2QAGC

Crystal structure of human septin trimer 2/6/7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
282
structure length
224
Chain Sequence
b'ANLPNQVYRKSVKGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSTVQVEQSKVLQLLLTIVDTPWQPVIDYIDSKFEDYLNAESRNRRQMPDNVQCCLYFIAPGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPLPLAVVGGRQYPWGVAEVGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septin-2
publication title Structural insight into filament formation by mammalian septins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, structural protein
total genus 29
structure length 224
sequence length 282
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qagC00
4WA7A 1W5SA 3MCAA 4B76A 1VG9B 1T0HB 1N6IA 1R5OA 1QHIA 1XTSA 3KJHA 1UM8A 2XEXA 3EPKA 3MWKA 3OEED 5JECA 1GKUB 4I81A 4M21A 2WJJA 4M1KA 1KDRA 2BHRA 2FWRA 4A36A 3AVYA 4MGYR 1ZNXA 3RC8A 3SFZA 1WB9A 1YRBA 4URUR 2XX3A 2VYFA 1Q57A 2QMEA 4TTPA 2KSQA 2ZANA 3BAFA 4DT1B 1ZU5A 2J3EA 4LDJA 1S1CA 3HR8A 3BORA 2ODEA 2OESA 1KNQA 2YOHA 4HSEA 2ONKA 3U7FB 4FMBB 4DDUA 4PQYA 3QXSA 4M53A 5FR1A 3ICQB 4HI0E 5FOVA 4P4UA 3H0KA 1OE0A 1Z6YA 2EYUA 2JLYA 1UADA 5F98A 2VHQA 4QHYA 1K8RA 4HUQA 4OK6A 4BFVA 4IFBA 4XWAA 3Q8XB 1AN0A 1KI6B 3D6TB 1F2TB 4NBSA 1SVLA 2IF2A 2PEYA 4URZR 4A6PA 1FMJA 2XTMA 4IDPA 4JIMA 1E96A 3ND9A 4B44A 2QPAA 1U9IC 5FPKA 5HPYB 3CRMA 4LI0A 3QPUA 3H2YA 4D0GA 2IA5A 1E79A 1FL9A 1X8LA 3GMTA 3U3MA 1Z0IA 3X2SA 4YMUA 3QEJA 4AYTA 3W8NA 3B78A 1G3IA 3GFTA 3EARA 4LYFA 1P72A 2L0XA 1ZVQA 2NO1A 2R65A 3QXJA 1JJ7A 4ZKDA 1HURA 1KZGB 3U44A 1Z47A 1XP8A 2DWPA 4FINA 4C0AC 4CEIB 5EE9A 2KBEA 2PT7A 2HEIA 1GNPA 4NKRA 4O0MA 3SBEA 1Z29A 2G0TA 1OPXA 3ASZA 4ZKEA 1D9XA 1KIMA 1ZM7A 4PANA 5DO9A 4DLUA 4OI4A 1P7CA 3B60A 1BH2A 3P1JA 2LWIA 3Q5EA 1T6NA 4V0MA 4PPQA 2J59A 2WV9A 1LV7A 5FPTA 1SXJA 1GRQA 4Q18A 4MKGA 2CLCX 1SVKA 4P0TA 1AQYA 1KDOA 2QAGA 3U7GA 3K9HA 4FI3C 2AN9A 2RHDA 1S9HA 4A6XA 4TZ6A 1IAQA 1KMHA 2OFXA 3K9NA 2WMNB 1E9SA 1TNDA 3IEUA 1M7GA 1AA9A 4B3FX 2WWGA 2FN4A 1W0JD 4LZZA 2D7CA 3RNLA 3GLIE 2FSFA 1S3SA 4R98A 3SN6A 4B3GA 1XCGB 3LQQA 3LX8A 1ONBA 5GADl 1U81A 2FSGA 3GJ3A 5E3HA 5DE3A 2NOAA 2VSFA 3QF7A 1CIPA 2CDNA 4ABYA 5DN6D 4BRUA 3SQXA 4BFWA 2JJ1D 1JECA 3EZFA 2DFKB 3BK7A 4DB4A 2OBLA 2FSIA 2JJ2D 4PQRA 1IXRC 4BLTA 1ANKA 4LHWA 2HDNB 1TF5A 3H1TA 4HAVA 221PA 2IS6A 2FMXA 2ORWA 2OSBA 2X77A 4POAA 4CGZA 5AUPB 2QTHA 4HLUA 2QRNA 1XTRA 4A8JB 1P6XA 5CYPA 1NRJB 3EZ9A 1IN5A 4C3ZA 4FMDF 4IOKA 3TSZA 2ZJOA 4MRVA 1PZNA 3B7GA 1Z8FA 5SZHB 4B3XA 4HAYA 4XH9B 4OJKA 4B47A 4FN5A 3R9IA 2FFQA 3EA0A 2QQ0A 4RSGA 2OO7A 5FFMA 1UJ2A 4D0NA 5C1BA 1DADA 2WMOB 821PA 4A0HA 3CRW1 4P33A 2VF8A 3SJCA 1IM2A 1YZNA 1T8TA 1P5ZB 2CBZA 3THXB 1R7RA 5C4GB 1RFLA 4IDNA 1BYUA 3KJGA 4G5RA 4RFSB 4UNSA 2C95A 4I99A 2EWWA 4TTRA 3S1AB 1E6CA 2OFOA 2GF9A 3A36A 4M2LA 3V9PA 4C0KA 4GZMA 4GMDA 3H84A 4K8OA 3OIWA 3UPUA 1JALA 3ZIAD 4CF7A 4TYYA 3FWYA 3SDZA 4LBVA 5KDOA 1NP6A 2XOKA 4B74A 1N5LA 3DMDA 4QJ5A 2VF7A 2BJVA 1XF9A 3DZDA 1NVWQ 2RGDA 3PUWA 1XWIA 4KBFA 1V5WA 1KYIA 2AR7A 3HPQA 3HR7A 4DLRA 3ADKA 4ARZB 3VR5A 1EGAA 3R8FA 3M0EA 1TQ6A 3EZ7A 4HB0A 1JXMA 3B8HA 4HAWA 4RVCA 4TYNA 3HU1A 3IQWA 4IVQA 3CO5A 1H8ED 4HZUA 3TKLA 3W3ZB 4FCTA 4UJ5A 1MH1A 5IK2A 3QXHA 2O8EA 1B0UA 1N0UA 1GRRA 2GESA 1NI3A 2O0HA 3ZVRA 1G4UR 1JBKA 5FOTA 3A37A 4Q01A 1ZC3A 1OF1A 1JQJC 1Z22A 2QE7A 3FPAA 5LB4A 4DSNA 1HT2E 2ZAMA 3ASYA 1OYWA 2WIBA 5KU1A 2IYWA 1G8GA 4LV6A 4JT2A 1GFIA 4LHZA 4XSGA 3RWOA 2PT5A 2IX3A 3LX5A 3Q85A 4D6PA 1HT1E 3TUIC 2DB3A 1F48A 2HF8A 3JVUA 3EZ6A 4XVQA 3I3SR 2A9KA 1KK2A 1DAHA 1YR8A 3KUDA 1FUKA 3AB3A 5KSYA 3J81k 4MGIR 1FP7A 3GLHE 1N6NA 2WKQA 4L16A 3CF6R 3FFBA 2NPIA 3BB4A 3CLVA 4V02A 5JWRA 1OH8A 1XFAA 2CMKA 1YZGA 3DOEA 3W90A 4AKGA 1QRAA 1QHNA 2DFNA 2J0UA 4KSCA 1NBME 5FTKA 3OIUA 3RAPR 2CNWD 3EA5A 3SOPA 1HEIA 2HCJB 3Q3JB 2CK3A 2WSSA 1W48A 1HA3A 2ZJAA 1WF3A 4N0DA 1E0JA 3IHWA 3KB2A 4ACBA 3K09C 4UQOA 2Z43A 3GP8A 3F8TA 3V4FA 2B21A 2F43A 2OG2A 3WP0A 2CLSA 2AX4A 1R6BX 1OFTA 4TWZA 3NTUA 3AH8A 3ZS9A 2Q6TA 1C1YA 1DVRA 4LPSA 1KOFA 5IF9A 3KL4A 4QBGB 4QJ3A 5A0FA 4JVMA 1Z08A 2G1KA 4DVGA 4U02A 4D4LA 4BZQA 2ASEA 2PL3A 4ASUA 3QKUA 1FPMA 3EZ2A 1FQJA 1UDXA 3T34A 3BGWA 2GEVA 3KQKA 3MRSA 3DMNA 2R6GA 3AKYA 1SULA 3PUXA 4TYWA 4RCZA 1MV5A 3NWJA 5DISB 2C9OA 3C41J 4JLBA 4AY2A 1UKYA 1GUAA 5CB6A 2IYQA 1KK3A 1BIFA 2GCOA 4PC7A 1G7CA 1MABA 1ZBDA 2N1BA 4W7SA 5EP1A 1GWNA 1LTQA 1CR2A 2W2VA 1VKJA 1KKMA 1N6OA 1VIAA 2BV3A 4GFDA 5K8IA 3A4MA 1D2EA 4LV8B 1EESA 2DBYA 2ZRFA 4I1VA 4P4TA 2V7QA 5EXTA 1P2VA 2YWGA 3Q5DA 1Q20A 2IW3A 1KI2A 4A2QA 2ATXA 4IXNA 1W1WA 4NE2A 5CB8A 1NN5A 1RVDA 2V55B 4Q9KA 3ZH9B 3FFAA 2WPDD 1PUJA 5FOSA 1CJKC 2W58A 1P4SA 4JL8A 3Q9LA 5M04A 3TVTA 2VHJA 2GJ8A 1VCMA 2VP6A 2IEYA 2V9PA 2GDJA 4DSUA 1CXZA 5J4KA 1ZNZA 3AF0A 4U00A 3MG9A 4DLZA 2Q9CA 1Q0UA 1QBKC 4N0EA 4EQ6B 5BN4A 5JRJA 2BEKA 5JWHA 4DCVA 1F2UA 3LV8A 4JBWA 3K70D 4AD8A 3AGPA 3QPWA 1XCPA 3MGCA 4UXJA 2IXEA 5HZHA 1X1SA 3FYHA 2OM2A 1KO7A 1IY2A 5DYGA 3VU9B 1MO6A 5LB2A 3ZD7A 3O8BA 3DM9B 2VP5A 5DI3B 2Q3MA 4M9SA 1E2EA 4QBFA 4BEJA 3CH5A 4TZ0A 3B1WA 1HQYE 1NSTA 2GXAA 2OLJA 1II0A 3TR0A 1XJCA 3AVWA 4US1R 3SC3A 1FOEB 1NSFA 2QM8A 3T5GA 1GL6A 2P67A 4HDQB 2XNDA 4Q1BA 3SS8A 2AWNA 4UNRA 2CHGA 1XBTA 5CJ2A 4RY2A 1J8MF 2WKPA 2MSEB 2ZAOA 4GP6A 5BN5A 2IYRA 1YQTA 1ETUA 2QNRA 1F5NA 4CZ2A 1N25A 4HB4A 1J2JA 4B3CA 4RZUA 4WXRA 1Z2AA 2QL6A 1N3BA 1VG8A 4KLZA 2CE2X 1DELA 3C14C 1K5GA 5ANRB 1XB2A 2H1LA 1YRAA 1PV4A 3H86A 1TPZA 1FMLA 3X1ZA 4TLDA 3K8YA 4OQNA 4PSAA 4G01B 1GTVA 1G18A 1XXHB 2QRZA 3IILA 1JAIA 4MUBA 1TAGA 3A4NA 3W5IA 1OXSC 4TSFD 2GVDC 3T1QA 2QPOA 3FB4A 4P4SB 1PLLA 3FMFA 1KSFX 1RIFA 5DNYB 3KKMA 3AQ4A 3LBIA 2P0EA 4OHYA 2CCJA 5JEEA 1S2MA 2VP2A 2BBSA 1OFIA 1GL9B 3LVRE 4ZDWA 3K0AA 1VECA 2RGGA 3CPHA 3Q72A 1DBSA 3RRMA 2GETA 4MRNA 3FE2A 4PZYA 3K9GA 3PEVA 4AKEA 1J90A 2QP4A 3AVTA 2ZI9A 5FL7D 5KDLA 4YMTA 1CLUA 1E4VA 2IT1A 3O47A 2W6IA 1KKLA 2YWEA 2F1JA 3QBTA 1WBDA 1DARA 2HV8A 1XMIA 3BIFA 3B1YA 2ZRCA 2IXGA 5EUQB 4Q9LA 3FTQA 1XEFA 4TL9A 3NDBB 1D5CA 3CWZA 1KJWA 5H70A 2C04A 2ZI4A 1G20E 3SZRA 4B35A 4LHYA 1H8HA 3DKVA 1PLKA 1T91A 2WKRA 1G16A 1YZKA 3TNFA 3MWJA 3QY0A 2OT3B 3FMIA 4RD3A 1RPZA 1T0JB 3NXSA 5FTMA 2ZE5A 3JZMA 4MRSA 4ZDIA 1LNZA 3VTKA 2REBA 3KJIA 3GEEA 2KE5A 4NH0A 4BEBA 1R10A 2H7VA 5JZVA 3K70C 2G77B 2GNOA 4YMSA 3T12A 5IT5A 2F55A 3NDPA 3EXAA 4FIDA 4WW0A 2Z4RA 3KQHA 2ZROA 4G1UC 4Q4JA 3I92A 1ZD8A 2GBLC 5JJIA 3AF4A 3GLIA 4L8GA 4MUAA 1X8JA 4OQMA 2CL7X 4DDTA 3IIKA 4TMZA 2O8DB 3TAHA 2JLRA 4LJ7A 3T5DA 1A5TA 2GKSA 3QF4B 2WSMA 5TV2A 2BVNA 2XNSA 1U0JA 4TMXA 1QHHA 2VP4A 1S0UA 2PJZA 1QZXA 2ZRLA 3ND8A 3NHBA 2VSXA 1GKIA 4TLEA 3U7EB 2O8CA 4W5HA 3W6PA 4B6EA 1Q3TA 2JDID 3QPVA 2EW1A 3TE6A 4Q4LA 2G3YA 4TT3D 4DCUA 5BQ5A 1JXOA 5FPYA 3R7WB 1YU9A 3NC1C 3AUXA 4AYXA 4TLAA 4URWR 1MRNA 1T5LA 1WP9A 3I73A 4K81B 4NONA 5CLLA 4H1VA 4A0RA 5FOUA 4LV5B 4V0KA 5G41A 2J1LA 2W6JD 4H1UA 3GJ5A 1IHUA 2ZRMA 4Q4HA 3R8CA 4DCNA 5DYIA 2IYSA 3CF2A 3JZAA 4BUJA 4DZZA 3TQCA 5J4VA 2IYYA 2FZ4A 5LBIA 2OILA 4JLMA 2G0NA 3SEAA 4BZPA 2ZYVX 3I32A 4KYIB 4PSVA 3DO6A 2QMUA 4HDOB 4LC1A 4A2PA 5CK4A 1E9CA 1AK2A 3LXRA 4RD4A 4F92B 1F2TA 2W83A 3L82B 4P31A 4DCSA 5KPJA 1E2LA 2C03A 2C2HA 3L8YA 4ZIRB 1R2QA 1G4AE 4GRAA 2GK6A 3OIYA 4PO8A 3RS7A 3PENA 2JA1A 1JJVA 2FPLA 3SQWA 2R6FA 2RMKA 1G8HA 2XGJA 1WBBA 4CVNA 1JI0A 1SXJD 1AIPA 2REXB 5FUXA 2QY9A 4I1UA 2VLIA 2GHIA 2IYVA 2IEZA 3IDQA 2VO1A 4PZLA 4IOMA 2NO0A 2YOGA 3V00A 3HP1A 2R6AA 4RD1A 4QG7A 2A78A 4XTCS 5TARA 4UKDA 2EU8A 4IEIA 3IBYA 4CEIA 1XCMA 4D26A 3K0SA 2QBYB 2YVUA 1NJGA 1R0WA 4TMKA 3DVLA 2HLDD 2GEUA 2BDTA 4O3MA 2O0KA 1IN7A 2XJ4A 1QG4A 4A8JC 1RC8A 3W9YA 2F7SA 4AKHA 5BXQC 1VCNA 3VKGA 2WWWA 2G88A 3CRQA 2ZRHA 1ZM3A 4Q48A 1LVGA 1II9A 1COWA 5AWFC 1X1RA 2NPFA 4FCVA 2WJYA 1N6KA 4MH0R 5AJXA 4E5UA 1SVSA 1P2SA 3BH0A 2IYXA 3IUYA 4KVGA 1MRSA 3UMSA 5BN3A 1E1RA 3IPXA 1AS3A 3B5JA 5FUYA 4QKQA 2JLZA 3B6EA 1Z0AA 3GLHA 5DGXA 3VMFA 4CIDA 1FW6A 4ESVA 1DOAA 4L15A 3T1TA 4LRWA 4LJYA 3SHWA 1NBMA 1AGPA 4PC3A 4ESHA 3EASA 3ZQJA 2EFDB 1E2PA 1AQUA 2V6JA 2MMCA 4JLVA 4IDHA 1ZJ6A 1G21E 2ZUBA 4EKDA 5BWMA 2GJ9A 621PA 2EFEB 1RRFA 2AD5A 5CITA 2XTNA 3LDAA 5CM9C 2FOLA 2C96A 4Q7JB 3MMPA 4ZO4A 5FBQB 2A2ZA 2CHVA 4AKIA 4GOJA 1ZRHA 2FGKA 3I8XA 4XJXA 2ZSDA 3QXXA 3K70B 3EW9A 1T8UA 4URXR 4TQ9A 3DOFA 5KSOA 5J5CA 3AV0B 1JEDA 3EG5A 4TLCA 2JEOA 2BCGY 4JLJA 1LS6A 4NMMA 3VFDA 1M34E 4QRHA 3UG7A 1XMVA 2ZJ2A 4BRWA 4C2UA 4HUTA 1EXMA 4QFMA 1E4YA 3U3JA 4B73A 2ZRGA 3CX8A 1Q1QA 4IOLA 3GJ6A 4AG6A 3DHWC 4LBZA 3UWKA 2DWOA 4DXAA 1ZP6A 2QPTA 4OQXA 4MGKR 1RRCA 2FX3A 1NMXA 5FOXA 2FE4A 1R8SA 4A1FA 3THXA 3RS0A 1SXJC 4B2PA 3VAAA 4JLDA 2WJIA 4OJQA 4OQLA 4RFSA 3T61A 1Z2CA 3S1AA 4FWIB 2EFHB 2DR3A 1SVIA 521PA 4D2IA 3VR6A 4TTQA 2XTZA 3FKSA 4R2IA 3OE7A 4RD2A 4US2R 1G5TA 3QG5A 1P62B 1N6LA 3GLGB 4LUCA 4OL0A 2EQBA 1EFRA 1DO2A 3VKWA 1R0YA 1EK0A 1G9XA 2FGJA 4IKEA 3VNUA 2ZI6A 4MQBA 5KNCA 3MFYA 5A5GA 2WWXA 2RGEA 4DIEA 5FI1B 2VA8A 2I3BA 4B6FA 1GZSA 4EUNA 1DPFA 1OXTA 1Z0FA 2YYZA 5HKKD 1ZIPA 2OAQ1 3L0SA 2C98A 4W5JA 3THYA 2P6RA 3K0CC 1GNRA 4ILEA 2GWHA 4M1MA 4NU0A 1D9ZA 1N6RA 2R44A 4JVNA 2ZVPX 3ZJYA 4KFTA 3U6BA 3ZVMA 2JCSA 1RKBA 4RCYA 1ZUIA 3W5JA 1W0KA 2Q9BA 1XPRA 1CJTC 1N2CE 5E4FA 4HLUC 4QGHA 5J4HA 2CLDX 3AVQA 1XEXB 3FKQA 1HV8A 1Z28A 4IOJA 1KI7A 5EZ5A 3U3OA 1SHKA 2G83A 2PX0A 2V6IA 3HWSA 4PZZA 4Y0AA 5FOWA 3SBDA 4A0FA 5KNDA 2R6DA 4V0NA 4Q7MB 2ANCA 1RRGA 3CR7A 2CCGA 1U9IA 2XZOA 4J0QA 1VMAA 1T3SA 4LBWA 2D2EA 5TB5A 1T9HA 4B71A 2GXQA 3F5FA 3BB1A 1IBRA 3SYKA 3B2EA 5AR1A 1N5IA 1YKSA 1E2KA 5AJVB 5KNBA 3CH4B 3IHLA 4K46A 4P32A 2ZSFA 4CEJB 4JLKA 1CJUC 1XRJA 3SYNA 2KI5A 5JWOA 4D0LB 3AVOA 1KSJA 4WIAA 3RLFA 1TADA 5IDVA 3WRXC 4NCHA 3WRYC 2QROA 5EP4A 721PA 2ZRBA 1KAGA 4QOSA 3VR3A 1Z63A 4MYUA 4MRRA 5KPDA 4TL8A 3X1WA 2GXSA 4Q1CA 2Q9AA 1E9BA 1YVDA 2QTVB 2RHMA 4NZYA 2DYKA 4RD0A 3CR8A 1IY0A 4D81A 4Z1MD 4EFMA 1XX6A 4MYCA 4B75A 4B43A 4JSTA 1G7TA 2OFWA 3AF2A 2J87A 2Y8EA 3ZVLA 4EPYA 1EFUA 2ZSEA 2VIIA 2HYIC 1KTVA 1XTJA 3B9QA 3KX2A 4IDQA 5D3MA 1OXUA 1E1QD 4PSKA 2NO7A 1CS4C 2O8BB 5EXSA 1PLJA 1WXQA 1TMKA 1NF3A 1GDDA 1OKKA 1JR3D 2G9NA 2CJWB 4DB2A 3B13B 2BEJA 2N46A 4LJAA 2QEQA 2ANBA 3LBNA 3A8TA 2C5LA 2IL1A 1PUIA 1P2UA 2QAJA 4HUQB 4PAQA 4V03A 4H9GA 3BFVA 1V43A 5FI0B 1W49A 4O25A 3OEEA 3SI7A 2F1IA 2CEAA 1ZCAA 4I4LA 4Q9JA 2VEDA 3DEFA 1W36B 3WYFA 4PX9A 2G1JA 3WMEA 4QL3A 3ZZ0A 4IW3B 2QUZA 5FBRB 1SVWA 2AKAB 2IHBA 2JIZD 4RZ2A 5HE9A 4CEHA 1P9WA 1GITA 1TF2A 4ON9A 1Y3AA 5F9FA 5AUNB 4JYCA 3GEHA 4X8LA 3CZQA 4JZKA 4OHZA 3B1XA 2OE2A 1G5RA 2PCLA 1FNMA 1EFTA 5SZJA 1GRNA 1KI3A 2VP9A 3GQBA 4LPKA 2XSZD 1U98A 2J7PD 2VHUA 1EG7A 1SKYB 4NCKA 4W5WA 1TF7A 3TW8B 2AKYA 2D62A 4Q19A 4DLSA 4XVUA 3OEHD 4L9WA 2N42A 2ZS7A 4TQUS 2E87A 1P73A 1GNQA 1QHSA 2C78A 1RJ9B 2EVWX 4WXPA 3R20A 2A5YB 4G5QA 2OCPA 4EQ6A 4Q21A 4ZCIA 1CR0A 8OHMA 1YZLA 1G17A 3N70A 3FHTA 2BIFA 1SXJB 2RB4A 3LW8A 5EP2A 4XOIA 2F6RA 3VU9A 3ADCA 4CYMA 1G3QA 3DDCA 3KKOA 5DI3A 5SZIA 1LB1B 4YLGA 3W8RA 3RC3A 4MKHA 1IN6A 1E0KA 2QT0A 4U7DA 2JLXA 5KSZA 3SYLA 2UZIR 2A5FA 3WNBA 3U61B 4XSHA 3H4MA 2ZRJA 4ZI3A 3A6PC 1CKEA 3CZPA 3UWOA 2BCJQ 5JCZA 4LOAA 5F2EA 3AF3A 4EPXA 2YWFA 4JJKA 3WHKA 3E1SA 4ERNA 3K0FB 4JLAA 5KO2A 2QI9C 3AKEA 1R0ZA 2D7DA 2ZSBA 4DUGD 1ZNYA 3IKJA 1VHLA 4PTLA 1SZPA 1Z0DA 2WTUA 3QKRA 1W5TA 4JS0A 2QTFA 2ODBA 3KFXA 5CLQA 3I5XA 2FZLA 1VYUA 2XAUA 3EC1A 1RW4A 1QDEA 3TUJC 3TK1A 1KHTA 5C46F 2WWYA 3GCGA 1U2RA 3T15A 4M9XA 4Q5IA 1D8TA 1E2FA 3OESA 4LBYA 2GCPA 3OFND 4DLYA 2VPPA 2UZ3A 3NVAA 4P4SA 3HJNA 1SQ5A 5DSZA 1W0JA 4TYPA 3TVDA 1UBFA 1GKYA 2UVQA 3IIMA 4BLOA 1EX6A 2FFAA 2P6NA 3K1JA 4EPWA 1H8HD 2DWQA 3VHLB 3A1SA 5B2ZA 1RZ3A 3KZ1E 2F3TA 1TQ2A 5DN6A 3OAAD 2O0JA 1Z07A 2JJ1A 3QENA 2PBRA 1IXZA 4RD6A 2QSZA 4NDZA 1FUUA 2JJ2A 3G82C 3GJXC 2B8TA 2C99A 1AZSC 4JL6A 3RSLA 4PPFA 4F4IA 1ZCBA 1VDZA 4URVR 1CJVC 1OHHD 1R5NA 1NLZA 4KFUA 2ZM5A 1A1VA 1W4AA 5K8TA 3BH6A 1NG9A 1TQDA 2AWOA 3M6AA 5SZKB 4DSTA 2PZGA 1S96A 3K09A 1A2BA 1E9EA 1TL7C 1ZMXA 4LJ6A 3TW4A 1XEWX 2IYZA 5CJPA 1Z6GA 4BLSA 4FWTA 2XITA 4DEXA 4F4JA 3KB1A 2QP9X 3WYAA 1DAIA 2XZLA 3LLMA 3WYGA 3D3QA 1BMFD 2Z83A 121PA 2P3SA 1XZPA 1LF0A 5DHAA 1OV4A 2WOOA 3CM0A 2REOA 3LO5A 2DPXA 3RS3A 5JBQA 4UJ3A 4C0JA 4TN1A 5FTLA 2BWJA 5HCIA 3KXKA 1CR1A 1VYTA 5G3ZA 5LDDC 1XTKA 4NHOA 3ZIAA 2PJRA 1NKSA 3AVUA 1LFDB 2O8DA 4NPHA 3W6NA 3KTAA 1KO5A 3HU2A 3QF4A 4PHHA 4UXHA 4XD7A 2A7QA 5BW8A 4JT4A 1R5BA 1N5KA 3LY5A 1LW7A 3DL0A 1TUEA 5EXXA 5A4JA 2QM7A 4B3DA 4HEJA 2Z6VA 3R9XA 1R8QA 3A4LA 2ZRDA 1E2NA 3BS4A 4JKYA 4KSBA 4IHQA 4LCBA 1LY1A 4PFSA 1G41A 5DIFA 3THOA 4HZIA 2BKEA 2MSDB 1ZC4A 1H8EA 3RS4A 5KOYA 3QKTA 3T1OA 4NCNA 3U5ZB 2WICA 3R7WA 2BBWA 4EIWA 3GFOA 5EE5B 4JJZA 1XNJA 3PFIA 4KFSA 2J0UB 4F91B 4OK3A 1E69A 1VTKA 1W4CA 1G8FA 3UANA 3CONA 2ZXUA 3AP3A 4KLNA 4F93B 1XTIA 3D8BA 2BMJA 2W2XA 2F3RA 1BKDR 3QSYA 1OH7A 4ZI2A 5TMPA 1G6HA 1SVMA 4M9QA 5JEDA 3WY9A 3G5UA 4IFEA 2BMEA 3NH9A 4JBYA 2F43B 1Z0JA 3MJHA 5FPSA 2J7KA 2BBOA 3RS2A 1F3OA 4DLXA 2VHCA 2WBLC 4NCIA 4F38A 1W7AA 3IO5A 1US8B 3TSOA 2MSCB 4IRUB 3C8UA 3MD0A 2BMFA 1IY1A 5E95A 3A1VA 4EPVA 4ZIRA 4RJLA 1MKYA 5EJEA 1UPTA 1EWRA 1G3RA 2CNWA 1X3SA 2A3RA 2IHYA 1KY2A 4M4SA 3QBVA 4QXAA 1IN4A 2V1UA 3VR1A 4G3XA 2QORA 2ZREA 3F0TA 1XJQA 3P20A 2ZTSA 1KZ7B 3UXMA 2GCNA 2WOJA 3MUFA 1XTQA 4GNKA 1MABB 2ZJ5A 4KODA 3WNDA 1I2DA 2O8FB 3LH5A 2BKUA 5J4YA 2F9MA 1KO4A 1GAJA 3QEOA 1KJYA 2ZS8A 3AVVA 1M1YE 3QVVA 4ZV4A 4YXWD 2PLFA 2QA5A 2AXNA 2E9SA 2QBYA 4XWKA 1KI8A 2VH5R 1ZYUA 4B3BA 4N3NA 2HJGA 3CRRA 2IS4A 2H16A 4QBHA 2DHRA 1II8A 2GAAA 5GJVC 3LA6A 5JSZA 2HT6A 5LD2C 2OHFA 1NJFA 3BXZA 5L8VA 1ZM9A 4OK5A 2FA9A 3KXLA 2WJGA 2ZEJA 4M0LA 5GJWC 4HAUA 4KI0A 3OHMA 1XD2B 4GP7A 3WBKA 1G8PA 3FGNA 3QQ5A 3VQTA 3FOZA 3PVSA 3TJZA 4UNNA 1ZD1A 1KNXA 3I72A 1S1MA 1S3GA 2IYLD 2ZITA 1Z5ZA 3FHCB 1M7HA 3IPYA 4QNMA 4BASA 5L3SA 1DG1G 1DTSA 5H68A 3BWDD 4G5OA 4E03A 4WZAE 3GLFB 4C7OA 4Z8XA 1FZQA 3C7KA 2ZR9A 1Q44A 4Q4AA 4YQFA 4LX0A 2FG5A 4HDCA 3N2IA 1SHZA 3C4JA 1XMSA 3LLUA 4B48A 3P4XA 4U5XA 4CDGA 3QJYA 4QHTA 1WMSA 5DH9A 2PZEA 1W36D 2WPDA 3KFVA 3QG1A 1OFHA 1GOTA 3KXIA 3T1VA 4LYJA 3O8CA 3BC1A 1Z0KA 3JVVA 3L2OB 1VCIA 1NVUQ 1WQ1R 3PCRB 4GBMA 1E2MA 4Q9HA 2NZ8A 4EJSC 1DE0A 4DT1A 1OH6A 3X1DA 4OBEA 1S8FA 1E79D 1G64A 5K8LA 4MYHA 1YE8A 4YDHB 3FDIA 1JPNA 1P9NA 2CL6X 1C4OA 3FKSD 4WOPA 3RDPA 4RKEA 2GZAA 3ZGXA 4ZCMA 4JKIA 3WHLA 1CJMA 2SHKA 4WZ6A 4IDOA 2NO6A 4DLTA 1KI6A 1JPJA 2GJSA 1P60A 5GVRA 3TAUA 1E2QA 1XXHE 3W34A 1T3LA 2FU5C 2OCYC 1E9FA 2B6HA 4LJ9A 1L2TA 3THWB 2V4ZA 1WCV1 4A4DA 1F6BA 3RRNA 4PO9A 3R9WA 1K6MA 2HF9A 2VP0A 4KV9A 3U4QA 2ODWA 1GP2A 3L0PA 1Z6AA 3HPRA 3A1WA 2NIPA 4PC6A 2ZUCA 2ZIAA 1IONA 2GXUA 3U3RA 1J8YF 1GILA 2VRWA 3QE0A 3PEYA 4LJ5A 4EFLA 2R9VA 3I62A 2BJWA 4PAOA 5EE1A 1OXVA 5B30A 3TUZC 1ZUNB 2GILA 1L7VC 2WZQA 1SKQA 2HXYA 2QMOA 4LGMA 1T3HA 1BYIA 1OFUX 4PO1A 5EP3A 4XIGS 1OLOA 2J41A 4Q7LA 4TSFA 4HLCA 3BBPA 3TGPA 2WJVA 4MDFA 2EFGA 4B33A 5FH9A 5EQTA 1Z83A 5C18A 1KSHA 2ZE7A 2CXXA 5E7IA 3BJIC 1NIJA 2OLKA 2HCBA 3B82A 1ESNA 4HAZA 3U4QB 3TMKA 5CM8B 4OI2A 3CF0A 4Z54A 2QQEA 1DEKA 1F60A 2RGNA 2HT1A 4BFUA 4C0QC 2B8WA 4CT5A 1WE2A 3CNLA 1JR3E 4RFVA 1L4UA 1KAOA 5JLJA 4LHXA 3F3YA 4X8MA 2UKDA 4M1OA 3NBYC 4DDVA 2V3CC 5FL7A 2IYUA 1NG1A 3NHAA 4YONB 2OBNA 2PH1A 1OIWA 1JR6A 3EAQA 1QHYA 1ZU4A 4HATA 4IJMA 1MT0A 3QUSA 2QMHA 2RGCA 3BH7A 3DM5A 1Q1ZA 2GEDA 1QHGA 3N5CA 1H65A 5KDDA 4F7WA 4WZBE 2AXPA 4LYAA 3KKPA 1P9RA 4HB3A 5K8UA 4DLVA 3O8RA 5B64A 1W36C 5C2JB 1XJ0A 2ZU6A 3SJZA 3HDTA 4M1YA 4MRPA 4R9UC 3IBGA 3TH5A 1QHHB 2P65A 3AF1A 4KJZA 4KU4A 4OHWA 3EIQA 1FFHA 2JLSA 1N6HA 5TVKA 3GLFE 1M6NA 2V8OA 1DAKA 2O8CB 1NMZA 5TY0A 1RRPA 3KKNA 4QGAA 2KJQA 1ZW6A 4D25A 3GJ8A 2KBFA 2J46A 3MWLA 4B2IA 4GOKA 3U6KA 2OBMA 1OXXK 4ZDKA 1CRPA 5LD2B 1KO8A 4C9BA 2ZJYA 4E22A 2HXSA 4KVAA 2ZPTX 4A8JA 5JHHB 2WVJA 2GZDA 1A2KC 3CIOA 4O2RA 3CKLA 2R8RA 5DI9A 4BLQA 3IQXA 4YMWA 2X2EA 4WAUA 3ETLA 1KDTA 2X1VA 4IXMA 1D2MA 2HYDA 2XOKD 4EFNA 4LJ8A 3AM1A 2QGNA 2RKOA 3MLEA 1UKZA 3AKDA 4Q4HB 4HYYA 2O8BA 1Z06A 5KYKA 3VR2A 2CJWA 3LWNA 4NCJA 1KDPA 3IGFA 2AFHE 2DFTA 3NC0C 3QKSB 1Z3IX 2LKCA 2JDIA 1AS0A 3BFKA 3WP1B 2C77A 5IK2D 1FX0B 4P3YA 4TT3A 5B57C 2OEPA 2QAGC 2ZJ8A 3B85A 4ACAA 2FV8A 2XB4A 2FNAA 3GJ7A 4LK2A 1XU4A 4B32A 5HR5A 3NBFA 1X86B 2QE7D 2A5DA 2JATA 3A1UA 3UK6A 2FJUA 5JHGB 4BWYA 2IF0A 2I1VB 2JAQA 5TDHA 3RRZA 1KO1A 2W6JA 2J0VA 3PQCA 4YDSA 1OH5A 4II7A 2ERYA 4EJSB 1TTTA 2IUSA 3CNOA 1XZQA 3BFXA 2WWFA 2ZYWX 3WXMA 2ZRNA 1BO6A 1N6PA 1EWQA 3EPHA 2YOFA 2ZRPA 4GDFA 1IN8A 4ITRC 2XXAB 2ZI5A 4ARZA 3I4LA 5FPHA 3NKVA 4QM6A 1XDBA 4EDHA 1E99A 2C8VA 2Q0HA 4FMCF 1E2HA 1E2JA 1KSGA 2ZI7A 1VYVA 4AURA 1DAGA 2PCJA 3FMOB 5L3QB 2ZS9A 5DHFA 2CVFA 4OHVA 3C5HA 4Q1FA 1NNEA 1N0VC 4OYHA 5FBVB 1RJ9A 2Q3HA 1E0AA 1ZAKA 3TLXA 5IHPA 1O3YA 3GFPA 2R6CA 2CK3D 2WSSD 1XPOA 4FMCB 4ZDJA 3TQFA 2J0SA 3B1VA 2OXRA 3W3AA 3AUYA 4AI6A 3U2QA 3DZ8A 3RS5A 4JVLA 5EE0A 4D80A 3PEWA 1J99A 1G291 1GSIA 2NO9A 4JMPA 1A4RA 1MR3F 1T4GA 1NL3A 4QJ4A 2CHQA 1E9AA 3D31A 1K5DA 3GLHB 3CPJB 3W6OA 4BFYA 2W00A 4R71A 1E94E 1ODFA 2QG6A 5LPNA 3TIFA 1AS2A 4ASUD 2ZR0A 2V1XA 3CNNA 5EXPA 4TMVA 5EUMA 1R4AA 2OUKA 2P2LA 4AK9A 3KQNA 4KAXA 1M2OB 2HLDA 4AG5A 4BZXA 1I4TD 2WAXA 1WDTA 3UMFA 5FTNA 2Z0MA 1U8AA 2ZRIA 1E9RA 4BGDA 5P21A 4DLWA 2GA8A 3K0FA 1M8PA 3PXGA 1OIVA 4E09A 5GJBA 2ORVA 5BYJA 2E1RA 1GVNB 2PMDA 2QT1A 1FTNA 2YWHA 2ZI3A 4QGFA 4E07A 1NY5A 3K0CA 3ZLJA 4GT1A 1OW3B 1UAAA 3LQRA 3E70C 1Q22A 3GPLA 4NTZA 2YKGA 2VTKA 3T35A 4Q02A 2I1QA 5CDFE 1G3UA 4YMVA 4KXFB 3O8DA 1XD8A 4PXAA 2X8AA 1N0WA 4O2LA 1P75A 3PV0A 4Q00A 1IXSB 1UF9A 3B1ZA 2V7QD 3VHXA 2IYTA 5FBLB 1SGWA 1IQPA 1RYFA 1TUIA 1OB2A 3GD7A 3KUCA 1CF4A 1MO3A 4HLQB 2YJTD 5FUVA 3RSOA 4A2WA 1TEXA 4C30A 2CCKA 3U3KA 4AWXA 1CRQA 4DCTA 2H5EA 3VX4A 1CEEA 4DWJA 3E2IA 4M22A 2GTPA 3I8SA 4LC0A 2A5GA 1AJEA 3M1IA 1OB5A 3LVQE 3ADBA 5JJLA 1G5PA 4FMDB 5CK5A 2C9CA 2BM1A 2F1RA 3IO3A 4UXIA 3ICEA 4A82A 2ATVA 1U8ZA 2GF0A 3I5YA 1G7RA 4R2HA 4X8HA 4N1AA 2H18A 4D82A 2GVZC 4MGZR 3ZDQA 4C4PA 1VIYA 1E0SA 4LSGA 5G53C 2ZU0C 1E2IA 2RGBA 4G0NA 3CPEA 4M1TA 3U7HB 3U44B 1YHNA 3GLGE 2JJ8A 4XD7D 2IWHA 3REGA 5KHOC 1Y63A 1UDWA 2XNDD 4JL5A 5H1YA 3RANA 4IVRA 3X1YA 421PA 1W2GA 3M4YA 4MDEA 2Q21A 1RYHA 5AUOB 2XJ9A 2ERXA 3WNCA 1XEWY 3QI2A 5ELXA 2VQSA 2ZUDA 1KI9A 2ZQ5A 1VG1A 3GJ0A 2IUUA 1G7SA 1I2MA 1KK0A 4TMWA 3THYB 1DG3A 1ELOA 1OYYA 1E3MA 4LYHA 3PITA 2BMDA 3KQUA 1FTSA 1X6VA 3QXCA 4TYQA 2YC4C 3X1XA 4I1SA 4JYBA 5J4LA 2QAGB 1FNNA 1JQLB 4D4MA 3HYTA 3EC2A 1U99A 1G3MA 1KMHB 3LXXA 1KGDA 1Q21A 4C0BA 3LRPA 4PPGA 3ZS8A 3NBZC 4C0SA 2O5VA 4A0GA 1XD9A 1ZNWA 1WRBA 2BC9A 4LHVA 4CW7A 4S35A 2OV2A 1W46A 1X8KA 4BLPA 4PHFA 5AK0A 3EX7C 1AKEA 1QF9A 2H17A 3ECCA 4QBIA 2IUTA 5F3WB 3TBKA 5HKKA 1IJEA 2B92A 1E32A 1VG0B 4RZXA 4AIIA 3ZVNA 2GZHA 3EIHA 3P27A 4EAQA 1JEEA 2GRJA 1UFQA 2K5UA 3P4YA 1GM5A 5CIQA 1ZINA 5DLQC 1QG2A 1AKYA 2ZYUX 4GOXA 2W6ID 4FD2A 1XXHA 2QGZA 4YC7A 4S2EA 4CT4B 5H8WA 1CBUA 2J0QA 2OXCA 4JVSB 1DS6A 2H8KA 5UKDA 1CU1A 2QU8A 2AFIE 3TSWA 3AP2A 2PX3A 4Q1AA 4LWZA 1R0XA 1A82A 1E2DA 4EPTA 2V54A 2GJKA 5D3MB 3AGQA 2F9LA 4L4UA 2ZVQX 2D2FA 2YNMA 4PQFA 4DDWA 2QSYA 1US8A 3ADDA 3QNUA 3TR5A 2IWRA 1PVOA 1I4LD 4BQSA 4PHTA 5E7JA 2VHTA 3AVPA 4KO8A 5JS8A 3L8ZA 1U0LA 1P61B 2D06A 3C15C 5G3YA 2HJVA 1U94A 2ZJZA 4Z1MA 2X19A 4KYUA 1YZUA 2WWIA 3RWMB 4PR0A 5JCPA 2XZPA 2FSHA 4XTRA 1E9DA 4Q66C 2YHSA 2P6UA 1P2TA 1G8YA 1U90A 5G40A 4CEHB 2O8FA 1E1QA 1E2GA 4D4JA 1QVAA 5AUQA 1IJFA 3I61A 2NQ2C 5CYOA 2MMGA 3EPLA 1JR3A 1RE0A 2O52A 1Q3HA 1NLFA 4M1WA 4D4KA 2W2TA 3RHFA 3QVUA 4GI7A 1DAEA 5HCNA 3DPUA 3SHFA 1UBGA 4HZUB 5FTJA 1NY6A 2FPKA 2J5XA 4MYTA 4M8NE 5B58C 4DEYA 4BLRA 2O8EB 2RAPA 1EX7A 1KY3A 1SKYE 2IBMA 4L5BA 2B7BA 1NN1A 4MA4A 4GZLA 1XD2A 3EIEA 1M74A 3GEIA 3RABA 2YZ2A 5FR2A 4TQAA 3P32A 2LKDA 2JIZA 2BM0A 2NMVA 1Z6TA 3GLFA 2IC5A 3MWYW 4V0ME 2KB0A 1B23P 5KTYA 1FP6A 2RH5A 2QZ4A 3EWAA 3QIAA 1SXJE 2RCNA 2RGAA 4G5GA 1TX4B 4KBGA 1EFCA 3BB3A 3K0EA 2H57A 1TEVA 2C9YA 2W0MA 1NLYA 3SR0A 3SJBA 2WIAA 1NKTA 5D3QA 2JLQA 2QP3A 4Q47A 4ZCLA 1S4QA 4V0LA 2XSZA 5JMTA 2J7PA 1QVRA 4WBSA 4WVFA 2Z5FA 1A7JA 1J7KA 1MO4A 3OEHA 2CVHA 1KJZA 5C4MA 2BBTA 4UNPA 3NIBA 2AD1A 1HY3A 1L4YA 4IEEA 4QGGA 2A5JA 3HYRA 4QNRA 4DJTA 3EWSA 3FVQA 4PAMA 3FMPB 5TXGA 3ZYCA 2ZJBA 4GL2A 3FHOA 2A30A 3G0HA 3NG1A 3BRWD 1GL7A 4OKSA 4JLOA 1HUQA 1KI1A 1MOZA 1U0HC 3D7MA 3PG5A 4NYIQ 4AC9A 3KQLA 3PJRA 1AZTA 1OIXA 2I4IA 2JASA 3GJ4A 2AK2A 4UNQA 1UEIA 2VBCA 3QKRB 1CR4A 5KSPA 5CIWA 1HE1C 2QN6A 2ZYTX 1L8QA 5EZ6B 4W9MC 3EPJA 4JSYA 5HTKA 3V4RA 1Q1BA 1AM4D 2FH5B 2NZJA 2EYQA 1G19A 1NVXQ 4JBXA 2IXFA 4PC2A 4DRZA 3THWA 4GSYA 4A15A 2HUPA 4QHSA 3REFA 4TL7A 3VX3A 1XPUA 2GJAA 3QOFA 1C9KA 3PUZA 3SNHA 4MKFA 5F9HA 2WM9B 1COWD 1UBEA 3NEJA 3PEUA 3NH6A 4Q7KA 4BFTA 1YZTA 3OZXA 4NYIR 1FQKA 4HB2A 2DFLA 1BOFA 1DAMA 1I4DD 1ZIOA 2AHOA 3OIVA 2GCOB 3CRVA 4DUGA 4KITB 5JJKA 5EE3A 4A92A 3VKHA 2Q3FA 4US0R 3E5HA 1E1RD 5AJWA 2CL0X 4M1SA 4MITA 5JRZA 4KHZA 2KWIA 2FFBA 4FW9A 3BE4A 4JLPA 4HLDA 2H92A 1IOZA 4DIDA 2F1HA 2NG1A 4OHXA 1M7BA 3CX6A 5L3RA 5JS7A 1JAHA 3AKCA 3OFNA 1NBMD 1S9DA 4RZ3A 1ZD9A 2VL7A 3MAAC 1D6JA 3OF5A 4Y0VA 1SVOA 2JGNA 3UKDA 3WBJA 4C0LA 1YR6A 2BOVA 2Z4SA 4BE7B 2ZE8A 4FXPA 4Q1DA 2IK8A 4DBLC 2JLVA 4FCWA 1G1MA 4Q1EA 2ECKA 4EPRA 1Q1EA 3ZQ6A 1N5JA 5HE8A 1O87A 3OAAA 1W44A 2LCFA 4C2TA 4V0OA 2PLRA 1HQCA 1F2UB 2JLUA 5JFGA 2ZRAA 3BD9A 4OQFA 3K53A 3C5CA 4KFRA 4CRWB 4Z51A 6Q21A 2IS2A 2G6BA 1UEJA 3LNCA 1OHHA 4IVPA 3RRYA 4KCGA 4NYMQ 3MSXA 1Z6XA 4TLBA 5FL3A 3VNVA 3L0IB 1CP2A 4X8OA 1KI4A 3TRFA 3PUYA 3RVBA 5IRCD 2FEMA 3PIRA 1TQ4A 1W4RA 2AL7A 2WWHA 3A1TA 2CE7A 3MJRA 1WA5A 1CTQA 1OT3A 3KTAB 3BERA 3KDSE 3SU8A 3ZZUA 5JI3E 1OJLA 4OI0A 2J9RA 4B34A 1HTWA 1ZM4A 4R7ZA 4NP6A 4XVRA 4Z8YA 5CDFA 1JB1A 3PUVA 1BMFA 2FFHA 4TMTA 2YV5A 2ZETA 3VR4A 3ZD6A 2WHXA 4PHGA 1VPLA 1YR7A 2YC2C 3WMGA 3I1FA 3UG6A 2ZRKA 1P3JA 2ORIA 1W47A 3NBXX 3OE7D 4XWOA 2OCBA 1HE8B 4NYMR 4URYR 5AJZA 4F4CA 2FPMA 5GVSA 3K9LA 5L3VA 1W2HA 2FDCA 1UBCA 1NN0A 2AK3A 2GBLA 3N2EA 1EFRD 4Q03A 5BYKA 1QHXA 5FBWB 1NMYA 2WAYA 4PC1A 1Q12A 4AYWA 1LF5A 1KMQA 2ZE6A 4NL4H 3SFVA 5AJYA 2DY1A 1G6OA 3Q7PA 4L9SA 5FUWA 2P5SA 3KKQA 1HH4A 5KUTA 1XMJA 2TMKA 3UIEA 3QKSA 5JI2E 4DHEA 4M9ZA 4BFZA 1MO5A 3CWQA 3CW2A 4Q9IA 1GIAA 4BFXA 3L0OA 1J70A 2RGNC 5J47A 2R62A 3CB4A 2ONJA 1FX0A 2VSOA 3K0AB 1NVVQ 1EFHA 4NYJQ 1UKEA 2FF7A 1W0KD 2W0SA 2J45A 1KK1A 1YZQA 4A9AA 3GLGA 2NTYC 1TU4A 3AVXA 1ZUHA 4I1OA 2OCAA 2XB2A 1BS1A 3PR1A 3P26A 1JNYA 1VHTA 3CUEF 4EJSA 4GPTA 3ZZTA 4DC9A 3SJAA 2D74A 3LW7A 2D3WA 2YINC 4G5SA 3CX7A 3C16C 3B9PA 4QM7A 3T06B 3HU3A 4DKXA 1PJRA 1ZM2A 2FEOA 2XXAA 2OAP1 2PMKA 5E7MA 5GJCA 3IIJA 4GMXA 3AP1A 4OI1A 1LS1A 4HAXA 1VCOA 2EFCB 1YR9A 2RGXA 3BOSA 1NN3A 2EWVA 4QC2A 1D2NA 2GK7A 1OSNA 3UMRA 5L3QA 2D4HA 1NVVR 2NGRA 4NYJR 3ONWA 3WMFA 1II8B 4MKIA 2PEZA 1DO0A 1T5IA 3LBHA 4LY6A 5JSZB 3IEVA 1E98A 3LAWA 5HZKA 1XEXA 2DCUA 3AEZA 3DKPA 1HYQA 3LD9A 2X2FA 4Q4JB 2PZFA 2R2AA 1UKVY 4JLNA 3RYTC 3U60B 3Q7QA 4LJ4A 5J40A 1W4BA 3GLIB 4C0HA 2B7CA 2ZSAA 2JLWA 2ODNA 2OZEA 2P5TB 2IS1A 4B2LA 5L3SB 4BECA 1DAFA 1AGRA 1GG2A 3NEYA 3A58B 3UATA 3L43A 4BPBA 3SE0A 3CBQA 2QENA 4BFSA 4CEJA 1OKKD 1YJ5A 1CULC 4C7OB 2WJHA 2ZR7A 3KJEA 3LFUA 1U8YA 4ZPXA 1ESMA 1NIPA 1TU3A 4Q4AB 4TL6A 4YXWA 4DSOA 2GAOA 4RKFA 4PPNA
chains in the Genus database with same CATH superfamily
5JNTA 3MCAA 4B76A 1SBYA 2A35A 4RTSA 1J23A 1YZVA 4QOFA 5ARBA 3GRYA 1V11A 2PGOA 4RMGA 1LPMA 1UM8A 2XEXA 3KJHA 4MYSA 4BYMA 5C35A 3MWKA 2VYVD 3QUQA 3QPDA 4JJEA 4P7BA 3RJZA 1IMOA 5K3FA 2HJSA 1USIA 2HQOA 2BHRA 2CLFB 4OAOA 2Q99A 3UH0A 4HVLA 1TQ8A 1ZNXA 4FZ5A 4U3JB 3RC8A 1JSXA 1EB9A 1L7BA 1O6ZA 1ZH8A 2FSPA 1QP7A 1YRBA 4URUR 2QXTA 5FO1A 3QBEA 4JNCA 3E1GA 1QH9A 3BTVA 5H7XA 5CEEA 2QV0A 1KOJA 1UP4A 1W88A 3BAFA 3HXLA 3QUAA 4FDVA 4QQRA 4U8GA 4ZOLA 5P8WA 4IIJF 4LDJA 4XEHA 3BORA 4OUDB 3PQFA 2ODEA 4ZREA 3WMXA 3MLBA 3LQKA 4OOEA 3WJAA 5CXUA 3EFHA 1JIIA 4IHAA 4G8CA 5EZYB 1F1JA 3KSRA 2CMGA 2ODAA 5JY6A 4K0KB 4PQYA 2AKEA 4M53A 4H35A 2XWSA 3OZVA 4HI0E 4UU7A 2HSJA 3DCIA 2OCDA 4O2BB 2PV7A 2X6RA 4UTNA 2JLYA 4QFCA 2AMYA 3VKUA 1K8RA 4HUQA 2AC2A 4IFBA 1GQ2A 3Q8XB 4FILA 1KI6B 4JUAA 4KK3A 4XWAA 3T4EA 3LKZA 4D9BA 4IIHA 2RHWA 4JIGA 1F2TB 5ENZA 1BWSA 1ZOIA 1EVEA 1SVLA 2IF2A 3GT7A 4OQEA 1VXOA 2AZTA 2BI4A 4M7OA 1G1AA 1ISFA 3PPIA 1DINA 4NEGA 3W1WA 4D46A 1AQIA 3CVVA 4L7QA 4URHA 1QIIA 1YC2A 3O4FA 4B44A 3V2HA 2Z9BA 3IUQA 3F6RA 4LI0A 1PEAA 2P27A 4F5YA 3TTVA 2V0GA 1ORDA 1MGOA 3L1VA 1NNSA 5ALEA 3WR5A 1AQNA 3QU5A 2GD6A 3EEQA 2IA5A 4RACA 4YMUA 1CIVA 1Z0IA 2HA2A 1TW3A 2PBZA 1SMKA 2G36A 4AYTA 1MB4A 4N5DA 3B78A 3EARA 3TTUA 2X6QA 2G1PA 3W2FA 1JN0A 1CZNA 2QTBA 4OXNA 5KTMA 2XYVA 3GJRA 1W8IA 1QFZA 1KZGB 1RHUA 1Z47A 4C0AC 6REQA 3U44A 1LSJA 2FY8A 3F74A 3TW8A 2IXTA 2VHYA 3HDGA 5TT1A 3FZYA 3Q3VA 4ODIA 4P93A 4WZZA 3W05A 5CEJA 1UPFA 3P0JA 1Z4KA 2YFQA 4NKRA 5JDCC 4AJJA 3SBEA 1JAXA 1P5HA 1Z29A 2G0TA 3ASZA 4X6YA 4YCLA 4PYQA 4PANA 1NZJA 4OI4A 1JFFA 4O5AA 4YTEA 3B60A 5EHZA 1BH2A 1KJ8A 4ZXPA 3MB5A 1KZ4A 2UXCB 1NFRA 3GUUA 2MYUA 4TKUB 2WV9A 1NBEA 3QOWA 3PE3A 4IIXA 1JA0A 1VGQA 1RWOA 1GRQA 3IESA 3L04A 1B41A 4K6GA 4Q18A 1N78A 4ZGGA 5JNRA 4FZVA 2Z57A 3GFFA 1TMGE 2QAGA 4ESEA 3EGOA 5JC8A 1X1BA 3BE5A 2RHDA 4PX3A 1OX4B 4H2DA 4MX8A 1IAQA 4OP2A 3IBCA 3WWYA 1IBLB 2E6UX 2H1IA 2OFXA 2BFBB 3OQNA 5D01A 1TNDA 5JRDS 1Q1GA 2X2PA 2DPGA 3QVOA 3UCEA 4PW0A 4TUYA 4FZ3A 3A2KA 3DXYA 2RK3A 3HXPA 4R8KA 2D7CA 2GBPA 1TW2A 4UEOA 4YEDA 1ZVMA 2VTBA 2YASA 3NNNA 3LX8A 2YY6A 1ONBA 3GJ3A 1LTKA 3N9IA 5CG2A 2CF6A 1J8FA 1Y9EA 1HDCA 1K7CA 1NXVA 1YB4A 2Q2QA 2V7XA 2YRFA 3LOPA 3EBPA 5BQOA 3VSAA 4BRUA 4O4LB 4Y1EA 2QX6A 5G1PA 4XEUA 3EZFA 3BK7A 3QU7A 3QVTA 4ZQCB 3KLNA 2OBLA 2JJ2D 3NTRA 5H16A 4BLTA 1MJ5A 1CQWA 4V2UA 1WV0A 1GNVA 3FMGA 3M4NA 5A5VA 5BSFA 1QX3A 3SC2A 1ML3A 5HOQA 4IUCS 1NVTA 1H2ZA 5AUPB 2QTHA 4TXLA 4D92A 3T7DA 4F4UA 1XTRA 4JROA 1YVUA 3LBAA 3C5VA 3EZ9A 3GN1A 5EJGA 1LZKA 4YV1A 1IN5A 2HLNA 4FMDF 4YV7A 4FHZA 4IOKA 2Y1CA 3HDHA 4MRVA 4IRXA 1PZNA 2HC9A 4JJ8A 3B7GA 1L4NA 1X13A 2V03A 2FSVA 3OUZA 4R9NA 5HJ5A 3FSRA 1JR2A 1YK0A 4INZA 4Y18A 3TDMA 3W5BA 4ZYVA 1U2ZA 3OOJA 1E8DA 2VNKA 2GHRA 4HFNA 1Q14A 2C31A 2FFQA 2FWPA 3EA0A 4JLWA 3ENWA 3S2ZA 1TYCA 3BWVA 3DOJA 4ZRMA 1DADA 2PKYX 4L0MA 1YB2A 2OD9A 4P33A 5HQTA 3A6ZA 2PUFA 1T8TA 3NDJA 2IHVA 3JQFA 1R7RA 1KPHA 3L4SO 4OEHA 4IDNA 5I5GA 1QB8A 1D2HA 3RSCA 1Z5VA 3LPMA 4G5RA 4UNSA 4Y1RA 1LPSA 1YVRA 2VPZA 2VPIA 3BX1A 4I99A 3S1AB 2JCGA 3GUCA 3KV1A 1I7PA 4R51A 1NW9B 4IR7A 3D5QA 3I42A 4J4HA 2ONZA 3ZCQA 4BFCA 3H9BA 1S2LA 3H84A 3O8OB 3UPUA 4UTZA 2C9MA 3U9LA 4PHCA 1Q7GA 1EAMA 5DM2A 1NLUA 3RJ5A 5KDOA 1NP6A 2X5KO 1T35A 4JJGA 1E6EA 5DN9A 2AI2A 3N8NA 3DMDA 5GV8A 3UZUA 1YS9A 2VF7A 1RXSA 4R41A 5DB4A 4XR4A 3DZDA 1IK4A 1FNDA 1XL0A 4XX1A 4F4IA 2XKJE 2ZXFA 3F4LA 3PUWA 1XWIA 5JQGF 3HR7A 3QPBA 2XR1A 4J8PA 4UPVA 4ZHQA 2AB0A 4KWTA 3EZXA 2C4HA 1TQ6A 3HNPA 3WGJA 1JXMA 4WFIA 3B8HA 4FUQA 4RVCA 4K9QA 3IQWA 4BMVA 3DVAA 3W3ZB 1OOEA 1BN6A 4IH9A 2OG1A 4AU1A 4BPRA 2B4AA 4P08A 1EE2A 4D9CA 2QKYA 4R2KA 5E4YA 2G0AA 5IK2A 3OQMA 1ODLA 4LMAA 2O8EA 1A3CA 2O0HA 3D2LA 1FNCA 1G4UR 3VNBA 1EZZA 3T1YB 3GUVA 3A37A 4D0SA 2B1IA 1VSUA 5EIBD 4M6WB 2G8LA 3UPDA 4DSAA 1L5ZA 1Z22A 4HNGA 3NATA 2PDAA 1TA4A 2OBBA 3FPAA 3G79A 4DSNA 1HT2E 1WDMA 4RC9A 1ZJ5A 2IYWA 2YVLA 4G4GA 2FPPB 1M2VB 1I0ZA 3IT3A 4XSGA 4N0PA 2DETA 1A04A 5H9VA 2M9MA 1E92A 1TD9A 1OXMA 4I50A 1CPYA 3DAPA 4D6PA 4CU5A 3JQBA 2VDRB 5HP4A 1KE2A 2DB3A 4FKZA 1QOQB 3QYJA 3EZ6A 5DHSA 1EH5A 1XZLA 3I3SR 1U7ZA 1DAHA 2Q6OA 5CFLA 1MJNA 3KVYA 3AB3A 1H4SA 3AR4A 2YQ5A 5KSYA 5EOVA 3J81k 1AF7A 4ZAXA 4DUPA 4LZWA 4L3WA 3CTMA 3RTDA 4TRRA 2ZYGA 5FUMA 1SEPA 3CF6R 3FFBA 4EG8A 2ZUTA 2D5AA 5JWRA 4AKGA 2YW2A 1XFAA 2QNIA 5B55A 1RD4A 2DFNA 2J0UA 3I1JA 3OLZA 4KSCA 3OIUA 5LZ5A 3T9CA 2R84A 3EA5A 1UT6A 2W4IA 2H4JA 2JIQA 3CGGA 3WOHA 4CM1A 5ALLA 4HRYA 3Q3JB 5BYAA 3L4KA 2XB8A 2CK3A 5HA5A 4JA2A 4CMAA 1ND6A 1H2WA 2CKMA 1WF3A 2YXDA 3LKDA 3IHWA 1LPBB 3W79A 3K09C 1JKMA 1SC6A 2J31A 3B3QA 2Z43A 2GBGA 1ESZA 1WG8A 4B4VA 3PZBA 2E0IA 3HCNA 3E8MA 3R75A 1HSOA 1U4SA 1N8SA 1R6BX 2AX4A 2W93A 1L3CA 4XUGB 5A3RA 1WNFA 3D0RA 1EK1A 2WU8A 1DVRA 1GXSB 1XAIA 1V6AA 3OPYB 4QBGB 4QJ3A 5A0FA 2ECQA 1E1MA 1JLLA 1Z08A 1WUYA 4AY3A 4DVGA 1WZCA 1P17A 1YQWA 1DKLA 2Y05A 1V2GA 4KVFA 3GH1A 3RV4A 1UBKS 1ISSA 1GQYA 4MV5A 5FPQA 5F98A 4URFA 1FPMA 1NT2A 2HV9A 4I2VA 1A4XA 1A71A 2LIVA 3DMNA 3AKYA 4Y2GA 3MA0A 3V1NA 5JNUA 1TJ5A 3DD1A 2DKNA 5C5EA 3GLRA 2JVKA 4GKJB 4OQZA 1MV5A 2FN7A 4MHTA 2M6LA 1WPRA 3TPFA 5FD8A 3DXFA 4AY2A 1UKYA 1GUAA 2BMVA 2Q6VA 4DMLA 3Q7RA 1BIFA 2EKDA 3NANA 4J43A 3C2QA 4LTNA 2PKWA 1T2UA 4PG7A 4IJWA 3R3YA 1YR1A 1MABA 5FWNA 1GWNA 3NAQA 4GOLD 1VKJA 5DLYA 3W7BA 1N6OA 1POXA 2BV3A 2XMGA 3DO5A 2OZPA 2J30A 1TI7A 2EP5A 2DBYA 4KXUA 4NEHB 3AM4A 3HKEA 4BVHA 4EHJA 1JEQA 4ZV7A 1A4IA 2GDZA 1VB5A 1O6BA 2PLWA 3GQBB 3Q5DA 1JEYA 1Q20A 2IW3A 2YN2A 3EXIA 1KDZA 5JNWA 1L1EA 1QH1B 1JHQA 1W1WA 2PH5A 2ZSJA 1RVDA 2V55B 3PR2B 4IXNA 3ZH9B 3L3BA 1JS1X 3ANTA 4JSRA 7GPBA 1NP7A 2W58A 3PKZA 2OECA 2G08A 3K3PA 3CF4G 3LUGA 1WPQA 2WTEA 4X7BA 2JFWA 3VPXA 2GDJA 2QM3A 4DSUA 4ZT5A 3SEFA 5JRJA 5K8VA 1VHWA 4DCVA 4ZOEA 1AUXA 2NN3C 3K70D 4UEQA 3K0HA 3PD1A 4Z9AA 1K66A 4UXJA 2HGSA 2NUPB 1T0BA 5E0KB 2OCLA 4EJFA 1PKXA 3MUEA 2OM2A 5DYGA 1JG4A 2VNHA 3I12A 2C3YA 3ZD7A 2VP5A 1SIUA 3TRHA 1E2EA 3HNOA 4LKOA 4BNHA 3IP8A 4ZTBA 4DR3B 2VZ9A 5IAGA 1A2OA 5AXCA 1II0A 2JVIA 3TR0A 4W5QA 1Z68A 2CDRA 3M6VA 5AOCA 4V38A 1FTGA 4KR2A 2W4MA 1NSFA 1ZESA 2Q1SA 2ZBGA 1L5KA 4MOWA 2P67A 3DQQA 3OTIA 4HDQB 3TLCA 4B83A 1J8QA 4I14A 2X0KA 4ILKA 4TV9B 4N0MA 4BVJA 4XX0A 4C6TA 1NVDA 1IMJA 3PQ4A 5CJ2A 3DMFA 3KKLA 1KZ1A 4NAVA 2YZGA 4F5DA 4R5MA 1NQUA 5HF6A 1EWVA 2H9YA 1F5NA 2QNRA 3I5MA 1N25A 2A94A 1J2JA 2XT6A 5FWXB 4RZUA 3ZY5A 4BX0A 1Z2AA 4QT4A 1KMCA 1IUNA 1N3BA 3A4YA 1F51E 1PFUA 3E9CA 3PJDA 2CE2X 2P30A 4KLZA 5CX1A 1FW8A 3E3LA 1DELA 3O4RA 1K5GA 4UTRA 5ANRB 3M49A 1PV4A 2WJ3A 1TPZA 4LZJA 5JXIA 1XNQB 3X1ZA 3FPSA 3C3KA 4C01A 4OQNA 4PSAA 1RYMA 1KOGA 2R6R1 3OFKA 1GTVA 4FN4A 4JEMA 3CN7A 1WIWA 2QJFA 3O8QA 4GGOA 1RI2A 1TAGA 1ZSNA 1KFJB 2DWCA 4LSMA 2OFPA 4O4HA 3FVTA 4OXIA 4AECA 2WZCA 2UXDB 2QPOA 2GPBA 1CJCA 3FB4A 3L8DA 1PLLA 1RAIA 4TMYA 1MJFA 1Y5IA 3GEPA 3KVNA 3VYWA 3HWWA 3PD7A 3ZLTA 4AZWA 4ENVA 5I3CA 5DNYB 1VL2A 4OHYA 2EW2A 5FYDA 3OOYA 5JEEA 3HZOA 3DBLA 3LUFA 2JGDB 1F6DA 1C8LA 4NK4A 1ACLA 1ISPA 3MBOA 1OFIA 4R9VA 3TYXA 3RT7A 4XGQA 3JYHA 1N8NA 3FNQA 1MLDA 3CS3A 5K01A 3N2KA 5FLYA 2K2QB 3IRUA 5HX7A 1SCQA 4ZVQA 3RRMA 3JQPA 1IY8A 3AYZB 3K9GA 1J90A 1U28A 2ZI9A 4JR0A 2Z1MA 3QPAA 5KDLA 1YL7A 4YMTA 5BQPA 5JJBA 1E4VA 4JBLA 3T52A 3I8OA 3SLGA 4CUJA 2PY6A 9MHTA 4UVGA 1VSVA 1UJ6A 2H0QA 1CWUA 1DARA 2O3SA 2RHGB 2SNIE 1JIVA 3CLUD 3KOZA 3HCEA 2PL1A 3KYCB 3PEFA 4L8FA 1F4VA 4AUMA 3EXFB 3NDBB 1RFGE 2BKXA 3IR6A 2J6HA 5DT2A 4YT8A 1KJWA 4R6XA 5JANA 1H42A 3MTBA 4PM4A 4RVFA 1G20E 4X91A 4DMHA 1XLVA 4QQ8A 1TZJA 1H8HA 3NWPA 2WKRA 4X7RA 3ZN2A 1YZKA 2HPHA 3MWJA 3FMIA 2ACWA 4E14A 1CUEA 3BGIA 4HH1A 3PDIB 4MVJF 5A3VA 2VRNA 2ZE5A 2JIOA 1YS7A 1LNZA 3KJIA 2UZ0A 1NDQA 3C6MA 3GEEA 4JCCA 2BGMA 4O29A 2ZJ1A 1R10A 3CHYA 4NH0A 4OLFA 5JZVA 1MT3A 3VBEA 1SR8A 1MPTA 1AKWA 3LUHA 2DFVA 3AM5A 3RUIA 4Z3KA 4FIDA 1PQWA 3FUVA 3KQHA 4JBNA 1YTUA 4BTVA 4G1UC 3KLPX 1XWFA 3QMVA 3ZYZA 1G9SA 4S1VA 1JG1A 2P9BA 1ZH4A 5DTQA 1TVCA 1VJTA 4IHKA 3V8VA 4LVNA 3TZQA 1U5BA 5JJIA 3FYDA 3AF4A 4M7RA 3GLIA 2CB0A 4TM8A 4ENQA 1I94B 5CPBA 1EFVA 3IIKA 3T9EA 3H9JA 5IAJA 4DA7A 5HKAA 4WRRA 1A5TA 3CJRA 5KNCH 3B3FA 4YP5A 5TV2A 2BVNA 1QIHA 1YOBA 3AW9A 4HPXB 4UTXA 5F1YA 5A2GA 2AS0A 4BMDA 3NHWA 4TMXA 4YIHA 3GJQA 2Q45A 2PJZA 3TNLA 3GFGA 3CFYA 5FLXA 1K2WA 4Q7QA 2C1ZA 3E22A 4B6EA 1Q3TA 2HL6A 3JYQA 4HTAA 1EI9A 3TE6A 4JT9A 1V16B 3HUEA 4IILA 4K6FA 4Q4LA 3I9OA 4TKMA 3ZHRA 4P3PA 4YRNA 2OMEA 4XXHA 1B3RA 2QRUA 1YB5A 3ND7A 3OLVA 1JXOA 3D6AA 3A3KA 3NC1C 1HLPA 3GY0A 3AUXA 3DAOA 4AYXA 3JYLA 4GPD1 4AQ7A 3VZQA 1JFTA 1NUSA 1W94A 2WAAA 1KWKA 2CNKA 5FOUA 4LV5B 2W6JD 2CDCA 4DDHA 3C7DB 4R81A 3N07A 4YR9A 2X42A 4DCNA 1IHOA 1M8JA 1ADFA 1KPIA 3OZSA 1YRHA 3KE8A 1X1DA 1O9HA 3CF2A 1VSBA 1Y4AE 1ZUD1 4M7PA 3TQCA 1GGVA 4DZZA 5J4VA 5KNBH 2GLUA 1RP7A 1DRVA 2OILA 1GPH1 4J16C 1TFUA 4X7PA 1U7HA 4QVIA 2EF0A 1GUFA 4C04A 2Y0EA 3N3AC 3IDOA 2V6FA 5M7EA 4MQEA 3NM6B 4OXYA 3R24A 5EIXA 1QYVA 1NMEA 2PV0A 4XIIA 2QMUA 4LA4A 4HDOB 1NOIA 5CK4A 3ZY2A 3LXRA 3PDUA 1AZLA 1NVEA 1KEWA 2BM8A 4P31A 5CB4F 3WWEA 3O94A 2XWJI 1F4LA 1E2LA 2V96A 5JVDF 3L8YA 1R2QA 4X44A 5HS4A 1SWVA 3GVIA 3KXPA 4OA8A 1A8SA 4J3NA 3L8HA 3UMFA 4QZVA 2FPLA 4Z49A 1J0XO 4O8ZA 5J58A 1O97D 3Q3IA 1WDKA 5K0EA 2OBYA 1Z33A 4MIYA 3H97A 1ZXBA 2JFNA 2QV7A 1JI0A 4RK4A 1Q7CA 3B1FA 3PHJA 4JR1A 1CW2B 5LYJA 5FUXA 5BV2P 3LNTA 3CLSC 1R4MA 1JTEA 1XAJA 1AQLA 4ER3A 2VLIA 3TGLA 3RYFA 3VH2A 3RR2A 3IDQA 2VO1A 1RHRA 2NO0A 2Q3DA 2A0KA 3H6GA 4WOCA 4ZTUB 3PBKA 1ZGZA 3KV3O 4RD1A 1R0RE 2B3DA 2FUEA 2HIAA 2PG3A 2EU8A 3F6PA 1Z5GA 3CZRA 4DABA 2OPBA 1HL3A 4CEIA 1TDJA 1BDHA 4D26A 4JJFA 4MZXA 5TE9A 3LMKA 1N2CB 5F1PA 1XHLA 2QHXA 1TC2A 3FCXA 4TMKA 4UCFA 3SZGA 2QUJA 4R3NA 2HLDD 3BMNA 2O0KA 5DK4A 3FI0A 2A9VA 4FFNA 4EZBA 4Q6BA 2F7SA 2VJAA 3JXEA 5BXQC 4LMRA 2F2TA 1ADYA 1I9GA 3EA4A 5IZ4A 3LZCA 3DAHA 4MSUA 4L4XA 1CUWA 1LVGA 1EQAA 2GR9A 3MHPA 2ZIEA 1SHTX 4H3KB 5AWFC 3S6JA 4EYGA 4RPLA 3VZSA 3OLWA 4FCVA 2GKGA 2ZKLA 3F5QA 1PEDA 3FTEA 1TAUA 1P2SA 3IUYA 2IYXA 4GQAA 5HS6A 1MRSA 3UMSA 5BN3A 4CUZA 3ZHXA 1X9IA 3W9BA 4AO7A 5KQPA 3TLZA 2Q8NA 3LQ2A 1A9XA 2JLZA 2C4WA 1XUOA 3GLHA 1FEZA 5DGXA 3DCYA 4MP6A 1HT3A 1B43A 1CZOA 2HMYB 4TXJA 5E0OA 4R3UC 4C2BA 1PFQA 4C3OB 4YJFB 4QUGA 3D8NA 3V7NA 4MVJE 3OQIA 4HX5A 3EASA 5ULLA 2YHIB 3ZQJA 5FP0A 1NR5A 2L69A 2ICAA 4KQCA 2R7AA 4P7GA 5EZYF 1XCBA 2H7YA 2ZUBA 4EKDA 2NV0A 2GJ9A 5JXWA 2G7ZA 5CITA 5MGNA 2VHEA 2XTNA 3LDAA 4O2BF 5CM9C 4WCFC 1ZIYA 4K1LA 1JW9B 4MPTA 4OQYA 3ET4A 4ZO4A 5FBQB 3WYEA 4CM8B 2A2ZA 2O2YA 4DR5B 2IZOA 3DV0A 3ENKA 1HZJA 3NTOA 2X8BA 4WHMA 1U1DA 2WMYA 2ZSDA 4WCVA 4C4YA 5KYNA 3OTWA 4ZMSA 4URXR 3X43A 2VI5A 2FN8A 3M4XA 5AOVA 1ULHA 3G8AA 3SKXA 3KQWA 4B6SA 2JEOA 2G80A 5E6UB 1OPRA 1HQKA 5E1MA 2D1YA 3PE4A 1RM5A 1XA3A 5H02A 1GY8A 4J94A 1M34E 3ENVA 3UGTA 6NULA 3S5JA 4HH4A 3T4XA 1TK2A 5IVKA 1H22A 3BRSA 4KR3A 4P8RA 4NH4A 4BGUA 1IG3A 2A9QA 2X41A 1ZOSA 3CX8A 3PHCA 1GFWA 1Q1QA 3F6SA 3KYIB 1PGPA 3GJ6A 1JQKA 4LX8A 2Y4NA 1WZ2A 4AG6A 4EJ6A 2JARA 3CJQA 4Y6SA 2K87A 1NXTA 3CY6A 4LBZA 4CLOA 2JRLA 1VLMA 1ZP6A 4MHOA 5AIBA 3QJGA 1CQXA 3CNHA 4YJGB 2FX3A 4JJ4A 4EH1A 4F3RA 4NG4A 2PFGA 1VBFA 3CEPB 1NYTA 4DG5A 1JB9A 2ZKIA 4UMFA 3IKTA 1GTSA 1JWAB 1ZHHA 2Q3EA 1WXGA 2VKQA 3M6MD 4OJQA 4QDTA 4QO7A 3KU4A 3VAAA 2HCFA 1T0IA 5ESDA 1H5NA 2DR3A 4FFVA 4RDCA 4MLCA 2XTZA 1NA5A 4R2IA 4R2JA 3WGUA 3E5NA 3QG5A 4HDNB 4B3TB 5DGHA 3L93A 5K0CA 2IHTA 2UZ1B 4Y67A 1EFRA 2XMRA 1F7VA 2FSUA 2B9VA 3FNBA 1EK0A 2FGJA 4YAJA 1USUA 3VNUA 2HMAA 3BVPA 1HKHA 2WT4A 3FDFA 2MU1A 1U3UA 3LX6A 3QWFA 4WDRA 5A5GA 5CVDA 2CV2A 1XMXA 2WIFA 1DPGA 2I3BA 1GZSA 1L4FA 1H9CA 1I1NA 3ZUPA 1Z0FA 2H3HA 2Z5GA 3MJFA 1WKVA 2R1VB 3P9PA 4M9UA 1R8JA 2P6RA 1GNRA 3AUJB 4E2FA 4ILEA 4M1MA 4NU0A 2ZVPX 2EGGA 4F9TA 1N9ZA 1R3UA 5JYDA 3HSKA 1YH3A 2Q9BA 3FSGD 4K87A 3V8RA 1CJTC 4RA9B 3L01A 4D3FA 7REQB 1XCOA 4HLUC 3DMGA 3WGZA 2J08A 5J4HA 4RPCA 4F2DA 5M2QA 4IOJA 3GVPA 3FKQA 3BKWA 3SBDA 4A0FA 2B94A 1G0OA 2YMQA 4B4OA 5HJ2A 1RRGA 5K3BA 3F4KA 2I54A 4HEA6 4XWGA 2FEPA 2ENUA 3DWIA 1RWVA 1T9HA 3KJXA 3NHRA 3NNSA 5DX1A 3BB1A 4NBUA 1WBJB 3GGPA 3ITDA 2RHBA 4K2AA 4C1BA 2JD0A 4XGRA 1A97A 1U65A 2EDAA 3P96A 1J24A 4U7GA 3DLAA 4JLKA 5FJJA 1XRJA 3SYNA 3UK1A 4AIRA 3MFQA 1XPJA 2OHGA 1KSJA 3GCWA 3KAKA 1YU6A 3WRYC 1SHJA 721PA 3DFZA 3TN7A 4QOSA 1YCGA 2WTBA 2PD6A 2NLOA 5CNKA 3H5LA 3P9YA 4Q1CA 4WACA 3ZI0A 3CH7A 2QTVB 1ZMOA 1V11B 2QLMA 3GQVA 2IPAB 3LWZA 3NP9A 3Q2IA 4NZYA 4R6WA 1MG5A 1IY0A 3CR8A 3ILYA 4MS1B 5JCXA 1XX6A 1Y8AA 1GT6A 3S8YA 5E8JA 5K3FB 3SBOA 3W1VA 1G7TA 3WNZA 4B43A 2J87A 3EMBA 1IAVA 3FTCA 5HBRA 4J6EA 2DTEA 1I4WA 1AU9A 5JH7A 2Y1XA 3GFBA 3L6OO 2VIIA 3DF9A 4JOCA 4FC7A 4N49A 3B9QA 3ZDZB 2V59A 1XKQA 3V4PB 1OXUA 3GFSA 3P4UA 2FG7C 5D51S 3RRBA 1WHTA 3VRHA 2X6TA 1WAMA 4ZOLB 3O83A 4M83A 2ABWA 1Z74A 3QNMA 4XZ3A 1W19A 5I8WA 2FAXA 4CL0A 2CJWB 1YQQA 1DU4A 4LJAA 2N46A 4XQCA 3VJRA 4KNYA 3AHCA 3SSAA 1ECFA 2FK7A 2YJZA 1GCAA 2ANBA 2FEXA 2NVWA 2DC1A 4GX0A 1YJXA 1A72A 2BUBA 2C5LA 3JD4A 4M46A 4G5XA 4HUQB 4DC1A 3IX7A 4EYQA 5HM8A 1W49A 3AHJA 4O25A 2QTCA 4W99A 2VYVA 3HCOA 4J0FA 4Q9JA 2VEDA 3DEFA 2VWGA 5C1IA 3H5IA 5T4FA 5TJ9A 3VPGA 3WYFA 5BV0A 5LSAA 2G1JA 2OQVA 2BGNA 5CX4A 3VYRB 3GGCA 5IT4A 3ZXYA 1SVWA 4IIYA 2B4TO 4MVXA 1KYWA 2PD4A 5HE9A 4CEHA 3VV2A 4ON9A 1Z8NA 2VRBA 1ETHA 4U2CA 1FFBA 3S2FA 3T7JA 3UAYA 3Q6MA 4H6XA 1IG0A 4UU1A 1NLMA 4QUHA 4Q3EA 5IBPA 3KP1A 1EFTA 1J1ZA 1TZMA 1PZFA 3HBAA 4KIFA 1GEEA 2VP9A 5THXA 4PINA 4XI9A 4B85A 1MN6A 1U8XX 2JBAA 2JCVA 2ORYA 2XSZD 3HA5A 5COBA 3G17A 5DTEA 5KQSA 4A1OA 1EG7A 1ULBA 4W5WA 4EW1A 3OZFA 3GP3A 3TW8B 3A9SA 1CF2O 1J2UA 1IEXA 4INOA 5EKDA 5EMHA 2D62A 2X15A 5E9AA 2AOVA 4D45A 1KGSA 1W1UA 1EB8A 5JBIA 2E87A 1P73A 2C78A 2EVWX 5CVCA 4WX2B 3FTNA 4WXPA 4Z7NB 3EGDA 3OU2A 4CMIA 4YJ2A 3KKZA 4V2IA 1NW4A 5GQSA 1JFFB 4EQ6A 2HCTA 5KYXA 3QTBA 2YS6A 1P7YA 4Q21A 4M0PA 3WO1A 2C4VA 4ZAZA 3P9RA 3UK2A 2E4VA 1K3UB 5F64A 3HFRA 4HK4A 3LHDA 2PQ0A 4LVCA 1XRNA 5EP2A 4OB6A 5CT6A 1B2RA 5F12A 4HRXA 4RV9A 1QJ4A 2XMZA 4OBXA 3ZE2B 5J2TB 4R1UA 3VU9A 4JB8A 5E3JA 2YNMC 3RKSA 2WE8A 1G3QA 2Q0QA 3RC1A 3ZOKA 4GMGA 3ZDYB 4DMFA 4H7KA 2RGWA 1UWLA 1LB1B 5AI0A 1DJQA 3WL8A 2QTRA 2EBFX 4YFVA 3IOCA 2WHYA 1CUDA 5KSZA 1HYHA 3MXTA 1MAUA 3GFRA 1SU6A 5EFZA 1PYOA 4EKGA 3U61B 1NXSA 2PL9A 1ZAYA 2J6CA 3O2SB 2UUOA 3RT9A 5LXTB 3PCTA 4G1BA 1GQSA 2FRVA 4PX5A 4DANA 3PGLA 4F1WA 3TLGA 2VTBB 3AF3A 4ALIA 2QTNA 2Q29A 2POQX 3HL4A 4K9NA 4YASA 3UJ6A 4DJFC 2WRZA 2XUZA 2P68A 2ZCVA 3UMYA 4EW3A 3IKJA 3DTTA 1VHLA 3DE3X 3OP4A 2X5JO 4MVJG 4MWZA 4WK2B 5H83A 4FQ7A 4LNUA 3NYQA 4XCQA 3STHA 5LQRA 5CLQA 4DARA 1Z2PX 3I5XA 3BXHA 4F9EA 2I7TA 2XAUA 1RW4A 5EWLA 1ADGA 3SDBA 3DDWA 5K6AA 3PC8A 1JV2B 1XTTA 2YCLA 1ZICA 1PJ8A 1P9OA 3BJEA 3WSTA 4EF5A 1BDMA 1BG6A 1E2FA 1L3BA 1OUMA 4U5QA 3OFND 4AQYB 4E2ZA 2DEUA 3DOUA 2PT9A 4MV6A 4Q3LA 2C4KA 3A0RB 1R9JA 3IQIX 4F97A 1GDTA 1SQ5A 5DSZA 2BR3A 4MRMB 4TYPA 3TVDA 4C78A 3IIMA 1WMDA 5A7GA 4MUEA 4NZ9A 5LZ4A 4G0YA 4MW7A 1EX6A 3NFYA 4KXWA 4NR0A 2UYCA 3UCXA 4LQ4A 4YDQA 5I6DA 4EPWA 4PYIA 1W85A 3DXZA 3VHLB 4G07A 4ALKA 1R88A 4KXLA 4LFAB 3Q0TA 1P19A 3TMAA 4NOKA 3ET5A 3VVMA 5CA1A 3NTQA 2P69A 4P5PA 2O0JA 3V4OA 1PFWA 1Z07A 4M60A 4KQJA 2PBRA 4RD6A 4F71A 2QSZA 4X85A 4N03A 1FUUA 2JJ2A 4MUHA 1CZRA 2V7TA 1Z7WA 4HQ0A 2FRDA 3IRVA 4Y1RB 3RSLA 3UV6A 4F85A 2PWPA 2X5XA 4X61A 5A4DA 1R5NA 4UBOA 3BWYA 4R40A 2JKZA 1W4AA 2HPAA 5K8TA 4ZVNA 1BFUA 2PGNA 3PDCA 3TDKA 4EY4A 3A7DA 4PBTA 1QQBA 1AF4A 3EVZA 4IHJB 1HWYA 3K73O 1E9EA 3QMMA 4PFKA 5TC4A 3SP1A 5LQDA 5T8KA 1N7JA 4OMUA 1XEWX 1ZZGA 3KIPA 4H0NA 2DPHA 4BLSA 1YVEI 3CVWA 1ZJJA 1FFGA 4MVJP 1DAIA 1KRHA 2I6TA 2QOEA 2XUAA 3H99A 1DV1A 4BVLA 1N1EA 3LLMA 4YAUA 3IE1A 1TJ3A 2I3GA 1KZ9A 2H8GA 1BMFD 2R8OA 3PS9A 4UAUA 4CLDA 121PA 2P3SA 2HJHA 4GS5A 1XZPA 1WMAA 2C4UA 4KRGA 4WOBA 4E2WA 2EJVA 1U2EA 1HO3A 2BGRA 5U9CA 4YRDA 5FNVA 2DU8A 3KOOA 3BL6A 1EHYA 4EVIA 5KYWA 1ZI9A 3K7EA 4G0VA 1X7GA 1YMVA 4BVKA 5HCIA 3KXKA 2C57A 4R5HA 1CR1A 1SOUA 1UQTA 4ZEXA 3E3AA 5LDDC 2PMCA 3WGTA 2PJRA 4ZI7F 2NV2B 4K6OA 3M2TA 4NPHA 2NQTA 4ND7A 3W6NA 1ODTC 1PAUA 2HDOA 1HFEL 2F90A 2PFSA 2HSDA 4XD7A 4C7KA 4YRBA 2YV3A 4JT4A 3USCS 2CVOA 3VH4A 3RGGA 5BRJA 1M72A 1TUEA 1IZ8A 2ZWVA 4KMRA 2Z2ZA 1L8OA 1URPA 2QM7A 4A91A 2YCBA 5C8DA 2WUVA 1R8QA 1TLFA 1D4OA 1M33A 1L5HA 3A4LA 4IO0A 1FLVA 1G2QA 1JQEA 3QZUA 3L0ZA 4LCBA 1E61A 1IBSA 1LY1A 3KAQA 1GPKA 4HZIA 3THOA 2C8LA 2A84A 1ZC4A 2FEAA 2XGOA 2PXXA 4WMLA 3FMVA 1U1EA 2RI6A 1GTL1 3QKTA 3T1OA 4PLFA 3F78A 1ZH0A 2WICA 4RESA 3R7WA 5B3KA 3E5RA 4UASA 3THRA 3GFOA 2Y67A 4GBJA 2Z2IA 3H11A 2VP3A 3PFIA 3EQ2A 4KFSA 4GVPA 2J0UB 3QVJA 2RHHA 4F8EA 5DM70 1VTKA 3OWHA 1W4CA 4KE8A 3LYUA 3AI2A 2LRHA 3DLIA 3GEBA 4MI3A 1OAOA 4QOHA 1IRXA 4XGNA 4F93B 1M2HA 4WVLA 1JA9A 5C3MA 3OJXA 1Z37A 4GVXA 2P6MA 1G6HA 2R1UA 3BJZA 1Y9JA 3NS7A 5GZ6A 3U3ZA 3WY9A 3G5UA 3UOAB 2GM3A 4Y6LA 2RGUA 2BMEA 3HEBA 4ECEA 4LDAA 3MJHA 3HGTA 3R5HA 1JU9A 4HGNA 5MN6A 5INTA 2VHCA 2VNJA 1FUYB 2WBLC 2XVMA 3CKMA 1DLIA 3UKOA 1HG1A 2BI8A 2MSCB 1E6UA 2Q62A 5CR9A 2W22A 2Z56A 3C8UA 3WMWA 2JHPA 4EYKA 2GOYA 4UULA 5KBYA 4IGFA 1IY1A 1KQPA 1TKRA 2NACA 4B8YA 3A1VA 4EPVA 4IPTA 3RGWS 3IAS1 2FMKA 4EJ2A 1UPTA 1LPOA 2JK1A 4FFMA 5AW1A 1X3SA 3PRJA 4IUBS 1KY2A 4V3CA 3QBVA 5E8RA 1E64A 4KZKA 3UENA 3R0QA 1RHKA 2DE0X 2QORA 3F0TA 4RKYA 4DY4A 1GTRA 2ILVA 1XJQA 4J90A 4J49A 1H0RA 3GAAA 2EX0A 4CR6A 3UXMA 2PYDA 5CFOA 1XP5A 1MABB 4PLTA 3QFCA 3S5UA 2JJQA 2F9MA 1WW2A 1TA9A 3P2IA 3WK6A 2Y1LA 3PGVA 2KS6A 1GAJA 3QEOA 4HXYA 2ZS8A 3RVNA 1M1YE 4ZV4A 4DR4B 2FG6C 4YXWD 1RAEA 2VK4A 4N76A 3FYSA 1UJCA 3C3XA 4FHGA 2P1DA 2VH5R 1ZYUA 2IS4A 4N3NA 1KYVA 3CRRA 4PBSA 3P52A 3HKEB 4RH0A 5KTRA 5TQ0A 2HU7A 3DMTC 1M2WA 1PQ4A 1VPEA 1X8XA 3KLBA 3OQJA 4FFWA 4GAEA 4LSWA 3ZWPA 1JEYB 5L8VA 3SVLA 3TB4A 1P4HA 3JD1A 3IDSA 5EJ2A 2Y9MB 4WLOA 3GFQA 4JXKA 2ZEJA 1L1FA 5BWCA 2QW8A 4U39A 3OHMA 3WOVA 3WNQA 3WBKA 2HREA 4NZMA 3FGNA 3QQ5A 2PR7A 3OPQA 1Z13A 4MIOA 1L5WA 1S1MA 2AHRA 2BFDA 2IYLD 2CD9A 1G8AA 1ZDMA 1W4LA 3IPYA 4BASA 2Y3IA 1K92A 4ZCPA 1C9DB