2QAGC

Crystal structure of human septin trimer 2/6/7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
282
structure length
224
Chain Sequence
b'ANLPNQVYRKSVKGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSTVQVEQSKVLQLLLTIVDTPWQPVIDYIDSKFEDYLNAESRNRRQMPDNVQCCLYFIAPGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPLPLAVVGGRQYPWGVAEVGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septin-2
publication title Structural insight into filament formation by mammalian septins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, structural protein
total genus 29
structure length 224
sequence length 282
ec nomenclature
pdb deposition date 2007-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qagC00
3MCAA 3WRYC 3U44A 1N6OA 4ILEA 2O8CB 1JAIA 3QG5A 5DIFA 2CL7X 3ADCA 2ZM5A 1NLFA 3RRZA 1A1VA 2O8EB 2XB4A 2QZ4A 1U0HC 1L7VC 5TV2A 2X19A 3PUXA 4EQ6B 3ICEA 2C9YA 1T3SA 5JMTA 1FTSA 2UVQA 3IGFA 4RCZA 2QSYA 4WBSA 3PCRB 1PLLA 4DLZA 2JLZA 4XVRA 1NLZA 1GL6A 1BMFD 3GFTA 1ESMA 2VLIA 3QXSA 5F9HA 2ZR7A 4KSCA 1CXZA 2DFKB 1S9HA 2IS2A 5EXSA 2O0KA 2W6ID 4M1OA 3OIYA 3AKCA 4RFSB 2QORA 1XXHA 3QKUA 1XB2A 3SHFA 5B58C 4LJ4A 4M9XA 4S35A 3B13B 5DYIA 1OKKD 4HAXA 3GEEA 3RLFA 2X1VA 4FN5A 4XVUA 4Z1MD 4Q4LA 3CRRA 3FPAA 3NBYC 3T34A 1FMJA 1NRJB 5C46F 4B3DA 2F43A 2XXAB 5EP3A 1YU9A 4DLTA 1TPZA 1B23P 2HLDA 2P3SA 4XIGS 2VP0A 1CS4C 4KCGA 2PH1A 2BM0A 1RRCA 2OLJA 3W3AA 2GCNA 1NNEA 4TWZA 5SZHB 1P3JA 4OBEA 3LXRA 2FV8A 4JLJA 3SEAA 1II9A 1XWIA 4LZZA 2O8FB 4TZ0A 2B6HA 1AGRA 3KX2A 1FP6A 1Z0FA 2O52A 3NWJA 4GP6A 4FMDF 4PPFA 1W0KD 1CULC 3MUFA 3LQQA 3B1WA 4G01B 2V3CC 1DARA 1NKSA 1NMYA 5JCZA 4HUQA 2XITA 3TKLA 5FPYA 4U02A 5L3VA 5EE3A 3VHXA 4OHZA 5M04A 3GLFA 2O8BB 3I73A 1RJ9A 4HLUA 2ZS9A 3JZMA 4LV6A 4MUBA 1OFTA 3RDPA 5J4KA 5FOSA 2ODBA 1E9SA 1QVAA 4JBXA 1JJVA 3FHCB 2OILA 3LO5A 1DAGA 5HE9A 4C0BA 2ZI3A 4ZCIA 1GFIA 1R0ZA 3PITA 3CH5A 4LDJA 4TSFA 3RSOA 4U5XA 4WZBE 4B75A 4PSVA 2H57A 4LV8B 5JCPA 3AVYA 221PA 2P0EA 2CK3A 3DKPA 1RW4A 3QPWA 3IUYA 4GZMA 2QMOA 2REBA 1E9CA 1KOFA 3W5IA 2ZSBA 1UJ2A 2I3BA 1X8LA 4NHOA 3ZIAD 4R2IA 1DADA 2YWGA 1TEXA 5DI9A 2FMXA 2MSCB 1BIFA 4ZO4A 4YLGA 4Z54A 5AJYA 1IAQA 1UDXA 5FTNA 3T1TA 1U98A 2QL6A 4AWXA 4CEJB 2I1QA 3KKQA 1SXJE 4A6XA 2MMCA 4BZQA 1A2BA 1X8JA 4Q03A 4YMTA 4FWTA 4ACBA 4LCBA 2QMHA 1XTKA 3D31A 3PQCA 1CJTC 4B2LA 2P5TB 1KYIA 5E3HA 1VYUA 2EWVA 3OE7A 4M4SA 1VCOA 4PXAA 2IHYA 2ZAMA 3JZAA 3T5GA 4LWZA 4ARZA 3GJ0A 1VCIA 3IIJA 4M1TA 1RRFA 4QBGB 4URWR 1E4VA 2E87A 1E98A 1VTKA 4D4MA 2IYZA 2PJZA 5FPSA 4F4IA 4LC1A 1E4YA 4FMDB 5ELXA 1E9FA 1EWRA 3ZVMA 5FBVB 1DAHA 2I4IA 1OF1A 4JJKA 1QHHA 3KFXA 4LI0A 2QTVB 4V03A 4PAMA 4S2EA 1C1YA 2YWEA 3CX8A 3D3QA 2IYVA 1UKVY 4P4TA 3DMDA 1IY0A 1E96A 5E7MA 3SYLA 2VHCA 1N6RA 4Q4HA 5H8WA 5JJLA 3EIQA 4YXWA 5GADl 3EX7C 3BIFA 4OK5A 1V5WA 1UFQA 2GETA 1HEIA 1R5NA 2LWIA 2QMUA 4AG5A 1NN5A 3W5JA 3CX6A 3QBTA 4TT3A 4UNSA 3QF4A 2X2EA 2W83A 1QBKC 2QSZA 4RSGA 4OJQA 1JBKA 2WPDA 2NIPA 2OLKA 3A1WA 3HDTA 2ERXA 1M1YE 3FDIA 1G5TA 1G7SA 1HT1E 2HV8A 4MYHA 4HAWA 5BW8A 1KK0A 4DBLC 3B7GA 4GBMA 4Q1CA 4DDTA 1ZCBA 2RB4A 2WBLC 3FHTA 1G9XA 5FI0B 1DG3A 2CMKA 1L8QA 3GLIA 5KDOA 1TQ2A 3AVPA 4DKXA 1G291 4JL5A 4NP6A 4DHEA 1NN3A 1TU4A 4OHXA 2ZJYA 2CCGA 2WSSA 2ZUCA 4TTPA 4F4CA 5FUVA 2OO7A 2QM7A 2VYFA 3CWZA 4LYJA 1EGAA 5FOUA 1PUJA 1UF9A 4AIIA 4AYWA 4IDHA 1P2UA 5AWFC 2CLDX 4C0JA 3KJHA 1KY2A 4Q1BA 1HQCA 1R0YA 3NHBA 3BRWD 4MITA 4IKEA 3J81k 3CIOA 4LYFA 1NF3A 2BJWA 4PC6A 4G5SA 2A5JA 4LX0A 1YZUA 1WCV1 2QPOA 4W5WA 4F7WA 2IYRA 2WWGA 3GEHA 1N6IA 4RJLA 4NCJA 4QBHA 2AKAB 4MGYR 5KO2A 1SVKA 3QG1A 3FFBA 5G40A 5CITA 3TW4A 1GDDA 5D3QA 1ELOA 1PLKA 5J47A 4AKGA 1VG0B 1HY3A 2YHSA 2D4HA 3L0OA 2PL3A 3IKJA 5AUPB 2V9PA 3O47A 4CT4B 5CJPA 4D2IA 1L2TA 4UNRA 1ZU5A 2I1VB 4NYJR 2ZE5A 2ZREA 4LHYA 4Z8YA 2G9NA 4TL7A 5DI3A 3GPLA 1IY2A 4PTLA 3W8RA 1NY5A 5JJIA 1OHHD 5K8LA 2IS4A 3V00A 3C16C 4IFBA 4B76A 4IVRA 5L8VA 3AB3A 4H1VA 2VIIA 2GXAA 2JIZA 2HUPA 3LAWA 4M1SA 1ZC3A 4B33A 5F2EA 3RS3A 4GL2A 4NBSA 2XZOA 1OYYA 3U3KA 2N46A 1G19A 2YVUA 1G8YA 1XF9A 3QXXA 4LPKA 1WRBA 4PAOA 1Z5ZA 1LV7A 3LBIA 4Q9IA 4JLAA 2ZRGA 3WNCA 2IYLD 1E2EA 5TXGA 1Q1EA 3NEYA 3I92A 4WZAE 1ETUA 2VP5A 1GG2A 4ZCMA 1OYWA 1Z47A 2AL7A 2GEVA 3FVQA 4NCNA 1WBBA 1HYQA 1F6BA 3WRXC 3A1TA 1X6VA 4BEJA 5JRJA 3PEWA 3PVSA 1FTNA 1SXJA 3GFPA 3QF7A 3AF1A 5FPHA 1FMLA 3BOSA 5FOWA 2KJQA 4XVQA 2GA8A 4GNKA 4LC0A 2IYSA 4BGDA 3QSYA 2JLQA 4IDOA 2QQEA 1RZ3A 1XJCA 2QRNA 4OKSA 4DLUA 1G1MA 1M7BA 3B1VA 1IN7A 4CVNA 1A82A 3P4YA 4LSGA 1RKBA 1Q12A 3T1VA 1AKEA 3QKSA 1KAGA 4C0HA 5K8TA 3JVVA 1KTVA 5CM9C 5JZVA 2J3EA 5CB8A 4JLOA 3TE6A 4JLMA 3REGA 1RPZA 2BCJQ 1WXQA 3I5YA 2FSIA 3QY0A 5DISB 1JNYA 3BFKA 3U3RA 4JYBA 5F98A 4QGFA 4MGKR 3A58B 1EFCA 3ZS8A 4YMUA 1F2UA 1W1WA 4RCYA 3LFUA 2WJYA 2B7CA 3I1FA 4PFSA 3E5HA 4QG7A 3R8CA 4PZYA 1DAKA 1G5RA 2XOKA 4KAXA 2MSDB 4DEYA 1SVLA 2B7BA 4MKHA 4Q7JB 3VU9A 2PZFA 1XMJA 2CNWA 1N6NA 4N3NA 2WJJA 2H18A 3Q85A 4KFTA 1YZQA 4M1KA 2J7PD 2CEAA 1W5TA 1S1MA 2JJ2A 4DSOA 1P7CA 2IHBA 1OH8A 2VL7A 1E9AA 4BFUA 3I8SA 3NKVA 2Q6TA 1Z0KA 5JRZA 4WA7A 3TUIC 2ZVQX 4F93B 2C95A 2BIFA 2PMDA 5BN4A 5L3QB 2ECKA 3QJYA 1SQ5A 3MJRA 4ASUD 1NIJA 5E7IA 3SBEA 4MDFA 3C15C 1GIAA 1T8UA 3QEOA 2C03A 2ZUDA 5FL7A 3I62A 3VR4A 1LW7A 3DM5A 3F0TA 4HZUA 3O8CA 4Y0AA 1J7KA 1IN4A 1XPUA 2DR3A 2R6DA 1S8FA 2LKCA 3IO5A 3ZZUA 3RABA 5H70A 4EFLA 4Q7LA 5BYJA 1JXOA 3Q8XB 1NVWQ 5FTKA 1FL9A 1SVSA 3GJ3A 1XTRA 3AUYA 2H17A 3KJGA 4X8HA 1U0JA 3E2IA 2P65A 1GRQA 2QTHA 3VTKA 4G5QA 3WXMA 2RGBA 3BH7A 4TLCA 1XNJA 4P33A 3FMOB 3NH9A 4DUGA 2EFDB 4HB3A 4HYYA 2IYQA 2YYZA 4HAZA 5E4FA 5HR5A 3K0SA 1CJVC 4BE7B 1Z07A 2IEZA 3CZQA 2E9SA 4D0NA 2W6JA 1GM5A 1DG1G 2IXFA 1ZNZA 4XSGA 1ZJ6A 4PPNA 4Q66C 4UKDA 2D62A 2GHIA 3LD9A 4QGAA 4ZDKA 5CYOA 2P6NA 2OFOA 1RYFA 1OXUA 3IO3A 2H7VA 3HPQA 5SZKB 4GZLA 1OFHA 2CJWB 4OI2A 1KDPA 1N6PA 3K9HA 2GXUA 2A5DA 3TW8B 2AWOA 3U61B 4BZPA 3LVQE 1QG2A 1YJ5A 4LPSA 5FI1B 2ZSFA 3U7EB 4K81B 2J45A 3GLGA 2JJ1D 3C5CA 4E5UA 2ZJ8A 2Q9CA 4CEIB 3LW7A 4JMPA 1VG8A 2IEYA 2GEDA 4LOAA 3L82B 3I8XA 3AKDA 1AS0A 1XPOA 2YC4C 1VG1A 4KBFA 2PJRA 4OQFA 2H92A 1N6LA 3RWMB 4ESVA 1XEXB 1KK2A 3HU2A 1GILA 1E2LA 5K8UA 2V4ZA 2RMKA 1KJZA 2Q3MA 4P4UA 3VX4A 5HZHA 2DCUA 1TL7C 1Z0AA 4US2R 3KDSE 3MWLA 4X8LA 2BDTA 1S3GA 4AKHA 1R10A 2RGNA 1FNNA 4POAA 1FQKA 2ZRLA 1AS3A 3K8YA 2G3YA 3K0EA 3THXA 3PJRA 4JLKA 2K5UA 4DT1B 2E1RA 2A3RA 3KTAB 4TLEA 3B1YA 2DBYA 3IDQA 1UEJA 1K5DA 1UDWA 3UANA 1M2OB 2OBNA 5TDHA 3ZVNA 2IF0A 3DOFA 2BJVA 3DOEA 1G7CA 3UPUA 3TUZC 1J2JA 1KSJA 2D2FA 2OT3B 2ZRFA 3X1WA 1O3YA 4RD4A 2AD5A 4DLXA 3OEHA 2HT1A 4IEIA 1TX4B 4HDQB 3CKLA 1NN0A 2FSGA 2CVFA 4BFVA 2J0QA 3EZ9A 5A0FA 2F1HA 4IOJA 3LX5A 5B2ZA 5JBQA 1A2KC 3A1SA 4JT4A 4W5HA 2WJVA 4MKIA 4EJSB 3AF2A 1XTIA 3R8FA 1MABA 4MUAA 1KK3A 4BFWA 3K1JA 3P1JA 2HCJB 3P20A 1W4AA 1P9NA 2CHQA 2OCYC 2JLXA 1OH6A 4JKIA 2WWIA 2Q9AA 1U9IA 2NTYC 5HCIA 3EARA 1E2HA 2GJKA 3EAQA 1L4UA 2R6GA 1XPRA 4TYYA 2V6IA 2XJ9A 1ZUHA 1OT3A 1KI3A 4TTRA 4HI0E 1DAMA 3TR0A 3UMRA 5L3SB 4QM6A 2FU5C 3B8HA 1VKJA 1OB2A 2WOJA 4OQMA 1E2DA 1DS6A 3QNUA 2AHOA 3GQBA 3PUWA 5KOYA 4BLOA 1KSHA 2NO0A 3AP3A 2OAP1 2ZRHA 4RKEA 1QHYA 1HV8A 1NIPA 2VPPA 2EU8A 2DWQA 4EKDA 1DE0A 1XD2B 5DNYB 1MT0A 4JBYA 4TYNA 4V0MA 2WZQA 4JVSB 2OFWA 3ZS9A 2C9OA 1QHXA 1VCMA 1Q0UA 4US0R 3CPJB 1E1RA 4A0FA 4D82A 1Z63A 4DC9A 2ZJBA 3TSOA 3THYA 2QEQA 2IUTA 1PLJA 4DB4A 2PX3A 1ZUIA 2WKRA 4KVAA 4D25A 1E2KA 5BN5A 1ESNA 2ANBA 3R7WA 1I4TD 2BMFA 1GTVA 2EWWA 2VQSA 2WAYA 2FGKA 1GL9B 4OHVA 4M1MA 2ZRNA 4JSYA 1J99A 1S0UA 3LVRE 2ZTSA 4EIWA 1D2MA 1NSTA 3K0FB 1X3SA 5EP1A 2ZRCA 4ZIRA 3CUEF 3IBGA 4DZZA 5K8IA 2V8OA 2F6RA 2WJGA 4Q1FA 3NG1A 5GJVC 2D2EA 3KZ1E 4EPWA 4NMMA 2BOVA 3T06B 3SJCA 4KODA 2WWHA 1G8HA 3P27A 3W34A 2NGRA 1O87A 1OV4A 1U8AA 2RH5A 4NKRA 2ZI5A 4RD0A 4BLQA 2EYQA 5KHOC 3LLMA 3IPYA 1HURA 4GMXA 1KDRA 421PA 1R5BA 1U81A 1ZP6A 3WNBA 1KI2A 2JAQA 3TMKA 3GLHE 2P5SA 3BJIC 5J5CA 4N0DA 1G7TA 3I72A 4PC3A 4B74A 2FH5B 1ZRHA 2CLCX 3CO5A 2PLRA 1J8MF 3KKNA 5JECA 3CWQA 4FCWA 2C2HA 2IBMA 3X1YA 1CLUA 2GBLA 1BYUA 3AP1A 2WJIA 2LKDA 2GEUA 5GJCA 3IEVA 4KYUA 4Q1DA 1X1RA 3Q5EA 1Z0IA 1P62B 2EFCB 1TAGA 4J0QA 2Q3FA 1M34E 4KO8A 4TLBA 3QKRB 4C0AC 2GXQA 4JL8A 3X1DA 1R8QA 1I2DA 3WP1B 2REXB 1OFIA 1E94E 2ZRBA 4HB4A 1XMSA 4OQXA 3L0SA 1IN5A 3B2EA 2FFQA 5HPYB 4FW9A 3CF6R 4Q21A 4A92A 2UZIR 2QI9C 5DHAA 2DB3A 1Y63A 3K70C 4C7OB 4A9AA 4FIDA 1F5NA 4P3YA 5JS7A 4LV5B 3BD9A 4M1WA 1UKYA 2C98A 1F2TB 4Q01A 1ZNYA 2PEYA 3M1IA 5FR1A 1R6BX 4QM7A 2CDNA 1SKYB 2WWXA 5EE5B 3S1AA 1P2TA 4CYMA 1JXMA 5SZJA 1FX0A 3QUSA 5CLLA 1QHIA 3EZ7A 1MH1A 2Z4RA 4Z51A 4Q7KA 3C5HA 1AGPA 4QFMA 4A0RA 3MAAC 4PSAA 4B3XA 1COWD 4A8JA 3KXKA 3QIAA 5HTKA 1V43A 1W4BA 4GOKA 3A6PC 2FA9A 2YNMA 3SI7A 2EYUA 2IA5A 3AF0A 4BLTA 4JIMA 4D80A 1G16A 5FBLB 5DH9A 2DPXA 1W49A 4QNMA 4IOMA 4BUJA 1E1QD 2XGJA 1W0JD 4A2QA 1H8HD 3BK7A 4G5OA 4KFRA 4W5JA 3D6TB 4TQAA 4JL6A 1PVOA 4JLBA 2JA1A 1SVOA 3TRFA 1HE8B 3QPUA 3T1OA 3TIFA 1JR6A 4HB2A 2Z5FA 3AGQA 3FFAA 2CCKA 2ZPTX 2GJ8A 2Y8EA 1KDTA 4IXNA 2OBLA 2J5XA 4L5BA 4BWYA 4WXRA 2OG2A 5TVKA 3DPUA 4CRWB 1W36B 1U0LA 2ODWA 1SKYE 4EPYA 1AS2A 3U3MA 2NO1A 1E9BA 3CRMA 3DDCA 4Q4AA 4R98A 4MYUA 4BFSA 3ADDA 1B0UA 2YC2C 1MRNA 1WE2A 5JSZB 3CRVA 1ZNXA 4A2WA 2REOA 2XSZD 2ODNA 2WHXA 2ZRAA 1P60A 1I2MA 2WIAA 4JKYA 2RKOA 4UQOA 4LJ5A 1KK1A 5B64A 4FI3C 1KDOA 1G17A 3U4QB 3OIVA 4Q4JB 1E0KA 4NONA 3DM9B 1M74A 3T12A 1GKYA 1XX6A 3Q7PA 2IYXA 4TMTA 2G0TA 4LBWA 3HR7A 4URUR 5P21A 3ZJYA 1VG9B 3FB4A 1XMVA 4JVMA 4CDGA 5HZKA 3RS2A 3FMFA 3CNLA 1H8EA 2XZLA 2ZSEA 1XEFA 4PO1A 2J9RA 1N25A 2UKDA 3B9QA 1VMAA 5FR2A 4IDQA 3FKSA 2QPTA 5J4HA 4JT2A 1E2NA 1DAIA 1XD9A 4O2LA 2JGNA 2F9MA 2G1JA 2OXCA 3TGPA 5D3MB 2J59A 1W7AA 2RGXA 2RGAA 2QBYA 4DLRA 1VDZA 3L2OB 2OESA 3GCGA 2ZANA 1W36D 1T0JB 4HEJA 4RD2A 1OW3B 3HJNA 3LY5A 3FMIA 4ZDWA 2VA8A 1H65A 3VR6A 4A2PA 3OAAD 2ANCA 5CLQA 1Z6YA 1QVRA 3MWJA 2QP3A 4B3GA 1S2MA 1EFUA 2ZI4A 4M8NE 2WAXA 3GLHA 1HH4A 1NBMD 3BH0A 4E09A 2BWJA 2A2ZA 2J0UB 4QGHA 5G3YA 4MRNA 3OFND 1G3MA 4D26A 2GNOA 4BQSA 2KB0A 1T3HA 1E79D 3IHWA 4L9WA 1P9WA 4D0GA 2NQ2C 2AXPA 2WSMA 5AUOB 2VHQA 1DOAA 5JS8A 5HKKD 1ONBA 1US8A 1P2VA 3KJEA 4MRVA 4NYJQ 2GAOA 2GK7A 4F4JA 2ZI6A 3GJ6A 3K0AA 3B82A 1BOFA 5FL3A 1EFRD 2J87A 1EG7A 4QOSA 2BKEA 1BYIA 3I32A 4Q9JA 2ZYWX 1E2PA 2JDID 2YOFA 2BVNA 1CR4A 2F1IA 4LHXA 4NCKA 3QXHA 1E3MA 3EIEA 3WYGA 4TLDA 2V1UA 3U6BA 1OLOA 3KQHA 4PZZA 2QAGA 1BMFA 1MO4A 1YVDA 4EDHA 1G5PA 3QEJA 1GUAA 2ZJ5A 3EA0A 2QE7D 4ZI3A 3RRYA 2W6IA 1LB1B 1R5OA 4MRSA 2QAJA 2Z4SA 1LF5A 1KMHB 1OKKA 1KZGB 3AF4A 1KMQA 3FMPB 3QQ5A 4QRHA 1DTSA 3KJIA 4QJ4A 4Z1MA 4WIAA 1ZU4A 4TMZA 1TF2A 2VSOA 3GJ8A 1WP9A 2HT6A 1Z2CA 4TMWA 3FYHA 2VRWA 4HB0A 2NG1A 2AN9A 4L9SA 3VX3A 4CW7A 1PV4A 4B6FA 1Q20A 4DRZA 3UG7A 3VR5A 4Y0VA 3A37A 4JLPA 821PA 2XNDD 3AGPA 2GZHA 4BASA 1OB5A 3MWKA 2ZYUX 3BS4A 2KBFA 2OZEA 1EXMA 3AUXA 1SXJC 2YOHA 4MGZR 4P4SA 4ERNA 4RZXA 3TBKA 3R9WA 2BBWA 1W0KA 1KKLA 5DLQC 3SE0A 5KPJA 2DFNA 1IJEA 1R7RA 5CB6A 1XU4A 2FE4A 4IEEA 2O8CA 4DVGA 1XD8A 4CEHB 2IYTA 2W2TA 2JJ8A 1KO4A 2O8EA 2AD1A 2ZU6A 3U5ZB 4EQ6A 4GSYA 5JWRA 4HATA 4LYHA 2QNRA 1E2JA 2ZRMA 1AN0A 3LRPA 5GVRA 4DCUA 3HU3A 2RCNA 3PG5A 4LYAA 5BXQC 3VAAA 1LFDB 5EUQB 3PEYA 3V9PA 4ZV4A 3A4NA 4RD1A 3QVUA 3SFZA 2O8DB 2ASEA 621PA 4GFDA 3VNVA 2GWHA 1IONA 4RFSA 2H5EA 4HAUA 3WHKA 3B60A 1G6HA 3EZ6A 1YKSA 2TMKA 1YZTA 4Q5IA 3H84A 3TVTA 4DSNA 5JHHB 4G1UC 2JLYA 2FPLA 1M8PA 3P32A 3AF3A 1LF0A 2XXAA 3W6OA 4KBGA 3ZYCA 4KYIB 1W5SA 2A30A 4LUCA 1G8PA 1II8B 5AJWA 3ZIAA 1VHLA 4URVR 1GZSA 2F1JA 4I1SA 1W48A 2YJTD 3SQXA 3IIMA 4BFYA 3IILA 2R6FA 1D2EA 1Z6GA 2O8FA 4H9GA 1T5IA 2WIBA 3BERA 3SU8A 5FOTA 2CL6X 4HDCA 4ZKDA 4ZI2A 5DYGA 3IQXA 2A5FA 3BFXA 2Z83A 4C0LA 2XX3A 2ZE6A 1ZM9A 1D5CA 1YZGA 3HWSA 3I61A 3TR5A 2F7SA 1AJEA 1G18A 2GF9A 1ZMXA 3AVXA 2JCSA 4NTZA 3NDPA 2HYIC 2CE7A 2GCOB 3DZDA 3P4XA 2O8BA 3BXZA 3PUVA 4WAUA 3VR2A 2O0JA 1KGDA 3ZLJA 3GEIA 1ZM3A 1W47A 1Z0JA 1S96A 2NO6A 2FFHA 1JR3E 1DO0A 2RGCA 4KVGA 4M9QA 5KNCA 2W2VA 3CR7A 2V7QD 1CRPA 3H86A 3OEED 2QPAA 4NZYA 3CRW1 4UNNA 1VIYA 3OHMA 3B5JA 3V4RA 2YOGA 3TNFA 4EFNA 3DMNA 4TN1A 5C1BA 1UEIA 1N2CE 1CJMA 3MGCA 2D7DA 1JR3D 3I4LA 5FOVA 1T4GA 2B92A 2WWFA 3CR8A 1ZD1A 1YE8A 3UKDA 2ZAOA 1J70A 4IDNA 3KKMA 4C0QC 1JALA 1JPJA 2OXRA 4PO8A 4TMVA 1RRPA 3RRMA 1FW6A 3QKTA 1KNXA 4BLSA 1I4DD 1R4AA 3M0EA 5EJEA 1YRAA 3T35A 3C7KA 3MSXA 4CEJA 2XTZA 1HT2E 1KZ7B 2R2AA 2R44A 2R6AA 2ZIAA 1NMXA 2GVDC 3E70C 1KI6B 4G5RA 1NSFA 1UBCA 2RGEA 5A4JA 1R0WA 3WBJA 5KNDA 2ZRJA 2VP6A 5SZIA 2IUSA 3WMEA 2W0SA 3TAHA 2ZYTX 4UJ3A 3THWB 1UBFA 2RGNC 2GJAA 3SR0A 4TL8A 3X2SA 2IS6A 3D8BA 3C41J 4L8GA 1T6NA 3EZFA 3AVOA 4AY2A 2PCLA 3UWOA 3N70A 4NH0A 2YV5A 2ZQ5A 4RY2A 5JFGA 1G3RA 2A9KA 2ONKA 4MDEA 2ZVPX 1KI7A 4MRRA 4PZLA 4PQRA 5AJZA 4LY6A 3R9IA 4LJYA 1TNDA 3UMSA 1GAJA 1I4LD 3ZVLA 5J4YA 3NHAA 5HCNA 2GILA 1GOTA 1IQPA 3FWYA 3LNCA 1OIWA 3FGNA 3EWAA 3BORA 4KV9A 4E07A 1ZM2A 4GRAA 5C2JB 1SVMA 4PC1A 2ZJOA 1IXSB 1U9IC 1XTJA 3U6KA 5FPKA 1FOEB 3CLVA 3L43A 3GFOA 2ZEJA 4D4LA 4ESHA 2VP9A 2JEOA 2WV9A 3U44B 1TEVA 3VKWA 3AV0B 4QJ5A 4BRWA 4D4KA 5J4VA 2EFGA 1FUKA 2GXSA 4KSBA 5JHGB 5ANRB 1F48A 4V0NA 2D74A 2KSQA 1OHHA 2YWFA 4ZCLA 4ZDIA 4M53A 1AM4D 2OV2A 4JVNA 3K9LA 2JASA 2IL1A 3WBKA 3OIWA 2VTKA 4DCSA 1Z0DA 3KKOA 3HYRA 2ZJAA 3MMPA 4NL4H 3GJ7A 4XD7D 1M6NA 3BGWA 1RRGA 1QHNA 4BFTA 2XEXA 4FMBB 4PC2A 5DGXA 2OEPA 1XXHB 6Q21A 1DAEA 2IF2A 5KDLA 4WW0A 4E22A 1RYHA 1U94A 4B3FX 1Z83A 2N42A 3EA5A 3LBHA 1TU3A 3EC1A 3LDAA 2B21A 2F43B 2OUKA 3VMFA 3IBYA 4B2IA 3KQNA 2B8WA 1NY6A 1AA9A 2AK2A 4BFXA 4C2TA 1SHKA 1Z29A 5IK2D 4DLYA 2FGJA 2VF7A 1N6KA 2JLUA 2R6CA 3FE2A 1G8FA 5JJKA 3L0IB 2EFHB 5E7JA 3AH8A 4IOKA 1U8YA 5DN6D 2IYWA 1Z6TA 2V1XA 4LBYA 3SHWA 2HJVA 2Z0MA 2NO9A 4HAVA 1Z3IX 4OK6A 3B1ZA 5JI3E 1GVNB 4BLPA 5BN3A 2PT7A 1DO2A 4A15A 2G0NA 1P2SA 4KFSA 5TMPA 2QUZA 4PANA 5FBWB 4HUQB 5CK5A 2AFIE 4LK2A 4GOXA 1GSIA 1CR2A 3EIHA 4N0EA 2H1LA 4BLRA 1EWQA 3N2EA 4U00A 3UG6A 4AYXA 4URYR 1XXHE 521PA 3GLFB 1HE1C 3X1ZA 1GNRA 1RJ9B 4TYQA 2NO7A 1KSFX 2FFAA 1RIFA 3PENA 2ATVA 3L8ZA 4JBWA 3ZZ0A 1Z6XA 3ADBA 4PQFA 4JYCA 1XZQA 4AI6A 2GBLC 1EX7A 3K70B 2HEIA 1CRQA 3HPRA 4I81A 3FTQA 2D7CA 5E95A 2A5GA 3PUZA 2FWRA 3A1VA 1GL7A 2OBMA 3NC0C 3C4JA 2AK3A 3RWOA 3BH6A 4DSUA 2J7PA 2FNAA 3KUCA 3DL0A 2FEOA 3T1QA 1ZNWA 2BMDA 2MSEB 1KJYA 2IC5A 2QQ0A 4IOLA 1VPLA 2HLDD 4NYMR 4BRUA 3NXSA 3KQLA 3EZ2A 4D4JA 3SNHA 2ZR0A 4ASUA 2CL0X 2DFLA 1KSGA 4C30A 4RZ2A 2HXYA 4M1YA 2P6UA 4LBVA 2W58A 2PZGA 4M9ZA 1NG9A 3OF5A 4Q19A 1ZYUA 1Z06A 1OFUX 5EUMA 3GLFE 4I4LA 4A8JC 5KSOA 3RANA 4AKIA 2W2XA 1NVVR 3AKEA 2VP4A 3Q5DA 4DXAA 1OIVA 1VIAA 4PHHA 1OXVA 3BC1A 5IF9A 1E0SA 5BWMA 3EG5A 1E2FA 3K9NA 3QENA 1MKYA 3NIBA 3UIEA 5F3WB 1U99A 4AK9A 1PZNA 4NPHA 2QP9X 5FTMA 2XTMA 1GWNA 2ZUBA 4ARZB 1VECA 2WICA 4TQ9A 2IWRA 2X2FA 3K70D 4DLVA 4PHTA 5AJXA 1CEEA 2ZJZA 3VR3A 1W4CA 4NYIR 4TSFD 2R62A 3DVLA 2P6RA 3ASZA 5G41A 2XB2A 3TK1A 4C0KA 4B32A 3WNDA 3MG9A 1G8GA 2B8TA 2WWYA 4UNPA 4I99A 3LA6A 2CK3D 3SFVA 3PFIA 1DBSA 4PPGA 2CBZA 4FMCF 1QHHB 4K8OA 1A5TA 1FQJA 4URZR 1SHZA 3CNNA 1NMZA 2OFXA 4BEBA 2WJHA 4Q4HB 4G3XA 4PQYA 2PMKA 4NCHA 5KSZA 4R71A 1ZIOA 3NEJA 1KHTA 2JJ1A 5L3QA 2CHVA 2FX3A 3HP1A 1G7RA 1MO6A 1KI4A 3AEZA 1GKIA 1ZCAA 1KI8A 4WXPA 3QF4B 1E32A 2C99A 1YHNA 4URXR 4IW3B 2HDNB 2AKYA 1QRAA 4DEXA 4A1FA 2ZYVX 4KI0A 5FTJA 3NTUA 3VR1A 2ZS7A 1Y3AA 3GD7A 3K09A 3KQKA 2XZPA 4N1AA 4OI4A 1EFHA 4OYHA 3THOA 4B71A 5FFMA 2BKUA 4RD3A 3QOFA 3EPKA 4DB2A 1AZSC 2JLRA 3AVQA 2N1BA 3GLIB 1IXZA 4NU0A 4AC9A 4WZ6A 2J41A 3FHOA 4P32A 1XDBA 2WWWA 3TH5A 4JLNA 3LH5A 4XWAA 4EJSC 1W44A 2QMEA 3OE7D 1G20E 4XWOA 4IFEA 3RS7A 3N2IA 4HLCA 4UXHA 1S9DA 3TUJC 1YR7A 2UZ3A 4DSTA 2A5YB 4PSKA 2GJ9A 8OHMA 5KUTA 5EE1A 3RHFA 3CZPA 3FOZA 1UAAA 2BM1A 4EFMA 1N0VC 1CJKC 2QRZA 1XFAA 4LHVA 1LY1A 1S1CA 3ZH9B 2CJWA 1P72A 2FZLA 3SBDA 1KIMA 1Z6AA 2KE5A 4CZ2A 3C8UA 3WP0A 1K5GA 4QGGA 3PIRA 3DEFA 1MR3F 3PEVA 4HLDA 4QBIA 1HUQA 4A0HA 4FXPA 2FSHA 3A1UA 2GZDA 4IVPA 2HCBA 4Q1EA 5G53C 5H68A 4YXWD 4KLZA 2PX0A 3RYTC 5LD2C 3AQ4A 3M4YA 3NDBB 5J4LA 5TB5A 4CEIA 3BB4A 3B9PA 1JQJC 2BBSA 1ZAKA 4TT3D 4X8MA 3TQCA 4DDVA 5LB4A 1R0XA 4A4DA 1P9RA 4IRUB 4DIDA 1XTSA 2ORVA 3IEUA 4DCVA 3GLIE 2G1KA 2WPDD 2VO1A 1XEXA 2FJUA 1Q44A 1KI9A 1T8TA 3LXXA 3D7MA 2AWNA 5DI3B 5FUYA 5C4GB 4YMWA 2GKSA 4GT1A 2GRJA 4LBZA 1N6HA 4ON9A 1XBTA 4DLWA 2FEMA 4FMCB 4HLQB 1QHGA 1WF3A 3UMFA 1J90A 2Q21A 2KWIA 3ZQ6A 1TTTA 3U3JA 4PAQA 4B35A 1G41A 4DT1A 5DE3A 2O5VA 2WSSD 4B34A 3KTAA 4IVQA 4MYCA 3L8YA 1LS6A 2IXGA 3GJ4A 3W9YA 2ZSAA 1LNZA 1D9ZA 4ABYA 3SYKA 3T15A 4B43A 5F9FA 2F9LA 2HF9A 2QAGC 2IXEA 4NCIA 5EE0A 2BMEA 4O25A 2GVZC 5IDVA 3F3YA 3AM1A 1U2RA 1XZPA 4BECA 3SZRA 5B57C 2CXXA 4OI1A 5IRCD 1G4AE 4IJMA 2Z6VA 1IN6A 3H4MA 4EJSA 5J40A 1WB9A 1IXRC 1QG4A 2QENA 4OL0A 2VH5R 3EXAA 1SXJB 2XJ4A 1U90A 4B73A 3VQTA 1P5ZB 2O0HA 2VHTA 3B78A 5FTLA 3A4LA 1XCPA 4MGIR 3P26A 5JEEA 2RAPA 1NN1A 3QKSB 2D3WA 4B2PA 1D6JA 4GDFA 4QHTA 1WA5A 5L3SA 1N5IA 4QL3A 4EPTA 3E1SA 4EPRA 1NBME 1XCMA 2WM9B 3PEUA 5CK4A 2JLSA 2CHGA 3ASYA 5KU1A 4I1VA 4O3MA 3Q7QA 1JJ7A 4A82A 1F2UB 4LGMA 2OCAA 2FFBA 2JIZD 3EPHA 2ERYA 3CPEA 3CW2A 3PUYA 1XD2A 1GRNA 1OXSC 4US1R 5G3ZA 1AIPA 1BH2A 1OXXK 1UKEA 3VNUA 4GI7A 3VU9B 3W6PA 2QU8A 5CM8B 2A7QA 1JEDA 1JEEA 2AR7A 1XEWX 2KBEA 1E0AA 1YZNA 1P4SA 1BS1A 4CIDA 4QJ3A 3B6EA 3CM0A 1S3SA 2R65A 4JZKA 3RS0A 5FUWA 3IQWA 4TL9A 1OXTA 5HE8A 4H1UA 4R9UC 2ZETA 4DCTA 2QG6A 3KFVA 5JEDA 1AQYA 1OPXA 3WY9A 2PT5A 2OE2A 3BE4A 4JS0A 1SXJD 2EFEB 3K0FA 3RS4A 4RZ3A 1MO3A 2WMOB 2BBTA 3W3ZB 3QVVA 3R9XA 2BEKA 1KO7A 2NZJA 1LTQA 2Z43A 2KI5A 1AQUA 5FPTA 3U60B 1COWA 5JWOA 2F55A 3CF2A 1YR8A 3F5FA 4AKEA 4B44A 4C9BA 1UADA 2DHRA 1P61B 4HZUB 5LBIA 4A6PA 1XMIA 1AZTA 1GITA 1GKUB 1QDEA 2ZRIA 1CR0A 3ZZTA 4QHSA 5CDFE 1MO5A 3AVWA 3RAPR 3ZQJA 2GK6A 4NDZA 2WKQA 1E1QA 1W0JA 4UNQA 1W36C 1H8HA 1SKQA 4B3CA 1SGWA 1TUEA 1E9EA 4OQNA 3BAFA 3DKVA 5KTYA 4Q9LA 2JLVA 1GP2A 1SULA 2NPIA 2ZRDA 5AK0A 4V02A 1N0WA 4ITRC 4YONB 5KDDA 2FOLA 2DWOA 4L16A 1KO8A 1UBGA 4QNRA 3VFDA 4XWKA 2XOKD 1JQLB 4DLSA 1T0HB 3QKRA 5EXTA 1U8ZA 1NJFA 4MYTA 5CIWA 5FUXA 1G4UR 2QN6A 1IN8A 1OIXA 1VYVA 3IPXA 2BV3A 1KO1A 1F60A 2CNWD 1UBEA 3MWYW 1FPMA 2DY1A 1TF7A 3MD0A 4EPXA 3CB4A 4GOJA 1W46A 3ND8A 2JJ2D 1YZKA 4C7OA 1RFLA 4CF7A 1N5JA 3QI2A 1N0UA 4QXAA 1F2TA 4A36A 3T5DA 4I1UA 2XSZA 3ICQB 4D81A 1E2IA 2VSXA 2VSFA 1CBUA 1X1SA 3HU1A 2AXNA 3CX7A 3GLGB 1SVIA 2C9CA 1SZPA 4Q7MB 4DDUA 2ZITA 1T5LA 1DPFA 4P0TA 2W0MA 1YZLA 3PV0A 4KXFB 3KQUA 1ZIPA 4B47A 5FL7D 2BCGY 1G3QA 2ZRKA 1NG1A 3DO6A 3QXJA 2BBOA 3KXIA 1W2HA 4PC7A 1A7JA 1UPTA 2DWPA 4Q1AA 4FD2A 1A4RA 2GESA 5FH9A 3KXLA 3WYFA 1G21E 3U3OA 3O8DA 2G88A 1KJWA 3AKYA 1E9DA 1QHSA 3SOPA 1IJFA 2V54A 3O8RA 2IT1A 3SC3A 1E6CA 4TZ6A 1EK0A 3CNOA 3RSLA 2OCBA 4AG6A 3THXB 4PX9A 3N5CA 3ZVRA 1FP7A 1WMSA 3WMGA 3RC3A 1ZINA 4TMKA 5CJ2A 4DUGD 2RHMA 3QXCA 3UATA 2IWHA 4PPQA 5FBQB 2ZI7A 3LQRA 2H8KA 3VHLB 2W6JD 4W9MC 2QGZA 3CBQA 3K9GA 5A5GA 4LHZA 2F1RA 1E2GA 4TYPA 1N3BA 2CE2X 2RGGA 1YRBA 1Z2AA 4YQFA 3GJ5A 3GLGE 1OH5A 1ZD8A 1N5LA 2EW1A 2PCJA 3LW8A 1KAOA 3OAAA 1TMKA 5LDDC 4V0KA 1LVGA 1M7GA 5EZ6B 2YKGA 4AURA 1P75A 1EFTA 1MABB 3H0KA 5JSZA 5KNBA 1Q21A 1R8SA 4HSEA 3EPJA 1CTQA 4C4PA 3W8NA 3RC8A 2AFHE 2YWHA 1NKTA 3TJZA 2C8VA 2IYYA 1P73A 2SHKA 1NBMA 2J7KA 2OHFA 4V0LA 2IYUA 3OFNA 3BBPA 3U4QA 4GPTA 2BMJA 1E79A 4PHGA 5CIQA 4Q4JA 3KUDA 1T9HA 1ZD9A 3LV8A 3SJZA 3X1XA 4WVFA 4PO9A 1Z8FA 1HTWA 5HKKA 1VYTA 4JJZA 3I5XA 2NZ8A 2PLFA 1MRSA 1Q57A 2FZ4A 3LBNA 1D8TA 2QROA 2HJGA 4LJ6A 1EFRA 4MRPA 1K8RA 2P67A 4K46A 2NMVA 2H16A 4TYWA 1QF9A 2XNSA 3MRSA 4RKFA 4Q00A 5JLJA 4BPBA 2JDIA 2NPFA 3AVUA 3EASA 2CVHA 5UKDA 2RHDA 3NVAA 1Z08A 2FSFA 2ZSDA 3QE0A 2X77A 3SYNA 3BFVA 5D3MA 1Z28A 1E9RA 4TLAA 2QE7A 3THYB 2VHUA 3OEHD 4ACAA 2IS1A 2OSBA 4OK3A 1GRRA 1ZUNB 1E2MA 3IIKA 5AUQA 2P2LA 4KU4A 1CF4A 2XTNA 3KB1A 3R7WB 4DJTA 3BB1A 3EC2A 4MQBA 1Q1ZA 4M22A 1ZM7A 2J0VA 2F3TA 5CDFA 1XP8A 4F91B 4ZIRB 1Z22A 1TADA 2C04A 4JVLA 2WTUA 2XNDA 2J0UA 1YR6A 2PEZA 2FDCA 1BO6A 2PBRA 4R2HA 4MA4A 2HF8A 2Q3HA 5IHPA 2ATXA 4OQLA 1P6XA 1W4RA 3NH6A 1E2QA 1ZM4A 4HDOB 4YDSA 1G3IA 4XTRA 1DAFA 2QM8A 1WDTA 2D06A 2XAUA 2DFTA 2VP2A 4V0ME 1CP2A 3OESA 4OHYA 1JPNA 3U7GA 2ZS8A 4XTCS 3G5UA 4QBFA 5LPNA 3UXMA 2EVWX 2J0SA 3IHLA 3LWNA 3RNLA 3HR8A 2VF8A 5CYPA 3MLEA 3TSWA 1G3UA 1CU1A 1CIPA 4FCTA 1GNPA 4Z8XA 1QZXA 2ZXUA 2ODEA 1W2GA 2ZE7A 3H2YA 1E1RD 2GCPA 2GJSA 3OZXA 1D9XA 2CCJA 2G77B 3A4MA 1CKEA 1TQ6A 3JVUA 1NL3A 1KMHA 2FN4A 1R2QA 3CPHA 4UJ5A 3QPVA 1N5KA 2C78A 2R8RA 3Q72A 1J8YF 3ZD6A 4HAYA 4R7ZA 5BYKA 4PR0A 5AJVB 5GJBA 1UKZA 1JAHA 1S4QA 3NC1C 3DHWC 1VCNA 3F8TA 4QC2A 3A36A 2JATA 2VEDA 3KKPA 3S1AB 4NYMQ 1RC8A 1FX0B 3RRNA 4KJZA 4BZXA 2GDJA 2X8AA 3MJHA 4C0SA 4EAQA 3G0HA 3TSZA 4I1OA 2QT1A 1IY1A 1NI3A 5B30A 1NP6A 4A8JB 2WVJA 4Q47A 1NVUQ 4RD6A 3RS5A 4KITB 2Q9BA 3SQWA 4FCVA 3MFYA 4YDHB 3SDZA 4M0LA 4P31A 1MV5A 2ZROA 5DHFA 1FZQA 2ONJA 4KHZA 3CONA 4RFVA 3WMFA 3ZDQA 4O0MA 3UWKA 1FUUA 1NVXQ 1NVVQ 4CEHA 1VHTA 5KYKA 3TQFA 3NBXX 1E0JA 1Q1QA 1KY3A 2C5LA 1KO5A 2IK8A 2YZ2A 5FBRB 3EPLA 3C14C 1G6OA 4U7DA 2ZI9A 3I3SR 4MKFA 721PA 1D2NA 1OH7A 3B1XA 1KI1A 4KFUA 2O8DA 1ZVQA 2FG5A 4IHQA 4M9SA 4YC7A 4UXIA 3TVDA 1WBDA 2ZR9A 4LJ7A 2V7QA 1JB1A 1NLYA 2FPKA 2MMGA 3KB2A 3OEEA 4TQUS 3ZGXA 4GMDA 4M2LA 2NOAA 4NYIQ 5KSPA 1XCGB 3OIUA 4G0NA 4Q4AB 2Q0HA 3AVTA 1UM8A 5BQ5A 4YMSA 5JI2E 1FFHA 4LJ9A 4AD8A 1JR3A 3SN6A 4TL6A 2WOOA 2GF0A 1Q3HA 1IOZA 4UXJA 4LJAA 4DWJA 4D6PA 1II0A 3WYAA 1XRJA 2IUUA 3ZD7A 4OHWA 2HYDA 1II8A 1IHUA 3O8BA 2OM2A 3PXGA 4Q02A 1C9KA 3V4FA 1F3OA 2G83A 4B6EA 2QGNA 5AR1A 2WMNB 3ADKA 5GVSA 5KSYA 3FKQA 5KPDA 2GZAA 5EXXA 1CR1A 4Q48A 2AX4A 2PZEA 5L3RA 2EQBA 3EW9A 5EQTA 3NBZC 1TF5A 4OI0A 1YQTA 4PHFA 2OAQ1 2FF7A 2CLSA 1JECA 1JI0A 4IDPA 121PA 2FPMA 4TTQA 1ZW6A 1XJ0A 2HXSA 3U2QA 3K0CC 1HA3A 3QBVA 4RZUA 1IBRA 3CH4B 1AKYA 1DEKA 4YMVA 2V6JA 4MH0R 1SVWA 3K09C 2QP4A 1E69A 2GTPA 5EP4A 2J1LA 1ANKA 4HZIA 3SJBA 4CGZA 2BHRA 3ETLA 2GCOA 2GAAA 1C4OA 5EP2A 1RE0A 5H1YA 1LS1A 4IXMA 1RVDA 4II7A 2C77A 3Q3JB 2J46A 1OJLA 4W7SA 5JWHA 1OSNA 4EPVA 4XJXA 1XJQA 3K53A 2QY9A 4JSTA 4ZDJA 4M21A 3U7FB 2QBYB 4FWIB 1ZC4A 1ZBDA 5EE9A 3G82C 2IW3A 3UK6A 4KLNA 3KL4A 1EESA 3SS8A 3NBFA 3WHLA 4B3BA 3GMTA 3TAUA 3ECCA 2QTFA 1ODFA 3M6AA 4L4UA 2ZRPA 3TLXA 5LD2B 2JLWA 4OJKA 1T91A 3CRQA 3BB3A 5IT5A 1PJRA 4HUTA 3GLHB 1PUIA 4QKQA 4QHYA 1MOZA 2ZU0C 3LLUA 1X86B 2VBCA 1TUIA 4TMXA 4LJ8A 4LHWA 4O2RA 4F38A 1L4YA 4BFZA 2ZJ2A 3Q9LA 1E99A 1K6MA 4EUNA 4Q9HA 4XSHA 4D0LB 1HQYE 1TQDA 1US8B 1X8KA 3RVBA 3K0AB 3L0PA 3AVVA 3LX8A 4ZKEA 1KI6A 5LB2A 1H8ED 2QA5A 5TARA 1XEWY 1KNQA 3SJAA 4DCNA 3GP8A 2ORIA 2ORWA 4GP7A 5C18A 2L0XA 3BWDD 3FKSD 2LCFA 3GJXC 3PR1A 2BEJA 1DELA 3A8TA 4FINA 4Q9KA 5C4MA 1TQ4A 2QAGB 1EX6A 1YR9A 4XD7A 4A0GA 3THWA 4L15A 4XH9B 3VKGA 2V55B 2DYKA 1XTQA 1Q1BA 1Q3TA 2R9VA 1GNQA 3HYTA 4CT5A 3VKHA 4F92B 3K0CA 4G5GA 2OCPA 1CJUC 4C3ZA 1FNMA 5DO9A 1DVRA 2A78A 2ZE8A 4X8OA 1M7HA 3R20A 5EZ5A 2C96A 4MKGA 4JLDA 5DSZA 4JLVA 1NJGA 4LRWA 2YINC 3REFA 3CF0A 4DIEA 1KKMA 1OE0A 2BC9A 3W90A 3DZ8A 4DDWA 3H1TA 5GJWC 5EXPA 5IK2A 4E03A 4B48A 2IX3A 2RGDA 1G64A 4ZPXA 5TY0A 3ND9A 3W6NA 1AK2A 3AP2A 4V0OA 5DN6A 3EWSA 1Q22A 3ONWA 4NE2A 4Q18A 1BKDR 3T61A 4C2UA 2F3RA 4RVCA 4AYTA 5AUNB 1IM2A 4HLUC 1T3LA 1WQ1R 2VHJA 2G6BA 2QT0A 2WKPA 3B85A 4P4SB 5FOXA 4WOPA 3U7HB 2W00A 4XOIA
chains in the Genus database with same CATH superfamily
5KOJB 4AQYB 3MCAA 3F9CA 5CAEB 5AVSA 3VPSA 4CKEB 2RH9B 1XTBA 4HV4A 3RSZA 3HXOA 1NDQA 1K2VN 4ILEA 3ZCRA 2G72A 3E03A 3QG5A 5DIFA 2ZM5A 1NLFA 2F48A 3RRZA 3UW1A 3RVRA 2O8EB 3FLAA 2RGYA 1QYXA 3K0HA 3BMOA 4I9NA 3K5PA 1JT9A 1L7VC 1U0HC 3ICEA 1PJ3A 1T3SA 5JMTA 2IPNA 4YRZA 2V0GA 4BC0A 4D0SA 1GLGA 5JISA 3IGFA 4RCZA 2QSYA 5IUKC 3AIMA 3OMWA 4FBMA 4PZ0A 3RJZA 4J43A 1QRRA 1YD7A 3JYNA 1ESMA 3QXSA 1ZCFA 3M4NA 2ZR7A 4UHJA 3QX9A 2P68A 5LZ9A 2DFKB 3WWDA 3COJA 2IS2A 2YJ5A 2ZJFA 3FZEA 2W6ID 4M1OA 5DNVA 1MT3A 2R3SA 3QV1A 5EXSA 4ZC8A 5A0TA 1TCBA 1XXHA 3H16A 2XNCA 4P34A 2BGMA 3G9ZA 4M9XA 4MUGA 2XMSA 2FEKA 1OKKD 3C98A 4HAXA 3RLFA 1R9NA 2O0MA 3E22A 4PSDA 1TZMA 4Y1EA 4B7ZA 2PGDA 4Z1MD 4XGIA 1NRJB 1OAAA 1U0NA 3H1BA 4NK5A 2OP0A 4B3DA 3PCXA 1YU9A 1YJXA 5ADVA 2NM0A 3FCCA 4MUEA 4W1SA 4XIGS 2AR0A 2NTEA 1M33A 1NFFA 1UBLS 1J00A 1P0IA 1LDMA 2GHRA 2NNLD 4FHGA 2WYIA 3LK6A 1RKQA 4N3BA 4TWZA 3KQMA 2HSWA 1P3JA 4OBEA 3SEAA 2FV8A 3VM6A 5DYYA 2H4XA 1KETA 5BYBA 1XWIA 3RAJA 2Q6LA 5AW9A 1UMDB 3MNFA 3WK5A 5JADA 1KQFA 3LFTA 4NWIA 4TZ0A 1T34A 1ZN7A 1TAQA 2GYYA 2VNKA 2Y1OA 4MWSA 4NQRA 4F11A 1Z0FA 3KEFA 3S70A 7AT1A 4FMDF 1LCIA 1W0KD 2AVDA 2HRCA 1CULC 3HKDA 1DJMA 3NJRA 1ZGCA 3DEYX 3OX2A 3O31A 3PDWA 3PT9A 5GOTA 5BV2P 4DGQA 3WQHA 3VYSB 1KJ9A 4UM7A 3WLFA 1I3MA 2BEWA 1W25A 4Z99A 1KYWA 3W2HA 3NWEA 1WW2A 3K6RA 3DDSA 3I73A 1RAGA 2XMQA 1I4OA 3H13A 4HLUA 4RK4A 1U0OC 5E6RB 1OFTA 3GGCA 4OHFA 5TIIA 2YXBA 1GCIA 2FR8A 3MOSA 4GKAA 4JBXA 1YJBA 3URKA 1FFXA 1OFVA 5CR9A 4PO3X 1DAGA 1LDYA 2R8OA 6YASA 1RJDA 2WVGA 2R96A 3F3MA 4L72A 3BXHA 4ME6A 1NYTA 1QV6A 4NS1A 4TSFA 3RSOA 4AECA 4A6EA 1NVTA 4E11A 1VI6A 4ZEXA 3AVYA 5ISMA 3O1HB 221PA 4G89A 3RLIA 5FJIA 4B6SA 1NSYA 3ZJ4A 2VWGA 3VI3B 4GLOA 2A0YA 1OFGA 2XIJA 3AEXA 1J49A 4RPGA 2Y4OA 2I67A 5DLYA 1P5FA 1OBFO 1GA1A 3W3AH 3T7SA 2X8JA 1UJ2A 2I3BA 2P1DA 2PUTA 3LUFA 1WR8A 5FFNA 5A9TA 4AUEA 3Q8LA 1UDRA 1FSGA 1SOAA 4R2IA 3SE7A 2XBUA 4HXEB 5EMJA 3ROTA 1Q7TA 1W88B 4KN8A 2EHDA 3AERB 4L7VA 3K8QA 2EL7A 3I2JA 4OGGA 5F78A 4ZVNA 3N1UA 3BK2A 4R1SA 3VSAA 4LKOA 3EXG2 2IHNA 5HCUA 4NG4A 3B1KA 1GR0A 2PL1A 2CXOA 5I9MA 2A35A 1U31A 3C45A 3UGKA 2OYRA 4N6OA 4EZBA 5IFKA 3FTPA 2I1QA 2OQRA 1SXJE 4R9VA 1PP4A 1LTHR 1CYEA 5IVDA 4ZT4A 5K05A 1H22A 1A2BA 1H0RA 4GX1A 3SYTA 4ZOQI 3UXEA 3ZE0B 1BC5A 3UKOA 4CCWA 4HHEA 2ZZKA 3QBJA 4P93A 5DDIP 1XTKA 3JVEA 5JY6A 1CJTC 2ABWA 4H6VA 2ID7A 1QH8B 3B20A 3MT7A 4IUYA 5K4AA 4WFJA 3JQ8A 3NZEA 5EJ4A 4EMUA 2I4TA 3CR3C 3OE7A 1H5QA 2PVSA 2PD3A 2X7JA 2YHUA 4PXAA 5AKYA 1WEHA 1FJXA 3M6VA 3T5GA 4F21A 1RHMA 3GJ0A 2IV2X 4CE6A 1HDYA 3AINA 1RWPA 2C4NA 4ENUA 1I94B 4KFCA 4W5OA 1O57A 3D6UA 4YTEA 1DWUA 3F2IA 4Z4CA 5F4ZA 1SXHA 1ZK1A 5CT5A 4D4MA 1VLMA 4GEKA 1E1MA 1UBKS 2HA4A 4EUHA 4FZ3A 4YT5A 2X7XA 2PMWB 5AYVA 4BP9A 2FI1A 2XMRA 4RYDA 1E9FA 3ZVMA 7MHTA 2R8YA 3ZG6A 5FBVB 4EUSA 1SN7A 1V8PA 2JFNA 9LDBA 1ULBA 4M76B 4PAMA 1DBVO 4GQAA 3K9QO 1NOJA 3D3QA 4Y2UA 5BOSA 5DX0A 3ZCVA 1ZGBA 3HZOA 1YRWA 4JX9A 4G5HA 3BIFA 4CMIA 4FHEA 4MS4B 3JQFA 1QFSA 4MI6A 1HEIA 1Y4DE 4LHEA 2LWIA 5T4EA 1NN5A 3W5JA 4KR2A 1ZLYA 3CX6A 3QBTA 4PZ9A 3OKFA 1U5AA 2NSJA 1SO8A 2VT7A 2X2EA 1YH3A 4YASA 1VSBA 1MX1A 4ZC1A 1KJ8A 2MJLA 1A9OA 1JGTA 3MTBA 3WWOA 4HX9A 1FX1A 2I9KA 2OLKA 3A7EA 3GIWA 2HBRA 3VR6H 1M1XB 1NWCA 5HEKA 2Q8PA 5LUAA 4HAWA 1UJBA 2O20A 2OGSA 3MMNA 4M55A 4Q1CA 5EPUA 2OO3A 1JG7A 3EVGA 2CUKA 1Y1LA 3GGGA 4QYMA 1HG0A 5ALOA 1G9XA 3O1LA 5JJ5A 5KNDD 3LLSA 4EY5A 2FEXA 5JD4A 5KDOA 1Z35A 4MA0A 3W2IA 1JHPA 4NP6A 1Z7BA 4G37A 4M1EA 1HQKA 1NN3A 2J3KA 3G0IA 1TU4A 4C6HA 4HDNA 5K0GA 2VHVA 2WSSA 4Q3KA 3UFXB 2XY4A 1E4OA 2W2PA 1PR9A 2WJ3A 4LYJA 4JI1B 3RR2A 4YIHA 3A2KA 1BVHA 2Y92A 3RC7A 2YXDA 3HJGA 3DMGA 3WNVA 2VDPB 5C53B 1GR1A 1TA4A 4U7PB 4NI5A 2PKXA 1KY2A 2C5BA 4MLZA 2PM8A 3NHBA 4OSPA 3C43A 4YT4A 1Z56C 1LPAB 1T4DA 4MR7B 4DCCA 1UH5A 4MITA 4CV1A 3FDZA 2JCBA 2ODTX 3CIOA 4LYFA 3DVQX 2EX1A 2BJWA 5IDXA 4G5SA 2A5JA 4YRSA 3PJDA 4V1CB 1YZUA 3FPKA 4WXMA 1PBTA 1PU2A 4F7WA 1KMCA 2WWGA 3W6ZA 2P9CA 1JIJA 5ICFA 5IJAA 1SUSA 2Z2JA 4FB4A 1I6MA 3ZIUA 3A2NA 1CFZA 2AKAB 2ZAYA 2EGUA 3C3WA 4MGYR 4RVHA 5G0WA 3THSA 4ER0A 5FI5A 1CZLA 4A8TA 3TW4A 4ARUA 1NXXA 3MWGA 4CMKA 2UXBB 1FFEA 2DE0X 1ZNQO 2A9JA 5IYZB 3F3SA 1F2DA 1HY3A 4UARA 2OXIA 2H9IA 2VPWA 2YHSA 3RM3A 3L0OA 4X65B 3HXTA 4F5ZA 2V9PA 2BR3A 4FDUA 4CT4B 4ZAYA 4XKJA 2DH5A 1ZU5A 1J2EA 2P5UA 2Z1MA 4TL7A 4RGQA 1SU4A 4M98A 5DI3A 2W6QA 3GPLA 4OHRA 5CPFA 4Z53A 1QQ6A 4PTLA 3LDFA 4R8VA 2LNDA 1TJYA 4C43A 3X2EA 4PGMA 2IS4A 5TGTA 4B76A 4CM9D 3IMCA 2ZJ6A 4J8PA 3D6HA 1BA3A 2ADOA 2D1FA 4WLUA 3AB3A 1N3IA 1E18A 2AYYA 2HTFA 2FLWA 2RC6A 3FNHA 3UMGA 4OMUA 1H1LA 2QX9A 3D6JA 2HUPA 1CJSA 1DIOB 2RONA 4M1SA 1ZC3A 3WIVA 3JD0A 3RS3A 5KOHB 4ZQFA 4GL2A 2I0FA 3GLVA 4JOSA 3E3LA 5LU8A 1G8YA 1XF9A 1A97A 1QE0A 1ULUA 1DAPA 1YBFA 4LPKA 1ONNA 1F1JA 1X7ZA 4HH1A 1ZQ1A 1E2EA 2GBPA 3CNEA 4WDRA 3W1EA 6PFKA 1ETUA 4FZ5A 4ZHQF 2QRMA 4Z7QB 1EP2B 1Z47A 1NXVA 1POXA 1RNLA 2AL7A 1IQUA 4NCNA 1WBBA 1HYQA 1OA0A 5ILOA 5COBA 2W2MA 1ZJZA 3LUPA 3SQLA 1YE3A 3IHKA 5JNRA 1QM5A 2Q6OA 5FULA 1FTNA 3GFPA 1MO2A 3QF7A 3RRJA 1YQDA 3AF1A 1FMLA 3BOSA 4CFSA 4CQMB 3KOWA 3VC1A 4GNKA 4QULA 4QASA 5IM5A 1Z8DA 3QSYA 2JLQA 1Y4SA 3BGVA 2QQEA 1RZ3A 1XJCA 3H9BA 3P9YA 4KE9A 1SOVA 2Q4EA 4OB6A 1IN7A 2AG5A 2C5FA 3E05A 4CVNA 5IW8A 1Q12A 4MMXB 3TKYA 1AKEA 4GWGA 2QTAA 1KGSA 4UZEA 3IKVA 5JZVA 4N47A 3T95A 3M9XA 1TVKB 1YXMA 4OFWA 3REGA 2PT6A 4PYQA 5LYJF 2R85A 3HO1A 4YP5A 1E5XA 1FJ2A 2VYCA 3QY0A 4Y2TA 3L4BA 3EMDA 3H5NA 4GMGA 2ZZNA 5KYXA 4RQBA 1J0XO 1GDTA 3BFKA 1CQJA 3U17A 1HTBA 1F2UA 2DC1A 1AOXA 2R7KA 4RCYA 4BNKA 1KU0A 3AY7A 1J0AA 2HBZA 2B7CA 2VF2A 1L5LA 3E5HA 4QTZA 4BKPA 2PIDA 4RCVA 3VU1A 1CUGA 1DIGA 4C6SA 1X1CA 2IE8A 3BZWA 4H7PA 2B78A 3NRCA 3F78A 1UPXA 2IDJA 1THZA 3VU9A 1HC7A 1UZUA 2V7GA 3FGZA 5G0VA 3SZOA 5HKOA 1XP5A 3BREA 1J56A 3TF5A 3W8FA 5DM70 4LF5B 4FS8A 4N3GA 1S1MA 2W4MA 4MPTA 1ULTA 2IHBA 1TYCA 3U16A 2VL7A 4BFUA 2YWDA 1P8JA 1TLTA 3CUWA 4M60A 2CLKB 3I8SA 4KIUA 2FP4A 4AZVA 3ZHSA 3CT4A 2BKLA 3NKVA 4MHSA 4ALNA 1M1YA 4IHKA 4KTVE 3LMKA 2XD9A 3G23A 3MMSA 4PYRA 2OYSA 2FQYA 2VH2A 2QN8A 2XA2A 4MVJP 1CD5A 5L3QB 2ECKA 2V74B 4E5YA 1SQ5A 3MJRA 4D9NA 3IHTA 5TPZD 1K75A 1GGMA 1YV9A 2HQBA 3M3PA 1SUWA 3ZGLA 3PA8A 2WPNA 3FCXA 4MDFA 2XT9A 1BJRE 5IS2A 1AO0A 3WB9A 1SXPA 3I62A 1M3SA 3GPDG 1C7JA 3DM5A 4LZWA 4HZUA 3B1JA 4KW7A 3T41A 1ZL2A 1ZMTA 3DOUA 2DBRA 3DBOB 4G2TA 4HQLA 4Y1GA 2WKSA 2AQHA 1R0LA 2WTNA 3QVSA 5MN5A 1A9ZA 1G2QA 2H17A 3LYAA 3OCCA 1RLJA 3SS7X 1USKA 4K40A 2P65A 1JHMA 4J0EA 2ENWA 1GRQA 2CXNA 2QTHA 2W70A 3VTKA 2PQ2A 1L5WA 3OH8A 2GEBA 4QICA 3BH7A 3LBAA 2A86A 1QNLA 3F6YA 5FWAA 4BO6A 4GI3A 4H4CA 5AQEA 4G1MB 1E5TA 2EFDB 3AR6A 4MQEB 4O1MA 1YB7A 1MB3A 3ZVKA 5FLKA 1O95D 5KTTA 3ND5A 3OMXA 2Y3IA 3FPGA 1CJVC 4MQFB 1Z07A 2IEZA 5T6BA 4MQ6A 4ESOA 3FUCA 4KRGA 4BMSA 2Q1YA 1ZNZA 4QUDA 1ZJ6A 2I80A 3DB2A 1LLQA 5LIPA 4PPNA 1UC9A 4Q66C 4UKDA 1X7WA 3T5CA 3VR3D 4HGNA 4QGAA 2QTNA 2GASA 2ZSIA 4RFLA 4WN9A 1RYFA 4MPPA 1PR0A 2AX3A 3NEAA 3Q7IA 1PG5A 4AX8A 3HHPA 2H7VA 5JDCA 2Z1NA 1NJ1A 3PXCX 2CJWB 3AUTA 4GZLA 4YNBA 3HBNA 3I64A 3IE2A 2AWOA 4C4TA 3GMIA 1RXEA 1WETA 1JDBC 5KYTA 1FYFA 2JCYA 1N2IA 1DB3A 3KVNA 2IITA 4U2FA 3OM0A 4K81B 2J45A 4MIKA 3C5CA 2R1TB 1M5UA 4CEIB 1K7EB 4R84A 1G98A 2IEYA 2QYOA 2WUFA 4LOAA 4TT8A 3WIBA 4NMHA 1CDDA 5AIAA 2VYNA 2WIKA 3ISJA 1VG1A 3LXMA 4FE3A 1BMDA 4JWTA 3RWMB 1Z25A 3TGLA 1TCCA 2VSQA 3EGIA 3HU2A 4YJGA 1NT2A 1X9HA 3KLBA 5LKAA 1BN7A 2LCIA 5JNWA 1VPVA 1RI5A 2RMKA 1LTKA 5ALVA 5KNCD 4F72A 1ZSNA 1M5RA 1TL7C 3KUKA 3L1JA 1OYVA 3CU5A 4H35A 1QONA 4HGPA 4DY4A 4DRXB 1S3GA 3GZNB 1GV0A 1R10A 2RGNA 3I8OA 4QXRA 5F7JA 3UJ7A 4QQNA 1FQKA 1EK5A 1UKBA 3A05A 3K8YA 3NIWA 2H9AA 3K0EA 4COOA 2WZCA 2I6QA 3EBLA 1VDMA 1JQKA 2NUPB 3SQOA 4J4TA 1ZK3A 3S2GA 1JAXA 2Q99A 3PR2B 5JSQA 1NP3A 2XF2A 1PTJA 4YJHB 5TDHA 4BUCA 1G8SA 1G7CA 1NR7A 1J2JA 4ARSA 1UKCA 2DECA 3R9XA 2LR0A 2AD5A 3GOQA 4KDCA 2GEKA 2RHJA 4W5QA 3O4RA 4YCBA 3TRJA 2W7TA 4HDQB 1YVEI 2Q1WA 1ECGA 2J3LA 2FSGA 3NTOA 1DUVG 2I6SA 3G8AA 5DCWA 2J0QA 3IDZA 2X42A 3V42A 3PICA 1MZVA 2XVAA 4ETIA 3D4PA 1Y8RB 1YBVA 1D4FA 4EJSB 2WJVA 3CHYA 3FUUA 3V1LA 4QAJA 3IV9A 3SHVA 3P1JA 4QUKA 5AHOA 1AGNA 3H8SA 4GPBA 1W4AA 1CVIA 3QI7A 2Q9AA 1U9IA 2JFZA 3OZFA 3VJKA 4FHZA 2RE8A 5H02A 4ZREA 1OAOA 2WVHA 2XUKA 2YXEA 3WKEA 3MJCA 1M8JA 1ZUHA 2ES4A 1G9SA 1Q0SA 3LY9A 5JALA 4CG2A 1JI3A 1CZUA 4C76A 3MINA 1HXHA 4BXOA 3KT0A 3TR0A 2FU5C 3B8HA 1VKJA 1R0CA 4DIBA 4RANA 1Q0PA 1DJPA 3ELDA 4UU1A 5HJEA 4BVAA 4N5LA 5CVEA 4HMQA 4BS9A 1LA2A 3RVDA 1LFAA 1R6DA 2M32A 3KM0A 4BU0A 1MC8A 1I3NA 4DW8A 2XV1A 3PGMA 4LQ4A 4RKEA 1V1JA 5BSGA 1DJLA 1NIPA 1UCFA 1J1IA 1H1TA 1ZOOA 1ZS9A 2WD7A 3FR8A 3O38A 3E7PA 3PQ7A 3ESYA 3H5WA 3JATA 4JT9A 4MV6A 9GPBA 4B8ZA 1TGYA 1XYGA 3EXEA 4GI5A 4HX2A 2H1RA 2OFWA 1XROA 4Z9BA 3ZS9A 3G49A 6ABPA 1VCMA 3KZNA 3CPJB 4US0R 3TCKA 3TLMA 4QEKA 3ET4A 1Y7PA 2OPBA 4DC9A 3THYA 2C5AA 1IK6A 1AKUA 2QEQA 3GUVA 3PSAA 2IELA 1XK6A 3QSGA 4JBGA 5KX5B 4ZT2A 1ZUNA 1ZUIA 2OV8A 2FDXA 2FN8A 1E2KA 5BN5A 1ESNA 4XIIA 1PJCA 1DT5A 1Q83A 2H3HA 3ILXA 2VQSA 2EWWA 2WAYA 3DTVB 3P9QA 4HNSA 1PYGA 3C74A 1UXIA 4K9OA 3KZOA 1B6TA 1EFLA 1T3TA 1J99A 1S0UA 1QG0A 2XUJA 3ESXA 3ILHA 4JSYA 3LVRE 4N49A 4PS0A 1D2MA 4EECA 3QWIA 4IF4A 4EVRA 2JFFA 3K0FB 3KVOA 1TM1E 3CUEF 2OQIA 3RUEA 5BMVA 3R9XB 3DBRB 2F6RA 5GJVC 4Q1FA 5LP6B 6ADHA 3KOOA 1UZMA 5K8CA 4C4YA 4R1NA 2CFSA 2RHCA 3TEMA 3P27A 4IS3A 3W34A 3EMKA 1LC0A 4NKRA 1U8AA 1FTYA 3O1IC 1SHTX 4JITA 3M4JA 2EYQA 4RD0A 4BLQA 3LLMA 2OC4A 1EDOA 1T0PA 1HURA 5EJ2A 4MMYB 4OGFA 421PA 3AEUB 4C3UA 2W43A 1TZJA 2C59A 5HIJA 3PXXA 2VHYA 3Q8MA 5GONB 2QQFA 1JLMA 4X1KA 3ZLBA 4B74A 4TZKA 5CA0B 4OLHA 3GROA 4RSMA 3CO5A 1ZONA 3DAHA 3AZQA 5JECA 3TG2A 2C2ZA 1G2OA 1DEXA 3AP1A 3BJZA 4N01A 4PX3A 1NJSA 1KOJA 2AMLA 3OJCA 3Q40A 4RZIA 4Z86A 5K6RA 5T41A 4Q1DA 1Z88A 2ZYSA 4WE3A 1NW8A 3AL0C 4WL0A 1DQSA 4KO8A 4EVIA 1JHUA 1YDWA 2X86A 4YGXB 1FJGB 2JEZA 3V1NA 4DSAA 5A6VA 1X1QA 4O02B 4KR7A 2O7NA 1GPMA 3E1KA 1A95A 2ZRBA 4HB4A 3TLGB 4D1YA 4KP7A 5IAAA 1ZN9A 3H9UA 1GZDA 1HK7A 1W96A 2FFQA 2VZ8A 4X3OA 5F51A 4BNLA 1XVUA 1KEKA 1TT5A 1GO2A 2UZIR 3R3ZA 1PQUA 3I9OA 1TU0A 4OA8A 4ZTZB 4OJTA 3JQ7B 4ZAGA 4A9AA 4GL4A 4K9KA 3BD9A 2IYEA 4LV5B 3EZYA 3MF4A 4M1WA 1F2TB 4Q01A 3G89A 3V97A 1RCFA 1R6BX 2CDNA 2WRZA 3K8ZA 1NMSA 1PEAA 3L8HA 4TQGA 4AF7A 3TOXA 2KPOA 3CKKA 3OCXA 4EKYA 2Q4OA 2IZ0A 1TXGA 1UP7A 1ZHOA 3GEDA 4Q7KA 2G71A 4NJEB 3N3AC 4B3XA 2AT1A 1Q7EA 3BTOA 3DFKA 4PSAA 4H31A 1PO7A 4RIHA 3QIAA 2V5VA 3TTYA 1KBZA 1UQUA 4E2YA 4DDKA 3EGVA 5JZSA 1V43A 1W4BA 3E6AA 1JILA 3ZTYA 2BEUA 1QO0D 2FA9A 2JIDA 5BSTA 1KXZA 3SI7A 4D80A 3AF0A 4IF6A 4P84A 4E4RA 1W49A 3BGOS 3GBSA 4IOMA 3WMWA 1E6LA 3PL5A 4PVCA 4HVTA 3T3IA 5FA8A 4A2QA 4PG8A 3TQQA 3CEMA 4G5OA 4KFRA 1P0FA 3QX8A 3D6TB 3QE3A 4NXMB 4OHCA 1EWTA 2IHKA 3A6FA 3PX3A 3ZGNA 3D3NA 5ALZA 2AJBA 4IQFA 4K6FA 2QTGA 1SVOA 2Y99A 4ZI7F 1T9KA 1BG6A 3A04A 3T1OA 2QJTA 2PYDA 1DDOA 3F7NA 3TIFA 3UA3A 3AGQA 2QLTA 4XEHA 3EVZA 3EUWA 4JI8B 2CCKA 2GJ8A 1SC9A 2Y8EA 4TV9F 1GPLA 4DQXA 5JIBA 3NM6B 4CTMA 4L5BA 3GUYA 2OG2A 3L1KA 2I8CA 2NV0A 2Y1XA 1U0LA 2ODWA 3PE3A 4E15A 2C8KA 4EPYA 2R5WA 2X7HA 4DQKA 3ZX4A 2H06A 4O4IB 4Q4AA 4N76A 3AO0B 4LYDA 3OT5A 4CM4A 1VQ1A 2JFUA 3H8VA 2O2HA 4RYLA 2LDBA 5EESA 3CUKA 5F5NA 1XNRB 1WE2A 5JSZB 1JFSA 2D5AA 1PZMA 4BX9A 1CUAA 1EU1A 3SD7A 3F46A 1TTPB 1JFRA 4NQZA 3T7JA 4A0QA 4DIUA 3Q15C 1BQEA 2RH8A 4X7PA 5C1PA 5HF5A 1K6XA 4PLYA 1NONA 4FI3C 1VMDA 1JQ3A 3PHLA 4YJFB 2EP8A 1LPPA 4KXLA 1Z15A 3RU7A 1O6CA 4KWEA 4RTLA 4YB8A 1XLUA 2W9XA 4CI9A 5LXTB 2MINA 3DFUA 1RI3A 4JT8A 4I50F 4MVJA 4RELA 1E0KA 4UHEA 3BHJA 4QTYA 3WO1A 1M74A 1STOA 1R74A 3GT0A 4K6KA 4C04A 4C20A 3Q7PA 1K97A 5F1PA 2G0TA 1O6ZA 3U31A 4W8GA 4O1IA 1LBHA 3GD5A 2H9YA 3LPCA 2AJDA 2NZ2A 5DRYA 2ESRA 4V38A 3TB6A 3L8GA 2OQVA 1ZXLA 2PTHA 5A9SA 2KW5A 3FMFA 1H8EA 1XHFA 4F2DA 2GB4A 1PT9A 3TQTA 1T29A 1PZFA 1YVUA 3HB5X 2Q8QA 3KWJA 4MZDA 2BHLA 1N25A 3L7JA 1Q0HA 2UKDA 4UDOA 4IDQA 4HTAA 2BW0A 2QN7A 2PUBA 2SCUA 5EUBA 2ZSHA 1E2NA 1BQ3A 4JUAA 4C4RA 2QX6A 1I30A 1JU9A 3RV4A 3TZCA 1NC3A 4BO9A 3VA7A 2NZVG 4XQ0A 5FBZA 3QOXA 4Z3DA 1V95A 2OLEA 3HCAA 4H0NA 1PIWA 4HH0A 4O4HF 4Q34A 5TQ2B 4BATA 4E13A 2J59A 1W7AA 2RGXA 2RGAA 3TW0A 3GAZA 3J7TA 4E2XA 4TKVA 2WSLA 2CEKA 3QFHA 3ZU5A 1USWA 3R5XA 3C8MA 3SZUA 3GCGA 2ZANA 3K5HA 2CXSA 1F0YA 2HLPA 4RD2A 4RU1A 3ZJUA 3OFKA 3HJNA 3LY5A 2BDUA 2LXNA 3M1LA 3JAKB 3R5KA 1EZ4A 4KQ1A 3OC0A 2Q1SA 2ANCA 2PS9A 1W0CA 1FFWA 1V7ZA 2JL1A 1N8TA 3R5JA 1GQ2A 1H9CA 4QDOA 5NLLA 3ETCA 1CF2O 1ZA2A 1MGPA 4JB3A 1JHZA 1Z3CA 1B8NA 4BVJA 1AQ6A 1EZ1A 2ODAA 1GQQA 1ZK0A 2X15A 4H6XA 4IMPA 4D26A 2M6RA 4UUOA 4M7OA 1E79D 1GD1O 2FE1A 2YZKA 3I6ZA 4JJGA 2ZB2A 1H3FA 1P9WA 2VBIA 1CV2A 3K7EA 3U3DA 2ZULA 4CPDA 4BJ6A 2VHQA 5TS2A 1M2HA 2V5UA 1FTQA 2XECA 3O94A 1ONBA 5THQA 2JKZA 5HKKD 4AIRA 1UC5B 4CG1A 2FG7C 4RL6A 4XCQA 2WY2D 1JV2B 16PKA 4I6EA 1I6WA 3OOEA 2QWXA 5CNIA 1ZA1A 2GM5A 5ENVA 2X8BA 3NANA 3P9ZA 2W2NA 2C3OA 1C3LA 3JR7A 4A23A 1MVOA 5BWNA 3CMMA 5EIAA 4LGVA 3GJRA 3QYJA 3QXHA 3QLUA 3WYGA 5BSWA 2O2CA 3AIIA 3BUSA 4P6VF 4RDCA 3R1IA 1MO4A 1YVDA 2CLIB 3VR0A 4EDHA 3OJ0A 3NALA 3K6SA 2X76A 4XSVA 1R1DA 1JEQA 4ZD6A 4EHLA 3RRYA 1M72A 5E4YA 3PRJA 4QECA 1LB1B 1QO0A 4FGUA 4JIGA 3QE9Y 1N36B 4MRSA 4BZWA 2QAJA 4JDPA 4X24A 4CKYA 1IBMB 1T24A 2C2WA 4D46A 1IHXA 2XWPA 1A9SA 1P1FA 4I1IA 1IZ9A 1I0IA 1JVNA 3EMVA 4L6IA 3QQ5A 2NU6B 3IA7A 3TAXA 1DTSA 3GGOA 2VJOA 3KJIA 3OQIB 4QJ4A 5AOAA 2OFFA 4AT1A 4U7HA 4TMZA 3BF7A 4TTJA 4YJ2F 2VSOA 3LZDA 1WP9A 3M5WA 2FUG1 2RHOA 2HT6A 2X1HA 2DQZA 4MP3A 5KWSA 2VRWA 4MAFA 2ZAGA 2VNSA 1R0RE 2AN9A 2NG1A 4IZHA 4WSOA 3RSFA 4EGCB 2JCXA 3RU3A 1Q20A 1G21B 4DRZA 3UG7A 1LDNA 3G9XA 3BA6A 4E12A 2PDAA 1QLWA 1RAFA 2EJUA 4U8GA 4JJ7A 2XKBA 3FUVA 1AUQA 4AKTA 1L5KA 3QKIA 4YRGA 3IV7A 2PRSA 3AGPA 3KAJA 2GZHA 3M70A 4R3UC 3OZIA 2ZYUX 3FLEA 4UVDA 2OZEA 4MGZR 1EJBA 2YOHA 2PG3A 3PSHA 4ERNA 2F67A 1V16A 2VAXA 3BE6A 4OJYA 4W4TA 3TBKA 4UDXX 1HEUA 4YP9A 2GMWA 1JFTA 1TYZA 4LVOA 3HJBA 5CX1B 4DIMA 1TO1E 5DLQC 1KQPA 5LQSA 5KPJA 2DFNA 4Z3KA 1XVVA 3FY4A 4CM3A 1XU4A 5C3MA 2EBUA 4IEEA 3DBLB 3F6EX 4DVGA 2IYTA 4J76A 2AYZA 4TOIA 1KO4A 1UANA 2O3RA 4ZMSA 2ZU6A 1E66A 1GUYA 4JKOA 5PNTA 4NHEA 4L85A 2HJ9A 4GSYA 3RADC 3O4HA 3DUFB 3SEFA 2CMDA 2YHBA 3P2EA 4DANA 5IWCA 2C8JA 2OC9A 5BXQC 4PXSA 2BHTA 1LFDB 2ZSUA 4UMFA 3OZWA 5JAMA 3VV2A 3PEYA 2WHEA 5I48A 4L0CA 2AFHB 2ASEA 1J22A 2QKYA 3W5DA 1OY1A 5JQGA 1SBZA 1ZR4A 1IONA 2H5EA 1LD3A 1J9EA 4D98A 2VXYA 2ZIXB 1S01A 1DUIA 2TMKA 4L9RA 1NJ8A 1YZTA 2XUDA 4L27A 1C1HA 2V0NA 3ZYZA 4G1UC 2FPLA 3P32A 2QUJA 1PT7A 4JC4A 1DXHA 1I10A 4HYTA 2BT4A 3O93A 1ITZA 3R6LA 4Q4DA 1Z5PA 2WM3A 1YR3A 3AG5A 1XRRA 4AJOA 1GPH1 5DMHA 2UVDA 1TTHA 2A30A 2VJNA 1G8PA 4LUCA 5AJWA 3ZIAA 1RTTA 3H11B 5ERYA 3TW8A 1NMEA 1GZSA 3A6GA 5EJIA 2QJFA 3V7UA 4URVR 2QV7A 3QMWA 6GPBA 1W48A 2YJTD 3AW8A 4RIIA 5JU6A 1L7DA 5EWMA 3IDAA 3IILA 3QU2A 5JVDF 1B42A 2C7VA 2O8FA 4H9GA 4UBLA 1PGOA 3P94A 4FYWA 1L7NA 5FOTA 2CL6X 2OP1A 1E3WA 1VJ1A 3AOEA 5EIHA 4UBKA 2QTCA 1NX9A 2SICE 4HRVA 5EMLA 2Z83A 4ITUA 3VPGA 2HSJA 3EXG1 3PYXA 4C0LA 3OUZA 2VP3A 3T4XA 1AHPA 1YZGA 4YP7A 5LOVF 3I61A 5DBGA 1KY5A 2F7SA 1R64A 2GN8A 2NP7A 2GF9A 2PYIA 1JTEA 4EZIA 3AVXA 2HBYA 4YRCA 3MYRA 3UB4A 3LK7A 1XKQA 2IUEA 3UH1A 2RK4A 1P44A 1PD0A 3B9RA 4YFVA 1WY7A 1OR8A 3GK3A 2G1UA 2QTWB 2O0JA 3SIWA 5CXSA 3SKVA 3VR2A 4D8UA 1CZOA 1T8WA 4OHUA 1W47A 3CLTC 2IKQA 1JR3E 4BAZA 3MOIA 4CXMA 1YFJA 3ESDA 3HDYA 2MYTA 4ER6A 4ND8B 3DE0X 1Y8AA 3HXKA 1IRXA 2PNFA 3E9QA 3HXQA 1KZ1A 1VIYA 1Z74A 3B5JA 2G80A 4OH1A 4CT0A 5K0CA 3P0IA 3R7FA 1UR5A 2BHNA 3QKWA 4TN1A 2H7YA 1QLHA 2UYGA 4FJ0A 4H0CA 1YS1X 2D7DA 3K73O 4GXQA 3PC8C 4TSRA 2D1TA 3HXLA 3WQQA 3MBIA 2J3MA 3MB8A 4WXHA 2IP4A 2PKQO 2Q3EA 1WUTA 3PVZA 2JK1A 1AKRA 1GGKA 3LPNA 4HTFA 5EIFA 2XWBF 5K0FA 4YEDA 4FDTA 2WZBA 2O19A 4NC9A 4S12A 3BMCB 4TMVA 1RRPA 4DJFC 1FYEA 3D3WA 2ZBFA 3D0KA 3GFBA 4H3KB 1P74A 1NA5A 5BN1A 3H18A 4BTEA 3LQYA 1ESDA 2VXCA 1I4DD 1WB5A 3CZCA 3PNMA 1U8FO 4HGYA 5EJAA 5EJEA 1YRAA 2VG8A 2ICAA 3MSXA 4K3VA 3T35A 1WUHS 5E6UA 3KWFA 4CEJA 1DX4A 2R44A 2R2AA 2ODQA 1PX2A 1NMXA 1WO8A 2Z8XA 4RACA 3ZE2B 4LXTA 5KNBH 4LF9B 1SD2A 3A2MA 3IVGA 3BBLA 1UDAA 1E1NA 2H5JA 2RGEA 3WLMA 3OPQA 3WBJA 3BD8A 3Q9SA 4LI3X 2LD4A 2ASVA 2EBHX 4OYYA 5F2NA 1JFFA 3OJXA 2NPOA 1OBHA 4Y98A 5KKAA 3WX0A 1JEYB 2HMTA 3D8NA 5KYUA 3WDMA 1E2BA 4UJ3A 5MN6A 2GFHA 3THWB 2ZIUB 3L8DA 2WU0A 2X9VA 1F6WA 1FSZA 3I1IA 4JGIA 3UJNA 1WU7A 5EIXA 3IE0A 2J9XB 3SSNA 4B4WA 4JI7B 4AY2A 2A5LA 2VYQA 3KTOA 1ZOPA 3N70A 2JARA 4MS1B 1TRHA 4IYRA 4OQDA 4UHCA 3S2SA 3NVDA 4RY2A 1RBYA 4DV6B 2IVZA 2WK1A 5CDGA 2HZBA 1JJIA 1AGYA 2WTAA 3WVNA 3G17A 4MRRA 5EIEA 4PQRA 3FB1A 1X0VA 2B4TO 1H2FA 3C5WP 3LQ4A 2HQ1A 5DMXA 3UMSA 1ICIA 1QP0A 5IC5A 3G0GA 2JAWA 4HAIA 2CWDA 5C5IA 2WU4A 2WYUA 1ZI6A 3ROZA 1IQPA 3JXEA 1NV8A 1DFHA 4EKIA 3B3AA 5HK8A 2C00A 3O95A 5I4CA 1E7SA 4I5FA 3BORA 4Y9SA 4E07A 4OQQA 2FEWB 5C2JB 1QIKA 1SQGA 2IYAA 1PQPA 5LZ7A 1IZYA 1KPHA 1PDWA 4CKCA 1XTJA 2EJVA 3NIFB 2VATA 2W2LD 4IL5A 2AG0A 2X4LA 2A7XA 2A33A 2B98A 2BZGA 3GFOA 2ZEJA 3L43A 4IQ8A 5A7FA 2JEOA 1I7QB 4BQRA 1EEXB 3AV0B 4CBVA 3FYUA 1T6YA 4E2FA 4NOMA 3TXXA 5JPCA 5GIPE 4BVLA 1ECPA 5L53A 5JHGB 5J2UF 1ST3A 2NAPA 1F48A 3BMOB 3PC6A 4IG9A 1OHHA 2YWFA 1NR1A 1TB4A 4XD2A 2IZ6A 4Y9RA 4ZCLA 4M0PA 4KEAA 5MHTA 4JA2A 1YQ9A 1Q7GA 2IL1A 3EWNA 3WBKA 4WK2B 1Z0DA 4RHYA 2PZAA 3BDAA 1MU0A 3PXDA 4FBGA 2P4SA 5A71A 2Q4TA 1KQ3A 1F5SA 3EUAA 3OQHA 1XN4A 5DP1A 3BSWA 1QHNA 3LDUA 4ZARA 4BFTA 4FMBB 3K2BA 3GN2A 5DGXA 5E1OA 2DQYA 3QLJA 1J9ZA 1XXHB 3O91A 1U3FA 2YQZA 5KDLA 5M3BA 5C4IA 2FCAA 2JD1A 3RGGA 4UUNA 3WDSA 2B82A 3H6KA 1P1JA 1U94A 2QVYX 1VKHA 2N42A 3E22B 2YWBA 2AW3A 2H63A 3NKLA 4FBLA 4K8RB 2C3MA 4HWPA 1Z37A 3IPLA 4WNCA 5D7BA 2B21A 4D9MA 4C1NA 5LVAA 4QX6A 2GSDA 4HH3C 3K0KA 2C7GA 4P8RA 2WWVD 1X1TA 2B8WA 2AK2A 2EHJA 4QFDA 3GCDA 4UHFA 2WNSA 3NUGA 1Z29A 3DGEC 3HEAA 4CNBA 2NQ8A 3H1EA 4N6GA 2GN6A 5IMSA 2R6CA 4K03A 2GLXA 5DX1A 5DW0A 2A0XA 1WUJS 5EZQA 3MS4A 2AF3C 4IOKA 3GCXA