2QAGC

Crystal structure of human septin trimer 2/6/7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
282
structure length
224
Chain Sequence
ANLPNQVYRKSVKGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSTVQVEQSKVLQLLLTIVDTPWQPVIDYIDSKFEDYLNAESRNRRQMPDNVQCCLYFIAPGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPLPLAVVGGRQYPWGVAEVGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, structural protein
molecule keywords Septin-2
publication title Structural insight into filament formation by mammalian septins.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 224
sequence length 282
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qagC00
1NN3A 5AJWA 5FUWA 3W90A 1FOEB 4BZXA 4D26A 1P62B 2H8KA 2QQEA 1RC8A 1NNEA 1XRJA 4QG7A 4CEIB 2IS2A 1QHGA 2FFHA 5K8UA 1KZ7B 4WZBE 1XFAA 3DPUA 1VCMA 4JLBA 1UEIA 5KDLA 4NP6A 5JJLA 3KFVA 1J2JA 1XDBA 4EFNA 2J87A 2WSSD 4XTCS 4YQFA 4UXIA 4LBVA 1VIAA 4IOLA 2D7DA 2DBYA 5TB5A 1G1MA 1ZYUA 3QKRA 2OLKA 3CX8A 2O0JA 1UKYA 1J99A 2Q6TA 3HWSA 2FFBA 2ZRFA 2YHSA 4YXWD 2MMGA 1XZQA 1KO8A 2AN9A 4ZIRB 1GAJA 3BS4A 4OK3A 3AH8A 1K5DA 2FU5C 4EPTA 2CHGA 2JDIA 2HUPA 1ELOA 1S3GA 1FW6A 4Q9IA 1SULA 1YZKA 1P60A 4WAUA 3ADCA 3Q7QA 3UXMA 4LRWA 4QC2A 1KI8A 2VSOA 3AKDA 4URUR 1GRQA 4L9SA 4CRWB 2ZAMA 4XSHA 4Q7MB 3I62A 2NPFA 3VKWA 4KFRA 4M9XA 4MRVA 2XB2A 5DYIA 2IUUA 2P6UA 2G0TA 4RD6A 2IYQA 4OJQA 3U5ZB 1KSHA 1KK1A 4UQOA 4DRZA 2RCNA 3AKEA 2ZS9A 2QU8A 2FEMA 2YINC 2IYUA 4IKEA 3P32A 4V0LA 3NBFA 4B3FX 3C5HA 4BFWA 4DDUA 3PUXA 1DE0A 4Q1CA 3T1VA 1LW7A 1S4QA 4YXWA 3X1XA 1H65A 1M7BA 4LHYA 3RS4A 2ZU6A 1S3SA 2ZRKA 4UKDA 5JJKA 1G6OA 2ZRDA 3QQ5A 2DWOA 4RD1A 2OCPA 4PSKA 3TRFA 3ZH9B 3TNFA 3LFUA 4UNSA 4DEYA 4O3MA 3B82A 1E2MA 2PT7A 4TLEA 1DS6A 1NBMA 4EQ6A 2XOKD 2A5GA 3QEJA 2QAGC 3JVVA 1KDOA 3U6KA 2XTNA 4EDHA 4Q03A 4JBWA 4U5XA 4Q7LA 3R9IA 1R2QA 1E2KA 2J3EA 3EZ9A 1II0A 1NIPA 2QPOA 3D6TB 4BFSA 2OFXA 3K8YA 4RCZA 1C1YA 1AIPA 2C96A 1CJVC 621PA 4MKHA 1FX0B 3THXA 3CX7A 1G3MA 1X6VA 1G21E 2F1JA 2WKPA 3FOZA 1E2NA 1MR3F 2RKOA 4HZIA 2WJYA 2CLCX 3MLEA 3BH7A 2ZYUX 4RVCA 3MWKA 3U2QA 2ODWA 4L9WA 5EE1A 4ZDWA 1OB2A 3RC8A 2XEXA 2ZRAA 3QUSA 4DLTA 4ZDIA 4NYIQ 2MSDB 2WIAA 4R9UC 1JPNA 2IK8A 1JXOA 3WMEA 1OT3A 2HLDD 4NBSA 1M7HA 4V03A 1TPZA 1JAIA 4B48A 2ONKA 1ZJ6A 1KI4A 1SVLA 3SDZA 4TMVA 1E99A 1TADA 3KXKA 4JJKA 1XXHB 1LF0A 2KB0A 3A8TA 1S9HA 1JBKA 3I73A 4PO9A 1XD2B 2OUKA 3A1UA 1AM4D 4HI0E 2CL7X 4KBGA 3B2EA 4LC0A 4XSGA 1L4UA 1NN0A 4EIWA 5AJYA 2Z83A 1AZTA 1JI0A 4JVSB 5EZ6B 2FG5A 3MJRA 2FNAA 4JLMA 1P73A 2WSMA 4TMXA 4KVAA 1N0WA 4A9AA 1IOZA 4FWIB 2R44A 2XB4A 3VR4A 4XH9B 3W9YA 1Q22A 2CCJA 1XCMA 4O2LA 3DZ8A 2RGNC 3FYHA 4V0KA 4TLBA 2X2EA 5BYKA 3K1JA 1XD9A 2ZSAA 3VQTA 2G6BA 2HYDA 2Z4RA 1G7SA 4IW3B 1OJLA 4LYHA 4DLSA 1II8A 1LTQA 4D82A 5FOWA 4QFMA 2IYTA 4LUCA 3BH6A 4MYHA 2GBLA 3I5YA 4F92B 1BH2A 1QHSA 5FH9A 1BS1A 1Z06A 5DNYB 4C4PA 2VP0A 3W6NA 4Q01A 3RAPR 1VYVA 1E9BA 2WKRA 2V7QD 4FMCB 1KAGA 2GEVA 1D6JA 2GESA 3F3YA 4OKSA 3FFBA 5J5CA 3EPLA 1T5IA 2R62A 3TE6A 4AWXA 1RYFA 1VG9B 3MSXA 1DAEA 2OESA 3N2IA 1HYQA 2XAUA 3O8CA 2Q3HA 1G5RA 2C99A 2VO1A 4NCJA 3GJ0A 2EYUA 4LC1A 3THWA 3LBNA 4KU4A 1M74A 2ZRHA 3QKSA 5KDDA 1NVVQ 4LYFA 5L3VA 5LDDC 5C46F 4NCKA 3DKPA 4RZ3A 3REGA 4TT3D 3GJ4A 2F3RA 3MG9A 3GFTA 4O25A 4S2EA 3X1ZA 5EE9A 1YZUA 4BFZA 4CZ2A 2GAOA 3NBZC 5BN3A 1E2LA 4BFTA 4WZAE 3FMPB 2GA8A 4B75A 4TMTA 2XX3A 3TVTA 3IQWA 2ANCA 4GOKA 1LS6A 2JJ2A 1E2GA 4DUGD 1XNJA 2CCKA 2NPIA 1LS1A 3LRPA 1PJRA 3VAAA 1HURA 3CRRA 4GDFA 1NSTA 2WM9B 4B2PA 2QAGB 2WPDD 2VF7A 4XVRA 1CR2A 1Z47A 4XVUA 1RRFA 3ND9A 5BN4A 3AF0A 2AWOA 1IY0A 3A1VA 4HSEA 3S1AA 1UFQA 2ZANA 4IDNA 4KYIB 4PZYA 3AF3A 1AQYA 2D74A 3WYGA 4F38A 4HLDA 2CVHA 2VP9A 1OFIA 2GETA 4LSGA 2REBA 3EPKA 3GLIE 2ZRGA 4OK6A 3CUEF 2VHTA 1E6CA 1AZSC 1NN5A 2EWVA 3MRSA 5F9HA 1GL6A 5DHFA 1Z08A 1ZM7A 4FINA 4TT3A 3AV0B 4ASUD 1VHTA 3ZLJA 3SOPA 1XPOA 1NSFA 2DFLA 4IFEA 1TU3A 3OESA 1P7CA 4JZKA 2ORVA 1AN0A 1P5ZB 1RPZA 1E2PA 2Z4SA 3KJIA 1KO5A 4ARZB 1W49A 3V4FA 4TYNA 3TK1A 4UJ3A 4BPBA 3TVDA 3LWNA 1CLUA 1P2VA 2BDTA 5JWHA 3U44B 3VR2A 3OFNA 5EJEA 4M1MA 1P72A 2FFAA 4YDHB 4C7OB 1XTKA 3CPHA 2GJ8A 1S96A 1W44A 3RS0A 1PLKA 3EPJA 5AR1A 4HUTA 4A36A 2FH5B 5KNCA 1NJGA 4R2IA 1SXJE 3FGNA 2F43A 3PG5A 2E87A 1GP2A 5TY0A 2OCAA 4C3ZA 4MITA 3U3OA 3TUZC 2WJJA 3CZQA 3RDPA 2RHDA 2P67A 4Q9HA 1KHTA 2E9SA 1EGAA 4WBSA 1WDTA 2FE4A 2V6IA 4RKEA 4ASUA 1AS2A 2FA9A 2QM7A 3QJYA 1FMLA 1YR8A 3I72A 1T8UA 4Q18A 4AG6A 3WNCA 2J5XA 2WWIA 1EG7A 4OI1A 3MAAC 3TSOA 1CR1A 4TZ6A 3QOFA 1XJCA 3U3RA 2EU8A 4KFUA 3QIAA 4II7A 2BHRA 4C0JA 2K5UA 4TTPA 2CK3A 2VF8A 4GL2A 2CJWB 3VX3A 3U3KA 1Z6TA 3NBYC 4NU0A 4I4LA 1UKVY 1IQPA 4BZPA 2JLQA 4WVFA 1Q1EA 3EC1A 1UADA 1G8GA 1MO6A 2ZITA 3PUWA 1Z0JA 4JL5A 5D3QA 3CIOA 1R4AA 2O8DB 3AVXA 5FI1B 1Z83A 5J47A 1RE0A 4Q9LA 2GXAA 2QA5A 4IXNA 4HLCA 4ESVA 4V0ME 3Q5EA 5SZIA 4IEEA 4BLTA 2ODEA 3SQWA 4TZ0A 3ZD6A 1C4OA 4M9SA 3H0KA 3ZYCA 3QBVA 1KTVA 2ZI6A 3CF0A 4D4MA 1Q12A 2NZJA 2ZRCA 2QP9X 4ZKEA 2ZUCA 5KHOC 3IPXA 5D3MA 1DELA 2ZIAA 3L2OB 1MRSA 5KPJA 4F7WA 3AEZA 3QXSA 4KYUA 3SE0A 1KIMA 1S2MA 2EFDB 3ICEA 1OH7A 5C1BA 4QBIA 1RFLA 1GIAA 4KLNA 1G3UA 5D3MB 2BM1A 2ZSEA 1AGPA 2Z43A 4MRPA 3TAHA 4C2UA 1VG8A 3SNHA 1S1CA 3Q8XB 1DADA 3TUJC 3LAWA 4HZUB 3EIEA 4FN5A 1T4GA 4PZLA 2GILA 4Q4HB 5G53C 1KO7A 1E4VA 3RWOA 5JI2E 2IEYA 3L0PA 2QBYB 1AJEA 3Q3JB 1X3SA 2P65A 4PR0A 3KKOA 3B9QA 1NVXQ 2OILA 5JJIA 3I32A 2PLRA 3SBDA 1HT1E 2IYWA 2DB3A 1NVUQ 2FOLA 3OE7A 5AUQA 1NL3A 2B6HA 3X1YA 4C0QC 4CDGA 1YHNA 4A8JA 1DOAA 2TMKA 5HR5A 4NPHA 2ZYWX 3Q5DA 3T5DA 4IDPA 5F2EA 1OKKD 5H8WA 3CRQA 1KDTA 1W5SA 3IEUA 4UNRA 3LLUA 2QRZA 1E79A 1HQYE 2CL6X 5CDFA 1WF3A 4F4CA 3U61B 4PPQA 1U0JA 4FW9A 5FPHA 3AVOA 1M7GA 1P9NA 1RYHA 2KSQA 3FVQA 4KHZA 5TDHA 4X8LA 3BC1A 1KSJA 4XWKA 1E0SA 3UK6A 1N6LA 2FWRA 4L4UA 1GKIA 4PFSA 2YNMA 3TR0A 2GK7A 3AP1A 2FSFA 1GRRA 4EUNA 1DAKA 2VP5A 1KMHA 2OHFA 4Q9KA 4ESHA 4C0SA 3L82B 2AXNA 5BWMA 4JJZA 3VR5A 1N6HA 4PAQA 4Q66C 2KI5A 3JVUA 2NTYC 3HJNA 4M4SA 3VMFA 5FOTA 1Z0FA 2R9VA 1KY3A 1EWQA 3A1WA 1ZM9A 1WQ1R 5JS7A 4TQAA 1N6RA 1OKKA 2ZJ5A 3BB1A 3I61A 1CULC 3IILA 1P2UA 3TSZA 1KK0A 1P3JA 2C03A 2ZREA 1ZINA 4P4UA 5KNDA 2D3WA 5HTKA 1EFTA 4PTLA 3UIEA 4CEJA 2VTKA 2OV2A 1G64A 2IL1A 3B13B 2IT1A 1I2MA 2V3CC 4CT5A 2LWIA 5HCIA 2OBNA 3QXCA 2ZVPX 1PV4A 1JEDA 1SVOA 3D31A 4BLRA 1XPUA 3GMTA 4JLKA 3GJ6A 2R8RA 3K9LA 1ZU5A 4LDJA 2VQSA 1Y3AA 1CP2A 1GL9B 3EIQA 1JQLB 2VPPA 2O8BB 2X2FA 1XP8A 2VYFA 1BMFD 2A5DA 2IHBA 4KFSA 1UKEA 1DG1G 4B76A 4B34A 2VP6A 1DVRA 1NKSA 1T91A 3KB2A 4BFVA 1ZW6A 2AXPA 3KQKA 2GXSA 2QTVB 5IK2D 2P2LA 4PC2A 5DH9A 3OIUA 3TW4A 2CNWD 2QMOA 5HZKA 2OXRA 1SKQA 1YZQA 3FFAA 2EFHB 4JLJA 4Q4LA 4AD8A 3A4NA 4D81A 1Z63A 4GBMA 3K0AA 3FMIA 4U02A 1G5PA 2GCOA 3HP1A 4ABYA 5JEDA 2H17A 1OH8A 1ZCBA 3W8NA 4HUQA 4M1WA 3HU1A 3REFA 1E2JA 3QF7A 4KITB 2HCBA 3VNUA 3P4YA 3AVYA 2O8EB 4Q1FA 2DWPA 2NO1A 1X8JA 3BFVA 4TYYA 3SFZA 1Q0UA 1ZM3A 2YOHA 4JVNA 3KFXA 1ZD9A 4HDQB 4Z1MD 4C0AC 4NYIR 5G40A 2OZEA 2R6DA 5KU1A 2YWFA 4B32A 1E1QD 3GLFE 3C41J 1KNXA 4TQUS 2VA8A 4U7DA 4HAVA 1EESA 1G18A 3PUZA 4D0GA 1HH4A 1XWIA 5GVSA 5JCPA 4AC9A 2V1UA 4LBZA 3LD9A 1YKSA 1ANKA 1JR3E 4ZDJA 1I4TD 1VYTA 4DSTA 1SXJC 1XTQA 2BMEA 4Y0VA 4KSBA 4ZCLA 4AG5A 1FZQA 2NQ2C 1IXZA 1LNZA 2QAJA 2QM8A 1N25A 2QEQA 4FCVA 3R8FA 4MKGA 2DR3A 3T35A 3EZFA 1ESMA 3T1TA 2QSYA 4LHVA 4MYUA 4PAOA 1RRCA 1FUKA 1A2BA 3GJ7A 4IVPA 2ZRLA 2NMVA 5EE3A 4L5BA 2V8OA 3NTUA 1UBEA 1D9XA 1QZXA 1H8HD 2LKDA 4QM7A 1C9KA 4EJSC 5TARA 4LJ7A 1KI1A 4LJYA 3SQXA 4Z1MA 5ELXA 1FQKA 2W83A 4EFLA 1OH5A 4BUJA 4QL3A 1ZM2A 1A5TA 4LI0A 1QVAA 2C2HA 1UBGA 2F1RA 2J0UA 4PQYA 4DIDA 4H9GA 1GOTA 2EFCB 3EXAA 5FBLB 3H84A 4MGKR 3VR3A 4F91B 4I99A 2BKEA 3TUIC 1AK2A 4F93B 2FSGA 2J0UB 5G41A 3NDBB 3IDQA 1TQ2A 1SVKA 2BOVA 3ADDA 2GJKA 3LDAA 1IAQA 2PCJA 2V55B 3K0FB 1W0KA 1DAIA 3HPRA 5EP2A 4LPKA 1MV5A 4JMPA 2CE2X 4XD7D 1G8PA 1TUEA 2HJVA 1U0LA 3G5UA 4CW7A 1G20E 2ZVQX 4LZZA 5CYOA 4MDEA 3B8HA 1NVVR 1NMZA 3F8TA 3T34A 3GCGA 5CK4A 3LXXA 4ZI3A 1GITA 1XEXB 1YE8A 1Z2AA 4ZDKA 3UWOA 3TGPA 2VSFA 2F1IA 3B5JA 1E2FA 4CEIA 3IO5A 1P6XA 2ZS8A 3ICQB 5UKDA 2J46A 3IBYA 5BN5A 1VCIA 5AK0A 2ZXUA 4JS0A 5CYPA 3FMFA 5C18A 3PEYA 3RWMB 1OV4A 1SHKA 4RD0A 5CM9C 1VPLA 3VTKA 1OXXK 5EQTA 4PQFA 2BIFA 3WYFA 4DLYA 3K09A 4PC6A 2P5SA 4RZ2A 1WBBA 5JCZA 2ZE5A 2G1JA 3CBQA 1VTKA 2FJUA 1SKYE 2IUTA 1H8EA 2NIPA 1IN6A 1MOZA 2D7CA 1NY5A 2RGXA 1SXJD 2J45A 2Q9AA 3QPUA 3SJCA 4ZIRA 2REOA 3UATA 3QVVA 2ERYA 3W5JA 3UPUA 1KO1A 2ONJA 1E4YA 3JZAA 4A6PA 4B73A 3DEFA 2ZM5A 2OFOA 4B6FA 4DDVA 3AP3A 1TQ6A 3QI2A 3NIBA 3V4RA 5KNBA 1G17A 1NP6A 4POAA 3GQBA 2G83A 1II9A 1AQUA 4GMXA 3A6PC 4E22A 2QUZA 1JB1A 3Q9LA 1DPFA 2W6JA 3IQXA 4RD2A 421PA 2XZPA 2GXQA 4OYHA 1JXMA 1W2GA 4MRSA 3B60A 5GJVC 5A0FA 3RANA 4RSGA 3EX7C 3RNLA 4LJAA 4KFTA 5AUOB 3CR8A 3PIRA 4DLVA 2J0SA 1UEJA 4KAXA 3NG1A 5CIWA 3PVSA 1BO6A 4PHFA 1OXVA 1XX6A 4FMDF 4Q4AB 2V4ZA 2ORIA 1I2DA 5FTLA 2GCPA 3B1ZA 3B9PA 2G9NA 3W6PA 1TMKA 1CIPA 1FNNA 1ZVQA 2WSSA 2Q3FA 1LY1A 3B1WA 1IXRC 1QHIA 2LKCA 4HLUC 4DDTA 5B57C 1EWRA 2GZHA 3QG5A 4MKIA 1M6NA 3LA6A 4Q9JA 1JEEA 5GADl 3N2EA 1SXJB 2FSIA 1SVIA 1HQCA 1KSGA 2B8TA 3KZ1E 4GP7A 4KVGA 4DB4A 1CJTC 2AD1A 4WXRA 4DLWA 1ZM4A 3FDIA 3BD9A 2J59A 3DMNA 4MUAA 1J70A 1UPTA 1PZNA 5H70A 5EE0A 2O8FB 1NLZA 4PX9A 3RRMA 4M1TA 4EJSB 4OQXA 2IS4A 2ZSBA 4UXJA 3U3MA 2P3SA 4X8OA 5HKKD 4JKYA 4M1YA 3J81k 4C9BA 4URWR 2JIZD 1FX0A 4RCYA 3VKGA 3R7WB 4LBYA 4TQ9A 2KJQA 2QRNA 4M21A 2GDJA 1X86B 3GP8A 2VIIA 2G3YA 3KB1A 4LJ6A 1E96A 4RD4A 4PQRA 3KQHA 1EFCA 2VHUA 1R6BX 2YYZA 1CR4A 2IHYA 3NBXX 2LCFA 2QGNA 3TW8B 4DCSA 3AF2A 2BMFA 1G3QA 2FZ4A 1VHLA 4EPYA 1ZP6A 4Q48A 2GTPA 3NC1C 5A5GA 4PC3A 4OBEA 3RSOA 2ZRJA 4LHXA 3AVTA 3TH5A 3B7GA 1KO4A 4RKFA 2RB4A 4MDFA 4EPWA 4JVLA 2R6CA 2QPAA 1OPXA 1A7JA 1U94A 1XTIA 3DM5A 1XXHA 3DZDA 1EXMA 2WWXA 2XOKA 3A1TA 3C7KA 4QOSA 5E3HA 1XD2A 4A2WA 1RZ3A 4MGZR 2F55A 5DYGA 3EG5A 1X8KA 4WW0A 3ZS9A 2N1BA 3NH6A 1E9DA 2ZJZA 4H1VA 1YU9A 4LV8B 2WMOB 5FR2A 4JSTA 5P21A 1VCNA 4J0QA 1E1RD 3ZQJA 5KYKA 2CHVA 1D5CA 1KAOA 4IOKA 4TTRA 2UZIR 1XTJA 4KLZA 5EXTA 4CGZA 3PXGA 4GFDA 1Z0IA 2CL0X 2JEOA 4Q19A 4AYWA 1JALA 1F3OA 3ZZTA 4URVR 1TF2A 1BKDR 5H68A 4B47A 4ZPXA 3U7GA 3T12A 2JLUA 4DT1B 4A2QA 4W7SA 2X77A 1DEKA 3IIJA 4AY2A 1NJFA 4B2LA 5DE3A 3GLGE 3KQLA 1IJEA 1T8TA 2QTHA 3OIYA 2G88A 3WP1B 2FDCA 3F0TA 1IY2A 2ZJBA 1NF3A 2YZ2A 1NG9A 1XF9A 4BE7B 1GKYA 4HYYA 1ZNWA 4K46A 4OHXA 4LJ5A 2HLDA 1OIXA 3ZVLA 3B1VA 4AKGA 4HEJA 4QHTA 1L8QA 2AX4A 5IF9A 2RGGA 2YC2C 3DVLA 4ON9A 4B3DA 3GLHE 1Z0AA 2OG2A 1XZPA 3IO3A 3VX4A 2GHIA 3BFXA 4YMUA 5GJWC 5DLQC 3O8RA 4NHOA 1J8YF 3MMPA 3UMFA 1W4CA 3EA5A 1VG0B 5JRZA 2ZJ2A 2FX3A 1PLLA 3NH9A 4Q1EA 5LB4A 1OXSC 2C5LA 3LO5A 4D6PA 5B58C 1ZNYA 3FHTA 1Z0DA 3KKPA 4YLGA 3WBJA 2DCUA 4LCBA 2KBFA 2BBOA 3QEOA 3BGWA 3SZRA 3RYTC 2DPXA 4K81B 1EFUA 3CPEA 1T3LA 1QHHB 4LPSA 3PR1A 2Q9CA 3RRYA 4DJTA 2PL3A 5AJXA 2D06A 5DN6D 1MO3A 1GWNA 3T1QA 2QAGA 3QPVA 3VKHA 2B7CA 4QBHA 5CITA 1G7TA 2H7VA 3L0OA 4JSYA 2V7QA 5IRCD 4V0OA 4Q7JB 4W5WA 1TL7C 3FMOB 2RGCA 2ZR7A 2NO9A 1F2UA 2IYVA 3CZPA 2YWEA 4LK2A 3O8BA 2X1VA 4HDCA 1KI3A 4OJKA 1ZNXA 4Z8XA 2B21A 5CK5A 4YMWA 3R9WA 3L43A 3KXIA 2FPMA 4AKHA 2FZLA 1AS0A 2PJZA 3D8BA 3A1SA 1F2UB 3MWLA 4W5HA 4US1R 2MSCB 4TYWA 1Z6YA 3CPJB 4N1AA 1RKBA 2IYSA 4HB3A 121PA 3RABA 3WMFA 4DDWA 5E7IA 5B2ZA 2ATXA 2FF7A 2BKUA 2QL6A 1EX7A 4A0RA 2Q0HA 1V43A 2Z0MA 3SJAA 1VCOA 2R6FA 2HEIA 4G5GA 3Q72A 4ARZA 2PZFA 1NY6A 1E98A 1MO5A 1R0YA 1XCPA 1ZC3A 3LV8A 3VHLB 1IY1A 2HJGA 4RFSB 1A2KC 1GDDA 4DUGA 3U44A 2QENA 5CJPA 3UANA 5J4LA 4B3BA 3BK7A 4MH0R 5L3SA 3FKSD 4C7OA 5E7JA 4FMCF 1B23P 3AB3A 3E70C 2WPDA 2HF9A 2DFNA 3L0SA 5FR1A 1JR3D 4FWTA 1OYWA 4LYJA 5FBWB 5DHAA 1ZIOA 5L3SB 1SVWA 3IUYA 5B64A 2CCGA 2GCNA 3K70C 4IJMA 1P9WA 5IT5A 3CNLA 4OQNA 4N3NA 1VIYA 1Z6XA 3AUXA 2RGNA 1UBFA 5BQ5A 3PV0A 2YVUA 1HUQA 1KI7A 4PSAA 2O8CB 2C78A 3I8SA 2GJAA 3IIMA 2FMXA 1F48A 3N5CA 2ASEA 4DIEA 3BWDD 1D8TA 4RZUA 3DOEA 3U60B 4M1KA 4QNMA 4A82A 5JHHB 4TL9A 4TLDA 1Q3TA 2R6GA 4MKFA 4OI0A 4QXAA 1QVRA 2BVNA 2WBLC 1J7KA 2C95A 3P20A 2J9RA 1ZD8A 3I5XA 1FNMA 2WICA 3OEED 3NWJA 4B71A 821PA 2CJWA 3FKSA 3OHMA 4IVQA 521PA 1NI3A 4B43A 2ZSDA 4IDQA 2XGJA 3GLFB 1WBDA 2QZ4A 1G7RA 4PO1A 4RY2A 3CKLA 1DARA 4GNKA 4XIGS 1U81A 5FI0B 1NN1A 1XD8A 3NHBA 1R7RA 3SYKA 2O8DA 1UBCA 1SVSA 1COWD 1G8YA 1HE8B 1XMVA 2RGBA 2XSZD 3OAAD 4FCWA 5G3ZA 4PAMA 1NBME 3DO6A 1GILA 4D4KA 5F3WB 1KKLA 1OLOA 3HYTA 3ZVNA 1Z6AA 4P4SB 1EFHA 4Q5IA 4TMZA 3SR0A 2UKDA 4DCVA 1Z2CA 2PT5A 1Z0KA 1N0VC 4R98A 2GKSA 4GI7A 4Q1BA 1OF1A 4B74A 3FPAA 4GOXA 2N46A 1NG1A 1ZUHA 1MABB 4DSNA 5KSPA 2WTUA 2W0SA 2GZDA 2C77A 2FFQA 4KBFA 4DKXA 2WJVA 2O0KA 1DAGA 1VG1A 2W6ID 2IWRA 3UG6A 3BB3A 5FUXA 3BBPA 4HB0A 1CRQA 1KY2A 4QNRA 4JL6A 5FTMA 2AR7A 2PJRA 2QGZA 2J7KA 4HZUA 1IXSB 5K8TA 2QP4A 4PPNA 4Q4HA 4QGHA 2YC4C 1W2HA 3EAQA 1OHHD 4DLXA 1Q3HA 3K70D 2EW1A 3LNCA 2QBYA 1OFUX 4PPFA 2NO0A 5FUVA 3WNBA 3AKYA 4R2HA 2H5EA 3KTAB 3OAAA 1SGWA 1IN4A 1L2TA 2OE2A 5JRJA 1PLJA 2IYZA 4HAYA 4YDSA 2ZRMA 4IDOA 2GWHA 3VR6A 1QRAA 1Z8FA 3CRMA 3E2IA 3GPLA 4ERNA 2IBMA 1U9IC 1Y63A 2JATA 1P4SA 4D25A 4DCNA 2QPTA 2GJSA 2QMUA 1IN8A 5KTYA 2A7QA 3LVQE 4NYMR 2XNDD 3ZJYA 1KI9A 2W6IA 5CJ2A 4TTQA 4HAUA 3KQUA 1J8MF 1KJYA 4NE2A 1Z28A 3MGCA 4QJ4A 2B8WA 2IS6A 1PVOA 1CJKC 2OO7A 4BLQA 3VNVA 3U3JA 4A0GA 4C0HA 3TIFA 3CWZA 1OHHA 1HT2E 3IBGA 1GVNB 4BLSA 1SKYB 3EIHA 1YQTA 4OQLA 2ZYVX 3LBIA 3HU3A 3IEVA 3I3SR 3KX2A 1E32A 3JZMA 2NG1A 4JLPA 4DWJA 1T9HA 2BCJQ 4CEHB 4Q21A 3K70B 2CDNA 2YWGA 4BRWA 3ADBA 2ZRIA 2KWIA 2P5TB 4GPTA 4M53A 4NL4H 1M1YE 3EZ6A 4AKEA 4BQSA 1EFRD 2PMDA 1YZLA 3Q85A 3E1SA 5CIQA 1DAMA 1OH6A 1WE2A 3GEEA 4QGGA 2JAQA 4L16A 4A6XA 3W8RA 1GZSA 2XNDA 1KJWA 3AUYA 4BFXA 4LJ9A 1WXQA 5EP1A 4D4LA 2ZU0C 4G3XA 1JJ7A 4JBXA 1KI6B 4A0FA 1XMIA 2D2FA 2ODNA 2Q21A 3BERA 4UNNA 4C0LA 4EPVA 2IXEA 3PEUA 4JT4A 1N0UA 1OB5A 2CXXA 4JLVA 2UVQA 2QMHA 1QDEA 5DIFA 4PHHA 3I4LA 2ZEJA 2A9KA 4TSFD 4JT2A 2HT6A 3WBKA 5C4GB 2O8BA 1ZUNB 1LB1B 2RHMA 4LJ8A 4CT4B 4UXHA 4KXFB 2YJTD 4I81A 2ODBA 2QORA 2ZPTX 5SZJA 4Q7KA 2R6AA 1WRBA 2QT1A 2WAXA 3K0CC 1VYUA 4HDOB 3BAFA 6Q21A 3EWSA 1TQ4A 2XXAB 1QHYA 4LV6A 2A2ZA 2ZE8A 1UKZA 1ZRHA 2FGJA 2GVZC 2XTZA 1R0XA 1US8B 1E0AA 3X1WA 1XBTA 4M8NE 3MJHA 1R5OA 3UKDA 4PXAA 3O8DA 1XEWX 2OSBA 2WJHA 2EYQA 1O3YA 3M4YA 2WWWA 3RS7A 2A30A 2AFIE 1M34E 2BEKA 4AYXA 5TV2A 1E0KA 4V0NA 5EUQB 2NOAA 4MRRA 1GNPA 1HEIA 3EZ2A 1R8QA 1NMXA 2DFKB 2Z6VA 3BORA 5SZHB 4DSUA 1GSIA 1N5IA 3CB4A 3CM0A 4YMSA 3WRYC 2OAQ1 3OF5A 5EZ5A 2O8EA 2OEPA 4TL6A 3X2SA 3RS3A 3NVAA 2HDNB 1G3RA 2H92A 3BOSA 4MGIR 3ZZUA 1E2EA 3RLFA 1G6HA 2QT0A 2ZAOA 3T06B 2WMNB 1GNRA 2A5FA 4QJ5A 5J4YA 1RJ9A 4DLUA 4A92A 5A4JA 1Z07A 4E03A 3QY0A 4NDZA 1BMFA 4B44A 5AJZA 3SS8A 4A0HA 1JNYA 2AD5A 2DYKA 3QXHA 1RJ9B 5DO9A 3TQCA 2HT1A 5DI3B 2QY9A 1HA3A 2ZYTX 4F4JA 2AK2A 1VDZA 2PEZA 3B1YA 5HZHA 4IOJA 3SFVA 3UMRA 1E94E 2PX0A 5CB8A 5IK2A 3SU8A 5DGXA 3VHXA 3AGPA 2CNWA 2PEYA 3ASYA 3MWJA 3ZIAD 4ILEA 1UF9A 1T0HB 3L0IB 1F2TA 3UMSA 3CW2A 3PUYA 4RJLA 1XTRA 2FSHA 3ONWA 2FN4A 4OI2A 4D80A 3K0SA 1XPRA 2NO6A 5JI3E 2BCGY 4KV9A 4QGFA 3BB4A 5BW8A 1F2TB 2JGNA 2ZE6A 3AVPA 3LW8A 4AKIA 3TR5A 2OXCA 2BMJA 4WZ6A 3TMKA 1SVMA 2EFGA 4OI4A 4M1OA 2VP4A 4FD2A 5FTKA 1YVDA 3GLGB 3U4QB 2HXYA 3N70A 2YV5A 2WJGA 2VL7A 3T61A 4S35A 2L0XA 1T3SA 3ZGXA 2ZI9A 1GUAA 1NVWQ 1E1QA 4IXMA 3R9XA 2JJ1D 4OK5A 4WIAA 3K0FA 8OHMA 3LY5A 1OXUA 1N5JA 2BBWA 4OQMA 3GLHB 2F9LA 1GRNA 5B30A 1KI2A 3MD0A 1OIVA 1QHNA 2EVWX 1W4BA 4DVGA 5J4HA 1FFHA 1P61B 4BZQA 1XEFA 4DLRA 1XEXA 4FXPA 4D0NA 1S0UA 5HE9A 3GEIA 2C9OA 1IONA 2GAAA 1GFIA 1KJZA 1AA9A 3QF4B 1NLYA 1H8HA 2ZETA 4OL0A 2C8VA 1W7AA 1ZBDA 2WV9A 2YKGA 4NYMQ 4BRUA 4QGAA 1AKEA 1YRBA 2ZI7A 1UAAA 5TVKA 3SEAA 3CNNA 4ZCMA 5LPNA 4YMTA 1DAFA 2D4HA 4YC7A 2JLZA 4HB2A 1OFTA 1LFDB 4A4DA 4M1SA 4QBFA 4X8MA 2ERXA 1ZD1A 4HAWA 4D4JA 3U6BA 3B6EA 3FB4A 5CLQA 1GM5A 1Q1ZA 3CRVA 4FIDA 5EXXA 1IJFA 2FPLA 4NCNA 4LJ4A 4PC1A 2YOGA 2FGKA 2FV8A 1YZGA 4GT1A 3RC3A 3U7FB 3THYB 221PA 2VEDA 3V9PA 1P9RA 3AF4A 4D0LB 2V6JA 1RRGA 5K8IA 2QN6A 3DM9B 5FPKA 4XD7A 4M0LA 3GLIA 1SQ5A 3RS5A 4IDHA 4PHTA 2ZRNA 1Q21A 1XB2A 1KK3A 2CLDX 5JSZA 2VP2A 3V00A 4JYBA 2H1LA 3CH5A 3P27A 2ZSFA 3VFDA 4QRHA 5LD2C 1G5TA 3PEWA 3GLIB 2PBRA 5JEEA 4I1SA 3MFYA 5JSZB 3EA0A 4BECA 2ATVA 2I1VB 2MSEB 3EASA 4IOMA 3PITA 4P4TA 5CLLA 5ANRB 2XJ4A 5EP4A 1UDWA 1ZIPA 2DHRA 3D7MA 4Q4AA 5CDFE 2ZRPA 4KCGA 3LX8A 3K53A 4TYQA 2D2EA 3QG1A 5FPTA 3SJZA 1FTNA 2J1LA 4GOJA 1SHZA 2CE7A 3QKRB 3TBKA 1NLFA 2ZROA 5BXQC 4G5RA 5E7MA 4QBGB 1D2MA 3ZDQA 3RVBA 2IEZA 1T0JB 1Z5ZA 3EC2A 4P33A 4WOPA 1JQJC 3KUDA 2JA1A 1SXJA 3RRZA 2R65A 1MH1A 1EX6A 2GBLC 1KNQA 1NBMD 3AM1A 4NONA 3T15A 4NTZA 4QJ3A 3C5CA 4TL7A 1MT0A 2NGRA 1G9XA 3WNDA 1ZCAA 4B35A 4WXPA 4V02A 1CU1A 4LV5B 3AKCA 4XOIA 2O8FA 2Q9BA 2HF8A 1DO2A 1UM8A 2C98A 2CHQA 4EJSA 2W2VA 4KODA 2ZUDA 5E4FA 1RIFA 4NCHA 2RGEA 4HAZA 4BWYA 4LX0A 1E9EA 3TAUA 2WKQA 2XITA 2RH5A 3AP2A 3R7WA 2JLXA 3CF6R 3G82C 1W4AA 1L7VC 3KJGA 3IIKA 1BYIA 1E2DA 5E95A 1WMSA 3ZZ0A 2XTMA 2ZJ8A 4Q00A 4Z51A 4BFYA 4B3GA 1ETUA 5FL7D 3AVUA 1M2OB 1R0ZA 3I92A 3SHFA 2IUSA 1TUIA 3C14C 3DKVA 1XU4A 2IF0A 5FOUA 4Y0AA 4W9MC 1IN5A 1KDPA 4MGYR 3VU9A 1OYYA 3OZXA 4B33A 4AIIA 4DBLC 4NMMA 1B0UA 3HU2A 1X1SA 4G5SA 4EQ6B 4V0MA 3IHLA 3H4MA 2QP3A 3VU9B 2C9CA 2WJIA 1Z3IX 2NO7A 5JZVA 4WA7A 4NZYA 1YZTA 3PQCA 2F7SA 721PA 1F5NA 4I1UA 4DB2A 1CEEA 2QTFA 1VKJA 2H16A 3QSYA 1Q20A 1AS3A 3THOA 3KL4A 4BEJA 1S1MA 5HKKA 2WWYA 1E9FA 2AFHE 4QM6A 3THXB 2IA5A 1KMQA 2JIZA 1U8YA 3C4JA 4AYTA 2ZRBA 2YOFA 2PZGA 2PMKA 5FL7A 3GD7A 4G5QA 1TAGA 3RS2A 2BWJA 4MUBA 1OW3B 1W4RA 2WIBA 2ZI5A 4DT1A 1ZNZA 2AHOA 4XVQA 3BFKA 2GF0A 3M0EA 1FP7A 1T3HA 1W1WA 1CBUA 1FUUA 3DL0A 1QBKC 3PCRB 3LQQA 2BMDA 2F9MA 4JLDA 3U7EB 1D2EA 1T6NA 4A2PA 3SYLA 2HV8A 4RD3A 5L3QA 4C30A 5HCNA 3R20A 3W34A 2BJVA 5LD2B 2VBCA 3I1FA 5JBQA 3SJBA 1J90A 3AF1A 5L3QB 3PEVA 1OIWA 4PHGA 2XZOA 1D9ZA 3T5GA 1I4LD 1Q44A 4IEIA 3TKLA 3G0HA 5CB6A 1GKUB 3C16C 2IYLD 3CF2A 1ZMXA 3NHAA 4G5OA 4EFMA 5KSOA 2DY1A 3EPHA 4I1OA 3W6OA 2J7PD 1E1RA 1GG2A 1K6MA 4JIMA 2BJWA 4X8HA 3QKUA 4TLCA 4HLUA 4UNPA 2VH5R 3SC3A 3SYNA 3RSLA 5EXPA 4RZXA 5FFMA 5HE8A 1YR9A 1V5WA 1II8B 4G0NA 2JJ2D 4KO8A 1DBSA 2CLSA 1KK2A 4DZZA 4ACBA 3QE0A 1QHHA 3P26A 3ZS8A 4MA4A 1W36C 2X19A 4DHEA 3CR7A 1Z6GA 1F6BA 2WAYA 3KJHA 4E5UA 2N42A 3PJRA 3DDCA 2OT3B 4LHZA 2C04A 1G16A 1LF5A 1N6KA 1P75A 2OCYC 4NYJQ 5DISB 2AKAB 2ZQ5A 5DI9A 5J40A 2OM2A 4P3YA 4G01B 4OHWA 1X1RA 4JKIA 4W5JA 3U7HB 3M1IA 2OAP1 4E09A 1G4UR 1EK0A 2ZJOA 2ZE7A 4Q1AA 1W46A 4LGMA 1N2CE 2OFWA 3THWB 1AGRA 3QKSB 2SHKA 2J7PA 2OBLA 2BEJA 2DWQA 1VECA 5FBVB 4B6EA 2Q3MA 5FL3A 1G8FA 2ZI4A 4OHYA 4Q4JA 1CJMA 2V1XA 1G3IA 2J41A 4LHWA 2H18A 1WP9A 2G0NA 4OHVA 4ZCIA 4A1FA 4ZI2A 3CRW1 1DTSA 4Q4JB 3ETLA 3K9GA 2QNRA 1YJ5A 3K9NA 5DSZA 1Q1BA 3QNUA 1FQJA 1E2HA 3BXZA 2QE7D 1FTSA 1N6PA 1G4AE 1P2TA 3OFND 4RFSA 4DSOA 1LV7A 1O87A 1U98A 1BYUA 2EWWA 2I1QA 4KJZA 4Q02A 3SN6A 4AK9A 2ZJYA 3R8CA 4BASA 1E0JA 1KOFA 5DN6A 4PPGA 2F3TA 3KDSE 2P0EA 2ZJAA 2A78A 1KKMA 5AUNB 1BIFA 5JWOA 5KDOA 3S1AB 4GZLA 4M2LA 1CJUC 2B92A 4E07A 4JBYA 3DMDA 3QKTA 1P2SA 4IFBA 4G1UC 4PSVA 4PC7A 4CIDA 2Z5FA 4JVMA 2WVJA 4DXAA 3BIFA 3P4XA 1YRAA 1U0HC 3D3QA 3A36A 3FWYA 4R7ZA 5FTNA 5JECA 1HE1C 1U99A 2O8CA 4A8JC 4YMVA 3SHWA 1OSNA 4IVRA 3K9HA 2H57A 1FP6A 4Q1DA 3H86A 2ZUBA 3FE2A 1E69A 2RGDA 2GEUA 3CLVA 3CNOA 3FHCB 3FHOA 3KJEA 3LH5A 1Q1QA 5KSZA 2PX3A 1W36D 4LY6A 1XTSA 2QROA 2PCLA 4P32A 2QE7A 2PZEA 5IDVA 5EXSA 3HPQA 2O52A 4Q47A 5GVRA 3VR1A 4JLNA 2CK3D 3K0EA 4BLOA 1CF4A 1NRJB 4IRUB 1YZNA 2XZLA 4GRAA 3CX6A 4JYCA 1HV8A 3SBEA 3GLFA 2J0QA 4JLAA 4CYMA 4TMWA 1M8PA 1ODFA 3WHLA 3KKMA 5M04A 3EZ7A 3L8YA 5AUPB 4O2RA 4UJ5A 1S9DA 1OXTA 4HLQB 1JR3A 1G41A 3E5HA 1A82A 2EQBA 3QENA 2F43B 1K8RA 3SI7A 2W2TA 3I8XA 4KI0A 4B2IA 3WRXC 2BC9A 2HCJB 4DCUA 4EPXA 5C2JB 3W5IA 3WXMA 2C9YA 4M9ZA 4B3CA 5KUTA 1A4RA 1N3BA 1Z22A 4P4SA 2ANBA 2JJ8A 2VSXA 2IW3A 4YONB 4BFUA 5L8VA 1IM2A 3Q7PA 5FOVA 1GTVA 1W5TA 3ZVRA 1JECA 4CF7A 2O0HA 1R8SA 1DAHA 1E2IA 2QG6A 1ZAKA 1MABA 4ACAA 1PUJA 1K5GA 3P1JA 1W36B 2KE5A 4MYTA 1TF5A 5JWRA 3B85A 3F5FA 4QHSA 4LYAA 3LW7A 4BLPA 3IGFA 1ZUIA 2RAPA 4NKRA 2BV3A 3OEEA 5FBRB 5FUYA 4TMKA 1CR0A 1MRNA 5HPYB 4IHQA 5EE5B 2IX3A 1VMAA 1G8HA 1T5LA 5J4VA 1W47A 4URYR 1W0JD 1JPJA 3FTQA 4ZV4A 3KTAA 5EP3A 3MUFA 3OE7D 1A1VA 3QPWA 3GJ3A 1COWA 1UDXA 1YR6A 3GFPA 1S8FA 2OBMA 2XSZA 4C0BA 1IHUA 2J0VA 2WOOA 1FL9A 4AI6A 4DCTA 1IN7A 1XXHE 5F98A 2GRJA 1Q57A 2E1RA 2KBEA 5K8LA 4ZO4A 3WHKA 4C2TA 5KPDA 1KYIA 1SZPA 1W48A 1E79D 4PO8A 3GJ8A 4L8GA 1WB9A 4EPRA 2GXUA 2RGAA 4HB4A 3GFOA 3FKQA 3WP0A 2A3RA 2F6RA 5BYJA 3A4LA 1R5NA 1TX4B 3ADKA 1UJ2A 4TN1A 4GP6A 2Y8EA 4PZZA 2IF2A 2ORWA 3LBHA 5CM8B 5LB2A 3CWQA 3TJZA 3NEYA 1AKYA 2QMEA 3WY9A 3W3AA 1G7CA 1TEXA 4EKDA 1R5BA 4MYCA 1W0JA 3T1OA 5TMPA 5EUMA 4CEHA 5LBIA 4LOAA 3RRNA 3ZQ6A 4URXR 3NDPA 2R2AA 3QBTA 3W3ZB 5KOYA 2ECKA 3BH0A 2RMKA 3NKVA 3HDTA 3RHFA 3O47A 2IYYA 2AWNA 2CBZA 3H2YA 3AGQA 5FOXA 3HR8A 4A8JB 2XJ9A 4K8OA 3BJIC 2CEAA 1QHXA 2AKYA 4CVNA 3ND8A 3NC0C 2BM0A 3A4MA 1PUIA 2ZR0A 2CVFA 3CH4B 1KI6A 4OHZA 3PENA 4BEBA 1JR6A 1E9SA 1HY3A 5TXGA 1E9CA 1BOFA 1G19A 4GSYA 2BBTA 2YWHA 3LQRA 4U00A 2IS1A 4AURA 2AL7A 1GNQA 1U8ZA 1KZGB 4MRNA 2HXSA 4NCIA 1XJ0A 5F9FA 1I4DD 1HTWA 3EW9A 4BGDA 2OCBA 2D62A 2B7BA 2GEDA 3QXXA 2F1HA 1GL7A 5JHGB 1XJQA 5FPYA 4JL8A 1TQDA 3B78A 3LLMA 1CS4C 2IYRA 5JFGA 4LWZA 2PH1A 2W00A 1KMHB 3WMGA 4M22A 2JLRA 4HAXA 1KGDA 3ECCA 2XXAA 3QXJA 5FOSA 3C15C 1R10A 5KO2A 1US8A 5L3RA 3TQFA 3OEHD 1TU4A 1EFRA 1N6IA 5IHPA 2ZS7A 4N0EA 4TYPA 4D2IA 2REXB 1E9RA 1MKYA 1XMJA 1CKEA 4CEJB 3GJ5A 4DEXA 4LBWA 2VLIA 3EWAA 2WHXA 4XWAA 1JJVA 3NXSA 2IXGA 3H1TA 3A37A 2WZQA 2MMCA 1WA5A 1XCGB 2WOJA 2WWGA 3IHWA 3IPYA 3KKNA 3L8ZA 4C0KA 4N0DA 2AK3A 4TSFA 1OE0A 3TSWA 2JASA 4EAQA 4GMDA 2ZTSA 1DG3A 2XNSA 1IBRA 4B3XA 3ASZA 1QF9A 2EFEB 4L15A 2P6NA 1CRPA 1L4YA 2I4IA 1E2QA 5DI3A 2GJ9A 1MO4A 3K09C 1E9AA 1U9IA 3BE4A 3UWKA 4PANA 3OEHA 5FBQB 4FCTA 3PFIA 2GVDC 1N6NA 1RRPA 4P0TA 4GZMA 1YR7A 1TF7A 2BBSA 4I1VA 4F4IA 1KDRA 1QG2A 3LX5A 5AJVB 1FPMA 5J4KA 4FMBB 3MWYW 5GJCA 2GNOA 1ZC4A 3AVQA 3ZD7A 4UNQA 3LVRE 3C8UA 3K0AB 4A15A 3HYRA 4TWZA 2GCOB 3KUCA 3WYAA 2HYIC 4TL8A 2IC5A 5G3YA 3AVVA 4HUQB 1RVDA 4M9QA 1ONBA 2PLFA 4FI3C 1TTTA 3AQ4A 3B1XA 3IKJA 1CXZA 2A5YB 2IXFA 2VHCA 1NKTA 1NMYA 4MQBA 5JLJA 2I3BA 4XTRA 2QQ0A 1N5KA 2FPKA 5H1YA 5GJBA 2V9PA 2O5VA 3QVUA 3GLGA 3U4QA 4DC9A 1OFHA 3KXLA 4HATA 2IWHA 2UZ3A 3DOFA 1CTQA 1NIJA 2IYXA 2JLWA 2A5JA 1W0KD 3OIVA 1LVGA 2NZ8A 2FEOA 2ZI3A 4Z8YA 5AWFC 2W0MA 3CONA 1R0WA 3LXRA 4QHYA 1TEVA 3CO5A 4US2R 1JAHA 3GLHA 1RW4A 2QI9C 2W2XA 2JCSA 4TLAA 5SZKB 3OIWA 1G291 4ZKDA 1N5LA 1QG4A 2VRWA 3ZIAA 2X8AA 2WWHA 2WWFA 4H1UA 4OQFA 2W58A 4DLZA 5JS8A 3QF4A 4R71A 3HR7A 2GZAA 2OLJA 3X1DA 3ZVMA 4FMDB 4RFVA 2V54A 1XMSA 1ZU4A 2CMKA 4QKQA 2G77B 3EARA 2JLSA 3KKQA 3K0CA 1D2NA 5KSYA 4XJXA 1U8AA 4O0MA 3UG7A 4XWOA 2ZR9A 1H8ED 1U2RA 3GJXC 4P31A 3NEJA 3PUVA 4JLOA 1KSFX 1TNDA 2GK6A 4ITRC 3TLXA 3AVWA 1X8LA 1DO0A 1F60A 2VHJA 4US0R 1U90A 4NH0A 5C4MA 2G1KA 1E3MA 4NYJR 5FPSA 2JJ1A 2VHQA 3GEHA 3M6AA 3DHWC 2DFTA 3THYA 3KQNA 3BRWD 1WCV1 4KSCA 1FMJA 5JMTA 2JDID 4Z54A 2JLVA 1XEWY 2QSZA 1ESNA 1Z29A 3A58B 3MCAA 5FTJA 2JLYA 2P6RA 1N6OA 4URZR 2GF9A 2W6JD
chains in the Genus database with same CATH superfamily
1NN3A 5AJWA 5FUWA 3A3PA 3F49S 4DY4A 4JAVC 4XUCA 2Q1UA 4NATA 1TC1A 2IS2A 4W63A 1T36A 5J58A 4E30A 3CUKA 2GYUA 1XFAA 3BGVA 5AI0A 4AZ3B 1VCMA 3EXHA 5KDLA 3C4QA 4NP6A 1BN7A 1Z68A 2YTZA 1Z8NA 4KRYA 1QC5A 5JQGB 2AT1A 2QJWA 1KH1A 4EFNA 2XUFA 2J87A 3COSA 1P6QA 4XTCS 4MV3A 1LI4A 1A88A 2D7DA 1FS4A 1SVNA 5TB5A 5CBPB 5AW2A 1BKYA 1R6DA 2OLKA 2HMYB 2Q1YA 3ZHSA 4JI4B 1UKYA 1J99A 2Q6TA 4Q9DA 4Z53A 4HR7A 4G67A 2A4KA 3TX6A 1ZR4A 3QMWA 1SBTA 1AHNA 2JAHA 5LVAA 2G5TA 4BX2A 4ZIRB 1K0UA 1WNFA 3AU9A 3KLOA 4OK3A 2JFUA 3ROTA 3EGDB 3GF4A 4WNAB 3AH8A 1CETA 2FU5C 2HA5A 4N6NA 4MDYA 3W77A 4EPTA 2JDIA 4IM7A 2I2WA 2M98A 1XDDA 4K88A 2CUKA 4Q9IA 2VPQA 4ENPA 5ALRA 4PBTA 3P8ZA 4P7BA 1YZKA 1OGYA 2R87A 4KR3A 1H1TA 1M1UA 3RF6A 1I3KA 2I8AA 4IZIA 3U37A 4DC0A 1W85A 2VSOA 4QWMA 4URUR 3IOYA 4PCUA 4L5YA 4CRWB 4EWLA 2O3JA 1WXXA 3TFWA 2ZAMA 3DVRX 1V2HE 3OLYA 3TRKA 4Q7MB 2NPFA 4M9XA 5CFZA 4R9RA 3U4GA 1KPHA 5BVGA 5AI9A 3SZLA 1AA6A 2F3SA 5HW0A 3HO8A 4RD6A 4DNQA 1B7GO 2OCKA 2W2LD 4YJHB 2Z9DA 5KHAA 3KEOA 4DLNA 2CFIA 3Q0TA 1H2YA 1CB7A 2FEMA 4RQAA 3KQTA 3RYIB 3STVA 5A4DA 4F84A 3URMA 5G2OA 2FQXA 3P32A 4RY8A 2PWZA 4G26A 1DE0A 2O0LA 4TYMA 4BNVA 1KAMA 2B1QA 1YRHA 2AEFA 4X1YA 3UJDA 4EGCB 4OUDA 4DLAA 4HNVA 1CRZA 4FN4A 2VJPA 1K5HA 5I45A 5LOVA 4EF5A 5JJKA 4YR9A 2ZRDA 5KWIA 4PIPA 3DT6A 1QRUA 1E1CB 4EFKA 4YRFA 5ALNA 3RFUA 1DI0A 4QQKA 4DEYA 1KJJA 4BNFA 1XNRB 4O3MA 3E4CA 3UJAA 1V96A 1E2MA 2PT7A 3F9IA 4GZ5A 2KLBA 2EJBA 2GPJA 1DS6A 4CCSA 1MDFA 2A5GA 2ETXA 2QAGC 2UVPB 4ZEWA 3VNVA 2YWXA 2X58A 4EW6A 3EZYA 3NTRA 3U6KA 3FUTA 2QOEA 2XTNA 4NOKA 4Q03A 1SU8A 3E61A 3KOZA 1XVLA 4JBWA 1T9CA 3KYIB 4Q7LA 3R9IA 2FG6C 1AUQA 3VPCA 1E2KA 1JG2A 2J3EA 1II0A 1NIPA 7REQA 3FCCA 4RCZA 1CQJA 4G1CA 1AIPA 5K3EA 1IZ7A 1XT6A 3N05A 1CJVC 3B7WA 1FXWA 4IDGA 4EJ0A 3DXFA 3Q8WA 2MCFA 1WR8A 3LKBA 3PNKA 4R8SA 1KERA 5IKEA 1X6VA 4C76A 1K4YA 3MELA 1K7YA 1OBFO 1GA4A 1ACLA 1J0AA 1UM9A 2BF4A 2CLCX 2FHPA 2I80A 3OJOA 4H3HB 2NUTA 3MWKA 3DFIA 4UDOA 5I3ZA 3JAWB 4HWOA 5CXQA 1LEHA 4N39A 4UUQA 1EINA 4DLTA 1JFFA 4NYIQ 4QELA 4R2LA 1N33B 1VKHA 1L6IA 4M60A 4U2FA 1K7EB 3NNDA 3JU3A 5U9CA 4EECA 3TGLA 3NBAA 4NV3A 2IK8A 1JG6A 1ENOA 2IKSA 2UVDA 3QWHA 4TS1A 5THKA 1OT3A 1D6MA 1X3LA 4JITA 4JNCA 4NBSA 3WXMA 3I52A 1VQ1A 3G2MA 3REQA 3ZR4B 2HNAA 1A2OA 2Q2VA 1YOVA 2CJYA 1OWOA 1JKMA 2FRDC 2ONKA 3D5TA 5K1ZA 4C88A 1KI4A 1OI2A 1X80A 3BCHA 4TMVA 3SDZA 3O4FA 1C41A 3PU6A 4D9KA 2KB0A 3A8TA 4S04A 1YCFA 1XD2B 2OUKA 1AM4D 3HEBA 2XKBA 5JEDA 4GGPA 2PZLA 4XSGA 1L4UA 1M54A 1NN0A 2I33A 3GLSA 1YL6A 2HR1A 1AZTA 1JI0A 3MJRA 1PU2A 3S8MA 1DBIA 3CPSA 3PJGA 4HK4A 5AVXA 2VAPA 1O94C 2GDZA 1QZ3A 4IG9A 3KELA 1IOZA 3IEIA 4FWIB 2XB4A 3VR4A 3G23A 3GAAA 1TVMA 1CQXA 1D2HA 1XQVA 2X2EA 4H0NA 1B0ZA 2Q3BA 2EW2A 2ZSAA 4RPGA 3KEMA 5ILGA 3WK4A 3P9SA 1NLMA 5C5IA 2BL4A 4BKUA 2B0CA 3RUIA 1UDAA 2C9BA 2I66A 5FOWA 1D1SA 4ZQEA 2PTHA 4M9RA 4P3OA 2PG3A 1JQ5A 2GBLA 3MEQA 4KC0A 4TT8A 3I5YA 2RD2A 4XPIA 3NV9A 1Y6JA 3ZLVA 4F12A 3L5OA 4PG6A 4GMHA 1KY4A 1E7MA 1NTOA 2WM3A 3NAGA 4YCMA 5KX5B 1E9BA 4OLJA 5T57A 4N8DA 1RWWA 3CLUD 5C8YF 4FMCB 3IFSA 4ZV7A 1D6JA 4DQDA 1TFUA 4YRJA 3KTOA 2QQ5A 3AESB 3H1AA 4AWXA 3PTAA 2BUBA 3UGQA 3ZOZA 4HDKB 3KLBA 1DAEA 3GYGA 2OESA 4JKOA 4JN6B 2NSHA 5J59A 1YVUA 4ZVOA 2AYZA 3TJRA 1LPMA 3GJ0A 1LWNA 2EYUA 3A4YA 1GQ2A 2ILVA 4LC1A 4QVGA 4UUBA 5E6RA 4DG5A 4EY4A 3TNJA 5KTNA 2AOWA 4PONA 5EHXA 3WKCA 5I6DA 3FYUC 1S2IA 1FNSA 2JD1A 1L5VA 1IPHA 1X42A 3AFMA 4GE0A 5AKJA 4RIEA 3GJ4A 3WBFA 3T3MB 2OHXA 2F3RA 3TSYA 2FR1A 4CKWA 2HRRA 2QGFA 1YGYA 2PX5A 3JD3A 3X1ZA 1J5PA 1DL5A 3NBZC 4BFZA 5BN3A 3EXFA 3WI7A 1CS0A 2PV7A 1NW4A 4P08A 3FMPB 1JLSA 2R1VB 3BMNA 4Q16A 3WNQA 1P2BA 3FSRA 5DYNA 5B58T 5MGNA 4RQTA 1P39A 3UHJA 2ZM6B 1I4WA 3HFGA 1OBCA 3L04A 3LRPA 1PJRA 3LLVA 2I7TA 3DDUA 4U7PB 4GDFA 2EQAA 4WH0A 3RJTA 1NYQA 1D8AA 4J6EA 3LWBA 3THRA 1Z47A 2AJLI 2ID7A 1RRFA 4P81A 3SC6A 4XVUA 1IY0A 5IAEA 1LPNA 2EBUA 2ZANA 5HF6A 1JZSA 1FS6A 4GVXA 4ZCTA 3AF3A 1UC5B 2UV8A 4JI0B 4XWWA 1N2XA 3JYHA 2D74A 2IEBA 5JXWA 5EJ2A 4C1NA 5K0SA 3Q3IA 1IM5A 2GM9A 1OA1A 1WS6A 1W87A 3RRXA 4C04A 4W7HA 2CVHA 1XCOA 4FZ3A 1X92A 4LQLA 5D87A 4LSGA 1U2SA 3MIZA 1R0LA 4DUPA 1VIMA 3WISA 4IIBA 5JMWA 2JCXA 2G82A 3ADPA 1GL6A 4RWEA 1Z08A 1ZM7A 4TT3A 2J4FA 3AV0B 3CLSD 4ZZ0A 4ASUD 4BBZA 1DOZA 1KZYC 1VHTA 5BT9A 3S2ZA 2VAXA 3KKZA 1N78A 2H2IA 1XPOA 2FMUA 2VBFA 3GMIA 4R1OA 5I9MA 2I1WA 3TDMA 4DQUA 2ZIXB 3IOMA 4PS0A 2NSLA 5ECWA 2ZBVA 4JZKA 5KYGA 1HYGA 3NDRA 2ZUTA 1ZXLA 2YY7A 3R3SA 2A67A 1FY2A 1IZYA 1GNLA 3VPDA 3V46A 1BVYF 4I50F 3HYNA 3P0IA 3V4FA 1ADCA 4ARZB 5KWJA 3MLAA 2QQFA 1AQLA 3MWDA 4FHDA 4HFNA 3EVAA 4K8RB 3LWNA 3TVDA 4YAKA 1XAIA 2BDTA 2XE8A 1I3CA 1EGVB 1H1DA 3C3KA 4OU5A 4BQQA 1DQRA 6ADHA 2FFAA 4C7OB 2GJ8A 3GZTB 3GFGA 3JVEA 5D3ZA 1ZZEA 2CGEA 5AR1A 3S40A 1NJGA 1SXJE 3E5NA 2Q6KA 2F64A 3FGNA 4E4YA 1GR1A 2WZDA 2F43A 4YCSA 1NWHA 3UMBA 4MO9A 1ZGHA 2C2MA 2OCAA 1G9SA 4MITA 3KWLA 4JK3A 3EVBA 1OCEA 1DNPA 4C7MA 2VZ8A 4FNOA 4E0BA 4Q9HA 1TIBA 2GYVA 2HM7A 3A9WA 4E5NA 3FWHA 2FE4A 3DWIA 1GGMA 2IHNA 3M6MD 3BIWA 2B9EA 4YRTA 3X2FA 1YR8A 2C54A 1S8OA 3DZHA 1HR0B 1RMYA 1YDHA 2I2FA 3GWGA 5D51S 7MHTA 2BCEA 5KNCH 4QFBA 5J2TF 4LQ4A 4HNSA 3WYNA 2HADA 3HNOA 4GWLA 4S1VA 3OT4A 2V7GA 4K26A 1GPDG 3BD6A 4KX5A 1WZEA 1MDBA 4KFUA 1OA0A 5FAXA 5DBGA 3WS7A 3CINA 2OECA 2K5UA 3VV2A 2VF8A 1VB5A 3A0RB 3FTPA 3BKXA 5T8KA 3VX3A 3JWIA 3NBYC 4GKKB 4TVOA 1K3TA 4EI7A 2HY7A 5AOBA 4BZPA 5FWDA 4LMAA 1G8GA 1MO6A 5AJTA 1LZKA 4PPYA 5AIBA 3E2MA 2DAPA 2J07A 4LDPA 1E1MA 3C87A 2HRBA 2VJKA 2O8DB 1Q11A 1JQKA 3D3JA 2Z8YM 1TJ5A 2X76A 1Z83A 4LMRA 3KO8A 3VR6D 1GPKA 6GPBA 2GXAA 1BE6A 3E81A 2QA5A 4YEDA 1VJ1A 2FEPA 4V0ME 5KIAA 3EQ7A 1YTUA 3EEIA 4IV0A 4ZV9A 3SQWA 4TZ0A 4M9SA 3K96A 4DNXA 5BW5A 5T4EA 1SEPA 3TPCA 3B6JA 3EYWA 1PZGA 3QBVA 4ZT2A 1DC8A 4KP7A 2C97A 1HRKA 4HWKA 1K8QA 1AUPA 2ZJ1A 1NVGA 1L5LA 5CA1B 4G0ZA 4YRIA 5KPJA 4GC9A 2PMBA 1MRSA 1LBQA 3QXSA 4F7WA 2YWRA 3SE0A 4QREA 3FGOA 3FVVA 3QEKA 4QBIA 3SC2B 1U2GA 3FPFA 1QG0A 3W2TA 1VMEA 1YQQA 1Z4IA 2BM1A 5D3MB 1Y4ZA 2FP4B 3AB8A 1S2LA 1UP7A 5FEMA 1PV1A 4WEOA 5F2NA 2JC3A 2M2IA 4UU8A 2J9GA 1CUYA 3IKTA 1WB6A 4HZUB 3EIEA 1L4MA 2E5FA 2ZBPA 3AUTA 4Y0NA 1QB7A 4Q4HB 2AZXA 4EI8A 4XYMA 2PX8A 4OV6B 1AHHA 3PE3A 3EZGA 3BQ9A 2FEKA 4G0VA 3L0PA 1JEQA 5DK4A 1E60A 4IGEA 3N86A 3Q3JB 2OV1A 3NNNA 1E3SA 3BX1A 1UK8A 4FFVA 5JJIA 2RKWA 3I32A 4ZOBA 5DGCA 1GQYA 1FP2A 1WXHA 2IYWA 1NF9A 3BMCA 1AZLA 2FOLA 2ZQYA 1HFEL 1NL3A 3LECA 3OE7A 3Q1LA 3UJHA 2DEUA 3VOAA 1BKSB 2P6PA 2TMKA 2H1FA 3GZNA 4BMCA 4NPHA 2P1RA 4U2EA 3NRJA 2YFYA 3PL1A 1GADO 3CG0A 4XM0A 3OBBA 4IDPA 4Y9TA 1NUUA 2PGNA 3ZX4A 1FJXA 4FFBA 1UT6A 3AU8A 4G41A 4LRTB 4WKCA 5H8WA 4AJKA 1KDTA 3I2GA 4DWWA 5ILOA 2C2ZA 1W5SA 2DH5A 2I1LA 3L41A 1FK8A 2QRZA 3LLUA 1E79A 2EATA 4JMLA 4B7CA 4DMRA 5KNDD 4PG4A 4UEJA 3NYIA 1WF3A 4H6VA 1TVKB 4PPQA 1U0JA 4KXMA 4IIJF 1IWBB 1UUFA 1KJ9A 1REQB 3OY2A 1P9NA 2GCIA 2WVGA 3SICE 2IBSA 5I01A 1MG5A 3AR2A 1RYHA 4NR0A 4X8LA 4DC1A 5IN5A 4E5KA 1K8XB 2Q6OA 1E0SA 3ST7A 2XAAA 1K66A 1VA4A 2W6QA 3FF4A 5DX8A 2OXFA 2ES4A 1X74A 2Y71A 2OM6A 4ZICA 1N6LA 2FWRA 2VJDA 2ZB4A 1GKIA 2ZTLA 2YNMA 3U4HA 4HDAA 5AXBA 2WIGA 2GK7A 3ASUA 1K4KA 3H83A 3M3PA 1GRRA 3LUDA 1QDLB 4K9NA 2VP5A 4ROSA 5DDIP 3NP9A 1GAWA 1UBRS 2OHFA 3K6RA 4Q9KA 4S05A 2AXNA 4C05A 1N6HA 2GEJA 4P84A 5PGMA 3VH4A 5F2OA 3TQQA 4CI0B 1KY3A 1L1RA 2QW0X 1E5TA 1ATIA 2JEYA 1JPUA 3DEYX 5AK5A 3C6ZA 4C03A 1Y8CA 1NFQA 1JZQA 5FB3A 3U1BA 1AH2A 3UO8B 2HCTA 1JU4A 1TZBA 2PQ0A 2IITA 3RUCA 3ILYA 1PJ4A 1RR6A 1O6FA 1NOJA 5JROA 4JWKA 2ZREA 4FLFA 1HPLA 4K6KA 3KDPA 1WULS 2V58A 1EFTA 1K0FA 4G25A 3UIEA 3M83A 4QXMA 2G4LA 1I2MA 2IT1A 1Q15A 2CMGA 1F51E 4CT5A 3KZCA 3VR5H 3RVKA 4EOGA 2OBNA 3KZOA 4KXXA 4OJYA 3I6IA 4BB6A 4ZTBA 1ESCA 3D31A 3KE8A 1R74A 3H5OA 3LXUX 2R8RA 2Q27A 3L8MA 4CT0A 1ZK2A 2ZATA 5A1TA 3LYAA 1L5SA 1CP2A 1YMVA 3EIQA 2VUUA 1MEJA 1W1IA 3OEWA 3QI7A 3WLEA 1XP8A 4AS2A 2A5DA 2IHBA 2JIMA 3C5WP 4O02B 1UKEA 2C3YA 4X3CA 5IKOA 1T8WA 5AO9A 4ZAZA 3CUYA 5ICEA 1T2UA 1T91A 1XL0A 3L0CA 1YC5A 4RS3A 4F3NA 4BFVA 2XLCA 1XVTA 1QKIA 2Z58A 1UOOA 1MAWA 1BXGB 4EHKA 3ZKWA 4TX1A 3Q8MA 3HVKA 2RH4A 2P2LA 4J7CA 2YV3A 2WTMA 3HFJA 3KS9A 4ZAGA 4MS3B 5BRJA 1Z7YA 4M76B 3NVKI 2XIJA 5FPPA 2QMOA 2XQIA 3ELBA 3GC6A 4Q4LA 3FFAA 5ECYA 4ZGBA 5FV7A 2MT9A 3UC9A 4D81A 2ZPAA 3D4IA 1O0SA 1ULZA 4OQEA 3K0AA 3V7WA 1OJ7A 1D7AA 1E4OA 2GCOA 2XYVA 2AFHA 4UZEA 3KKKA 1EK2A 2Q29A 4Q24A 3D43A 4LTNA 4M1WA 2W42A 5C5CA 3JWHA 2WSIA 1G21B 1E2JA 1E3QA 1L5QA 2HCBA 3VNUA 2NSDA 1Q3KA 2WTBA 1ZSVA 1X8JA 4YAJA 2RAVA 2CZCA 4TYYA 3RF7A 2VXYA 1ZM3A 1JXQA 2YOHA 3F1KA 2NSYA 4M1ZA 3TO5A 3IDAA 4NCXA 4NYIR 5BPFA 3E5MA 4J3JA 5IKPA 1RBYA 1A50B 4FM9A 5KU1A 3MINA 2Y05A 1UXJA 4MAAA 3RHSA 4CIWA 4TQUS 1WCYA 3SVLA 1EESA 3PZBA 1G18A 1GXSA 1XWIA 3INYA 2FPOA 2VJCA 1RWVA 4RENA 3HZZA 4FFNA 4G8CA 1DKOA 3RFTA 9LDBA 4ZDJA 1KL7A 1TT5A 4KSBA 4HYEA 4AG5A 4CG1A 1FYDA 2WWRA 4R3WA 3MXTA 4WJLA 5E8RA 1MAUA 1D04A 1U7WA 2GEFA 2VTBB 2QEQA 3FB1A 4FCVA 4BNLA 3UMMA 3R8FA 2W71A 3P71T 4OD0A 4LHVA 2IU0A 2ODPA 4G8DA 1FUKA 1I1QB 3GJ7A 4R54A 3A28A 4EKGA 5EE3A 3UV3A 3AJ8A 2AW3A 1B6GA 1U7OA 3M1AA 4RZQA 3OKCA 4F4HA 3FTNA 1JYSA 2IEDA 1TIKA 5DCYA 1UFVA 3CCCA 2MINA 3GFRA 4LJ7A 4EB6B 4Z1MA 2OXEA 4EVSA 3SQXA 1TE2A 1FQKA 1ULUA 3JRXA 4IFTA 1TW2A 1ZM2A 1A5TA 1QVAA 1MQSA 5ABPA 3MCTA 1PTJC 3L79A 2HA4A 4F91B 1DLJA 1KFKB 2QUHA 2WIJA 3MS7A 5A05A 2P30A 1CDOA 1CUIA 1NMQA 3TAHA 4GPZA 4F0JA 4Q12A 1TQ2A 1QH1A 1SVKA 2G63A 1TYDE 2B2XA 2PWPA 3M4JA 4KQWA 5IG2A 3QU9A 2YHBA 3FAZA 4MV7A 1XZEA 3ED1A 1ZIYA 3GAZA 1TA9A 3PNPA 3HPRA 4QO8A 3ZNNA 1O9BA 2HUNA 2ZIVB 3CISA 3OC0A 4JMPA 4PW0A 5IX8A 4HF7A 3M6IA 1TUEA 2LZ0A 4FDLA 5CJJA 2HJVA 1KYXA 1Z4OA 3CEMA 3DMGA 1QS0A 3G5UA 4M0CA 2ZVQX 4LZZA 5BNFA 2A9PA 2OZLA 4MDEA 4KQEA 2OMKA 3BULA 1UK6A 4HMPA 1LZLA 1M10A 1J1ZA 3GCGA 3VUFA 3E9NA 5CK4A 2CB0A 4O4HF 3UGTA 5KVCA 3F1LA 4ZI3A 1T4CB 1XEXB 1YE8A 5B1DA 4ZDKA 3LUHA 2Z57A 2VSFA 2F1IA 1E2FA 3DXXA 4JU8A 2ZS8A 3S2SA 1XV5A 2J46A 2TYSB 3IBYA 5BN5A 3VH2A 4NZNA 4FFPA 1PK9A 2PX2A 4UEWA 4W4TA 2ZXUA 5B2FA 4BRSA 4QDTA 1HBJA 1NTRA 2VJLA 2OK8A 4RD0A 4U2DA 2H1VA 4L28A 4I3GA 5EQTA 5JPIA 4I9GA 5IHXA 5CBPA 2PM8A 4PLFA 2VK4A 4RZ2A 4UCQA 5D5PA 2HHAA 1J0CA 1DFHA 4X66B 3S2GA 4Z7QB 1SKYE 4KR7A 1IN6A 4Z9FA 1SXJD 4CBVA 2J45A 4ZIRA 1X15A 2XUOA 3TIGA 5EJMA 2X23A 3EGDA 3LRXA 4WNAA 2X9VA 2ONJA 3MC1A 4A6PA 4MYDA 2O9JA 4U9HS 4YJ3B 4DDVA 3FNBA 3V1KA 4ZZ1A 2B8NA 4N82A 4B3HA 4DMKA 3QFFA 3M9LA 5CP8A 3O4GA 4IS3A 4BO1A 2JLBA 4BAUA 1HYEA 2Q5LA 2B3DA 1C8BA 4E22A 1JKXA 4KMMA 5FNVB 2HLPA 3L7YA 4D98A 1DPFA 4RD2A 5AQEA 2GXQA 3LJKA 3GQBB 1T4BA 5A0FA 4BMDA 3RNLA 2ZB2A 4KFTA 1YRYE 5AUOB 1U8TA 3CR8A 2DWCA 3PIRA 1KHHA 5A9RA 5CB0A 1UEJA 3IQIX 3NG1A 5FA8A 1ISIA 2JRCA 4W5RA 1BO6A 3WGJA 1DJOA 3FUXA 4YJHA 4WNYA 4A3SA 5I7HA 3C8MA 1SRQA 4GX0A 3CSUA 4Q4AB 2GZRA 3ZE6A 5KNBH 2GCPA 3B1ZA 3B9PA 5C5DA 3LQ4A 1TMKA 1GTRA 4UUAA 3UBMA 4P4GA 1UXHA 4FBMA 1HDZA 1CIPA 1FNNA 1H94A 1ZVQA 2WSSA 2BEVB 1LY1A 3F71A 2WNHA 3LQ1A 4LNAA 5AKEA 1QHIA 3WLKX 3S5JA 2V0NA 5B57C 4KDRA 2HCFA 1J1UA 1D0SA 4BNGA 3A6JA 2EAUA 4Y2JA 1XCLA 5CDTA 1R66A 4FGLA 1M6NA 2ERCA 4D96A 2GN0A 5EQFA 1G59A 3KLPX 3FTEA 2CFCA 1VZ3A 4DQKA 4RTKA 3WLNA 1E1CA 3A9TA 4JUDX 4PZUA 3ORRA 5IDQA 4KVGA 4Y6RA 2AD1A 3WLQA 2C7VA 4DLWA 3FMGA 3BYZA 3NB0A 4HVAA 4PLWA 5HS6A 3BD9A 1AURA 2J59A 2R6ZA 3UT6A 1MMFB 4MUAA 1PX2A 4ZALA 3PNLA 3USCS 2XF8A 3FROA 3DG9A 4AF8A 1QG6A 2GBCA 2GN1A 4LYYA 4QOFA 4RZIA 3EBPA 4P34A 2O8FB 3F5QA 4PX9A 4BV2A 4EABA 4Z7OB 3FN4A 4O8CA 1T9ZA 3GPBA 5LLSA 5A3SA 1DRWA 5KJCA 1LGYA 3WLTA 3L9XA 4UXJA 1PR9A 2QLFA 4FGZA 4LVCA 3J81k 1VL0A 3PQ5A 1JUDA 2X9NA 5JNWA 2HC9A 4LBYA 4TQ9A 2KJQA 4OYRA 1RADA 1ABBA 1A77A 2G7MC 5TC4A 4BAZA 1FFXB 2OD2A 2QG9A 3B3GA 2ZIGA 3JXEA 3PJDA 3UMCA 2GPWA 2VIIA 3RFVA 3QFSA 3B5EA 4YUZA 4WK6A 2ZSKA 4RD4A 4PQRA 3JAWA 5KYXB 1NGSA 3OWXA 3UJ3X 4A03A 2QY6A 3QYJA 3KIPA 3T5MA 4FFSA 4XXHA 1F1JA 2FPWA 3HA7A 2XD9A 2IP2A 2GHQA 2IDKA 3F8SA 3MPUA 5BSRA 4B8ZA 1TMOA 2YIMA 4E1VA 4QU9A 4FWBA 1G0NA 1HOXA 2SBTA 4OBEA 4TWBA 2HNKA 4QXPA 4ND8B 4A16A 1I6KA 3H0EA 3HNPA 4GKVA 1BEEA 1KO4A 1Z0SA 3B7GA 1YI8A 3DP7A 3EMVA 4J1TC 3LG2A 4RKFA 2QPAA 3KHUA 5HIJA 4J9UE 3AR7A 2J3MA 1EXMA 2XOKA 3OQPA 1NJ1A 1XJWA 2GPTA 4D9GA 1XD2A 1KQOA 3GOQA 1RZ3A 4A2WA 4MGZR 2F55A 2P8JA 1V71A 5KKCA 3BK1A 4QICA 4EW1A 1B8PA 2ZJZA 3BCRA 2VZLA 4FYHA 4LV8B 4H7IA 4U8HA 1IVSA 5IPFA 4PYJA 3NM6B 1H0HA 3UHPA 2IZ0A 2CHVA 3CZ9A 4TTRA 2VYCA 4BGEA 4WBNB 1TKAA 1XTJA 4KLZA 5EXTA 3H1EA 4D1YA 3F73A 4NU8X 4CGZA 4GFDA 2PZAA 3T52A 1DEHA 3QJGA 4Q19A 4R0NA 1KEWA 4AYWA 4URVR 3KP1A 2EFJA 4XJVA 3UXHA 1E2BA 1FYVA 4EELA 3WQRA 1RQLA 1SUSA 3G9TA 1OXMA 4IHAA 3T12A 2W2QA 3BTUA 2JLUA 3PR2B 4TGLA 3EF3A 3AR4A 2ZUVA 1T4MA 3IIJA 3KQVA 4OVKA 1XVAA 1IQRA 4B2LA 3GLGE 2IHKA 3C7CB 2QTHA 3AYZB 3MN1A 2YJNA 4ZVMA 1DQNA 2QX7A 3I6MA 4I4IA 3P19A 1EJ0A 3WGGA 1NF3A 1NU6A 1XF9A 1BXKA 1RCTE 4BE7B 5FF9A 4ZCRA 1UQRA 4R1TA 3B89A 4LJ5A 4RV4A 1DIGA 1OIXA 2OC9A 3MAGA 1H23A 1MAHA 4WKBA 4CFYA 4AKGA 5IJAA 4HDKA 1PT8A 2AX4A 1FFAA 4WDQA 4PNEA 4ON9A 5ADUS 2JZNA 4YYZA 3WO1A 1KZ6A 5JR3A 1B16A 4G5FA 1Z0AA 3GCXA 1XZPA 3E35A 4LWQA 3RKSA 1XZMA 3P9ZA 4JB2A 3BFXA 2DF8A 1GTL1 3I9NA 5T41A 3RSSA 2BF7A 5GJWC 4KAFA 3ZTTA 1QTRA 3U16A 3NT2A 5BNIA 1OV6A 3TRHA 3LVFO 1Y3FE 4FFOA 1VHWA 1M0EA 3KVOA 1M73E 2AN1A 4PX3A 2W93A 4XKJA 3ZDDA 1IOVA 1W4CA 1VG0B 4TVKA 3G2QA 3PPIA 4U6NA 2OQVA 2MWMA 3FCOA 3P5BA 1FXWF 3KLNA 4C4XA 1OX5A 4YHHB 3EGOA 5J23A 1ZNYA 4DCJA 1Z0DA 4Q93A 1GDTA 1BQEA 3WB0A 1LA2A 2DCUA 2R1VA 4JQCA 3I28A 3WMXA 4CV3A 1PFVA 2PUFA 2J8ZA 2DPXA 2RC6A 2JZOA 3CPEA 1U4SA 2HA3A 4LPSA 3ZNPA 4TS3A 2CUNA 2Q9CA 5FAKA 3AC0A 2D06A 5C1PA 1MEOA 1N4DA 3QPVA 4B3RB 1Z82A 5B55A 4QBHA 5JVDB 3LA8A 5CITA 1P5FA 4PG5A 3SEZA 3U31A 1LK0A 2WA2A 4JSYA 4WXHA 3E8XA 4TYQA 3UPDA 4V0OA 4W5WA 1ZKDA 3CUTA 4I46A 1TL7C 3EIUA 1P29A 3CUWA 2IOQA 3G9UA 4FX5A 5ECDA 5K4AA 4ECAA 4HEHA 2FW1A 2NO9A 1F2UA 1BCSB 3VI4B 2I22A 2B69A 4LK2A 2X1VA 1DCFA 4Q3DA 1L4KA 2CXQA 4YMWA 3RJMA 2FSSA 2G80A 2PX6A 2HO4A 3B6MA 3RVQA 3S2FA 1T9DA 4JXXA 3VDMA 4F2GA 1I13A 3S70A 2FUKA 4US1R 2I54A 2XE7A 3K16A 5LZ7A 3FBWA 3TIVA 3TQRA 2VDJA 1SZJG 4TYWA 1RWKA 4KZPA 3SXJA 2R5NA 2PGJA 5A2QA 1SCBA 3CPJB 1P0IA 5TGTA 3RR2A 4LQDA 4LTDA 1T9GR 3ENWA 3GPLA 2ZBDA 4A6DA 2ZIXA 4DDWA 5GZ3A 1WL8A 5C4IA 5B2ZA 4HVLA 3M5WA 1WJGA 2BKUA 2QL6A 3NRCA 4AP9A 2O6HA 3IBTA 2VQEB 3IHKA 4ARZA 2VZEA 1NY6A 1E98A 1MO5A 1KBZA 1R0YA 3AEXA 2ECFA 1T5DX 2C2KA 2EP8A 3VHLB 4L22A 3HLKA 4L4XA 2HJGA 2QUJA 3AEYA 3FNFA 3SLKA 1SK9A 3X0DA 4TXJA 1QNLA 2QENA 5CJPA 5J4LA 1YRLA 3OWHA 3VVBA 4FB5A 3HSKA 4C7OA 3G2LA 3PCTA 1ZD3A 2W37A 1VRVA 3E70C 4B8WA 3QEMA 3WKEA 5FR1A 5LMZA 5E3JA 3DV9A 4FWTA 4LYJA 1ZLYA 4IDBA 1Z17A 1PFWA 3GRPA 1SQGA 2MTBA 4DGQA 4DJJA 1I6WA 2OENG 2HRDA 3N07A 1SVWA 1DUVG 3KOMA 2QHXA 2XUQA 3WIUA 3K70C 1FUIA 3PFBA 4ZYXA 3NTOA 5A71A 5IT5A 3AFNA 4N3NA 2G5PA 3AUXA 5BQ5A 1MB9A 2YVUA 1HUQA 3RVRA 3UNXA 5JCXA 1KI7A 3ASVA 2HFKA 2OY0A 4OM7A 4PSAA 4W1QA 4MHSA 4M89A 3I8SA 1K98A 4BX8A 1BDMA 4DIEA 3QEBZ 2VFAA 2HLNA 1ZS9A 4Y9DA 4DMGA 3OFVA 4Q9AA 1Z4LA 1ZJJA 4M0KA 4RZUA 4QNMA 4WLOA 4A82A 4DNPA 4F3TA 4TLDA 2G17A 5F5LA 3F6YA 5TT1A 4IXDA 4HWTA 4OI0A 1JBQA 1Q83A 4ARAA 5A3QA 1HEUA 3WGQA 4EG6A 3OCVA 9ATCA 2BONA 1GPYA 1HF3A 3EBOA 4MKRA 1CFZA 4BB9A 5LLDA 1NMSA 4A26A 4B71A 5TLSA 3OZTA 1I7LA 1E6KA 1R0RE 4B43A 2XGJA 3TEJA 5REQB 2WNIA 2D5BA 3QLUA 3GLFB 1WBDA 4BP9A 3CKLA 4XFDA 1V3UA 4GNKA 1K8ZB 5DLDA 1RHRA 4ZN6A 1P2FA 4PTZA 1JA0A 4UUOA 1JHPA 1L0BA 1GQRA 1XD8A 4CTOA 4TTTS 3OFJA 4TOIA 4AJHA 2O8DA 4BMYA 1COWD 2PSHA 1G8YA 1L7OA 5JJ5A 3PJEA 2RGBA 2XSZD 2C4HA 1LNQA 5G3ZA 1CV2A 3K5PA 3KB8A 4YUAA 3Q4GA 1E63A 3IA2A 1ZBQA 1EEXB 1IWOA 1Z6AA 1NWCA 2LDXA 3EVDA 3H3FA 1I4OA 1JPVA 5K7SA 2PU7A 4KV7A 3GX1A 3NUQA 2A0UA 4KLCA 5HIMA 1O6CA 4KTVE 3SR0A 5A02A 3OQMA 5I4IA 3EAGA 1PSDA 3RTGA 1DEOA 1WLSA 4F45A 4UD2A 5CA1A 1HDIA 1OF1A 2HMAA 4REQB 1NG1A 4DSNA 5KOIA 2TECE 5CVCA 4MOWA 3SC2A 3O2JA 2FFQA 1VG1A 3ITEA 1DHTA 3HS3A 1QP0A 5A4AA 1H9CA 3U4IA 2ZIUB 5FTMA 1F4VA 1JHVA 1TM3E 1X9HA 2PJDA 1PJQA 3CRZA 4H35A 2PJRA 3DJFA 1LC3A 1BQ4A 2PQ2A 2RHTA 2VF5X 3N2ZB 4HZUA 4LHSA 5JE8A 4EJMA 1AC5A 2EL7A 4EHFA 4PPNA 5IZCA 4Q4HA 3VKVA 3IRVA 2PUDA 1U1EA 5U1PA 1IDOA 1OHHD 3FIUA 3QWIA 1Q3HA 3GCZA 5KJFA 3QVTA 3LNCA 4URFA 5EYPB 3WC4A 1X7XB 5A7FA 4N76A 3A7EA 5AM1A 3OAAA 5LJLA 5LQCA 3VMMA 2OE2A 4B9AA 1E5XA 4ZMBA 5JRJA 4GYYA 4YDSA 3I34X 5CLFA 3GVXA 2JEZA 5AW3A 1G20B 1HMYA 4WCFC 4BX3A 1G42A 1LUAA 3F2VA 3OQIB 4HNUA 3CRMA 5E2IA 4BRZA 3BDAA 3SQDA 3EIWA 1JX6A 2BE7A 2IBMA 3R5KA 1U0TA 3AZQA 4TTVA 2MJLA 1U4NA 4L2IB 4WCDA 2JATA 4HUJA 4AL4A 3NOXA 4AG3A 4D25A 1PCXA 1L7QA 2Q2OA 5KEIA 3G9XA 4BMPB 3V55A 1E7WA 2O7SA 3ZJYA 2BHLA 2W6IA 1KDZA 1E2UA 1Y3DE 3FTDA 4WESA 3Q40A 4HAUA 5DM0A 3NGLA 4NOLA 5A03A 1TVKA 4XX1A 3LP8A 3T5AA 4QJ4A 1REQA 2YMQA 2B8JA 5JNTA 3VR6H 1UDBA 1V39A 1Z73A 2VH2A 3LHSA 3QNWA 4LSWA 4LZPA 4YFYA 4EMUA 1OI7A 2EJWA 3IBGA 3T95A 1E18A 4OQLA 3CS3A 3IEVA 1XLWA 1LBTA 1E32A 2EKLA 1XJ5A 1FSPA 1T5OA 2BCJQ 2RHBA 2AJ8A 4FGKA 1U0SY 3WK5A 4Q21A 1E9VA 4QAQA 1J0XO 3KR2A 4E2XA 3ND6A 2YWGA 2WTXA 1FEZA 1MB0A 1K5PA 1WW2A 1F0NA 1WAMA 2KWIA 1L5OA 2WB4A 3DE6X 5AHRA 5ED4A 4YMHA 3HB5X 3DAFA 4BQSA 4DV2B 2R79A 2OP1A 2FQ1A 1XA3A 3UAXA 1VLMA 3E1SA 4D5GA 1RM3A 2FJ0A 2LIVA 3LF2A 1JSXA 1CRLA 3GEEA 4G1EB 3KJQA 3EXG1 3W8RA 1DP4A 5K8VA 1Z2PX 3HKEB 2XKKA 1KJWA 1XRLA 3CVJA 4G3XA 1QU3A 4D5EA 4NK4A 4ZREA 3HCFA 3ESXA 3MLBA 1K9VF 1PTKA 4EPVA 2IXEA 3PEUA 2P2CA 2BUCA 1N0UA 4FHEA 3IT1A 2QMYA 2CXXA 2NU7B 1L7AA 1AF4A 3DYIA 3F74A 1HX7A 5CT8A 1JNXX 5DIFA 1GPAA 2I2BA 2O2CA 1N7GA 2Q7XA 1YH3A 3PPYA 3UW1A 1O08A 5F51A 3HC7A 4G2TA 3ZHZA 1EXNA 5HZGA 3NANA 2IPMA 2HT6A 4JT2A 2J9FB 1PNTA 1RD4A 4CN8A 4DLBA 2OQIA 3RTDA 4RIIA 2RHMA 4LJ8A 4E5YA 1UC9A 3BIJA 1UBUS 2RHWA 4R2JA 2ODBA 3H2JA 5KTPA 1L8AA 3BD7A 4Q7KA 2R6AA 1WRBA 4IIFA 2WAXA 1HNXB 1WXDA 3LIIA 1BFKA 1MQAA 3UB3A 3GRZA 2XXAB 2AXQA 4HADA 3L92A 1RYEA 1US8B 1E0AA 3L4KA 3QVJA 4P2GA 5HFAA 3MJHA 3A1EA 5A4IS 3UKDA 1K7SN 3V8PA 3D7NA