1JE1A

5'-deoxy-5'-methylthioadenosine phosphorylase complex with guanosine and sulfate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
234
structure length
232
Chain Sequence
b'PVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKIWITKEELEKSVMDGAKAVLDTLTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-METHYLTHIOADENOSINE PHOSPHORYLASE
publication title Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 81
structure length 232
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2001-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1je1A00
1Y6QA 2HRDA 1VFNA 1A9TA 5CYGA 3SCZA 3E9RA 5F7ZA 4TTIA 1CB0A 1Z35A 3E9ZA 1TGYA 3DP9A 4WKPA 4M7WA 4M1EA 5IFKA 3EMVA 4OGLA 1JP7A 1PR6A 3NM5A 3LA8A 4EB8A 1TCVA 1SQ6A 1YR3A 1M73E 4BMZA 1NC1A 1U1FA 5CXQA 2GUWA 4L5AA 2B94A 1SJ9A 1PR2A 1V48A 1LX7A 1Q1GA 3BJEA 1LVUA 3LBAA 1VHWA 3PNPA 1A9PA 4DANA 3KVVA 4F3KA 1JDZA 1N3IA 4LKRA 2HSWA 4ECEA 4YMLA 1PF7E 3TL6A 3OF3A 3DJFA 2AC7A 4TS9A 3O4VA 4KN5A 5B7GA 3PNSA 1B8OA 5F7XA 1YRYE 4UC0A 1FXUA 3OZDA 1JPVA 1Y6RA 3OZCA 4FFSA 4QARA 4LNHA 1Y1SA 3E0QA 5K1ZA 1U1EA 1SD1A 5FAKA 3UAVA 5ETJA 3OZBA 2HWUA 2A8YA 4TXMA 4X24A 3KVRA 5C80A 1T8WA 3EUFA 2A0XA 1ULAA 4QAQA 2QTGA 5B7PA 2ISCA 1PKEA 4F1WA 1RSZA 4E1VA 4QEZA 1JYSA 1U1DA 1PR4A 4QFBA 3F8WA 3DF9A 1RT9A 2H8GA 2I4TA 4G89A 1LV8A 3OCCA 1NC3A 2QDKA 4I2VA 3KVYA 1C3XA 1ZL2A 1TD1A 4BN0A 1CG6A 1K3FA 3OOHA 1ODLA 3PHBE 2BSXA 1V4NA 2AI3A 1A9OA 3OPVA 4PNPA 4WKOA 3ODGA 4YO8A 3UT6A 1ODIA 5F73A 1TGVA 1Z5NA 1A69A 1PWYE 3NBQA 1U1CA 4QATA 3FAZA 1ECPA 5F78A 1A9RA 1Z5PA 4D8VA 4H1TA 2QPLA 4LDNA 4F3CA 2OC9A 1Z38A 4DAEA 1RXYA 1K27A 2I8AA 4JOSA 4R2XA 2ON6A 1V2HE 1I80A 3NM6B 4P54A 3U40A 4L5YA 5EFOA 4GLFA 4GLJA 2P4SA 4TXHA 3OOEA 1RCTE 3DDOA 3MB8A 4DABA 1PR1A 1NW4A 4L5CA 1OV6A 1RXUA 4DA0A 3UAZA 1JE0A 1JDTA 1Y1RA 4TTAA 3FWPA 4G41A 3EEIA 1PBNA 1JDVA 1T0UA 4MCIA 3O6VA 4RJ2A 2PGAA 3IEXA 1RXCA 4TTJA 5CCEA 4LNAA 3FNQA 4M3NA 5DK6A 2OC4A 5CYFA 3LGSA 5B7NA 1TCUA 1ODJA 5F76A 5F7JA 1QE5A 1RR6A 2IQ5A 3PHCA 1VHJA 4D8XA 2RJ3A 4MARA 4D98A 3KHSA 1ODKA 4EARA 1ULBA 1OVGA 3FB1A 3FUCA 3ONVA 3KU4A 5EUBA 5EPUA 1ZOSA 1SD2A 3GGSA 1VMKA 4L0MA 3P0FA 3FOWA 3K8QA 4NS1A 3IOMA 1OTYA 4D8YA 4OEHA 3UAWA 4WKCA 4IP0A 1XE3A 1JE1A 5CXSA 3INYA 4DA8A 2OECA 4GMHA 1PR5A 4MCHA 3T94A 1PK9A 3BL6A 1T8RA 1T8YA 1Z39A 4OF4A 1V3QE 5F77A 4DA6A 4OY3A 2A0WA 3OZEA 1JDSA 5I3CA 3MMSA 1B8NA 4D9HA 3NM4A 2OXFA 3EUEA 4QASA 1WTAA 4BMYA 4R2WA 5F7OA 1Y1TA 2AI1A 4R31A 4JP5A 4YJKA 1RYZA 1Z36A 1OTXA 1YQUA 5CCDA 1PW7A 2Q7OE 4PR3A 5JPCA 4YNBA 4L6IA 2QSUA 4BMXA 4F2WA 1V45E 1Z5OA 3GB9A 4DARA 1PK7A 1K9SA 1OUMA 1YQQA 1Z37A 1OU4A 2QTTA 3D1VA 4G8JA 4JWTA 3QPBA 1JDUA 1G2OA 3DPSA 4WKBA 3UAYA 1Z34A 2AI2A 3UAXA 2HN9A 5KB3A 1RFGE 4TYMA 4K6OA 4NY1A 4WKNA 3C74A 1T8SA 1PR0A 3P0EA 1Z33A 4OJTA 4OGKA 4DA7A 2XRFA 4TXNA 1RXSA 4TXLA 3KUKA 4NSNA 5B7QA 4TXJA 4DAOA 4GKAA 1YBFA 1Y1QA 3BSFA 1U1GA 1V41E 3K8OE 5IU6A 3ENZA 1A9SA 4F2PA 4LZWA 4TS3A 4U2KA 3BGSA 2A0YA 1A9QA
chains in the Genus database with same CATH superfamily
4IX9A 2E3JA 2REQA 3E3OA 1U0OC 3RRBA 2BIFA 3SG0A 4F8JA 5IM4A 1WMDA 4ENSA 2ACEA 4LWZA 3DVQX 3OQ1A 1XJWA 1Z35A 1YA4A 3FPEA 5IAOA 2OA0A 2ZIAA 5ILGA 1KBOA 5EGNA 1DMRA 1ZU4A 2R2AA 4HDMB 4RA6A 4D5EA 1ODTC 1JG3A 2X40A 1ZHFA 4L3VA 4IIVA 3SM3A 2A4MA 4YI5A 2R60A 2VPTA 4CRWB 2IY9A 3TQCA 2FPUA 4LAFA 3RVSA 4OI4A 3C48A 2QVYX 1K4KA 1Q19A 3FZQA 4MYUA 4J1QA 3B7WA 3LA8A 3TZLA 4EKIA 3DOCA 1VLJA 4TTRA 3MWKA 2FWRA 1P7PA 5CX4A 5FP0A 3SYKA 4BKRA 4HZUA 2EYQA 4OK3A 2IUTA 4CIAA 3LQKA 5DCYA 2JDID 1OI4A 1AKEA 2XYHA 4FYKA 4MQ5A 4J4BA 5CLHA 4A82A 5TE9A 3WO1A 1VE3A 2AK3A 1OW3B 1W581 1D0SA 2XRYA 3HCCA 3KQSA 3FMPB 4IG4A 5JCZA 3MGBA 4D02A 2ZJFA 1WMBA 3RFCA 3MRSA 2G5TA 1E2NA 2P67A 1DBQA 1PBTA 4NDZA 5THKA 2NO6A 2PEYA 3PQ7A 2VHYA 4X97A 1G8PA 2ZJYA 1NGSA 2A9JA 3ZVNA 1AKMA 3ZLJA 1NVTA 1PFYA 2Y0PA 4YUAA 3DHVA 4G0XA 4ONEA 4P7GA 1YT5A 3S3TA 3MXOA 3F73A 4ZOLF 2GEJA 4Q82A 2WU0A 3RW9A 3LLMA 4JENA 1IBLB 4V02A 1VOTA 5IKEA 3PEWA 1HQCA 1QX3A 2ZB3A 4JJ6A 4XD2A 3KS9A 5IC6A 1DPGA 3T61A 5CFLA 1BGVA 3ST7A 1LFAA 3EULA 2WG0A 1ZGZA 3VMMA 3OMLA 2C2KA 2G4CA 3U26A 1Q7BA 1YS2X 2DHRA 3DL0A 3KQWA 1Z18A 3KKLA 2WWGA 4D3XA 5AVZA 4XKJA 4HWGA 4X62B 5A9RA 1KZGB 3T5PA 2NQ2C 4WERA 1XJCA 2GN2A 2JFUA 2Y3IA 4URFA 1XHFA 4CLDA 4YT4A 1YBHA 5DN9A 1L5GB 1OE0A 1XVIA 2Y67A 1S1MA 5ENDA 2VDMB 1SOAA 3OMXA 4QGAA 3RC9A 1UPAA 2VP5A 1V8DA 3PJRA 2QTNA 3HB4X 4BMCA 1BRMA 3IIMA 5TRTA 2PUAA 4I14A 1L3BA 5DOVA 4COKA 5EKDA 1NXXA 5ES4B 2H4XA 4TMYA 4XTRA 4AYWA 4PFKA 4O2AB 3QWBA 4NDAA 3PPIA 1RAFA 821PA 1NF9A 3IO3A 3PXEA 1K8QA 1OQAA 3EQ7A 4H4DA 5EWJA 3L02A 1MZPA 3TEFA 3J80A 1HNNA 2PXAA 4E2ZA 1N2HA 2RGUA 2M6LA 2PAAA 1GP2A 3GAAA 2X42A 4CL0A 4E08A 1HQYE 3CX8A 1BEZA 2OBBA 1YVPA 3VPCA 2W6QA 1RQ7A 4AL4A 4JQOA 3QW2A 5EMLA 3VKUA 3UZUA 1SC3A 1VIYA 1WDMA 3GPDG 4YBRA 4IUCS 3F3SA 2CXHA 1YMUA 3HDJA 2O59A 3IP6A 3WGVA 1UOQA 4CLRA 4HAUA 1JB9A 5ABPA 3EBPA 5KREA 1OWNA 1U2DA 2QN7A 3JQBC 4H4CA 3BX1A 1YR2A 2DWPA 5AHXA 1CW2B 2F3SA 2Q27A 3Q87B 3IUNA 2BFPA 1YZNA 2J3MA 3GJZA 4N6NA 5FF9A 5HF9A 3T9CA 3TZQA 3VISA 3VR5H 1J0EA 4OK6A 3RRXA 3ZUGA 4EKGA 2IH4A 4UXIA 4WLUA 4NBSA 1P2DA 3KQPA 2XUAA 2QP3A 1NG1A 2G9RA 3O8BA 1Q0UA 1UKBA 2PRKA 3GD7A 3N87A 3T06B 4ZA2A 2B69A 1U1DA 3HMKA 2FJ0A 1AE1A 3PIIA 5DNUA 1UADA 4AJJA 2DR3A 3OQOA 1G6HA 5FD8A 2JLUA 2WJGA 3CUEF 1LV8A 2ZWOA 3F5MA 4NP6A 4MHOA 1WM1A 3TB4A 2JFVA 1E5XA 3L7DA 4R16A 3C14C 2OXTA 1D4ZA 1LW6E 5L95A 1FSPA 2YN0A 3G13A 4D97A 1AO0A 2V9ZA 3UGTA 2DJ5A 3JXEA 3MT0A 1K97A 3K5IA 3PRYA 4I1UA 4L08A 4DXHA 1K3FA 5L6LB 4G0VA 3AXSA 4TKVB 5HRAA 4F0JA 1QDUA 2ZRBA 3NX4A 1N5IA 3BK1A 1XZLA 1BXGA 3GT4A 5DHRA 1C7ZA 3N8NA 5H02A 3P97A 2GZ3A 4N65A 1SXJB 2NZUG 3C5HA 5BMVA 1FYVA 3WDMA 2OGUA 4Q7MB 1EESA 2QP9X 1ANKA 3F6SA 1WUYA 4ZQGA 3JWHA 4MS3A 3DMHA 5FFFA 3EC7A 4FSHA 3EBOA 4NARA 1CUFA 1WCYA 1J8QA 1ZRNA 4B4DA 4QTXA 5FLKA 3M49A 4KVAA 3TLXA 3WB1A 1VKZA 1C81A 1QC5A 4OHCA 1XMPA 5HBGA 1PD1A 2JATA 1LWNA 4K6HA 4AICA 3OCUA 3FW1A 3WK4A 1AKTA 4DR3B 4YDQA 1Z73A 4A23A 4FD3A 1MENA 4GOLD 3U7QB 1KAOA 1F2DA 2Q4OA 2YWJA 1T9ZA 4LN1A 2V0GA 4KIWA 2FEWB 1DBPA 2WDZA 1MX3A 5ALJA 4EPYA 1A9RA 1G7CA 1KDRA 3PFCA 2XNCA 4O59O 5I6DA 1G8FA 4YWJA 4R84A 3FHOA 3PLNA 3UOGA 1NR1A 1O97C 3VXKA 2PWBA 1CZRA 3ZV4A 3PVZA 3W78A 4W82A 5DWQA 3CRMA 1UIRA 2BEWA 4ZU1X 1ACLA 2W2NA 2ZM6B 4DR6B 4U63A 1H6CA 1Y0BA 2BJHA 2O0JA 3G2JA 3P2IA 3PI7A 1AZWA 4UHBA 5E9QA 3DMYA 3D7KA 3U4HA 3NIGB 4GRIA 4WSOA 3UCFA 4CKWA 2WSBA 4PQGA 5TGDA 4KDEA 2VNKA 3G02A 1QO9A 1USIA 1LH0A 4RIGA 3V34A 4JLPA 3NKVA 3TZHA 3G82C 4J16C 4WE3A 2V6JA 2IV7A 3V9PA 3GUYA 4CKBB 4LQ4A 4DRXA 3DMFA 2W6JA 4UE3S 1FTYA 2N0SA 1FZTA 2YRFA 1ESDA 4HADA 4OB6A 4JB2A 2Z8XA 1M33A 3EGWA 5REQB 3G85A 3ZV7A 4RULA 1J0BA 4RD4A 1J5XA 2E1RA 4QXOA 1GNSA 2WSMA 5BV7A 3KWLA 1GDDA 3DEFA 1UBCA 4FR0A 4M86A 1MX1A 3WAGA 4F4DA 3VC3A 2H5EA 3OECA 4B32A 4BMNA 2XNJA 2VKQA 1Y98A 2BMVA 5IAGA 5EJ4A 1ADJA 2JFZA 3K5WA 3NHAA 3RSCA 2JLVA 3ZE8A 5CIYA 1KJ8A 2VWHA 3AR2A 2FOIA 4YMWA 4EO7A 1NXPA 1QWOA 2HUPA 1PNOA 2KE5A 3M2TA 1ISMA 2V8BA 3GLHB 3NGLA 1UPUA 3N2NA 3QQPA 4QO8A 3ZN2A 4BL5A 4BE9A 4DABA 2IIVA 5KVAA 4X63A 3NEYA 3SM9A 4BTEA 4DLPA 4BIIA 3KB6A 2IXTA 2QE6A 4FFWA 4HCJA 3A28A 4XWYA 4XLTA 3T3HA 1P2FA 1TZCA 3QLJA 5AW6A 2AG5A 1AHPA 1JH8A 1CJMA 3HP4A 4MWOA 1Y89A 1N25A 1PZEA 4YH1A 2VF7A 1L1EA 4LC1A 1UBNA 4YVFA 2ZTMA 3KDSE 1QS0A 4TTAA 5L4LA 4AKHA 2QG9A 2SBTA 2XMQA 3EC1A 3RGWS 5CEJA 721PA 1G3MA 1I01A 1DWQA 1EZ4A 1IATA 2YY7A 2ZIWB 3DBVO 1U3FA 2JCVA 3LIIA 2RGWA 3N0WA 1IY2A 1GPDG 5K51A 1OI2A 1FBTA 2Q21A 2B3DA 4TM8A 2AZTA 4INJA 4A73A 4YRCA 4NESA 5JBNA 3ILXA 2R00C 3BXOA 1UM9A 1O9HA 5HRCA 3LVFO 1DCTA 2F7SA 1FBNA 2J5XA 2A9OA 1I0IA 1WZIA 4IUBS 3B6IA 4FDLA 4E13A 2V58A 3TGWA 3I3OA 4Z7QB 3B60A 1Q15A 4CLOB 1P0QA 3F9RA 2NUTB 2XNDA 1PJRA 4HSEA 2B6NA 3A06A 3QSGA 5F76A 5CDGA 1U0FA 1X74A 1N5MA 2F3PA 2IYVA 3LBHA 1TUBA 1CUDA 2QU7A 4HH4A 1C2TA 5EPEA 5K8JB 4XJVA 1ABFA 3ZKAA 3VTFA 1V7PC 5JYDA 1P61B 1QPGA 1G6OA 1FYFA 3PEEA 4W5HA 3ZTWA 5T4HA 4I8IA 2N46A 4NKRA 3Q0IA 2OPHA 2GVNA 1EI9A 3M5DA 5TVKA 3K72B 5L53A 1EB9A 4IO1A 2QROA 2I03A 3ETHA 4GLLA 4CLXA 2QJWA 2VPZA 3FUWA 3DZFA 3E61A 1II0A 2OG1A 2Q8PA 3TYXA 1E3TA 1ZK2A 3IR5A 3AH8A 4C3UA 4B85A 4MW5A 3CRZA 1IXZA 1T0HB 3KU4A 5C5EA 1W49A 4YT5A 2PA3A 4D82A 4N48A 3AP3A 2FW1A 1SD2A 2WR8A 4L4YA 4Q3LA 4X95A 3O1LA 1VLHA 3KKZA 4MOWA 5EKXA 1QH8A 4AZ3B 4DM7A 3P0FA 1RVDA 4BNIA 5IAAA 1ODFA 2HU7A 3S1AA 1KK2A 3T1OA 4XTCS 3AEZA 5C7IO 4PC7A 1OJLA 3PCRB 1VTKA 1H0KA 1SHKA 1ZRSA 2DZDA 5BNIA 1U2EA 1F8FA 4LVNA 3KELA 2PWYA 1XTKA 2ZJ0A 3C6KA 2ZTSA 2Q5QA 1OIVA 1C8KA 2X6TA 3ZHUA 2R97A 1OWLA 2QRPA 3MS7A 3NOOA 5FYQA 1XEWY 4AJ4A 6ADHA 4GEKA 1HEYA 4Y2GA 3PEYA 3W9SA 1VJTA 4IMRA 4QFDA 3MAJA 2OLKA 4GXRA 3AIKA 3UCXA 4IILA 2OHFA 1ZYUA 3E6AA 3OPXA 3AC0A 4JLKA 4UTRA 2FZEA 5FBRB 3P2OA 2HBRA 1KK3A 2I6UA 2L18A 1Q11A 3DKPA 4BEWA 4ZMRA 1KC1A 1RCFA 3VR4A 1XZPA 1ISSA 1CTQA 4FX2A 1TNDA 2GO1A 2HWYA 1JHUA 2FPXA 2R7MA 4JNKA 3KTOA 2EF1A 4C0XA 1DBSA 1EVIA 1QLHA 3IEKA 4E5UA 4RJKA 1NR7A 2QMUA 3LRPA 3VO2A 1UBTS 2A7QA 1CY8A 4MP6A 4N0QA 3O21A 4F1JA 1TAUA 3T1TA 2R8BA 1IK6A 4LKOA 2J3LA 2D54A 2GAOA 4FMBB 1TAHA 5CB6A 1IOWA 3PNLA 3AL0C 3H5AA 4IDHA 4R2WA 2IITA 4ZCQA 4XR9A 4CQMA 2EGUA 3R5KA 2PHZA 4X7PA 2H6EA 3W5HA 3M6MD 1P39A 5EP3A 4J8PA 3QEMB 4CG3A 2J9YB 1HMYA 3M7IA 1CR1A 3GOHA 4LMRA 4BX9A 3DA8A 3QKTA 3NTRA 3MAAC 1RJEA 3W05A 1JHMA 1J8FA 1HYGA 5K3EA 1O96A 4M87A 4RH1A 2RI6A 2D0OB 2PXHA 4KMOA 1ONNA 2R47A 3C3XA 2IZ0A 2D5IA 2X1MA 1XCMA 1QZUA 4TRMA 1SQGA 3DONA 4FP9A 4H7DA 10MHA 5IKXA 3LSYA 3EAQA 5JALA 1EP2B 2VDUE 4IFIA 4KO8A 4PLPA 4Q1FA 5BRNA 5BR7A 3K70B 4I55A 5DTRA 1BYIA 1FUYB 4RXMA 3DJYA 1EFPB 1VKJA 2AJ8A 1UMBB 3DNFA 1U7TA 3OJOA 1SHUX 2OCBA 1KYIA 1IHXA 4II3A 4YASA 1CHDA 2FPOA 3TPCA 3PQ4A 4D0RA 3DDUA 2QQFA 4HAOA 1YQQA 5F9MA 4JR0A 5TMBA 4BPBA 4J3NA 1QZTA 3D6TB 4CVNA 4IJWA 4DJEC 1I4TD 2CL5A 1LC3A 2BI4A 2ZYWX 1NLFA 3IHTA 4GX1A 5IUNC 4EMSA 1Z0FA 2W83A 3A58B 1SRRA 3QY9A 2XDWA 4CQLA 1W5FA 1P7ZA 4NQRA 5IDWA 4BFSA 3IB3A 4QG7A 3X0DA 1M1NA 3LHIA 1QCCA 4KQCA 5DNEA 4Z9BA 3W8DA 3NC1C 3INTA 3R20A 4RZIA 5JISA 1Y33E 3NIDB 1ZJWA 1QTNA 3SHTA 3M2PA 3TLAA 3ND9A 3WLSA 4R6XA 3ZPXA 4JI2B 3TGLA 1RI4A 1G3QA 1M6WA 2C20A 2WIKA 3RC3A 1SHJA 2PX8A 3SMVA 4QOHA 5EMHA 3WGNA 3WI7A 3SSMA 4ER0A 2JG3A 1DGQA 1JLLA 4GPIB 3LPLA 2JK0A 4A26A 3SJCA 4BFTA 1SIOA 2VBGA 5BN4B 4Q4JB 4S1NA 4Y2UA 2ZUTA 1V5IA 1R0ZA 1W96A 4PC6A 3IDOA 5I7WA 4J0HA 1E7RA 3UYKA 2OGTA 2PNFA 2YCBA 4XIYA 2GJAA 4NCJA 3J81k 4X8HA 4MWBA 2QX7A 1BWQA 3V2GA 4C88A 4U7DA 3ZOKA 1O97D 4W8GA 1P1JA 2YYZA 3C1UA 2GQ0A 2P6NA 2WKPA 2GLUA 1HE5A 4LZOA 2PMBA 2WRZA 2A94A 1BFKA 4AUNA 3OLCX 4AIRA 4DV5B 4C3ZA 3D1JA 4AMZA 2Z6QA 4EPTA 1RQLA 5HJ7A 4LS3A 3CUTA 3MCZA 2IFTA 2WT8A 3B82A 4UNIA 5EZYA 3WL4A 5CFPA 1BHJA 6LDHA 5KVSA 1XEAA 1I5EA 2WNSA 1KY4A 5BSFA 1O54A 2VSFA 3GYGA 2GCIA 4F3NA 3M9WA 5MN6A 3W6ZA 2CBZA 4KX5A 4JLDA 3KR9A 4MVJF 2OCYC 1QP0A 3K2QA 4Y98A 5AK4A 4X92A 3WGHA 2HA0A 3TDKA 4G1EB 4FLMA 5E7MA 4RGYA 2GM5A 3H75A 1QHGA 4FNMA 5TY0A 4E94A 3EPKA 2AZXA 4POOA 1NVXQ 1SKUA 3AQIA 1W4LA 2PS1A 3DCNA 1SCAA 3OFJA 5KQGA 4INOA 4E5NA 3EMVA 2W2PA 4MRSA 3FTCA 4Y1RA 5CB4F 2C96A 3GH1A 5JMPA 5AW0A 2OOKA 1YRHA 3LUBA 4MITA 2BR3A 4OCZA 2HGSA 3EGXA 1WB6A 1YR3A 3U7HB 3TQOA 2WQZA 3CT4A 4BNVA 1YJCA 3F67A 3QI7A 3SEAA 4ETNA 4B7ZA 4UVHA 1M7GA 1ESMA 3MGKA 3R7LA 4NATA 2HL6A 3O1JC 4OHFA 4BS9A 2VCYA 1CEYA 1F06A 1C9MA 1JHAA 4RJJA 4QDUA 1PNVA 1MVLA 1P81A 1V48A 2A1UA 4RSRA 1XO1A 3BYZA 1LX7A 2FWNA 4TKUA 5E1MA 4KR0A 4J75A 3C6MA 2WM9B 3EOZA 4IOLA 1WX1A 4KWTA 3RBVA 3RV4A 3W06A 4YHHB 3HZRA 4WFKA 4XPZA 1MIHA 4GOKA 3OQVA 4YUXA 4P36A 1CRPA 5LNK6 3A2MA 4UAUA 4D9FA 5CLIA 1UC5B 4KQ9A 2IBSA 2RHRA 3GA0A 4IXDA 1XQ6A 3T1QA 2OP0A 4L85A 3GZNB 5DGDA 2LWIA 2EFCB 5JSQA 2OB2A 5CLGA 1XKXA 5DSZA 2Y92A 3BKWA 4QJ4A 1MEEA 4F97A 2R62A 1JG6A 1N6PA 1H65A 1Z7WA 4XVQA 1S8AA 2A1TS 1ZQ1A 3UJHA 3H6HA 2QX9A 5SY4A 3D7NA 4RGBA 1GPUA 3GIWA 1X8JA 4TWIA 1SBHA 3PHHA 2O1XA 3BTOA 3O4VA 4LY0A 4Q6WA 1WXFA 4A0RA 4ODIA 4M98A 3DYBA 3GFRA 4WCFB 4XFJA 5IKOA 2V7VA 3VYUB 5JJIA 1V1JA 1V7ZA 4W7SA 1GN9A 3CZ5A 1PS0A 1MQAA 1N5KA 4Y0NA 3ZE1B 3DBHB 5F1OA 1FQJA 4AMYA 2V97A 2WHEA 2XR1A 2I3DA 1Z8NA 1NVAA 3KX2A 3ZS9A 2GXAA 1M7BA 3SQOA 1E9VA 1KBQA 1TK3A 4CWAA 2J3DA 4YT8A 5ALYA 2QTAA 3FPAA 2ETVA 3B48A 1RZ3A 2GK4A 5F9HA 4RIEA 5LYJA 1YACA 2NT3A 2MU1A 2ZR9A 3ND8A 3R3UA 1KDVA 3CUVA 3UKOA 1DEHA 5JSYA 5LD2B 4JNCA 2F90A 4B9EA 1GRCA 5KX5B 3ZWNA 5BOSA 2CV2A 2C5FA 3A7EA 4RTMA 3E7FA 3GCGA 3A26A 1X8XA 1NHGA 1FFWA 1XL1A 3Q3EA 2Q07A 4AMBA 4D0SA 5I47A 4RJIA 5KTOA 2VDVE 1X87A 1MR3F 1NWHA 1U1EA 3AEKB 3CPJB 3QZUA 2BFNA 4L02A 4R9UC 5LLSA 5AM5A 2FN3A 3H2HA 4ZN6A 2NADA 3JTMA 4XPIB 2PZAA 3U4IA 2C4NA 4QRIA 1E9BA 4PY2A 1RM0A 1WB9A 1UFRA 4FFLA 1JR6A 2GAJA 1VL1A 1PEAA 1Z2NX 2JAWA 4H0CA 4L2IB 1S7CA 4N47A 5HBRA 5U1PA 4TV9B 1WD7A 3ZW9A 4AW9A 3A4LA 1Y9JA 3E70C 3PZBA 4EP1A 2CJYA 3L7NA 1TKRA 3ZY3A 1TA9A 2ZOSA 2B2XA 2B21A 3LX4A 3ENKA 4UOEA 2B8JA 5AI6A 4Y8VA 4IMPA 4YRBA 3QJGA 3BHIA 4KQFA 3C0KA 4K87A 1P6QA 1Y8ZA 1X1CA 4I81A 4QFBA 5EVCA 5YASA 3TIVA 5EQDA 2VRNA 1RT9A 2FKNA 5LCXA 3CEPB 5KNBD 3N39C 4Q47A 1DIGA 1GU0A 5KDLA 3GLFA 2VP6A 2CXQA 3GJ7A 4FS8A 5JY6A 1NA5A 2B4AA 4Q1VA 1W7AA 1TD1A 4QPPA 2PZEA 2HREA 3RRZA 5K01A 2OHJA 4Q7KA 4Y2RA 1Z9BA 3DLPX 4Q3DA 3RFVA 3RANA 2FPIA 1PHRA 3C41J 1Y42X 1FPQA 5EJEA 3KJQA 4PSKA 1OPXA 3W2FA 4ERXA 5JC1A 4YJ2A 2VBCA 4HDOB 5IBPA 2GR9A 3NT2A 3Q40A 5A3SA 3WWDA 3EDRA 1IVNA 2ZUFA 3MM4A 1T1JA 2J6CA 1XXHE 2QKYA 2W4IA 4ZI5A 2DE0X 2HRQA 3L7LA 3RHTA 1AF7A 3P9YA 4L16A 2NU6A 3C8UA 3PUYA 4H35A 3GDHA 3EZ2A 3X1DA 1AJEA 3G2OA 4HUJA 2V4UA 5FNZA 2WUFA 4OIFA 4PZ0A 4LW8A 2BKUA 4EHNA 1KMCA 3TIGA 2HLHA 2VQ6A 1WPQA 3DZKA 3V4VB 4F86A 4KFRA 5IJXA 3RUFA 5EZ5A 3BGIA 5CPFA 3U3OA 1NP7A 1LLQA 4RVCA 3I01A 1X7XB 4BNKA 4LRYA 3NBQA 3JQCA 4FGUA 2XRZA 4WY5A 5EXTA 3DCJA 4C07A 1BDHA 4CUZA 1UCFA 3OIFA 4KQHA 1Y63A 3PD0A 2DT5A 1QVRA 1KPIA 4IZHA 2V0NA 2JJ1A 4RPIA 3G7SA 3GXOA 1ICEA 2UZ4A 1SVUA 1XNGA 3MSXA 4PLCA 4Z5XA 3B1FA 2R6ZA 1LK7A 4H1TA 5L51A 1DXYA 4BMDA 5P21A 3DDZX 4EHDA 1D9XA 1GTG1 3HZOA 5E6SB 5BY2A 4FYVA 4X45A 2CUNA 3O1HB 4DDHA 1F8YA 4IL5A 4Z2AA 3EFOA 4BMOB 1LBEA 2LE0A 1ZM2A 3KQHA 1XP8A 3HDHA 1JHPA 1YS1X 5JJBA 2Z6UA 3OLVA 4JA2A 4FB4A 4HNAB 4QBIA 2QMHA 2HQSA 1CF4A 4DHWA 4ZTBA 2PYZA 4J6EA 3SPXA 1D1TA 3JVEA 5DBFA 4LV6A 1F6DA 5GJCA 1CIVA 1N8SA 1YDWA 3W2TA 2FQXA 5A1TA 3EZ7A 4EMBA 1C8VB 4GW3A 2DECA 4OUDA 4P92A 3ADKA 3FOAA 3V1KA 5LL6P 4REQA 1WR8A 2AN5A 1E5LA 3F7TA 2FZGA 4N9QA 1RYMA 1LDMA 2LP4Y 3BCSA 1FMLA 3IALA 4LWPA 1WLSA 4MMZB 4QBHA 5H3HA 3DS8A 3ICPA 1X15A 2XMBA 5IJZA 1LTHR 4M0EA 1JQBA 2DFDA 1G5TA 4AXBA 5CDUA 5TDHA 1DOAA 3BBPA 2RI0A 4OM7A 1YCFA 2J31A 3KKMA 5A7HA 2G9NA 1UFKA 1QE0A 4FHDA 4MR7B 1T5BA 3B5IA 3K9NA 3O3OB 3CVUA 2O19A 1E6CA 1IHUA 2AE2A 2FSUA 2R8EA 5TEVA 3C70A 1VLVA 2E49A 2Q0XA 5TJHA 2JGKA 3WMGA 4M2LA 1WV0A 5IWAB 2GDZA 5C1BA 4MP3A 3WDSA 1ZUWA 3R0ZA 1EJ2A 1RQRA 5JXWA 1T4GA 1SXPA 3ZWOA 1PUJA 2ARKA 3JASA 4F1KA 3MUEA 3NGXA 1LX6A 4XWWA 3FYUB 4HAYA 3IT0A 1MP0A 4Q4LA 1AQIA 1G8AA 2VXOA 3A3PA 4YAIA 5C4IA 2AYZA 4QOIA 3V4OA 3ZZTA 1KO4A 2C4UA 2QQEA 1T6YA 2QUKA 2BLLA 3GJ4A 1E9CA 4RV9A 4ZIRA 1OKKA 3JPYA 1NFFA 2GZHA 1HYBA 1KVSA 4J49A 2RKBA 3DE1X 2FN7A 2VYCA 4OHMA 4MS1A 3EIEA 3M4XA 3GMIA 5AM3A 1KJIA 3O8LA 4UJ3A 1Y8AA 2XZTA 3DE5X 5E95A 3STXA 3T9EA 1E2QA 2H4FA 2J3JA 4HG2A 4PTYA 1M0TA 3UH1A 2EZUA 5ESRA 4ZYZA 4RNDB 2YYSA 3TH5A 1ZK4A 3HL0A 3K9HA 4AY6A 3RSZA 4UM8B 5E2AA 3TOXA 3PPXA 1HURA 4JMLA 2Z08A 4RDHA 1CQIA 1XJ0A 3R3SA 3GY0A 2H3HA 4NL4H 3WG9A 3X1ZA 4Z53A 2WF7A 3CZ4A 1GVHA 1VA4A 2DUNA 4OLHA 4PQYA 1YH3A 4J0FA 4BRZA 1TFUA 4MS4A 3LCRA 3UQZA 3WQHA 3IPAA 3GLUA 3WLLA 1ZH2A 5ALUA 3UJ6A 2C8KA 3P0JA 2AB0A 1KTVA 3H18A 5K3FB 3CF6R 1SKYE 3DFFA 2KYRA 4PGAA 2I7CA 3IE0A 3G79A 1ULSA 1H85A 2PQ0A 1XC7A 3T99A 4PBRA 2FDXA 4FILA 1AK9A 3A9CA 3T4UA 1Y3AA 2H07A 4AWAA 2I1QA 1YHNA 5JWOA 1XPOA 3GEBA 2IDZA 2WWVD 4IIEA 4WI1A 1Z0IA 3L0DA 1Y6JA 3BM5A 3L49A 4MYHA 5HIMA 1OFUA 1FNMA 1AHIA 1B3BA 2ZS8A 4QDJA 1HE4A 2X3FA 1Y4DE 3HDTA 3KSBC 1BH6A 4M1YA 1DTEA 3NTVA 2XTMA 4L57A 2DJIA 4YMIA 1K8ZB 1TQ6A 5DH9A 1KIFA 3VPDA 3TW0A 5A3QA 3FUTA 4AZTA 3Q7RA 5JS8A 5C46F 4Y1EA 2PX2A 3KQOA 4ESEA 3UMCA 2F4NA 3MOSA 1QCDA 4KGDA 1K5PA 3K05A 2ZRQA 4FSDA 1BD3A 4M8NE 2JIZD 4FOLA 4P0QB 1HYEA 5KBYA 2IF2A 3NNNA 4AJPA 1VL5A 1W8DA 3QXGA 4IDDA 1OTYA 1NV9A 2Z5FA 3DAYA 1WUIS 4G09A 4JCCA 4E5SA 2FR1A 5FBZA 2ZAOA 4PVDA 3HJRA 5FOVA 3ZK8A 2F1IA 2F1OA 3BN3A 2EEZA 3AKYA 3T95A 4B44A 3LC2O 2RARA 1TKBA 1UXOA 4MZXA 3UH0A 5B2ZA 2X8JB 4E6EA 4W5NA 4N3AA 1NW9B 1MB4A 3FJYA 4TWAA 1MF7A 3CS3A 3LM8A 2AJDA 4IX1A 1M66A 2B30A 2UXDB 3VJKA 2ZXFA 1QJCA 2LW7A 1I3NA 4MWCA 3IAS1 2FSVC 5FA6A 3AIOA 1M1XB 3BAZA 3S5JA 1XA3A 3PTAA 1XAGA 2H2WA 5DK4A 3FUUA 3ZHSA 4F9FA 3N05A 3LCVB 2A0WA 3OZEA 5EIEA 1FTSA 4XJXA 4DZTA 3KALA 5KPDA 1QP7A 3L6EA 5J1TB 4ZQBA 1B8NA 2ODNA 5FULA 1GTMA 4D9HA 2G83A 4NENA 1TF7A 3T9FA 3ABRB 3MRTA 5D00A 1I30A 2XUJA 5ECWA 3WA6A 3OX1A 3HKCA 1M8KA 2OZVA 4MYDA 3SR4A 3GLRA 4B76A 3IILA 3PHIA 1Z62A 2LKDA 1Y1TA 5CT5A 3W2HA 4CM9D 3BWVA 2X3YA 5AW2A 1QYRA 5I01A 3KPUA 3EJWA 5C8YF 3E1GA 4GD3Q 3MA0A 1RJ9A 3R9WA 4U8GA 2ENUA 1NF2A 3JQAD 4II2A 3A04A 4R8SA 3AK4A 4Z9XA 2HH9A 1OLUB 1QAQA 3GEDA 2BMEA 2OMEA 3RIGA 1E92A 4DYHA 1TB4A 2JAHA 1H2AS 2QS9A 3MTDA 4TMKA 1GKIA 2XNSA 1RHMA 2QSUA 4YV1A 1SVKA 2E89A 2C5HA 5DOZA 2DF8A 3W3AA 4KEAA 4U39A 3AESB 3KEQA 4LCBA 4GX5A 1EE1A 1V45E 1YONA 2PPLA 3LNCA 3O4JA 5EQFA 1P8AA 3UK7A 4AULA 4D8UA 1P73A 1U4OA 1K0FA 1FLDA 3AFIA 5IZCC 3WNZA 1PAUA 2XVMA 4PCUA 4YV0A 1LBTA 1ZGGA 1Z8FA 2PSFA 1GCAA 4H1HA 2B1JA 5BSUA 1W0CA 4HI0E 1OU4A 4N3NA 3EIXA 1C3OA 4HGOA 3GROA 3QMWA 1RTKA 1SIBE 3KUCA 1SVIA 2DH5A 2QSYA 5KYXB 2AMJA 4WKBA 1DV1A 1HLGA 3RS0A 1YZHA 2HN9A 3FI9A 2HCBA 4C6TB 2JBAA 5FORA 4HFJA 4MV9A 1EX7A 1UXKA 2ONKA 4J1SA 4PC3A 5TMEA 3T54A 2XWPA 5CJ2A 1ZR2A 2BHTA 2C77A 4K9MA 1JJIA 2OM2A 2W8BB 4JSRA 3MGAA 4KW7A 4S2EA 2WPDA 2J46A 3OPNA 4Y7CA 3O7WA 3UOWA 1I2MA 1GL7A 5ER9A 5KOYA 3SVTA 5CDFA 2XCRB 2WB2A 4P22A 4LVOA 2AWOA 2AXQA 3BJZA 3QX9A 1Z33A 1DJPA 1DEAA 1DG1G 1Q5PA 3OKFA 4N5DA 5CK4A 4BVKA 1T3ZA 3WBKA 1O6GA 3HKDA 4H3SA 3QLVA 3WJ2A 4W9MC 4RFSA 4XYBA 3GLGE 3TE7A 1X1DA 3BG5A 2P40A 2IVFA 1K9VF 4M55A 3RU9A 3HVRA 3U4GA 3SYMA 1T9KA 3HMQA 4O08A 4ARBA 4Z3KA 4URZR 3N07A 4G5FA 5I48A 1L7DA 1DDGA 3OIYA 3IVGA 4Z0HO 3CNOA 2H5JA 4XWGA 3QEOA 4UVIA 3T5BA 2BN4A 4BVAA 1S7GA 5LM3A 1R6TA 4KYTA 5C32A 1A9SA 3ZYZA 1EUYA 4ZEOA 3FY4A 1YQDA 4CT0A 3PD7A 5HK9A 1FLVA 1U3TA 1LDYA 3DEJA 4UZEA 1V8OA 4LWOA 3KPYA 3MT8A 2AFHB 4CLEA 4TYWA 6REQB 4BDSA 5I45A 2WP8J 3I6BA 3U17A 1Z4KA 3RJ5A 2YYYA 2WWIA 4LSGA 4F6LA 2ZK7A 3BZUA 3K15A 3STTA 1ACJA 2FTKE 5TXGA 3F96A 3ETLA 1B41A 2ZJAA 1J5PA 2Q45A 5K3CA 3TD6A 4AKTA 1YQTA 3R7FA 4B31A 4Q01A 3W5UA 3VTZA 1YZLA 5ECDA 1DWOA 1VHDA 1SOVA 1AH2A 2D13A 1WXGA 2A9KA 1S1CA 3KVOA 3KZCA 1TEVA 4HGNA 1SCNE 4HEJA 3A70A 4MINA 4QT0A 2QTLA 2QXTA 4KC0A 5FFMA 4AJNA 1ZVVA 5TF4A 4C78A 5BO5A 4HDSA 1UBRS 2WUDA 4LK3A 5AM4A 3TSWA 3SMQA 2PUTA 1VE6A 1IN5A 4FZVA 4OHWA 3JU3A 4UVDA 2AN1A 2DQ4A 3WKDA 1SQ6A 5F5LA 5A5GA 3LC1O 3QK7A 5AK6A 5LWHA 1EBBA 1NW8A 2R11A 4B3FX 4Y0AA 5K8UA 4YP7A 4ALNA 1KYYA 4HPWA 2B8WA 1Q6YA 1FJGB 3P4UA 5A5EA 3JWPA 1LDNA 3HVUA 3OEWA 5AD1A 3E5RA 3GELA 3HZHA 4CMEC 1NMEA 2C2GA 1BMDA 2WAXA 2AVNA 2HNKA 2WDPA 3AO0B 3Q5GA 2Q2OA 1KPGA 2AJLI 4UNPA 1SJ9A 5CGZA 3CPSA 4CLHA 4DUGD 1F9AA 4H1UA 3UGQA 4EABA 1VPLA 2AG8A 4C5AA 3K0AB 1LC0A 5JSHA 2YJ6A 4MI3A 1P18A 3L7KA 2IZZA 2JFPA 1XQ9A 3NTXA 2HU2A 4K86A 5EWLA 5CXUA 2WWYA 3Q8LA 1V9SA 4O25A 4PNEA 3K6KA 2XA1A 5HIAA 1KEZA 2I34A 3DUFB 3JQDA 3WMFA 1A8SA 2VRWA 3D6AA 3JVDA 1NU8A 1L4KA 2OVBA 5HZHA 1VGQA 1NI3A 1YDGA 2FFBA 4OD0A 2I78A 3R9XB 2GJKA 3L06A 1KIMA 1N1GA 3GCXA 3QPWA 2CLLB 1IRXA 1UFOA 3HU2A 3AI1A 4KKXB 4QUGA 3UWOA 5C9ZA 3L8YA 3B78A 4MW1A 4TS9A 2P9HA 4AY4A 4F96A 4PBTA 2IOFK 2NLOA 1FE8A 4A91A 1HT1E 2BFWA 3AFMA 3RHZA 3UY4A 2HA5A 4MDYA 2ZUCA 4IRMA 1P7YA 1SIWA 3RTDA 3TE6A 1H2FA 3QUQA 4M0KA 2FPIB 3D4OA 3O3MB 4RM3A 4Y2PA 3NZEA 4I1YA 2LGJA 3R6TA 1SXIA 3OZDA 1L7RA 4W5JA 1Y7LA 3MNFA 1ID1A 2QB5A 4RS3A 1JPVA 2HXYA 1KOGA 3WGUA 3ZDQA 4TZTA 1HLPA 2CLHB 5AXDA 1QH1B 5B1IA 1BS2A 4QTUB 1NVEA 2JGNA 5EFZA 4ZV4A 1H5QA 1B6SA 1NN1A 1T4BA 4D3DA 3E9CA 3N7AA 1Y3CE 5ICMA 2Q2QA 2QLBA 2QR2A 2E4XA 1YJQA 5LOVA 5M29A 4LXIA 3ZGVA 4ZJPA 3AKZA 2IDKA 3L84A 1IIBA 4JITA 2Y99A 1ZK3A 3IQFA 3BXXA 2YN2A 4FYIA 4RWEA 3AG5A 3SD7A 3KEOA 3H9UA 1V3TA 1QHXA 3TDMA 2NVBA 1RP1A 4LEIA 3E1SA 4R05A 1E0DA 2EFGA 3V7YA 2VHZA 3ZDYB 1ML3A 4U6SA 4CHGA 2HWUA 3T9BA 2FI1A 5I7VA 3N76A 5MHTA 5HYVA 2CYBA 2AOTA 2TMGA 3WK8A 3KXKA 4IKOA 1PUXA 1AKRA 5EPOA 3BJIC 4UASA 1J99A 3F6BX 4IDQA 2HFKA 1N2CB 4WBXC 1GVNB 3PRHA 1HDGO 4S1VA 1XDUA 4HT3B 2HPAA 5BN1A 2C4KA 3OH8A 3WHPA 1RRGA 4J9UE 3PRJA 2IUUA 3P52A 5ESWA 1JA1A 3BOSA 1A2QA 4OO3A 4A8JB 2IUEA 3SFZA 5F1KA 5H59A 1P0CA 1EUZA 4MCJA 4D2IA 3RSFA 1WBJB 4ZZ3A 1D6MA 2GEUA 2F67A 1SCBA 3DULA 2HIAA 4OXKA 1HC7A 2DBRA 3MJCA 3TX2A 2I5PO 2DFTA 3HQ4O 5DVZA 1R16A 2CDBA 4NMWA 1CSEE 2GSWA 1IWPB 3GN2A 5K0CA 2HJ9A 1RAEA 2W98A 1IH8A 1OBHA 4MV8A 1XLUA 1IZ0A 2OWEA 1B6TA 1NVVQ 4C29A 2J4FA 4EHKA 4IJMA 1Y3HA 3PPVA 4CCYB 4Q1AA 1Z4PX 5ICEA 1WETA 1NDUA 3SF0A 1QXSA 4LCEA 2B83A 4X0EA 4REQB 2VJDA 3G0BA 1G5IA 2VH2A 1LPBB 3LCMA 5I7RA 2DERA 1NI5A 3RAFC 1DQZA 1NVWQ 1THGA 2HK6A 4BC1A 2XY4A 1JG1A 3GZTB 1BN6A 1Z13A 4I1RA 1M5UA 2H1CA 3LDFA 2ECOA 5I7AA 1QE3A 1RKVA 1T5HX 1U3VA 2IZ5A 3P32A 3KSMA 4TRNA 1XFDA 2WV7A 5TVGA 4RPHA 3M5CA 3S5UA 3TBKA 2J9RA 4AU1A 1FMJA 1JU9A 4RVNA 5IK2D 2DYKA 5K8LA 3GZJA 4ND3A 5E2IA 4QXMA 3WTCA 1JEYA 1HKHA 5GJWC 2YJNA 5HDQA 2OLEA 5SZJA 3U13A 1G3UA 3SSAA 1GR0A 2C3OA 2GCEA 3SXPA 4KREA 3H9CA 3NRJA 2PUCA 2Z5VA 1KAGA 3KWJA 4MDEA 2JLYA 5IASA 3RVMA 2VG8A 1Y5IA 4UD6A 1X80B 5DYIA 3VC7A 4MS1B 3H17A 3NV7A 1FFXA 3CLRD 2E4WA 3ZQJA 1N2ZA 4IVPA 3ZWDA 2VPXA 4FKMA 4DCGA 3A1TA 5IM4F 4HAVA 4B3MB 2HQBA 4A8TA 5B36A 2VAMA 2ZRFA 3DQPA 5WRFA 3QU7A 3EVFA 2I6XA 2ZTLA 2CFTA 3A1DA 1BXRA 1VCHA 1GZUA 2PYDA 2AFRA 1F8XA 2GNPA 4KR7A 2BP7B 2VRCA 5J4KA 1DADA 1A9XA 2NAPA 3HKBA 3VPXA 2YBEA 1HWYA 1KDPA 3P9KA 1DHRA 4CMKA 5CA1A 5KC8A 5JCJA 2B6HA 1GUBA 2MYUA 3RFXA 4AKIA 3N2KB 4LYYA 4PM4A 4EZBA 2P5UA 4UTNA 1MT3A 1INLA 2P4SA 3ACDA 3TUIC 1SWVA 2C2BA 1XROA 2IDMA 1L5RA 1M1YB 4QXQA 3R0JA 1X19A 3R2JA 1U2ZA 3AHCA 1UK7A 2CE7A 2XWSA 3NNDA 4N3BA 4RL4A 5FTWA 3R7NA 2OFXA 3K0BA 3O4HA 4LXGA 2IPAB 4BIMA 2WUGA 5JYCA 3CF0A 1RWQA 1SCQA 2J5KA 5BUZA 1WPGA 5EAIA 5LU8A 4Y3UA 2GSDA 1WMAA 4L4RA 4EBFA 1DRWA 2GX6A 2NYUA 3REOA 3H05A 3OO0A 1G1MA 3AZOA 1FVXA 1YR1A 2G4LA 3JALB 3TTXA 5LQMA 1T8UA 2W4QA 4EW1A 3R75A 1EP3B 2HA6A 4EGAA 5BSVA 2B1RA 4M49A 4EL0A 3SS7X 4MJ3A 4BVHA 4DDKA 3DTVD 1PZHA 1DLIA 2H57A 3T7RA 3O6VA 4V2IA 4C4RA 2AD5A 2OLJA 3DMDA 3DG9A 1TVKA 1FOEB 4P3NA 1C0PA 1WRBA 5HF6A 3H1FA 4O29A 5FL7A 2ZRCA 2HIGA 3CWQA 4I36A 2P3QA 3OURA 2ZWPA 2ZYAA 4YP5A 4DBVO 4Q48A 3FCXA 2LPMA 1WXXA 2GFQA 2QI9F 5JCXA 3LCJA 1X9GA 2D5LA 1LK0A 3BWXA 4IPTA 4YJGA 1IXYA 3NC4A 1UC8A 1J6UA 4AKGA 3PT5A 3EG5A 2JEYA 2FW7A 3KJXA 3QUAA 2A6PA 3A9WA 2W48A 3L77A 2DFVA 2E21A 1JVNA 4KFTA 4P2BA 1JJFA 4NBKA 4YRDA 4ZHSA 1R3UA 5I4IA 2NV6A 5KVVA 1LDEA 1NUPA 5DISB 1JGTA 2ADFA 1P0IA 3CJQA 5A9SB 1R0YA 1Y6GA 4RELA 1XLVA 1PL0A 1P1KA 1Z08A 2WV9A 4QFCA 3NWEA 4YONB 4LXTA 4P86A 3AJAA 3CZAA 3T0FA 3RS9A 4HVCA 3GZ4A 5J2UA 3SP1A 4WV3A 3PUKA 3HKCB 5BORA 3OZXA 5FX2A 5ALMA 4ENRA 2GH1A 3GYBA 2NIPA 1GU1A 1A72A 1TPYA 4YMGA 4B46A 3EA4A 3FCCA 1V39A 4H77A 5K3DA 3NHRA 3EDOA 1H1LB 4OA8A 5H4HA 1F7UA 1N57A 2R6R1 1Y5NA 4HMPA 5F4BA 3FFTA 1SXJC 2WTEA 3W2GA 4OMDA 1RJ9B 4E7PA 4RKEA 1XK6A 4GC5A 2UVDA 2QRNA 3I39X 4K28A 4O4HB 2BGGA 1G7TA 1WSBA 2EZ8A 1UT6A 1A7AA 5A0TA 3VBEA 1JSXA 3FOWA 3H42B 3OQIB 1C3VA 1RMTA 1UUFA 3VJLA 1NPYA 3B1WA 1EVYA 1Z7GA 3CRVA 3OZTA 1YDEA 1QG0A 4RFLA 4YRQA 5L7YA 3USES 4G5GA 4IKPA 2YHAA 2VQFB 3EH1A 4HYTA 2X22A 4DDUA 2VC2B 4X6UA 1P7VA 5EJ9A 3FFXA 1YMVA 2FVYA 2WSYB 2XKAA 1D7AA 1WZNA 4B3JA 1GZVA 1V26A 4EG4A 5EXDA 3KG2A 3QI2A 3MTAA 2PGJA 1F48A 4XSVA 3D7MA 3CLVA 5JH7A 4A0FA 1PK9A 5SYNA 4HSGA 4W5WA 4KHZA 3KAPA 3TIIA 3LA6A 4RQBA 1JNYA 1VQ1A 3LP6A 4WNCA 3WKBA 1C30A 1LI7A 4ZJUA 2PUBA 1T6ZA 1CUZA 4OF4A 4RAQA 3ZTYA 1T36B 1R4ZA 4BAGA 3KXPA 3FTQA 5BMVF 5I3CA 1J2YA 3ME5A 4G86A 4UHDA 4DT1A 1NVDA 3FDIA 4G4JA 5IDVA 1VRCA 3RKSA 5A05A 2JW5A 1ZH8A 1ZGBA 4KN8A 1HR0B 1MAAA 1VJ5A 3VOAA 3M5WA 3BWYA 3TM4A 3ZVLA 4M8LA 3E18A 3S8MA 2CDCA 3R3VA 4EHFA 3PEUA 1SB8A 2P3LA 5FV4A 3W7BA 2AI1A 2QR3A 2FR0A 2G6BA 1M67A 1QOQB 3PFNA 1R6AA 4OYHA 3ER9A 3FTFA 2ZUEA 1EA5A 4QJ3A 2WABA 1R18A 1S9DA 4KRFA 4K6FA 3E22B 5I4CA 2QUIA 3V4RA 1HT2E 2JD2A 4HDRA 2C4MA 2NTJA 3ID6C 1AS0A 3GP3A 2OYSA 4IY1A 3RFUA 1BWSA 1WLYA 4WL0A 4YR7A 5ARBA 1SUCA 2GBPA 2Z56A 3MQ4A 4B6RA 2VJAA 2HLDD 3R0QA 3KE8A 4TPKA 4Q4HB 1LDGA 3WLOA 3MFQA 1WZ2A 3RTAA 4LFBB 2HBQA 3FWNA 5IF3A 4Q3NA 1IQUA 4WCDA 4LECA 2G09A 5CU7A 3M4YA 3I92A 4ALLA 5DX1A 4G84A 3T6KA 1KY3A 3RS3A 3WC4A 3BD8A 1W9HA 5P8WA 3D2BA 2M2IA 1RE0A 2ZU0C 3ROEA 4C5CA 4DNXA 5AKKA 4FFMA 4ZVNA 5CFNA 5L3SB 4EEZA 1A8QA 2C9YA 3OIDA 1EEXB 1NLZA 4H7IA 1LY1A 4UFOA 1RHQA 3V2HA 2O3JA 4PSDA 2A5YB 3K32A 1FQOA 3EYWA 3LKDA 4ZHQB 2HK8A 2XKJE 1H94A 1FDOA 1RRKA 2HJRA 3IKJA 3MILA 4TTTS 4U7HA 2HSDA 3EHEA 3RREA 1NSFA 4RW0A 4K1LA 5GOZA 4ZQEA 3FFBA 5E4TA 5J40A 4CODB 1EK1A 4CW7A 1G2IA 2X6RA 3AB3A 1N9GA 2HV8A 3COYA 4BOYA 4JJ8A 4E32A 3S0JA 4K6OA 5DLYA 3VVCA 1X2BA 2V45A 3I2IA 4M1SA 5D6NA 1HF3A 1T8SA 1UBOS 3QXXA 2IE0A 3HYCA 3IDZA 4KFUA 2H7VA 2ZUBA 4YC7A 4IQFA 4Y6QA 1MXFA 1UANA 4HLNA 3UJ7A 4FUTA 3BL8A 3KZKA 2WWWA 4IIYA 5H9VA 5AQ1A 3G88A 1R88A 2G77B 1XEXA 2YJTD 4MHSA 3SHQA 1P3JA 3T3PB 1I2DA 5H68A 3ZWQA 2Q1TA 4BX3A 1W44A 2XE8A 1DUVG 3JZAA 2WFAA 1AGNA 2H31A 4XWOA 5IU6A 2J32A 5FPTA 3IPCA 3BWDD 4P9NA 2NV0A 4FYYA 3FPKA 2BFCB 4MQFA 4DSAA 4F2PA 1IRIA 1WW2A 3G5AA 2JDIA 3UO8B 4C0JA 1S3IA 2M9MA 3RVOA 4FUQA 3TW8A 1XDGA 2C5BA 2X7JA 4GS5A 4H16A 5G0SA 2VDJA 4YP9A 3SXJA 3PT9A 5JPIA 3NEJA 3QF7A 5KNLA 3CH5A 1EINA 1TKAA 4UQOA 4BQNA 2LDBA 4MV7A 3QYPA 3HYRA 3G2MA 4TYYA 4J1TA 1J7JA 2P2GA 2Y2UA 3Q7IA 1WUTA 2JNWA 2JEZA 3PIRA 2IEAA 3C1AA 4L8YA 1W30A 2JPDA 3NVDA 5DBHX 3AF6A 4CJXA 1ICIA 2GFIA 2Q41A 4W7HA 3T5DA 4B09A 1BCSB 3HY6A 4XW2A 5I7OA 4PLWA 4I3GA 1ZONA 3EVTA 2FLVA 1YV9A 3QE3A 4PFJA 4TRJA 1THZA 2UYCA 3KYJB 1CX9B 1GTJ1 4AJIA 5K0ZA 3HBLA 3SZUA 5GTDA 3D7SA 1GU7A 4PPGA 2NX2A 2ZI9A 4PGHA 2G1JA 3HG7A 4D4GA 2YC2C 3I2JA 1WUKS 1VL8A 4D25A 1AQYA 4ZAGA 1QYWA 3IMGA 3QKSA 3SXUB 3T34A 4ESHA 4JUAA 4FFOA 2XLBA 4DCSA 4P33A 4EG6A 5HZMA 1A1SA 3HHEA 3STWA 1ZD3A 2FPMA 2OV1A 3QTBA 4OM8A 3HHPA 5HSGA 3S8EA 1EFLA 4MAMA 3S2YA 1X1BA 9GPBA 2JRLA 2QJTA 4QTZA 3UT5A 2QUAA 5TF0A 3NS7A 3DE7X 3ZVRA 3FN4A 1MHTA 1VM6A 3S81A 3N2YA 4AMGA 1KWKA 3UBMA 4HO1X 2QPOA 4DYDA 2QD1A 1RLOA 2OO5A 3AUXA 3HI6A 1H2WA 4ETWA 2N9UA 3TUZC 1UJCA 1Z2PX 3QW4B 4WZZA 5JJCA 4OLFA 4JAVC 5IXYA 1D2HA 3K0FB 5IUKC 4BTVA 4ZYWA 3BMNA 4F4UA 5FWXB 3KT6A 4N82A 4UREA 4DTCA 2O8DB 2BCEA 3HCRA 2AMLA 4OATA 5ECYA 1FY2A 1OXVA 2NXCA 5GQSA 1TT5A 2FFQA 3TPZA 3DOFA 1CQZA 2WU1A 4EPVA 2QAGB 4WOPA 1E2GA 1MIOA 4EYKA 3UPTA 4YDHB 1KI6A 1JU4A 1RWNA 4QOSA 5FI1B 3CCBA 4P58A 2R68A 3CWZA 1KQPA 2JJMA 4X1KA 5DXJA 1CNFA 2CL7X 3PNSA 4D74A 3E35A 2X0FA 4H6PA 2AW3A 3EWIA 3IBYA 4E5KA 4N0MA 3KD2A 1MAHA 4ZAFA 1OH6A 2CJPA 1BS1A 2REXB 2V6MA 3VSBA 2BGLA 1Y9DA 3M9XA 5BR8B 1SQFA 3HJNA 3BE6A 2BM8A 3K70C 3R9KA 3U44A 1A7JA 4C03A 2VPQA 2WJYA 3JVUA 4B7XA 3DAFA 2H48A 3AONB 5IMBA 1M54A 4F4FA 3KQVA 1LSSA 3F1LA 1ODCA 3KJIA 1C4OA 2XYQA 4KXQA 5AKYA 2I4OA 2VLBA 1AKQA 1DG9A 1QIHA 3MPUA 4ECAA 1AS3A 4MW9A 5JS2A 1KMMA 4XVHA 5B6PA 5JD3A 3JZIA 3DMTC 5IC5A 4QLBA 3MVEA 4S0ZA 2O52A 3Q88A 3UFBA 3VOSA 2ZB4A 4HLQB 1VJRA 4E11A 3VV2A 5FAKA 1HORA 1DRVA 4M54A 3VPBA 4B6EA 1LV7A 1RMQA 3WSWA 4I50B 4RFVA 1W85A 1SXJD 1MG5A 3PE4A 4KIJA 4H7FA 4YJFA 1DUIA 1RHRA 5C80A 1E0KA 3E3NA 4RF2A 4ZCMA 4UTZA 1TYAE 3LQRA 8AT1A 4B2LA 5IJAA 4XM0A 3WX0A 5DW3A 4J3JA 2IV3A 2A9QA 2XTZA 3QG5A 1YR9A 2JKYA 3UUEA 1W5AA 2RH4A 1C9DB 3G8YA 3SF8B 4I55F 1JMKC 3VVBA 3WWEA 5MDHA 3TN7A 1MTOA 3B3GA 2GXQA 4NHEA 4Q16A 1E2MA 4QEZA 3TR5A 1CNEA 1E1CA 2H8GA 1J07A 2I4TA 3R1IA 2BRUA 1Q50A 1RRMA 1XLTC 121PA 2F1HA 2DUWA 1GGVA 4XIGS 1X13A 3THYB 1JIQA 1E4YA 2CUKA 4G1UC 3H5RA 1R8YA 4QRHA 1E79A 4MJXA 5BN3B 4INPA 4R7TA 2EP7A 2OO7A 2PIDA 3LFUA 3AP1A 3O74A 4M6WA 3QELB 1NSYA 3RUIA 4REOA 1A97A 5LKAA 3K5PA 2R7KA 3PHBE 4KOAA 4BNYA 1YNSA 1A9XB 3HKBB 3SYTA 5KNDH 4D92A 2C1XA 1GL6A 3ASZA 4OQYA 4IIGA 1KSGA 5G3YA 2FCAA 4EI9A 2GXSA 5SYMA 3PX2A 1LI5A 4JJ7A 4E6PA 1P74A 3TR0A 5C8VA 5HF8A 2QX8A 2XOEA 3QE4A 1G8KA 1OBCA 4QQNA 2BI7A 2GEDA 4J3FA 3OOWA 4YMVA 4EF4A 2CVZA 1GRVA 4LV8B 4MEAA 2Q6KA 3K96A 4MB0A 5ERGB 1WCXA 2HO4A 2FE4A 3T7AA 2NNLD 1Y4SA 1DIHA 2YIMA 3LUAA 5JS7A 2J9FA 2ZTHA 3GLQA 1G60A 1IB6A 2IPNA 2YXBA 3OA0A 4TMXA 1OAOA 3FDXA 5G53C 4IDAA 3H65A 1U3GA 3HXKA 3F1KA 3JQ8A 4LJYA 3GEIA 4GGMX 4BVEA 1NMQA 5JY1A 1JFSA 2F59A 1IXRC 3CVOA 3UAOA 1T9GS 4PR0A 4OU4A 2WJJA 5EZYF 2VDWA 5KQLA 3PGLA 1W59A 2XODA 3OPYI 3QVVA 4OHPA 4QICA 4EHLA 1Y3BE 4BNXA 2JS7A 1S2LA 1V9CA 2BMFA 2CL0X 4URUR 5EIXA 4DB2A 1SQ0A 3ORRA 3QOWA 1EK6A 4PZLA 1GKUB 3VYRB 3ADBA 1U31A 1ZUNB 5TPWA 4LZPA 3PC6A 1HH4A 4YTEA 3KOUA 4PG6A 2PCLA 1U80A 3QU9A 3IKTA 4R2XA 5IULC 1VPEA 4IF4A 3FPGA 2B2CA 1U9ZA 2AOUB 1JHQA 1HV8A 1XTSA 1HRDA 1ZOIA 2GCPA 2VYVD 1I3OA 3B3AA 3KQMA 4NDNE 1JPUA 2XT0A 1DKQA 4KQMA 5EHZA 3ITNA 4MQEB 5A2GA 3IPLA 5JS1A 1HLFA 3WXMA 5J2TB 4BKPA 3A11A 4BUJA 1KERA 3FSRA 4YFYA 1JV2B 1Z2OX 1AG9A 1XAJA 5C7LO 2COUA 2V9PA 3AERB 4N0EA 2HMSA 3JAKB 4GYWA 1BDBA 3F90A 2I80A 3L4KA 1B8UA 1Z4OA 3BSSA 3GPBA 3LIPA 3C87A 5DM2A 4BFXA 3JRWA 1NPDA 2VNJA 3BMCA 2ZSIA 4HNQA 5JSUA 1Z4QA 3AEUA 4QOFA 2GILA 2QRUA 3GJ0A 3W5JA 2Q49A 1A4XA 1IG0A 1L8LA 2ILVA 4D6YA 4L73A 4GWLA 2BFAA 1FP6A 1GG9A 3Q9SA 1UWVA 3OZIA 1UP4A 4ZVQA 2FQQA 2C0CA 4DADA 4KPUA 4D5GA 4BLQA 5CM8B 1SBIA 1F4VA 2YMPA 1SC9A 4NZ9A 3R74A 1B1AA 3GJRA 4ZC1A 1T4DA 1JE0A 3G0IA 1WQ4A 1MJGA 4IICA 1SXHA 2H4ZA 4CCAA 1N32B 1T5DX 1YL5A 2CCGA 4RC9A 4HDCA 4RLQA 2HWKA 2BBOA 2G88A 3OE4A 1JDVA 1N1DA 2D7JA 3N8GA 4RY0A 4WUVA 4WZBA 4PTZA 2PGAA 3CCFA 2NU8A 1FS5A 1E0AA 3NHSA 4IEEA 4LDPA 5PNTA 4RLHA 5ICFA 1NXSA 1VJGA 5AOVA 3EF0A 2EDAA 2Q3BA 2V9CA 2AFHE 1JIJA 4JEHA 4DPMA 4ZCRA 5ALPA 2IUSA 1OIXA 1U7DA 3M6XA 5TX7A 3UJ9A 3OCYA 3AWDA 1S3GA 4N0PA 3VSAA 3PXUA 3Q6IA 2X13A 1WDKA 1TW2A 4UU0A 1LSUA 2PRZA 3VDNB 4KJXA 2PH7A 2Q5CA 3UC9A 3O75A 3HABA 4YRKA 3IJPA 1KZ9A 3VKGA 3AIMA 2J5BA 2Q4RA 3CG4A 3Q5EA 3RKUA 4DY4A 4C7OA 4C89A 4ASUD 1YOVA 4AJOA 3D59A 3GFVA 3IP8A 5CHYA 5LYJF 5DHAA 4W6ZA 3FNEA 5JAIA 1NXTA 2IIPA 1OC2A 1S2OA 1WHSA 2ZDHA 3DXFA 2PMEA 4F6CA 4OFXA 4WXYB 1S2NA 4QXPA 3JRXA 5F7JA 5AVQA 1AUPA 3H04A 5FPYA 1P6XA 3VMFA 4E33A 4O4LA 3OF5A 1C9KA 4RO0A 5I7SA 3GT7A 1KZYC 5FPQA 1TIKA 1QGUA 3O0DA 4GLBA 4K6GA 2H51A 5AM1A 4D8WA 2NT4A 4FQ5A 4YJ3B 5JVDA 1Y8QA 1N2EA 1V35A 1E2JA 1E2IA 3HJCA 4DLTA 1BFUA 1JFFB 3ABZA 5M7EA 3NLLA 4MVJE 1Y4ZA 1GAWA 4HX5A 1KAEA 3CRNA 3P9QA 2HT6A 5EUBA 3MWDA 2KM1A 2QENA 1J1ZA 3GI1A 4IEFB 1QRAA 4QYIB 3WB2A 2GFHA 1WZUA 2OV4A 1IMOA 1N2SA 1VMKA 2MYTA 1ULUA 4IGEA 2XMGA 2XTJA 4L7QA 1T9HA 4JU8A 4DLBA 2KQUA 2EWVA 3FG9A 3N3AC 4Q19A 9ABPA 2FSIA 1DQRA 2OHOA 4JHLA 2FPPB 2XYGA 1U0RA 2I4MA 4I08A 2G7ZA 2BF4A 3UFXB 4ATNA 2Z57A 3E3LA 3SDBA 4J76A 2WYOA 5EHIA 5JXJA 3TLYA 3ACBA 3FXAA 4KNVA 4Y2HA 1Q0PA 3ZU6A 2AK2A 4U7PB 1W48A 5IVIA 3CRRA 2A14A 4RCZA 3RG8A 3K6SB 4KR6A 1BQ4A 2OAP1 3JQBA 3KUUA 3K9FC 1OX5A 3RAEC 1MKYA 4AZ0B 3FTNA 4L72A 4MCHA 2CJWA 1V25A 3L4BC 1N7HA 5T8KA 1UWCA 2B98A 3V7WA 2AHOA 2JL1A 3SIWA 1GTRA 1T8YA 4YJ2F 2QD4A 1OV4A 3VU1A 5CJJA 3EQ9A 4V1CB 1W6RA 4Z2YA 3ADDA 3K70D 2A5LA 2C9MA 1BH2A 2Y76A 1IM8A 1XZBA 3H0EA 4GZLA 4BFZA 4RTPA 3ITEA 4WWHA 3DBRA 4WY8A 2CLEB 4NBNA 3KZMA 2QQ5A 2G5CA 2JGRA 1N9GB 3AZPA 2A0KA 4HWOA 4LRXA 5CBPB 3KUDA 3NM4A 4JOBA 1ZMTA 1JPNA 2DKOA 3R7AA 4C0HA 1XQ1A 4QA9A 2B5OA 4ARAA 1USWA 2X77A 1X6VA 1CQWA 4KN6A 4RF5A 3JVIA 2JJ8A 5HFNA 3HU3A 1HLDA 1WCIB 2VNAA 1COWD 4YJKA 5E1OA 1D2CA 4Q1EA 3ZD8A 4X6LA 2ET6A 1OTXA 4FN4A 3PUZA 1GKYA 1XEFA 3GHHA 2ZT6A 3I3SR 2AL7A 4PYLA 5JANA 1WKBA 3PDIA 4G2TA 5M3BA 1QU2A 2MYPA 1BDJA 1MG0A 4J2OA 5SICE 3AM4A 1OCEA 4P5PA 5ELLA 5LIPA 5HQJA 1AF4A 1EG7A 4YNBA 4L6IA 3TCKA 4TLEA 3VAYA 3GDFA 1Y7HA 3TINA 5IDQA 4RV4A 1N2CE 1LS1A 2ZE6A 1CCWA 4J07A 3FGZA 1NP6A 3ITKA 4LOLA 3ZQUA 4BMXA 4IDBA 4BYGA 1MN6A 4PYOA 3HRIA 2IEZA 5CG2A 1LNZA 1OGJA 2R0QC 3IPYA 3ECSA 3OBIA 5JRDS 1KA9H 1U0LA 2ZTVA 4TWZA 5TGTA 5JZBA 2VZ8A 1E64A 1NXQA 4LC0A 1Z0KA 1XZNA 3K09C 4GECA 2Y05A 3RF6A 4AYTA 1MJFA 1CY4A 4LYAA 4G67A 1WHTB 1PJ4A 3VHXA 1H2ZA 1DBVO 1XRLA 1KNXA 2H9YA 1GGJA 3FYUC 1NMXA 2QTTA 3ANTA 1GAJA 5G1PA 3LT0A 3QPBA 3P94A 1JDUA 2C2XA 3FYSA 3G0GA 3DXXA 3KLMX 4XVUA 3DH0A 5DHQA 4FHEA 3TK1A 3BXFA 4TV8A 4D43A 5DNVA 4UUBA 3VH4A 4PPNA 3JYOA 1YS7A 3T7SA 3TG2A 2CHVA 1Z0SA 2VHUA 2XF2A 4O8ZA 4PGFA 3CUWA 1G20A 4EYGA 4KQJA 2EWMA 3OZWA 3K2EA 3HNPA 4PFQA 2IQIA 3HGMA 3V1NA 3PDJA 3ZDCA 2IHVA 2H11A 1PR0A 2PBFA 2RAVA 3M82A 2B7LA 1GNVA 1T2NA 3FNBA 4FE4A 4J16A 4MVJG 1JHDA 2O8FA 3VPHA 1KK1A 2D2FA 4TLAA 3GGGA 2A7XA 3UT5B 1GYQA 4NQZA 4XGRA 5TS3A 1OLXA 5FUWA 2ONZA 4NEQA 1VB3A 5KSYA 1OIWA 2PBZA 2QPTA 3AB8A 2KWIA 2XCIA 4GI1A 1Y1QA 3CA8A 1ZJ4A 1MT0A 4BUCA 5JZOA 1AXEA 1EEHA 5C1PA 1JAXA 1T2UA 3OPYA 2G06A 1A8HA 4QOEA 5FKJA 1Z45A 3QRWA 2H52A 3QFRA 3L6CA 1ONOA 2NMVA 3GOQA 3BH6A 2EL9A 4OKNA 1ADYA 2G8NA 2Y8EA 4IIJA 2J6HA 1ENOA 3A6GA 4LX0A 4R3WA 1TT5B 1GKLA 5BQOA 2ZCJA 2CSXA 5DSTA 1DKMA 2J3HA 4J03A 1HDZA 1GPBA 4B40A 2A0YA 4GPD1 4CUJA 2ABWA 1Y1KE 4DUZB 2WMNB 1MIOB 1M2FA 1QHHB 1AD2A 1X7WA 2GPBA 2R751 3GVXA 4JU9A 4R51A 3ORHA 3OMWA 4OK5A 1EVEA 3BT7A 5FR1A 1N5JA 1AOXA 1ZEJA 1BKSB 2A1TR 3NHYA 4XUGB 4ISCA 1NW5A 5EMKA 4ZYTA 4DLZA 4FNOA 3ZJVA 2AG0A 3FVVA 4QGHA 1U7HA 4DJAA 3PFIA 1S8FA 1U7UA 2CW5A 3BREA 2CYAA 3TZ6A 4J0KA 4A03A 1L5HB 1J8MF 4Y2VA 1TPZA 2HQOA 3LRXA 5I8PA 3B5JA 2R3SA 2HMWA 3GXBA 4D41A 3U44B 1J97A 3KT3A 4P7KA 1P9OA 3S4YA 1GG8A 3K9WA 1ISJA 4ABYA 2ZITA 4RABA 4ZCSA 2WHPA 3ROZA 3ZHOA 4ARCA 4FPXA 4O2LA 1KYQA 1EQUA 1Z0AA 1HFKA 4LI3X 1Y81A 4MI1A 2R00A 1EQAA 1Q92A 2ECPA 4GM1A 5D1HA 4U9UA 4EJMA 3SVZA 1KNQA 1YR7A 2WIBA 5G4LA 3RADC 4G0YA 4QVKA 1QQAA 4JLUA 1JMYA 3SU8A 2ATIA 5AUPB 1UJ5A 1NNUA 1SRQA 2WSSD 3HWX1 1O94D 1LW7A 1OFHA 1OXBB 4X3CA 4N03A 3BL5A 2QU8A 5B55A 1KMQA 1LRLA 1SQ5A 2GBLC 1M1YE 3AOEC 4XQ0A 2AKAB 1Q1GA 1T35A 3AUAA 2VSNA 4FMCF 4DLXA 1TEXA 4ND8A 5J59A 2Q3DA 3SOZA 1DO8A 4MRNA 4BQRA 3V6MA 2QLNA 4DANA 1XPJA 2C03A 3N8DA 1QRTA 4Y2QA 5BN5B 3L01A 2IF0A 2YINC 3II6X 1XZGA 4GSKA 1M1UA 4ADSG 4EECA 5K2OA 2MIIA 2B8EA 3EPHA 3EDQA 3UJBA 3F4KA 4M0MA 4DJFC 4LOHA 4EUFA 5DCLA 4OSPA 1FRQA 2R8OA 3GAZA 4PX5A 4TZKA 5I7FA 4CF5A 1O6CA 4AAYA 1E59A 5FNVB 2PQ2A 2W58A 4AECA 4Q9JA 4BVLA 4BO4A 4CZ2A 2I3GA 3DJFA 2YWBA 3IL2A 2B3TA 3KKNA 4XRRA 3RV3A 4OH7A 1K6JA 1IC6A 2QUHA 5HR5A 3PRKE 1HYHA 1O6ZA 2HWWA 4YPOA 3STYA 2V1XA 1AB5A 1Q0ZA 1BHO1 1G5HA 5GM2A 3KE9A 2IE8A 4A5SA 1YFKA 2E37A 5L45A 1YRYE 2E2WA 1O03A 2Q28A 2YV5A 3C43A 4X1IB 4X5OA 1P5RA 4L9WA 2WUVA 4IVNA 1GD1O 4UC0A 3TNLA 2GJ4A 3T3NA 2O0MA 1L4BA 4UBIA 1ZD2P 3I5YA 1TYCA 1BQEA 2CNBA 5ADHA 4NZPA 2FX2A 1MB9A 2FOLA 2LR0A 3G7UA 2CHUA 1WD5A 1XZMA 3BERA 3EIOA 3P0RA 3PKZA 4KO4S 3MD0A 5CYPA 4A0GA 3QYFA 4EOGA 5KNBA 3U16A 1EIWA 4GEGA 4RV5A 4V39A 3U09A 1LPMA 1JAHA 1L5ZA 3EVCA 3H9QA 2HHJA 5TQ2A 3E0QA 1OASA 3I73A 4HY3A 1GIAA 1QVWA 1XZHA 2CY0A 2NZ8A 2BSAA 2VDLB 4DGQA 4YK7A 1P5FA 1TUEA 1TM2A 2YHBA 1G19A 3T3IA 1PZFA 4RD6A 2Q9UA 4GFDA 4Y67A 2GN8A 4U5QA 2BEVA 3EMDA 2IPLA 3UWPA 3VR6D 1LTQA 2AEMA 4FGLA 3LPNA 3RVKA 4MVJM 3VZDA 3H5OA 3MWEB 1R6DA 4BATA 1ZNWA 4FR5A 3IA7A 3V1TC 5HKKD 3STHA 1Y80A 2A0XA 4JLVA 1KQNA 4KN9S 3M83A 4NAHA 3LDGA 4U6QA 4KDFA 4KODA 3DEAA 3P0HA 2FWJA 2REBA 2WF8A 5C81A 1FVOA 4GE0A 3PDHA 2FK7A 1NUHA 1NJ2A 1P72A 3BH7A 3GGOA 1BIFA 3JATA 6YASA 2E5LB 4BWFB 3F8WA 3H7IA 2GRJA 5B4VA 1UZUA 4BVBA 5JFOA 3RB8A 1HG0A 2EAUA 3D6VA 3PKIA 4QULA 2SNIE 4DG8A 4GPBA 2WUWE 3KVYA 4HGZA 4O2BB 3TRKA 4Q1DA 1JR2A 3VGPA 3NGMA 1FC0A 3BIFA 1P6UA 3CLUC 1N4AA 3UMJA 3JQ9C 3D0KA 3P9PA 2FQ1A 5AVVA 3B6JA 2GO7A 3P7MA 4BKMA 4FCVA 4KI7A 2MDTA 5ITSA 2IYEA 3O4IA 1SUFA 1X7ZA 4X8LA 1MH1A 4BBAA 2ASEA 2Q2NA 4RTLA 5FQNA 1DO0A 2GT1A 4GMKA 1LLUA 1O3YA 3OZUA 3BBLA 3VTAA 3IQEA 2W0MA 1RZRD 4DV0B 5JNLA 4WPGA 3H7AA 4IZ6A 4JLJA 1U7ZA 1VPTA 3AFOA 4UUPA 4KRGA 3AEUB 4QQ8A 2I4NA 3N8KA 4G1BA 3U7EB 1KEPA 2CNDA 3A0RB 1G55A 3PQ5A 5TJ9A 3TRIA 2ZRNA 4O2RA 3TAXA 1IBMB 2C99A 1IBKB 3H9BA 3LLUA 2JFHA 2PY6A 1RVV1 1P77A 1E2EA 2CEKA 2O2DA 3CCCA 1I3CA 3DCYA 4PRLA 1W5TA 4PONA 3TD2A 3LTEA 3R7WA 1XJQA 3U3JA 3AUSA 3IBTA 3IIEA 4R8KA 4B0OA 1NBMD 2HDNB 2R8RA 5EXSA 5A7GA 1NQ5A 1W36B 2GF9A 1CUXA 3F5SA 1TTTA 1U5AA 5MFPA 3H2SA 1TLFA 3NDPA 5DX8A 1GAXA 4NEHB 4IGAA 2NW6A 3OLZA 1IONA 1V47A 2V59A 1Z2DA 4HV4A 2NU8B 2YFHA 4GWKA 1V5EA 3LKBA 4QNMA 4XAQA 3C3WA 2OEPA 2Q7XA 4GR5A 1X2EA 3QFSA 5K0TA 3HUDA 1RXYA 4RMGA 1JLKA 2AXNA 5TMPA 1JXAA 3I6YA 4LYFA 3FMFA 5FO1A 3MWFA 4BO5A 4CI9A 3N6RA 4FHCA 5BUSA 2HNAA 1E3LA 1ZCAA 3PYMA 2YVUA 1NE7A 1LEHA 1WW8A 2I8AA 3CUKA 4LYDA 4RQUA 4KR9A 3D6HA 3NHPA 3K8YA 2BAGA 3OTOB 1X9HA 1GA4A 4FONA 2JLZA 3ZJUA 1KDOA 2X8LA 4ZGGA 3TW4A 4NONA 4YCBA 3WFJA 2WAOA 4F7WA 1II8B 1YE5A 1UOOA 2NVWA 1LLFA 3IAM6 1EGMB 3EGEA 3ORSA 4M7OA 5AESA 2XBMA 1FJ2A 2GBCA 4EA6A 2QZZA 2I8LA 1OVMA 1SCJA 3H11B 2WA2A 3IKLA 2O7VA 5EIHA 5HJ2A 2DHCA 3L0PA 3DDWA 4NC9A 4LXQA 1GN8A 1IUKA 4JI3B 2BE9A 4GLJA 3IV9A 2PKWA 3LHSA 3TIXB 3HO8A 5KQSA 1M6VA 1Z6XA 1KHTA 4XXHA 4B79A 3KPJA 5BNTA 4PZPA 3MB8A 4WBNA 1UKZA 3IODA 1V9LA 4HB0A 2B20A 1VJDA 3PDWA 4G36A 4OKSA 5IVPA 5FTNA 1DCMA 2IOHA 3TXXA 2YFKA 2B0JA 2J45A 2ORIA 3P2KA 2BBTA 2R65A 3RD5A 4C04A 5CVJA 2HZBA 4L22A 2YR0A 2P9GA 2PD3A 4FD2A 1K3UB 2VCEA 1REQA 4IZIA 2W6NA 3N70A 4YMTA 5D6OA 2WHQA 4TS1A 1ISGA 5CIQA 5GPBA 3WYBA 1M75A 3TW6A 4RTRA 2OV8A 3ETCA 4EYSA 4B45A 4TSRA 4WK2B 4G37A 4PS1A 5JMOA 3LU1A 4C05A 4DMCA 1K5GA 2BTQA 1I2CA 1WXIA 3AVPA 4TTJA 4EYOA 1S4QA 2QRHA 2J0UB 5BSWA 4B75A 1BMQA 4DBLE 4CIWA 2P9EA 3QE9Y 4WLOA 3V8QA 2SHKA 5LR6A 3GJTA 1UK8A 4B6QA 4RF4A 5B57C 4H31A 3LQ2A 4HMQA 4MQ4A 4QDOA 2FSFA 4PVCA 3BHNA 4ALMA 5HRUA 1UZMA 2QMOA 3FPFA 2EKZA 2OG2A 1IY0A 1AMNA 4JQCA 1Q1ZA 1HYQA 2XUDA 3AU8A 2X23A 1KL7A 4NOKA 3ZDRA 5JARA 2XGJA 2Q3MA 1TL7C 2BGTA 3O93A 3PGMA 1QFYA 4J0CA 3L1JA 2JIZA 4IFTA 2DTDA 1RQNA 2CD7A 2CNWD 4FI3C 4XX0B 1FQKA 3QTLA 1LQ2A 4LJKA 2HD4A 2JHFA 3I23A 4A8JC 1QE5A 1V6CA 2L2QA 3D8RA 3ZIAD 2OBFA 2Y0DA 4M99A 5LOVF 5JU6A 1TYZA 3QMPA 1NOJA 3DOUA 2PYIA 5JAOA 5KOJA 4ZO4A 1KFKB 2GA9A 2RAFA 1O95A 1Q91A 2JFWA 1EGHA 2GPSA 3KTAA 3CKLA 3VU9A 1APBA 2W2LD 1J22A 2VDRB 3R4CA 3C6QA 4F7DA 1C7QA 5A0VA 5B12A 4I46A 4OP3A 4YJHA 3FUCA 4EIWA 1GR1A 2PUHA 1TM7E 5EPUA 1HMPA 1OAKA 5BRAA 3H1PA 3MOGA 3MAGA 2OAGA 4K8RB 3OF2A 4B4KA 4BJ1A 1FUUA 2CUZA 5IJ0A 2GZ2A 1ECLA 3DEZA 4DHEA 2C61A 4MP8A 1DHTA 2O8EB 5E6UA 4ZVOA 3PQ2A 4RHYA 4RA9A 3IP7A 1E4EB 1SELA 1WCV1 2VPPA 4GR4A 7REQB 3OZ7A 2SCUB 2Q3HA 1S01A 8ABPA 1O4VA 4O0MA 2IWHA 3I4FA 2OORC 4CKEB 4ME6A 3VDRA 3FBTA 4U1RA 4CM9A 1KE2A 1FVHA 2FQYA 3RARA 5KU1A 4WKCA 2WB4A 1ESNA 2OBLA 3HH8A 4X1YB 1YDHA 1R9JA 4Y6OA 5T4FA 2XDQA 1J39A 3OHSX 4NS4A 4GGOA 3M3PA 2B8NA 1J2UA 4NOMA 1IHOA 4GMGA 1P33A 4UEOA 5CXSA 4CKXA 1XNRB 1YS6A 4ZPXA 4BFLA 3JQAA 2B37A 2VUHB 3ROMA 4Z49A 1QQBA 3CZ9A 3DZBA 3MTQA 3BL6A 5BT8A 2P90A 2R6CA 5ESDA 3RSGA 3U9LA 1WCWA 5DSXA 4B3RB 1W88A 5E6RA 3BF8A 1C4XA 4OY3A 1E1MA 2RG1A 2MSEB 5IS2A 3GAMA 2H08A 3IESA 3CGGA 1K7SN 3KC2A 2X6QA 1JSCA 1PT9A 3P9XA 3O9VA 4IIDA 1U3CA 2C58A 4HS9A 1G20B 2FMKA 5KYUA 3X2EA 2O8CB 2FSPA 5DP2A 1NVBA 2PLWA 2Y9MB 3NIFB 5LA6B 4PZ9A 5FTJA 3VH3A 3ZC3A 2VI5A 3GMTA 3DVAA 3FSJX 3U4CA 3V8EA 1CULC 1H6AA 1RZUA 3L1UA 3L7JA 2F8TA 3ZCRA 1PS9A 4URWR 2PZFA 1FP4B 4AJ9A 5EJIA 1K7CA 4IJ6A 2PQMA 4R69A 3D3WB 3AYZB 4DQUA 4HUTA 2HSJA 3OESA 5HKBA 3PPWA 2ZYDA 2ZUDA 4OHOA 1Z36A 3NJRA 1S0UA 1MQ8B 2BM0A 3WISA 5FT9A 1KFCB 2O5RA 4HDKA 5FI3A 1SBYA 3UA4A 1P2VA 4HTFA 4TT8A 4X8OA 2HDWA 3DNMA 2OZLB 4YRLA 3W4KA 2IPXA 1GUZA 3OPYB 1XNHA 2ESRA 1L4GA 3EY4A 1QTRA 4ZZ0A 2ID7A 2O5VA 1A96A 3R5JA 2ZYVX 1DTWA 2ORYA 3CISA 1CHNA 1MNAA 4JZKA 4U2CA 3UJ8A 1YK1A 5HGXA 1YU9A 3HGQA 4J0JA 4M53A 3LZ6A 1FK8A 4YWHA 4OYRA 5JMWA 2WF5A 1NUAA 3DFKA 4X85A 3D02A 1P8JA 2OQRA 2HDOA 1FXSA 2RHLA 5CFMA 3REQA 2CCKA 1H22A 2X4IA 4D3ZA 3OTQA 5GADl 1JILA 1Z06A 3CLUD 5DGHA 3RRJA 1QGAA 4S1TA 2EKLA 2HA2A 2X5JO 2X9QA 3CFYA 3O83A 5HQ3A 3D1VA 4HRXA 3D6JA 3T3GA 1NZFA 3P2MA 2G04A 4WXHA 2C2WA 2MSNA 3DPSA 2N3ZA 1XRJA 3ZR4B 2PSSA 1RAGA 3Q0EA 1BZYA 2DBVO 5CA1F 3LLCA 4V0LA 5KI6A 1P4JA 5EJGA 1XYVA 1O1YA 2O2GA 3DXZA 3L9XA 3LBNA 2VTBA 1B0AA 3GFBA 2AEFA 3HKEB 4ZOEA 1YIAA 1H2XA 1I10A 3AEQA 4UNRA 3DOIA 3BRSA 1FRZA 1KC3A 1NRWA 1SULA 3AT1A 2H9AA 2QTVB 3C7AA 2BFEA 2Z2XA 3KQUA 5K99A 3AGPA 1JG2A 3KHTA 5G02A 5T6BA 4Q6BA 3N9IA 4ZPJA 3S40A 3W5CA 1XTUA 2AOXA 3A3NA 2XCUA 4JJEA 3EXHA 1M3SA 3QU2A 3SDZA 4KDCA 4B4OA 3KZ1E 4PPFA 5CH5A 1DAHA 2REOA 4A2WA 1ZS9A 3NWPA 1IPFA 4YMHA 2RDMA 4UTPA 4CEIB 4O33A 1EE9A 2NUAA 3X44A 1PQPA 2RAUA 4HFRA 3SSNA 1XVAA 1NULA 2JANA 3E9NA 2QV7A 3B7PA 3VO9A 2WJIA 4Q15A 2WMOB 3OBBA 3QVTA 5AKHA 4EUKA 4RZUA 1MJHA 1G9TA 1XMOB 1P2TA 3MCVA