1JE1A

5'-deoxy-5'-methylthioadenosine phosphorylase complex with guanosine and sulfate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
234
structure length
232
Chain Sequence
PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKIWITKEELEKSVMDGAKAVLDTLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 81
structure length 232
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1je1A00
3BJEA 4YO8A 1JYSA 1A9TA 1Z39A 1PR4A 1WTAA 4DANA 1T0UA 1T8RA 4NSNA 4I2VA 4QARA 4R2WA 5F7ZA 2H8GA 3FOWA 3KVYA 5IU6A 4GMHA 3ONVA 4R31A 5KB3A 3OOHA 4MCHA 4F3KA 4G41A 1PWYE 3LBAA 4JWTA 5I3CA 1PKEA 1Z5OA 5B7GA 4WKBA 2P4SA 4DA0A 3LA8A 2HSWA 4DA8A 1SD1A 3FB1A 4OGKA 2B94A 1Z5PA 4D8YA 1PBNA 3EUEA 4YMLA 3PNSA 3UAXA 1Y1SA 4IP0A 1A9PA 3KVVA 4TXNA 3MB8A 1U1GA 1B8NA 2RJ3A 3BGSA 4TTJA 4LNAA 1I80A 5B7NA 1G2OA 1LVUA 2OC4A 1VHJA 1RXYA 2IQ5A 1Y1QA 1Z35A 2ISCA 3UAYA 1JP7A 3PNPA 5DK6A 1JPVA 1Z38A 1JDUA 4WKOA 4OF4A 3KUKA 1ODKA 5F76A 2ON6A 2QTTA 4L5AA 4BMYA 2HN9A 1TCVA 3EUFA 3OZCA 5FAKA 3KU4A 1YQUA 1A9OA 3FUCA 5EPUA 4MCIA 1YQQA 4NS1A 5CCDA 4D8XA 3PHCA 3EMVA 5CYFA 1CG6A 5CXQA 5F7JA 4EB8A 4PNPA 4D8VA 1T8WA 3INYA 5F77A 5F7XA 3GB9A 1PR0A 2A0YA 3UAWA 3SCZA 3LGSA 4ECEA 1T8SA 2AI3A 4QASA 1PK9A 1RXUA 1TGYA 5CCEA 4JP5A 3NM4A 2AC7A 3KHSA 4R2XA 4LDNA 3OZBA 1XE3A 4LNHA 5EFOA 1TCUA 3GGSA 4WKNA 3OOEA 1V4NA 1V2HE 5EUBA 1VFNA 4L6IA 1RFGE 1NW4A 5IFKA 5K1ZA 1K3FA 1Y1RA 4L5YA 3DPSA 1NC1A 2Q7OE 1K9SA 3OZDA 4DA6A 2QSUA 1ECPA 1YR3A 1PR1A 1Z5NA 1Z34A 3UAZA 1V48A 4F2PA 2AI1A 3E9RA 4TXLA 4K6OA 3IOMA 1OV6A 2A0XA 3TL6A 4UC0A 1YBFA 3P0FA 3OF3A 1SD2A 1PW7A 3C74A 4NY1A 4LZWA 2BSXA 2QPLA 2I8AA 4D9HA 1Z36A 1Y1TA 1JDZA 4TYMA 1VHWA 1Z37A 4EARA 1U1DA 1QE5A 3UT6A 3BSFA 1VMKA 3ENZA 4G89A 5F7OA 1JDTA 3O6VA 1ULBA 3NM6B 2HWUA 1A9SA 4QFBA 4H1TA 4TTIA 1OUMA 4PR3A 5F78A 3IEXA 3U40A 1TGVA 2QTGA 4QEZA 4L0MA 1C3XA 1PK7A 1ODIA 2GUWA 4OGLA 4RJ2A 3OCCA 3ODGA 1B8OA 4L5CA 1M73E 4QAQA 4LKRA 1PR5A 1ZL2A 5CYGA 4MARA 4TTAA 1JE1A 1NC3A 4FFSA 1OTXA 3E0QA 2OXFA 5B7QA 2OC9A 1LV8A 1PR6A 4U2KA 4BMZA 1V41E 4DAEA 3MMSA 1Z33A 4TXJA 4TS3A 4DAOA 1U1FA 3BL6A 4GLJA 4OY3A 3NBQA 1RSZA 2A8YA 5B7PA 1U1CA 2PGAA 1ODLA 3KVRA 1CB0A 3D1VA 1ODJA 4QATA 2XRFA 1SJ9A 5CXSA 4TXHA 3K8QA 1ULAA 3PHBE 3DP9A 1T8YA 3OPVA 1OTYA 4TS9A 4TXMA 1JDSA 1PF7E 2A0WA 4P54A 4X24A 1Q1GA 1RR6A 4GKAA 1OVGA 3P0EA 1RT9A 4M3NA 4JOSA 1U1EA 3DDOA 1OU4A 3T94A 3EEIA 1A9RA 1A9QA 1V3QE 5JPCA 1V45E 1A69A 2HRDA 4WKPA 4BMXA 4F1WA 1FXUA 3FNQA 1Y6RA 1PR2A 1YRYE 1TD1A 4F2WA 1RYZA 3K8OE 4M7WA 3FWPA 2AI2A 3FAZA 3O4VA 4YJKA 3QPBA 4F3CA 4GLFA 1RCTE 2OECA 4KN5A 4DA7A 1JE0A 5F73A 4WKCA 1K27A 4M1EA 3DF9A 3E9ZA 4YNBA 4OEHA 3F8WA 1JDVA 1RXSA 4E1VA 4OJTA 1SQ6A 1ZOSA 4BN0A 3NM5A 1N3IA 4DARA 1LX7A 1RXCA 3OZEA 5ETJA 2I4TA 5C80A 3UAVA 4D98A 3DJFA 2QDKA 1Y6QA 4DABA 4G8JA
chains in the Genus database with same CATH superfamily
4RSRA 4MMZB 3OF5A 4R6XA 3FBTA 5JANA 3JYQA 5G3YA 1EK1A 1YJ8A 2XJ9A 3ZHUA 1XJQA 1JQBA 5JAIA 1GZHB 1L7MA 1VKZA 3KLOA 2OZVA 5AUQA 2G06A 4OKNA 2PSSA 4B3HA 4DIUA 5GWXA 4Z3KA 1U65A 1UKZA 5C32A 3I6MA 3VYUB 5EIWA 3GPLA 4IDGA 1V9LA 1ZM2A 3T0IA 2X0KA 2GFIA 3PLNA 4QARA 1WSBA 3ANSA 5AI0A 1CZNA 5EWJA 4B6EA 3A4YA 2IKSA 5K0SA 4C7XA 3A1WA 4B45A 1APBA 1HQKA 1KSHA 4XYBA 3UMBA 3TOCA 1VL1A 2J85A 4QELA 1QG6A 4KOAA 5FV4A 2D5AA 4FMPA 2HY7A 3PTZA 3KKKA 1W47A 4J6EA 3CN7A 3LC2O 2NUAB 3I5AA 4KQ2A 4C08A 5CA1F 1P39A 4D4MA 1NMQA 1SRRA 1Y3BE 4B4DA 5I3CA 2YN2A 5M3BA 1P45A 3EXIA 3R6TA 3I2JA 4RHYA 5JADA 5U9CA 2O0HA 4F9GA 3SR4A 3FSRA 3JQPA 3KSDO 1WKVA 5EJGA 1M6NA 1E92A 5E1OA 4FX2A 1GA6A 3HJAA 1QO9A 1N8SA 3HB1A 3WBJA 2P8SA 3KYDA 4CCAA 3ECCA 1I33A 1TJYA 4WH0A 4R84A 3VHQA 4PC1A 3LYAA 3K4QA 4XOUA 1T36B 4HPXB 5KOHA 5HKKD 1P18A 4QJ5A 3SF0A 5DASA 1RRVA 4U02A 4E94A 2VTBA 3PLRA 1O58A 3DS8A 2C9OA 1QH1B 5CNJA 1PHPA 4LSWA 3RB8A 1ZMBA 4JI4B 1B8NA 4GICA 1P9RA 2I22A 2D1FA 1VCOA 2IXTA 4JJ6A 1KZGB 3RSQA 3P0IA 4I4TF 3W5AA 2QW0X 2VNKA 3JQFA 4RABA 2AQIA 2RBGA 2DJIA 2MDTA 5DK4A 3H2IA 1W9MA 4AP5A 1P2FA 2IOFK 4UXJA 2AH5A 4DRXA 2AFIB 5D8DA 3BIJA 4ZMSA 5L3SA 1B74A 3EG9B 1R5JA 3RKRA 3WWCA 5IJZA 1P3DA 4RC9A 3KALA 1KBOA 1PGQA 3UJ3X 3NTOA 2IDMA 2AN3A 1B2RA 1V9CA 2WWFA 3OIGA 4MR7B 1DAGA 4YC7A 2QRMA 5ED0A 4KMMA 4U7DA 1W48A 3KTOA 1CUBA 1T8PA 2ISCA 2ZWOA 1THGA 4GG1A 1S3IA 3P97A 3IR5A 4M1OA 1QB7A 2EATA 2R66A 4C4AA 1TZJA 1QUEA 3V1TC 4UPVA 1FTNA 4ZT3A 3GX1A 4AMUA 5KBYA 3TAHA 1BMQA 1C9MA 1NI5A 2QY9A 3MD0A 4CCYB 2YWGA 1G5TA 1QYIA 4MINA 3DC7A 3SS8A 4GI7A 2HN9A 1RWOA 1FB5A 3KU1A 1TCVA 1TVCA 2QNIA 1IZ8A 3B8EA 3FUUA 4LX0A 4Y0VA 3ROMA 3BCUA 4EATA 1TXGA 4MV4A 3DHVA 4KIUA 3UPDA 1KO5A 5ELXA 2HTEA 3B82A 1EVZA 1AKWA 1YQUA 4L8FA 4L76A 3FUCA 4PICA 2YXDA 3PVCA 5K8TA 4MRSA 5EPUA 4MCIA 1O8BA 1CUUA 5I3ZA 1CEXA 1VLLA 4CKCB 3K72B 4NS1A 5DTEA 5IARA 4MV1A 2OM6A 3ESQA 4MHTA 1VLVA 3WGGA 2A86A 2VQ3A 1PK8A 2YMLA 3L77A 2WKPA 3V8RA 1RTKA 4AUKA 4N40A 4BPRA 4LF6B 1G5HA 4NAUA 1WCIA 4H1HA 3L7JA 5CYFA 4L72A 2OV2A 5CAEB 3OEWA 2I7TA 3DD1A 3RBVA 4YRGA 3PBKA 1HE2A 1IVYA 2G1UA 1E6KA 4ZYZA 4QGGA 4M0PA 2XDQB 4QXPA 3WQRA 4ZYWA 4E4RA 4JVLA 4OI4A 4AJ9A 3NBAA 2XA1A 3RYIA 1G6Q1 3DEAA 4W8OA 4WLFA 3R74A 3ORQA 3GL9A 4MUXA 2QXUA 4E4YA 2VN8A 3U62A 13PKA 4CDRA 1E7RA 2HIAA 4O2AA 3EY9A 2UUOA 3GBVA 3PXEA 4F3RA 2PWPA 4KSCA 1SVUA 2V7XA 4Y2RA 3ZHVA 3QVTA 5HQ3B 1QKKA 4PLYA 3S2FA 4YJ3F 4RTPA 2IDJA 2RHGB 3GJTA 2VQFB 3I5MA 3ADCA 1XLVA 4E07A 1QTIA 1CUJA 2AI3A 2RHTA 2ZULA 1KAQA 2FE4A 2X6RA 3KWJA 3QMVA 4MP3A 3U1TA 1TGYA 4G0XA 2HRRA 4FZVA 4M0LA 4OQNA 5DEOA 4D96A 1NBHA 2QJWA 4HT3B 3AZOA 1PP4A 3MUFA 5EGSA 3H7AA 4N0PA 4EEXA 3JRNA 1FP7A 1MQAA 2F7SA 1F2VA 4BKPA 4D0SA 2JIBA 2D0IA 1D04A 4BJHB 1PEDA 2ZR0A 2NU9A 1KHHA 4BGUA 2G9RA 3CXRA 2A5GA 5FWDA 1JHVA 2DUJA 3LUGA 3HJBA 1K06A 3CB2A 5LYJA 4ZJYA 3EQ7A 3OIWA 4MUAA 5F64A 4ETMA 5IFKA 5FBHA 1K3FA 1HYBA 3A9CA 1P1RA 1PT9A 3TBFA 5CU7A 1U9IC 1IZYA 1Q14A 2RJNA 2PKXA 4XQCA 2JLZA 3PI6A 2AOUB 3G89A 4JJIA 2Q8PA 1XJ5A 4MGKR 3RFTA 5MN4A 1CQIA 3A05A 1QC5A 3Q7SA 5FWXA 3WTBA 1VCHA 1XP8A 1HWYA 1Z68A 2WD8A 3QF4B 1MFPA 2EJBA 2P5SA 1OLUA 4MRMB 4HUQA 4WY2A 4JVMA 4O2BA 5FI1B 4HWSA 5IK2A 2BOVA 3P45A 2FSHA 2NU7B 1NUUA 1Z6YA 1MNQA 1TDJA 4NDZA 5AHXA 4CHTA 1CZLA 4ICIA 3P2IA 4ATNA 2BGNA 5JYBA 4L78A 2YJZA 4GZMA 4MWDA 5CNIA 3AERA 5AMXA 2MIIA 1Z5UA 1WUHS 1A7AA 2PHZA 2WT9A 5CM9C 5DBHX 4F6LA 4Z6KA 1J39A 1U9JA 2BGGA 4I14A 4Q6BA 1W36C 3JZAA 5L3QB 3JAMA 5I5EA 1QV9A 1DJPA 2CZGA 3B8HA 1XZNA 4DNQA 1LD3A 5BWCA 4RFSA 1PR3A 2FU5C 2GYYA 1IBRA 1TLTA 2ZQYA 3PRYA 4UC0A 2NADA 5J63A 3R0XA 3RYTC 1UWCA 3WL6A 1L5GB 2IHVA 5FHRA 4CNQA 4MYHA 2IOQA 1AGRA 1YJCA 4D4IA 1YC2A 2YV3A 3ZU2A 5LN1A 1FDOA 1QYRA 2O7SA 3SC2A 3QVKA 1KWGA 3ZCVA 4BQIA 3H9JA 4C9BA 4MQEA 3D0OA 4GMKA 2QTVB 3B12A 4YQYA 1R9GA 1SOUA 4HX2A 3IXMA 2C4MA 3ODPA 1TK2A 3GPDG 3BE4A 1NN1A 1KI6B 1N0HA 4IDNA 4LDAA 3WK8A 2D8AA 3IP1A 5DGDA 4D6YA 1WMEA 2O2YA 3H8SA 4MAMA 4OQZA 1TVKB 1JXOA 4P83A 3NAZA 3H04A 3QLVC 4TQ9A 4TS1A 5HE9A 1IBMB 4AWBA 2QYSA 2Q8QA 1C0KA 2X4DA 3L6OO 1E7WA 4TYMA 1U7UA 3MWDB 2NO6A 2ZUCA 4Y30A 3E9EA 1W25A 2UKDA 3LX8A 1Z4NA 5A3JA 5KTKA 5IT9A 2EDCA 1XEWX 3EVZA 1QHGA 3O2NA 2O5CA 4GOJA 3HHEA 3ZZNA 2JFBA 2Z43A 3AUFA 5FTMA 1K4KA 1TLFA 3BBLA 3T8YA 3EZXA 2VS1A 4HVCA 1VKRA 3GELA 2IF2A 3EZYA 2ZT7A 2R6JA 3T5CA 1PZGA 4FBMA 3BSFA 2QLFA 3R7FA 4PZCA 3TIFA 4XWOA 1ZI9A 1ODTC 4HDRB 2A7QA 1TCBA 1EFDN 1VMKA 1XA0A 4PQEA 1J8FA 4WKGA 4C1NA 4D4GA 4IF6A 1YAHA 5FXMA 2VEOA 3G7UA 3SGLA 3TOVA 2HW8A 3MQFA 4NCJA 1O6GA 4DWOA 2G5PA 2ISSD 2HSDA 1L9KA 2CUNA 4KIWA 5K3DA 4AJ4A 1Y4UA 5GTDA 4GGMX 2BR4A 2P69A 4CQMB 2Z9DA 2EQBA 1BW9B 1I6WA 2X15A 2H59A 3MIZA 5D84A 4GWKA 4JYMA 2IF0A 4UE6A 4ZT7A 4WZAA 4GH5A 2LIPA 5U4QA 3T1OA 4YCAA 1WXWA 1LDEA 1N1GA 4BNTA 4TTIA 1VKJA 2ZJ2A 4X1OA 4MVJI 4PLFA 5LB4A 2O8BB 5KYTA 4PR3A 2JAQA 2YWCA 3EARA 4G36A 2GD1O 1XNHA 2YZNA 3B1JA 2I8LA 4G0VA 3PDUA 4RQUA 2W0SA 3U40A 4BU1A 1FMFA 1ZK0A 5DWDA 3WYDA 4JJZA 1E62A 3HFJA 3LKZA 3QKRA 4K0RA 3TTTA 1MVLA 2AMVA 2NVWA 2OO3A 1GNVA 3COJA 2A2ZA 2Q7XA 4HDKB 2B6HA 2H54A 1ZA1A 1QFMA 5DOZA 1NBME 2CFRA 1P72A 1XHLA 3E9QA 3FVRA 2B8TA 5CB8A 1R0YA 3VR6A 1GRVA 1RW4A 1QANA 1WIWA 3A1UA 2WJJA 2XECA 4OI2A 1AN9A 1RAAA 2D3WA 2X9NA 3ODGA 4R8LA 1A2KC 4B46A 4DY6A 9ATCA 4NZPA 3V7NA 4QBHA 2G4VA 3VX4A 4C5BA 2FWMX 3DMRA 5LQKA 2DCUA 4PGFA 5BOVA 4H1UA 4OK6A 1OTXA 3PP8A 3Q3EA 3G0GA 4RAOA 3BVPA 5DM0A 3RFXA 3ZX4A 1W4AA 4F21A 3I28A 3CF4A 3RUAA 3TWOA 2W48A 3T3OA 2X5NA 3G2KA 4Q02A 2R751 2LCIA 4O29A 1MO5A 2P3LA 2J0EA 4G0OA 3ZWWA 4JEHA 3DZKA 5JDCA 3R7LA 2ZM5A 3K1ZA 1JJBA 1E8NA 2RG1A 5D6OA 3WV4A 2W7TA 3RHSA 3SBOA 3D81A 3DZBA 1IAVA 4B6QA 3GP5A 1ECFA 4LF7B 3AZPA 5I51A 3LKBA 2ZUDA 4DAEA 1RZ3A 3T3PB 3MMSA 3V4VB 1BVUA 3LT2A 2VH5R 4LMAA 1S2LA 1J8VA 4BCCA 1OF1A 3LGAA 3W5UA 5A62A 4GVXA 1IK4A 3ENQA 4IDEA 4KI0A 3NBQA 4KR0A 3A9UA 4MWSA 1LBTA 1U7OA 1CUVA 4IG9A 3V4FA 5EN4A 5JCJD 4TWAA 3T1TA 1NU8A 1W87A 3DNPA 4RA6A 2CB0A 3ZLVA 2FMHA 1GU0A 3AW8A 3PQEA 1KQPA 2QSZA 1JQJC 3DEZA 3VBEA 1KI2A 1ZOIA 1KJWA 1GGNA 3G13A 5F23A 4I1OA 4IR7A 2FMIA 3WXBA 1Q7BA 3R2JA 1LVHA 4DLPA 1Z7BA 4AF6A 1ES9A 1Z8FA 3D6JA 2AFHA 1YONA 3I6YA 3RR2A 4ZEOA 1UQRA 3HCEA 5SY9A 4DHEA 4KDCA 4NK5A 4AZ3A 1O95D 4K8RB 1UBRS 4GZ6A 2GPJA 4JN6B 4W63A 3X0DA 2CK3D 3CT4A 2O2JA 3JWPA 4GPZA 2ZBFA 2W8BB 3TDKA 3VO2A 3QFFA 2JRCA 1NBWB 3A10A 3K9CA 4Z5XA 1KU6A 3N2ZB 1GADO 1K3UB 2XOKA 4OXKA 1WUYA 1I9GA 5A7GA 3KAKA 1JTEA 3O94A 4LZZA 4M38A 1GNTA 4QJ4A 2G8NA 4GT1A 3SQOA 3RAPR 3KHUA 2NO0A 2H9IA 2OPBA 5KSZA 1QDEA 1YI0A 1U94A 2WR8A 2H18A 4PGAA 4P7JA 4IJQA 4E46A 1FYXA 3NDRA 3MGAA 1G20A 1YL6A 3VC2A 5G0TA 1R4AA 3FTCA 5I5GA 3F2IA 3EBLA 1Q6ZA 4FEEA 3KXDA 4OGGA 3RYHA 4OTZA 4M9XA 5KSWB 3S0JA 1U1EA 1GLGA 3PTAA 3G82C 3IQIX 4CLEA 1ADFA 1N6IA 2ZRCA 4OHRA 5GADl 4WNYA 1CF9A 2CL7X 5K0EA 2WWIA 4PZUA 1A9RA 1WJGA 3C7KA 1R9NA 2QYHA 3CPHA 2XEDA 2A3NA 1WBBA 3VMFA 5LZ8A 2NLOA 1KNQA 2ECKA 4FZRA 2YICA 2D8MA 3EGXA 3F3SA 2VJNA 3HB5X 5FYQA 2JLAA 3D2CA 4TRMA 4ARSA 4OP2A 1QVZA 4X90A 3A9RA 3DHWC 1NT2A 1U7TA 1Z75A 4PAQA 4WNIA 5DYWA 1CQJA 1XL1A 1C3OA 4D44A 4LHWA 5JPIA 1WG8A 1D8TA 2PVCA 5JVDF 1H0HA 1SHUX 1EIZA 4GXQA 1QIKA 1SZJG 3PE6A 3SKXA 4DDUA 1XK6A 1ID1A 4PEVA 5EMNA 4EW1A 1NZFA 5I7HA 4GM4A 3SJUA 2HMVA 3WGOA 1J2TA 3TYXA 3AQIA 4CF7A 3GIDA 3PE4A 3R5XA 3UV6A 1TIBA 2Z8ZA 3ITKA 4XH9B 4EW6A 2VDUE 4WNAB 3ZCTA 4BMVA 1Z2NX 2P3OA 4LRWA 4R68A 1KI3A 4ARVA 5HHTA 5T57A 3ZXYA 1ST3A 3SYTA 3O95A 3V9PA 3MAGA 3RU7A 5EHXA 2GMWA 3WE7A 5C46F 4H7DA 1FFXB 1UJCA 4AX4A 1ZVJA 1WHTB 4FNGA 4PPQA 3F8WA 2XCOA 4KVFA 2QAGA 5LJIA 2FI1A 2W42A 4MMYB 4Q3OA 4AMYA 4HYQA 3EOAI 5A0FA 1YUBA 1NQTA 1YZVA 1I3CA 3A6DA 5EXPA 5E2AA 4DRYA 1H4QA 3MJEA 2J4FA 2JZNA 3TRKA 3TW8B 1T2UA 3DL7A 4HXEB 1OXTA 5EIXA 1I36A 3NP9A 2V03A 4NMHA 1Z63A 4QQNA 5EZSA 3S8YA 1DKUA 5AR1A 3BRCA 4F4FA 4RYLA 2Q9UA 1CW2B 3OTIA 2NTYC 3G7SA 4YDRA 3LJKA 1FS6A 2BFDA 5DTQA 3OA0A 4X1YA 4S05A 2ZJ3A 2IYAA 4QDKA 1Z8DA 4R83A 3THXB 2C5HA 4OQFA 1KS2A 2IW1A 4X1IA 3U7JA 3IT0A 4LXUA 2DP4E 1C8LA 4RZQA 3HB7A 1NU6A 3N6VA 2WE8A 3FPCA 1YS2X 4NH4A 3C1AA 2ZRKA 3ZU4A 1X77A 2HOQA 2PD3A 3F2VA 4MVWA 1EVYA 5H3CA 3IIIA 3FOWA 3WRYC 1K8RA 3VJMA 5LNK1 2FR0A 4OUDA 3L1JA 5C31A 2XMPA 5ENVA 1T1JA 3R7NA 2J8ZA 3IAUA 4RLQA 4ASUD 1NPYA 1YXMA 3B1KA 4UHCA 2A67A 2B4RO 2FMTA 1SXGA 2CXPA 4W5TA 5HX7A 2YINC 1VSTA 4Y2SA 1CVIA 2HDOA 3RTBA 1TW2A 2BFCA 2VUUA 3OOHA 3T4PA 4KH1A 2YHUA 2WZBA 1X1EA 3IQZA 4KLRA 3RC1A 3JQ7A 3UATA 1ID8A 4C43A 1RAIA 1WCV1 3RRMA 5B7GA 1XDZA 3AO0B 3DUFB 3VYRB 4H60A 4Z9AA 1ZH2A 4IO0A 4C3OB 3FYTA 1U0SY 3TIXB 2VSNA 4JROA 4XLZA 4XE5A 1TCCA 2Q1TA 2QR2A 1P9LA 1D09A 2A33A 4TMZA 2KBEA 4Q7QA 4WBNB 5HIAA 1D7AA 3A4IA 2Q5EA 2WJYA 1WCYA 2FPPB 2QENA 5E9AA 1L4GA 1J99A 1ZZEA 3HADA 3KKEA 1ST2A 4E15A 2BTOA 4Z8YA 1FYVA 3KBBA 4EHAA 2ZJ7A 3RLIA 4DDVA 1E4YA 1YZLA 2JGNA 2PL1A 4OK3A 1G7TA 1Z08A 1ZN7A 4U6SA 5EUCA 5AWFC 3ZWYA 2DBVO 1WW2A 1XNJA 2J3QA 3DHYA 3MEQA 2RCNA 3KVVA 4TXNA 3VR0A 1I2MA 1PBTA 5KVQA 2QIOA 1IPEA 4KBYA 3P9PA 3FJYA 4XX0A 5BR7A 3AHFA 1ZNWA 2BRUC 1BNCA 2VA9A 1TU4A 3JU3A 4DMGA 5JSFA 3DZFA 1US8B 1XVVA 3C5HA 3G8YA 4RK6A 3GIWA 2E48A 2FXIA 1XEXA 5EA2A 3E8XA 4S1NA 1G5IA 3RTCA 3ZEAA 2FSIA 1PHRA 1VYVA 2FUNB 2XODA 4DPMA 5C5EA 4YUAA 5JJCA 1N9GB 1JEQA 4L15A 2OFFA 1EFCA 1WMBA 2GHQA 2KYRA 3KKLA 4OMFG 3RRJA 2GAJA 5ECYA 2ECFA 3JQBA 3SIWA 3TZKA 4HI0E 4DKJA 4OXRA 4A23A 2X8LA 3ACBA 3LQYA 3ZGZA 5C8YB 1DC6A 2H29A 1NVTA 2XKAA 4BYGA 3PFKA 1A98A 4IZHA 2FQYA 1JQAA 2HH9A 3F5MA 2G0TA 1E4EA 4KXMA 1UFVA 1SIOA 1XO1A 1ZZGA 3K96A 1PS0A 3DOCA 4DSUA 5JECA 3HY6A 4IJ5A 2ANCA 1JJVA 1EEHA 3IE1A 1ZH0A 1ZIXA 4ZYXA 3TI7A 1A8QA 4Y2XA 3LE8A 3OY2A 3EUWA 4UD2A 1HC7A 1U7XA 2GZ3A 1O87A 2HPHA 3OZCA 1JR2A 3BXZA 1I1OA 2C3YA 3K1AA 4Q47A 1A82A 4QLBA 3T5AA 3LX4A 1TYAE 3T34A 5KDDA 3MTEA 1I3KA 1W6UA 5DIFA 4MROA 3Q72A 4FHDA 5A3VA 5TQ0B 1RBYA 3D0QA 3NT4A 5G3ZA 4DMFA 821PA 5L4SA 2GBFA 4MVJF 1DS6A 2PBLA 1O89A 5KQRA 1AQLA 2Z8XA 4D3YA 1A4IA 2PT6A 5JNWA 2OKCA 1HYGA 1WEHA 4UU0A 1S4QA 3ZOZA 4ZV4A 3GLGE 1G0OA 3GQBB 5C52B 1J90A 3NBUA 1P2UA 1URPA 3ORSA 1D9XA 4L27A 3DTVA 5FPHA 3P9YA 1X87A 4TUYA 2IP1A 5IM4A 3AILA 4I9HA 2PG3A 4D8VA 4AJOA 4BEVA 3U7QA 2ZRGA 1GAWA 3ND5A 1NZJA 3SG0A 4NYIR 5E0OA 1QGOA 3RGWS 1SKQA 3U4QB 3TD6A 1YKFA 1KJ9A 4GOKA 1E5XA 3IGFA 1TM7E 3QUQA 3DL4A 1V96A 2JFHA 4I3HA 1MCZA 4MS4A 4QDUA 4HRAA 3WWYA 2XMZA 5DYIA 4A8PA 3RPEA 1QGAA 3W1WA 4LJ4A 4A2WA 1SVLA 3KD3A 3BGVA 1KE1A 1A7KA 2AZDA 3IURA 4G5XA 4CTMA 1MT3A 2VJCA 3MWLA 2QUJA 3O3CA 3TIGA 5I7SA 1J5EB 3N05A 5B12A 5BUQA 2O2GA 1XEXB 3P96A 5GGYA 2J9FB 5A6VA 1RBMA 1HYHA 4FEYA 5GM1A 3WLKX 4J1TC 4NU8X 4FN5A 1GEGA 2CFOA 2II6A 3HGMA 4UNNA 3Q2KA 1PK9A 5AM4A 2ACVA 2FR1A 4QPNA 2GZDA 2QYTA 1Z2CA 3GJ4A 1ZJ6A 2XLBA 1N2EA 2OV4A 3LWZA 2XOEA 5B36A 1UM9B 3EXHC 1RAGA 2QD1A 1P19A 5FO0A 3FOEC 3KV1A 3S3TA 3LQQA 1NTOA 5JZSA 3K6SA 3PHJA 2RI6A 1PJ8A 2Q45A 2VSXA 3U80A 4MQLA 1OROA 3GVIA 3FNRA 1QH8B 4EPRA 5KHOC 5CVUA 3U17A 3KCNA 4NARA 5DM60 4L1KA 3A7DA 4BO3A 5ADUS 3ET5A 1UBLS 2PA0A 4RVNA 5EUBA 2V45A 1U90A 3A6GA 5DM2A 3Q8MA 1ISJA 3UK0A 2BJHA 6GPBA 4H0CA 3QBVA 2QE6A 3Q9LA 4PPYA 5L45A 1I1HA 2JGFA 4B2IA 1M8KA 1CYDA 2K5UA 2YW2A 4YA6A 4KR9A 2P2CA 3AR7A 3OWXA 3IMCA 1I13A 3Q3JB 2C03A 3OP4A 1SBZA 1ZISA 2MSNA 4HFNA 3RRNA 2LBPA 3UK6A 5BORA 3SDZA 4PQRA 2X41A 5LXTB 5DCYA 3Q98A 4JY7A 4MWTA 3DOHA 1PR1A 4MPRA 4FC7A 1EX6A 1L4YA 2WILA 1GTRA 1WL8A 2ONYA 3QJ5A 4KG7A 4OFBA 2XE7A 2XIQA 3ELWA 3HNRA 1GGVA 4DVGA 2JFNA 5CBKA 3E9CA 5BVHA 6NULA 1IOWA 3OAAD 4M87A 1SZPA 2OMKA 4TLBA 4YJDA 2O54A 4TXLA 4HQFA 3IOYA 3FF4A 3AI7A 4PVDA 2VJYA 3KEGA 3X2SA 1B7GO 1M76A 1DO2A 3BWBA 3AEKB 1R6UA 2XR1A 1Y8RB 4FFLA 2R60A 4Q9AA 2AOWA 1FNDA 1WNTA 2G40A 3EEQA 1K5PA 3ZYZA 5D1HA 3L4SO 4GM0A 2OFWA 1AURA 1E2IA 1NOIA 2NZXA 2V3WA 4TKLA 3BWEA 3IUNA 4JUCA 4YP5A 1TT5A 4ALMA 2RC6A 2REQB 3GDOA 3SHOA 2FP4A 1VGRA 3INGA 4G1MB 2M98A 2GCNA 2EG5A 2RGCA 2XTMA 3O21A 3ZI0A 1BEZA 1R8YA 4RK4A 2VDVE 4YAWA 1D4OA 3DFZA 3UG7A 4ZQIA 1DEXA 4KOEC 3GLUA 2HWWA 5LKAA 2EZUA 1H0SA 2P2DA 3LUKA 4ZU3A 2WFLA 3B13B 4W7HA 2P9FA 3IVGA 3ICPA 2AE2A 3JVEA 2YY7A 3HVRA 2GKOA 3PWKA 5D3KA 2C97A 3BTUA 4X1KA 4WINA 4Z0TA 3VZDA 4G9EA 5DISB 2BI8A 3PNMA 3UT6A 3OCYA 1LVGA 2DPLA 2B83A 4C0QC 1EMDA 1NY5A 3K0FA 2QQGA 4HMPA 2P3SA 4KCGA 4HYTA 3DE3X 2HEIA 4R51A 3NKFA 3V7YA 1M2NA 3QA9A 4PGMA 4IXTA 3ZCRA 2VSFA 1MENA 1MRNA 4PY2A 5LUAA 1YOVA 1XIVA 2QWXA 3QOWA 3L8HA 2FK8A 4FONA 3KQMA 1WF3A 2JIZA 4LUCA 1PV1A 1ISIA 2MMGA 2CSUA 1A4XA 1MIOA 4KIFA 1XZPA 2CXRA 3M6IA 3N39C 3AY0A 4WVFA 3CISA 1VL0A 3LS2A 3AM4A 5FI0B 1YRQA 1M6VA 2R4TA 3NX4A 5IASA 3PEEA 4RQBA 1ISRA 1RM4A 2Q8NA 3GJXC 5FQOA 2NW6A 5G0SA 3KO8A 1PYGA 2E37A 4LTDA 4JI0B 5A5GA 5BYBA 3LZDA 1RRPA 1X7YA 1U8ZA 4I8DA 3CLKA 1G3UA 1A77A 5F78A 1II0A 1ZM9A 1A3CA 4EMBA 5TLSA 1ZOPA 2BUCA 1TGVA 1IB6A 1Q0TA 2ZDGA 2EFGA 1PZMA 1RYHA 1W5BA 2QUKA 2AT1A 2VHVA 3SHTA 3PU6A 1OVMA 4EIWA 3I1FA 4DV7B 1RWKA 1WUKS 3QPVA 4F3NA 1KYXA 1NQAO 3HUUA 4AYWA 4NBWA 1YGYA 3FKSA 1SVMA 2CKMA 2OESA 1W6RA 1KO4A 1LPBB 1ORVA 3OKCA 1ZUD1 4MH0R 1KS9A 4RSGA 3WKDA 4UNRA 2XMSA 1RKVA 2JFUA 3VNAA 3PGXA 1GUBA 4LKRA 3QWAA 1P33A 5ANRB 2OCBA 5JXHA 3RANA 1EESA 5ERXA 1IQPA 1RWBA 2QN3A 1JG2A 2JFPA 1YASA 1JAYA 4YJ2A 3WB2A 4FIDA 2AN1A 4F72A 4QULA 2L2QA 2Z9BA 4WK6A 5GJVC 2OC9A 1BGVA 3EVAA 2Y0BA 4NBUA 5EP1A 2IGTA 2W2TA 3R1IA 1LV8A 3K0KA 3OUZA 5DM1A 3RKSA 2P9CA 2C20A 1ZFNA 2WWRA 5LUBA 4A16A 3WRXA 3IP5A 4HCJA 2WNSA 3V8EA 3E3AA 2JI7A 3DMYA 4FGJA 2IZ1A 1RHMA 4XR4A 1WNFA 5KTMA 4N3GA 5ERYA 1LI5A 3T1HB 2DLDA 4P7FA 3D3WA 1TQ4A 4DZTA 3HY4A 2QROA 4QO8A 3GP3A 3VKWA 3FDZB 4ZKDA 5HJ7A 3BOSA 5K0CA 3TG8A 1Q12A 4FX5A 4TLEA 5C1BA 4GLJA 2GPBA 3LYHA 2KLHA 5AHOA 5DW0A 4V1CA 2EFCB 1YDWA 2FEKA 3W1EA 3NOOA 4DSZA 5CLGA 3B85A 3ETCA 2RGWA 5I01A 4BO2A 7MHTA 1ZCAA 1GEEA 5T4FA 1L4UA 2VPYA 4CT0A 3VDRA 3I53A 3W2HA 2CZCA 1LBSA 4IGFA 3NYWA 2I6TA 4GMXA 5K99A 3DUWA 1C14A 2TMKA 4IY1A 4MUIA 5CW2A 3RK0A 3T95A 5BSWA 3BERA 3EDYA 2H1WA 2X0IA 2ZUWA 1WHSA 3PHBE 4BS9A 1N5JA 3IP8A 5JQWA 3L4BA 4BNYA 3PB3A 5BO5A 1EX1A 3EQZA 1P2GA 3MUOA 4ND3A 2IH5A 1HFWA 1FJGB 1WP9A 3K4HA 1KY3A 2VF5X 3D6MA 5MFZA 4UUOA 1B76A 4WSOA 2P9QA 2FFAA 3ZD9A 5A4AA 1AKTA 2OK8A 2FPMA 5CFLA 5L9AA 2Z8YA 1AQUA 3KHTA 4M53A 4R69A 4LBYA 3H1GA 4YPFA 2WJAA 1H4VB 4ZYVA 3AEUB 4R2IA 3RJMA 4BGEA 2H1CA 2OZLA 4ER5A 1M0SA 1XZKA 5CEEA 1LSUA 1MX9A 1F2DA 5EY5B 3OBBA 4CI9A 4P86A 3CJRA 2VFAA 3E27A 3CWZA 4QYIA 4P31A 1HPLA 2O57A 3I6QA 4M3NA 3W8RA 4IVPA 1CS0A 3JQFC 3KFLA 3KQPA 4JOSA 4K9KA 4QVKA 3R7WA 4ZJPA 2XHZA 1CY8A 3LVQE 4KAXA 1NJFA 4C0SA 2JFYA 2O9JA 3QPUA 4NESA 4X85A 1B8VA 2BKAA 4Q3EA 3LXMA 2YWBA 4NV3A 3DFKA 3EQ9A 4RD6A 5ALTA 5JRDS 2NTNA 2X4GA 3WGQA 1NDQA 4DXHA 1GOTA 5F3DA 4QKQA 1OXMA 1Q0QA 4GHWA 3V1KA 1CUCA 5DHTA 1YO6A 5L51A 1FVOA 4JQSA 5DBEX 3SVLA 3FNQA 4AZ0B 4NNOA 4UJ5A 3TEMA 3UT5A 5AVSA 3MMZA 2Q4EA 3OLXA 3PNVA 4NP6A 4AUMA 5KYWB 2QTHA 4Q1EA 1PFUA 2V5UA 1FSGA 4RDHA 4X44A 1B8PA 1BTOA 3NYIA 1X7XB 4H0NA 3RC2A 6YASA 1PWEA 3GLTA 2GF9A 4GQIA 4TV9B 3K8OE 1M2KA 3E2MA 2GYUA 1RPTA 3QYAA 3B60A 4ZOLA 1AK1A 5IK2D 1AC5A 3P9QA 2ZYVX 4UFNA 2WWVD 5BSEA 5BW6B 1TTTA 4U7PB 4XLLA 3R4CA 1NZDA 3K32A 4KI7A 5CB4A 1O08A 8OHMA 2BZ0A 2QRHA 3EJWA 5SY6A 4F7DA 2GHTA 1U2ZA 1GFIA 2HSZA 3HRIA 3K35A 2CL5A 4IO1A 1OX4A 1W4ZA 3MBOA 4UEJA 3SE7A 1ZIPA 2DFDA 2YZKA 3ZDEA 1GNQA 2FHPA 4G5YA 1NQVA 4DA7A 2WABA 2WV7A 5EZ6B 3UVEA 4O4LF 1PJBA 1G4UR 1AQYA 1XCBA 2AKAB 3GK3A 4HLCA 3F0TA 3EE6A 1DKNA 1P5JA 2CJPA 2VAWA 3MHTA 1XA3A 2G8LA 3HO8A 4E1VA 2WHXA 1UMDB 2NT3A 4A5SA 1Z8HA 2Y1OA 3N2YA 3T3NA 5JD3A 3STVA 4IV5A 2R0QC 3SX2A 2FPRA 4KXXA 3H5AA 3OZXA 5JBQA 2HQRA 3ZCXA 1DAHA 1LX7A 1UCFA 2GZAA 3OZEA 4Z54A 5K3EA 3UBTA 2CEAA 2YJ3A 2KJQA 3BK1A 1UIRA 4DABA 2HJVA 4JP2A 1AQJA 1EJ6A 4MWGA 1P2BA 4YO8A 2BI4A 2LR0A 1QGUA 3SQXA 2EW2A 2GUGA 2XZPA 3R9XB 1VSVA 3EZNA 2P7HA 1CEQA 2EOAA 4P35A 4C0HA 1KZ7B 3FHCB 3OZAA 4ZU1X 4N03A 4ZYYA 3EZ9A 3J81A 1KL7A 1WAMA 1HT0A 1CRLA 2H8GA 2OVBA 3E6AA 3ESDA 4PANA 1MDFA 4MVJH 5H7XA 5JQGB 2IODA 3A1CA 3LPDA 3GRRA 4FKZA 2YUTA 3N87A 3FFTA 3SICE 3SZOA 1QQ7A 4DIFA 5IKMA 2SCUA 4MLCA 2VQ6A 4HWPA 4BP1A 1LNSA 2Y1EA 2JNWA 4I50B 1TA4A 1EWRA 4W1RA 3BC1A 4H35A 3ZEIA 3QI7A 1H9CA 3IKTA 3ESCA 2YN0A 5DTJA 4HAOA 2EVWX 5DCWA 4P81A 3LUDA 3WFJA 1PWYE 2QTWB 4UVDA 3KXPA 2H0RA 1UKAA 1ZCBA 1E3WA 1ADJA 1E1MA 3G1WA 1BGXT 2Y05A 2X7XA 4BEJA 4W9NA 4C7KA 2G08A 1OI2A 3QY9A 1KMCA 1SD1A 4LEIA 2RHJA 2R4UA 4KE8A 1JXQA 4L50A 5K20A 2E4UA 2PXCA 3RS5A 1HSOA 3VO9A 5CFRA 2OBFA 3DBRA 4INOA 1OXSC 4PX5A 3M9WA 3QBEA 4NG5A 1AUVA 3UUFA 1WOMA 1Z25A 3Q3HA 1SY7A 4MHOA 3EUEA 1GNPA 4YREA 4E5YA 2ZXFA 2GJ9A 1JVNA 3BJRA 1CR1A 3JR7A 5G4KB 3R7BA 2R8RA 2V4UA 3FMPB 4NLLA 2GEFA 1J49A 1PSZA 1HFEL 4R1QA 5HP4A 4DPLA 2J6CA 2N0SA 2QRVB 1UMCA 1MOQA 4IIJF 1OREA 4IAOA 4ETNA 3GA0A 4PGGA 3A28A 4NCBA 1I80A 2GGSA 3T5MA 2JH8A 1EB9A 2VZ9A 2A14A 3O1HB 1VHJA 1VKOA 5F1KA 5HGJA 5K0JA 1W59A 3VR6D 1S9DA 2I2AA 2ZSIA 4IGAA 4QOGA 4BFYA 5TVGA 4BNLA 3IBSA 1NUQA 3QFTA 5JUWA 1L7VC 4JNKA 2JGKA 1OLXB 2HF7A 5IXSA 1T34A 3C5VA 3F3YA 4PAGA 2P9ZA 2FQXA 1T1IA 1KERA 1E2MA 2VJMB 3EVTA 1XCPA 2VHUA 3ORRA 3VNRA 1X8LA 3UKDA 2Q2VA 1E7YA 1TZ2A 1RAEA 1NKVA 1XXLA 2JI9A 3FR8A 3KQWA 4KE7A 3HYLA 3LDUA 3ONWA 4NQZA 2ERYA 2POQX 4NFYA 3EXFB 1ANKA 4MRPA 4BB0A 1FTWA 4BLUA 2QTMA 5HIKA 2ZDHA 1YA4A 4PRKA 4S0ZA 5T64A 4NVRA 4B6SA 1RYFA 4V03A 1DG9A 1HDCA 2BV3A 2GI4A 2JEYA 2WUVA 2ZP1A 4OMUA 1UBUS 2QUIA 3A4NA 1OZAA 3TRFA 1D8AA 4RD1A 1MUUA 1TF5A 3NRBA 3EA4A 2O3RA 4L2IA 4PQGA 4TL6A 4C88A 1M33A 4R7GA 4GD3Q 5G1OA 2IPMA 2X2EA 3KYCB 4EY8A 3EYAA 1EFPB 5FAKA 1E3QA 1VBFA 3JQQA 1ADGA 2ZAYA 3GQVA 4UPDA 3H5TA 3IELA 3RDPA 4FEGA 5AJUA 3WSWA 1DRJA 1XN4A 3TMKA 3LD9A 2VF4X 3IRVA 4CL0A 2J3LA 4NF2A 3OOWA 2MR6A 3ZLUA 1XZCA 5FTWA 5SY4A 3TX6A 2RBEA 4MKFA 1COZA 5HQJA 4MULA 2AMYA 2C95A 2WEKA 4KH0A 1WDMA 2FLWA 2Q9CA 2YS6A 3LCMA 1J21A 2P30A 3EMDA 2WK1A 2NU8B 3HFRA 2BMAA 2JFOA 3OPYI 1AA6A 1XRSB 4UVIA 1V8DA 1SUPA 1L4KA 3CZAA 5HEKA 4AX8A 4B4WA 1A9ZA 1T0HB 2OXEA 2XVZA 5KTYA 2EBUA 4JI1B 1H6AA 1EQ2A 5AVZA 4YJGA 5B1SA 4C21A 4BIIA 4GX0A 3LQFA 2EKQA 2K7ZA 4QTYA 5JWOA 3RVOA 2C5GA 5KYKA 2CFCA 3AIOA 2PXAA 5JCZA 2IEZA 2W71A 1W8DA 3K4PA 4TTRA 4TSRA 2CKDA 2MSKA 4OKIA 3AM1A 1HEIA 1NASA 4UQOA 1XRJA 3M2TA 4HEA1 1FFEA 5DXAA 3M3HA 1VBKA 2HX1A 3WB0A 3DMNA 1T29A 3MTBA 4WN9B 3U13A 1IRIA 3FZEA 3U3MA 2IKQA 4CQLB 5I9BA 3ENWA 1NXWA 1QX4A 5EWLB 5C37A 2XMRA 3AHDA 2H5JA 2X6QA 3UH1A 4ME6A 3TECE 1JLKA 3IHKA 2XOKD 5KTNA 1C4XA 4KGDA 1FBNA 2NZJA 5CCEA 3GUCA 1W75A 5IANA 1W1WA 2ZJZA 2FPIB 2XEXA 3RUEA 2CLHB 1N0WA 2O2CA 3BHMA 1RZVA 4YACA 1VHQA 1XZIA 3GUVA 1WMAA 2GN0A 2NSLA 3TGPA 3F6CA 2A6PA 2GLUA 5F33A 3L06A 2RFLA 3SHWA 3GG9A 2Q3EA 5HRAA 4E12A 3U3JA 1CE8A 1V2HE 1BROA 2E5FA 1AHHA 2E4WA 3ZY4A 2QTNA 4BQQA 1RFGE 5TMBA 1C7EA 2QF7A 3WLIA 2RKWA 4MKIA 1BO6A 3WNZA 5DXJA 2CLIB 3I73A 4G37A 4GVLA 4DYHA 2OHIA 1LRLA 3AZQA 3H84A 4U9UA 1GQ2A 1N7JA 5AYVA 5KYVA 2EX4A 1H4TA 3UMFA 4PCLA 5GONB 3OZUA 2ZPTX 3DOIA 4MWCA 1FLDA 3ESZA 1I2AA 1R6TA 3S5UA 7REQA 3UMYA 4INAA 4ERXA 5CDYA 1RP7A 1J1ZA 3K0CA 4WK0B 3IAM1 3SN6A 5L4LA 4NBVA 3JYLA 3LVRE 3EPRA 2QMOA 2DG2A 1NR1A 5DEIA 1NDHA 3KJXA 2HADA 4R1OA 2W8ZA 2EJVA 3UAZA 3HJTA 8ADHA 3L1VA 1OFVA 1SVOA 2VHYA 4G1FA 4UHEA 2QVCA 3RE1A 2PT9A 4MP8A 3JATB 4ND7A 1KH1A 2BFWA 2ESRA 4WA8A 2ORWA 3NMUF 2XA2A 3QEMA 1IBLB 3T54A 4U7GA 2EFHB 3MYRA 3U4QA 4TQAA 2C1EA 4J2OA 4UREA 5MN6A 3HLYA 5KVSA 1HETA 2QG4A 5A7FA 1H0RA 4U2CA 4NXMB 1KFEB 3E1SA 3GH3A 5ITZB 3OPNA 3L92A 2B82A 4UD6A 5CX1A 1G8YA 2DHRA 3OZRA 5H5JA 4IUCS 3WL5A 2I03A 2ASVA 4PHHA 5ALXA 4U4AA 3WS7A 1VL2A 4LV8B 3ZGVA 4QZVA 5I7AA 4ZMBA 1XMVA 2Q9BA 4MQBA 1M75A 2PZJA 2D13A 1LFDB 2Z95A 1L5ZA 3RS8A 1EP3B 4HH1A 1VE9A 2W6ZA 4Y2VA 5IC6A 3O8CA 1D6NA 1Z36A 2RGAA 1YT5A 1YS1X 4PZEA 4XPZA 3GXOA 1ENYA 4D8WA 1U11A 3GRYA 1EP2B 2GSDA 1B6RA 3L7NA 5B3JA 3UENA 1MO4A 3DE4X 3N8NA 2EL7A 4IVRA 1BD3A 1HNWB 3QKSA 4KQEA 4F06A 5EUQB 2IE0A 4YRJA 4M54A 1DV2A 2VDNB 4N0DA 1JLLA 1P60A 1Z4KA 3B20A 3QOXA 3V2HA 2CHFA 4RTRA 3FTQA 2QW8A 2JLCA 2Q3HA 4JS0A 5FWAA 4QOIA 1RVV1 1SQ0A 4RZSA 3ZU3A 3JASA 4LFAB 3SI7A 2NUPA 2OCPA 2VJQA 3ZTTA 1RQRA 5BURA 1FP4B 5AP9A 3QA3E 2C8VA 4OVKA 2JIRA 4YRDA 1G9SA 5C35A 4HNAA 5T67A 4R2MA 2IH4A 1EWVA 3WFIA 1XUOA 4YUWA 2AFRA 2EV9A 2Z09A 3OJXA 3Q41A 5LU8A 4U7HA 5IT0A 4JYBA 2F4NA 3OZVA 1W30A 3QY0A 3IUPA 1DBRA 3SAJA 2Z3WA 4NBTA 2H4XA 1GYQA 5ESRA 3PGVA 2HTFA 2CJXA 4DUZB 4M1QA 4CMCA 5EHIA 2G9VA 1RKQA 5ILGA 2UZ1A 5B37A 2VWQA 1CJCA 2B1RA 3TLKA 5FHQA 1U5BA 1H22A 1OIVA 1C3VA 3DE7X 1VPEA 3BMNB 3DE6X 3R3UA 4TS4A 3ERCA 1KIMA 5KX5A 4MAAA 3FPSA 1IG0A 1WPRA 1N2OA 2WJ6A 3TTYA 4MCAA 1BD4A 3JQGB 4P08A 3DBLA 1HYQA 5CDUA 3AOGA 1M7GA 4QEZA 3OF2A 1Z26A 5JG7A 2C4VA 4M7OA 4B3BA 4HAZA 3L3BA 2XF8A 1JT2A 2E85A 3HKDA 2X5KO 5FOVA 4B8WA 3B1ZA 4GZ5A 4EW3A 3EZGA 5ALDA 2ODEA 2PZMA 2QPOA 4FBLA 4WY8A 5JE8A 1PX0A 3IPAA 4J94A 2IPNA 3ED5A 1HRDA 2IU4A 3IBCA 2ECPA 3CVXA 2HLPA 4IS3A 5BV8A 5DNCA 1FE8A 1TEVA 4GC5A 4HQNA 3OEEA 5PNTA 4AMZA 1COWA 3TQIA 4HFJA 2I2WA 3NNSA 4D57A 3Q6IA 4NENA 3H2BA 4R05A 1N4DA 3OPXA 2OAGA 2OXCA 1H05A 5KQSA 2Q3JA 4CM4A 3LM8A 5KVCA 2JFFA 2OCAA 5C5IA 2FSUA 1DBVO 5K0NA 2R47A 3NVDA 2NPFA 1Z2DA 3AGQA 4PBTA 1LK5A 3FN4A 5LD2B 1P6XA 5JCXA 2XVAA 3S8EA 1P0PA 4AY6A 1IOLA 1E58A 4PV7A 5JHHB 1TUEA 1E9SA 2UVDA 3VH1A 1J8YF 4PYKA 4CMGA 1YS9A 3EXAA 2IU3A 3D5TA 2X0FA 1NV8A 5A0VA 4LJLA 2H4ZA 2YNMD 5AVKA 1OC4A 3VR4A 1DBPA 2ATVA 2PUDA 4CIBA 3OQNA 2G1JA 1II9A 1E32A 1H2AS 3LL7A 4RIEA 2WB2A 3DV9A 4TS3A 5SYMA 1EXWA 3PXGA 1U1FA 3CZQA 2JHCA 1Y8QA 1ENPA 3OUTA 4NYIQ 2WP0A 1Q50A 4FFPA 2ZS8A 1QTQA 3IQGX 3FGOA 4HWTA 3OLZA 1JL3A 2ET6A 1E1QA 2Z8YM 4PC2A 5T3YA 3BH0A 1GL9B 2ALJA 1CB0A 1ZM3A 1C1YA 5CHEA 2VT3A 4LQDA 1T3ZA 3OTHA 2AQHA 1LU9A 2PAAA 4BN5A 2ZJ1A 3K5HA 1SJ9A 2JS7A 3C3MA 4RJIA 5D3MB 2EKLA 1OJLA 1OBOA 4FZ3A 4I8XA 5CXSA 4EF4A 1XHFA 2KB0A 4IEIA 1Z6GA 5ELLA 3V48A 2EWWA 4PSAA 1VE7A 3FD8A 3H4TA 1XMOB 4LRUA 5SICE 2CWWA 1IB0A 4GPAA 4O1IA 4RH0A 1YE3A 1DCMA 3CZPA 2GZHA 3I4CA 1DI0A 4AY5A 5AUPB 4FILA 1OTYA 2VK4A 4LZJA 2I99A 3DTVD 3CF0A 4BUZA 4PCVA 3TSAA 4AMVA 4Z9FA 3B3GA 1GN9A 3P2MA 5FJJA 2JVIA 3QX7A 1IQ0A 4XJXA 3VHXB 3VSEA 9LDBA 1DAMA 4W8GA 4DJEC 4UM9B 5I4CA 1E94E 1JZSA 2PRKA 5FBLB 1AOXA 3EC2A 1QHEA 2CMFA 2HA6A 3Q7RA 4Q3LA 4XIFA 1SVWA 1P0FA 2IHZA 2IEYA 3CCCA 1GUFA 1J24A 3SFZA 5KUTA 4OMCA 1KY2A 3PRJA 2P41A 3DWIA 2XMDA 3KWLA 5G41A 4C7MA 4A3SA 2PE5A 1FVHA 2C1XA 4F9FA 2MSDB 1ETUA 3FCOA 1T3GA 2F55A 4URFA 1MB4A 3CF2A 4HGRA 5HG0A 3RRBA 4FCCA 4YYEA 4FDUA 1KH3A 3VTFA 2F3SA 2CJWB 3UKOA 5AM3A 5JT1A 3DWFA 5KTTA 1ZC3A 2AUMA 4K9LA 3KQNA 2B34A 1JDBB 5FF9A 3NHJA 4PS1A 4OGWA 3LG2A 1J0BA 3G6WA 3UMVA 3OM0A 2QMUA 2IOFA 1RCUA 2FPKA 4EPYA 1J0DA 5JPDA 5KQGA 3P9RA 4JMPA 1UOOA 4XQGA 4GS5A 3AVUA 4J43A 1HYEA 3QTTA 3ZK9A 4RHTA 1J2JA 3PHGA 1UODA 2H1SA 4JV5B 1QRRA 1SD5A 1PJZA 1USUA 3HJRA 3AFNA 1NX6A 4PZPA 1TUBA 2R96A 2H1IA 3LF2A 3PX2A 1M1XB 5DWQA 3IPRA 4D46A 1Z2EA 4YAFA 2GJAA 1B4DA 2XNSA 1YVEI 2VWPA 5FNVB 2DF8A 2YNMC 3RCBA 4WGGA 4ZCIA 1BC5A 1XKQA 4YAJA 1HKUA 3NBXX 2R48A 3ZZ0A 3KZVA 2SBTA 1J5XA 4US1R 3A1SA 3GJYA 1XMJA 1UQTA 2EL9A 4KQWA 4PPNA 2V7VA 4UBIA 3E84A 4B84A 1ONBA 3C5EA 4QU5A 1QLWA 7ADHA 1S2IA 4DR3B 1VB5A 2FX5A 1R9JA 2H48A 3IDQA 1YQEA 3JCZA 3KAJA 1QYDA 4RU1A 3DDUA 2VL7A 1ZICA 4H3VA 1Z2PX 3KPUA 2IVFA 3ZDXB 3DLCA 2RONA 2ZR8A 2I65A 3A1NA 1Q11A 4GNKA 4LXGA 4N0EA 1SXPA 4QODA 2VH1A 4REMA 1P2VA 4UUMA 3SZRA 3BMCB 1DIGA 1JEAA 3ILSA 3SC4A 2GWHA 2YFKA 4ZQCB 1NIJA 5IJ0B 2Q5FA 4LYGA 4WUVA 3CMCO 4KP7A 3Q8XB 4R5MA 4NOJA 3GJ3A 3VZPA 3C3CA 4G5OA 4NX2A 4D0GA 4GUAA 1W7AA 3RVPA 5TX7A 1NXTA 3D8NA 4DT1A 1K08A 4ZI7F 4BN0A 5KOJB 1N3IA 2QSYA 1RD4A 1I9CA 3TTXA 4CV3A 4D8TA 4OL9A 5IH3A 1KAGA 5TC4A 1RLTA 2VDJA 1KYZA 4WN3A 1VDMA 4LI0A 1TYDE 4XI9A 2AXQA 4E14A 2C07A 4DSOA 2ZVDA 1A9TA 1LPPA 3UV7A 1TF2A 5JCOA 3ZCSA 5ICMA 4UDYX 3HU1A 2OXIA 1J20A 1G6KA 2WYVA 3C98A 1NE7A 2WOJA 1MN6A 3TX2A 2X3YA 3KLMX 2ZYTX 4DLVA 1BE6A 3HY3A 4NR0A 1NVWQ 4R2WA 3F78A 5A02A 1ZHOA 5F7ZA 1O0SA 3URMA 1SA0A 1XHEA 4UAUA 4U0KA 2GYVA 3Q8KA 3LNCA 1KEUA 1FFWA 4RM3A 3R7DA 1YK0A 3PDHA 2OFXA 4KDRA 5LCXA 3RC3A 2B78A 5HCUA 3U0VA 4F38A 2GD0A 2B98A 1F48A 1SQSA 4KGZA 1XCJA 4GBMA 3MWEA 2BGJA 1NJGA 3ABQB 3TLYA 1XDUA 2DR0A 2VT6A 4JI2B 4IWXA 1IULA 1M0WA 3CNNA 3REGA 2JIZD 1BWQA 3MK31 1G21B 3PQ8A 2Y27A 3FNGA 4RSHA 5FTNA 5JSZB 3KUXA 5IVPA 1B6GA 3EIWA 4D97A 5HKAA 2AMFA 4LBZA 3LMKA 4KB5A 1Q95A 3QNWA 4TN1A 5AJTA 4D8YA 2DE0X 2V4MA 3K16A 3M4NA 4FYHA 4FHCA 2XYQA 3GMSA 1I2ZA 4CV0A 1HL3A 3GAFA 1V39A 5BN1A 3GAMA 2AGVA 4GVPA 4OD0A 4O2RA 4QPPA 3I01A 4M8IA 2ZI5A 4C2AA 3FIJA 5AK4A 1NQXA 2PGLA 5AKKA 2XMGA 2O6LA 3ANLA 1XKLA 1NMEA 2O7QA 2AHRA 4NL4H 1C1DA 3FGPA 4Q1CA 4RHXA 5K0FA 1Y1KE 3B6ZA 2QT1A 2H16A 1VECA 2FF7A 1Z0FA 2SKCA 3T9DA 4EB0A 4YCMA 3K6JA 5SZKB 4IDAA 4LJRA 1CULC 4EUKA 2YDXA 3MLEA 4GPEA 1P8AA 1L5QA 2JASA 3BFPA 3IEVA 1R3UA 3FTDA 4JT8A 4B7XA 2NUTB 1P2DA 4K26A 4UW9A 1M54A 1JYFA 4G81A 5JSKA 5HPYB 1Z35A 1W96A 1L4BA 1FSZA 2G0NA 2ZIUB 3EY4A 2ZI7A 4L9SA 1QH0A 3L7DA 5FB3A 1XTQA 3UA3A 2GLXA 4L16A 1JECA 4EGAA 3ADBA 5EGNA 2JHPA 2OORA 3SXUA 4G26A 3KZMA 4OAOA 1MB9A 1WA5A 2XQVA 4EJ6A 3EXG1 5FLKA 3U3DA 4Q12A 3VNUA 1GAJA 1OZHA 1KDOA 3K09C 1VXRA 3NNNA 4AFNA 5K8UA 1H1LB 2AK3A 1Y37A 1GPH1 1WTCA 4PVCA 2BELA 3HNPA 4GR9A 3DE5X 1WQ1R 2FZWA 4UUBA 4E32A 4HPJB 4BMYA 4HNSA 2J5RA 4RQTA 1V3UA 1XZLA 1M66A 3F5SA 1FNBA 4GF5A 4CUKA 2YQ4A 1A5AB 3JTMA 1PZNA 1AHIA 4GX2A 3VDQA 1GKYA 2ZBUA 4I9GA 5ALIA 1AKUA 1AXGA 2DSTA 3I1YA 1X1CA 4HEQA 3G7NA 1MC8A 4WASA 3KU4A 1SM4A 4FQ7A 1I51A 2R8EA 1BH6A 2NZUG 3U9SA 4BKUA 4IINA 1LPMA 5GPBA 4QOSA 1QAQA 3RAFC 2W2QA 3D8TA 5EJ4A 4PN7A 5EKDA 2MR5A 3BGWA 2Y0DA 4IKOA 1H5UA 3RTGA 3OIDA 3PXUA 4J0GA 2UUPA 3QMPA 1W76A 4R16A 4CETA 3QLEA 4AKGA 4ND1A 1ML4A 4Y2YA 1NULA 1Z6XA 3ES9A 3KDPA 4S3MA 1CU1A 1Q7RA 4IIUA 4XM0A 1U28C 2E18A 2BKLA 4EYOA 3I72A 2HJWA 1HDXA 3UB2A 5CXQA 3QEAZ 4C0AC 3WLMA 5HOQA 4PSKA 4RY8A 3M6LA 2I6XA 3TE7A 4UUAA 2Y8EA 1UJMA 4Z4HA 2H4FA 1ZD8A 2GBPA 3EIEA 5K3FA 5AW4A 4U2DA 4ZV7A 4D9NA 1XZDA 4X6UA 2VP6A 3MRXA 4BNNA 3I6BA 1XPUA 2FRDA 4HK4A 1SUEA 4YAKA 2VT2A 4R1LA 4K6CA 2J30A 4Z7OB 3PF9A 3LYLA 1O97C 5BMVB 1N6RA 2V5AA 2A35A 4GOND 5CDSA 4FP9A 5GZ1A 3GEIA 1ZH4A 1PZHA 1OV4A 4NMMA 1OSNA 3G5LA 3I23A 3LZCA 3TI9A 4GP6A 4AVYA 4YUYA 2BMJA 4R9RA 5E9WA 3M34A 2ATXA 3NRJA 3KZNA 4C7JA 4KNYA 4QXOA 4UMDA 3T7IA 1ZVMA 4QGBA 5C4MA 4OMDA 3VC7A 4F4IA 4EKEA 3ENNA 4M4SA 5HCNA 1V8FA 2K87A 1YUMA 3IVCA 3KZXA 1W34A 3E9NA 5EKXA 5BUZA 2AC7A 2QG6A 3OE7A 3EBPA 1Y33E 2CNOA 3HP4A 1VCNA 2IYXA 3SFTA 2O5RA 1QGZA 4JUFA 4YRNA 5AKZA 5M5BA 3DT6A 4HX9A 4O4JB 1MEJA 1GNRA 4HQRA 2PVSA 3MT7A 3OJCA 1IOVA 4NBRA 2XB9A 2H3HA 2PS0A 1XAHA 2QDXA 1GV0A 5A3SA 5I9IA 2R3SA 3GLGA 4R98A 2Y68A 4Q7EA 4BVLA 4PIPA 4KQKA 3W77A 2XMBA 4I5EA 1CQZA 1UPAA 4UTXA 2FWIA 4KXVA 2PBRA 3DP7A 1CHNA 1ZGCA 4KWTA 4KN9S 1BXKA 2FEOA 3C41J 5E2BA 1NJ6A 5E1MA 3QWFA 3R3YA 1FJHA 1B42A 1ZITA 3TM5A 4DLZA 1M1YB 2OE2A 2PZAA 1C0EA 2Z04A 4OHVA 5JJ5A 3FY4A 5JJKA 1X80B 1GZVA 2Q3CA 5COAA 1QNLA 1I4EB 1Z5NA 1M7HA 2NXJA 3T5DA 1QHXA 3RSZA 4EDHA 3CZ9A 4R9UC 1BQ4A 1C4OA 3L8DA 5TSDA 1UJ5A 3GO4A 4S0XA 3T3HA 4OV6B 4LJ8A 2V6FA 4TTQA 5BN5A 1ZGHA 1JMKC 3BE6A 5CBPB 1Y3AA 4B2YA 1SCNE 1CQPA 2GR9A 4NOKA 2C0QA 4EI9A 1TUIA 2AJCA 5IP5A 1I7DA 3T06B 3Q9SA 3SSNA 1JZTA 1JEYA 1YDGA 4YHHB 4J0FA 3GYGA 2IHJA 5BRNA 1P4JA 1NFFA 3SYLA 5JSHA 3PDIB 1L8QA 4OQMA 1M8PA 1YCFA 4YFVA 2BEWB 4CTJA 2A88A 4YMUA 2PY6A 4A36A 1KBQA 4IJVA 4G5QA 4P33A 4WXMA 2YR0A 3ZJYA 3ZV3A 3NOQA 4JR0A 3IYLW 2FQQA 3MUEA 4WZBB 5BN4A 3WIVA 3MJ4A 3ND9A 3ZLJA 2O19A 2BLLA 2OFOA 2HBYA 3HRHA 5CUQA 1M6HA 2FW6A 4IHJB 4AAYA 3GT0A 1AMOA 1T6XA 3A2KA 3K15A 1IG3A 3RU9A 4JIGA 4QUKA 2XITA 4IRXA 4UHHA 4XLTA 5FTKA 5LQDA 2J0UA 1O03A 5CT8A 4XYMA 3RYCA 2O05A 2UVQA 4K6FA 2AEFA 1EP1B 2WUEA 4NKRA 4BWYA 5IS2A 1G8PA 4JP8A 3NAMA 1QYXA 4OU4A 4S1VA 1SCKA 1YHNA 2LVBA 3DAGA 3KS9A 4KTVE 3O91A 1QVWA 1WZNA 2B4YA 2XGMA 3KZCA 2ZBQA 4IV8A 5L3RA 1ZCZA 3G8BA 3STWA 3V80A 3Q8WA 4YRKA 3AF6A 3IQXA 3WLLA 3BTVA 1OB5A 3CR8A 3UMMA 4O2AF 1H8EA 1RJGA 3TRHA 1RQPA 3M82A 4FLFA 4K9QA 1SUWA 2FSVC 2FZ5A 4KLNA 4Z49A 1R0RE 1O0CA 2HHHB 3NZEA 2HU5A 2WIFA 4KXYA 1EINA 3HCRA 3ML1A 3TNLA 2Q5LA 3K8ZA 4FS8A 1X13A 4JEMA 3IE0A 3QOFA 4QRHA 5IN4A 2XUZA 2VR1A 2O14A 4PGHA 3OLVA 1FW6A 1IN6A 1T25A 4HH4A 3NM6B 1ISPA 1UFKA 2YV2A 4G25A 4X64B 2CHGA 3FW1A 1YZGA 3DMGA 3VKHA 3TZQA 1GD1O 4F7WA 2XAAA 3ZKWA 1I6KA 2Z4SA 2G9QA 2WIKA 3E1GA 5AOAA 2C2KA 4B35A 3U5ZB 4NZ9A 4ZVOA 1JJAA 1PR9A 2M2IA 3DEIA 5ALFA 4ZKEA 1ZG3A 5TGDA 3ZZUA 4WFQA 1GDDA 2VG8A 4ZJUA 1YZUA 3QUAA 4K6HA 1G64A 3HC7A 3NT5A 4LZOA 2QN8A 1ULUA 4EMSA 1DC3A 1HRKA 5LYJF 2XVXA 4YLEA 1KK0A 4M37A 1GG8A 1JIJA 1P1IA 1DRKA 2G25A 2WJ4A 2JFWA 2ZI3A 3DAFA 2VJDA 2A59A 3PC3A 4K3UA 3AHGA 3LCVB 4LDQA 4ZT2A 4C29A 1R88A 4JP1A 5JS7A 2AD5A 1AXEA 1IAQA 1XAJA 5LOVA 1CKEA 2XZOA 2P8JA 3HP7A 4DNXA 3E03A 3N74A 3OCCA 4YX9A 3DEHA 5FOWA 3TLGA 1GPMA 4L5CA 1Y5IA 1BXRA 2X5JO 1QKJA 3H65A 2FMUA 1R10A 5BSMA 4O2BF 2CBGA 4P0PB 3F6BX 4AJKA 4G01B 3B1VA 4BLVA 3QLTA 3VU9A 5CYGA 3H4MA 4QL3A 2CLLB 3CW8X 2G7MC 1M10A 3MRSA 1T4BA 4ZC8A 1ZJWA 3H2SA 3PEFA 4POAA 3E0QA 4PW0A 4D9CA 4O4HB 4QUGA 4H18A 3CLRD 4HN9A 3VPCA 3GJQA 3WTCA 5BNTA 1EUDA 2F43B 4MQ6A 1WOYA 4Z7NB 1PR6A 3R3WA 3HBMA 2O2DA 4LRYA 4QUHA 2SNIE 1W88A 5CA1B 4C0XA 3D7RA 2HA5A 4CEJA 1AU9A 1EDZA 1IRXA 2IEBA 2BEUA 4K87A 3TQHA 3HCPA 3L7MA 3LT1A 3O7WA 4MHSA 3LRXA 3PYLA 2BFEA 2CVPA 4DMMA 3K31A 2CXXA 2Q0SA 3M5WA 2P2GA 1WETA 4IDFA 2AUNA 4JT2A 3TDMA 1CLEA 5GV7A 1R0ZA 1U99A 2WD7B 1SUBA 4C3ZA 2Y1FA 3ZYCA 1QRDA 2FA9A 5LC1A 3HCOA 2BBTA 2OILA 4AMGA 4BP9A 1ZMTA 1M1YE 3L7YA 3QLUC 3QUSA 4HDMA 3PUKA 4BXOA 5F4BA 3D1VA 4CG2A 3A3PA 4RDCA 4MUKA 2LRHA 3W0LB 5EHZA 4I4TB 4C4YA 4X91A 5BWOA 1MNAA 2YYSA 3MCWA 4UKDA 1IYZA 1V6AA 2FW8A 3IUMA 4DV2B 3SF8A 3LDHA 5JI2E 1ZVQA 1YCDA 3G2MA 2Z08A 1L3IA 4NU6A 4KQFA 1T2DA 1JG4A 4X65B 2C98A 2EP8A 2IVZA 5FWYA 4YAOA 2DFKB 2UYGA 3FX2A 2I6QA 3PJGA 3CEJA 4F97A 3ESYA 3DYBA 1RNLA 5KJ6A 3GLFE 2X3FA 1MMFB 3LCUA 2QL7A 4X7RA 4NULA 5LP6A 1GTMA 3LCJA 4RZIA 4CTNA 1Z5GA 2QQ5A 3PWSA 3WIDA 2FSSA 1WZEA 3REFA 2F00A 4KWCA 4GP7A 4PFQA 4P34A 2HHCA 2WUFA 5D00A 1L1FA 3U1VA 4JA0A 1H94A 3KQLA 2Q0XA 1ENOA 1NJ8A 2NV0A 2F9FA 5FEUA 1JSZA 3SLRA 1U8XX 5FOTA 1PO7A 5IVIA 1L5SA 3HKCB 1GTG1 4J91A 1DIHA 4PRYA 1M9NA 3I30X 4YCJA 4F8EA 5FWNA 3P0EA 2BFMA 2NSDA 1CC1S 2J3MA 2DFPA 4HNVA 2E6KA 3ECAA 2BKVA 3GT3A 2FWAA 1Q7EA 2B21A 4BX3A 1GL6A 2OYSA 2ES4A 1SEPA 3T94A 1Y6ZA 1DAKA 4OHXA 3O2QB 4EJ2A 4JXZA 4U00A 1QZUA 1DL5A 2O7RA 4JELA 1ARZA 5E7JA 4BNJA 2O8EB 3CLRC 3U39A 2JBAB 1YQTA 2XDWA 1PS8A 3ZDQA 1BX1A 3BDAA 1KXZA 3BFJA 4HQKA 2CNBA 1R8QA 7MDHA 2I1QA 2YXBA 1JFFB 4WWHA 1T4DA 2A92A 4YCDA 5FLEX 3PWTA 4X45A 1W8IA 2W2LA 3NVMB 4JGGA 1V95A 1YR9A 3PUXA 1N9KA 5KTSA 1RJ9A 3WXMA 2ACWA 2WPDA 3ROGA 2CSXA 1VGVA 2IH2A 1CT9A 3EF0A 4QOFA 4B3XA 2GPYA 5A2QA 1NR5A 1GQSA 4N5NA 1SCUA 1ZBDA 2MSEB 4J0DA 3CMMA 4FMBB 3VJKA 3U7EB 2Y2VA 1DKOA 1ZAYA 5FUYA 1T9DA 3H8JA 1GLVA 1LLFA 3PS9A 4WZ6A 4XM2A 4NYMR 2NMVA 4GKVA 3UJ9A 4YJ3B 4EO7A 1OFGA 4UEQA 1DEKA 5A4FS 1XYGA 1ZJYA 3IKLA 5F73A 1JA1A 2PR7A 4DQUA 3WA7A 1I4WA 5AH0A 4LAFA 4UTVA 5F3WB 4HB0A 5JAHA 1GGFA 2DQYA 5KWEA 5L3ZA 3IBTA 2FUG6 3EWIA 5GJCA 5LP6B 2QR3A 3KDSE 3ZU6A 4RADA 1C9KA 3T1VA 4E0BA 1G38A 1AGYA 1KY5A 2HLHA 3V34A 2CLKB 1UDCA 3K2BA 1N6PA 4FWBA 1Y6QA 2DPYA 4XVCA 1XQ9A 4CKEA 1P62B 4G8JA 4RF2A 1DX4A 2PYIA 5TS3A 1OXVA 3TZCA 4PZLA 4EHDA 4PSVA 4FE3A 4NCKA 4KQCA 1MEOA 4RORA 2X2FA 1Z4IA 2GKSA 2OHFA 1U4OA 3AY6A 3DAPA 4HLUC 4IQ4A 4JDPA 2PUTA 3T5BA 4YECA 2JIOA 1FVFA 4QFCA 4H6WA 4DCUA 5IUNC 1USGA 1BE1A 3GWGA 2B30A 5IDYA 2ATIA 1KU0A 2G09A 1XZAA 1H3FA 1JIIA 2PCJA 4ZVNA 3I01M 2Q1WA 1WXXA 2JLXA 3PXXA 1QJCA 2ZITA 3H2JA 4H6VA 4QYXA 4WK2B 5JR3A 3I62A 2DTEA 5KB3A 1SUDA 5DBOA 3IIEA 3WSTA 4AN4A 1N9ZA 1NX9A 1ZUNA 4XWTA 5FUXA 4AG6A 5TQJA 1TF7A 4Q4HA 4C5AA 5IJXA 1FPMA 2QLTA 3G1UA 4DLKA 3MOIA 4DM7A 2ECOA 3SYRA 4HFMA 1CD5A 3BAZA 4J3NA 1N77A 3ZIDA 2O2IA 4RIIA 2PQ0A 4XSGA 1OWLA 5M2QA 2ZTUA 2OOSA 4MIYA 4GMGA 3L9XA 2FVXA 3GF4A 2J5KA 1G19A 1T13A 1IQUA 1U6IA 4F04A 1QK4A 1V16B 4P82A 3GA5A 1ENZA 1SZCA 2VYVA 5K45A 1JKJA 3X1KA 1M7BA 1J5PA 1PTJA 1RHUA 2Q5JA 1AUPA 3G6KA 3HZOA 3JRXA 3KB2A 3U48A 2CMGA 5B6PA 4H3SA 2Z56A 2QRJA 2VLBA 3W5DA 2ODWA 1TAQA 4EK9A 1QFJA 4ZAVA 2NPOA 4ZZ2A 3IT3A 5C4GB 3SS7X 4ZZIA 2YVUA 2P75A 5A3QA 2QZ4A 1TCAA 1DFHA 1JKIA 3S40A 1UFQA 4TLMB 2Z2JA 6CHYA 4IVQA 4DWVA 4H59A 2WWXA 3QSYA 4X3PA 3GH1A 2HMWA 4N47A 2I6UA 3ICVA 4UM9D 4Z4CA 1ISMA 4DR1B 4TL7A 2FZEA 3F97A 2XGJA 4JLJA 4KJXA 3PNQA 5ARDA 3P4UA 3BHJA 5EZQA 1PI3A 3O4FA 3A6LA 1DT5A 4MPDA 3VR2A 4BVJA 5BN3B 4FM9A 1EAMA 5AVVA 5M7EA 3OEED 3A1FA 4K03A 1COWD 1GQYA 4W8HA 4N4AA 1EA7A 3E05A 1CETA 4J29A 1JDJA 2O8DA 2P2NA 1PJ4A 5GVRA 5CA0A 1A8UA 2A9PA 1IHPA 3AKDA 1FQJA 2VYFA 4G86A 2PS1A 2PS3A 2ZG6A 1RYDA 3G9XA 5I8PA 1L8AA 1UZMA 4FIZA 2PNFA 1DCFA 3MGGA 2RE8A 1AGXA 1UC8A 3R0VA 1Z7YA 3LX5A 1W5AA 3A0RB 3CR3C 3GY0A 3OZSA 5AOCA 2WKRA 1ISFA 4W9RA 3N2GA 4HB4A 2NAFA 4LQ4A 1WP4A 4FFVA 5H02A 5LD2C 3UG6A 1MQSA 3VR4D 3TVTA 3I83A 1FYEA 2QR5A 4KYUA 3CEHA 2B4TO 1OFHA 5THXA 4TYYA 4MICA 4FT4A 1KARA 1FTYA 1TQ8A 1AM4D 2FLKA 2GPNA 3GRPA 4C6HA 4JQYA 4YH1A 2QK4A 2JG3A 4AN1A 1I7SB 3HVHA 2G5CA 4K0KB 2WJHA 1NMZA 3OI7A 4FOTA 2E21A 3K71B 4MI1A 3IKJA 2LP4Y 1FFHA 1VJ0A 4QJIA 5KJCA 2PIAA 5EI5A 3VDMA 4CFSA 3JQRA 1F17A 2FMFA 2YBEA 3MGBA 3WKCA 5JAPA 1KRHA 1DBWA 1XTKA 2X9VA 3BRQA 4H0FA 4W5OA 4YBRA 4RVDA 1Z7GA 1CG6A 2J9RA 1KFKB 3V46A 1E2QA 2JVJA 4FOSA 2ZAOA 1C3LA 2ZIXB 4FDTA 4L9AA 4UNQA 3ZVRA 1V5FA 1DJNA 3RVKA 1U2QA 1UBCA 4FDMA 5BYKA 1GPUA 4K2HA 1RPJA 3H1BA 3WOHA 4AP6A 3H1EA 3OZ7A 4TMTA 5JC1A 4Y2GA 1MQ9A 1RMQA 2ZWMA 4MUYA 2WWYA 2AXNA 3BE8A 2JCBA 2OGZA 4BO8A 2FETA 4BNMA 1TQ6A 1WEKA 5AK6A 1XA4A 2E6UX 1VYHA 4M1ZA 2AZMA 3QVVA 4IQ8A 5CLFA 3GB9A 1UMBA 1YB6A 4IFIA 4IIDA 1E3DA 4MSUA 4OAPA 3BIXA 3AWIA 3G9TA 4RPLA 3ANNA 2GNAA 3S2IA 2PRZA 3F4KA 1E77A 3ZQJA 2FX3A 1B41A 1CBUA 3IQFA 3ZD7A 3L9WA 1AF7A 1KDYA 3F1KA 4RCVA 2YYAA 4CMIA 1J25A 3FFAA 1BGWA 1X19A 2C8KA 1JTFA 2XQKA 3WLQA 4BV2A 2C1ZA 5TJHA 4Q9DA 1ZNYA 4N5LA 1FDRA 3E22A 3UJNA 4R5HA 3GJ8A 1G42A 4WEOA 4XUCA 3WLPA 4NTZA 3PA6A 1Q91A 1XR3A 4I8IA 1FL9A 3DULA 1ZUHA 3L0ZA 3KQSA 4YI5A 2KPOA 2YH2A 5FFFA 4XDGA 3P2OA 5K1ZA 4ER6A 3EVNA 2O23A 3PQ4A 5IDWA 2CMDA 2C0PA 3OECA 4MA4A 4ZIRA 3DVSX 4F92B 3N1UA 4J76A 3AUYA 2XQFA 3FFWA 3MJFA 2ANBA 2ZAIA 5DBFA 4AKIA 3B1FA 1JS1X 1M34E 1J8QA 2YXPX 1NFRA 3B51X 2WW8A 3VZRA 4ER0A 5JMOA 3LK6A 5IBPA 8AT1A 2HSGA 2I2DA 3TQRA 1EFUA 1QYCA 621PA 3R4VA 2HO5A 5FFNA 4W1SA 5MF6A 1P7YA 3N86A 3NP7A 5H16A 1CUYA 4WOPA 3BMOA 1OBHA 2QYOA 1WZ2A 2Y9PB 2ID4A 5F5NA 1ZI8A 3WL7A 4XVUA 2ENWA 2EQ5A 3HSYA 1T6NA 5EMHA 2ZRNA 4V38A 4PZAA 5EQTA 3T7KA 2PH3A 5AW6A 2V7QA 2RDMA 2ZYRA 3Q6MA 3UAGA 4OYLA 5I8ZA 4N8EA 4NEGA 3OOJA 4K2AA 2J9XB 4Q7JB 3WR5A 4N48A 3DTTA 1BDJA 2QM0A 4HBGA 1E6MA 3JQAB 3NGXA 4AKEA 5KO2A 4Q7LA 3OMWA 4EWLA 1LPAB 1FYDA 3FYUA 5K3CA 1K66A 2YV4A 3KJZA 3KSBC 3WNDA 1RTTA 3ZS8A 4B85A 1Z13A 1AKMA 2HK6A 4L7QA 3TNYA 2IU6A 3AU8A 1S1CA 3DZIA 1R0WA 2JEOA 3VDXA 4POOA 2Q62A 3C74A 2G36A 2FOXA 3OHPA 3KJNA 3KG2A 3MILA 1M0EA 1YNOA 4FSXA 4B6OA 1FIUA 2WIBA 2DHDA 3C0KA 3HVUA 4GSKA 4FYXA 3JYOA 4N0MA 3HVJA 4L6AA 4D9HA 1PV4A 3HCBA 3AVXA 2FJUA 4UHKA 1TJNA 4ZDKA 1U0NA 4YVFA 4TUYF 3P9KA 3KOZA 1UPXA 4MYTA 5DFAA 2VP0A 2HRBA 1D2CA 3QMWA 3W7AA 4YI3A 1KO8A 1J4AA 1B2LA 2Y6UA 3D7NA 4RD2A 3K9WA 5C4IA 5REQA 1P61B 4R1PA 4BFWA 1KFCB 1HQDA 4HDNB 4II2A 2OWEA 2WAYA 1QE5A 1R0SA 3DQZA 4IS2A 4O63O 5JVDB 3S1LA 3W1VA 3T1QA 4M0EA 5J4LA 3A11A 4DBLE 4N9QA 5F5XA 1YB2A 3O9ZA 4MW5A 4RVOA 3X2FA 4DEVA 1GTSA 1DARA 4DC9A 1J97A 2W58A 2Y1KA 2PX3A 4KNWA 1UXHA 4JSYA 3IESA 2HC9A 2C0CA 2J4DA 3K0AB 1PDVA 4JBYA 1F0KA 1HLGA 3Q7EA 4V0SA 1G8GA 2N46A 3BDVA 2IP4A 5LA6A 4WRRA 1E99A 4ACBA 2WSIA 1BN7A 2AJDA 1NF9A 1ULBA 3TD9A 2C8JA 4ZIRB 5JMTA 4JJFA 2D4HA 2IU0A 1BS1A 4W99A 5JH7A 1LPNA 1ODCA 3MERA 3L46A 2XGGA 3IBFA 1QV6A 1GHTA 1T9HA 1RPAA 2BGKA 2FN7A 2H2AA 3AHIA 3B5EA 4EJMA 5BT8A 4NHOA 3EYWA 1MGPA 5BVGA 2EHDA 3S2EA 4S1TA 1Z2AA 2CVHA 4ZP1A 4KUGA 4D0LB 1NT4A 3AUJB 3KJFA 5FBQB 3USES 5BMOA 5KDOA 3FBWA 2CFTA 2QTGA 1Z6ZA 3JAKB 5IABA 2F8TA 1Q7CA 1SXIA 3RFFA 3G5MA 1VM6A 1ZWKA 4Z0NA 4IH9A 1H8HA 4GEKA 1IUPA 3CWCA 2RK3A 3PNBA 1AH2A 2GUWA 2RAUA 2ZTMA 4BVHA 1MABA 3FGZA 2VQDA 1NM5C 1R12A 3IVAA 4UEWA 4CM6A 1CRZA 3QFCA 4XPIB 2TS1A 1DKMA 3B38A 4RGBA 2WTEA 2QRGA 2AW3A 3AONB 4EY5A 1IDOA 1MTZA 1WU8A 2EW1A 3LY9A 2NZYA 3QVJA 4DXAA 4ZJZA 4MARA 3ZE1B 4QYMA 5JNRA 5EJMA 3VR6H 4FNMA 3F4BA 3KT8A 1SU4A 2L82A 3OKPA 4DCNA 1NLYA 5CP8A 4L8LA 2WHPB 1AF4A 3Q7IA 1MO6A 2A9KA 3HMQA 4MZXA 4KO2S 4BQRA 3USZA 4MYUA 2PUCA 1Z83A 3KVNA 2J07A 1EAYA 3G85A 1D1TA 4IJKA 4JLBA 1UDWA 5FUWA 5EIOA 4J9VA 4GZ3A 1HL7A 2XYHA 3S7TA 1QO0D 2CXNA 3HJUA 3SDBA 1ESNA 2R85A 4MVCA 3IVRA 3M6FA 4ZXPA 4CE6A 4J1NA 2GN4A 3R5HA 3JS5A 2EKPA 4PSUA 4RKFA 3M9XA 2X0DA 4Z51A 2P67A 4RD4A 2FQ1A 1JU4A 3M1LA 3ELYA 1P5HA 4GI1A 1O7JA 5AJXA 1EI9A 2ZW9A 4S1WA 3ZY5A 5FD8A 5AO9A 3ROXA 2LGJA 2VNJA 1QCYA 4B40A 2ZT8A 3VKUA 1MFZA 1WQ3A 3MINA 1GPBA 2A8YA 3LQ2A 1NKSA 2OQ2A 3AR2A 3M4JA 4CNBA 3GLVA 4YJFB 3ZQKA 1GCOA 4C0JA 3AI3A 3C8UA 4LNUB 5A4JA 1KMHA 3OIYA 3IERA 3RC8A 5BSFA 5I6DA 3NOXA 4WD3A 5AJVB 3WLFA 2L18A 4HDCA 1OYYA 3RARA 5FH9A 3SIRA 3D4OA 4TXHA 3UMJA 2DQZA 3U31A 4EGSA 4Z7QB 3QPWA 1O94A 4D9GA 4MYSA 4RVGA 3TVYA 4BNFA 1JAZA 4UU8A 1JEJA 1IC6A 3JAWA 5E3HA 2W0MA 2W6JA 4WOBA 3SWWA 1P7WA 3NHKA 3ZWDA 2ZUFA 3ONFA 2FFRA 2F9MA 3L8ZA 3V8VA 2YRWA 3DFMA 3DHNA 3VVBA 2CV0A 1GKLA 3ID6C 1R5OA 2RK4A 3E3LA 3PIRA 4P54A 1NSYA 2Q9AA 2OHHA 5AKHA 1JIQA 2VDOB 3C6ZA 3QVGA 1F8UA 2XNKA 4PZ9A 5ECGC 5LWQA 1P5ZB 4FHFA 4OIFA 2YHBA 1RLJA 3I9MA 4MPPA 1ECBA 3X1MA 2JFQA 5EIBC 4GXTA 2G3YA 3KTDA 4GKAA 2GEBA 1MORA 3TIIA 5IULC 3OJFA 1YVDA 1Y8CA 2X5OA 2VT7A 1VPTA 2EJWA 1WDLA 2J5XA 3PC2A 3PC4A 1GZ6A 1WBDA 2QD2A 3V7WA 1GO2A 1Y98A 5JS6A 5A0TA 4A03A 2HBQA 5K8CA 1O6CA 3UMCA 2VNHA 1Z17A 2FX2A 3Q5DA 2QL6A 3OE7D 4L08A 2F90A 3H4IA 1R6DA 2X5XA 4TSKA 3TQTA 4D9MA 1WXGA 4P3OA 2QZ9A 4R3UC 3NQ41 1E1LA 1Q0LA 2P27A 2ZE5A 2GX6A 3KSUA 4W9MC 1YD7A 2BHSA 4I5FA 1OLOA 2NO4A 3AQ4A 4HVTA 3U7GA 2X8JA