4MK4A

S197c variant of human ferrochelatase.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCCTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title S197C variant of human ferrochelatase.
rcsb
source organism Homo sapiens
total genus 132
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mk4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mk4A01
3HCRA 2PNJA 2XVXA 3AQIA 2JH3A 2XWSA 2QD5A 1TJNA 2Q2OA 2AC4A 4MK4A 4F4DA 2PO7A 4KLAA 2Q2NA 1HRKA 2DJ5A 2HRCA 2XWPA 3LYHA 2AC2A 3HCOA 2C8JA 2QD4A 3W1WA 4KLRA 2QD3A 4KLCA 2XVZA 1N0IA 3HCPA 1QGOA 1DOZA 2PO5A 2QD2A 1C1HA 1LD3A 1C9EA 2Q3JA 2XWQA 1L8XA 1LBQA 4KMMA 4CCSA 3HCNA 2XVYA 3M4ZA 1AK1A 2HK6A 2QD1A 2H1VA 3GOQA 2H1WA 2HREA
chains in the Genus database with same CATH superfamily
2H1FA 3P45A 4PC1A 4EB8A 1A95A 1TJ4A 1M8FA 1FL9A 1Y9JA 3EYWA 3HKDA 1ZH8A 1H2FA 4LZLA 4FFVA 1G0OA 1RTKA 2DT8A 2FK7A 3F5FA 3M5DA 2Q4TA 3PS9A 2JAUA 5CLIA 1QTNA 4CE6A 1D1TA 3F6YA 2OAP1 3AIIA 3MTJA 1X87A 3R5JA 1ATIA 2AOWA 4BJ6A 3A7DA 4HOYA 4M1KA 3P0FA 1NUAA 5CA1B 3COPA 2QM3A 3RAFC 1RKBA 2XNDD 3EMDA 4C22A 3FBWA 1E77A 1EFCA 1TRHA 2F3RA 2Q1UA 2I2AA 2PXXA 3AY3A 4QOFA 1EG7A 4ZOCA 5IF9A 2WF6A 2UZ4A 4PRYA 1BCSA 3FKSD 5KMGA 2V6MA 3I1YA 3VKHA 1MA0A 5JARA 4ND8B 2WVJA 1W29A 3DWIA 2WABA 1M8KA 1IAVA 1NBHA 2RHLA 1G291 1USIA 1I0LA 2XNJA 2Y77A 3T4EA 3JQ8A 2ABWA 2K5UA 4MWZA 5DHSA 4KV9A 2BIFA 1G3UA 1WOMA 2R85A 3EZ9A 3H7AA 5AKYA 4DJAA 5JD5A 1CIJA 1IBSA 2VH1A 2VK8A 4G5YA 1K86A 3T3EA 1J8QA 5GJWC 3JWJA 2QTAA 3DOUA 3I9V6 3U7GA 5JSZA 4R7TA 4C29A 2PRSA 5FWXA 1TM3E 5TMEA 2DTXA 4H3VA 2HLHA 2O8BB 5CYFA 2F9FA 3CLUD 3IEVA 3SCZA 3F7NA 3GFSA 2HV9A 3LT0A 2LGJA 3GFOA 4YACA 4EW1A 3N2ZB 4NJEA 2ZSDA 3PGMA 1UM9A 3HCEA 4R3UC 3P2EA 4ROSA 5LQSA 5IVDA 1KARA 3H2SA 4PSDA 3CT4A 4CQMA 2X3YA 4DNFA 4TWJA 1Z2AA 3O3CA 4OP1A 5CEFA 2IYAA 2PRJA 1FP4B 4GE3A 1EFDN 2H16A 1ABFA 1PS0A 3ORFA 5THKA 3SYKA 3W6PA 2ZUEA 3HR7A 3JRNA 2Q5CA 2HK9A 4JCCA 2D1FA 2QSZA 3D6UA 2OB2A 1N8KA 2KLBA 3Q8XB 1N92A 2WMNB 4G2TA 5AI6A 3DC7A 1P1IA 3GUUA 4UTVA 1T4GA 4HZGA 3UHPA 1U65A 5K0TA 1RPNA 1LBHA 2WLTA 4HY3A 3WFJA 1HX7A 4WBNF 5WRFA 5F51A 5IBPA 1KWKA 4MUBA 2VTKA 3PV0A 2J7PD 3E05A 4ZDJA 1B6GA 1JS1X 2XWQA 1V7CA 3SF0A 1AS3A 3I9OA 4C7VA 1Z06A 1GGNA 2VSOA 1TZMA 4P6VF 4KLNA 4OK5A 3P0RA 1BFKA 3DC2A 4WOKA 4AURA 4ZOQI 4C2TA 2J67A 2BI8A 1EVJA 2A5DA 3FWHA 3B1KA 1QWSA 2DCUA 2OCGA 5CG1A 1LSUA 3S99A 1JH8A 5A9TA 3WLLA 1YU9A 3KALA 4QO7A 4TWBA 1M6HA 4EELA 1T8TA 2XV1A 3O0DA 3DPIA 2ZBEA 1MP0A 2HA5A 4HZIA 2OMKA 4XVQA 4YX9A 3THXB 2FZVA 4OSOA 4RGYA 1HNZB 2XW6A 2VF7A 2PL9A 4IVNA 1GRCA 1JKXA 2H11A 3U31A 1IG3A 1FX0B 1CY7A 2IS2A 4AMGA 4V1CA 4RHYA 1FU4A 1YQTA 1N3BA 4OYRA 4I5EA 2EJCA 3KB1A 1T8YA 1SBYA 4N8DA 1XA0A 4YMTA 1Z4IA 4WEOA 2VUTA 2ZSUA 2LUOA 3EB9A 4H0FA 1GU1A 4KAJA 4BGUA 5FPPA 4MW1A 1WD7A 4KQCA 4FYXA 5C8YA 4YXFA 3OX3A 16PKA 2YXDA 2YJGA 3QUTA 4GZMA 1U8XX 1W85A 3CH6A 2YFQA 3H19A 3IE0A 3NJ8A 4TL8A 2ERYA 5AJUA 2HOQA 3VNQA 1KI4A 2XNDA 5JXGA 1E89A 5F2KA 1I2DA 2DKFA 1BMFD 2ACWA 4UEKA 1FRZA 4FFPA 4PQYA 3FKSA 2YZKA 1UJBA 2GZRA 3C6XA 4JL8A 1K0FA 4NR0A 4TWZA 3WGLA 3OQIA 3ZUPA 4DR4B 3NBXX 3LO8A 1FNDA 2WM9B 3K6JA 3UWPA 1V8ZA 2OQRA 3CNOA 2YJ3A 3ECSA 3ZW8A 4DPLA 4MUKA 1OPRA 3WLAA 3WK5A 1A8SA 3VU9B 3ZV4A 1AMNA 2OYSA 3OHPA 3KPWA 3NTLA 5BOSB 3CF0A 2FX3A 3BFVA 4DRZA 2XMCA 1WY7A 4N6GA 5LP6B 1GLNA 1YB5A 4W99A 4DG8A 3MTBA 2VZEA 3I64A 1NP3A 4LJSA 3WB9A 1TRKA 4EY3A 1T25A 4HWPA 1IN1A 3HB5X 5C0OE 5AVQA 5I01A 2OHJA 3VPBA 3JQ6A 1WL8A 1US8A 3A06A 2NT3A 3Q5EA 5FPQA 4IILA 2XVXA 4KI7A 5KYWB 3NHAA 3ZDZB 2YJ5A 3TSOA 4Y2JA 4UDNA 2Z8ZA 4CPDA 1XELA 1E4EA 5K3CA 4G41A 3OAAD 2YASA 1II8A 4PLWA 3ZGNA 3M3PA 4PIVA 1UAAA 3GZTB 1SC9A 5D7NA 3OT5A 2N47A 2F9MA 2J1LA 5A7GA 1MFZA 3KNZA 4A16A 5HK8A 4DG9A 2ZZNA 5CDHA 4K0KB 3VTZA 5LXTA 5IJ9B 1NNSA 1RBYA 2H2GA 4C3OB 1SHKA 4Q82A 4C4OA 1LTHR 3I8SA 3L7BA 4RA6A 2G9VA 4XPIB 3TQHA 2B8JA 1L5FA 4EVQA 1YNSA 5IM4F 3LRTA 3D7LA 4I9UA 3L8DA 5LZ7A 1YRWA 3QYPA 2J7PA 5JPDA 3IPCA 4DNXA 1TEHA 1P7VA 5HM8A 4U7FA 2BBTA 1Y1KE 3FX2A 1I7QB 4MQ6A 4OGFA 1CUBA 1NR1A 2IJGX 2CL5A 3FAZA 3UMYA 4MQBA 4YRQA 2ZJZA 1SCIA 3PE3A 5C1OA 2DWUA 1ZITA 1DC6A 2XWPA 3HCDA 1DG3A 1OXKB 3EGXA 2IE8A 2H18A 2X0IA 4N0PA 5AESA 5AM5A 2BI7A 2G1AA 2VHQA 2H85A 3C3DA 3KAPA 4I46A 4XXHA 2W6QA 1H22A 1ZI9A 2D0OB 3DZBA 4O2AF 621PA 4ZANA 2I1VB 1XCOA 2Y1OA 1JILA 3TZLA 5ICGA 1UK6A 3RUHA 2PMEA 5KCMA 1WKCA 4MYDA 3RC9A 3T5CA 1DB3A 4YT8A 4REQB 3IOCA 5JH7A 1K08A 4CKEA 5JJKA 2WILA 1YBMA 2JGLA 4U7WA 4WBNA 4QDZA 1L4EA 1NHWA 3WBFA 4GRIA 3ED5A 3TLAA 1I6WA 1KMHA 2FFHA 2H2FA 3D2CA 3F3KA 3KOXA 4FYVA 3RSLA 5JQGA 1K97A 5MFZA 3AR3A 4L0MA 3SG0A 3KYJB 5ETJA 3ZI7A 1SIWA 2JCBA 5JWOA 1HT0A 4MPPA 4LJAA 4OMCA 1RLOA 1QYWA 1RIIA 1G8SA 1U1DA 4AICA 1GR0A 2FUG1 3N8HA 3HNOA 2R68A 1JHDA 1UBJS 3DXZA 3R4CA 4OXQA 1QH8A 1DAEA 5IAEA 4K9DA 3DHEA 4I1VA 4G07A 1S2MA 4U7PB 1Y1TA 4M1MA 2C96A 1M1ZA 1Y3BE 3U44A 3TKLA 1T6XA 1B1CA 5TT1A 3BRWD 3PUVA 1LX7A 2F1OA 2Y0EA 3BGVA 3E15A 2HXYA 1MAVA 3MAJA 1JF8A 3MYYA 2C57A 2AXEA 1J2RA 2XOEA 2AMJA 4AN0A 1YBAA 3RJ5A 5ALJA 5IXJA 2F1HA 3DB2A 4A73A 5K0EA 4UUMA 3DJFA 1QCYA 4EVSA 4TUYF 3ZIUA 3K53A 4ITVA 2C99A 1Z12A 2H9YA 4NZPA 5GINE 1SQSA 4CLRB 5LL6P 1F17A 3FYDA 1NI3A 2FP3A 1YTUA 2XJ9A 1SFRA 4YAWA 3IV9A 4A91A 1CJTC 3AVOA 4J1TC 1Z4LA 1KI1A 2AF4C 1J25A 1MJHA 4IQFA 4LHSA 4LZPA 2EX4A 3N39C 3OAAA 1UEJA 3EGVA 3IUNA 1MB0A 4EW2A 3Q88A 5GY7A 3VR6H 3I73A 2EZUA 3IHKA 4DIUA 1LDMA 1WU8A 1UK8A 3ZTWA 5T67A 3VO8A 4HUQA 2A0UA 3RLIA 4DMKA 5BYAA 3THWA 1K7YA 1ITZA 1R4NB 2AFHA 2F7SA 1Z9BA 2NAFA 2XZPA 3M82A 4I19A 1G98A 1HT3A 1KEVA 2J0UB 2QN6A 4FEGA 1RKUA 4FDVA 5ILOA 2E6UX 3H4IA 3PXXA 1Q5PA 1R88A 5BV2P 3C3KA 2ZUTA 5JJCA 2NWQA 2QXTA 2SNIE 4JBWA 4ZJPA 4OLJA 2ZRHA 4L4UA 4WLEA 4A0QA 1J0XO 1TQDA 3CRVA 1CQIA 3C15C 4X45A 1HH4A 4YUXA 2HBQA 1R0RE 5I4BA 1ARZA 3T9AA 2IYXA 4R1LA 3VGJA 4UTOA 2INGX 1TFUA 4QSHA 3G0BA 4IHJB 2I3ZA 1AHIA 1VHTA 3IO3A 3T7EA 2FN4A 3UK0A 1QCCA 3L79A 1VHLA 1E60A 3ICCA 3IHTA 2PKXA 3H1GA 1ULSA 4MQFA 1JVBA 1QE3A 3EWAA 1LLDA 3OX1A 3D02A 2V97A 2V4MA 3OO1A 4GF5A 3DCJA 2AWOA 3E7PA 4UCXA 1PS9A 4O02B 2X4LA 4AZ0B 5IM4A 3UEOA 2BMVA 3FZGA 1UADA 4MITA 1I4TD 4Y2UA 1O87A 4MVJE 1YOVA 3NCTA 4RVCA 3KWLA 1HDIA 4MAAA 2BW0A 5TQVA 4F12A 3GFRA 4ADSG 2W2VA 1N7GA 5AM1A 3ZBTA 1X1SA 2PGAA 3UAYA 4AKGA 2FZKA 4AVYA 1S2DA 3GT0A 3LQQA 4L9AA 2WSSD 3C3XA 5DV9A 1SXJE 2OCBA 4LBWA 3KLMX 4UBIA 4D3YA 2MHCA 1SVNA 4EKDA 2C2OA 3BJRA 2GTPA 3G0IA 4FYWA 4G84A 4P80A 1FRQA 4LCEA 4OU4A 4O2AA 4ZVVA 1WZEA 1ZJYA 3DVAA 2PGIA 3W5DA 1GY8A 3V8PA 1FU8A 1CW2B 3BRWA 4LSZA 2V7XA 1SBZA 5U4QA 3OJOA 3M5PA 4DMLA 1B0PA 2DHDA 2J32A 4JJKA 1CEYA 1QK4A 3IAS6 5F21A 4AUKA 2GPYA 3NS7A 3QHQA 1PJ8A 4DMRA 3J7AC 5ICEA 2DFTA 2UUOA 1PKEA 3WHKA 3Q41A 1C4XA 5K8VA 1E59A 2EBWA 3G79A 3LKBA 1O97C 3QVGA 3KXKA 1JIJA 1AKEA 3E58A 4GMDA 1A72A 1PZMA 4DT1A 2PUFA 1YOBA 5DEIA 4GOND 4L74A 1BDHA 1A1VA 1NLFA 2REQA 4OXXA 3WYCA 3BS4A 2NV6A 3R7WB 1BD4A 4FJ2A 3ZWPA 2O50A 1I4WA 3AEQB 1RM5A 2AOUB 1A8PA 3EJ6A 3LHFA 3NT5A 3HL4A 4KQIA 4PTYA 4WXPA 1XWIA 5E6UA 5TGZA 4AMVA 1UBGA 2CYBA 5AKKA 4EYEA 1JU9A 4IPTA 2LR0A 2ZDHA 4D92A 1P72A 4CW7A 1AUOA 3G89A 3SHQA 4MZDA 3PFWO 2DXIA 2BBWA 2G6BA 3L1HA 3MB8A 1CUCA 5BW8A 5TGDA 2WU4A 4O33A 5JSUA 1D3AA 1V26A 2BCEA 4TUYA 5U1PA 4U2FA 3T3OA 1AK1A 2V3CC 2J0QA 2J07A 3ILYA 3A6FA 3IHWA 3K6SB 3IAUA 4WADA 5AI4A 2H1HA 4XGNA 1VBNA 5GV7A 1HQKA 5EZYF 1VBMA 1DIAA 1GSHA 2JF0A 2QVXX 3KPUA 5JNVA 3QYFA 4F92B 1W36D 2GCOA 2RBEA 2EKPA 4JK3A 5IC5A 2IS6A 4BFVA 1D1SA 3EGIA 2CUNA 1NJ1A 4O4IB 4YI5A 2JA2A 2QMQA 5LMUB 1NMXA 4EF4A 4KHPB 4EHNA 1IY1A 2P9YA 3QKRA 3JASA 4R8KA 5DHAA 3V80A 3E7DA 4HAVA 3VKVA 4RY0A 1C9JA 5BSEA 3JZIA 1T9BA 2ZSBA 3EK2A 3T7CA 3PFHA 2MR6A 4CDMA 2I6XA 5FFFA 5C7IO 2R1ZA 3NTXA 2B69A 4LECA 1EVYA 5B6IA 5I7HA 3ZD6A 2VZLA 2PNFA 1PR6A 1JQAA 3FNQA 3VJMA 1DIGA 4ER7A 4XWKA 4US2R 4GHWA 2WSSA 4Y2YA 3ZCPA 1Z28A 1ZNXA 3BFPA 3ISVA 3PC7A 1PL7A 1NMQA 2DUJA 2F6RA 2POQX 1PR2A 3GT3A 1YS7A 4QUAA 3ZU4A 3WA7A 2P6MA 2J3DA 1O08A 3EZYA 4EITA 1CV2A 1L7QA 4DJTA 2ZRJA 4AJLA 1NBMD 5TEVA 3BGDA 4PC2A 1UZUA 3NBFA 1GG9A 3VQTA 2XUAA 3F1LA 1S1CA 4EEZA 5H8WA 4BWVA 1KDZA 2I2XB 4TVOA 4D9HA 1TMOA 7ADHA 2O0MA 3WLEA 4AAYA 3GD5A 5ELXA 4ZI2A 2V7BA 2YN4A 3WNCA 4EUHA 1U0TA 2P4SA 2EJVA 3HM2A 2VTBA 2IU3A 3CTMA 1LRJA 3G7UA 3P9PA 3N7AA 1SVMA 2JFXA 1XV5A 2OLKA 2ZIVB 1OLSA 2REXB 2VHXA 1HNNA 1QVWA 2GUGA 1E3TA 4Y1FA 1UP4A 1C30B 3IBTA 1KAGA 4PX5A 3QTTA 1NYLA 3MWDA 3O1IC 3P9CA 1I3NA 1PEKE 2EEPA 3KOYA 4IIXA 4QFCA 3PNLA 2CNKA 3CF4G 1T3LA 4X1IA 4ZREA 3PSAA 1M1YE 2P9BA 4KVGA 3WYFA 4YCLA 3SU8A 1RWQA 4NZYA 1I2CA 4PC3A 1UMKA 1SCDA 2O1XA 4DLWA 1W59A 4ZIRB 3OIUA 4MR8B 1EA5A 4WLNA 1V4BA 4J0CA 3VSCA 2FMFA 1JJAA 3KR2A 4IQ4A 4S2EA 4D8UA 1YAJA 3KJEA 5KVVA 3B82A 5IX8A 2QR2A 4JYZA 1MVLA 1U2TA 2GJ4A 3B1ZA 5EE1A 3LPMA 1IPFA 3S70A 4GR5A 1VOTA 3SQWA 1UH5A 4MR9A 3UBMA 4H35A 4L0DA 4E5UA 5JAHA 3FFXA 3N7TA 2DWOA 3H5TA 1D8AA 2P2LA 4XWOA 2CSXA 2HTFA 2QVBA 1YI8A 2Q29A 3GEMA 3WLKX 4LYFA 1X0VA 4LXUA 4CM8B 3I04A 2GB4A 3W5VA 4AXXA 5DCYA 4UU8A 3CZQA 5HJ2A 1E32A 4OHYA 5JAUA 1Y5RA 3A27A 2CJWB 5EP2A 2ZSAA 1F5SA 4AMUA 3QPAA 4UHHA 2C7QA 3FPFA 1GPYA 1HY3A 2VKTA 3N2GB 1RFLA 1Z8FA 4A6DA 4UTPA 2PSSA 3N2EA 3M3HA 3O38A 8ATCA 3WB2A 1R64A 1USWA 3CR3C 4YLEA 3YASA 4POOA 3IQHX 1D1QA 4D4LA 4IIGA 3NJ4A 4BLVA 1IOZA 2OVFA 4MUEA 2QN2A 3T0FA 2O6HA 3VKGA 2B8EA 3GQBA 3TIGA 2H00A 1PE0A 2WNSA 2WSIA 1V9LA 3BF8A 3KB8A 3GY0A 3L18A 3LOQA 5AXBA 3VISA 4AJJA 1D0IA 2FI1A 4IXMA 4DYVA 4YMHA 3T99A 1IG0A 4B3BA 1P2VA 1A8HA 2I67A 2JFZA 4P32A 2IEIA 4ZVMA 1Q2UA 3PA6A 1QP7A 1CHDA 1K75A 3R9WA 5EN4A 1TYEB 2R8PA 2FWJA 2GTIA 3PUZA 1VB3A 4HNHA 3N70A 5EZYA 1YRLA 2OV2A 2CLIB 3FYUC 4M7WA 4RXUA 2WYVA 5FV7A 1HSZA 1U81A 1FYXA 3I5AA 1UP7A 5ENDA 2P8SA 2WUWE 4KQ6A 1P0MA 3GFTA 3V2UA 2CY0A 3EXFB 2A59A 1RI5A 1E0KA 1GRNA 3RS3A 3R3HA 1NBMA 1ZL2A 1D0SA 2ORYA 2EX1A 4D43A 1DX9A 2ZJ4A 5JDIA 2FX2A 4J9VA 2KLHA 4H1VA 3TQFA 4LTNA 4CF6A 4GP9A 4ESOA 5I7VA 1CSEE 4WN3A 1MZPA 3KD3A 4JL6A 3S5JA 5C32A 2EFDB 3E9RA 3NBKA 3UPUA 1IQRA 3DEIA 3EAFA 2GNAA 4HQKA 2DPMA 2PZMA 1JLMA 5FXMA 3U3ZA 3EWSA 4V0OA 2I3GA 3PENA 1IM2A 4DIMA 5JCPA 4IV0A 2E21A 2ODAA 3GCXA 1HYHA 3KQPA 5DN6D 1Z4MA 3Q3GE 5JJBA 2FSUA 1Y5MA 4NMMA 1KY2A 3T5DA 2XUGA 2P9HA 5ESXA 4FOOA 3A0RB 1IPEA 2OILA 2XITA 1JJBA 2H4ZA 3V00A 5K1ZA 1GQSA 1Y9ZA 3OA0A 4MK4A 2DQZA 3PWKA 3SSOA 4NPAA 4L9SA 1RADA 1UT8A 4IKOA 4RA9B 3SWWA 3LZ6A 5D1NA 5ALXA 2HSJA 4BLQA 5TR9A 2WB4A 1XJ0A 1HE2A 3O5AA 4HAYA 4MWGA 1TW2A 3LKZA 4LISA 5ALOA 3C3MA 3V97A 2D13A 3AL3A 4CMBA 2PFKA 4HLQB 4M21A 4UD6A 3BL6A 3ASVA 3PTZA 2B20A 5YASA 5IJ0A 4CKCA 3GFBA 4MNTA 3RBAA 3T9DA 2GXAA 1DHRA 2DC1A 1E5QA 5CUQA 4BX3A 1A04A 1ESNA 2AL7A 3K9GA 4I14A 5KJCA 4OHKA 3OT1A 3LGSA 4Q7LA 3B12A 1OZHA 1LC3A 3KK0A 3DM5A 5FR1A 5DB4A 1NMEA 2RKBA 5ECDA 3T9BA 4NMHA 4UMVA 5EMMA 3AM3A 3UUGA 1P81A 4RDIA 2C78A 2QRGA 3OCYA 1DKPA 5GWXA 3MG9A 3J81k 4YASA 1AURA 1NTRA 2G9RA 1W1WA 2RI0A 2B4KA 3E8MA 3H1AA 4H17A 2H6EA 4GOLD 4X90A 1OBHA 4PONA 1QV9A 4NECA 4RTOA 4Q9KA 1J1ZA 1Z88A 2EQBA 2N1BA 5ITZB 1TUGA 3MMPA 5CBPB 3CVWA 1E6WA 2A0FA 5C1DA 3A4TA 2LPMA 3Q0EA 4BEJA 4R31A 3QVSA 1A2QA 4JP1A 4NDAA 5EQTA 3VYRB 3G9ZA 4DMHA 5L7TA 5AK6A 2C2WA 5DBIA 2X2OA 3TGWA 3OETA 3DLTA 4IVPA 3I28A 4MPDA 3GHHA 3SYMA 4MS1A 4Q0MA 3WV4A 3VTFA 4FB4A 2RHRA 3QE3A 3UMCA 1O54A 5IN4A 3TPCA 1GPKA 1DO2A 1J0AA 3B13B 3H2GA 3MS7A 5F1PA 1RFGE 3DYIA 4HGZA 1G6Q1 1Y4SA 1CQZA 4YDRA 4BGIA 3O3OB 1JBEA 1ZIXA 4MYCA 4JD5A 1GR1A 1HI9A 4WZZA 2GH1A 4LSWA 1AX9A 3V1YA 4KWTA 1ZC4A 3II6X 1KI3A 2OBBA 4R68A 2IPAB 1E2GA 4B45A 3I12A 4JXZA 1XF1A 2MYTA 3DHYA 4LG1A 3DO6A 2HW8A 2DVMA 2XRZA 5SZIA 2OFPA 1BROA 3DCNA 1ODFA 4RIIA 1G20A 5EIBD 2ESRA 3H6KA 1G21E 2VYND 5DN6A 2ZZMA 1TJ3A 1OE0A 1KTVA 1UJ5A 1X70A 2EL9A 3IP7A 5EA2A 4YRKA 2G9QA 5IWAB 1X94A 3I4CA 3PGKA 2QUJA 3I9LA 4PLYA 3V1TC 2ZT5A 4S1WA 9ABPA 2G1PA 4ZVLA 3O84A 2DHEA 4M87A 1EAYA 1GV0A 2YV5A 3KSDO 5L7WA 1NXVA 1DPGA 2F17A 4G1VA 5DIFA 1WBDA 3AHDA 3PKIA 4RZIA 3FHJA 4A2QA 4ETIA 5GZ3A 3SHWA 2Q62A 3QSYA 1ZGHA 3RC8A 1Q95A 1TM1E 4GRDA 1WKVA 4Q12A 3WGHA 1KYZA 1Z62A 1II0A 3LFTA 5EHZA 2IXGA 1UC5B 4PAOA 3G82C 1JTFA 3I76A 4B1FA 4NZZA 3LT2A 4D4MA 4MW9A 4NEHB 1BC5A 4XOIA 1MX9A 4OX9Y 1JPVA 1TZCA 1E2MA 3OIGA 2BGUA 3FYTA 3OPYI 3RYHB 3I32A 1FFHA 5F5LA 1QDLB 4KIGA 5JS6A 4JP8A 5H3LA 3FYSA 4G63A 3ND7A 1ZN7A 3R5SA 5B3AA 3S1SA 3WMGA 2NYUA 3KEFA 4UASA 3RYFB 1PK7A 2XGJA 1CC1S 3FHOA 1MJGM 3FKQA 2EFEB 1AKVA 3STHA 1L4MA 1TTHA 2VSFA 2W43A 1P0IA 2IC5A 4JGIA 4Y1EA 4E30A 3OQJA 2H4XA 3RYIB 4JXXA 2HSGA 3LXXA 4N01A 2ZTUA 4M88A 1ZD8A 5EHGA 3I37X 3RFUA 5K8LA 5A9SA 1YL6A 3AEZA 1Q0PA 4DLUA 3JYNA 2VF5X 3PQ6A 3SQDA 2ZYHA 1EDEA 3GOQA 2ZJ7A 1OKKD 2JI7A 3K0FB 3L1UA 1IBKB 3JQBC 3QLEA 4P22A 3C87A 1C7EA 4DTCA 2XZOA 5F2NA 1FUYB 2H1RA 4N7MA 1GADO 3ILXA 4OAQA 2Z5FA 4X00A 1ZLYA 1FFSA 1UJMA 1TD9A 2BFPA 1EXWA 3C1TA 3HVJA 2Z2KA 4KJZA 3W1WA 5KOHA 2B61A 4HWTA 1VJRA 3I2JA 2NW6A 2MT9A 3KJNA 4FILA 1JR3E 4QTTB 4JT8A 4YQZA 4DWWA 1TOAA 4L4XA 3LFHA 3K2EA 4DUZB 3WQRA 5A05A 1G9SA 2X2PA 2QQ0A 3AB8A 3HJBA 4RUKA 1YWGO 3D7SA 3FDZA 5K3BA 5TEWA 1SUWA 4PZCA 4FYYA 4TTRA 1U5CA 2CNOA 4BP1A 3BA1A 2OV1A 3HS3A 2FPWA 3CSUA 1RI3A 1T10A 4HDMA 5AKEA 1KI9A 5A1JA 1EAMA 3OMXA 5IJWA 1HTTA 4PW0A 4JL5A 1UPAA 2XGOA 4M1WA 4YRZA 2GYVA 3FFWA 2OHIA 4HEHA 3S29A 5LNK6 4OREX 5CR9A 1HE5A 2CNNA 1J6UA 2HUNA 2YIVX 3H5OA 4Z86A 2VYNA 3BMCA 3EF0A 4W8GA 1L5HA 3WBBA 1HFEL 1XL0A 1XEWY 3G5TA 4E70A 1WETA 1LBSA 4I1YA 3M6FA 3RT1A 1OH5A 3TXYA 3CW9A 3WNBA 4LYEA 3W78A 5EYPA 2WQ6A 2Y1KA 1UBRS 1L5OA 3O4VA 1IDN1 1TCUA 4UCFA 2EAUA 4BP9A 2OQVA 3GW8A 2UDPA 2Z2XA 1KJNA 4DSAA 2FPPB 3P1JA 2G9ZA 5KO2A 1EJ0A 5FFNA 4BNYA 4RCYA 2CZGA 5DBHX 4BHTA 2GBGA 1J0DA 1N6NA 3OZXA 4FUQA 3VNSA 1ODCA 5IN5A 5CXUA 4KAXA 4TLAA 1ZCAA 4FI3F 1K88A 2HC9A 4E5PA 1BN6A 3VPSA 4RM3A 3I30X 1KK3A 1Z0SA 4HYQA 1IVSA 2GM4A 4NXMB 1WD5A 4R8RA 2PE5A 4U7JA 1CHNA 2JLBA 3ET4A 1WKBA 3R9XB 3GLIE 3I9KA 4GI7A 2F3QA 1FTQA 4P7KA 4P4SA 4ZCTA 2RIPA 1BN7A 4Y6QA 3W8EA 1NBIA 5JWRA 1NUSA 1D7OA 5KINB 3QKUA 2WTUA 2JAQA 1P4AA 2ADMA 3ICWA 4OJNA 3PX7A 1NXSA 3IJEB 2BAGA 3CRNA 3HY3A 3OLVA 2GHQA 4JZKA 1BXRB 3N59A 4UQOA 1SQ6A 3KTFA 2FE4A 3GRCA 3LIIA 1OKKA 3BC1A 4QHYA 4FVTA 3ZNNA 1UMCA 4E3WA 4KXFB 4UTZA 4DLPA 1YJQA 3I09A 3R3ZA 3S4YA 1JNYA 3G1UA 3CX6A 3GRYA 1TT5A 4PPYA 1FS6A 1PFUA 1L4KA 1ZAKA 2ZQYA 4PHTA 2C4MA 3NQ41 4XQGA 4D9CA 3K9CA 2WIKA 2JCYA 2Z5GA 3D9QX 2HU7A 1X1CA 4CMEA 1R9JA 5KQPA 3ESAA 3RQSA 2M32A 1ZUD1 1I14A 2YWFA 4M2LA 2C4VA 1XVLA 4J91A 3LDHA 4X1KB 1IHYA 5CH8A 4M1YA 2F43B 5FL7D 1V8DA 1RWVA 1ZISA 4V0NA 4Z5XA 2IV3A 3R3VA 3KEQA 5IM5A 2FF7A 3WGIA 2PKWA 4GL2A 1JDUA 2PL5A 1VPLA 2WNHA 1CRLA 3A70A 1V8OA 3HBFA 2IP4A 2V4UA 3ISTA 5IMBA 1E3WB 4JENA 2XAUA 2FR8A 2G40A 2POCA 3GR6A 2J9XB 4PLPA 1OX5A 1NJ2A 1DTWB 2ERXA 3QTBA 3WG9A 3WO1A 1QFXA 1ZKDA 3FRHA 2ECKA 4NMLA 2RHOA 1TFRA 4D99A 3GDFA 1XGKA 1J24A 4JASB 1AO3A 1OYYA 2W9XA 1L2TA 1IEXA 3LXMA 4N7JA 4YJFB 3LCVB 3O9ZA 4KQHA 2ACKA 4TX1A 4IJVA 3AUFA 5EHIA 4A8TA 2FEKA 1MC5A 3GGCA 4A10A 5MN4A 2BCJQ 2HIAA 3ICPA 3IUPA 3IUJA 4NHOA 1IEQA 5DMHA 1Y1RA 1UOQA 1E1CA 3R6TA 3UUWA 3QU2A 1Q77A 4ZQEA 1XLTC 3O8QB 3QXHA 3RVQA 1WSBA 2CB9A 4H7JA 1F3LA 1LJLA 1A5BB 4IDBA 4N8EA 1HQCA 1LRLA 2E1RA 3BSSA 3IAM6 3O9MA 3DDOA 5DXJA 4NXNB 2OG1A 2WHPB 3AYXB 1D09A 2EJBA 4D81A 3MQ4A 4I2NA 4ME6A 1Y4ZA 4MH0R 2IEAA 3K4PA 3P9YA 4LDRA 4OI1A 1DZIA 2ZJFA 3WV5A 4U9IS 5LCXA 5J1SB 2P9FA 1JDVA 1SVUA 1UOOA 2HD4A 2P9QA 1N9GA 3NKVA 1G4UR 2XNCA 2XDQA 2AI2A 4IEEA 4JIMA 4N9WA 4OHVA 3RU7A 2YL2A 3PQ3A 1ZN9A 2PZFA 3O4HA 4TXHA 4KNYA 2CDAA 3QLVC 3ZKWA 2KYRA 5DTRA 3D3EA 2Q9AA 1IY8A 4B31A 1QRAA 2G8LA 1U0GA 4FGZA 3MINA 2QVYX 1K9SA 3HJAA 2G4CA 3EGDB 1WHTB 3GEIA 4ZU3A 3JD0A 4HYTA 3T3HA 3TEMA 4ZVUA 4TV8F 1W47A 3T7AA 3JALB 3U1TA 2AJDA 2C04A 2VFAA 4XDYA 3ZWWA 1J7KA 4GSLA 4RKYA 3NFRA 4XM1A 4RPHA 4BNFA 1EJ2A 4CMKA 3OLWA 4ABTA 2FFQA 4Y2HA 2QVGA 2QRMA 3O03A 1K66A 2M1XA 1H1DA 4ZU6X 1J2UA 2DPHA 3HQ4O 1NN0A 4Q1DA 1XLWA 5AXDA 1C3EA 3N53A 3ZVNA 3FHTA 1GAEO 3FR8A 4C01A 2NSHA 3D8NA 1VIYA 4H9GA 4TT8A 2Y6UA 4FYKA 1CPYA 4G24A 3GJ4A 1MJFA 3DE2X 2EVWX 2NVOA 4RVSA 4WOJA 1E7YA 1KO4A 2VHEA 1GDDA 2YINC 2WWFA 3H0CA 1E1QD 1WXEA 2VLIA 3O74A 4AKIA 5HZGA 2BGMA 3F6RA 3TLGA 5FL7A 4UW9A 3PRYA 4E03A 1L0BA 5HQ3B 4UHEA 3BE5A 4UNQA 4C08A 3QWBA 1JECA 4Q4DA 2RK4A 3ANSA 4RK7A 1V9CA 5T4BA 5DRTA 3UGTA 4AL4A 4BLTA 1NOKA 1SG9A 2R47A 1XNRB 3FCUB 1A7JA 1FFBA 3FIJA 5DVZA 1HYGA 1JSLA 1BVHA 2L17A 3MIIA 1EHYA 4OOEA 3FGZA 4WY8A 3UMVA 1GZ3A 5AIBA 5BORA 13PKA 1PNQA 2GPTA 3QEOA 4XIYA 1FIUA 1UZAA 1JP7A 3M8KA 4E3ZA 2EW2A 1EK5A 1H5UA 2Q1XA 1ILEA 3VR1A 3U39A 4DLRA 5J43A 5JAOA 2RIRA 1A5TA 3UXMA 4I50F 3BT7A 3W34A 4J0HA 4JKYA 2QKYA 2OECA 2NACA 4QOSA 5KVCA 3FRIA 2HCTA 1Q0LA 4JBNA 4Y98A 3W7AA 3M4YA 4UFNA 1Z82A 1QX4A 3QE2A 3MWLA 1NXXA 4Q4HA 4HEA1 4D9NA 3WYGA 1O6FA 2C9MA 5J58A 1MPXA 2AYYA 3BXFA 3WGOA 2WUGA 5ALTA 1U2SA 4XLTA 2GESA 4PWYA 4B4UA 2QF7A 3INGA 1L8QA 2JJMA 1NW4A 1V16A 3WBJA 4F85A 2AFIB 5DK6A 1QFJA 4JQSA 3DH0A 5BN3A 4K6CA 2YQZA 3OQVA 4L22A 1KF0A 3FTQA 3TYXA 1NAIA 2O2SA 2ZSKA 3I45A 4JEHA 4KO8A 4II3A 4DLYA 3QWAA 4GQAA 3HDQA 1GTSA 1NJ5A 4A0HA 5GGYA 2VTVA 2QM7A 3NIBA 5HDQA 3KLPX 3MRXA 4XPZA 4CKWB 3IKVA 1A50B 4JC5A 5JYCA 1M6VA 2ATVA 2DFDA 5JLAA 1PJTA 5AK3A 3SSNA 4DTIA 3K70D 4K81B 1XDBA 2PANA 1MHPA 2WKWA 4H4EA 1U3CA 4KDRA 4QNNA 2XRYA 2PSJA 4DUGD 8ADHA 3D1LA 2BRUC 5L40A 2Q0HA 3DXXA 4JQYA 1BCRA 3DKIA 5L3QB 5MF6A 5FLEX 2A5LA 3K0EA 4MA5A 3V1MA 1JSXA 3ZHOA 3BK7A 1PLJA 3LM8A 1UZNA 1TO6A 5E3JA 1DAHA 3UICA 2JDID 4CYMA 5FOUA 5BMVA 4DM3A 3CX8A 2ENWA 4IH9A 5CVUA 4FW9A 3DTVD 4YGYA 2BDTA 4G23A 4N0EA 4YH1A 4RK0A 4XE5A 5ALNA 3T52A 2WSLA 4EOGA 1Q16A 4DNPA 2NZJA 1YBFA 2QV7A 4O2LA 1E1QA 3PUYA 1YQXA 2PH7A 4QRIA 5FKJA 3NGMA 3QFFA 5IVIA 4GM4A 1RZVA 3KO8A 4MHSA 1ZCJA 2CHFA 3DBLA 3AEKA 3EQZA 2C2ZA 3DWEX 4TV8A 4D4JA 3VOTA 1HMPA 5CT6A 2P0AA 4ZK2A 1GU0A 5FP0A 3FTDA 4PZLA 4QYIA 2ET6A 1XXHA 1NUTA 3BUSA 5TSDA 3LW7A 5HG0A 4CM1A 1KI6B 2XIQA 1WUYA 2AIRA 1Y80A 3E9EA 1PNTA 1J00A 1R6UA 4TTAA 3WYAA 1ST2A 1DO8A 2EBFX 4J1QA 1MV5A 4DBVO 5CAEA 1SHJA 4UUQA 5ILGA 4CQJA 4BO5A 2CW5A 1PFQA 1Y7HA 2FHSA 5J5CA 3RU3A 1E18A 2G72A 4LRXA 4J0JA 4RLFA 1DBWA 1OA1A 2DJIA 2VBGA 4CFSA 4HFNA 3ETNA 4LY3A 3K5WA 5DKFA 1ISJA 1UZLA 5G02A 1DKQA 1BEZA 1U3VA 1ZJJA 1ULZA 4TYQA 1DI0A 3KQKA 1TJYA 4FSHA 4O1MA 1JPNA 2HF2A 3P26A 4UMFA 3VR0A 7GPBA 4GRAA 3PYXA 2P30A 2OGSA 3JVDA 4HVTA 4UNNA 5T57A 2FPRA 3CZCA 4K03A 5DO9A 3RRNA 1EP3B 3LU1A 5GJBA 1N7JA 1E99A 3ETJA 4KLRA 1FYVA 3RQIA 4HDSB 4NLLA 5JHGB 3KSBC 4BVEA 1QIMA 3BKWA 2QRKA 2R6CA 5D7BA 3R5HA 4BNXA 1PSDA 4QEZA 5B37A 3UY4A 2QTHA 3AFHA 1CUUA 1RM0A 2ISCA 3O8OB 5G53C 3RIEA 4AIRA 2D5IA 3MK31 5BSTA 4I50A 3ZNOA 4IEIA 1KQOA 4KQ2A 1LSJA 4QREA 4IS2A 3VR4D 1POWA 4Q02A 2O3JA 2PFGA 3FOBA 3ZY4A 4RJTA 4LF7B 3AGQA 4ZVKA 1DBPA 3RRZA 1PWXA 4NENA 2Q99A 4Y30A 4C14A 4J03A 3WHLA 5C7YA 1FSSA 1IPHA 2OXTA 4XSHA 1RM4A 1M6WA 5TC4A 3QBDA 4DUGA 3EZLA 4C6TB 3WWEA 2DBQA 2QSJA 4U0KA 3K3PA 4WFQA 1PV2A 2G09A 2CYCA 3O1LA 5AQEA 3EPPA 3X2EA 5IZCC 1G5QA 2ZIUB 2XB2A 3MWJA 4XX1A 1OROA 3Q9UA 2H07A 4I9GA 2WHRA 2JDIA 3RKRA 3ZXXA 5DTMA 3GXBA 5LOVF 3OCVA 1JL3A 3SDSA 4P5DA 4XIFA 1YCFA 2WHYA 3DTVA 3AHCA 1G0NA 4R81A 4CODB 3DBHB 3DZFA 4ZOLF 3HP4A 2XGMA 1J56A 4DW8A 2HWXA 3IE1A 4OYLA 1PR1A 2Y2VA 2ZYDA 3HJRA 5BMVF 2B4RO 2OK8A 4N65A 4KN5A 1T0UA 2FSVA 2E89A 3OTWA 4D9MA 2FPGA 1RLMA 1G2IA 4MQEB 2CT8A 1D5WA 1Q7RA 1GQ2A 3JQPA 4J16A 4M7RA 1SRRA 2RDMA 2BTQB 3A1EA 4REMA 1JAHA 2QPTA 3B3AA 5AW0A 5K99A 2XKKA 3EXHC 4BNGA 1AV7A 2PLRA 5KPDA 5ALWA 2J9FB 2VH2A 4HDOB 4DLVA 1HEYA 3OF2A 3Q87B 2G63A 4B09A 5DGCA 4BGEA 5JVDF 3DMDA 2Y99A 2IIVA 5IT9A 3B8EA 4CL3A 4RWEA 3G9UA 3EPHA 2HJRA 3LCCA 4C1NA 2WWRA 2XYHA 1F12A 3LHSA 1W2GA 3AF0A 3C98A 3OIVA 4RS3A 1DAGA 3BJEA 4BKUA 1CWUA 3BFKA 4LKOA 3SS9X 3ZWYA 3FPCA 3CH4B 4COOA 1RWOA 1XMIA 4Y0VA 4Q9HA 1U7XA 1T91A 4CM7A 1JFSA 2F8TA 2TSYB 5I6DA 3W6UA 1QHYA 4FE4A 2WZBA 3BL5A 1ECBA 1I3LA 3MTDA 2FZLA 2A86A 2VQDA 3PDHA 2O2EA 3QVWA 3DPSA 1NDHA 3DZIA 1I2ZA 1IHUA 2ZANA 3U6KA 2D6FA 4Q5IA 2W6JD 4C20A 3L8MA 1VLVA 2PU7A 4ZWNA 3S3TA 2DETA 1D2GA 1SCUB 2P69A 3G2QA 3H5AA 4KXVA 5SY4A 1PQPA 3CIOA 2XB4A 4HWGA 4XFKA 4YP0A 2YS6A 3L7CA 3QXGA 1MPTA 1TJNA 2OLEA 3QEAZ 2B82A 5KTNA 5HJEA 1RZRD 3MJFA 5HNKA 2EC5A 4HD8A 3VR4A 4LC0A 1MRNA 2P1RA 3PJDA 3ZNQA 4Y6GB 5ALDA 3RSOA 4F9GA 3VGPA 1RBZA 5B1YA 1RQNA 3PQEA 1XWFA 1CP2A 1D04A 1PW5A 4E94A 2CGEA 1SEVA 4U7DA 3EA4A 2VDNB 5B53A 1TVCA 1GTG1 2BGTA 2X0NA 3MTEA 1VECA 1R0YA 1SXIA 5L45A 1E9EA 3WMWA 1NW7A 4WCFB 1FNSA 1FFYA 3DHNA 4NJMB 5BV7A 5CNKA 4F3CA 4CF7A 4FZ3A 2D1QA 3FI0A 5EHXA 1NKTA 4EFLA 3H1EA 3BWMA 3EXG1 4L6AA 3V8EA 1U5BB 4AKHA 4TLCA 1TTQB 2I2DA 4OVKA 5G0VA 1XTJA 3LBIA 3Q8WA 3QUAA 4S12A 5EIFA 1EUCA 3V8QA 3ZDFA 1KDTA 4ESHA 3C43A 2Y0DA 2WJ3A 1H5NA 3A6JA 3TIVA 4OH1A 3IQFA 5I4CA 4J0QA 1B15A 3FPGA 1FDUA 2QAJA 3HA3A 5GADl 4TGLA 2ACVA 4KK3A 2PQ2A 3MCVA 3OM8A 2BKLA 2LCIA 3OZDA 4Q00A 2C2MA 1D7AA 4KACA 1XEAA 2CXQA 3TMKA 4ENRA 1FYEA 4M9UA 5CDUA 4FZJA 1HFWA 2AJCA 3W9UA 3MOSA 3WB0A 3L8YA 4ZHQF 4FZ5A 1IJEA 3OJFA 5ADUS 3PUXA 4XB2A 1HOTA 4FFDA 3CZ5A 4LBVA 4YBRA 4DLAA 3GLRA 2TMYA 1RLJA 1MEOA 5LOVA 3JYHA 5EPUA 4D9EA 5KDOA 4XX0B 1AMOA 4Z3KA 3IALA 4WK0B 3IDFA 4MWBA 5DNUA 3Q3EA 1H2YA 3FZQA 4GYYA 2X77A 4ZOLA 1DMSA 2JGNA 4KE7A 2VL7A 1YRYE 2HPAA 2JH9A 4LJ7A 3EG9A 1VL8A 2R00C 3HWX1 3QLJA 5IKXA 3LNCA 1H1LB 1DVRA 5KKCA 1TKBA 2ODEA 5K5EA 2WZCA 1RXCA 4C30A 1FW8A 5TF4A 2ZSEA 3OG9A 4INOA 5JDCA 2AG5A 1COWA 1YZUA 1RQ2A 1FQWA 2F3UA 2I3AA 3PPXA 4Y8VA 1QXSA 1E2QA 3TJZA 1KAOA 4YEDA 3EDOA 2AEJA 2R86A 1B0AA 3PUWA 4RD4A 1H2BA 2P5SA 3HZRA 3D1JA 3PXEA 2FKNA 3EC2A 4LNHA 5HF8A 3R9KA 4CM9D 4QVIA 1VPEA 1DUIA 1HWYA 4BBZA 1RZRA 4JNKA 4E14A 2GBLA 2HJGA 3P32A 3DQPA 4PNEA 3MPOA 1IB0A 4ZO9A 5AJTA 2ENUA 5ESRA 2JARA 5CLHA 4FS8A 4WNIA 2WF8A 1Y98A 2WJHA 4Y67A 4ER6A 2IIPA 3B1YA 4JT4A 5AUOB 1XEXA 3CEHA 3H2JA 3UOWA 2CMDA 2ZI3A 1DMRA 3PITA 3EWNA 5HBRA 1Q1AA 5KU7A 4BXOA 2CF6A 2GPNA 2OOKA 4BZZA 3WISA 1CNMA 4DV6B 1E1LA 4TSFD 3X1XA 3TJRA 2B7BA 2JI6A 2PUTA 3CUWA 5FA8A 3DBRB 1YRQA 2A8YA 4JB0A 1DCFA 4G1UC 2JLVA 1TLLA 7ABPA 4DE5A 1EMDA 1JHXA 1W30A 2GAIA 2P9GA 2OC4A 3L0YA 2A6PA 4FE3A 4JLSA 4YC7A 1JR6A 4RTSA 1Y4DE 2I62A 2RBKA 4B6OA 4KYTA 3C5CA 2PUHA 3E9ZA 5A5EA 1ODSA 1XCBA 1YC2A 1UJCA 4GSYA 3ZGOA 4DDTA 4IG4A 2CHQA 1T26A 5FBZA 1SXJB 1QG0A 3L0OA 5LBTA 1Q0SA 3UCFA 1WX1A 2O8NA 3UHJA 1DG1G 1JKFA 1PDOA 6YASA 4ZVOA 2PEZA 5KJEA 1B76A 1SUAA 2O6LA 3CCFA 3TW8B 1JHVA 1MQSA 3R24A 2H65A 4OH7A 3SFZA 2OGUA 2QZZA 3M89A 5ARDA 4ZT5A 1YH3A 4BQPA 3RRFA 4AZ3B 3L3BA 5PNTA 1YIOA 4RD6A 5AH0A 1IUOA 1I5RA 3HJGA 3PIDA 4TM8A 5ICMA 4LPSA 3HLYA 3RSSA 5ECYA 4F4CA 3L7DA 4W9NC 3GI1A 4MINA 1NULA 4BNLA 3F67A 2H1SA 2AHRA 3WK7A 1YVRA 4UREA 3N0VA 2FLKA 4TKZA 3RAGA 4XM0A 3UXEA 4URWR 3P9NA 3ZKAA 5IULC 3OCJA 4UEQA 1M5RA 4UTXA 3EYAA 4MWTA 3O8NA 5EKXA 3THWB 3N07A 4PS0A 1CZKA 1QGED 4HXEB 4WZBB 1DEXA 4MS4B 5CIQA 1RWBA 4IDOA 2ZS8A 3ZK8A 2BKEA 4E4TA 2E4WA 4C0JA 6LDHA 3CKLA 4U9UA 5B6PA 2Z30A 1UXGA 2E37A 3O2NA 2RE8A 1VZ3A 4UQLA 5JMPA 4GQBA 2Q3HA 4ZHQA 1OIVA 3IIMA 2BGKA 4DCGA 3I9V1 1RW4A 4ZJZA 5TMBA 3K1ZA 2AYZA 4L2IA 2O8FA 1B3BA 1FFEA 3HBAA 3F78A 1JEYA 1R6XA 4UKDA 2BYTA 2GM5A 1BVUA 4FBMA 3V42A 3LOPA 4CM9A 4F1JA 1DL5A 5BN5B 3CUTA 3DXYA 4KQGA 4QFMA 4CT0A 4B9AA 4Z9YA 2AFRA 4KTTE 1A0OA 2PT9A 1Q74A 1NF9A 1V8PA 2IZ0A 4EJSB 3ERCA 2QYSA 2NU7B 3K4QA 2C03A 2WP8J 1XN4A 2ZIWB 3FPJA 1H6DA 4QGBA 4YRFA 3L7KA 2IX9A 3F5SA 3KKNA 2X0JA 3OCWA 1OFHA 1S02A 1UQTA 1M0WA 5DTJA 5BSGA 1NT2A 1Q1NA 3WDSA 2QB5A 3HVKA 1KZGB 2WM2A 1CF9A 2Q5FA 2FXVA 4M8LA 5F9FA 2VDWA 1VI6A 4DLSA 4CEHB 5DX1A 2YWEA 5CB4A 5A04A 1E2BA 4TSFA 2UZAA 2ONCA 3WSTA 3I2YX 5F35A 3V8BA 1Q0UA 5JBIA 2V1UA 3CCCA 3KB2A 1T8PA 2Q1SA 4N40A 2ZWPA 4HAUA 4QO8A 2O2ZA 1X1QA 2XIJA 2A9JA 3C14C 1S96A 4LXQA 1KH2A 1VA5A 2GAOA 4G9BA 2UXBB 3SY8A 2ZULA 1WP4A 2Z8YM 2W83A 2WJGA 3PHLA 3IS3A 2BD0A 1WMFA 4JVNA 4Y6PA 2IHYA 4OHXA 4UHFA 3PEEA 1ZVMA 1B41A 2X8AA 3OJEA 3EPKA 4C3UA 4BDSA 4B6FA 3VNBA 3TTWA 4G5QA 3G13A 3OPMA 3LDGA 2AZDA 1PT7A 3KQQA 2QT1A 3RFXA 5EZSA 2RG1A 3ZEAA 5LU8A 1C1YA 2PSEA 2QMEA 1BRMA 1GZ4A 1JPUA 2R9VA 2V54A 2V7TA 1N0HA 3K6RA 4YJHA 5L7YA 2JEYA 4RD3A 5KAPA 4B3SB 3CF2A 1F14A 5KQRA 5A5DA 4PBSA 1X1AA 2IYYA 3GRKA 5JI3E 2YUTA 3FW1A 4IOLA 1MORA 2WM3A 1PZGA 1N1GA 3PT9A 2DH5A 2BR4A 4A23A 3D8SA 1NONA 5EJ9A 1KDPA 4EJ2A 3H3FA 4JGGA 3V5NA 2BP7A 2IYLD 2QLMA 2Y76A 3D2BA 4LUCA 3IT3A 5AVYA 4WQMA 5JSHA 4PCLA 1I1QB 1GTMA 3FROA 4DR5B 3TECE 4JBGA 3WO0A 3WQHA 1U6KA 3ZH2A 3WTCA 4QTZA 3DDSA 4Q15A 4W5HA 3C7CB 1L1QA 4ZAVA 4UDXX 4G85A 2IY9A 4CF3A 1CBUA 3TX2A 1LNZA 1Y4UA 1R6DA 4LJ9A 4MRMB 4NBLA 1TB4A 1PS8A 1S2GA 3RDPA 3RW9A 3BMQB 3M6VA 2R8YA 2JLYA 1V35A 4LXHA 1VCNA 3MQFA 1LV8A 1QK5A 1VDZA 2JAXA 4MROA 3T4UA 3LLCA 1H2ZA 4RACA 1U7ZA 2A78A 3VSDA 3CF6R 4ES6A 2LZ0A 1CIVA 1JIKA 1ENPA 4OHUA 1TXGA 4UE3S 3HKCB 3SF8A 4D4GA 1OC2A 3RAEC 1EWYA 1KERA 4DM7A 4UPEA 4DUYB 5CH5A 1M2HA 3I01A 2GCGA 4LQCA 5IVKA 1UJ4A 1ZQ1A 3GJ8A 3ENKA 5FTNA 4IBOA 2CB0A 1VSBA 1DAOA 3D59A 3NNDA 3WGNA 3IAXA 4LFAB 3WS7A 1EVIA 1CY8A 4X3OA 3OIFA 4NULA 4MDYA 4TWRA 2W11A 1Z13A 2D74A 1EM8B 1G8AA 3ROMA 1FS4A 1Z0IA 3C7KA 2ECQA 4K0RA 1GT91 3JPWA 1HEIA 1K4MA 1KP2A 2WUFA 4A6EA 1BZYA 2VJBA 2VP6A 3BREA 3MUFA 3PHHA 4QXPA 4BJHB 3K1AB 4XQEA 5BPHA 3M9LA 5HE9A 5DM60 4HNAA 1XRMA 2WUDA 1KI2A 1M67A 5LLTA 4ASUD 4M7PA 2P75A 4NAHA 3EPJA 4FTWA 5FFMA 5BO5A 1XZIA 4C6RA 5KBYA 3EVDA 3OKAA 1WCIA 2O1EA 5AVXA 1T9GS 2VEDA 1BMTA 4KFRA 4V2IA 3ONWA 3BIFA 3JQ9A 4IOJA 2GAFA 2G5GX 4YBZA 2VK4A 5DYWA 1KJ9A 2JFQA 2LV8A 1JW9B 2G82A 2ZUCA 4A8JB 3VYWA 4CM5A 5EIWA 1JIQA 1Y8CA 2HPHA 1SBQA 3LRPA 3VNAA 4AS2A 1RMYA 3NONA 2FR0A 2C59A 3K0KA 1KQ3A 4WKPA 4FDLA 5JCOC 1U2GA 5E6SB 3VZQA 3RUEA 4BBJA 1E7RA 2PKYX 3PICA 3M4XA 3CEJA 4PYIA 5GVRA 3QQPA 4IUCS 5CX1A 4ECAA 3PXUA 4C06A 4UHDA 2IHUA 1GQYA 1U1GA 3HO8A 2JS7A 3QXXA 5AT1A 4RMHA 3L4BA 1VSUA 4P2GA 4EMUA 3UK1A 3FVRA 1DFGA 3ACBA 2YR0A 3GT4A 1T0IA 1DJPA 2BEWA 2W2KA 4QYWA 3NETA 2CL6X 1NKSA 1TCVA 5DPMA 1GQFA 1OFUA 2QOEA 4G0UA 1IDOA 1WSWA 3HUUA 4FMBB 4DVJA 5K4GA 2AC7A 3FYHA 4UE2A 3SEAA 2ANCA 4DYHA 2JLZA 2AW5A 4XZ3A 4P98A 4V0QA 1XYVA 3AOGA 1EK6A 2G9UA 1H8ED 3ZY5A 1CJKC 4O4JF 4J49A 4Z7NB 3L0BA 1Z5OA 3V55A 3IPYA 1OZGA 4BRZA 1NFQA 1N6IA 2P77A 3NHWA 2OENG 1XLUA 3JRXA 1PQUA 4ID9A 4GNKA 4JLKA 2VEOA 3MCUA 3KE9A 1IULA 2IELA 3E81A 5FF9A 4NCBA 1NXWA 2W48A 2D2FA 4XTCS 2YXBA 1VMIA 1YNOA 5ECGC 2VJAA 4C4YA 5I7OA 2YXEA 4IJUA 1XYGA 3SVLA 4MGKR 2EG5A 4HQ6A 1I10A 5HUQA 4B35A 5K8IA 3QV2A 5LXTB 4BMDA 2R48A 3H5VA 5FWYA 1E1RD 2IYTA 5IAJA 1QO7A 4OU5A 1QM5A 1X0XA 1U9ZA 2LVBA 2WTXA 3AONB 2ZI7A 4HDRB 2NXNA 2GARA 3ENNA 3OTIA 3C5HA 2FWNA 4JLAA 1G8GA 3THRA 2AOTB 1B3RA 3F1KA 3UWDA 1I7NA 1L7BA 5A7HA 2IHBA 1GG2A 4L5IA 1BH6A 2D59A 4K28A 3MRSA 4YO8A 3UK6A 4ENWA 3U2QA 2ZKIA 2N1MA 5BW5A 1CNEA 1RRGA 1YR7A 2AMLA 4JBIA 1M54A 4M9RA 4RMNA 4EY7A 5FNVB 2XXJA 3P2MA 3AQ4A 4HWRA 3KXDA 3Q11A 4F6LA 1DFIA 3OU7A 4I4TB 3MWKA 5AUPB 1I51A 3UAGA 4W7HA 5H82A 4Q47A 5TPWA 3IP6A 1HFKA 2QN3A 2CBXA 1JEQA 1GGVA 1VIAA 1KEWA 2WA1A 2H0AA 3ANYB 4I4CA 3RUAA 4X1YA 4ASUA 4RTMA 2E4XA 1YDHA 1G20E 2FHPA 2UAGA 2V9ZA 4ZDKA 3ETLA 3GZ4A 4QUDA 3DFUA 2UZ1A 2WA2A 2LKDA 1TYDE 2KBEA 2UV8A 3NXKA 4QU0A 4R01A 3DONA 4PSUA 2YZ2A 2CWWA 4BO7A 4D5GA 4B6JA 4Q16A 5EXSA 2B21A 4S1PA 5LC1A 1ODIA 4UQPA 2K7ZA 3WWOA 1R66A 2HZBA 2P27A 3B1WA 4M1SA 1AZTA 4L57A 3UT6A 5B3JC 6PFKA 4ABYA 4C7OA 4WOBA 3O95A 3UV3A 1THGA 1QHXA 2NO6A 2ID8A 1XTRA 1M2VA 1WF3A 4R7ZA 1B6SA 4GVXA 4AP9A 1WHSB 4HS4A 5HCNA 5JS1A 3PUJA 1NF8A 3GLGA 1U1CA 2Q4OA 4AJEA 4ZV4A 1SCBA 1XKXA 2J5KA 2PVPA 3GMDA 3L49A 4HZUA 4KSYA 1HK7A 2OXFA 1EHCA 4O2BA 4YP5A 5JNLA 2V7VA 2QLLA 3PJGA 1N5RA 3I5YA 1XTVA 3KKZA 2YMLA 3OURA 4ZZ2A 1R10A 5HQTA 1EXVA 3QWIA 2CLOB 1JUDA 4CLOB 4TZKA 4NCHA 3VR4H 3AYZB 4BMOB 4C4SA 4FD3A 1TLTA 1REQB 3RUPA 1ZSNA 1MOQA 1EFLA 1PSZA 4QPNA 3IAS1 3ME5A 4KE6A 3STVA 3QYJA 4PHGA 2NNWB 1WQ4A 4YA6A 3IVCA 3R41A 1W35A 4JY7A 1Q21A 4UZEA 1N5OX 1U9YA 1E2JA 3ORHA 4U2EA 1H9CA 2X6TA 3KYCB 4IUYA 3SFTA 5JCZA 4MKHA 1G19A 1I7PA 3VKFA 1GA4A 4NC9A 4RZUA 5ARCA 5C1IA 2X3UA 1MMFB 2CHGA 2DWQA 1S8AA 3M5CA 4RDHA 3GLKA 3U3XA 4AI6A 1IBLB 4F8EA 3PZRA 4O4HB 5L3ZA 1VCOA 2GK6A 1E1RA 3D4NA 4WGGA 5DCUA 3R2JA 2XMSA 4KIUA 3PLAE 3MHPA 4U5QA 3FOZA 5KTOA 1YE3A 1XB2A 3E61A 3SR0A 2JLUA 4RSHA 2E49A 1FE8A 1PJAA 4PGHA 3T7SA 3VH2A 4B7CA 1OLUB 3LY7A 5EEGA 2WV7A 3H5LA 1A9YA 2P1DA 3PQ7A 2CDBA 1E1MA 1O94C 1TIKA 2C61A 5ALSA 3V4FA 4EYSA 3ANTA 1XRSB 1LBQA 1P9WA 2GTHA 1QOZA 2BEUA 2XMPA 5HM6A 1GEGA 1UKVY 1PLLA 3DOCA 1DEKA 4N48A 1NI5A 5BP7A 3BMOB 4B8WA 3OFJA 1SKBA 2BM9A 3S40A 4Q01A 1NN1A 3W2GA 4CL0A 4J1SA 1AK9A 1ONOA 3CJQA 4MPJA 3GUYA 4OIMA 2ZUSA 4C9BA 2YHUA 3K31A 3W04A 1E6UA 3WGGA 2VSXA 3QVTA 5EIHA 2F00A 2FEOA 2BFEB 1X1BA 2VDKB 5JT1A 3TK1A 1HDZA 4WJKB 3AR6A 4UE6A 2X6QA 3T5BA 2DPGA 4OXKA 5DN9A 4NI5A 4MWEA 1WIWA 5AW2A 1HKHA 4JJIA 3M6UA 1F2UB 4RLSA 2OTCA 1CR2A 4BQQA 3A32A 4RIEA 2O8VA 1JPJA 3K9LA 2Q8NA 1ICEA 4IGKA 3ITEA 4RVFA 2JHPA 4X7MA 5GPBA 3AWDA 2B9VA 5CGZA 2VJLA 3IDOA 5KSOA 3RFTA 2XCQA 3A4YA 4UM7A 1MAAA 1YS6A 4AT1A 3GLVA 4QEKA 1K92A 2ZXEA 3E0QA 3OZEA 1HRDA 3D6JA 1IYZA 2MYNA 3U7IA 1EDBA 2REBA 3A6LA 1IIRA 2GBIA 1EGQA 1WBBA 2IHVA 1NXTA 3UYKA 2CC2A 5EGSA 4CV3A 2XCRB 3FVQA 3K9NA 1G4AE 2A5YB 2COEA 4HPXB 2PGNA 1Z2NX 1X77A 1AU9A 2HXGA 4IDQA 4KK4A 5IW8A 3TZBA 5LLDA 1D6MA 2J4FA 1XX6A 1ENYA 1XPOA 4YYZA 2ZE7A 4CU2A 1UKBA 5JS7A 1QRDA 1CY4A 3BBPA 3O0TA 4FNOA 4M8SA 1Q1QA 3F9IA 4XWTA 3NBQA 4C05A 1LDYA 1A4XA 1ORTA 2XYRA 4KNWA 3ESBA 5EP3A 3F90A 4H18A 1LA2A 4KN9S 1RC8A 4NAVA 4OBXA 2VRNA 2FPIA 1GL3A 2NG1A 2FETA 2UXDB 1A4IA 1W1IA 1C0LA 4ENTA 1OWLA 1ZINA 5JADA 1EXMA 2HGZA 4R6XA 5CDGA 3IR5A 4YQEA 2C98A 4F97A 4IIDA 2QD4A 3PXBA 5BVHB 4I4IA 2QG4A 4I3FA 3A31A 3E2PA 3MEQA 4PWZA 3D2LA 3PEVA 2FAXA 2H3EA 4EQ6A 1TEZA 5EQDA 1UANA 3B78A 3IP5A 4EB6B 1I80A 1Y5LA 3CNNA 1F4PA 1NQXA 3GLIB 3CTPA 3EQ6A 2FVYA 2P9CA 3MT7A 4RMJA 1JSCA 4CQLA 5KTKA 2FW0A 1QE0A 2Q21A 3BK1A 3F4KA 4LQDA 4ZZ0A 2WJ4A 3RRYA 4K5QA 4G8CA 2I2CA 3KU4A 3TE6A 5F7XA 4RU1A 1U2EA 2D1TA 2M6KA 3O92A 4A1FA 3R75A 3ADCA 3GEGA 3ER9A 4HRXA 1XCLA 3P9SA 3ZV7A 2PDAA 3JZDA 1AH2A 3FUCA 5AM3A 2KI5A 5IDYA 3T0GA 2VHUA 5KOIA 4LY9A 2GJ9A 4P34A 3NATA 2VJMB 3G7SA 2AMFA 3ACCA 5FT9A 4Z2YA 2NVUB 3ZTYA 2J9YB 1EKXA 1G2PA 2XEDA 1N2CA 3EEBA 4G86A 1OTHA 4R1TA 4PSVA 5JNSA 1TLFA 1IB6A 5I3CA 3M6XA 2D1YA 5F12A 2FWRA 4R1SA 4WNYA 3DQZA 1Z33A 1XNQB 3U26A 3V4SA 4AXBA 1NM5C 3ZIAD 4CCWA 1TJ5A 3JQFC 4EPXA 5A4JA 3HYNA 4JUBA 2PR2A 1AQNA 4EP1A 1KFCB 1HE8B 2W8BB 2IF2A 3GZNA 1V5GA 5HIAA 1XDWA 1SPBS 4IH4A 4JBYA 1ZXBA 3EMKA 1G3RA 1JEAA 4IJKA 3R76A 2Q3CA 5FTJA 1B00A 3ZW9A 3QHPA 3AINA 2BFOA 2Q5IA 3LC0A 1AKQA 4S2UA 3T4PA 4DFDA 4F6RB 1O6CA 3OPYA 3C8ZA 5JROA 3AJDA 1P9RA 3P9ZA 3UB2A 5DBOA 3C7TA 3Q9SA 4EY4A 2DT5A 1P7ZA 1UBKS 2HU8A 3FOWA 4TXNA 1EPUA 1H93A 3TXAA 1C1DB 3OCCA 3BYZA 1TO2E 4IIBA 1N3YA 3IFSA 1AGYA 2EDAA 2KE5A 1AA6A 4AECA 2WB2A 5D3KA 2ZZKA 4RTPA 1OYWA 1T5DX 1LVUA 4L5AA 3N76A 1DIHA 2YCLA 3TIIA 5LWHA 4NV3A 1J8FA 3UKDA 4Z49A 2YFYA 1CQJB 2O7VA 1A27A 3QVJA 4D57A 3T5GA 1XRJA 2EP5A 1UMBA 1RQXA 3A10A 4KYVA 4TQ9A 4GXQA 5EGNA 2IZZA 2NXJA 3FLAA 3SHTA 4CTMA 4ZDIA 3CSSA 4LOIA 3I8XA 4RK4A 4YJ2F 2ADFA 1VKHA 3QEMB 5HK9A 4BMNA 1JWLA 2DKOA 1DT5A 1H42A 2OCYC 1G55A 4KHZA 4P5EA 3ZI0A 4DRXB 1NUPA 3LY9A 1N36B 4OMUA 6GPBA 2EWVA 2OZEA 5JAIA 5DHTA 2DSNA 4KPGA 1Q11A 3CF4A 3EJWA 4LNUB 4R2WA 3HP1A 3S44A 3KB6A 1HRKA 2AN4A 2LP4Y 2W2XA 2YQ4A 3C74A 4Q4JB 1R0BA 4OJKA 3SBEA 5C5EA 3UM9A 3HYLA 1VTKA 3QE9Y 3CNLA 1ST3A 3SZOA 4EGFA 1BAPA 3H11A 4QOHA 4WESB 2FN3A 3FPEA 3QENA 3CFYA 3U4AA 1SC4A 1I1NA 4I3HA 1Y3DE 3PI6A 5G4KB 2UVPA 3A2NA 1IJBA 2PRZA 2J59A 3DAGA 4DJFC 4ER0A 1C0PA 4BO8A 4POAA 1TIPA 2GASA 5JJ5A 1WA5A 3TI9A 3MMNA 4KFCA 1ZIOA 3IMEA 3IEMA 3H9CA 4FGWA 1TF5A 2OV4A 4XYEA 4FFNA 3HVIA 3CR7A 1CDDA 1EDOA 2WT8A 1I6LA 4P3XA 1X7XA 4F72A 1JJFA 1XL1A 4F21A 3AV0B 1U1EA 1DDOA 3LUJA 2IHJA 3Q3JB 4C7OB 2QW1A 1KMCA 2NUPB 1GZ5A 3QLUC 3SZLA 4LS3A 4B84A 4EI8A 3H13A 3LYAA 3DZ8A 2ZWAA 5B55A 1WS6A 3MLBA 3KQTA 4X0EA 4NCKA 3I9MA 3GFGA 4D4HA 1LPMA 3IMKA 3KX2A 2BFNA 2EYQA 2X1HA 1O8CA 4B4DA 4Q1AA 4PRLA 3IEUA 1M6YA 1WXXA 4QBFA 1U2DA 2C5AA 3DDUA 1WTAA 3VKUA 1UXHA 1UBNA 1KEPA 2C7VA 4P4UA 2WYOA 3ESXA 4UUOA 2J5RA 5EOVA 4F0JA 5JD6A 3PIIA 3WZLA 2GCPA 4Z9BA 1PJRA 2WYUA 4BO1A 4PLVA 3RVLA 2HMAA 2BM1A 5CDYA 2D2IA 4PPNA 1OILA 1PX2A 1T0JB 2IOQA 1XFAA 2VXYA 1WEHA 1RU3A 2BGLA 3FIUA 5K09A 1LCIA 1YB1A 4F5YA 2C7OA 2D5AA 2WG0A 3VC3A 4E2ZA 1T2FA 5T64A 2ZW9A 1F4VA 1P29A 4EHKA 3K0CA 1U3FA 4NNOA 3WGZA 1TIBA 4CEIA 1DOZA 4N9QA 1TU4A 4GGPA 5EFOA 3C1UA 2B1IA 3REQA 3L6DA 1Q6ZA 4E21A 3OM9A 2ZCJA 3TEFA 3FHCB 1GRQA 1FW6A 3OOEA 4G0OA 4AX4A 3HU2A 1NQ5A 4A6PA 2FEAA 2J9ZB 4BCDA 5ANRB 4ALNA 3W2EA 4K9OA 1F9AA 4PN7A 1IK4A 3OZIA 4KNVA 4MUNA 4TMWA 3FJOA 2PX2A 5K3FA 4YUVA 1Q19A 3HKDB 1Z29A 1S8NA 4J2TA 4TKVA 1OAAA 1PKXA 2HSEA 3L4JA 3OOWA 3HDJA 4Q6BA 1LI7A 3AVTA 2XRFA 1OXXK 4P33A 2ZRAA 4IH1A 4IZHA 3DQQA 4KUHA 3BWDD 4QULA 1DHTA 2X40A 1L5LA 2A1TS 4HADA 1CG6A 2V96A 4LSMA 1Z07A 4ENUA 1U8YA 5EL0A 4EUNA 2FW1A 4QWWA 5B2FA 1B6RA 3X1WA 1WPQA 1ZIDA 4JGBA 4XH9B 1JMVA 1KJZA 3V48A 4QU8A 4MYRA 1V48A 1W4LA 2B4QA 3RVDA 2ZAYA 1NQUA 1ODJA 3OY2A 1N1MA 1BCSB 2FQXA 3NM5A 4Q6WA 3C16C 1NW9B 2QORA 3IKMB 4X7PA 4D1YA 4CTOA 1AG9A 4M4SA 5CP8A 3BGIA 3AR7A 3C8MA 3KQOA 3VPDA 3PGA1 5JMOA 1ZM2A 1TCBA 3SHOA 2VNJA 1D03A 3I6YA 1PTJC 1GQOA 1S2NA 4WK6A 3LLVA 2CLMB 2FN7A 4XD7D 5IDVA 3OFSA 5HJ5A 3UPTA 4TYWA 2QTGA 1JEDA 5KJ6A 2CHUA 3N8KA 4DM4A 1Y1SA 5JSZB 4YJ2A 5FWXB 5AHOA 1P0QA 4C07A 2C3YA 1NVMB 1U5AA 3EARA 4PQRA 1QANA 1Z22A 2ATXA 2VT6A 2PZEA 1S8OA 3OSZA 1FTYA 4GWGA 3Q8MA 2OBMA 5FOVA 4NJEB 2QUKA 2HBYA 3V8RA 2OGZA 1UM9B 1IONA 1QYXA 4P08A 1S9HA 3L7YA 2DZDA 4UPVA 2WIBA 4GP7A 3QH4A 4CQMB 1EB9A 3RASA 3T4XA 5FLYA 1A7AA 2HIGA 3SQLA 2HADA 5DBGA 3REFA 2RGNC 3CMMA 4IY1A 3LQFA 4W8OA 2PKQP 2YVLA 2FRDC 3FMGA 3MYRA 3GWZA 1OAOA 2GJAA 2CE7A 1JKIA 1GZUA 4M36A 2VZ9A 4DHEA 4EK9A 5GTDA 1RJWA 3IUBA 1KGDA 1ZCBA 1M73E 1HDXA 3JD1A 5FUYA 5CDTA 2OZVA 3I62A 1VKZA 4KH0A 1ZW1A 4HYEA 1L5WA 2P62A 4BNKA 5JRDS 3X1JA 1I0IA 2PLAA 5ELLA 3O4GA 4QYSA 5ERYA 2OG2A 1XTUA 3ONDA 2J85A 1JFFA 4DQXA 4HN9A 3WKBA 5BSRA 2BJWA 4UMEA 4AY6A 4XRRA 3ROKA 1IJKA 1DINA 1H66A 2R7LA 3L6UA 2HHAA 4XB6B 4WZAA 3L07A 2QTVB 3NXSA 1CVLA 4LRSB 4JWKA 2RI6A 4US0R 5TXGA 1JHQA 2D62A 3OU2A 5TF0A 2I99A 3CRZA 2A9PA 3H5NA 1YFLA 1P3Y1 1TMGE 2ZBFA 3U3KA 1EP9A 4HV4A 1H8HD 3OJ0A 2PWPA 3C45A 2J87A 2XQVA 4I36A 3I5MA 5CVCA 4Y0AA 3B6IA 4X6UA 4V1CB 2XNSA 4C0AC 3ADKA 1ATZA 4I1OA 1CUVA 1PWYE 4UEJA 1E66A 2O2CA 3F6SA 1E1YA 2OUIA 4M8IA 2IQ5A 2NVWA 2OFOA 1DXYA 3H17A 4JEMA 1M76A 5C8YB 3FWPA 1T4BA 1T0PA 2XE8A 1W85B 3O93A 1SC3A 4NYIR 2CLLB 1N2XA 3RV3A 4L3OA 1R18A 5DXFA 4DCMA 3Q85A 3R8CA 1PAUA 5SZJA 4V1CI 4C7XA 3P5SA 2PR7A 5D3ZA 2ZUBA 1EI9A 3PFFA 4KP7A 2IXBA 2Q0QA 4W7IA 3WADA 3TRFA 1RXSA 5LQRA 4FMDB 3SVTA 3OQIB 4B46A 1BDIA 1JDBC 4LK2A 1ZGZA 1XRQA 1LX6A 1T15A 4HTFA 3TQTA 3JQEA 5H3CA 2ZB3A 4YRIA 4XD7A 4MKGA 2HTEA 3CA8A 3DGEC 1OBOA 4FJ0A 4HRYA 2ZYTX 4JFAA 3RRBA 4LF9B 1O6BA 3A3NA 3IELA 4X41A 1CP3A 1X7WA 3X2SA 1GTL1 2H2WA 1BW9A 2NPFA 1Y3AA 2YOGA 4CMAA 1NJ6A 2JJQA 4C6SA 1ZOIA 3C3BA 1SIUA 2AVDA 3D4PA 3VO9A 4AULA 3AIMA 4NIMA 5FWNA 2EX0A 4K7JA 4Q39A 3ESDA 2PTHA 1FUEA 3D6VA 4W5WA 4YP1A 3K1JA 1US8B 3EIUA 5LDGA 1V7ZA 3G59A 1AGPA 3NCHA 1QHIA 1LJUA 3L0CA 4WKBA 2C3PA 1ZZEA 1PR3A 2V3WA 5FI1B 2CK3D 5KSWB 1XKQA 4KQFA 1MEEA 1X7GA 2OB1A 3JTEA 4PO3X 4HVCA 1E4EB 2VR1A 4PXAA 1DTSA 2AI1A 2KPOA 1CXZA 3PP8A 4G26A 3TQRA 2HU5A 4ZI3A 4PG5A 3ANLA 2ZIXA 1A4RA 2HI0A 1KQPA 1CR4A 3STUA 3LH5A 4BFWA 1YBVA 5G0WA 3HSKA 4FBGA 3R3YA 4RTRA 2IS4A 1U7DA 3X2FA 5EHNA 2R84A 4RA6B 5AO9A 3UPDA 1VIMA 1L5RA 5CA0B 4Y2TA 3P9XA 4F4FA 5JATA 2PJZA 2W70A 4ZEMA 4TKMA 1VL1A 5CXQA 5J4YA 4KQ9A 4QJ3A 1KYVA 2FN9A 2JHFA 3PXGA 3VTAA 2WW8A 1U02A 2VP9A 4D3SA 1PN3A 1J9ZA 3W9BA 3OEWA 2I9PA 1RRCA 4ER5A 1J07A 3ASYA 3F3YA 4MS3A 4BX2A 2VDLB 4DEYA 3EGXB 2MTBA 4FHZA 5EJAA 2LW7A 1XF9A 2GN2A 3L5OA 3ND5A 3RIHA 4CLEA 2VAMA 4DDHA 2DULA 2Y92A 4XA8A 2OQ2A 3D5QA 3OE5A 3T5TA 1U28C 2KJQA 4EVRA 4X6LA 3A3PA 3MJVA 1H8HA 2FMUA 1LQUA 4W5RA 1NDUA 2XEXA 5LMCA 1KAQA 4G65A 5JH7B 1PLKA 3DSRA 2CLFB 4GGMX 3D3WA 4CKEB 1TKAA 3HU3A 4OSPA 4YJ3F 4WBNB 1C9KA 4KMOA 4A5SA 2KBFA 4CR6A 4FCWA 2GNOA 1BOFA 5JQGB 3K09C 2O2HA 1T29A 1XDSA 4M7OA 4BFLA 3VNRA 3ZOKA 2H2DA 4AJ4A 3PNKA 4OQZA 3EF1A 3TLMA 2UU9B 2VTEA 3L7MA 2QR3A 1XTTA 2IOFK 4K46A 1GPLA 4RY9A 1E4VA 4BO4A 1XCMA 1QH8B 1K6EA 1GU7A 2WK1A 2DG2A 1CR1A 2QN8A 3CLTD 3IAM1 4ZPXA 2E5FA 1II9A 3ZJ4A 1ETUA 3FPAA 4B7AA 5LQAA 1MLDA 4CCSA 2XTJA 3U44B 3AF2A 3BMNA 2J3IA 4GNRA 2BFFA 4UDOA 1LFDB 1AIPA 4PYMA 3T38A 4JYBA 2I5PO 3AHFA 1QH9A 1RYYA 5GOZA 4A0SA 3PFGA 1XZQA 2Z4RA 3IUMA 3KTOA 2VJPA 3CSDA 5TY0A 4DF3A 5DLYA 3K1TA 1XEWX 5GONB 1BWQA 4B32A 5I9LA 3NH9A 3ZHZA 4D4IA 3AG5A 2CXHA 4BVKA 2G7MC 5EUMA 4M49A 1VJDA 2WQ7A 3M49A 2CK3A 1AXEA 3FH0A 4JOCA 2WG1A 4C4RA 4PLTA 2Z58A 4WLUA 4NOKA 4AJ1A 5KHOC 1UZMA 1C8VB 3P20A 5EVCA 3KAQA 1ISIA 1JAYA 4F6CA 1AO0A 3NKFA 2O9JA 1LNQA 2WD8A 1GGHA 5HYVA 5ED4A 3EDQA 4HUQB 4OEHA 5JANA 3DZKA 3ND9A 5FPSA 3ZWKA 4E13A 2GN6A 2QD1A 5K6AA 3KVOA 1H5QA 1FLAA 1K9VF 1GYPA 2G76A 5E8RA 1D4OA 1LLUA 5DGHA 5LM3A 3FZEA 1G1MA 3QXJA 4IP0A 1AE1A 1Z08A 2YXLA 4R84A 5DISB 4ZAWA 3ROXA 1F2TA 3RSQA 4G67A 5I4KA 1K1EA 2GILA 2ZQ5A 3HN2A 1QKJA 2FA9A 4BNTA 3DE4X 5A4KA 1MABA 1Y6QA 2H2AA 1RQGA 4I7EA 2FSPA 3QQ5A 1E2UA 4YAKA 1UFVA 1LBTA 1CQIB 1DKNA 3P9RA 2GUWA 2ASEA 3R5TA 2OORC 3ZLUA 2OZKA 1VHJA 1Q1ZA 1FSZA 4RZQA 1KJJA 2GA8A 4BMSA 2JBHA 2W0SA 4HKTA 2BH9A 2DFKB 4XEUA 5FQNA 2GCNA 1I5EA 1DPFA 3G5LA 3KPJA 4S1TA 4OQQA 1TAUA 2WPDD 1F2VA 1IVNA 1I4OA 4BN0A 3U1BA 4QBTA 4MQFB 2IP2A 3WK8A 2OCKA 1ZUNA 2F8LA 1Z38A 2IFTA 4WNAA 2DEUA 5IFKA 1DC7A 4JDPA 5AI8A 3VPXA 5LSAA 2IYOA 1MB2A 2GS9A 1GT6A 3BBLA 4A7PA 4B6PA 3ESRA 3NH6A 1HPLA 1LVHA 3O2QB 5K3DA 4NK4A 4MGYR 4D25A 4QT0A 3QFRA 4DMCA 1YOVB 3OQNA 3GRFA 3JVIA 3RS8A 4IX1A 1SA0A 1J2JA 2WT4A 2YY7A 4I2VA 4JEIA 3FUTA 4RJ2A 5T41A 5BUSA 4N1AA 4PPGA 1VJ1A 1YDGA 3B1FA 5CLQA 1RYHA 3MCWA 4CTNA 4DCTA 1CB7A 1B8VA 1QHNA 1QTRA 1TW3A 4NFSA 1U0FA 3K2QA 1BX1A 1FYFA 4JEUA 4ZODA 4Q9DA 4B6EA 3TG2A 2J09A 3AUYA 1IBRA 4GFDA 1MAWA 2D4AA 2HSWA 2HK6A 3HNRA 4IDCA 5G0TA 1KH1A 4B5LA 2CEKA 1V95A 2H92A 4O2AB 3X1YA 3DVAB 4L50A 2YJ4A 5EJFA 5ES3A 1C7IA 4S1OA 4C78A 1J0EA 1E98A 3GQVA 4CG3A 2R8ZA 2V98A 3QFCA 4TLBA 1Z8NA 4LZWA 5HCIA 3TLCA 1RRFA 3BD7A 3HCFA 3L0IB 2QTWB 3WZ2A 4YJ3A 1LK0A 1X7DA 2C7RA 4OYYA 1I9CA 1Y8QB 3G85A 1KYIA 2DBZA 3AESA 3IH5A 1BE1A 3HUEA 3I9FA 4RD1A 5SY9A 5JNWA 1VL6A 1R0WA 4A8HA 4OB6A 2OAQ1 3OOHA 5CNIA 3FCEA 4DT1B 1NNI1 1XTBA 3KDPA 4CCYB 3EVGA 3GLQA 5H81A 1T34A 3AOEA 2REQB 1SHZA 2BN4A 1XTZA 5FOQA 1QP8A 4H2DA 1NVKA 5AUQA 3UJPA 3WGKA 3AKZA 5JZSA 3H75A 5IWCA 4B2IA 1V6AA 5E6UB 1FJXA 1X42A 3PQ4A 1OYOA 2H0QA 3EBLA 2TRSB 3KUDA 3NP7A 4LHYA 4NEQA 5IBQA 2NSYA 1CUJA 2WWGA 4AX8A 4FCVA 3FPHA 1SC6A 1D4ZA 4XR9A 2FZGA 2GEJA 4CR8A 3OFND 5FOXA 3VOAA 4RVGA 2J7KA 1F20A 4E2XA 3KV1A 2DHCA 4EF6A 1MUUA 2AZMA 4TUYB 3KETA 1HE4A 2EYUA 4FNGA 3HR8A 3OUTA 4TQGA 4Y6SA 4D56A 4YR9A 4EPVA 3ZVRA 2GRJA 1ZGJA 1I32A 4OQLA 2XD4A 1J21A 1JDSA 3RE1A 4QL3A 4I6JA 1YVPA 4FYPA 1UC4B 3NDPA 4AO8A 4F5DA 1VPWA 2ZB7A 5FQOA 1E1DA 3IBGA 4JT9A 1FB5A 3KSUA 5E4TA 4QARA 3HTXA 3QZUA 2JFOA 1IY9A 2GCOB 3NGXA 4BVLA 3B6ZA 3WB1A 1OU0A 2HYIC 2R6ZA 5MFPA 5FI3A 2AE2A 2QLJA 5EQJB 3E53A 3N3AC 3ABSB 1MAHA 3SJ7A 3CU5A 2AX3A 2CD7A 2AR0A 3DEAA 4LWOA 1G6HA 2ONKA 1D6SA 3R0XA 4N4AA 3QKRB 2P2DA 2A5JA 3BSWA 3JASB 4P3PA 1T5BA 4YP6A 4ENSA 1PJ2A 1RC0A 1O6GA 2AR7A 1T0HB 2MDTA 3DZJA 4TYMA 5DM2A 2LDBA 3UB4A 4U3JA 3D7RA 3JQAD 4L9WA 3S6JA 1FRNA 2QUAA 1P77A 5LBUA 1V9SA 2VT7A 3AETA 3T54A 4CIDA 1CEQA 2D06A 2I7CA 3LTEA 4GOMD 2MSCB 4KN6A 4AB1A 1A76A 4P4LA 1E5XA 4S0XA 3GDHA 2R6R1 3D8UA 4V0RA 3AILA 1K89A 5ALGA 1GD1O 5JMTA 2JD1A 4NPCA 5FEMA 4FUTA 4W9RA 5I9NA 2ZJ3A 2B2NA 2OESA 1SKQA 3DFMA 1T3ZA 3LUDA 1GNQA 4FN5A 2OO5C 1PJSA 1H2HA 1SURA 3DE1X 3HCNA 4ROTA 1Z4JA 2V0CA 3SZGA 4JYAB 1ISGA 1ZHFA 2ZM5A 2BCGY 1V7PC 2OLJA 4BTEA 2MINA 4MAFA 5FIUA 3GPDG 2RH8A 1RI2A 4G4SO 4RL4A 3ZQ6A 4HXYA 2QTTA 2Q7DA 4OQMA 3H2IA 4QWMA 5FBVB 2CJPA 1FFDA 4HHEA 2CFIA 5FTMA 2IODA 1JLHA 3KVNA 3MWDB 4FR2A 2AR9A 3PLNA 3UJCA 1SXGA 5K51A 4DMUB 4X1IB 3GXOA 1DV2A 3BAZA 4IO0A 1P9LA 3C48A 3LLUA 5E1DA 3D3KA 7REQA 4C1BA 1Z3CA 3PA8A 4TLMB 4XB1A 2VAWA 1XD9A 2I4TA 2P5UA 1BKDR 3ONEA 3PDJA 4UOEA 2W7TA 3GMSA 3OM0A 1OXUA 2FEWB 3OFNA 4HRVA 4BMZA 4DCVA 1QQAA 5A6VA 4ZCLA 3SI7A 2CCGA 2IHTA 1UPXA 4PQFA 3CUUA 4ND8A 2XYQA 2ZUUA 2ODWA 3I1IA 3K30A 4PSAA 5EE9A 4UZSA 2WU8A 1YASA 2GBPA 2V7EA 5CPBA 2ZREA 4MR9B 4DC1A 4DQUA 3KU1A 4BJ3A 4LJYA 5ALEA 2HRCA 2EARA 2KW5A 4HXFB 2R1VA 5FA5A 3RRMA 4EKGA 4ER3A 2O06A 1OY1A 2AD5A 1FNCA 1VKNA 1X1RA 2SHKA 2Y05A 4F86A 1U0BB 3W5AA 2JKZA 3LI2A 3U09A 2QM8A 3M1YA 3T95A 2BPOA 5LA6F 2BGGA 1B7GO 4M9SA 1P8JA 1V5WA 4CHGA 2VYFA 2WDPA 3EIWA 4IJMA 2WKRA 4DBLC 1MO4A 1YQ9A 1Y3CE 1P80A 4QE3A