4MK4A

S197c variant of human ferrochelatase.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCCTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title S197C variant of human ferrochelatase.
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 132
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mk4A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mk4A01
2QD3A 4F4DA 2AC2A 2QD1A 1C9EA 2JH3A 2DJ5A 2XWPA 3HCRA 1HRKA 2PNJA 2Q2NA 4KLCA 3LYHA 4KMMA 2QD4A 1L8XA 2Q2OA 1LD3A 3HCNA 2XWSA 2XVYA 1DOZA 2PO7A 3M4ZA 2QD2A 2AC4A 3AQIA 2PO5A 3HCPA 4KLAA 2QD5A 2XVZA 2H1WA 3W1WA 3GOQA 1C1HA 4CCSA 1AK1A 2H1VA 1QGOA 1TJNA 4KLRA 4MK4A 2HK6A 1LBQA 2XVXA 2HRCA 3HCOA 2HREA 2C8JA 2XWQA 1N0IA 2Q3JA
chains in the Genus database with same CATH superfamily
3UC9A 3H65A 3EPJA 1PTKA 1Z5ZA 1K6MA 3M6WA 2BRUA 4WH0A 5KYYA 2AJLI 1JPJA 3AHCA 4BQNA 7AT1A 5LZ8A 1CP2A 3VH3A 1KAQA 1U2DC 3G88A 3NLLA 3OX1A 3F73A 2P2SA 4ZTBA 4UEJA 3CLUC 4F6CA 3LPNA 3OOSA 3V34A 3QTLA 4E21A 4HRXA 1KOJA 2WJJA 4I66A 4BRWA 2HPVA 2Q0XA 2OB2A 2RGXA 3AJ8A 3LOQA 2GXUA 1JE0A 2R00C 1GSAA 2QT0A 3LUCA 3M9XA 1NT4A 1NUAA 2I0FA 2Q21A 3HVUA 1JWLA 2Y0BA 4Q93A 4DV2B 1CVRA 3KQYA 2QLNA 3DFKA 1Q15A 1VG0B 2PD4A 2VYQA 4TN1A 1DEAA 4FYVA 4Q16A 2G6BA 3SVTA 2WQZA 2YX1A 3LO8A 4RZ2A 2R6ZA 2C4UA 2JH3A 3I30X 4TM7A 4TTTS 1NXSA 4G1CA 5CTJA 5D85A 2AXQA 3TW8B 3QIVA 4NMHA 4P32A 2H2WA 4LZLA 3W5UA 3ZE9A 1WUIS 3E5MA 2EBHX 2ZRQA 3OU7A 4CTOA 1YOBA 4YI5A 1AKQA 2WICA 3DTTA 1UFQA 3TZ6A 4IJMA 2JA1A 4KYTA 4WCDA 4ZI2A 1FSZA 1CRQA 1BA3A 3OM9A 5BYAA 1BXRB 1EJBA 4FFOA 2NU9A 4KVZA 5AXAA 2Z2JA 3N2LA 1JHZA 3MT9A 1XXHA 2RGGA 5BSKA 3ZKAA 1M2JA 2FW1A 2OGSA 2XRFA 4B3DA 2G09A 3UGKA 3WK9A 1ZCJA 3FWNA 4GL2A 1SCUA 4ND7A 1HQCA 3IVMA 2J6CA 4C04A 4MJ3A 3DKVA 2IOHA 3VYTB 1TLFA 1HYGA 2PWYA 4BO7A 5CGZA 2RAPA 1ADCA 3CHYA 3DDZX 3HY3A 5AKJA 3EGXB 3ER9A 5G0VA 3FWPA 1J33A 3GH1A 2YS7A 3JRNA 3UVEA 4OSOA 4D7AA 3GZNB 2AJCA 1T3ZA 1Z6YA 1ELOA 2D62A 4OLFA 5CLIA 1U8CB 4XRGA 1QMGA 1V3VA 1VKOA 2PLAA 2I55A 4RYLA 1ZVVA 2QPLA 3G9ZA 5DYTA 5FNVA 3FOBA 4GM4A 5CEFA 1MV5A 4OGWA 2WUFA 5A6SB 3IO3A 2FE4A 2X0RA 1W8DA 2XI4A 3H2ZA 2A9VA 4NQZA 5E8JA 4CMGA 3GIDA 2PTGA 5AW0A 3KSAC 1U11A 4YBZA 4FKZA 4W8OA 3QW2A 5KDLA 3M9LA 1IHYA 1N0VC 3AHFA 5JAPA 2RHMA 1YBVA 1KE1A 4X41A 2ZB7A 3SHOA 2I5PO 3PKZA 4AJ2A 1Y8RB 3WIBA 5EPUA 1N7GA 4YROA 3EGEA 3R0VA 3EVTA 3LDAA 5EXTA 3OCZA 1IOVA 3C14C 1KDZA 4E6EA 4RCYA 4N3BA 1Q0TA 3RBXA 3WFJA 3NJ8A 4RXMA 3SJZA 3MN1A 2XSZA 9MHTA 3OSZA 1U02A 2AUNA 3GJ4A 3ROGA 5EXXA 1PHRA 3BGOS 2C1ZA 2EZUA 4CIYA 2QMZA 4MRVA 4EP1A 2PXHA 4MUFA 5A6VA 1AGYA 1ZXXA 3SR4A 4AJ4A 1POXA 4X0EA 5J2UA 3C1TA 3LP5A 1V11A 1EZ4A 3EVAA 4RPLA 3IKVA 1RJGA 1ZM9A 3HG7A 3PCRB 5FPHA 4ZYZA 1LLFA 4ZGGA 4AL4A 3O82A 5K0EA 5J47A 3LT2A 1RRPA 3EHDA 1QV9A 2P79A 3GLSA 3K5WA 4IMJB 3GA0A 2EL9A 1V16A 5DLEA 4TYNA 2PGDA 1QQ6A 4FI3F 4QQNA 5F35A 4IWXA 4XCXA 5CH3A 1EINA 3AXSA 1D0VA 3LCRA 4H16A 4DFDA 2RGNC 1U4SA 3H3XA 4H3HB 4O4JF 3ZNQA 3QF4B 3GJ5A 2YYZA 4J0CA 5BN1A 3P9KA 1OWMA 2IF2A 1G64A 1UK9A 3BJRA 4P7KA 1KY4A 1WCXA 4AF6A 4KQJA 1Z68A 2QVZX 3SY8A 2P6UA 4Q9IA 4F4DA 2PUBA 4QOGA 4ZT3A 2PRZA 2PXAA 3D7KA 4LUCA 1Q1ZA 2RK4A 1HLGA 4I3GA 3OKFA 3A7DA 4JNKA 1ISHA 2WF8A 3F0TA 3E5HA 2JGDA 4M3NA 1BZYA 1AKUA 1G0OA 2WV9A 4BX3A 1OLSA 2JFYA 2QWXA 1KEEA 1W36C 2A0KA 3AUKA 4GZ5A 1LH0A 1CRLA 2H3HA 1YNOA 4OPMA 1FRFS 1H85A 5IP5A 3W5IA 2V7VA 2QRHA 4YT8A 2Q5JA 3L06A 1HE8B 3RF7A 3WNVA 1AT1A 3BL5A 3EEFA 3QQ5A 3VU8A 1KO4A 2WYHA 3C41J 3W4JA 2AWOA 5D00A 5ISMA 3DLBA 1U9JA 4DLAA 4IDCA 5CU7A 1MVLA 2VYVD 2GPBA 5KNBD 1Z7GA 3CC8A 7ADHA 2X19A 2GPTA 4C01A 3RHZA 1UODA 2YBEA 1W85A 3SQMA 3U3KA 3UK2A 1MAHA 4F0JA 5BMVA 2NSDA 3EEIA 4H1UA 5AHOA 3UJ9A 1OGIA 4HK4A 1WHSB 4FDLA 4J9UE 2NV2B 2VPIA 1KFBB 3U48A 4M4SA 3KQHA 1AK9A 2FVYA 4TYQA 1EXWA 3E9NA 3I5AA 1KDTA 1BCSA 2L18A 2BKXA 2X9LA 3R9IA 3TXAA 3ZBTA 1UT6A 2FPPA 3KXDA 3VC7A 1E6CA 1QVZA 4MRPA 4WFQA 3PVCA 3CNBA 1XFDA 3QJ5A 1PJTA 1SG9A 4DNFA 2IH2A 3MJEA 1P5JA 5F12A 3KFLA 2F1JA 3JY6A 2FPXA 1NQVA 3R77A 4FCWA 1U65A 2P9HA 4DG5A 2ZWPA 4L6AA 3QU7A 1PR4A 2NU6A 3A6ZA 4IEFB 2JI9A 1E4YA 2I7DA 3MINB 2FCAA 4FP9A 4QTXA 2W70A 3LQ2A 4DIMA 4EB8A 5EZQA 1C50A 1CS0A 2CXRA 2HCBA 2XOXA 3HCPA 3ONWA 4KXXA 3SVLA 3SCZA 4OHVA 1XPJA 1D6NA 4ESEA 5DNEA 2ATXA 3GGDA 3LC2O 3R7SA 1MRZA 2DUWA 4UM7A 1N4AA 2VHEA 1TU0A 2R97A 1N2CA 1DRVA 4CQMB 1H3NA 2PA0A 4MB0A 4XD7A 4PS1A 1THMA 3A37A 5AK3A 2CZGA 2NNLD 3T5CA 4QFMA 1I2BA 4A1FA 4MITA 5EQTA 1Z6XA 3AYZB 3D59A 3OCVA 4FYIA 2J3MA 4B4WA 5LYJB 3S55A 3RU7A 4FBMA 3L4JA 3KYDA 4AN0A 1I6KA 3DAGA 5AUOB 1MENA 3L02A 2CDRA 4FFRA 1C3OB 4JQCA 5FYDA 3WAKA 3ILVA 1FUEA 1TIBA 1FLAA 1X1TA 2LTAA 1E1CB 1V9LA 4R8RA 4Y2HA 3ZZNA 3IV6A 3IPXA 1VL8A 1U99A 1TYBE 3ETLA 2VEOA 2PX2A 3R76A 3HKCA 1A9SA 1GPMA 5LWQA 3FZEA 3RTGA 4DKJA 2I76A 3E48A 1Z3IX 2H29A 3AHGA 1T8SA 1C1HA 1QIFA 5GGXA 1AOXA 2YXBA 1XLUA 1QFYA 3H2HA 3OQMA 1ENZA 3C6YA 3GLQA 4ZXFA 3JR3A 5K3EA 3HKEA 1PQUA 1RXIA 3MA0A 3PS9A 5D3MA 1JLHA 3KDSE 2R7AA 3UOWA 5IYZB 2XZTA 1PZMA 2P6NA 1UJ4A 3L6BA 4EHHA 1A97A 4W6ZA 5CM9C 2PNFA 1HZZA 2BE9A 2N75A 3MCUA 3B1YA 4I5EA 1B0UA 1GGFA 2YJGA 3AC0A 1JEYB 1TJ5A 1LTQA 5KJ6A 4DLKA 1KIAA 3BC1A 5IDXA 1K7XB 1L6IA 4QXOA 2OV1A 2WM9B 4YMWA 5DU2A 4B1FA 2EWMA 2C04A 2AN3A 2C82A 4G1UC 4IPTA 4KGDA 1FFWA 4WCFB 4FINA 1DT3A 1FZQA 2Y8EA 3MHPA 4RD4A 4JI1B 3CZRA 3EF0A 3I28A 2J46A 4MS4B 5AYVA 4BVHA 1DAMA 1L5RA 1RCFA 4TYMA 3KKKA 4DA9A 4JB3A 1M1ZA 3D6HA 2RMKA 2QU8A 5E9WA 1BE1A 2Q6OA 3NBAA 2QP4A 3TPCA 5C1BA 5DX8A 3VX3A 4MWOA 1HDYA 2FLVA 4OHOA 3SSMA 3GYGA 3ZHTA 4DDWA 3HVKA 3BWBA 3KQQA 2HHAA 3R6WA 1PDVA 2QAJA 3DJYA 1MOZA 2VDLB 3N2GB 1PQWA 4Q3BA 5KWVA 3K5IA 2ZYAA 4TKZA 3X1WA 3WGIA 2YNMD 3M6FA 2AEMA 3FPAA 3NRCA 1EUCB 1DAFA 4B48A 2JJ1D 2ZULA 3VXKA 3M5CA 5IK2A 2FPWA 5L4LA 1DDGA 4PFKA 3R7BA 3WYGA 1DP4A 1BCRB 3K0AA 3PR1A 1T3TA 3EXHB 3B6IA 4I19A 3F6RA 4UHBA 2A5GA 1O58A 4KQWA 1N9GB 4Q7MB 4PX5A 5FWAA 3UJBA 1G55A 4JJ6A 1XA3A 3NHUA 2KQUA 3FHCB 2BFFB 1SQ6A 1T5DX 1Z6QA 4KAJA 5JYEA 2J7PD 3OFNA 5BRAA 4Q9DA 3IVRA 3KT3A 5AJYA 5TC4A 3TRDA 2B1QA 1Q84A 2EVWX 2DM6A 1IPFA 1TAHA 3NHFA 3URMA 3E3OA 4KPEC 2EG9A 1A4UA 2WU1A 5EWJB 4JFRA 4EJ6A 2J6HA 1XO1A 5SV2A 5WRFA 1WETA 1D4AA 4ZHQB 3GFTA 4AZWA 3FUXA 1N9ZA 4HTFA 1Q2XA 1KFCB 5B6PA 3HLTA 1H2RS 1Z08A 3RS0A 3WB1A 5C3MA 1EK0A 1EE9A 4B6GA 2CUKA 2X2EA 4PSDA 3MWFA 4Y7CA 3PQ8A 4J7CA 3AF1A 3A11A 3H9EO 4Z54A 4NBTA 3TMKA 2V6JA 2R65A 2IYAA 10MHA 1SCDA 4E2FA 2O2HA 4N7RA 3E7FA 3F6YA 2IEYA 3RROA 5KYTA 1ZK4A 1DEXA 2AR9A 3PUXA 4QUAA 5C3UA 2JFXA 1NKTA 1JIIA 1RXEA 1T4MA 3AX6A 3EFOA 3JAKA 1G6OA 1C2TA 2ORED 2X76A 3V4VB 1I3CA 2NYAA 1UPBA 5CVEA 3T41A 3OIYA 5F23A 3LKBA 4YAWA 3SEZA 3QLUC 1Y0BA 4G4GA 4K6OA 4KOEC 4II3A 4DNOA 3RJTA 1CUCA 1Z62A 3FWKA 2IYWA 4QX6A 3WK8A 1NR5A 2EKLA 3E3NA 3Q9NA 3T34A 3KLNA 1XKQA 1BYIA 2P9YA 3E6AA 2IEBA 2ONCA 1UL1X 1SIWA 4JVSB 5EJ2A 4Y2SA 2A9FA 5FKJA 3SX2A 2R7MA 4BMYA 3IDQA 5IF9A 1UFVA 4HDRA 1KJIA 1TECE 5GM1A 4GU5A 4Q1BA 2WAYA 1RC8A 4WBSA 4M6WA 3V8VA 2UZ4A 4AQYB 1NU6A 1A2BA 3F7TA 2R6CA 4V2IA 5DW3A 1P5RA 3SHWA 3TD6A 1P2SA 2A9RA 3R6GA 4M7PA 5KYWA 4UC0A 1E60A 3MMNA 2J1LA 3OKPA 4FDTA 3K70D 2AC7A 1G7SA 3F47A 3EVGA 4GBJA 3AEQA 4ASUD 2DPMA 1HNWB 1MC4A 5JNWA 3AJDA 3OKAA 2N0SA 3SHVA 5MHTA 1KEKA 1TEZA 4HDSB 4P36A 3GQVA 4X61A 1OFVA 4FGWA 3T1OA 3WK7A 1XQWA 3AVWA 3ONEA 4DV7B 1ZCZA 2HOQA 3U3JA 3SZ3A 4C7MA 4KH0A 3V5NA 1Z4KA 1RI5A 1KJJA 3RK4A 1PLLA 3THWB 2ANCA 4B3XA 3KB2A 3FYSA 3T7RA 1CU1A 2LE0A 1KVRA 3LTEA 4WFKA 1X80B 4PZPA 1WD7A 4D92A 4DCTA 3LH5A 3PDCA 2V65A 4HLUC 4KPGA 2PEZA 3VVBA 3I2HA 1L4MA 5GONB 2VF4X 4K86A 5HK8A 3UTCA 5ADHA 2ZUVA 2O2YA 4YV1A 4QGHA 3NNSA 4RA6A 1R4MA 2FW8A 3I72A 4C4PA 1QIEA 2AZMA 1NR7A 3AF5A 1VLLA 1CXZA 2A1IA 4NJEA 5HRCA 4XZ3A 4HXEB 3UWKA 3U44B 4AUNA 3TIGA 5AM2A 1IONA 4LPSA 3ZIAD 4EPVA 1QR6A 2WTMA 1FQOA 3W3AA 5JCOA 1MW9X 4BAZA 5AW9A 5LQKA 5B3AA 1L7DA 2HK7A 2BGUA 1EFPB 2X2PA 3GP3A 4RK6A 5K05A 4Z4QA 1QE3A 5B1IA 1I4DD 5JAIA 4MW9A 1QR2A 3NX4A 4LIPD 1EQUA 1U1EA 2I4TA 2B1RA 1BG6A 2O0MA 1SXJD 3GJ7A 3SDBA 3T6KA 1QOPB 1NW5A 3OE7A 3PF8A 1VDMA 3U7GA 3H83A 2AEEA 3ANTA 3T1HB 1THGA 4PCUA 5AXDA 4K9SA 3AHEA 3VZBA 4QOHA 4IMPA 1UJ2A 4KU4A 2P9EA 2GEJA 3OEYA 3EZ9A 1XL0A 3K1ZA 1R0KA 3LRXA 4TYYA 4DR5B 3B7PA 4EEZA 3UJCA 3KFVA 1GCIA 1SHLA 2IKSA 2OD9A 3BWVA 4XX1A 2JGRA 2YJ3A 3DQZA 2PUVA 1RWWA 3C8DA 1OIWA 3G6WA 2V7BA 4JEHA 4LMPA 4FFSA 4NOMA 4US1R 5D1NA 2C96A 3GNLA 3OMXA 2G1JA 1PWHA 3CRZA 1FYDA 3RUFA 2JNWA 3L79A 2HGSA 3BHIA 2BBTA 2ALJA 3L41A 3RH0A 4A6DA 4KI0A 2BFEB 3H9BA 4HN4B 1YCDA 3E8MA 3QF7A 1RDFA 4JU8A 2P9FA 2ZSDA 3DWFA 3GG9A 4EG4A 5L3QB 2FPGB 4QOFA 2HO5A 4TMFA 3JATA 2Z2KA 5LBIA 4BFZA 1P80A 1O0BA 1C8LA 2E1PA 3C8MA 3Q0TA 4Z4IA 1RQ7A 1JHAA 1XVVA 3USES 3A9TA 2BTQA 2P68A 1Y1SA 5EJ6A 2FR0A 2PMKA 3ZHOA 5K3FA 1T8TA 1FNMA 1SY7A 3SEQA 3O2SB 1OLOA 1QX3A 2J9ZB 1ZEJA 3EXIB 4JD5A 3OTIA 4TZ6A 1E2FA 2PGJA 3U9LA 4F3YA 2CY0A 4ARIA 4TKVA 1M6VA 1DIBA 4D44A 4R31A 1SPXA 3NHAA 3SZGA 1WB5A 4Q9KA 1M75A 2AW5A 5IKOA 5K8VA 4P31A 1E9SA 5GV7A 4C89A 1P2TA 1U0HC 2G8NA 2V54A 1AU9A 4PC1A 3LJKA 4DIDA 3U4MA 3VR2D 1N57A 2OKGA 1QXSA 2W5UA 2H8GA 2L69A 3DLPX 4XKJA 5KBYA 3NFRA 1PX2A 5DJ5A 5JVDA 1G20A 3DPUA 4LY6A 5DI9A 4GLOA 2GD6A 5AVZA 1YQTA 2FPKA 5DULA 2R86A 2IQIA 4CLXA 2B98A 3UKOA 3H9GA 3BOSA 3DLTA 4PVCA 2G67A 1BSVA 1E69A 4ALKA 3LFTA 1US8B 1YXMA 3JYNA 4JU9A 4YP1A 5LIPA 4EECA 3ZQ6A 4V0ME 4DMRA 2IHZA 2PZJA 1A8UA 2H0RA 2F1KA 4XLTA 1YBHA 1RWKA 4D4IA 1WBDA 1KRXA 1C5KA 2PMBA 1HK7A 4Q1DA 3RK1A 3OCCA 5JLAA 2ZRFA 3P94A 1B0PA 3Q9LA 3WHPA 2FVXA 3L7YA 3GJXC 4TN5A 3GLVA 4HNAB 1J24A 2Y4NA 1K06A 3AW8A 1B15A 1V43A 2Q3DA 5DHTA 3GN2A 2FK7A 4U4AA 4TS9A 1W47A 3CXRA 3GJRA 4HP8A 5FXMA 3KEOA 2XUFA 2IYVA 2ZT8A 4ZDIA 2RGAA 3ZCPA 1EVZA 4KWCA 1YS1X 1BH6A 1PTJA 1F20A 2IPLA 3P20A 4Y3UA 1HF3A 3TSYA 3V97A 4DLVA 1SHZA 3DWIA 4A8JA 1PNVA 2PL5A 5DCWA 4Y6SA 1NBHA 1NQAO 4FFPA 3H5NA 1CIPA 2NZVG 2ZIVB 4KPUB 4EEXA 4BKQA 1A7KA 1C14A 1UC4B 4C0LA 1PL6A 3W5VA 3U3DA 5FUQA 3V8BA 4MO2A 4UMDA 3U7IA 2XXBA 5JYBA 1OXKB 1IBRA 2CFCA 1DO0A 3KBOA 2CNOA 2FLKA 2HF9A 4HAIA 2AI3A 2GBLC 4JAVC 1ZVKA 4LMAA 4TV8B 4DSNA 2C2OA 3A06A 1LJ8A 2I2CA 2OYRA 3F67A 4MUKA 3TYXA 3WRXA 4UTOA 4R4JA 1A0OA 1Z3CA 4HUQA 4I6JA 1AVTA 4HDNB 4DSUA 1HEIA 3ZU2A 3B13B 1M1YA 2C1EA 1LLUA 3GB9A 1J0AA 1PR3A 1NKVA 1E1QD 1UMBA 2C3MA 2OZLA 4EPWA 5HS6A 2OCPA 3G8AA 1ZVMA 2IPNA 2ZVPX 3K9FC 5F5LA 1G8GA 4ML3A 3EFHA 2AOXA 2E4YA 2P40A 4KLCA 1N8NA 5DM2A 3FIUA 1EK6A 3DV0A 3PT5A 5LQAA 4MHTA 4RNDB 1P6UA 3W2GA 4PM4A 3GEEA 4D9MA 3GGCA 3TWOA 4B6PA 2QG6A 3HBJA 2IC5A 2PVSA 1UKYA 2WTNA 3A31A 3JPWA 2O8FB 1DAGA 1L8LA 2IELA 1JHPA 1QGUA 5EKTA 5CFLA 1L4NA 2WM2A 4KO4S 1DG9A 1SBZA 5EI5A 5EJ9A 1CDZA 2YUTA 3LOPA 1HNNA 2FB9A 1ORTA 2NVBA 3QPDA 4QT0A 3BEDA 2HFJA 3DQPA 4WTOA 3GFGA 2ZSHA 2HLPA 3O4GA 4X5OA 3KQNA 4H1TA 2B8NA 3O6VA 4KKVA 1I7LA 1RM4A 3R0XA 4Y2UA 1KMHA 2GA8A 2WUDA 1WQ4A 5EE3A 2PT5A 2Q4EA 2WAOA 1TVKB 2DFVA 3NGMA 4LSZA 1JAHA 3F6SA 1JDZA 1ONBA 2C4MA 3G2JA 3U3XA 3WA6A 3C6KA 4DLUA 2CL5A 2XLCA 4FE4A 4KXQA 3G9XA 4Q00A 2SKEA 3TZBA 4DLLA 5JJBA 3DAPA 1DLJA 3TEFA 3UM9A 2WT9A 1M0TA 1YI8A 1Y8QA 3QBEA 2OECA 3A10A 1G291 4QICA 4LRTB 2D1TA 5HCIA 3MBKA 4QPZA 4KBGA 2Y77A 5TPWA 3HCEA 3JYPA 4JLMA 2ONJA 3RIXA 3TN7A 3HUFA 5D5QA 3RBVA 3ZR4B 5D86A 1TIKA 3EA4A 1M5RA 3KLBA 4Y2JA 4NCXA 2DSTA 1XQ9A 5JNLA 4AI6A 4GP7A 3TZCA 1SZPA 2HL6A 3RS8A 3L7BA 2OHIA 1IYZA 1WMBA 3WA7A 3VAYA 1QHSA 2H52A 2V59A 1TCCA 3K0BA 2HWKA 4LHSA 3O8BA 4CE6A 4RK5A 1PT6A 5H81A 2C20A 2CB9A 1XCLA 2Z6QA 1ZWLA 5EIWA 1OD6A 2A84A 1FYEA 1TZMA 3NRBA 1ZD2P 3KQSA 3ZLTA 4WOJA 3U0VA 3QFHA 1PL7A 3FYTA 5IJWA 2UYGA 1TYZA 2IY9A 1OPRA 2RH9B 2PUWA 1JQKA 3KLMX 5JMTA 1OILA 4F5WA 5AHKA 4AT1A 3R5HA 1ZAKA 3TLXA 3ZI7A 3Q3HA 2CLKB 1DQZA 3DE7X 3E27A 4RJIA 3ZS9A 1AA6A 2HCTA 2XUZA 1VJRA 1NX9A 1G9XA 1LVGA 2I4OA 2FWAA 5CPFA 1BQEA 1IWPB 1CB0A 1SUCA 3QH4A 4JYMA 4KE9A 3RWBA 5BN3B 2B37A 4IDFA 2Q5FA 3PJEA 4L57A 1R2QA 5IWCA 4RTRA 5A4AA 4IWYA 5IRCD 1ESNA 2EKPA 5LD2C 4RGQA 4Y8VA 3JR7A 1PNOA 2XVYA 3VKVA 5E38A 4GECA 4F85A 1OFHA 1QE5A 3DNFA 4RSRA 3N9IA 3IDFA 3U26A 3UJPA 5FDFA 1Y4DE 4KXVA 3UV3A 3BTUA 1W2GA 3S1LA 4DCCA 5AKZA 4V3BA 2ZQZA 4TKUA 5EZ5A 5KMGB 5JS6A 1DXYA 3C3MA 2IUTA 1E5VA 3O8OA 3M6UA 3FWHA 1FTYA 1FPQA 1GQOA 1XVUA 3EQ6A 2H2IA 1L3IA 5LOVF 4EKNB 1PDWA 4HJRA 2WYVA 2YZKA 2FZ5A 3RGGA 3T3OA 3GZJA 2NVWA 3U3ZA 4UHEA 3UG6A 2JAPA 2QTCA 3K70C 1EU1A 1SQSA 2I4RA 1VLHA 2VOEA 3K9LA 3T4UA 3ERCA 4QEDA 1PZEA 2MMGA 3CY6A 4YP7A 4N76A 2TRSB 3BFKA 1A5SB 1JH8A 2GN6A 3ESQA 4JROA 4WY2A 4C4SA 1Q0ZA 2FEKA 5IKMA 3HH8A 1IJEA 2XUQA 1L5MA 5EZYB 4ER0A 3C98A 1HTBA 3MWLA 1GAWA 1NVDA 2HK6A 5BORA 1HGXA 3LT0A 3VR3D 4NI5A 5LQMA 3MCAA 5TQ0B 4E5MA 1CRWG 3ETHA 1GGHA 1JV2B 5K0LA 3B8HA 5A7HA 3EEOA 5SYMA 3F6EX 1COWA 3I0NA 3IEKA 4OK3A 3I9FA 1AA9A 2B61A 1EFRA 4NOKA 1RMYA 5TB5A 1ZITA 3LV8A 2RDMA 4Q4HA 1U3CA 2FU5C 4M1SA 4UBLA 3C8UA 1UMCA 2XUJA 1HTTA 4AK9A 4LQ4A 4OL9A 4UFOA 1FPMA 2OORC 1TF7A 2D5AA 3E9CA 1I51A 4NU6A 1SKQA 4NMXB 3L6OO 3A27A 3GJTA 4C7KA 2E6UX 4K6GA 2XRMA 1QK3A 1T5OA 4URHA 5FL3A 1K92A 4D0GA 3LE8A 4B3FX 4ZIRA 3W2IA 4P53A 2VNIA 4MWGA 5CMLA 3K72B 3NDBB 1JU3A 3K0SA 4C0AC 3LUAA 4CFYA 1JHYA 2D3TA 3URKA 2JHGA 2Z2YA 3R9XB 1M1UA 3COJA 2VP2A 3AKEA 1H0HA 1H5QA 4BIMA 2NUPB 1OC2A 2PMDA 3EC2A 3FSRA 1ND6A 2IDZA 1UFKA 4PTZA 4Z0TA 3Q4GA 3SF8A 3BJMA 5C8YA 1NN3A 2PMCA 2QMQA 2BHTA 3ZOKA 4C05A 4HYTA 5FOQA 3VDRA 5KNBA 2CVPA 1E79D 1JMVA 3DDCA 4F3NA 1IEQA 1U90A 6NULA 4B6SA 2PZFA 4G0OA 3BMCA 3OBBA 4P0TA 3WB0A 4F1JA 3DYVA 4F2WA 1ML4A 4ENSA 5C1OA 3C3XA 3CLRC 2BMEA 1FJGB 1CEXA 3C1AA 3DEFA 4KTVE 3WICA 4P08A 3PEWA 3RYHB 1F8GA 2ZRNA 4CEIB 3CLKA 2D0PB 1MFZA 4KDRA 3DB1A 1GNSA 5IAEA 3V42A 3WGQA 2JRCA 4BLWA 3JCZA 1WSDA 2KI5A 4UVIA 5IWAB 1Z4MA 3I9JA 3CCFA 3VPHA 5GWXA 2JHPA 2QSZA 2O2CA 1U7XA 3ILSA 5H5JA 2A1UB 4EY3A 2ET6A 4R2MA 1WUHS 4QNRA 3PDUA 4JHXA 3ZY6A 3RRXA 1LPPA 2P1RA 2Z1NA 4OU4A 5B1DA 4MEJA 4BNNA 5K6AA 3DKIA 4MIOA 1GPUA 2R7KA 1B4DA 1XTTA 2EGHA 3O90A 1BXRA 1O94A 2O7RA 2DCMA 3ZD6A 2A6PA 4L8GA 2P3OA 1ZPDA 3TIIA 4EMBA 5DLQC 1HMYA 3KZXA 5EMMA 1T6XA 1UWVA 1WXFA 3LQ4A 3MIZA 4JFAA 6AT1A 2PEYA 2XLBA 3AXTA 3VMMA 2XVMA 4CI9A 1FVOA 2SCUB 4AY2A 3CLHA 2I4LA 1DQNA 3BQNB 3KT8A 1L8AA 3ROPA 4UDOA 3UJAA 3VJLA 1FF9A 3H1EA 3TNYA 1XTZA 3HO1A 4S3MA 1VXRA 2W2QA 1KZ7B 3EGXA 4LSMA 4FR2A 2QTAA 3B6JA 3IP5A 1OZHA 4HDKB 2R1ZA 4K7JA 1T36B 3GZNA 4URYR 1EDZA 5ENDA 3HVRA 2IL1A 1SO8A 1LVUA 2PLNA 2Z4TA 1JFVA 2EX0A 4GOXA 4OQMA 2Z4RA 1A27A 5BWCA 1L7BA 4ALNA 1NRIA 2OLJA 3GRYA 3IUSA 3T61A 1D1QA 2IFTA 3C4QA 5IBRA 1R0WA 2AK3A 2OV8A 1XPOA 5C8DA 1G4UR 1W29A 4G5QA 2AI2A 4LSWA 2IWRA 1K68A 5JWHA 1K4KA 3NVMB 3AF4A 1K4YA 1SVLA 3EUAA 1K98A 3QWHA 5PGMA 1DFIA 3W2EA 4A0RA 3ZHSA 3GNSA 1U0TA 2LWIA 3LLCA 1G42A 1XZ8A 1UKCA 2B83A 1Y8RA 4JYCA 5KOJB 3ZKWB 4US0R 3FYCA 3HVIA 3OFSA 2UZIR 4QEZA 2HSZA 3QKTA 4QQKA 3X2EA 1PL0A 1FSFA 3PA6A 1J39A 3OZ7A 1P91A 5BUSA 2I2BA 3W34A 1I2CA 4NECA 4BOYA 3KDPA 4ED9A 3ZDCA 1XD2B 2ONKA 5I7WA 2AOVA 1TUBB 3PQ3A 1GYRA 3C87A 4KUHA 3AGPA 3QNUA 5EGNA 3KTOA 3OHSX 2C3PA 1W5FA 1EHCA 3RI3A 5C31A 4QPPA 5KI6A 3ZJVA 4CKXA 3Q6NA 1R12A 4M7RA 4DLWA 2HZ7A 1PKEA 3QFFA 4H7JA 5LWHA 4IVRA 3S40A 4Y2YA 1ZXBA 2I6QA 3N0WA 4XYEA 1AQUA 1LLDA 1PJ8A 2FQ1A 3L7MA 2C42A 1TC1A 2GFHA 3EPKA 3NALA 2Y1FA 4YUZA 4QNMA 5DO9A 4LSGA 1L7PA 4ZRDA 2C2XA 2PKQO 5A3VA 2IUYA 1KPHA 1QIMA 3MRTA 1J99A 4XIFA 4UXHA 3Q72A 2H1VA 4BVEA 5JFGA 3FY4A 1BX0A 1Y5NA 1UPFA 1QAMA 4IRUB 5F7JA 2WILA 2GAJA 3IH5A 3QF4A 1VHDA 2WUEA 3C15C 4YRSA 3RYCB 1UR5A 4EG3A 4HUTA 2OOSA 1G6KA 3BAFA 3AZQA 3GEHA 3M83A 4LRSB 2ECFA 3LGSA 2YIJA 2UU9B 1HETA 1Y4ZA 2HUNA 4HDAA 3ESYA 3TRHA 2QMHA 4ZV7A 1AUXA 3BKXA 3SFTA 3WLTA 1LFAA 2Q4OA 1JIUA 1PWYE 2XTNA 3L8GA 2VATA 4CMEC 4RPJA 1B8OA 2FJPA 5BWNA 1CJMA 3NCTA 2VRBA 3ZJUA 1SVMA 3ZD7A 3B38A 2PJUA 3OTHA 4ZVVA 3FPGA 4FXPA 4KGVA 1KI9A 3HDHA 4RZHA 4CM8A 4OJKA 2VJKA 1G0NA 3I83A 4UAGA 1U8TA 2ERXA 3F4LA 2ZE5A 1G17A 4HQOA 2CNDA 4O4JB 3WHKA 2MU1A 1T2EA 1U94A 4JZYA 2FW0A 5CLFA 3EUWA 2BM8A 1ZW6A 4IBOA 3G5LA 5EKDA 4OK6A 3IVGA 4MQUA 4S2EA 1M6NA 1PYOA 3AUSA 3KPUA 2NO1A 2W2VA 3R4CA 4Q9NA 2GM5A 5KREA 2H16A 4BNHA 2WJYA 3B2NA 4Q37A 4NZZA 1NN0A 2CF6A 4XR9A 2J9RA 2BFAA 2X6TA 3AR4A 1Z0KA 4BVGA 1N6RA 1XDZA 2BHNA 2NZWA 3WGYA 3T3PB 4KQCA 4K6KA 2BEKA 3HXLA 1XVLA 5AOCA 4RTPA 3CISA 1H9AA 1VBKA 2V5UA 3E3AA 5DIFA 1CZRA 1O6ZA 5NLLA 2QGNA 4GQBA 4JELA 3TTYA 2AYZA 5EINA 3I8OA 3WOHA 1DCFA 3OETA 4OAPA 3VYWA 1TF5A 2AE2A 3Q2OA 2HX1A 4HNSA 1XKTA 4Z9AA 5JASA 1SKMA 2M6KA 2MTBA 2X7HA 1BS1A 3INYA 3ZWKA 3C2QA 4XXHA 4TL6A 1S8OA 4CRWB 4KGXA 3FCSB 3K0FB 1XDDA 3G2PA 4YS6A 2PRYA 3GD5A 3K9NA 2CYAA 4ND3A 4RZSA 2CGEA 3BL8A 4HZIA 4TGLA 4J6EA 2YS6A 3MJSA 4OYLA 5CG2A 2JI7A 2Q2WA 5FL7A 3EMDA 5FPPA 3RAPR 3TKLA 4CM6A 1PGOA 1L7EA 1CW2B 1XK7A 3CEHA 3TQTA 2NIPA 4YAIA 4AKGA 2FRXA 16PKA 5U4XA 5I9MA 4DEYA 5K6TA 2VJQA 2WG1A 3OIFA 1UK8A 2R6AA 3MQ2A 4MRAA 1NFQA 4CUZA 4EY6A 5CFNA 3TFQA 1C4OA 2JJ8A 1F2DA 4OB8A 2DEUA 3TZHA 4CQMA 1DJLA 1GDDA 2FDCA 3U1BA 2ISQA 5FUXA 2A0YA 4KIWA 1J90A 5DLDA 2KS6A 3IGFA 1QTQA 3JV7A 2HMUA 4G0VA 1MTZA 1D9XA 3S7ZA 4OQZA 5JPCA 1N32B 2J9XB 1DJNA 2KWIA 2EBUA 4P5DA 5ALJA 2IE8A 3PUVA 1C3OA 1E9EA 1XHFA 1OI3A 1TKBA 1D1PA 2BUAA 1E1CA 1ZW1A 2F3QA 2PKYX 2DH5A 3R44A 4Y2XA 1ZICA 3OM8A 2O2GA 5E2AA 2FG7C 1JHRA 2R8RA 3FJOA 4IDAA 1RQ2A 4GI3A 3WL8A 4EG1A 3V1NA 1KH1A 1PHPA 3F5SA 2K6GA 4HAYA 3O94A 4K6FA 3QFCA 4JQOA 4IUCS 3SM9A 1NN5A 1WF3A 2DYKA 1A2OA 3BJIC 3BSWA 4R8MA 1KJ9A 7GPBA 3OC0A 1ZOPA 1KEWA 1VKZA 2O3RA 1NASA 2Y1CA 2ZUDA 4DQXA 5CA1F 4ZT4A 3E0QA 4BZXA 1EFTA 1S1MA 1GT6A 3B52X 4PRZA 1TVCA 4KJZA 1R64A 1QDLB 1QF7A 2ODQA 3IBSA 1P0CA 3AU9A 3BMQB 3GCGA 4KWTA 5AKXA 4LBWA 1FYFA 4MARA 1WJGA 1JEYA 4B9EA 4GGOA 4GOLD 4HN2A 2ZTHA 4IKEA 3L8YA 3PVSA 1SOWA 3UENA 1XFAA 3LXMA 5KCMA 3WKCA 4XLLA 4LJ5A 2E4ZA 4M1OA 3M6AA 2EEZA 1CCWA 3QUCA 1GCAA 1E1DA 3HR8A 5G3ZA 4MS4A 2RIRA 3DT8A 2PSFA 2G76A 4YGYA 3RK0A 3A6KA 4YK7A 3RT7A 4D42A 1FDRA 3MS2A 4OGLA 4MGZR 1F17A 5J58A 2A58A 1F8YA 5JAZA 3LNTA 2ZWIA 1MQSA 2BFNA 2Q2VA 5AIBA 5BR1A 2XNJA 5HYVA 1KYZA 1JDJA 4BMVA 2CW5A 3AKDA 1QX4A 1E6UA 1GM5A 1P33A 1IM5A 3RDPA 2R6FA 4FYWA 1M2WA 3F9CA 4OH7A 3VHXB 1ZN7A 4RH1A 4RL6A 2BD0A 2E4AA 3PWKA 5EQFA 1A9QA 3L1UA 4XJSA 4RV5A 4LFAB 1W0CA 3N2GA 3PNBA 5JPIA 1AH2A 1AO0A 4L27A 3JALB 4EG7A 1LBSA 3MJVA 4L5YA 3FAZA 1YNSA 4E22A 3HNRA 1PWZA 1TEXA 3IR5A 1YFJA 2G9UA 1MN6A 5AJWA 1L4LA 1P0IA 3TQSA 5LR6A 4BC0A 3ISJA 2CHGA 3TGLA 3NO4A 4EZIA 3EXHA 1Q7CA 3CZMA 4HB0A 5J1SB 4OMFG 2Z5FA 1V5IA 3HZOA 1N9GA 4L22A 2C2GA 2CK3D 1YUBA 2C97A 2YASA 5EIHA 2XQIA 3EW7A 2BFFA 4XIIA 3ZXUB 3A2KA 1RPNA 1SCQA 3CGGA 4OQLA 5FI5A 4FMBB 2LGJA 5B2ZA 3U19A 4B87A 2RH5A 2BTEA 2W6OA 4MYRA 1NXWA 1P7ZA 3TPFA 5JO9A 5F1OA 2BN4A 1XTUA 5IKXA 2QM7A 2QB5A 1MG5A 2ETVA 5EWJA 2XB6A 2XGOA 1EVEA 4ZYTA 4XYGA 1F3LA 2EZ4A 3IEPA 3WHIA 4ZHQA 4CF7A 5CB8A 1CNFA 2GCOB 3ZCTA 2JGKA 4G8CA 3DHVA 4HNRA 4OIMA 1SD1A 3H6HA 2F3SA 1Z25A 1P2VA 1BXGA 4O2BA 4EFLA 1Z82A 2AN5A 2ZZKA 4IDOA 5JXJA 1R0SA 2FF5A 3IVCA 3QW4B 4TXHA 1V8ZA 4DA8A 5IXYA 1Z33A 1Y3IA 5B6JA 2G83A 2ZE7A 3OU2A 3G2MA 3NWPA 1CP3A 4OO3A 3BMNA 4R41A 2WHRA 1Y7TA 1FK8A 4DMUB 2DECA 5JCJD 2C5BA 5EJ4A 4K1LA 2M9MA 4W9NC 3J7TA 3O83A 1BE6A 1GZDA 3X2SA 2AR0A 1Q1EA 1BD3A 4CCSA 3PPXA 3ZNPA 3S8YA 1T5LA 4DLBA 4DV6B 3IHKA 1WULS 3RTAA 2PKCA 1M5TA 3LIPA 3LW7A 4O0LA 4XGRA 1YB5A 4X6LA 3BL6A 4ZGWA 2BBWA 2FETA 1NPTO 3QENA 3U7QA 1OY1A 1OXMA 2HNBA 3NTQA 4HB4A 1Z38A 1M7GA 3AIOA 4DSAA 2W6JA 1P1BA 3WGKA 4UQLA 4XFJA 3RO7A 4CKEB 3UH0A 4UOQA 1TFRA 1OX4B 2DR3A 2I67A 2I7XA 2NSHA 2D2IA 4JH0A 3Q1KA 1PFGA 5CH5A 5EXDA 5BO5A 2UYQA 3SXUB 1ADGA 1C8VB 2Q6IA 3HNOA 1RLMA 1J1ZA 3WX0A 5IULC 3HXMA 1CHNA 1TW2A 3E61A 4WNIA 1U1FA 2CHEA 1EFUA 3DMHA 3QEBZ 2GK4A 2QTRA 2D4AA 3WGZA 4AJNA 4CR6A 5KSWB 4RKQA 3NKFA 1Y80A 3V7FA 5KB3A 1JP7A 4I46A 3RYFB 5FV4A 3AV3A 4XD2A 1JW9B 1RJEA 3SU8A 3RGWS 2IHJA 3D3QA 3IERA 4KR0A 4B71A 1NATA 4EB6B 5BQFA 2KM1A 3ND9A 5HKBA 5KTYA 4PYJA 5ILOA 3K73O 4MUHA 6PFKA 2WA1A 3UPTA 5LMNB 4RIIA 2A0WA 2IV7A 2W6ZA 1UKVY 2ZG6A 2O3UA 3ZWBA 5GZ1A 2BEVA 3KOUA 3S5UA 2BR4A 2XF8A 1CUZA 2D5LA 1K97A 3AF3A 2VJLA 4OM7A 3TL2A 1CQXA 5FX2A 5IKPA 3IQZA 4FS3A 4IS3A 1VZ2A 1NOJA 4MYHA 1SUSA 1ESCA 2WU3A 2CZCA 2GJ8A 4FGSA 4J94A 1Q1GA 4JLVA 4MH0R 4HDOB 2QMEA 3LK6A 1X80A 2AHRA 4NYIR 4EBFA 1ZD4A 2OFFA 2YVQA 1O96A 4MQEA 3STTA 1MJHA 2H1SA 5GONA 1SKAA 5CXSA 1HE3A 3CA8A 4MWDA 4Z1MA 4YV7A 5CUQA 2Y27A 1AKYA 2ADMA 5JEEA 1XJ5A 4Z3OA 4AS1A 2W2NA 4UUMA 2OO3A 4J0EA 1JLSA 2NNWB 3OWOA 1LU9A 5KNDD 2ZRGA 4TTAA 2G82A 3VNQA 1XU7A 3ENWA 2G88A 3IUJA 4YGXB 4HPXB 1G2OA 1ZINA 2BVNA 4HQNA 4RVSA 4C0WA 4D9EA 2H07A 2IOQA 3U44A 1WG8A 1TCAA 1XMJA 2PO7A 4UATA 1C2YA 2C7QA 5IVKA 1Q57A 2PH3A 3C3WA 1JR6A 1G2QA 4FHGA 3MRXA 2X6RA 1U28C 3WJ7A 4AO6A 1GU1A 3ZWMA 4H08A 1EFPA 3SIPA 4N03A 2O5EA 1VFNA 1K1EA 4FW9A 3RUEA 4P4LA 1GXSB 2NVUB 1XCGB 3UAVA 5CLJA 2Z04A 4H7HA 3LECA 1UZMA 2HCRA 5AJXA 1QWSA 2Y71A 1R6BX 4V1CB 5A4KA 1K63A 5ARCA 2L19A 2PRSA 3AHJA 3HBMA 4KXYA 4OY3A 1T43A 4PYMA 2Y76A 3N7TA 2G4VA 1TYEB 1FP7A 1W0KA 4L76A 5IX8A 3C97A 2HDOA 3MTEA 4MUIA 4TT3A 3V4SA 3WQQA 5FA5A 1Q0PA 1OIVA 1FBTA 1IJKA 1T91A 2X0JA 3KYIB 3C24A 4MEBA 1SBIA 1W76A 2R751 3RUDA 1HFWA 1VIDA 1P9NA 1GZVA 2CCJA 4HR7A 4DF3A 4J1SA 2E6KA 1R1DA 4II2A 1U3GA 1STOA 2CMHA 2X14A 2I2DA 1T0PA 3MW8A 2ZCVA 1IAQA 4GXRA 5D7BA 5DBOA 3LZDA 2BFDB 3OZVA 4NCHA 2ONYA 2QENA 3K7EA 3ZK7A 3SZMA 2WZBA 4P80A 4P4UA 1DHTA 4QOEA 1Z18A 3G8BA 4QG7A 4J0QA 4M87A 2WQ6A 5DMXA 3NKLA 5FLEX 1WX1A 3PPIA 4LRYA 4ZU3A 1M33A 2BFEA 2PLRA 1P9LA 4HO1X 1IRIA 1TJPB 2WJ4A 5L3QA 1VCHA 1UBGA 2FPGA 1IM2A 2GH1A 2OBMA 3LT4A 4NLLA 4PS0A 4BCBA 1KJYA 4LJ4A 3L7JA 1WSWA 1PUJA 2DLNA 2A4MA 1P75A 4YIKA 2FG6C 4BASA 5A71A 1AK2A 1C7EA 1LZKA 2G72A 2DY1A 4QD3A 4AZ3B 2QQFA 2FPIB 1W73A 4PXAA 3GN1A 5JD6A 4JSTA 4QGFA 4B85A 1JFSA 2QX8A 1ZWKA 1ZSNA 2RK3A 4AWAA 5KHLB 5JJLA 3IP1A 2ZYVX 5FAKA 4D6XA 3EXIA 2W6IA 3CN7A 1JTEA 1QOQB 1DBIA 4ZT6A 4DRXB 5K3OA 4QRDA 1N6NA 3KZCA 1XP5A 4IOLA 3RF6A 1L5QA 2NZ2A 3A05A 3JWHA 1QP4A 1N5RA 4N0MA 4E4RA 3KG2A 4EAAA 3LA8A 1S2NA 2QD5A 1G18A 1VHTA 4XSVA 1YZQA 1A3CA 4HVCA 3IAUA 1Z0JA 2HWXA 1DC3A 4TV9F 1CG6A 4ALMA 1TO2E 2FNAA 2IGTA 4RJJA 2BUBA 4AFNA 2B4TO 2F43B 3LKDA 4Z4EA 2BI7A 3HP1A 4NE9A 4ZQFA 3UJ8A 3UMVA 3WGTA 4DREA 5ITZB 1B0ZA 4P1ZA 3OY7A 1SC1A 3IOMA 3HCWA 3BIWA 3WL6A 2QRKA 4GLBA 1US8A 3BYZA 4DAEA 3D4NA 2C8VA 2CZQA 5KTPA 1WXEA 5ES4B 1KZYC 1CSEE 3DM9B 4PO3X 3KR9A 4H77A 4XTCS 4YQZA 3LCCA 3C3EA 3HYRA 2FZEA 3N7AA 4E2WA 3N2KB 4RLQA 2Y6VA 4D46A 4L0CA 1MGOA 1XZLA 3V1YA 4BRSA 1ZHFA 4KIFA 1P9WA 3EYAA 3KX2A 2Q1SA 2H1WA 1OV4A 3PNMA 4GVXA 1ZJZA 3IUPA 1JIJA 4ISCA 4ZCIA 4MOWA 4U6NA 5HF8A 3E53A 4JUFA 4AMBA 1JT2A 2X5NA 2ZYGA 3N53A 4WESB 3CR8A 2W2TA 4MB2A 1SKUA 3QE0A 1NDHA 2IKQA 4EQ6B 1CJTC 3IUBA 1F8XA 1OU4A 3FVWA 4FHFA 1QANA 4Q9HA 4E08A 2QORA 4E1AA 4LDQA 5FEUA 3EBPA 3KALA 2A8YA 4ZJZA 2XT6A 4TZ0A 1KH3A 4KPUA 5DGHA 4BGEA 1OB5A 1YQWA 3P0JA 1UADA 5CXXA 4HWKA 3O3OB 5FO0A 4QG3A 3E9YA 4FVTA 1VMIA 4GICA 4HGZA 3GBVA 4N4AA 4HD8A 2PIAA 3EIWA 3OUTA 1OV6A 4P4SB 4XOIA 1AMUA 5HKLA 1IIBA 1TADA 1SXJE 1G66A 3ORRA 4C76A 2OKCA 2J7KA 5LJIA 1LF5A 4TV8A 3EH1A 5AFSA 1K8QA 4FOOA 4EFMA 4YRIA 1MRSA 4HZUA 3B9QA 4YDRA 3TIVA 1OH5A 4R2IA 1SOMA 4NG4A 1OYYA 2DRIA 2PZGA 3E84A 2NO6A 4JA2A 5DOZA 1JDPA 1AMNA 1F0PA 4AKHA 4Z5XA 5CW1A 1EVYA 3HFJA 4G6ZA 5EA2A 1YQDA 4LV8B 3K71B 1X7YB 5C1IA 5JQGA 4P0PB 1OGYA 1DCMA 2WF6A 3OTQA 1P0MA 3GROA 2OM2A 4X7RA 2UXBB 2C5HA 5LQJA 2VNJA 3GAMA 2NV0A 3VZQA 1JWBB 4MRRA 4C2TA 4POAA 4IDGA 2O8FA 1NQTA 4IILA 1KSFX 1S7GA 4PFSA 5AW2A 4R1QA 4TLBA 4BMDA 2R44A 2ZIAA 1QGZA 3LLMA 1PLJA 2A14A 2XITA 3FSEA 4TZKA 3U4AA 1XGKA 4Q24A 3A70A 5IEJA 1BN6A 1DSSG 4HTAA 1TUGA 1Y8ZA 3HZZA 4HI0E 3SIRA 2I3GA 3ZTWA 2W6QA 5ICGA 3CPJB 1QP8A 3KFXA 3KM0A 4KNWA 2P8JA 3KXKA 4JLAA 4D6PA 4GOKA 1D4OA 4Q7EA 1ML3A 1TVKA 1J1UA 2GQ0A 4KMMA 4AYXA 3NHZA 1NOKA 2DFNA 2HHCA 2EDAA 2JAUA 2QGFA 3IXQA 5EPEA 2FG5A 4ZVTA 2Y1EA 4BFLA 2E89A 3AR3A 1T0UA 3N2EA 4G1FA 3N8HA 3WMEA 2WJZB 3JWIA 1W5TA 5ALDA 4PZUA 4EJ0A 4TS1A 2ACKA 1RKXA 2FFAA 3TJMA 1XVTA 4GPIB 1E2JA 1SCKA 1TM2A 4LISA 1UXOA 4GPTA 3E2IA 1VI5A 1NXXA 1AX9A 2GEBA 1T5HX 3NYIA 2Q6TA 5A3RA 5CFPA 4Q4AB 1AKWA 3INGA 2XMGA 4AN4A 4J1TA 1IVNA 1E63A 3JQGB 3A58B 3LBYA 5DP1A 3D6TB 4HGRA 5EHQA 1J0CA 3VR4H 3W6ZA 2CKDA 4FWIB 4MVCA 4URUR 4WADA 1AQNA 1S3IA 1U2QA 3S2UA 2DETA 1NBOA 4F93B 5DOVA 3A6LA 3A6DA 4JL5A 4TUYF 3Q3VA 2UZAA 3DCYA 1MR3F 3LX6A 2IX9A 4CMKA 2JGJA 3K70B 4U7HA 3L07A 4PX2A 3LSYA 5L7YA 4COOA 5J63A 5CT4A 4YMHA 2M6RA 4LXHA 1R5BA 3EVDA 2M98A 5EHNA 2AJ8A 4UNQA 2ZM6B 1XC7A 3OF3A 3TL6A 4K3UA 4B3HA 2OGTA 5HCNA 4B35A 1XNRB 1DCTA 1TW3A 4ZICA 5ER9A 4FUQA 1F0YA 4ATNA 4DDMA 4ZYVA 2VXOA 4WKBA 1AY0A 4C0JA 4Q4JB 4BNWA 1GQ2A 3G79A 3F90A 3O3CA 1SBYA 3NOQA 3FTNA 2GI4A 5ECWA 1QIGA 4TQAA 5BN3A 4WCVA 2EJUA 3LHSA 3QEKA 4PXYA 3N59A 3UIEA 4V0MA 1YVRA 2RHCA 3B6MA 2CHVA 2V4UA 3L4BC 3LCMA 3W5SA 1LSJA 4RY9A 4H6WA 1C0IA 2AIRA 4R1LA 1ABFA 3UICA 2QUJA 4JODA 3JQAD 2GYWA 3UAGA 3N8IA 3OECA 5G1PA 4JEIA 1ZI6A 5KKCA 4ZVNA 1QCDA 1WXGA 2JKYA 3QFTA 3O8RA 1A4IA 4KFTA 3STHA 3UB4A 1TOAA 3N1UA 3PEEA 3WLHA 4PC2A 3PHJA 5EMKA 1RAIA 4D3XA 1I30A 5KMGA 3E81A 1MIHA 3WYNA 4IFEA 5JC8A 3SKVA 1RXSA 4X8LA 1R4ZA 3SQDA 3ZH2A 5CNKA 3EX7C 2F4VB 4FB5A 1O3YA 2XCIA 4UU8A 3IV9A 4PZDA 4LF4B 3AG6A 3QMWA 1CUEA 4KP7A 3RIMA 3V6MA 4I1PA 2XYVA 1Q7RA 1XRRA 4LZJA 4CG1A 3NNDA 2ZROA 2QLLA 4ZJYA 2WMYA 4QGAA 5A2GA 1XZFA 1PIWA 1SXJB 5I9NA 3ZD9A 4JLDA 3T1QA 3D4OA 4JJIA 4PG4A 3IP8A 2NXNA 4LV6A 1F2TB 1B8UA 3GJ3A 4RELA 4B80A 5TQ0A 5HQ3B 1U0BB 3FR8A 2G40A 4RPCA 2YHSA 5F52A 2Z8YM 2R00A 4WZBE 4C6RA 4RPIA 3EY4A 2GHTA 3V8NA 2K7FA 1LW7A 5DASA 5ADUS 4A6PA 1BMDA 1YI0A 3BXZA 5LOVB 3OT5A 5D1HA 4IIEA 3BHMA 3F4BA 1P4AA 2I71A 4M0DA 5CK5A 1IY2A 2EOAA 4YRDA 5AOAA 4F4IA 1QG2A 4CHTA 2ILVA 4ENPA 5IVDA 3T3DA 5JE8A 3TRKA 4DJEC 1XDSA 4YMIA 3ZE0B 2ZDGA 1RJ9B 1TVMA 5IDQA 4PIVA 3B1ZA 2O3QA 1JAXA 5BOSB 4EO4A 1DG1G 1HA3A 3RYIA 4BFXA 1ISJA 4RGBA 2J5QA 5H3LA 2LVBA 2BP7B 1KI1A 3GU3A 3A6EA 1G7RA 4WHMA 3DMYA 1D1SA 3W2FA 5HIAA 1PJ4A 5KAMA 2XBLA 4GVPA 2IYFA 1MORA 1T0BA 1GSHA 4MTCA 1BOOA 1O5OA 3PRYA 2NUPA 5G4LA 4B44A 2FUNB 1JDNA 1XEWX 2QRMA 3H4VA 1AKMA 4G26A 2YFQA 2Y1XA 4GS5A 4FYHA 3RVKA 1RE0A 2PG3A 2WWGA 1KI6A 4HT3B 1OGJA 3BN3A 1SIBE 1Y1PA 3OPMA 3QUQA 3LMKA 4DZZA 2ZUFA 4PLVA 2HF2A 3JYHA 2A92A 3G13A 5IC5A 3L1JA 4EL0A 5AP9A 5EP1A 5ELLA 4RKFA 2HD4A 2A9KA 1ZL0A 3ETJA 2WW8A 1G63A 2GN9A 2JLVA 5DYNA 3Q7EA 1U8YA 5KTOA 1ISPA 2OXFA 1YJXA 3RYHA 2CMFA 2E55A 2ZR0A 2AV6A 3FI9A 3O8QB 3HS3A 3R24A 3TTSA 3K8QA 4JXJA 3G7UA 4D5EA 1OFIA 3AOEC 4B8ZA 3VBCA 1GN8A 3V7NA 2B1IA 3QITA 1B2RA 1Z6AA 4DPKA 1QVRA 1SU8A 3R7NA 2P69A 1KR2A 1LRLA 4WY8A 5BSWA 2H2GA 1XTBA 1GSIA 3WLOA 2ISSD 2WKQA 3N75A 1FQWA 3PDIB 3SC3A 1B2LA 1Z83A 1GTG1 1D7AA 4DT1B 2ASEA 2Q0QA 4QPCA 1QPBA 2BMWA 1YR3A 1ZQ9A 4R40A 2O1SA 1UAGA 1XCJA 6GPBA 2VSFA 1N78A 5COBA 3KQLA 4RW0A 2Z8YA 3KPVA 4YEDA 2AFHE 3ZNNA 3PRKE 4PHFA 1HG1A 3PD1A 1ILEA 3CRRA 2SCUA 5DGIA 2AUMA 3QLJA 4WOPA 3F71A 3JZFA 4OXRA 4WUVA 5HGJA 1RHUA 5LL6P 1CD5A 3IL2A 2OGUA 2H4XA 3PQ2A 3I3SR 1KOFA 4QUEA 2POQX 3QKWA 4HDKA 2BLLA 1QO7A 2WTBA 1BE8A 2VG8A 2JIRA 4J16C 4YCBA 4YCSA 5DXFA 2MSLA 1MNQA 2A3NA 3A4LA 4LCBA 3LX5A 3CWZA 4G0XA 3PHCA 1ZA2A 3CYFA 4NZYA 4BNYA 3LKZA 1E9BA 5ALYA 1GG9A 5KQSA 2R5FA 1EX7A 3DT6A 2M6SA 1RYEA 3UHAA 2EFEB 3CRQA 3HJNA 4J0KA 3H2YA 3M6IA 3OJOA 2O4UX 2WP0A 4PAOA 5A05A 1A9OA 1ZMXA 3UH1A 4DNXA 1MIOB 4NFSA 2BZ1A 3BE8A 2SECE 3LUKA 3ANSA 3MWDB 3OJ0A 3ZKWA 5K8IA 5KOJA 1A2QA 3CCCA 1AXRA 3T1TA 2ZI5A 2PBZA 2ZRDA 3NGXA 3ZZUA 1D4FA 4TXMA 2Q3HA 3I58A 2YC4C 1TCVA 4AJLA 1J4AA 1O6BA 2VS1A 3M1IA 1KOGA 1XD2A 1RRVA 3OZUA 1JLLB 3LUBA 1A7UA 1TUBA 4KC0A 4KXLA 3O7MA 1G9SA 3HSKA 1MV8A 1UQTA 3DBRB 2IYUA 1E2DA 1NP6A 1NY5A 4J1NA 4JJ4A 3RC7A 5JH7F 2AG1A 1CQIB 3G49A 3H16A 2X5XA 4HL6A 1W19A 4IZOA 3PTZA 5DLPA 1X2EA 2Q7DA 4K0KB 3OX4A 2X3UA 1R5OA 1NBME 3UHPA 2NSLA 2IXGA 4YCLA 4ZRMA 2E21A 4Q3EA 5G2OA 4A8HA 3VX4A 1TPYA 2QVYX 3HV0A 3M1AA 4IEIA 2HMAA 3BWYA 4L4ZA 2JLBA 3NDJA 3OJWA 4OQFA 1KBOA 1WMFA 3PPYA 5EHGA 5ITWA 1YS2X 1UMKA 2NXJA 2IZ7A 1ABEA 4JL8A 1E62A 2O2JA 2QV7A 2QE7D 4R0MA 4JBLA 3RQIA 3QELB 4HS9A 2ERCA 4RA9A 4UUBA 2W0MA 3ASVA 1S2OA 3EFEA 4I4TF 2PS3A 2O2XA 4ZXPA 2GTPA 3KSUA 1P9OA 4TSFA 4Z49A 4RVHA 4BAGA 5F1PA 5D5HA 3R2JA 4UPVA 1QF9A 1FQJA 3P8ZA 4WZ6A 5AVKA 4ZVQA 3P0FA 4K0RA 3TDKA 4IUYA 3RYCA 3P0IA 2NXWA 3KYCB 4OHUA 3SP1A 1QDEA 1CULC 1SKYE 1IG3A 5T67A 3BE5A 2UVPB 1LD3A 2FFJA 2ZI4A 2DBVO 1YUMA 3K1TA 3TTUA 5BMVF 2J85A 1FFSA 5FTNA 2B92A 4B4KA 3VKHA 1EDOA 1UEIA 2JIQA 2OL4A 2FX5A 1IHOA 3S81A 2DQYA 2PKXA 5AHRA 3WGJA 4JVMA 1DX4A 2ZUEA 4DCGA 1YVEI 1L7QA 3KAKA 1OZFA 5IHPA 1NW4A 2HRZA 2VXYA 1CIVA 1DU4A 4IH4A 1M2OB 1SU4A 1F51E 3BILA 4IH1A 4BLRA 5JCXA 4N5HX 4JVNA 1FDOA 2XAAA 4OV6B 5AOBA 1E61A 4NIMA 1OBOA 1UFRA 1VYVA 3TIXB 4O4JA 1A7AA 2FE1A 2F3PA 1IN5A 1IJFA 3BRQA 3DZHA 3V2HA 1IMOA 3K0HA 1V1MB 1KC3A 3DTVB 5E1BA 2QPAA 1KP2A 3FPSA 4OUDB 2HQ1A 4QTUB 3RC1A 4WA7A 4DCVA 5IFLA 2EJTA 4ZOAA 4QLBA 2H7VA 1G5FA 3BS4A 2EIHA 4KODA 2H2HA 1Y5RA 1M6EX 1LX7A 1L4UA 1BGXT 3B1KA 3I04M 1M2VB 4JP1A 1PJ2A 3LUPA 4XOUA 4CG0A 2DUNA 3LDFA 4TTSA 2EX1A 4YRQA 2FP4A 5A1JA 3QGMA 1Q0QA 1NLUA 3RU9A 2NTJA 4GMHA 5EXPA 1MZVA 2P5YA 3UFXA 3UHOA 2H2DA 4RTMA 1F1BA 1EFAA 4R7TA 2OO5C 1EWRA 5EFOA 3P97A 3VVCA 4EELA 2HA4A 3AR6A 3LF2A 2BM1A 2FN8A 4JSYA 4M36A 3D7MA 5L3SA 3C39A 2XT9A 2IXEA 2OSBA 4ID9A 5HIJA 2CL6X 3IDSA 5EJ5A 3L4SO 1UIRA 4D57A 1G5TA 2IHYA 2BFMA 1JKIA 1ULBA 1GL6A 2WPNA 2YOFA 3KR2A 2AFHB 4IFBA 1ZZGA 4KFRA 1MDBA 1GU7A 4MULA 4AB1A 4RZ3A 3OOJA 1B26A 3WTBA 3OOWA 4BN4A 1UEXC 5CPBA 1WUJS 5I51A 4GPZA 4JI5B 1NMSA 2BF4A 2HPHA 1HBJA 2HK9A 1CUIA 2Z1MA 4UEKA 3M5WA 3FUVA 2IEDA 3D0RA 4O2AF 3AY6A 4I36A 3TKAA 4AMYA 2Y05A 3UWPA 3ZGLA 1P29A 4XDZA 1TK9A 2ZJ7A 1JJBA 1B8NA 1ZC4A 3BDIA 4MKIA 1RRFA 1YZLA 4MQLA 1YZHA 1TUEA 1QFJA 4J90A 4JLPA 2V3VA 4RLFA 5CFOA 4DR3B 2PY6A 2QTLA 4HFJA 3ORHA 2HB6A 1JG7A 3AUAA 4DBVO 4Z8XA 1WUKS 3GT3A 3HDGA 3GVIA 3OEWA 3IUQA 3C5VA 3I64A 1J97A 3OCYA 4TWRA 2A4KA 1FFEA 2FFRA 2NO0A 1JU9A 3H5RA 4RETA 3NHMA 2CL7X 3WQHA 3FDJA 5HZMA 3RAGA 4Q9LA 2WDPA 4BY9E 2J0SA 4N3GA 3ZG6A 2XCSB 3OI7A 1KPIA 1JEOA 4NCKA 5EIAA 3VKGA 2AQKA 1IZ7A 4QXAA 1YIDA 3IXMA 2C9YA 3B82A 5C5EA 1FP4A 3GXBA 1JF8A 2FWMX 3GW8A 4QJIA 5TV2A 3SJAA 4B7ZA 1B1CA 3R75A 4U7DA 1NQUA 3PD0A 2AJTA 1NNLA 3D31A 2UZ3A 4CKCB 3A1SA 4AJOA 4J4TA 3PRHA 3ANXA 4BV9A 3PXXA 3D7SA 3DD5A 4TVOA 1H6CA 3BMQA 2VXCA 5AM1A 4WBXC 1KKMA 3SQWA 1EZZA 4P9NA 1NVUQ 1V48A 4BDSA 3IOEA 3AL0C 4D02A 4GVLA 4OHMA 5FCDA 3FG9A 3O74A 3ZBQA 2WKPA 1DXOA 1DOAA 4OVKA 1PK9A 2FSIA 3K4PA 4EHBA 5BWBA 2KYRA 2JK0A 1K08A 5CRIA 3UGJA 2ID9A 1E0SA 1EEXB 2GAIA 2HT1A 1Q44A 3I9KA 3LYLA 1L2TA 2YHBA 2GMWA 3GDWA 3O92A 4XQCA 2RI0A 3MS7A 3TSAA 1FX0B 1VE6A 3D6VA 1RJDA 1KO7A 1TQ4A 2JJ2D 4RVGA 4M1TA 4KUGA 5CA1B 1BMFA 1OXBB 1SKYB 3VGJA 2YJ5A 5LDHA 5LLSA 1ARZA 2CLHB 3K0KA 2UYOA 4LBYA 5HTOA 4YCCA 2QQGA 2Q3LA 1ZM4A 3F6CA 4DLYA 2ODBA 3GLTA 3TRFA 5TT1A 2ADOA 2VBCA 5K7SA 3RVJA 4ON9A 4BJ5A 1J8VA 4EPTA 1VYUA 2YIVX 1QGDA 1L7OA 2XTJA 3JALA 1IRXA 2EHJA 2VCYA 1BFDA 3EZ7A 3W9YA 5GY7A 2XWBF 2W93A 1J06A 3OOEA 4IQ0A 5DX1A 1WQ1R 3HB1A 4DQ0A 2Z6AA 4UARA 3B70A 3E70C 1Q1QA 2H11A 5E95A 5GGYA 3ZHZA 5DMHA 4WJZA 3RRBA 1GY8A 1IE3A 5FF9A 2AOUB 9GPBA 3ZHXA 4IGAA 1K75A 2FJUA 5E3HA 4ZYWA 5B3KA 4PSVA 4CDMA 4DDTA 5C2JB 1CETA 3DA8A 2LNDA 3KWFA 2BKVA 3ROKA 3O31A 3VR5D 2FN7A 1Q0LA 2IU4A 5KQMA 3P0EA 3P9ZA 4XQ0A 1FVFA 4G84A 1EWTA 3OT4A 2ES4A 2GN0A 1RVDA 2NZYA 3IQFA 4DILA 5CITA 4JI0B 3L6RA 2QZPA 3IT1A 5B1EA 1NSFA 4JJZA 1JG3A 5LUBA 3UF0A 3RAFC 4OFXA 4EF5A 2HIAA 3IDAA 4QJ4A 3OUZA 3VUFA 1O03A 5AXCA 4R71A 3B2EA 1EAMA 3ZQKA 1OVMA 3UUGA 3W9UA 3ICOA 5UKDA 1QUFA 2GESA 4ZI7F 2GCOA 3MWJA 1U6IA 3BTVA 1CS4C 1XD9A 4K88A 3SBXA 5C7IO 3A2MA 2RHOA 3OESA 4QUBA 4UUOA 1KORA 4NU5A 5J4HA 4QM7A 3Q2IA 4I50F 4BNIA 4LJRA 2FX3A 4LGVA 1K5PA 3OLVA 4RIGA 2FSUA 4L28A 4LHWA 2YXDA 2H4FA 4L75A 4BKUA 5BSGA 4P82A 4GKJB 2P5TB 4LJLA 3V7YA 1PKXA 4KR3A 1NTOA 1NQ5A 1Q6ZA 1TT5A 2UXCB 2WSBA 3RTEA 4IX1A 4ENQA 5K5EA 3S2ZA 1YR6A 3E7WA 4G4SO 3RSGA 3IMFA 1LJUA 4GIBA 1H1DA 1JKXA 2G7MC 5AVOA 4L9WA 2I3DA 2ZS9A 3HE3A 1H9BA 1BFUA 1T1EA 3O8CA 3IOCA 3K1AB 4P81A 4H7PA 1KP3A 2PS0A 5JBNA 4HLUA 1TKCA 2G1AA 5JFTA 3LNCA 2MCFA 3T4PA 3WE7A 1JDTA 3G2HA 4RHFA 4BKOA 1M0SA 4DLPA 4FSXA 4PG5A 1L4HA 1W0JD 2NUAA 1MO6A 2C9DA 3PJGA 2FEWB 2QD4A 4HQRA 4IIDA 5IH3A 4EKIA 4L6CA 2BGTA 3RNOA 4CKEA 2HSDA 1Z17A 1LI4A 1ODLA 1EG7A 1OX4A 3B5EA 1IN7A 3QUSA 4LYYA 3RVQA 3EF3A 2G17A 4A0FA 4OAOA 1K8ZB 3RODA 3DOEA 2CLIB 1MRNA 3PFCA 3T52A 4GX0A 4RQUA 4ERXA 2E4VA 4YXWD 3AF6A 5ESWA 1XPRA 4HQ0A 4TLLB 4D74A 4INZA 1PQ4A 1YJBA 1EBUA 4J76A 3TOVA 3RYFA 1Z0SA 2P9GA 2JLAA 2ZIWB 4YJ2F 1G3QA 2DSNA 4PU0A 4PWYA 4WPGA 1M2KA 1Y3HA 4YJFB 5DPMA 5E4FA 3TTVA 4EB6A 4OHYA 1OTXA 3OQHA 3QEOA 3D0QA 4TRRA 1R4NB 3V1LA 4EVQA 3LQ1A 1ZQ1A 5CBPB 4QEKA 1HPLA 1FMJA 4JI7B 3LGAA 2N1MA 4BZWA 2V3CC 1XRLA 3ZCXA 1D7OA 3FPFA 5FT9A 3L4KA 4UJ5A 3P0HA 4EY5A 4KMSA 1U2RA 4PHHA 4DR1B 5FTMA 1P1FA 4C4YA 2H0QA 2OAP1 3FRJA 4F72A 2FWJA 4IDHA 4TVKA 3ZY4A 2HRCA 4WLUA 3T7TA 1X6VA 2H1HA 1L1RA 2ZR9A 3GLHE 2ENUA 2G5GX 4ZU6X 3W6OA 1P7WA 1QP0A 1WDKA 4TS3A 5I4KA 2VPQA 3T94A 3COVA 3FKJA 3ST7A 3LHIA 1M10A 4FCVA 1OI7A 3C8ZA 4JYAB 3BGWA 4Z8YA 2N42A 3DHYA 1X77A 4X84A 4NP6A 1IJBA 5EIFA 1Z35A 2XAUA 1G2IA 1G8AA 1S89A 1JKJB 2FRDC 3MMXA 4UMEA 4BUZA 1XAGA 1E2KA 3ORYA 4YB8A 1M0WA 2TS1A 5EWLB 1Z2CA 4AX4A 1Q7EA 3CZCA 3VKWA 5LDDC 5FHQA 4Q4CA 4N0DA 1WV1A 3W8EA 2C2MA 5CT5A 3NHBA 2GK6A 3H97A 3O1JC 4ZKDA 1I01A 3I32A 3JU3A 4P22A 1GXSA 1U8AA 1X0XA 4YUVA 5C35A 4ITRC 4D56A 2CHUA 2VYVA 1T5TA 4IJVA 3UAZA 3QWAA 4V1CA 1FSSA 5IVHA 1DAKA 2YR0A 4PYIA 5U9CA 2PGAA 1KVSA 1NXQA 4GRIA 4MWBA 4OHRA 4WNAB 3VMFA 3WWOA 4D3ZA 5L40A 3HXQA 1RCTE 1V6CA 3BE4A 3H5LA 1TPZA 1CUFA 1HL3A 1UBNA 3LPMA 3PFGA 4LJ8A 4QULA 3RTBA 5ECDA 5EUQB 2BSAA 1RQRA 1SXHA 3DOHA 4DXAA 4EH1A 2VTBB 2EJCA 3D0KA 4X44A 3U7HB 1IY0A 3QBDA 3TI7A 4CQLA 4NCIA 3RFCA 3AR7A 1HWYA 1V8OA 1XLTC 1E2EA 3PNKA 1X1BA 3U6BA 3GUVA 3GK3A 2GSWA 4I55F 2BFDA 2YYYA 4RTKA 4IIUA 4L3VA 4ZQEA 3AERB 4E2ZA 2VHQA 5D6NA 1SPBS 4ZPJA 3RVBA 1PI3A 3VDQA 2RI6A 2XVAA 3ZHCA 5LSAA 3E05A 2YZNA 1G8JA 3WFIA 3FAKA 2QXYA 3E9EA 3HBAA 1S2IA 1WKVA 4B4OA 3BBLA 3GT4A 4L7VA 4DG9A 5I4CA 4X62B 1PFUA 1EYZA 2GK3A 1U2EA 2NO7A 3KXPA 2DHQA 3C7TA 2HSJA 4L8YA 2CLCX 2ZQYA 4MV5A 3LXUX 3N5KA 5CXQA 5I7EA 4D26A 4IJ5A 1YSCA 1NUSA 5DP2A 2FPIA 1KFKB 1XT6A 2R4QA 1E2PA 5JSKA 1PE0A 1RAHA 3PUWA 4YPFA 6LDHA 2VCHA 1Y9EA 3IEXA 4FLMA 3BB3A 1K2WA 1V6AA 3OFKA 1KEZA 1PV2A 2PNJA 4AKTA 2Q3BA 1RTKA 2JFVA 3E22B 4JQSA 3R7FA 1MEEA 3GJ8A 3O3MB 4N7JA 4R9UC 4AVYA 4XVUA 1N77A 1IBLB 4DRXA 3P4YA 3HC7A 3I39X 2JZOA 1N92A 1XTRA 4PYLA 3S27A 4MV4A 5K4AA 3I2IA 4EJSB 3DDWA 4L74A 5CDFE 2ZJ2A 3M1YA 5FUVA 3NPMA 4IKOA 2OP0A 1Z28A 1DAPA 1FEZA 2WTEA 3C4JA 4JP2A 3EH2A 4AP6A 2Q46A 3B6KA 3NHYA 2J33A 4JP5A 1CUVA 1AXGA 4MYCA 1TRKA 4UREA 2VCEA 5JG7A 3WLEA 2WG2A 1R4AA 3HU2A 4R54A 5LA6F 2PCLA 2F43A 1JDVA 2GBLA 5ILQA 5A9SA 2CNKA 5ITZA 3S8EA 4YHBA 3ZWPA 4HV4A 3ZXIA 4W9MC 3BGIA 2HLHA 3THYB 5MN6A 3LUGA 2XQFA 4LBZA 3IR7A 2R6GA 3DE1X 1R0RE 4IVNA 1T0JB 1XB2A 3GVPA 3PL1A 3PC7A 3IEMA 4OQNA 1IY8A 3NORA 4RJ2A 4EARA 4MNTA 1NOIA 3MLAA 4AULA 4DL9A 3N2KA 5F3DA 1U98A 5L7WA 2BYTA 2CLOB 1XMXA 3IAM6 3UBTA 2DZDA 5REQA 3HBLA 1VGRA 2F00A 2O2IA 3DDHA 4NBNA 4DCPA 3V8QA 3AH8A 1A7JA 4W6QA 5F9MA 3VO1A 3IE2A 1MX9A 1RXCA 2J07A 3KWJA 1Y6GA 4NNPA 4BB5A 1J70A 1KIFA 2QL6A 4TV9B 3RAEC 5KVCA 1ZAYA 3SYKA 4B5KA 5LFAA 2RE8A 4TZTA 4WESA 1S2DA 3BXGA 2FN3A 2H9YA 1MF7A 3BUSA 3JVVA 4CIDA 1ZVJA 1CUDA 2CUTA 1U1IA 4H7EA 121PA 4EQ6A 4FYYA 1E4OA 1NVAA 1PU2A 3PICA 1VQ1A 2PZLA 3I4LA 5JAQA 3HM9A 1EIZA 2YRXA 4GRDA 5TPZA 3SYNA 4E11A 3BHJA 4QFBA 3P9PA 2J8ZA 3WIOA 5EJIA 2EW1A 1TKRA 2HA5A 1DXHA 2PH7A 3D4BA 2YNMA 3Q7RA 5TMEA 4B6RA 4E5YA 4GP9A 1RRKA 2KMLA 2QUKA 3L5OA 4AP9A 2JD2A 1UBLS 2JJ1A 3WBKA 4I8IA 4XGNA 1HR0B 4I1IA 4CVNA 1YQEA 4P4SA 2C9CA 3L1IA 3ENQA 1XCMA 3RWOA 1BN7A 3IPCA 1USVA 1H8ED 4KSBA 3KSBC 3KO8A 3IVAA 4OIFA 4GMDA 1O0CA 1K89A 3MF4A 2CNLA 4TQ9A 2QTVB 4Y1RB 3OA2A 2IU3A 3LTNC 3KDAA 2VRWA 1CF2O 4KFUA 5H80A 4GC9A 4NMWA 3ZIDA 1R6XA 1BHJA 2PVPA 5E7JA 2HXYA 2HGZA 4IXDA 4JLOA 3RFFA 4PGHA 2I66A 4AQ7A 1YONA 4ZEWA 1QV7A 2EG5A 5I5EA 3L7IA 4PXSA 2MHCA 2IIVA 1D5CA 1X7YA 3C48A 2H9AA 1AUPA 2VK8A 2D5IA 3UMGA 3X1DA 2XWJI 5CCXA 4LDPA 4IW3B 4E4YA 2CXPA 1QH8A 3B36A 3O21A 2FSFA 4AF8A 5LLTA 4S0ZA 1Z6PA 2FWRA 4XYMA 4D9JA 13PKA 3EZYA 3OPNA 2W11A 3TH5A 1X19A 5IZCC 3SVZA 2J3DA 1VE3A 4BQOA 4QGBA 3I12A 3W5AA 1BHQ1 2GARA 2JFGA 3QUBA 3RS7A 1S3FA 2NTEA 1KARA 4II7A 3VNSA 3RADC 3O4VA 2NU7B 2DKOA 2NVOA 3SNKA 1T6BY 4HRYA 1YDFA 4XEHA 4MVJD 1ST2A 2DVMA 4B4VA 1QWOA 3KUDA 3KKLA 1PZNA 1I4EB 3WWYA 5JNSA 2P67A 1WZEA 4NHEA 2QQ0A 1F5SA 1PFYA 4DDVA 3RPEA 1BEUB 3Q7PA 3UK1A 4XEUA 2Z57A 4ACAA 3MG9A 1VIMA 1AGPA 2GPAA 1D0IA 1INLA 4FR5A 1IY1A 3AZPA 4DVGA 4C87A 4URVR 5I47A 3HFSA 3OOHA 1TAGA 1TM1E 1IPHA 4NYJQ 4U3JA 4V1CI 1A71A 3KVOA 4UOEA 3E7XA 4UVDA 4AIRA 4LXQA 4C7OB 1XQXA 2V97A 1IQUA 1KR5A 2R5WA 4FGJA 5J5AA 1U9YA 3RT1A 3SLKA 5IDYA 2C03A 2W6NA 4UEOA 3CUSA 1MOSA 3KTAB 3T12A 3IKLA 4L5AA 1FTQA 2YY7A 3JQGA 4WACA 2PAAA 4Z6KA 2BGIA 1V8BA 2YY5A 1WMEA 2RB5A 3GPDG 5J4YA 5JZMA 4UMFA 2F62A 1XJWA 3D1VA 3ESCA 1YASA 3AIKA 2ROQA 4OYYA 5ALWA 3WP0A 3GUYA 4ZAXA 3FGOA 1ISSA 1KO5A 3JQFA 5G41A 2FEAA 5T6MA 2QUAA 5DN6A 3ABRB 2Q45A 4EEKA 4R7ZA 3NIFB 4CV0A 3L49A 3N8DA 4FC7A 4WDQA 3C16C 4F60A 4TTJA 1QNFA 3QK7A 3SF0A 2C5FA 5JR3A 4ASUA 4DV1B 1NVXQ 3PA8A 4DM7A 1FC0A 4RHXA 2XW6A 3ANYB 5BURA 3SG0A 1RMQA 2O52A 3BCHA 3JYLA 4N54A 5D7NA 4AG6A 1ODKA 1P2BA 4XJXA 2IUUA 5FHRA 3NWEA 3TRJA 3HEBA 4MP3A 4C21A 4FN5A 3TQOA 2PK3A 9ATCA 4ZK6A 2AC4A 2OFOA 1FQKA 1W48A 2XQJA 1WCIA 4TUYB 2A0UA 4AROA 2BGLA 1DKUA 1ONOA 1T15A 2B8EA 3N7UA 2ACWA 5DEOA 1FFYA 3NEAA 2AZXA 2B99A 4FMCB 4CL2A 2VJPA 3V6LA 4QIHA 4TMZA 5C8YF 2GZ2A 2OORA 3UJ3X 4MQFA 5C9ZA 3N5CA 2Z0MA 1RYBA 1V9CA 3CF0A 3VU0A 4R6XA 1YE3A 1NYTA 2VDWB 4GSYA 2Y4OA 3OY2A 4MW2A 3GR6A 1O97C 4O0MA 1O9HA 4ZEXA 2CFIA 4ZYXA 1BOFA 1WXXA 4DLZA 3CBQA 1E20A 3AEKB 1VMAA 4G07A 1ETHA 3OWHA 3ZIAA 4PO8A 4DJ5X 1Y7IA 4FFVA 2C5AA 2NYRA 1DINA 1N2JA 1UDAA 4ISBA 1QTIA 4GOND 1SK8A 5J4VA 5K6RA 3BQ9A 3W4IA 1NTRA 2NO5A 3Q8XB 1VHWA 4IHJF 4UE2A 5FWDA 4XLZA 2VYCA 2OBYA 3PQ4A 4WOBA 3HACA 3OE4A 2QRLA 4YBRA 4EY7A 1CY4A 3GD7A 1NXTA 2GHRA 3Q85A 1QJCA 4CL3A 5JSFA 2J5XA 1RWQA 2XX3A 3QVGB 1DIGA 3NBUA 3U5TA 1K3FA 4DNQA 1I7PA 1KEPA 4J3FA 2AF4C 2D8AA 2VWQA 3AFGA 3VR6D 4BLQA 1SXJA 2GLUA 1XMQB 1SHJA 3B1XA 4BVKA 3F4KA 3DT9A 1F2TA 4LHXA 2HLDD 5HQ3A 1ZGGA 3SBEA 2Y66A 3DEIA 2O2DA 1L7NA 2QEQA 4UJ3A 5DIZA 1V3TA 2OQ2A 1HDZA 3TQFA 2ADFA 2L17A 1RYMA 1UKBA 3SFVA 2RC6A 3M6LA 4N5LA 3D5EA 3PEYA 5AQ1A 1M8KA 2CNNA 5CM2Z 2B35A 3R0IA 2F8SA 1RPZA 3U1VA 4PNZA 3HJHA 3K9GA 1COZA 2Q8QA 1G5IA 1P3JA 3N87A 1T5BA 3RYTC 2Q9AA 4X1KB 2IIQA 4U2FA 2ZSAA 1ZP6A 2R66A 3CUKA 4M9ZA 5DGTA 3VPGA 1B8PA 4X93A 4EHKA 3GEBA 4QOSA 4Z7NB 1VYHA 1GO2A 2BP7A 3W06A 1R7RA 3RUPA 3CZ9A 2CDBA 3N8KA 5JDIC 3MUFA 4FX5A 1HV8A 2Z9DA 1W5SA 2X3FA 3DP9A 3NJRA 1WE2A 1XZDA 3OVMA 4ODIA 1IUPA 1YS6A 4Z4CA 4HLCA 1MAVA 2DLDA 1AB6A 2X4IA 1NV8A 4FUTA 4RHYA 2GBFA 2ZTUA 3QV1A 5F7ZA 3L8DA 5BNWA 4KSYA 1ETUA 4EI7A 1ZNWA 1QIIA 5DTRA 3H5WA 5G1NA 5LLDA 4B32A 1KQGA 1XQVA 2JVIA 4MW6A 4QAJA 2ZREA 4XPZA 4Y0VA 3SJUA 1J2YA 1KFEB 1EVJA 2V7QD 2GYVA 4R9SA 1JR3D 1NHWA 1Q7TA 3ACDA 3FYDA 1IXSB 3NBKA 3O8QA 2XUHA 3D8HA 3AETB 3MB5A 4NPHA 4Y1FA 5TMPA 5JI3E 1Z2AA 2OLKA 4JCOA 1TYAE 3OHMA 4BX8A 2VK2A 1ZC3A 5BW5A 3A3KA 1BVYF 2GPWA 4M0KA 2YTZA 4EB3A 1IDOA 5JW6A 3COPA 3LVQE 1NJ6A 3CSDA 5GPBA 2W4IA 3KOWA 4TMVA 1C30B 2HA0A 1NI4B 3A6FA 3DMGA 2ZCUA 2CN1A 1WKCA 3PDIA 1RFGE 3HCBA 4POOA 1N36B 3K09A 1MH1A 3D43A 4DT1A 2KHZA 2CUZA 3QE3A 1E1YA 2A7QA 1RXYA 4NU8X 1E96A 3FDZA 2OPBA 3PYXA 4QBIA 4DMCA 2PX4A 4HBGA 2HM7A 2WSSA 2R6JA 3ISVA 3KUKA 4BNDB 2QL7A 1TU4A 1XCOA 4RV4A 1JSLA 1T2FA 1A9XA 4U5QA 4BU1A 4O4IF 1VMKA 4GOOD 4WQMA 5EIOA 4U00A 1EFHA 4A3SA 2XE8A 3ZWAA 4DUGA 4BNJA 3QNWA 2FZGA 1L3CA 4G0YA 4DUYB 3P19A 1ZKMA 3DR5A 1BVHA 2H00A 1XTSA 2GCNA 4EZBA 1C41A 2GWRA 3DOJA 1Z7EA 2GF9A 3ZDZB 3V4FA 2O2SA 4AJIA 2J6IA 3NC0C 3I6YA 4UM9D 3F5MA 3LHFA 3V55A 4CU5A 2DWOA 4P54A 3JVDA 2B4KA 2HO4A 1U0OC 3H8VA 3QMMA 4B3RB 3LQYA 1CEQA 1Z5WA 2VJDA 3H6KA 4XWTA 5DTEA 3TECE 1HYHA 4ZANA 2ZT6A 3FFBA 2JIMA 2XODA 1J0EA 4D0LB 3OM0A 2FMTA 4LWPA 2EDCA 4UD6A 5EXSA 4OSPA 3BSYA 5HBRA 4LMRA 1VSQA 3PGLA 2XGJA 2IOFA 3MWDA 1KMIY 2OXCA 1JS1X 5J5CA 2AG5A 2IK8A 4LHYA 1KZHA 3NAQA 4WV3A 3WBJA 4CMEA 2C9BA 2XE7A 3ED5A 3GX1A 3FBGA 2YZMA 4PFJA 5A9TA 4V24A 3D3NA 2JARA 3PV0A 1LTKA 4MVJF 5DE3A 4ZPXA 2EGUA 3JX9A 2B2CA 4W4TA 3C0KA 1CQIA 4DLNA 4IMRA 4Y0NA 3FN4A 1KEEB 3I2FA 2JCGA 1D03A 2HV8A 3AY7A 2C3UA 2IITA 1IMJA 3D9QX 3EUEA 1Q22A 4G1VA 4JC4A 4N6NA 5AI0A 4B6EA 4DEVA 1E0KA 4BQIA 4GEKA 3QVJA 4WZBA 3T7IA 4GD3Q 2Y93A 2PUFA 1EXMA 3DFFA 4TLCA 1MJNA 1T4GA 2WJPA 3HY6A 2V9ZA 4LDNA 2AW3A 5CB4A 3PGJA 1USUA 4UUNA 2ID8A 2VDUE 3X1YA 4GNKA 4EGFA