2QAGC

Crystal structure of human septin trimer 2/6/7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
282
structure length
224
Chain Sequence
ANLPNQVYRKSVKGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSTVQVEQSKVLQLLLTIVDTPWQPVIDYIDSKFEDYLNAESRNRRQMPDNVQCCLYFIAPGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPLPLAVVGGRQYPWGVAEVGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into filament formation by mammalian septins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, structural protein
molecule keywords Septin-2
total genus 29
structure length 224
sequence length 282
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qagC00
1E2NA 1MO5A 1VPLA 4AKGA 3N70A 4NPHA 2Z6VA 3SYNA 4AG5A 4DDTA 5AUOB 1D8TA 1DAFA 3NBFA 1SVLA 3KB1A 4HEJA 4A8JC 1G4UR 4TL7A 1G8GA 2TMKA 2AKAB 1KSFX 2FG5A 5JEDA 1BOFA 2ORVA 3QKRB 3NVAA 4D4MA 2QT1A 4P0TA 1SVKA 5CLLA 1N6NA 2OCBA 1VCMA 2RCNA 3FMPB 3QXHA 5KUTA 1XTIA 3ZJYA 4DWJA 5CJ2A 4UJ3A 3MCAA 2RHDA 4HAZA 4PHTA 821PA 2VF8A 3W3ZB 1GNPA 2V6IA 4R98A 1B0UA 1P6XA 5HR5A 4C0SA 1L8QA 2GCOB 3U7GA 1GIAA 1KOFA 3P20A 4HAYA 4WXPA 5GJBA 2O0JA 3AQ4A 3CX8A 1G4AE 2QQEA 3RRZA 1OKKD 1Z0AA 4DLYA 1AGRA 2Q6TA 1CTQA 1E0SA 1IY1A 1KZ7B 1AM4D 2IYZA 4KYIB 4MQBA 1CEEA 2WWIA 2FU5C 4C0HA 5D3MB 2ODNA 3QIAA 4UQOA 5J4LA 5KSOA 4ERNA 4GSYA 1M1YE 4I99A 5AJXA 3KJEA 5FOUA 2ZRGA 4JT2A 4RJLA 5LBIA 2WV9A 3H4MA 2VP0A 4WAUA 3BERA 2X77A 2HLDD 1E0KA 1KNXA 2J9RA 2QMHA 1EXMA 1W4AA 1KY2A 4BLTA 1XX6A 1W5TA 5LD2C 2F3TA 1T3SA 4KAXA 4YMVA 3RS5A 3UKDA 4M22A 2DFTA 4QRHA 1Z6YA 2BM1A 4PC2A 4PO1A 4Q4LA 2GJ9A 5F9FA 3FHCB 2IA5A 2XZPA 4R2HA 4M21A 3BORA 3ONWA 1P2TA 2PEYA 3SHWA 1GRQA 3SBEA 3OEEA 3NXSA 3ND9A 4WIAA 5FBVB 3QPUA 4ON9A 4HUTA 1HE8B 2P2LA 2YOGA 3CONA 3IO5A 3K0AB 3QVVA 1NP6A 2ODWA 1TPZA 4ZCMA 2GZHA 2VL7A 1NF3A 1XJCA 1WE2A 2JCSA 1DAEA 2NPIA 5FTNA 2GF9A 1G3IA 2GHIA 3X1WA 2DB3A 2CLCX 4C0LA 2NTYC 2JJ8A 2PCLA 2CEAA 2WOJA 1HUQA 1YR9A 3REFA 3LWNA 3ZVMA 1R0YA 2FEOA 3I5YA 2C8VA 1K5DA 1V5WA 4M9SA 1OLOA 4Q7LA 4KFSA 2IEZA 1ZC4A 4NBSA 1EWQA 1R5NA 3DPUA 4MGIR 1MRSA 5J47A 4OK3A 4F4CA 1NBMD 1P62B 2X2FA 1Y63A 5B2ZA 3L2OB 1KSGA 1OH5A 5H1YA 3UMRA 4US1R 3GLFE 4LUCA 1OPXA 4RZ3A 2QAGA 1G291 3VKWA 4LHWA 4M1SA 1DVRA 2EFHB 3I92A 3GLIA 3PEYA 1M74A 1Z8FA 2BKEA 2EWVA 5F9HA 1ZUIA 2VTKA 3U7FB 3T61A 3R8FA 4EJSA 3TUZC 5FTJA 1AIPA 1AZSC 3LO5A 1AN0A 1A5TA 1FUUA 3WMFA 1FQJA 3KQNA 3G0HA 4MA4A 2IS4A 2IXEA 3HWSA 2CHQA 4M9XA 4P4SA 3WRXC 4A9AA 1XNJA 2O8CA 1E2KA 2EFGA 4XH9B 4LSGA 4GZLA 4H1VA 1IY2A 3PIRA 5AUNB 3MWKA 3QXJA 5DE3A 1FOEB 5JRJA 5JWOA 1E9AA 4M53A 2CCGA 2RGGA 1TF7A 4IVPA 2OCPA 3GCGA 3GLHE 3TQCA 2ZJOA 4YDHB 2ZR0A 3THWA 4DJTA 2HCBA 1UEIA 1JEDA 4B76A 3U6BA 3RWOA 4BPBA 2ZUDA 3PXGA 2QPOA 3GFPA 4QG7A 4N1AA 3FTQA 4LHXA 3W8NA 4YLGA 3T1VA 1Q20A 1RYFA 3B82A 5FBWB 1GM5A 1E94E 3CH4B 5AJVB 4KSCA 2ZYWX 4UNSA 5HZKA 2QMEA 4D0GA 4Q7JB 2GILA 5JS8A 1PJRA 2B21A 1EFTA 4KHZA 2WIAA 2GTPA 3QF4B 4DLTA 1XD8A 5DLQC 4CIDA 2D4HA 5AUPB 2FFHA 4CEHA 4M8NE 3ZQ6A 3ZIAA 1NBME 1AKYA 3OAAA 4IW3B 1Z0JA 4NCHA 3X1ZA 3D6TB 4NKRA 3PFIA 5FPSA 2VHQA 3GPLA 4XSGA 3X1DA 1SXJB 2ZRAA 4BRWA 1P4SA 3EA0A 2LKDA 4GBMA 3VAAA 2BV3A 4WA7A 1YR8A 1XDBA 3WHLA 4BFXA 2G83A 2RKOA 1E2HA 1UKYA 2XOKD 1IN6A 2ZXUA 1MR3F 1WA5A 1DG1G 1NVVR 2YC2C 1N6LA 2J7KA 3QXSA 4B48A 1US8B 2GBLC 2CNWA 4IEEA 4Q4HB 3EXAA 3I61A 4LBZA 4Q1CA 3NIBA 1KK2A 3WP0A 2WSSD 3HR8A 1UJ2A 4NTZA 2YJTD 1AS3A 2OEPA 3UIEA 4CT4B 4DRZA 5EP1A 2ZYUX 1YU9A 2H5EA 2NO1A 2JIZD 4MUAA 1DAMA 3CB4A 3AKEA 4HAVA 3I8XA 2O52A 2CJWA 1JBKA 1KI6B 2GKSA 2QAGB 1JAHA 2V1XA 3MJHA 2IYLD 4M1TA 3Q7PA 4DSNA 1ONBA 2E87A 4IXMA 3RANA 3KXKA 3QBVA 2OLJA 3NBXX 4DVGA 5J4KA 2DY1A 4CEIB 2WJVA 3R7WB 3LDAA 2ZSEA 4JLOA 4QBIA 4URXR 2RHMA 2GJSA 3U3JA 5AJYA 2VP6A 3BXZA 1S1CA 4V0OA 1XJ0A 2JDIA 1A7JA 5DNYB 2H7VA 1R0WA 4GOXA 1DS6A 1S3SA 2QGZA 3FB4A 2BBWA 3JZMA 5EE3A 3QF7A 2WAYA 121PA 2CK3A 2ZRBA 4KBFA 1IN8A 3IKJA 2CK3D 1XU4A 1E9SA 4DLVA 4OHZA 3GEIA 1X8KA 3QKRA 5TARA 3RS3A 5HPYB 5IK2D 1GL6A 2X19A 5K8TA 1JPNA 1HV8A 2VP4A 2ZRMA 1A2BA 3PENA 1TL7C 1TF5A 2GESA 1TX4B 4FW9A 4GRAA 2ZRIA 2MSDB 2OHFA 3CO5A 2ZAOA 5FL3A 1I2DA 2ZE7A 3CWZA 1VYTA 5E7MA 1P73A 4EPRA 3C41J 1X6VA 3CRRA 2Q21A 3Q5DA 3FMOB 1CS4C 4MKFA 3ZD7A 1XEXA 2CLSA 4QBFA 2ZETA 1AJEA 3VR1A 5A5GA 2A9KA 3CNNA 2IYYA 1Z83A 4DB4A 2ECKA 1IAQA 3O8DA 2H92A 2J0SA 4AWXA 4BFTA 4BFZA 1N0WA 2ZS8A 1YE8A 1G6OA 2R8RA 2YWEA 3GJ4A 4A2WA 2ODBA 1XXHA 4M9ZA 1NVVQ 2LWIA 1FMJA 4IVQA 4IJMA 3L82B 5SZKB 4A15A 3MLEA 1UBFA 1NMYA 5E4FA 1NG9A 1CP2A 1PUIA 1ZIPA 1ZRHA 3GJ7A 4GT1A 4DBLC 3M0EA 3N5CA 1TTTA 3LW8A 5SZJA 4A8JB 4JL8A 1TU3A 3B9QA 3VFDA 2VRWA 3LLMA 4NYIQ 4PQYA 3FPAA 2ZVPX 4HAWA 1C4OA 1S0UA 4MGZR 4Z8XA 1NJGA 3CW2A 1MABB 2IT1A 4DLRA 3RLFA 5DHAA 1YZQA 3DVLA 4LV6A 5D3QA 3THOA 2BWJA 4R71A 2GETA 5BN4A 5KDOA 1F2TB 2IYSA 4XVUA 1W36B 2R6DA 3AGQA 2AFIE 4EQ6B 1CJTC 3AP1A 3QVUA 5EP2A 1ZCAA 4U5XA 1TQ6A 5EXSA 4M1MA 2ZUCA 1H8EA 1ZM4A 3P4XA 4KJZA 4M0LA 2ZITA 3PUVA 4N3NA 3KQLA 5DIFA 2J87A 3DZDA 3ZZUA 1Z2AA 3QE0A 4ZPXA 2SHKA 2AD5A 521PA 1C9KA 1N0UA 3BH7A 3K1JA 1GKIA 1P2UA 1A2KC 3KKNA 2FWRA 3GEEA 4WZ6A 1Z07A 2QL6A 5A0FA 4P32A 1FMLA 4CDGA 2QE7A 3KUDA 1WRBA 4GI7A 3ETLA 2WM9B 3KKPA 2C04A 1ETUA 3U3RA 1Z08A 1E96A 5A4JA 1Z47A 4M9QA 2P3SA 3FKQA 5CYPA 4N0DA 3EIQA 1IN5A 1F5NA 4ABYA 4UXHA 2IEYA 2W6ID 4YMUA 2X2EA 3W34A 3HDTA 3K70C 2AR7A 1Q1EA 4AI6A 1SKYB 2IYRA 1EFUA 4FN5A 1YZLA 5TXGA 4DCUA 4KITB 2BBSA 4KO8A 3K0SA 1BYUA 3C15C 3IHWA 1VCIA 3DKPA 2GEDA 3AUXA 3CM0A 2J45A 3FFBA 3CPHA 1E3MA 4B3GA 2V8OA 4JLNA 4XWAA 4Q9IA 5CK5A 3RC8A 2F9LA 2VEDA 2IS6A 4JLDA 4FXPA 5KO2A 2J41A 4Q7KA 2VLIA 3LBNA 3U3MA 3ADBA 1UPTA 1VKJA 1U9IA 1ZM3A 1FTSA 4MYHA 1NN3A 3T34A 4F4JA 3LQQA 2BC9A 2CDNA 4BLPA 4WW0A 1E4YA 2ZE8A 3FHOA 4BFYA 4EJSC 2CJWB 4B35A 2WJJA 4JZKA 4X8LA 4MYUA 4V0MA 3RS7A 5FPKA 4DLSA 1DE0A 5KSYA 2F7SA 3RRNA 4JKIA 3W5JA 3EA5A 5FR2A 1NBMA 2OO7A 4C0QC 3FMFA 1BKDR 3A1VA 3QKSB 3VR6A 2WWGA 4QGHA 4B6FA 4XTCS 4CEJA 1EX7A 4D80A 3GLGE 2OFWA 2NMVA 2WJYA 4ESHA 3B1WA 5DI9A 1JECA 2G9NA 1AA9A 4O0MA 1F6BA 2QAJA 1VYUA 4E09A 1G3UA 721PA 2RGAA 2JJ1D 1G7TA 4TL6A 5TMPA 1TMKA 1PV4A 3OEHA 1VCNA 4GZMA 4KFUA 4Q18A 3KUCA 1Z0IA 4MKHA 4RVCA 2ZI3A 5EE0A 1GG2A 1U94A 3VKGA 3UWKA 1YVDA 3TQFA 3U7HB 4RD3A 3B85A 3THYA 2AWOA 5CDFE 1QVAA 3QKTA 3ZS8A 2XTNA 1Q1BA 3D3QA 3RS4A 1R0ZA 3C7KA 1O3YA 3VR4A 1OIVA 2BEJA 2QI9C 2Q3MA 4P33A 4P31A 3OEED 2FE4A 1S9HA 3NHBA 2QEQA 4JLPA 4Q9KA 1LFDB 2DPXA 3AVOA 3I1FA 3DM9B 2IS1A 2JGNA 3RSOA 2H16A 5L8VA 1MO3A 3CZQA 3M1IA 2G77B 2GA8A 1NVUQ 2YINC 2HDNB 4RD6A 4B3BA 4TTRA 2ZJAA 5LB2A 1OXXK 1SHKA 1U0LA 4AY2A 4OKSA 2PL3A 2HLDA 1XEWX 3BWDD 4TT3D 3LV8A 2A5YB 1TNDA 1Z3IX 2YWFA 3TAHA 3KQKA 4XOIA 2L0XA 4LJ5A 1XMIA 1KMHB 1RRGA 4FMBB 4OQXA 4KBGA 1M7HA 1UKZA 4DDVA 3AF3A 3CRVA 1YZGA 4MYCA 3RS0A 1DAIA 2Z4SA 4LBYA 5P21A 1CJUC 2VO1A 4OYHA 4US0R 4RCZA 1H8HA 4CZ2A 1NLFA 4LHZA 2CVFA 1YKSA 5FPYA 4A0HA 1ZM2A 3O47A 4Q19A 4A2QA 2R65A 1JNYA 5GJWC 2WJGA 4JLVA 1BMFA 4JVMA 1PLJA 1UBCA 3PUWA 2BEKA 3R20A 4LJ4A 4PC6A 1OXVA 2OSBA 2P5TB 3MUFA 4B6EA 4JVNA 1CLUA 1SZPA 2QBYB 2OFXA 2R6GA 1XPOA 3CH5A 2AD1A 1VECA 3N2IA 3Q5EA 2VHJA 3QXCA 2FDCA 2XNDA 1DO0A 3CPEA 1DADA 2ZRCA 4BFVA 5FI0B 3W9YA 1NIJA 1NLYA 4Q4HA 3E2IA 5L3VA 5JFGA 4C7OA 2IS2A 2B8WA 1OE0A 2QTHA 4A6PA 5E95A 4W5JA 3C4JA 3TKLA 4BFSA 5JEEA 2W6JD 2XSZA 2NPFA 1KSHA 3SEAA 2ZI4A 1E6CA 5DI3B 3G5UA 4P4TA 2IK8A 4JVSB 3Q85A 3VU9A 5GJCA 1ZUHA 3QI2A 3TJZA 3UK6A 1S9DA 2H18A 2I3BA 2WKPA 1HYQA 1QHXA 1EFHA 4B73A 5E7JA 5EE1A 1ZD1A 4GNKA 4U00A 1Q22A 4TLBA 5FI1B 1P3JA 3B1YA 2PX0A 2BJVA 2VHTA 3MFYA 3L8ZA 4OJQA 2F1JA 4LJYA 3ZYCA 3QG1A 4TZ6A 3B60A 4UNQA 3AF2A 1G3MA 3P1JA 5C4MA 1E2LA 3T1TA 1O87A 1RC8A 2FGJA 5TDHA 2J0UB 1R5OA 1E69A 3BH6A 4GOJA 2P6UA 3KJGA 3FVQA 2WWWA 3NTUA 4C0BA 1KMHA 2QM8A 4A8JA 5SZHB 1DAGA 3ASYA 1T5IA 2I1QA 3CNOA 4LYJA 2FN4A 3ND8A 3BOSA 1T0HB 2O0KA 3MMPA 3TVDA 1KZGB 1XD9A 1CRPA 4PAMA 1E98A 2Q0HA 4TLEA 3HU1A 4YONB 1R10A 3ADKA 5FUWA 4PAQA 4Q7MB 4PANA 1G5PA 4QXAA 4V0NA 1E2MA 3UMFA 3V4RA 5BYJA 4OQFA 2GEUA 1SXJD 3DHWC 3F5FA 3C5HA 2A5GA 4HAUA 2E9SA 2ZRPA 1U8AA 4PR0A 4NCKA 2ATXA 2FZLA 4MGYR 3TW4A 1QHHB 4QHSA 3PR1A 4KVAA 3W5IA 1BH2A 3I62A 5TVKA 3SJZA 1R2QA 3RS2A 2X1VA 2DWPA 2HEIA 1D9XA 1SKYE 1U90A 1U99A 1ZIOA 3ZVLA 1DG3A 2JA1A 4TLDA 2YYZA 1ZVQA 2IL1A 3NDPA 2WWHA 2OG2A 1T5LA 3IPYA 4LHVA 2C9YA 3FE2A 2GJAA 1OFUX 4YQFA 1C1YA 4Q03A 2FNAA 4ACBA 2WWYA 4ASUD 1TQDA 4ZIRA 1XPRA 3CRMA 4ZIRB 1T8UA 5G40A 1KI4A 5HKKD 4HLUC 2BKUA 2ODEA 2BDTA 4B34A 1KMQA 4S35A 4S2EA 1GILA 1XTQA 2IUSA 2B6HA 5UKDA 3EIHA 3RRMA 4GL2A 4G5GA 1W0JD 2HF9A 1GDDA 3BB4A 2HYDA 4RD4A 1ZD8A 4HZUA 3PEWA 1H8ED 2QPTA 3LLUA 1KKMA 4ZI2A 4DDUA 2ZRLA 3MD0A 2LCFA 3V00A 2RAPA 3MWLA 4Z1MD 1SXJC 2XXAB 1QDEA 4OHWA 2FZ4A 1CBUA 4EUNA 3TLXA 3RHFA 1G9XA 1OSNA 3WMEA 5CLQA 4MYTA 5FR1A 5HE9A 3CF0A 3U4QA 4OHXA 4IOJA 1Q1ZA 5JECA 5LB4A 3SQXA 4UXIA 2GRJA 4H1UA 4LI0A 5DYIA 4ACAA 4DXAA 4LC1A 4B3CA 5LD2B 5CM8B 1NI3A 3NDBB 2ZS9A 1E9BA 1OFIA 2JLVA 1W4CA 2QA5A 2R2AA 1E1RA 2IYWA 3EARA 4QGGA 4WZBE 4MRVA 2CE2X 4IDOA 4PPNA 1Z29A 1SQ5A 2QSYA 2KBFA 1T6NA 4EQ6A 4FWIB 5FOVA 3ADCA 2EWWA 2YKGA 1FNMA 1N3BA 4NYMR 4DCVA 4AKHA 4TYQA 5CK4A 1XCGB 2OUKA 3AP2A 1ESMA 2F1IA 2MSCB 5FTMA 5TV2A 2JLSA 2O8DB 3PITA 4HATA 3U61B 1G3RA 3BJIC 2ZE5A 4ZDJA 1NN1A 3C5CA 2XZLA 3RVBA 1RRFA 2ZSDA 2WVJA 5CB8A 2WPDD 1CRQA 4OI4A 1OH8A 1EX6A 3X1XA 3EPJA 4OL0A 3LXXA 1ZUNB 4RFVA 5HZHA 1QHIA 1EFRA 4L5BA 4EPXA 4LY6A 3LBIA 4Q66C 3WYAA 1UBGA 4U7DA 1IJEA 1Z63A 3SJBA 1D9ZA 1P9WA 1MT0A 1S96A 1Y3AA 2GBLA 2WAXA 2G1KA 1H65A 3LBHA 5G3YA 1N6HA 4DKXA 1CF4A 2J1LA 4GDFA 1W48A 3Q72A 5E3HA 3FDIA 3SDZA 4P4UA 1FL9A 1R5BA 4QHYA 2QSZA 1Z5ZA 2ONKA 2XJ4A 3ZVRA 5KSZA 4HDCA 3U60B 5IDVA 1KO4A 3RSLA 1N5LA 3DMDA 1W4RA 2IYVA 4HZUB 5KSPA 4DUGD 3DKVA 4LJ9A 1ZU4A 4FIDA 221PA 2NO7A 3KZ1E 2F1RA 2YC4C 3T35A 4JS0A 1Z06A 1U2RA 4DT1A 2EVWX 2QORA 5KDLA 2C96A 2FOLA 3WRYC 1G8FA 1CJMA 1NVXQ 3QNUA 3P32A 3PUZA 2A30A 1XXHB 1GTVA 4D4JA 2PEZA 5FOTA 1J7KA 5JJKA 3VKHA 2KE5A 1DELA 1GZSA 1ZYUA 3FYHA 3H86A 2JIZA 4C0JA 1D2EA 1EK0A 3D7MA 1GP2A 3EAQA 5FOWA 4FD2A 1AZTA 1JXOA 5FL7D 4PO9A 3BBPA 3I4LA 3WYGA 4KVGA 1LNZA 2JATA 2WSSA 4HUQB 2OESA 3NKVA 4LZZA 4NYMQ 1QF9A 2GCNA 1QRAA 2ZSAA 3WNDA 3IILA 4LK2A 4F38A 2QQ0A 4XVQA 5K8IA 1R8QA 1S1MA 5JSZB 5CJPA 621PA 1P9RA 1PLKA 1M8PA 2GK6A 2VBCA 4FI3C 3VMFA 4BGDA 4Q1AA 3PUXA 2FPKA 4OQLA 2Z83A 3ZVNA 4D25A 1U98A 2ZI7A 4Q1FA 1G21E 1OYYA 3ZZ0A 2IBMA 3U5ZB 3TH5A 1A1VA 4MDEA 1FX0B 3BGWA 5JS7A 1JJ7A 4Z1MA 1M2OB 3FFAA 2ZJBA 3SS8A 1I4DD 3K0FA 1GFIA 3KKMA 4EDHA 4HYYA 4IDHA 4IVRA 4C30A 3HYTA 4DT1B 4KYUA 4YXWD 3ZS9A 4DCNA 2MSEB 1Z6GA 4OI2A 2ZJZA 1G16A 1W1WA 1QHYA 2ANCA 3W6OA 1G64A 4UNRA 3MJRA 1RJ9B 2VYFA 1IJFA 3DO6A 1X1SA 4ITRC 1K5GA 2H1LA 2NIPA 1RZ3A 2G0NA 4M1OA 3GLFB 4V0KA 5J40A 4HDQB 2NO0A 2UZIR 3JVVA 1A82A 3GMTA 4B3FX 4TYYA 3QY0A 2GCPA 3MWJA 4QM6A 2G3YA 4JSTA 4ZKEA 4C4PA 4DEYA 3TK1A 1DAHA 2P65A 3SC3A 3H84A 4BUJA 2EYUA 1L2TA 2ZI5A 4RZUA 3QENA 4PZLA 3IIMA 1L4UA 4JLJA 4AYWA 1NSTA 2B7BA 2FV8A 4A1FA 3I72A 4CEJB 5DYGA 1W7AA 3U2QA 4DLUA 1Q44A 3BS4A 5BN5A 1PLLA 5C46F 3VQTA 4AC9A 1SXJA 1W46A 5BQ5A 4KI0A 2HUPA 3IUYA 5FPHA 2GCOA 1Q3TA 3FGNA 2WHXA 4Z54A 1JR6A 2WIBA 4GP6A 1TEVA 5BYKA 1F3OA 1QHSA 3BAFA 3GJ0A 1ZD9A 2Z0MA 2AKYA 4DZZA 4NZYA 3MGCA 3TR0A 4CW7A 1XTRA 2HF8A 1AS2A 3AKCA 3L0IB 4URWR 3RC3A 1FNNA 3K8YA 3M6AA 3B78A 1N5KA 1Q12A 5C18A 4KFRA 5AR1A 1COWD 4US2R 1KI3A 2R9VA 2OBNA 1FP7A 4JBWA 1RKBA 2GEVA 4LGMA 4EJSB 1T4GA 3CX6A 3B8HA 4GMXA 4I1VA 1N6PA 2AFHE 4R7ZA 4MITA 4JL6A 1P75A 4AIIA 5BN3A 3AVVA 5B64A 1J8MF 4HB0A 3QJYA 5J4YA 2FSIA 1XBTA 3CKLA 1X8LA 2EW1A 1VIAA 4E03A 4QJ3A 2QTFA 1BS1A 3K0CA 5K8UA 3X2SA 3J81k 1JEEA 1P9NA 2CL0X 2EFEB 4PFSA 5GVRA 3THXA 4U02A 2R44A 1FX0A 4JBXA 4D4KA 2HYIC 1XCMA 1Z6AA 3L8YA 3WY9A 5F3WB 3RWMB 4AYXA 1WBDA 1E9DA 2QAGC 4IDNA 4IDPA 4G5OA 2W0MA 3DOEA 4DSUA 2VP9A 1D2NA 2OXCA 3K9HA 2C2HA 1N25A 3AH8A 1E2DA 3VX4A 2RGXA 1UKVY 1VHLA 4IRUB 4LWZA 4ZI3A 1Q1QA 2OBMA 4TMKA 3KQUA 3UPUA 1P2VA 3CZPA 3TUIC 5DGXA 4ZCIA 4PHHA 4Q00A 1G8PA 1JB1A 5CB6A 3THYB 3WNBA 2VP5A 2ZRNA 1P72A 2JJ2D 2PT5A 2QU8A 1GVNB 4Y0AA 1A4RA 3CR8A 1KY3A 1BYIA 2R6CA 5L3QA 4B2IA 5JZVA 4JSYA 2J3EA 1KI9A 2R62A 2ZANA 3LX5A 5KNBA 3PV0A 3G82C 2FH5B 5CIWA 5KPDA 4V02A 1HEIA 4PZYA 1H8HD 2XITA 3ZZTA 4EPWA 4E5UA 3RAPR 3S1AA 4E22A 3M4YA 3EASA 2B8TA 2O8EA 1ZBDA 3I8SA 1OJLA 1E79D 2HV8A 5ANRB 1IXRC 2AWNA 3I3SR 4ZDWA 5JLJA 1QG2A 2ZTSA 3OESA 4TMVA 1YR7A 4AKIA 1Z2CA 3MWYW 1DARA 1DAKA 3IGFA 1TUEA 2ZEJA 3OIWA 3ZGXA 2GXAA 1OIXA 4HB2A 4B43A 2NG1A 1W4BA 2V55B 3UG6A 2J0QA 1RPZA 3U6KA 3O8BA 3IBGA 1KGDA 4LYHA 3AVUA 5EP4A 4IEIA 2RGNA 2O8CB 2W58A 4KV9A 4IXNA 3MRSA 1II8B 3TVTA 4F4IA 4DHEA 4KCGA 4MUBA 5HCNA 5IF9A 3ZH9B 1M34E 1W2GA 3CRQA 1LS1A 1P60A 4Q4JB 3BH0A 4ESVA 3CWQA 1W0KD 2BMEA 2WKQA 4LJAA 1RYHA 2FPLA 1E2IA 5FBLB 5H8WA 3ICEA 3EPHA 4JJZA 2QP4A 2J7PA 2VP2A 2YHSA 4R9UC 1XP8A 2PX3A 3ADDA 3ZD6A 4A0FA 4M4SA 1AGPA 2PBRA 4L4UA 3QXXA 3THXB 2GK7A 1U8ZA 4E07A 1LY1A 3A1UA 3AKDA 3F8TA 4BLOA 4D6PA 5EQTA 4KXFB 2JJ1A 4B3XA 1TQ4A 4G5RA 3WNCA 1XRJA 4ZKDA 5G53C 3U3OA 4LX0A 1KJWA 2D06A 1R0XA 1WB9A 2BMFA 4IKEA 4DDWA 3K09A 3BRWD 3AF0A 2DR3A 4PXAA 3SYKA 1NL3A 1OW3B 1F48A 3W8RA 2XGJA 4L9SA 3HJNA 4Z8YA 3KDSE 3FOZA 2QROA 2GVDC 3T1QA 1QG4A 4C3ZA 4B3DA 3DL0A 5C1BA 1ELOA 1E2GA 1G19A 4G5SA 2IF2A 5F2EA 4D0LB 1SVIA 3R9XA 1MH1A 4LHYA 5BXQC 3KQHA 3VHXA 2BMJA 3PVSA 1II0A 2QNRA 2YZ2A 2ZYTX 1VYVA 2F3RA 2N46A 3A6PC 2ZUBA 4TYPA 4NCNA 4XTRA 2QP9X 5IHPA 2F43B 1MV5A 2XX3A 4IOKA 2A5FA 4EPYA 2CCKA 1DBSA 1N6OA 1KI8A 1KI2A 4PHGA 4LJ7A 3E5HA 1E2FA 2EU8A 3B7GA 5JJIA 2H57A 4MRRA 1N5JA 3OF5A 3SE0A 2BVNA 5IT5A 1VIYA 4H9GA 2F6RA 4Q1EA 1OHHD 1X3SA 2GAOA 3HU2A 4Q1DA 5JMTA 4NU0A 1G3QA 3CF6R 2AXNA 4PC1A 2IWHA 1JAIA 4JBYA 2W6IA 2QPAA 2IHBA 3UG7A 2XZOA 3WBJA 4D26A 1M7BA 3U3KA 1F2TA 2O8EB 1G18A 2YWGA 4Q4JA 3BE4A 2RGEA 2MMGA 1EG7A 2P67A 2PCJA 2D2FA 3TGPA 3AVQA 2ONJA 3AVXA 1JI0A 5KDDA 4BECA 1GKYA 3OIUA 5HTKA 3D8BA 3OE7D 1L7VC 2JLWA 2R6AA 1HURA 4X8HA 2KSQA 1XZPA 1FZQA 1NMZA 3WXMA 2FFAA 4IOMA 5JWRA 4YXWA 3I5XA 3SBDA 2Z43A 1Z22A 4PZZA 2JLQA 1PUJA 2F1HA 1CJVC 3EZ7A 2C95A 2KB0A 3NWJA 4JVLA 2B7CA 4TN1A 1AK2A 1K8RA 1P7CA 1DOAA 3QQ5A 1TAGA 3P4YA 2XB2A 2QRZA 3AV0B 4MRPA 2BJWA 2VHCA 3T12A 4EFNA 2NGRA 4DEXA 4OBEA 2IYQA 4PC7A 4RSGA 3VX3A 5FUYA 2V7QD 4BLQA 1SVOA 2V9PA 4GMDA 5JHGB 1OB5A 2YNMA 2OAQ1 4RZXA 3PEVA 1ZCBA 4D4LA 2XJ9A 5JSZA 3U44A 4BFWA 3OFND 3FKSA 3LNCA 5FUXA 4DLXA 1F2UB 1IBRA 1R7RA 3A4NA 5J4VA 1F60A 2W00A 2KWIA 5FL7A 1YZKA 4POAA 2QP3A 2NZ8A 3NEJA 5CIQA 3DM5A 2ASEA 3GJ5A 1E1QD 1U8YA 5CDFA 3D31A 4FCWA 4ZV4A 3B1XA 1TU4A 3Q9LA 4FINA 1ZINA 3PCRB 1KSJA 1Q57A 2GZDA 4HLDA 3SNHA 2RB4A 4F7WA 4EPVA 1XXHE 2CCJA 2GWHA 4TYNA 1ZW6A 1M7GA 2ERXA 4O25A 4FMCF 4JLBA 4TMZA 1NMXA 2PZEA 4LJ6A 3SOPA 4B74A 2IYTA 1S8FA 3GD7A 4JLAA 3K9LA 1FPMA 1S4QA 3MSXA 4XD7A 3R9WA 4PQRA 1XFAA 2OBLA 1VTKA 3K0CC 4KODA 4PQFA 1MKYA 4YMWA 4A36A 1XB2A 4C0KA 4W9MC 1I4LD 1Q3HA 2F43A 2BM0A 2XTMA 4K46A 3SN6A 2QMOA 1XMJA 1AKEA 2WSMA 1DPFA 5DSZA 3SI7A 4HI0E 4TSFD 1KO8A 2UZ3A 3KB2A 4JJKA 2VH5R 2RGDA 1GRNA 4RKFA 3A1WA 5KNDA 3V4FA 4K8OA 1MRNA 4IDQA 4Q9LA 2NQ2C 3Q3JB 4BLRA 4TSFA 1F2UA 4I81A 4TYWA 4RY2A 2VPPA 4J0QA 1YZNA 2XEXA 3FMIA 2WWXA 4LPSA 3CPJB 1I4TD 2OV2A 2DBYA 5EXTA 1EFRD 2C03A 2Q9BA 3FWYA 1OV4A 1RVDA 4XD7D 1R6BX 1GL9B 1XD2A 5EZ5A 3TW8B 4Q01A 3B2EA 2WJIA 4W5WA 3SJAA 5LDDC 1T3LA 4AK9A 4NDZA 1KO7A 5AK0A 2Q9CA 2YWHA 3IEVA 1UEJA 2IUUA 2ERYA 3EWAA 1N5IA 3U7EB 4QNRA 3SFVA 4TTQA 1HTWA 1N0VC 5LPNA 1RW4A 2ZS7A 2A78A 2X8AA 2BOVA 1NSFA 3GFTA 1LW7A 2H8KA 1G20E 3LW7A 2HT6A 2E1RA 2ZROA 2ZSBA 5DH9A 4YC7A 3ASZA 4LYFA 5H68A 1T8TA 1FTNA 2WMNB 3EZ6A 4TL8A 2OCAA 1ZP6A 5GJVC 3CUEF 3LVRE 4NCIA 2IYUA 2HJVA 1XTSA 3K09C 1Z0KA 4IFBA 2ZRDA 4A4DA 2FEMA 1E1RD 3FKSD 3OFNA 2PLRA 4FWTA 1IXZA 2CNWD 2YV5A 1FW6A 1CR0A 2IHYA 4DB2A 3B13B 5K8LA 1YRAA 3K9GA 2GVZC 2C77A 2XOKA 4B44A 1EFCA 2O0HA 2QM7A 3W3AA 1TADA 2V7QA 1OFTA 1X86B 4EAQA 4DLWA 2QY9A 1UDXA 2QT0A 2QTVB 5EUMA 2IW3A 4DSTA 2OLKA 3GLFA 1NJFA 1HT2E 1TF2A 4NONA 2PZGA 4Q9JA 1OT3A 2HJGA 4QFMA 3SJCA 2ZRKA 1S2MA 1E2QA 3EWSA 4HZIA 2ZREA 1NG1A 4HAXA 1W36C 2NOAA 3H0KA 1SVMA 3SR0A 1ZNYA 3T15A 4AG6A 3OE7A 3BD9A 4PX9A 2FFBA 3VR3A 1WDTA 1SGWA 1GITA 1NN0A 1VDZA 2N1BA 2ZR7A 4ASUA 3PG5A 1OF1A 1NN5A 3GJXC 2WMOB 3LAWA 1E9EA 1VCOA 2BCGY 3GFOA 3QKSA 3C16C 1HQCA 3HPRA 5EUQB 4M1KA 3H2YA 3H1TA 2QBYA 2OFOA 1IM2A 2RGCA 5GADl 1HE1C 4XJXA 4BLSA 3EX7C 2QMUA 5AWFC 3SU8A 1RIFA 3GLHB 4ARZB 4KLZA 1IY0A 4BASA 3I32A 1ANKA 2ZYVX 3TMKA 3K0AA 1OHHA 2WJHA 2P0EA 1VHTA 3TSOA 3ZDQA 4AD8A 1XF9A 2O5VA 5KHOC 3A1SA 2PH1A 3SYLA 5CITA 3A58B 1PZNA 2QUZA 2ATVA 1FP6A 3L0PA 4V0LA 2OT3B 3B1ZA 4CEIA 2RGBA 4O2RA 3DEFA 3T5DA 1P5ZB 3UWOA 4K81B 4R2IA 3TBKA 2RH5A 2YOHA 4L15A 1NKSA 3VR2A 2ANBA 3O8CA 4JLMA 1YQTA 2W83A 3GLHA 4ARZA 5L3SA 1RRPA 1HH4A 2J59A 4C2TA 4NYJR 4TQUS 4JMPA 4ILEA 1G8HA 4Q9HA 4LPKA 3R8CA 2G1JA 5JI3E 3WMGA 4QNMA 1XMVA 3KTAB 3KKOA 1UAAA 3VNVA 1E9RA 4G1UC 2IXFA 2UKDA 5KYKA 2G88A 2JLYA 1II9A 4GPTA 5SZIA 3EG5A 1KK1A 1RE0A 3KFVA 3AKYA 4TQAA 3RRYA 4Q02A 5FH9A 3CIOA 1MO6A 2V4ZA 4B33A 2YVUA 4NL4H 3LFUA 4HUQA 2ZJ2A 4A6XA 1QHHA 3UATA 3BC1A 1VG9B 2XNSA 3DDCA 1GRRA 2CLDX 1XMSA 4A92A 1PVOA 1N2CE 1KKLA 2GXQA 2CL7X 4DLZA 5EP3A 2C78A 1KIMA 5J4HA 3QOFA 2AK2A 4XIGS 1ZJ6A 1Q0UA 4QHTA 1KDPA 4X8OA 2D62A 4WXRA 1W49A 2BMDA 3AUYA 3KJIA 4LJ8A 1CULC 1OXUA 1M6NA 1WCV1 3B6EA 3KTAA 4BWYA 2A3RA 2WBLC 4UNNA 1UM8A 4O3MA 3AF1A 1J99A 2NO6A 4BQSA 2ZI6A 4HLCA 1W5SA 1W0KA 4LDJA 1KI1A 3AF4A 2W2VA 3NH6A 1GL7A 2GZAA 1E2EA 5H70A 2V6JA 4HLUA 2DWQA 1QVRA 2VQSA 2W6JA 3BFKA 3QPWA 1EWRA 2ORIA 1KO1A 2VSXA 3A37A 1Z0DA 3EZ2A 1W44A 4PO8A 4I1UA 1I2MA 1U9IC 3OIYA 2O8DA 1KDOA 4HB3A 4G5QA 3IIJA 3TE6A 1OH7A 3AEZA 2FSFA 2XNDD 3RABA 3GLGA 1KTVA 4W5HA 4MRNA 1UBEA 4IOLA 1UFQA 4V0ME 3REGA 4JL5A 1NY6A 4D81A 2JLXA 4XWKA 3IHLA 2D74A 5EXXA 2DFKB 2GAAA 3UANA 2XXAA 3HP1A 5DHFA 3KKQA 1BMFD 2V3CC 5FOXA 1E79A 2QENA 1HQYE 2PJRA 3LXRA 3W90A 1LTQA 1QZXA 4JIMA 4C0AC 3JVUA 2FPMA 1DTSA 4TTPA 1IN4A 3JZAA 2Z4RA 4Y0VA 5JWHA 2A5DA 4AYTA 4OQMA 2PJZA 2VHUA 4LBVA 3PJRA 4FCTA 1KI7A 3EPLA 1IONA 2ZRFA 2WWFA 4LV5B 5C2JB 1OKKA 2O8BB 2EYQA 3F0TA 4URUR 1KK3A 1B23P 3LQRA 1CR2A 3THWB 2KBEA 3A4LA 2DWOA 5DISB 3I73A 4CYMA 5JRZA 5FBQB 4X8MA 3ECCA 3K0FB 2JJ2A 2AL7A 3KXLA 2BBTA 4Q48A 4TT3A 1ZM7A 4QKQA 2PMKA 4JLKA 4QOSA 2RGNC 1G7RA 2Y8EA 4HSEA 4QBGB 1OB2A 4MGKR 3K9NA 2VF7A 2OILA 4RZ2A 2PZFA 4AURA 3OIVA 2IF0A 5JBQA 1J70A 4B75A 4P3YA 2BBOA 4Z51A 1WP9A 3QUSA 1N6KA 3CBQA 3T06B 1AQYA 2CVHA 2A2ZA 4G0NA 1IHUA 1NIPA 1ODFA 5FFMA 4C9BA 1II8A 2MMCA 3R7WA 5CM9C 5EZ6B 5DO9A 4TLCA 2K5UA 3EZFA 4ZDKA 1UF9A 3KJHA 1ZAKA 1KHTA 3B1VA 4LV8B 5JCZA 1KK0A 1W36D 1NKTA 4CRWB 2AXPA 2HXYA 4F93B 1KI6A 3KFXA 4NHOA 1WBBA 4MKIA 5J5CA 4A0GA 3LVQE 4Q4AB 2OM2A 3GLGB 4WVFA 3E1SA 2OZEA 3O8RA 5TY0A 4EFLA 2WZQA 3OEHD 1CU1A 1MABA 4TZ0A 2QN6A 4UNPA 4CEHB 4D0NA 2C9CA 3AVYA 1E9CA 2FF7A 3QF4A 5FTLA 1YR6A 4RD0A 3A36A 4II7A 2O8FA 3K70B 2VIIA 2P6RA 4WBSA 1COWA 4DC9A 1JR3A 4FMDB 2P5SA 5L3RA 1XZQA 3TRFA 5B58C 4NMMA 1G7CA 3TUJC 1AS0A 1CXZA 2IWRA 5L3QB 2W2XA 1NVWQ 2QGNA 4BZQA 1VG8A 2EFCB 4BE7B 1Z0FA 5KU1A 1GKUB 1G17A 2CXXA 3DZ8A 3L0SA 3QPVA 4EFMA 4JYBA 4Q4AA 1G7SA 1JQJC 1FUKA 3IQXA 1YZUA 2DYKA 2KI5A 3TSWA 2FMXA 4N0EA 3R9IA 1ZNZA 1L4YA 4GFDA 2JLRA 2I1VB 5DI3A 3TIFA 1ZNXA 1OFHA 5BWMA 2N42A 4A2PA 1GSIA 4O2LA 2CBZA 1GWNA 4OQNA 5EE9A 4LBWA 1ZNWA 3EC2A 4BZXA 1G1MA 4YMTA 1XEWY 2CMKA 4L9WA 5AJZA 4TMWA 4LYAA 3HPQA 4BEJA 3AP3A 4CF7A 4NCJA 4MDFA 2EQBA 5HE8A 1XWIA 3EW9A 4CVNA 3BB1A 1DEKA 1XJQA 4RD2A 4PPQA 3N2EA 1X1RA 2ORWA 1JJVA 1UDWA 1SKQA 4FMDF 4W7SA 3PUYA 1VG0B 2ZE6A 3NBYC 4OJKA 1NY5A 4M2LA 1P61B 1LF5A 1FFHA 4QJ4A 3DOFA 8OHMA 1SXJE 5FOSA 4EIWA 5AUQA 2W2TA 3VU9B 3PEUA 1QHGA 1RFLA 1WXQA 1YZTA 4ZO4A 3P27A 5B57C 1QHNA 2GJKA 4G3XA 1IOZA 2J0UA 3LH5A 5DN6A 5KPJA 4DCTA 1G41A 3LD9A 1MOZA 5E7IA 3K53A 2C98A 2QE7D 4QGFA 1DO2A 2BHRA 2ZJ5A 3CRW1 2G6BA 3GEHA 4LC0A 4P4SB 421PA 3GJ8A 3GQBA 5G3ZA 4CGZA 4I4LA 1XTKA 3K0EA 3TSZA 2XB4A 3BFVA 4KU4A 1GUAA 2FGKA 2DFNA 2KJQA 1E4VA 2LKCA 3V9PA 4IFEA 1ZU5A 3C8UA 3IBYA 5JJLA 1KNQA 1BO6A 1Z6TA 4I1SA 4TLAA 2ZPTX 4B71A 5L3SB 3QG5A 4NP6A 1Q21A 4QGAA 2R6FA 2ZU6A 2H17A 1J2JA 2OCYC 4URYR 1TEXA 2F55A 2DHRA 2CHVA 2GXSA 4BZPA 1XTJA 1X8JA 1KJZA 2YOFA 2ZQ5A 3IIKA 1XEFA 3L0OA 4PAOA 4V03A 5CYOA 2O8BA 3NG1A 2NO9A 2PT7A 3QEJA 4L16A 5EJEA 1GNRA 2JEOA 3QSYA 1WMSA 3NC0C 1TQ2A 3B9PA 4AKEA 3QEOA 3MAAC 4LOAA 5GVSA 2IXGA 2C99A 3GJ3A 2DCUA 2IUTA 4PSKA 3HU3A 4XWOA 2ZU0C 3LA6A 5JCPA 2FSGA 1FQKA 4JT4A 3VHLB 3NEYA 4TMTA 1ZMXA 2F9MA 3EZ9A 4OK5A 1LV7A 4YDSA 4Q47A 1SULA 4PSAA 1N6RA 2A5JA 3TNFA 4QM7A 2Z5FA 1E9FA 4RFSB 2WTUA 2IX3A 2PLFA 4HB4A 3E70C 1OIWA 1UKEA 1D5CA 4PHFA 3A8TA 4D82A 2C9OA 1YJ5A 4KLNA 2QG6A 3NC1C 2VA8A 2XAUA 5D3MA 4TL9A 2JLZA 4RKEA 5M04A 1E0AA 4GP7A 1LVGA 1E32A 3VTKA 1E2JA 2V1UA 5HCIA 1WF3A 1LS6A 4DUGA 4B2LA 3GP8A 3AM1A 4MRSA 4XSHA 4DSOA 4G01B 1N6IA 1T3HA 2C5LA 1Z6XA 2IYXA 5IK2A 3OZXA 4RFSA 4QL3A 1P2SA 3A4MA 2BCJQ 1OYWA 1LF0A 2AK3A 4MH0R 2EFDB 2REOA 1NNEA 3FHTA 1E0JA 2IC5A 2FSHA 4TMXA 2ZIAA 1JQLB 4BRUA 1GOTA 2GDJA 2JDID 4OI0A 4URVR 2REXB 1LB1B 4OK6A 4M1WA 4NYJQ 2O8FB 1U0HC 1XEXB 2J0VA 2W0SA 3NBZC 4BFUA 3CF2A 2WPDA 1KAGA 4OHYA 4F92B 1U81A 1SHZA 2B92A 3T1OA 1IXSB 5G41A 4CT5A 4B47A 3U4QB 5AJWA 3L43A 3AVWA 4GOKA 3LRPA 3CNLA 1JALA 5FUVA 1NRJB 1GAJA 2J46A 4LRWA 2D2EA 4NE2A 3NHAA 2NZJA 2JLUA 1QBKC 2P6NA 2ZVQX 1IN7A 1T9HA 1D6JA 2ZRHA 1WQ1R 1E1QA 3SFZA 2V54A 1CIPA 4EPTA 1KAOA 1KYIA 2FA9A 4DIEA 1ZM9A 1R4AA 2OE2A 1YRBA 2UVQA 1XCPA 2D7CA 3WBKA 4PPGA 2FX3A 3AVPA 3EC1A 4M1YA 3AB3A 4UJ5A 3IO3A 4C2UA 1GNQA 1MO4A 4WOPA 1JPJA 1HY3A 4I1OA 5TB5A 1R8SA 1VMAA 3RYTC 3TAUA 4B32A 4C7OB 1US8A 1V43A 3AVTA 1E99A 4A82A 3VNUA 2AN9A 3KL4A 1OXTA 3C14C 3GLIB 4UXJA 2REBA 3WHKA 4IHQA 1T91A 6Q21A 2WOOA 3Q8XB 2JAQA 3RDPA 2CL6X 2G0TA 3IQWA 4TQ9A 3DMNA 2CHGA 5EXPA 1EESA 1AQUA 1Z28A 1J90A 1CKEA 3GJ6A 3OAAD 2QZ4A 3B5JA 2WKRA 3ZIAD 4PSVA 4ZCLA 5EE5B 2PMDA 4QC2A 3CX7A 5KTYA 4RD1A 3W6NA 1W0JA 1KO5A 1G8YA 5BW8A 1T0JB 3ICQB 3U44B 2GJ8A 5HKKA 2ZJYA 3NH9A 1NLZA 1EGAA 1TUIA 2D3WA 3RNLA 4UKDA 2CE7A 4A0RA 3IEUA 5DN6D 4B2PA 4D2IA 1KDRA 2ZAMA 2ZI9A 2D7DA 4BEBA 2ZJ8A 4WZAE 1CR1A 3IPXA 1W47A 2VSOA 3BIFA 2WICA 1CJKC 2OXRA 2Q3FA 4URZR 4PTLA 2OAP1 3QBTA 4Q21A 1J8YF 1KDTA 3LX8A 2AX4A 4QBHA 1YHNA 1ESNA 4FMCB 3T5GA 2ZRJA 2ZSFA 5FPTA 3SZRA 2GNOA 1XPUA 3CLVA 4FCVA 5C4GB 2ZM5A 3BB3A 3SHFA 2Q9AA 4HDOB 5JHHB 4JKYA 5FBRB 3S1AB 4Q1BA 2FFQA 3KX2A 2QRNA 1G6HA 1XD2B 3EIEA 4PPFA 1RRCA 3X1YA 1SVSA 3ZQJA 3Q7QA 4HLQB 4ZDIA 5F98A 4MKGA 3A1TA 1HT1E 4RCYA 2AHOA 3OHMA 4XVRA 4PC3A 1KJYA 3ZLJA 4DCSA 3KXIA 3CR7A 4NYIR 3MG9A 3EPKA 2ZR9A 2JASA 1U0JA 1JXMA 1HA3A 2DFLA 3AGPA 2J5XA 3HYRA 3LY5A 4EKDA 4LCBA 1JR3D 2BIFA 1SVWA 1ZC3A 2A7QA 5KOYA 3WYFA 4DIDA 4NH0A 1BIFA 4OI1A 2XTZA 2HXSA 1D2MA 1VG1A 4YMSA 3K70D 2Q3HA 1W2HA 4KFTA 5IRCD 3F3YA 2HCJB 3QKUA 3GLIE 3BK7A 2FJUA 3UMSA 4OHVA 1JR3E 2GXUA 1G5TA 1G5RA 1CR4A 3W6PA 3SQWA 3WP1B 3TR5A 1K6MA 3PQCA 1OH6A 4JYCA 4F91B 2J7PD 2I4IA 3HR7A 3IDQA 5FTKA 3P26A 1IQPA 1E2PA 1S3GA 4Q5IA 5B30A 1OXSC 1RJ9A 1UADA 5JI2E 2HT1A 4KSBA 4TWZA 4L8GA 3VR5A 5KNCA 4QJ5A 3BFXA 2RMKA 2VSFA 2XSZD 2GF0A 3UXMA 5ELXA
chains in the Genus database with same CATH superfamily
1E2NA 1Q3KA 1TM2A 2CKDA 1PR2A 2H9AA 2Y9MB 3E3NA 3KQVA 4GR9A 3IEPA 4H7HA 4N5LA 4OPMA 3SYNA 5AUOB 1OXMA 1DAFA 1NONA 5HRAA 2JGDB 3QUCA 3CMCO 5JATA 2BJHA 2AKAB 1EMDA 1PG2A 2FG5A 2PBFA 3WZ2A 2YS6A 3DBRA 3N7UA 2F2TA 3C3WA 3AEUB 2W2PA 1UZAA 1YRYE 4L1KA 2RCNA 3SS9X 4RTSA 5BRJA 1SM4A 5KUTA 4HL6A 4YMGA 3ZJYA 2I4TA 2O14A 1QP8A 2PX8A 4JQCA 3D5QA 5GZ1A 1M2HA 2PXAA 5FNZA 1M1YA 3JR7A 5DXAA 3OQ1A 1F4LA 5KYXA 1KOFA 3P20A 2OHHA 2QTLA 2HW8A 1Z13A 2WMDA 3OCXA 2EIXA 1KORA 1LDMA 3NTRA 1T9GR 1LLCA 3L4BC 1ORVA 2X1HA 3AL3A 3A9VA 3LZCA 2IYZA 4KYIB 2Q27A 3OJWA 2VP3A 2WWIA 1J24A 3L77A 5D3MB 3QIAA 5KSOA 3MMXA 4FHZA 4BVHA 4ERNA 1HSZA 3A1CA 1UC9A 3CR3C 3HYCA 4FEGA 3PE4A 1BX3A 4BNDB 4UM9D 1JDJA 3K30A 3H9JA 3A31A 1NBWB 1QF7A 4RJLA 4YS6A 5LBIA 5CW1A 4BP1A 1MT3A 1ZHFA 2GCIA 3C70A 4O2AF 5BXYA 1VRCA 3HVHA 4OB7A 3PFCA 3SLGA 2QUJA 1Z4OA 1K27A 2F3TA 4MVJE 4M22A 4QDJA 4TV8F 1KC3A 3UW3A 2QLBA 1GQ2A 3HGMA 4KWHA 4PLZA 1WHSB 4B9AA 4BDTA 4YRBA 3IDAA 2JAUA 3ELUA 5F9FA 3AJ8A 3BORA 3ZDZB 2I55A 4MO9A 4R8MA 1TZ2A 3N74A 1I30A 3SBEA 3OEEA 1O6ZA 3NXSA 3ESZA 1IZ0A 4CIVA 2IU4A 2I2DA 3RW9A 4ON9A 1UM9B 2XB2A 1LRKA 3C7TA 1PT9A 4HUTA 2BSQA 4XLZA 4L57A 2CHEA 3QVVA 5A71A 3ZCVA 3MXTA 1TPZA 4ZCMA 2GZHA 2VL7A 4BRZA 2VZLA 3T9CA 2XIJA 1WE2A 2JCSA 2NPIA 3X1WA 2GF9A 2GHIA 1J06A 1SKAA 1UOOA 2CLCX 1XWFA 2FPGA 2G63A 4RM2A 5A3RA 1N32B 5AKKA 5BQ3A 4X20A 1O95A 2AOUA 2WOJA 3HI4A 3D7SA 1TT5A 5DEOA 3OOSA 5EZYA 3V2GA 4FDAA 2BEVB 4JFAA 2O59A 3H8VA 3LWNA 1AQIA 1AO0A 3SJUA 4Q7LA 1K5DA 4CMIA 4CDNA 4HY3A 4KFSA 4H77A 2IEZA 5DCUA 2NX2A 4D8TA 4NBSA 4NULA 2O19A 3IYLW 3L1JA 1KARA 5C7LO 4YJ3B 5K4GA 4IIFA 1JRLA 4OK3A 3NR2A 2F4VB 1O8CA 1NBMD 2DPGA 3LF1A 1QGZA 5IH3A 1ZVVA 1V9SA 3U19A 2X4DA 1WQ3A 4L8FA 3BG5A 4US1R 5I8WA 1D4ZA 1DQRA 3WWOA 2QAGA 3KPJA 1ZGBA 3O9VA 3HLKA 3PHHA 4FDTA 4U7JA 1NASA 1DVRA 2EFHB 4IIEA 2BKEA 2EWVA 3W5DA 1H42A 3OZWA 5CEEA 1XU7A 2WKSA 1ZUIA 2VTKA 5KOJA 1DQPA 4YRQA 3T61A 3SWWA 4JJ7A 4QDUA 1R0KA 1BS2A 1FYEA 1A5TA 3SEFA 4LXXA 1VFPA 1FQJA 3DS8A 3I42A 5SICE 3DUWA 2E4UA 4EX6A 5B1DA 3HWSA 5JNUA 2CHQA 4M9XA 3RJ9A 1C9EA 1WF6A 4KAAA 4BOYA 3L8HA 4KL8S 3ETCA 4YCNA 1MG0A 2E37A 3ANXA 4BCDA 3QPAA 2JAWA 2QX8A 4H3VA 2ATIA 2EFGA 1IY2A 1RWKA 1NQWA 4GYWA 3BZUA 4B5KA 5AUNB 2XUHA 3P2KA 4I3GA 2X0FA 1ZSVA 1DHTA 3UM9A 4DAOA 3HDGA 1XQVA 2RGGA 4IHJA 6ABPA 1JR4A 1XMXA 4O0LA 3DLHA 1RYEA 1XHEA 2F90A 2OYCA 2MYPA 4B76A 3AT1A 2I22A 1V5IA 2O54A 1LBQA 2PKYX 4GYKA 2FPUA 4MGHA 1QPGA 2ZUDA 4JY7A 4BPBA 3ML1A 1ZR2A 1U0OC 3C4VA 3DQZA 3FTQA 1YS2X 4J1NA 3IR6A 4YLGA 4LAFA 5BT8A 1Q20A 1RYFA 3OJXA 4QXMA 4RGVA 1TC2A 2XWJI 4U2FA 3WIUA 4B7UA 5HIIA 4UNSA 2JFGA 1I7SB 4O8ZA 4XB1A 3G79A 4ER0A 2WF8A 3U4AA 2H0QA 2R6ZA 4NZ9A 2WIAA 1RMTA 4TVSA 5GV7A 4Z4FA 5FWXA 2VUSA 5BSTA 3K5WA 4OH7A 2NXJA 1Q17A 1Z34A 2NSHA 3ZIAA 2OY0A 3ZQ6A 2Y1FA 4QNNA 1AKYA 3AW9A 3WSVA 5JD4A 1ZPDA 4IW3B 3KT8A 4NCHA 3I9V1 3NKLA 4NKRA 4H0FA 4UU1A 5FPSA 2DHQA 2VHQA 3ZWCA 4XOUA 3WX0A 5B53A 4L02A 5JO9A 4LFAB 5KREA 4BRWA 3T3DA 3U4HA 1XIVA 1QVVA 1APBA 4B3RB 2D0PB 4DJDC 1PR9A 3LXMA 2YY6A 2KM1A 2P27A 4WA7A 3DMRA 1DIAA 1W9HA 3NTOA 3DMTA 5A2QA 5EA2A 1CQIB 1VYHA 2AVDA 5ES3A 3EVZA 2VDWB 1OLXB 1QFXA 3FSRA 4QXOA 3E9ZA 1WA5A 5CDYA 1XG5A 2YC2C 3GVPA 2P0YA 2GBLC 4Q93A 4RVGA 4Q4HB 2I4MA 1UANA 3EXAA 4LBZA 4FYVA 3NIBA 4RL6A 4BNYA 1V5GA 1UJ2A 3LHSA 3IOEA 3ESQA 1LJUA 5EP1A 1RQNA 4AY6A 1YU9A 2H5EA 5JQGF 2O2CA 3LDFA 1ZEMA 2JIZD 2I7DA 2FPIA 2J33A 4I9GA 3K8OE 3DONA 4K40A 4UBMA 5TQVA 5HYVA 1QB7A 1U7UA 4HAVA 1J0DA 2ABWA 2WDPA 1B3BA 1JBKA 4WE3A 3JW8A 4KPFC 2GKSA 3GAFA 2EP5A 2VJPA 2B78A 1IMJA 1P8JA 3L8GA 5FI5A 5CVDA 1SA0A 3KXKA 4D97A 2WD7B 2OLJA 1XL1A 4RESA 1Y7IA 1ZHHA 1FDRA 5M3BA 3IXMA 1NHWA 1W88A 3CURA 3HDVA 3R7WB 3LDAA 2ZSEA 1GPWB 3H5IA 3FWNA 3OX3A 4G56A 4C5AA 3U3JA 4QTUB 2X6QA 2BTEA 1HZZA 1X7WB 3UOAB 2DUJA 3RHTA 4KTVE 1IQUA 1XJ0A 4P7GA 1X38A 2NPOA 2JDIA 5ED4A 1RJWA 2FEWB 2F00A 3FOBA 5LKRA 1R0WA 4N5MA 1DS6A 2QGZA 1M33A 1TCBA 4UAVA 2WILA 5EE3A 3VZSA 2IYEA 3GYBA 2CK3A 2VT7A 2ZRBA 4KBFA 4LDAA 3TNYA 1IN8A 1P4JA 4IH9A 7MHTA 2B20A 1VLJA 4Q3KA 1EDDA 2Z9BA 4MB0A 4E2YA 4NIMA 3A6KA 5IK2D 3QWAA 1RPZA 1GL6A 2DY0A 4G0UA 2X19A 1E1CB 1JPNA 1Y9JA 3GHYA 1P0FA 2YRWA 3MBKA 6NULA 1WTAA 2ZRMA 3PENA 3RUDA 3RH0A 1QOZA 3FBTA 5DB4A 2FF5A 1FS4A 2UAGA 4FW9A 2VAMA 2VDNB 5A5EA 2Q2WA 1TTQB 2J0EA 3UK2A 3E23A 4NENB 4V1CI 5J2UA 4OQDA 2Y4OA 2ZAOA 3SAJA 5DULA 1I2DA 1FSSA 1L4FA 1NM5C 3CWZA 5FL3A 5I45A 5AI6A 3C41J 2C3UA 3Q5DA 3ZD7A 5ED0A 1CS4C 4YBRA 1XEXA 4KMRA 5H02A 4DJ5X 2ZETA 2VOJA 3I9MA 2GFIA 3HA7A 2IFTA 1EVZA 3LFHA 3A6EA 1LK5A 1QIFA 2ECKA 1KEUA 5IDYA 4ODIA 1M8FA 4EUFA 3V55A 1XTUA 4FXOA 1N1GA 4Z7NB 3KG2A 3TD2A 1EE9A 3C6MA 5DBEX 4AMBA 1XXHA 2HJHA 2IIBA 4M9ZA 3AUFA 2Z8XA 1OBOA 1FMJA 2LWIA 3GIWA 2X5NA 1I36A 4MW1A 5K45A 2Y93A 3PDWA 2EKPA 1UBFA 3ZEIA 1CP2A 2H48A 1DV1A 1MA0A 4GT1A 2HXGA 5D5QA 1N33B 2IPXA 3AXSA 3OA0A 3HBAA 5JYEA 4G2NA 1R16A 2ZTMA 3KEGA 4FGKA 4R9VA 1JB9A 1YDHA 3PPVA 1N4AA 4E5YA 1L5HA 2GRUA 3IULA 3ORQA 3Q3GE 5FUBA 4AUKA 3QOWA 5AVVA 1F4VA 2JFOA 1NJGA 2EKBA 2QZSA 2GS9A 3G2LA 3KEOA 5HUQA 3TQRA 2EEPA 5DHAA 4YRTA 2FVYA 3DVLA 4LV6A 4YASA 3OCZA 2FHSA 2Z95A 4MWTA 2R84A 4R71A 1VE9A 4LNAA 4J6FA 1DBVO 3P2EA 2H65A 2IYSA 3H2BA 1NLMA 1VE3A 1PK8A 2P3QA 2ZVDA 4LF8B 3MMSA 1NW3A 2N0SA 1VB5A 1V9CA 2XDYA 3AP1A 4U5XA 5EP2A 2O4UX 3PYMA 2A4KA 5TT1A 4CLEA 5CXQA 3HCNA 3IALA 3ZXIA 4M1MA 4N3GA 4FKBA 2ZUCA 1SCNE 4RTOA 1ILEA 3PUVA 3V80A 2BR5A 1A5AB 3DZDA 4CF4A 5TR9A 4N8EA 1J8FA 3HBLA 1A2KC 1XTBA 1ZXXA 5E9AA 1Z07A 1FMLA 3WQQA 1J22A 2PWZA 2O2DA 2QE7A 3I6BA 4GI7A 1DMRA 3ETLA 4YP1A 3KKPA 4EZEA 2ZT7A 4Z49A 3U3RA 4UHCA 1E96A 1ICIA 4OUDA 3I04A 2OCXA 4M9QA 2B2XA 1H1LA 1IUKA 2Z5LA 4OQYA 2P3SA 4WNCA 5E0OA 3EIQA 1IN5A 2O1EA 3AR3A 3GRAA 4ABYA 5LP1A 2W6ID 3CCCA 3DE4X 3K70C 2H31A 4CM5A 1Q1EA 4CR7A 2V6GA 2NTEA 1GRVA 4L0QA 4JI1B 2UXDB 4UW9A 3SVLA 1HWYA 5JZ9A 5HS4A 1MHPA 1BYUA 1F8YA 4HN9A 1Z5OA 3T1YB 1AUVA 2Q1XA 1Y1RA 4C6HA 1CNFA 2PD6A 1MNAA 3H2JA 5TPWA 2ES4A 4JBLA 2GN1A 3AUXA 2J45A 3CM0A 2YFYA 4WLVA 1UBKS 3CPHA 3WISA 1DRJA 3BX1A 1VC2A 2PU7A 2JLCA 2XW6A 4V3CA 5JCOC 4JLNA 1SK9A 3KV1A 3Q6IA 4FNOA 2F9LA 4LRYA 3ZHQA 2NVBA 4FXPA 4CG0A 2J41A 2GSWA 5KO2A 4KQ1A 3PTAA 2I91A 3U3MA 1VKJA 1PTJC 1FTSA 1ZGGA 2FVXA 1MORA 3P9RA 4HEA1 4L28A 3OZBA 2BC9A 3H2GA 4CLXA 1BRMA 3F67A 4IQFA 1E4YA 1JAXA 2ZE8A 4KWEA 1JSCA 4LS3A 4Z9AA 1CE8A 3OBIA 1NVAA 1NVFA 1E61A 3PGJA 2HD4A 4V0MA 1ULBA 4GC9A 1ZWLA 1MJGM 3BA1A 3RGGA 3W05A 2VJCA 2F7SA 3EA5A 5FR2A 1NBMA 4C0QC 4CM6A 3GR6A 4KKXB 4YRRA 3GIDA 3KETA 5IUJC 3TXYA 2WWGA 4KQEA 4G0OA 2W4MA 3KELA 3OO0A 3W79A 4XTCS 1Z2EA 1PFYA 2W22A 3VI3B 4CEJA 4P34A 1SC1A 4YT5A 1QC5A 3WK6A 4G4IA 2O05A 1XK7A 3QPBA 3U40A 5AVWA 2FUCA 5G0SA 1Y6GA 2GO1A 2WJYA 4Q3CA 1JECA 1H85A 3NORA 1LLUA 4O0MA 4DQKA 1F6BA 4M8SA 1T9ZA 4HEQA 2ODPA 4P3PA 1Z5NA 4DNOA 5C7IO 1O95D 1S02A 4OSEA 1Y1TA 4L50A 4K3UA 5LXTB 2FZGA 5A4IS 1OWLA 1K4KA 4MKHA 4EF5A 2XCTB 4RVCA 5EE0A 4EG8A 1ORTA 4QULA 3A10A 1U94A 4K86A 4KQMA 3EULA 3TQFA 4WNAA 2OPHA 3LHFA 2AWOA 2I03A 4L27A 2AEJA 5EGSA 3ZS8A 1PYDA 1Q1BA 1PJBA 1YULA 1R0ZA 3C7KA 1X1EA 4JB0A 1KQNA 1OIVA 2Q7DA 3P7MA 2BEJA 1OBFO 3OP1A 4P33A 1ZCJA 3OEED 1GKLA 1Z7YA 2NNLD 4KH1A 4P31A 2JI8A 1N78A 3KJZA 1K1EA 4IGIA 4JLPA 4WL0A 1G6Q1 4YJFB 1LFDB 3OWXA 4BAGA 2DPXA 2FB9A 3AVOA 2ZXEA 4II2A 3EGVA 4P1ZA 2PMWB 1UFKA 3RUHA 1GTJ1 3VC7A 4CUZA 4D5EA 3JTEA 4DHWA 4O4LB 5JV5A 4A8TA 3M1IA 1TEHA 3WAJA 3LUBA 1ZH6A 1Z4KA 5JD3A 2GAJA 2G77B 2X4LA 2GA8A 1NVUQ 3DVAA 4OTZA 3TF5A 2DPYA 3DZHA 4INJA 1P2DA 2O2ZA 4B3BA 4BE9A 1OXXK 3ADOA 4UARA 1V8OA 1QDLB 3LX6A 2G8NA 3BE5A 3A1DA 4OOEA 5EG5A 1VL0A 1D2CA 2TECE 1VP3A 4YUXA 2HPZA 2A5YB 4HH1A 1WXHA 3KQKA 3TS1A 2L0XA 4EY4A 3CZ9A 3EVEA 4YAGA 3AR8A 3ER8A 2HLHA 4JUAA 4KBGA 1M7HA 1SRQA 1F12A 1W4LA 1Y9AA 1UKZA 3AYZB 3HY6A 3AF3A 3WLOA 1GQQA 5IPFA 3KV3O 4K9OA 1P1CA 2GWRA 2PMCA 3F7TA 4MYCA 2X58A 1ACJA 2HRBA 2Z4SA 1M0WA 5T5QA 1ZMBA 3HV0A 5I01A 1M0EA 1YTUA 3TQTA 1THGA 1KQFA 3IKTA 1SUWA 2CVFA 5CYFA 2DECA 4Q3NA 4YONB 1W30A 1C1DA 1WW2A 3PJFA 5FPYA 4O33A 5AW3A 3FBGA 4A0HA 4QSHA 4YUAA 3O47A 2RGRA 4GGOA 4LYYA 1NYQA 2QYSA 3QFRA 3VR5H 5MN5A 2CVOA 4XDHA 1HZZC 1BMFA 3D8TA 1AJEA 2JA2A 3MWEA 1CUVA 4B6EA 3N0WA 5ECWA 3GH1A 2Q2NA 3KWFA 1WDWB 2V6MA 2ZSIA 3RTGA 3PHCA 1JEAA 3O74A 1XPOA 1ZLYA 2ZQZA 1DO0A 1P0PA 2MWMA 1DADA 2WB4A 4ZO7A 1N92A 1AZWA 3KE9A 2XCLA 5J2TF 2DGDA 2FSSA 5L3VA 1EP1B 4K6FA 2QTHA 3G2NA 2IS2A 4Z99A 4A6PA 4N5HX 3NMUF 4EY7A 3FPFA 1YJCA 3VDMA 1QH8A 4KVZA 5HX7A 1IPEA 2R7LA 1CUDA 2W6JD 4KR0A 3H5OA 1HF3A 5LNK1 4TMFA 1SOVA 5KNCD 3R7SA 1VBFA 3FFTA 4HWGA 2Z8ZA 5AVRA 1QYRA 4NZNA 2IK8A 4JVSB 3UA4A 2P1ZA 4XM2A 1X14A 2IY8A 1QK3A 1UUFA 2WG2A 3H11B 3EVDA 1JEOA 1QKIA 1DC4A 1GTL1 4ATNA 3STTA 5JPDA 3E84A 3HFJA 4IX1A 3SHQA 4U1RA 1RYZA 1ZD1A 4GNKA 5EPUA 5AM4A 2H59A 2CSXA 1MW8X 4BO4A 3B1YA 2PX0A 3DP9A 2R8OA 2W2QA 2NU9A 1NOKA 3GH3A 3JQ8A 3L8ZA 3DMYA 4RK6A 2O2GA 3WDKA 5MFZA 3QJGA 1CW2B 4R81A 1L5WA 3G9QA 4O3MA 4TZ6A 3QA9A 4UNQA 2OG1A 5EJ5A 2P4EA 2NO4A 1E3WA 4QQRA 3ZK7A 2VFAA 2FGJA 1BXKA 1JSXA 1HT3A 2J0UB 3BHIA 2OORC 4UMEA 2YJGA 2BHSA 2NV2B 2IZ0A 2QJWA 3KJGA 4JQYA 3FVQA 2WWWA 1BJKA 4C0BA 1KMHA 1KMNA 1QM5A 2HX1A 2OVFA 5EWLB 3CGGA 2QM8A 4UM9B 4A8JA 4PG6A 5JDIA 1C50A 2I1QA 3DL4A 2FN4A 1T5OA 3CIFA 2F64A 3DW1X 3BOSA 4UVGA 1POXA 3ETNA 3TRKA 3HLTA 1YVPA 1K8XB 3Q2KA 1Z73A 2JIPA 3R3XA 1UBNA 3FZQA 1Z6PA 3AB8A 1W8DA 1O9GA 2ZJ7A 2DHCA 5K0CA 4PANA 5B6PA 5C1PA 3Q7RA 4Y18A 3QHPA 5BYJA 3RS8A 3TTXA 2VTBA 2NU6A 1WR8A 2Q2VA 2A5GA 2YIDA 3AK4A 3CE6A 3GF4A 1NTRA 3IUMA 1LV8A 2X4IA 3UMJA 3OMLA 2FZLA 2Q1SA 2YHIB 3MAGA 1U3WA 2MJLA 2SKDA 4LXQA 4Q0MA 2CV2A 1FDUA 3ZU4A 2W8ZA 4UTPA 3R24A 2D0OB 4UE2A 4JP5A 3D4OA 1L1FA 1RFGE 1T5BA 2FSPA 2X1VA 3A0UA 4WZAB 3SJZA 4LSWA 1C80A 2ZWIA 1U90A 2RHHA 3S99A 2HQRA 4B8WA 3PKJA 1EE2A 2UUAB 3ZVLA 4YAFA 2JFFA 1X39A 1NJ1A 1KMIY 1QQ5A 4TV9A 3MCWA 3MEQA 1CERA 5DSTA 2C7OA 4Z4GA 1Z37A 5AHRA 3IVGA 3NDPA 3DC2A 4R69A 1A8SA 2WWHA 3L92A 3I8OA 3OSUA 2XVXA 4OQPA 3OY7A 3JYHA 4LHVA 1UK9A 4L95C 5KQGA 4MEAA 2BLLA 1RCUA 3NC4A 1TCCA 4TRNA 1P0IA 5ITZA 3OP4A 1N2XA 3V6LA 2OAEA 4YQFA 5K8JB 4CODB 3CGWA 2HRRA 3O4JA 2WWYA 5ESXA 4YV7A 2I4RA 4OATA 3TSAA 3GCDA 1DRKA 3MGAA 4GMKA 4QBKA 3UAZA 3PL1A 3IR5A 4ZIRB 4INPA 2B2NA 5HKKD 4IZIA 4QAJA 5BQOA 3HSKA 4KUEA 4R40A 1KMQA 3G0CA 2YQ5A 3SHOA 4S35A 1WY5A 4I6JA 4BATA 3U09A 4BNLA 3TOSA 4NG5A 4G4SO 3T7IA 2FR0A 1GDDA 1WPQA 2W48A 2XIQA 4HQFA 2IIVA 4QYTA 4TV8A 2PS9A 3CUTA 4JNKA 4L7QA 4Q37A 1OWPA 4ZI2A 4G0VA 4D98A 2LCFA 3V00A 3U4MA 3MWLA 5CP8A 4Z1MD 1SXJC 3MF4A 1E7YA 4OHWA 3N0VA 4G0PA 1OSNA 4L4SA 3WMEA 1IIBA 3ZI4A 1M6YA 4MYTA 4PIMA 1NW8A 2WYWA 4GVPA 5FR1A 3C7DB 1FFDA 3HNOA 1NA5A 1R4MA 5JH7F 4WHMA 1BA2A 2IZ7A 3D4LA 4G23A 4ND4A 5HBGA 3HCPA 4ND3A 1U28A 5LB4A 4RA9B 1JVBA 1QNFA 4UXIA 3CH7A 4ID9A 4JLSA 5DM2A 2ZPUA 5DYIA 4NFLA 1BDJA 3GPIA 4S1TA 1XR3A 4KIFA 3CLUC 1PZFA 1NI3A 3AF5A 2AQ8A 3G7UA 1HG1A 3IUPA 2GEFA 2OR3A 3LIPA 3MLAA 2ZS9A 4CJXA 1N9KA 3LP6A 4LHEA 1OFIA 5B58T 4OXKA 4R3NA 3KK0A 1E1RA 3GBPA 1TB4A 4C29A 1QH0A 2J9ZB 4GQBA 5ALJA 2HWKA 1H0HA 1XTZA 4CF5A 4BNZA 5DF1A 2AJTA 3A14A 4IDOA 4XARA 3DULA 1YB5A 5BYAA 3C8HA 1CJCA 3EC7A 2D1RA 2KBFA 2Q5LA 3DAGA 4FWIB 4YO7A 3F4BA 3DTYA 3A70A 5AW7A 1UPFA 2PRJA 5HQ3B 2EWWA 4BMSA 1KVSA 2YKGA 2VJOA 4TQGA 4N48A 1PD1A 4FP9A 5IVIA 1T3ZA 3LWBA 4P36A 5CK4A 2HCTA 3CRNA 2DFDA 3AP2A 3L7CA 1TMOA 2XUKA 3X1KA 5FTMA 4KPUB 2EWMA 2JLSA 3PQ6A 3QMVA 3QOXA 4JEHA 1I3OA 3H19A 3BJIC 1C29B 1NN1A 1LTHR 1RRFA 1FNSA 3ENZA 4A6DA 1D7OA 3ZZ1A 1U2SA 3OZFA 4RUKA 1TZJA 1OI3A 5CB8A 3F73A 1OH8A 2VT2A 1EX6A 3MFQA 4EHAA 4N6OA 3X1XA 3MPOA 1YFJA 4M0EA 3LXXA 4OQ4A 4D8WA 4YRLA 3D8SA 5HZHA 1KEPA 4L5BA 5I9BA 5FO0A 3DCYA 4EHKA 1RBZA 1GLGA 1Y6JA 2PUVA 4FFDA 2I6XA 3DYBA 4MQLA 1D9ZA 1P9WA 2O4CA 4COKA 2W6MA 4CM8A 1W76A 3HTXA 5TX7A 1VL1A 1BVYF 3O2NA 3WGIA 1VJDA 2G1KA 4TN5A 1H65A 1N6HA 5EY5B 4DNPA 1ECCA 2J1LA 4MKRA 4OX9Y 3HVKA 2XLBA 1VHQA 3U0VA 5E3HA 2JI4A 4G37A 2F3PA 4IIJB 3L0CA 1FL9A 3E7DA 3VZRA 2ALJA 1JFLA 3FOAA 1TE2A 3FVVA 4HDCA 1SN7A 3GFSA 2ZBGA 4RLHA 3S2UA 3ZWXA 3ZDCA 1N5LA 3DMDA 1W4RA 4LE2A 5KSPA 4DUGD 2ZYRA 4E5NA 5L7TA 1LSUA 3HFRA 1U3TA 4FIDA 3WL5A 3OQMA 3KZ1E 1EZ4A 2YC4C 3B6IA 2GN8A 2QSJA 4Q3EA 1OFGA 2BFNA 2PAAA 1CLEA 1R37A 1ZZGA 2JAXA 1F2DA 4DT1A 4E31A 1XZJA 2BEUB 1BMDA 1DLJA 4PU0A 1PR3A 1G8FA 3I6MA 2C5EA 2DR2A 1YJBA 3P32A 3JQ7B 3PF8A 3ZKAA 3O94A 1XXHB 1BCRB 1X7YA 3PPWA 3OJ0A 3I5MA 2FZ5A 2PKCA 1G5HA 5FOTA 1DQSA 1JTEA 4HXEB 1UZUA 1DC5A 1FNBA 4I9HA 3SGLA 4CIWA 1ZYUA 3GV0A 2VDOB 2HA4A 3WAKA 4DADA 3R74A 3ZHCA 5KMGB 1X13A 2GT1A 1JXOA 1MX3A 4UAGA 3I4LA 2C97A 3AFHA 3UT5B 3HCWA 1LNZA 1A88A 1TO2E 2OESA 1LFAA 3R3JA 4OJTA 1G20B 1LQUA 3AM3A 2VF4X 4RJJA 5BV1A 1TAUA 3ORFA 4DUYB 3B52X 2NSDA 2WPNA 4RBNA 8AT1A 5K8IA 1LDEA 3JWGA 1ZY2A 4PICA 4MP3A 5E2BA 2FN3A 4R16A 3KAQA 5JSZB 4EZBA 1OZAA 1OLUB 4BGDA 5EZYB 4D5GA 3NANA 2C9ZA 4RXUA 1U98A 5E2IA 1V4VA 4Q1FA 4FK8A 3V7FA 4M0MA 3WDSA 2B37A 4B4KA 1E2BA 4BX8A 5A7GA 5T4BA 3PPYA 4ZZIA 4LOHA 1BROA 4FVTA 2UZ4A 3BGWA 5A3JA 1JJ7A 1UPUA 1X7ZB 2ZJBA 1HDXA 4S24A 1V25A 1FQOA 1U7OA 5LA6A 3RC7A 4BX9A 3KPWA 3EXFA 3OT1B 3C6KA 1I1HA 3KKMA 1NDUA 2Q46A 1XVUA 3QVOA 1UM9A 3G85A 4BV8A 2GPNA 4HYYA 4IVRA 4C30A 5FA5A 3BULA 4GYJA 3AJRA 3GNQA 3ZS9A 4ER7A 2MSEB 5LJIA 1J9ZA 3VNSA 4FI3F 2ECQA 3NUQA 5C34B 4ZZ0A 2M1ZA 3PYLA 3JSXA 2XTAA 4RXMA 3L0DA 2ANCA 4MINA 1G64A 1B00A 1Q74A 2PGAA 4LNHA 4M86A 2Z09A 3IURA 1XXLA 3A9RA 4YP9A 3VC2A 2ICAA 4ITRC 5CH5A 2H1LA 4J0JA 2E5WA 1Z17A 2SECE 3LT0A 5HK8A 3CNBA 3QE2A 5DXJA 2W37A 2XRZA 2HJ9A 5JMPA 2ADMA 2H3EA 1Z7GA 3QWHA 1T4MA 3BDAA 4E1BA 3HVRA 2AFHB 4MS4A 4I9UA 3Q5GA 1GCUA 4FFRA 4C4PA 8GPBA 4L3WA 4AX8A 2PUHA 2QHXA 1YF3A 3SSNA 3ZWDA 3V3KA 3CTPA 1M6WA 4IIJF 5JUWA 2JFPA 1L2TA 2QD2A 4V0RA 4BFLA 3QENA 3IP5A 3WKAA 3IIMA 3I9KA 1CT9A 1MIOA 4EO4A 4FOLA 3V3TA 5JADA 1H1TA 3FCYA 2I2FA 4G4SP 5DYGA 2OUIA 1WP4A 4AW9A 1MX1A 2FZVA 2OC9A 3CUSA 4DLUA 1RHMA 4H35A 4G85A 1MVOA 4MQ5A 3DAYA 1M75A 2VPZA 3GNSA 1XVLA 3O4VA 3JSAA 5BQ5A 4LYEA 2VTDA 5H9VA 2FSVA 4TTVA 5FPHA 1KZHA 2F3UA 4MPDA 2GCOA 4ZAWA 4WFQA 2H7XA 3H5RA 1ORHA 4KEAA 1JR6A 1Y37A 5ALNA 3W7BA 5I7RA 4REMA 3GJ0A 3IMKA 3ENKA 4PGHA 4XWGA 5FPPA 2Z0MA 2AKYA 4DZZA 1GKKA 3RTCA 4CW7A 5L4SA 1TJ5A 3M1LA 1XTRA 5JXHA 1EB9A 1XZBA 3L0IB 3RC3A 2I33A 5JPCA 4BNNA 5KC9A 5EQDA 2A94A 2W5UA 4KFRA 3M82A 2OBBA 2X3YA 1PZMA 4X66B 1FP7A 3WGTA 4JBWA 2GEVA 4LGMA 3CKYA 1HFEL 1X87A 2GHTA 2WIFA 3B8HA 3M81A 4GMXA 4I1VA 4QWWA 3DDNA 5L6MB 5TQ0B 3S8EA 2YFKA 1DG9A 4R7ZA 3SIWA 3R8CA 3R8XA 1EVYA 4PF1A 2BM9A 3ZGYA 5CR9A 3V8RA 5J4YA 4FB4A 3EFOB 1X8LA 3SSAA 1VIAA 1DWQA 5I7EA 3K0CA 4JELA 4IIBA 1JEEA 1NXTA 3BK2A 3ZTTA 3PYXA 3VJLA 2M98A 1KH2A 1SUCA 5E9QA 3G9UA 2G9RA 5I47A 3KYBA 4IUCS 4D4KA 3DSRA 5F3RA 1I5RA 3HA2A 1LW6E 2XYGA 3IL2A 3NJRA 4DJAA 2BAGA 3K2IA 5IAGA 3HC7A 4GPEA 1A0OA 1EX9A 2QAGC 4IEFB 4OF4A 5IJ9A 3ZI0A 2AHRA 3A1EA 3H9EO 4RSMA 4MZDA 4DSUA 4FFMA 1YI0A 1QGED 4NZOA 5AW9A 4BNWA 1QLHA 3DWFA 1U5AA 4IHAA 3AH8A 2E5LB 1E2DA 3EXG2 4YUWA 1UKVY 2ZIZA 2EJUA 4LWZA 4D9NA 4ZI3A 4FNGA 2ZAYA 4X1YA 1WUYA 1JJIA 3QW4B 3KQUA 4RGBA 1GGNA 3DD5A 3TLGB 3TUIC 5CAEB 4FE4A 2HNAA 3K1YA 3G0DA 3TECE 1UXGA 2D5AA 1Y82A 3LQFA 1IY8A 4HLNA 4KE7A 1T34A 3WNBA 3UENA 1P72A 2K6GA 2PXHA 3IX7A 5IEJA 3RKRA 1FFGA 3W2GA 3V7WA 4C4RA 5BUSA 2OB2A 5F5LA 2C8JA 5IAJA 4Y0AA 5JYDA 2X0JA 2OFFA 4HN2A 3WHIA 1UK7A 1NV9A 1K6EA 2HGZA 2OB1A 1BYIA 1KYVA 2R6CA 3IMCA 3IRVA 3L6BA 4YIKA 3HY4A 4QOFA 2J3EA 1KI9A 3CFYA 1Y7LA 2ZANA 3LX5A 1H0SA 4PLGA 5AOBA 5JALA 5KNBA 2FR8A 2PV7A 3AZOA 1H8HD 2XITA 2AOUB 3H1EA 2GRAA 1H2XA 3AI2A 3TM5A 5KNBD 4X62B 1L4HA 3PD0A 1PYGA 1N3IA 3W2TA 3M4YA 3CNHA 5JZMA 2YASA 1MMFB 3Q9NA 3USZA 3AUJB 1QTQA 1OJLA 1E79D 1NU8A 1SG0A 2HV8A 4H0CA 4JKOA 2VK8A 4X94A 1CYEA 2FKAA 3OESA 3PKZA 4TMVA 4PG5A 1Z2CA 3LOPA 5K3OA 2OXEA 3ZW7A 3IGFA 1TUEA 1ZXLA 3DYIA 5GONA 4FBGA 2NG1A 1NUPA 1W4BA 2V55B 4N0QA 1WXDA 1QGDA 2Q5CA 4YCMA 1SD2A 5C1OA 3PFFA 2O8CB 3I9NA 2W58A 1HL7A 1ZESA 3ETGA 1ZVJA 4IWYA 4IXNA 4KGXA 4KV9A 4ZJYA 3RVDA 1II8B 3TVTA 4X61A 4D3DA 4F4IA 4D3YA 3PEFA 1OREA 5IF9A 1QC5B 3L4SO 3R5FA 1M34E 3I23A 4PNHA 3BH0A 3KQLA 3I4CA 4C89A 4E12A 4WACA 3HBFA 5FLYA 4H18A 5LSAA 4TKUB 1G63A 3H16A 3CWQA 5F5NA 4H60A 3KLPX 3AZPA 4J8PA 4FM9A 3E5NA 2FK7A 1E2IA 3CLRD 1YTLA 4DA8A 2YHSA 3ZHBA 2HTEA 4R68A 4RAQA 3PR3A 3ZD6A 2OXFA 4A0FA 5I7HA 3VJKA 3S68A 4UASA 2JARA 3THXB 4FC6A 3UXEA 5CNJA 4F85A 3A1UA 3AESB 4LCEA 4AY5A 1XCOA 1KS2A 1SH7A 4GLBA 4ZARA 5BW6B 3RC1A 5DRYA 1SPBS 3AHHA 2V8BA 4G5RA 5G53C 1GZ6A 1EVLA 4FU0A 4ZAYA 2D06A 5KAPA 1IUPA 4F2GA 1V6SA 2BMFA 3II6X 3DGEC 4L78A 4DDWA 5DX1A 3R7AA 3K09A 3KVRA 4QEDA 3AF0A 1OWNA 4PXAA 1AZLA 5DMXA 1NL3A 1OW3B 1R0BA 4L9SA 1CD5A 1U8TA 1V95A 2HNKA 3KDSE 4PNPA 4AY3A 4D6XA 1A9PA 2XVAA 4MIYA 2I54A 1EWVA 4X90A 5K2OA 4JBIA 1SQSA 1ZGAA 1UP4A 2W2KA 2C8LA 1ACLA 1OVGA 2O5EA 4FE3A 1E2GA 1THMA 4HNUA 1EX1A 1I3KA 3H5AA 1EM8B 1G6KA 1A8HA 4BB9A 5FYDA 5I7AA 5AVUA 2HIGA 5ALOA 1CRZA 2XMGA 4J07A 1UOPA 2YZ2A 2SNIE 1VYVA 2F3RA 4RIFA 3ZY4A 5JSQA 2XGOA 4L08A 3UMGA 4PX3A 6ADHA 2CKMA 5ARDA 1XVAA 4IWXA 5IKOA 1UXJA 2GVNA 4EYSA 3PGKA 3OLZA 1DBSA 4MWZA 3GRRA 1JQEA 4JYAB 2E85A 3GJSA 3R0QA 5JJIA 2RBEA 3B7GA 2R7KA 2PVPA 4B7AA 5CG1A 5IT5A 1O58A 3ZWMA 4DCPA 1QU3A 4H9GA 2VHXA 2F6RA 3ZHYA 2XRFA 1U7TA 3ISJA 1RAFA 2VDQB 1MB4A 1Z68A 4UTOA 2C54A 4JBYA 4I50F 2IXDA 4QWMA 3DT6A 4HDSB 3UG7A 4X45A 1RDFA 2QTGA 4MI9A 4NMHA 1E92A 4BQIA 2YWGA 3FZEA 1KTIA 1OFUA 2Y66A 1GDHA 2FDXA 3U3ZA 1AKRA 2OV8A 2MMGA 1EG7A 2H1HA 1JG2A 5ICEA 1C0EA 4ER3A 3M8KA 3AVQA 1ISHA 3J81A 3H5NA 1TUGA 4UOZA 4OLBA 1SFRA 3A4YA 1PO7A 1GKYA 1PR6A 2IZ5A 3OE7D 1L9KA 4YRNA 1OPRA 1ZN8A 4DIMA 2R6AA 4LRTB 1NMZA 1EHCA 1KYTA 3H7AA 2FFAA 4YRAA 2EL9A 2Z2YA 3BFJA 1LI4A 4I4TF 3I5XA 2P2GA 1A5ZA 2H0AA 1DXQA 1XC7A 2DZDA 2F1HA 4UM8B 3IB6A 4R1NA 4OHRA 5F76A 1JTFA 1HDGO 1DKUA 3OC6A 3QQ5A 1CQJB 1P31A 3P4YA 2QRZA 1BU8A 3GJRA 4XUDA 3QVMA 2J6CA 5HGJA 3E2MA 5EKTA 3JQAB 1SD5A 4TROA 3IQEA 5CB4A 5JZOA 1G9SA 4MRPA 1U28C 4TKUA 4OMCA 5GMOA 2IV3A 2XRMA </