA 2X41A 5DF1A 1F0YA 2A1TS 4NEGA 3ZGLA 3QWBA 1RW4A 2AI3A 3BTVA 3QXCA 2Q0XA 2DLNA 4RH0A 3ROGA 1HT2E 1WNFA 2W2NA 3ZDXB 4DLYA 2WK1A 4U6QA 4FFOA 4IW3B 5ALIA 3CVWA 4A92A 4LV5B 5C80A 1PR0A 4IIUA 2TMYA 1R0CA 4ZAGA 1YB7A 4CCAA 3QE9Y 1CRWG 1FB5A 2P3OA 1YRHA 1Z28A 4EY6A 1DFIA 1JRLA 3MOGA 3UFXA 4Y2YA 1UEXC 3DDNA 4QKQA 4DBZA 2YWDA 4HL6A 1ZWLA 2X9NA 1JFLA 4ML3A 1PEDA 1Q14A 2YFKA 2XSZA 4LS3A 3U4MA 2GF9A 3HHEA 1S6YA 1XMSA 5IAJA 1JHUA 2X1VA 3FTQA 2EQBA 3DZJA 2WV7A 5EZSA 2QM3A 3UUEA 2ZW9A 4JLJA 1JLKA 1Z6YA 3HSKA 4N5NA 4B6QA 5AFSA 4EQ6B 1YWGO 1E7RA 1PWHA 2QW8A 1KAGA 4FYVA 5NULA 4EHAA 4PHHA 2IU0A 4L1KA 3CONA 1NSTA 2VAMA 2ORWA 3BTUA 2RGYA 3CBGA 4FLFA 4UVHA 3TINA 2R6GA 2AN5A 5J2UF 4I9GA 1EDDA 3C74A 2ZJ3A 1XZMA 1E3EA 2VZ9A 4XGNA 5BQOA 3B9PA 2OTCA 2ZSFA 1JWLA 2XNHA 5L4LA 2OP1A 1IZYA 3S2IA 5AKIA 4BGIA 1J20A 3INGA 4MUIA 1RBMA 4DEXA 4PBSA 3N7AA 1QV7A 2BL4A 2HXGA 3CO0S 1BWSA 1SC4A 5ESWA 1N6IA 2FQWA 3M5CA 4M87A 4FGSA 1JFSA 3L02A 2K4MA 2X6TA 4DA9A 3FFAA 2VWPA 3G0GA 4B7UA 1JAIA 3SGLA 4BXOB 4RH3A 3U31A 4OMDA 2F67A 4D1YA 4ZYTA 4D9EA 1RZ3A 2C07A 2AMJA 4DA6A 4FC6A 4A1OA 1M0EA 5JNTA 2F00A 3ASUA 1P4RA 4MVJD 3H9GA 5CCBA 2KB0A 1LX6A 2ZT7A 4Q9NA 4DCVA 2A57A 3ECAA 4ZIRA 3JQPA 3PZBA 1EQAA 1KJQA 3B9BA 3INYA 3K8OE 3B82A 2E85A 4FIDA 4G8CA 4LOKA 5CT4A 3UV3A 4BLPA 3B1JA 4EMSA 4BIMA 4Z6KA 3BE4A 3B3QA 2BOVA 4H7DA 3PEVA 3OQIA 1JKIA 1KNQA 2AFHB 1C1YA 3EB9A 2F43B 4QJIA 2WWFA 2VP6A 1FUEA 3ANTA 5ADWA 5LOVA 1OZGA 5DGXA 1JTVA 4WBNF 3Q11A 1QO0A 1KBQA 4KQWA 4JB3A 4AG3A 5C52B 1VBMA 1DS6A 1F5NA 1T10A 2V3WA 2AOXA 1YFKA 2AKAB 4RS3A 5I7RA 3KR2A 2R00A 4B3RB 4K40A 3VTAA 1FPMA 2ZR9A 4KQGA 1J56A 1XRJA 4P80A 3LKZA 3V1MA 1WZ2A 2XV1A 2Q5FA 2VDWA 4W7HA 2GPBA 2UYCA 1BFDA 2FW0A 1UKBA 1N5OX 3ABRB 2NW6A 2W2QA 4IDPA 1EFVA 4LK3A 3B36A 2O8NA 4YCBA 2HDNB 1HNXB 4LFAB 1TC1A 5JALA 1J23A 2IVZA 3HDQA 3NBUA 3BAZA 4J3FA 1LPAB 1L7RA 1CS4C 4YC7A 5F76A 5B64A 4MQEA 1JR3D 3PHIA 1K63A 3UHOA 7MDHA 3ZEAA 5E6UB 2OHHA 4MKHA 4LXTA 5A0TA 4J43A 1KI7A 1PQ4A 2GKSA 3RHZA 3K3PA 2VFAA 1FBTA 3WQRA 3PXBA 3GF4A 1ZD3A 1NZJA 1KJJA 2TECE 3MJHA 6YASA 2Q45A 5EUCA 5K7SA 4CGZA 2UXBB 3R5KA 4NMXB 2F3SA 2VEDA 3NAQA 3OEED 1BROA 4E70A 1JXQA 2BFDB 2HSWA 4R6WA 5C4GB 1JI3A 4A6PA 3K09A 3RARA 4B3BA 5KTSA 1H1DA 3TMKA 4BWGA 4DQKA 2Q1UA 2VJMB 4P35A 1KJ9A 2LRHA 5I9LA 2OP0A 3HI4A 4HYYA 4JVOA 4MCAA 5FA8A 4EPRA 4CF5A 2NZJA 1GQOA 4D4GA 1BWQA 1JLLA 1SU7A 3H9JA 4K6FA 3T4PA 2NN3C 3KXIA 3JARB 2DULA 5JZBA 3IXMA 1H3NA 3WGNA 4OXKA 5AKZA 1D4FA 1PFUA 1YUMA 1TD1A 3SWWA 3TLYA 2SKEA 4HDSA 4PRZA 4O4JA 3T1VA 3NC1C 4MR9B 1EHIA 1EVYA 2FZKA 3MLEA 3MQ4A 4OHCA 4DY6A 2YXBA 1CZHA 3NORA 3TZEA 4TOIA 16PKA 4WBNB 3I39X 1VP3A 4DCPA 1RYDA 1LD3A 1F8XA 1QG2A 2IS2A 3WXBA 1J0CA 4BATA 4POAA 2OM6A 3OBBA 4M2LA 5A3RA 2RGGA 2AEFA 1QLJA 2Z2YA 4KH0A 1A7AA 2P2CA 3F9CA 4EQ6A 1VL6A 3SIPA 5CVTA 3FPEA 1ODFA 2NX2A 4YJGA 5A3VA 4JI1B 4AP6A 5MGBA 1A5BB 3UMMA 1VI2A 1E92A 2BV3A 2VNSA 3LP5A 4KO4S 3RJZA 3VR4A 3AF6A 2BBSA 3LY8A 3ZXYA 1EBFA 3KQPA 5FWYB 3B12A 4AO7A 2PNJA 5CLFA 5LIRA 1HL3A 3V7UA 1Y7PA 2G04A 4HS4A 4URXR 1G55A 1RCFA 3HXTA 4QHSA 5DSTA 2DFKB 2DWUA 3HB4X 1U6IA 1SB8A 1YS7A 3L4SO 1HG0A 1DOZA 2HPHA 3IOYA 1G8SA 1X9GA 3KKNA 2IIVA 1WVIA 3GFRA 1DQPA 2QTVA 2X76A 2YVLA 5FLYA 4YAKA 4BKPA 2ODPA 1MTZA 1NX9A 3RVMA 3BWCA 3O73A 2QEQA 5COQA 4LYYA 4OKSA 5DBOA 5IYZF 3RGGA 4WZAA 1Y3FE 4FZ3A 4HQ6A 3ST7A 1G2OA 1G8PA 1V9CA 3O84A 3S40A 2VRNA 3G0OA 4GT1A 1JT2A 2QDKA 1N78A 3AEKA 1HF3A 1Z8HA 2G76A 1KU6A 3HYNA 2XRZA 1F5SA 1RHKA 2MMGA 3N8NA 2XWSA 3OOWA 3RHSA 1FW8A 4PHTA 4KFUA 2D6FA 4A4DA 3CX4A 2LIVA 2GZHA 2X15A 3GIWA 3A6LA 2YH2A 3RSZA 1PDOA 1N2HA 1P4GA 1LDMA 3ZW8A 1ZVKA 2VJCA 2FPPA 5K2MA 2R6CA 4WX2B 4CIVA 4O4HA 1T43A 3LL4A 4YGYA 5F7OA 1NQWA 2DC1A 3B38A 2GPYA 2DPLA 4IQ4A 1T8WA 2DFNA 1OPXA 2PEYA 4AECA 2YTZA 3KDAA 3DOIA 5T7BA 1XFAA 1HE2A 2P78A 5BSUA 1ZK0A 4RD6A 2UYHA 1THTA 1GA4A 2EERA 1FX0A 4PLHA 1QHIA 3ET4A 3P0FA 5EUMA 3F6RA 1ND5A 5AXDA 1Y3CE 2NU7A 4MZDA 5DXAA 2GPNA 2RAFA 4KPUA 2UZ1A 1H2RS 5B6IA 1HTWA 2OCBA 4S3MA 1SQ6A 4RTOA 2FB9A 3H11B 3ZK9A 3H4VA 2P8JA 4R8KA 2IX3A 1KDTA 2FF5A 1WTAA 2KYRA 2R79A 4GVLA 1X7HA 2HB6A 1ATIA 2J6IA 5IT9A 1GHTA 1FS5A 1KOFA 1RC1A 2PX8A 2W71A 3H6GA 4MUKA 4P9NA 3PXGA 3KPUA 2HXSA 4JODA 5CMLA 5SZHB 4CG0A 2R48A 1I7SB 5DBGA 4UAJA 3C3EA 2C9YA 3IQIX 4HKTA 1FFXA 3WADA 1YHNA 3Q6MA 4DBLC 5CB4A 2FZVA 2QL9A 4I4TB 1X7DA 2A9PA 4LHSA 2H3HA 1DJNA 1LSSA 1M54A 1OBCA 4M86A 3TMYA 2F1JA 2VXBA 3K1ZA 2WRZA 5MN4A 3LXUX 1RDFA 3GQBA 4KQ9A 4MAFA 2KWIA 4PC6A 2XDAA 4J9UE 4Q39A 4TKUA 5AI5A 3K09C 3P0EA 3ADKA 5JEDA 1KPGA 4B9AA 3S27A 3VPFA 3K0CC 4RD4A 5CFQA 2CUKA 4MR9A 3CN7A 4YRRA 5JLJA 1UBLS 4XLTA 5DB4A 1V39A 3IHLA 4RX1A 4YLGA 3V3KA 4D3XA 4OHRA 2IYRA 5IMBA 4OBBA 4MQFA 1ZJWA 4QRHA 3RHTA 4U9UA 2IBMA 1EDEA 3DXXA 5FAXA 4N49A 1S7GA 3O4VA 5CJ2A 1HORA 3VO8A 4RMIA 3GPCA 5CVUA 3GC6A 2AE1A 2Q6LA 5EIHA 1YR6A 2PLFA 3OZVA 1W7AA 1FA9A 4OQFA 1RXUA 1LNZA 2X40A 1ZU5A 3CLSD 1E2EA 1QF7A 2RGCA 4LDRA 4YMHA 4G4GA 2QGNA 1UJBA 4KUEA 4RVCA 1PG0A 2W2XA 3BQ9A 3KZKA 4EYSA 3MGCA 3MHPA 1A76A 3QFRA 2YIMA 2JRLA 4GIBA 1F20A 1EP1B 1M6NA 1NZFA 1LK7A 2A0XA 2XMGA 1XQVA 3QVTA 5FTWA 3KDSE 3G0IA 3W6OA 5ADHA 5JCJD 3QEBZ 4AKIA 2W6MA 4J75A 2RFLA 4WIAA 2DY0A 4REQA 3WLEA 1JDPA 1PFQA 1R74A 1JE0A 1K2WA 1VGRA 3BKWA 2BBOA 4C4YA 3DDZX 3KV3O 4XDHA 4MQ6A 2I8AA 5ARDA 2V0NA 2QVGA 4YJ3B 2GTHA 1EFVB 2C7BA 2GSDA 3F47A 3DNFA 5E3HA 3CLKA 1E77A 2X5XA 4AZ0B 1SXHA 2IQ5A 4Y7DA 5IHPA 3F78A 4XFJA 3IBTA 2C57A 1VKHA 3V2UA 1QQBA 4H2DA 1I9GA 2BFEA 4I1PA 2X4IA 1SH7A 3S81A 4L95C 5ICEA 2BDEA 1U1IA 3W2EA 2QW1A 1M5UA 1OGYA 4PZEA 2RGXA 3LWDA 1LBHA 4MB2A 1NBEA 4RKRA 1I80A 3VSAA 2X5JO 1C7RA 1K6JA 1D6JA 2Y66A 1Z12A 3P32A 1FP4B 3UHAA 1JIJA 3ZG6A 1O94C 1X87A 3Q9SA 2O8EB 3RYIB 1RBYA 3HJTA 4FJ0A 5JVDB 3GJ6A 1UK6A 3IUBA