4WKOA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with hydroxybutylthio-dadme-immucillin-a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wkoA00
2B94A 4F2WA 4YMLA 2HSWA 4FFSA 4M7WA 3P0EA 3FOWA 1T8YA 1PR2A 4WKPA 3LGSA 4YJKA 4R31A 1Y1QA 3OZEA 5F7ZA 1WTAA 4F2PA 4GLFA 5EFOA 1PK9A 3GGSA 1U1DA 2QDKA 4TS3A 4P54A 4R2WA 1OTYA 5CYFA 3LBAA 1ZL2A 4K6OA 4BMXA 1OUMA 1M73E 1LVUA 2OXFA 5I3CA 3OZBA 3UAVA 3EMVA 2AC7A 1RCTE 3FB1A 1VHWA 4WKBA 1JDSA 5K1ZA 1ODJA 3FNQA 1Z33A 3C74A 3PHCA 3INYA 4TXNA 4BMYA 5B7QA 1SQ6A 4D8YA 4NSNA 1I80A 1K3FA 1SJ9A 3KHSA 4M3NA 1OV6A 1Z37A 4G41A 1ULBA 1PR0A 1LX7A 2QTGA 3ONVA 3T94A 3P0FA 1Y1RA 3D1VA 1PK7A 3EUFA 2ISCA 5B7GA 2GUWA 1TD1A 2AI2A 3OCCA 1A69A 3UT6A 1K27A 1RXUA 5B7PA 3K8OE 5F7XA 1JDZA 2IQ5A 4QAQA 4L5CA 4TYMA 3O6VA 1Z5OA 3OZCA 3ODGA 1Z5PA 1JYSA 1TCVA 2A0XA 1PR4A 4M1EA 4LDNA 4YO8A 5EPUA 4I2VA 2QSUA 5CYGA 1U1CA 2PGAA 4PR3A 4JOSA 4WKOA 1B8NA 3IOMA 1YQQA 3DPSA 5KB3A 2H8GA 1Y6QA 1OTXA 1TGVA 1Y1SA 3PNSA 1Y6RA 4TTAA 1ODLA 4EARA 1VFNA 1U1FA 2I4TA 1RXYA 4JP5A 4QFBA 3O4VA 3NM6B 2Q7OE 1Q1GA 4DA6A 4UC0A 2QTTA 4L6IA 5F7JA 5FAKA 4MCIA 1T0UA 3NM5A 4L5YA 4D98A 4G89A 4F3CA 4DA0A 1SD1A 1Y1TA 4D8XA 4DARA 4DANA 4H1TA 1VMKA 3BSFA 3UAYA 2A0YA 2ON6A 4ECEA 4F3KA 2I8AA 3PHBE 4MARA 1VHJA 5ETJA 1RFGE 4LNHA 1RSZA 5CCDA 2A8YA 3ENZA 1PKEA 3KU4A 3OF3A 1Z35A 1JE0A 4L0MA 1RT9A 1V45E 5CXSA 3BJEA 3F8WA 1ODKA 3EUEA 3E9RA 4GMHA 1XE3A 2HN9A 3DP9A 1LV8A 1JDTA 1JDUA 3KVRA 3OOEA 4LZWA 5CCEA 3TL6A 3EEIA 4DA8A 4OJTA 1Z34A 3PNPA 1YQUA 5C80A 2OECA 1V4NA 1CG6A 2OC4A 1U1GA 4QATA 4TTIA 1V3QE 4D9HA 1ULAA 4OF4A 3KUKA 1PW7A 4KN5A 1TGYA 4R2XA 1B8OA 1RYZA 3FAZA 2BSXA 3BL6A 1NC3A 1T8RA 2XRFA 3DDOA 3UAXA 1CB0A 1ECPA 3GB9A 4BMZA 5F73A 2P4SA 4YNBA 5DK6A 3QPBA 1JP7A 1RXCA 1PBNA 3UAZA 4EB8A 1YR3A 2QPLA 1JE1A 1A9PA 1Z38A 1PR1A 4BN0A 1U1EA 1ZOSA 1Z5NA 4L5AA 4TS9A 1PWYE 4TXHA 1V48A 4F1WA 1SD2A 2OC9A 3DF9A 1QE5A 4LKRA 5CXQA 1A9OA 1YRYE 4NS1A 4RJ2A 3KVVA 3E9ZA 2A0WA 1N3IA 1PR5A 4JWTA 1A9RA 1RXSA 2HRDA 5JPCA 1A9SA 4E1VA 1A9QA 4OGLA 1JDVA 4QASA 3FUCA 4DABA 4QEZA 3UAWA 1T8SA 1V41E 3NBQA 3OZDA 4TTJA 1Z36A 4DAEA 3DJFA 1YBFA 1G2OA 4DAOA 1JPVA 5EUBA 3IEXA 1PR6A 4X24A 3MMSA 1RR6A 4TXLA 3NM4A 1Z39A 2AI3A 5F77A 4U2KA 4GLJA 3KVYA 4TXMA 4IP0A 1C3XA 2HWUA 3SCZA 4DA7A 1TCUA 1FXUA 1V2HE 3OPVA 4MCHA 3E0QA 3LA8A 4TXJA 4OY3A 2RJ3A 1NC1A 3FWPA 3MB8A 5B7NA 5IFKA 4QARA 4PNPA 4G8JA 2AI1A 4NY1A 1NW4A 4OEHA 1PF7E 4WKCA 3U40A 5F7OA 1T8WA 3OOHA 4WKNA 5F78A 5IU6A 1ODIA 4D8VA 1OVGA 1K9SA 1OU4A 3BGSA 4OGKA 4GKAA 5F76A 3K8QA 1A9TA 4LNAA
chains in the Genus database with same CATH superfamily
3TRFA 5IP5A 3DMHA 3SQLA 4DV7B 3H0KA 3U3JA 1MCZA 4UUMA 3WLPA 5C8VA 4X92A 3ABSB 3I9V6 3TSAA 4GQAA 4QBFA 3UCXA 7ADHA 1QIGA 2E4ZA 3GJXC 4L73A 2PZ8A 2QNBA 1BNCA 5IF3A 1YV9A 1PR2A 4PC3A 3V2GA 2VP2A 1EFKA 1RQ2A 4I4LA 3OF5A 4ZU6X 1HNWB 2C57A 1PEAA 3GMIA 1UZMA 1F6DA 2ZM5A 3DYIA 3LK6A 2WSYB 1PZHA 4MCAA 3MPUA 5FFNA 4DV4B 2XZLA 4OXKA 2JVIA 3CFYA 5F7ZA 3MAJA 1WTAA 3D6HA 1MQAA 1ORTA 1C9EA 1TDJA 4OIMA 3CBGA 1ZGBA 5TY0A 4BNGA 1PVVA 2QTHA 3L18A 1Z4NA 1FPQA 3WO1A 3PC8A 4S35A 1P80A 4GXTA 4MH0R 4DMCA 5BSGA 2AOUA 4QBKA 1PK9A 1CSEE 4UVDA 1TT5B 5EEHA 3TCXB 2LW7A 3CEPB 1L1EA 2PS1A 2QJFA 4IHKA 4JQCA 2Y77A 4U9HS 5EGSA 2OGZA 3IB6A 4PYLA 4B84A 1DCFA 3THXA 1ATIA 1GJRA 1JG2A 1EJ0A 1TO2E 3MJ4A 2CFIA 2OYRA 3UB4A 2CL7X 3DEIA 1Z6QA 2W2KB 3AXTA 3GYGA 2HU7A 3DE2X 4K6OA 2P91A 3VKHA 3GLHA 4EY4A 4CQMD 2JJ8A 5JDIC 1QV6A 2FOIA 1FJHA 2Y3IA 1KXJA 2EDCA 2YBDA 2X5JO 3RK4A 5LLTA 5F9FA 1Z06A 4UU8A 3S2YA 3IUBA 4PVCA 4RMGA 1M7BA 1FYVA 3G5TA 1FNNA 2BGWA 2XYHA 3C3XA 5THKA 3LFUA 3L01A 1WE2A 4GYKA 1UMBB 5BW4A 4MHTA 3R5JA 4NYJR 4Q3LA 4L4XA 4MDEA 3E9MA 3GVHA 5KYWB 3SU8A 2X1HA 5GPBA 1PGPA 4WESB 5E9AA 1PWHA 1UEJA 5KQPA 3HY4A 4PHGA 3RDPA 4B3JA 2DTXA 1M0SA 4FBGA 3EPRA 3TN7A 4L4ZA 1IL0A 2CLOB 4Q1BA 1QKJA 4HQLA 2V54A 3STHA 5JVDF 3H9QA 4OOFA 3LRTA 2HLPA 4XCQA 1P29A 2PCJA 4RE5A 3BICA 4D99A 1MABB 1VG8A 1HOXA 2IIQA 2CNOA 1DKMA 2C3MA 2P4QA 3QVKA 1N6RA 3FLMA 4LBWA 2A9PA 1B6RA 1E5QA 4BNUA 2HUNA 3TQIA 4D8UA 2W7TA 1K3FA 2OFWA 3O1IC 4KV9A 4TYQA 5COQA 1EFRA 1UC9A 1Y98A 1ULZA 1TZCA 2V7EA 2ZTVA 4NYJQ 2GO7A 4W9RA 2YXNA 3B38A 3QG1A 5CLFA 4YCLA 1TQ4A 5KKNB 5FPKA 5KNLA 2H18A 3FNIA 3QI7A 1U3TA 1QGYA 1OV6A 3GDOA 2I6QA 1F8XA 3BJRA 3L2OB 3VHXA 5EA2A 4MP3A 4BTLA 3QXCA 2VI5A 4ZTZB 1PJQA 3C0KA 2QZJA 3QA3E 4YRIA 5BWCA 2JDID 2ZRBA 4HBZA 4MVJM 5BRNA 2PFKA 4OB6A 4IDQA 4FYXA 2R47A 1G19A 2DFPA 2J3MA 1B1CA 1FFAA 3JASB 4RHFA 4OTZA 3QNMA 1QYCA 5L45A 1SUWA 1ZN2A 3MLAA 1MXHA 4Z5XA 5JQGA 2Y0BA 2NO1A 3OU7A 3R8XA 1VPEA 1E89A 2BOVA 1CJMA 1NBAA 5FUVA 4G5OA 4H17A 3R44A 5I7EA 1DPGA 3GRKA 3K15A 2LV8A 4XUGB 4XGKA 4B2IA 2QTVA 5G4KB 3ZN2A 1UZAA 4LFCB 4BNLA 1KVTA 3LPLA 5DX0A 1I5OA 2B35A 3KZVA 4XPZA 2CZCA 2PGJA 1U7PA 3QYJA 3G5MA 4BFVA 5BV8A 3VHQA 4TKVB 1RXUA 4OQZA 4A1FA 2O5RA 2EF0A 4DCTA 5L53A 1G8AA 2J5QA 4MS1A 5DM2A 4IIJB 5DSTA 2DWPA 2ZT7A 4TYMA 4L5CA 3PSHA 4X61A 4KMMA 5BQPA 1CQPA 2X58A 1ECGA 4PO1A 4URYR 3URKA 4NH4A 2O9JA 4IJMA 2IHVA 4O59O 3HM9A 3T3DA 4BRZA 5AJWA 1CXZA 4M76B 2PKQP 2DQZA 3FI9A 2ADOA 2XUDA 1EQAA 2R00C 4JP8A 5CFQA 3RFVA 4LCEA 4HGQA 3PI7A 4PEVA 1FFSA 2OXCA 4M99A 5AM2A 1ZYUA 1WABA 2H17A 1U1CA 3WTBA 4BO0A 3N6XA 3L6OO 3K1YA 1BEUB 4XWWA 4FYVA 3ZGNA 4HX2A 4RH3A 4RTJA 3DFUA 4RF5A 3IV9A 3N0RA 4G9BA 1TF7A 4HAZA 3ZDYB 1XKXA 1JLRA 2GUGA 1J8QA 4IAOA 4LMBA 3MHPA 1MJHA 1E3MA 4B6PA 4JEIA 5BXQC 1GPAA 2WFAA 4C6SA 2JHAA 1OKKD 1RQNA 3LZCA 1P77A 2QQEA 2WDZA 1THGA 1IMOA 3C6BA 2DWOA 2ODWA 4EKGA 2AS0A 2ZJAA 3DYVA 3PEEA 4HC4A 5C3UA 1Z7WA 1M1XB 5I7RA 1SCQA 5AK6A 2VHQA 4UJ3A 4YCAA 5E8RA 1CQWA 1R9JA 2GXQA 3E3NA 1GZSA 5JO9A 1O9HA 1KI8A 3PXDA 3WLKX 4D9JA 3OUTA 4KHPB 2JVKA 2I9KA 1M0EA 2BKUA 5E4FA 4NFLA 3X43A 4IXTA 5T4FA 1E2MA 3OZWA 1CR4A 2ZRMA 3HB1A 4BJHB 5DYTA 3HKCA 4IBOA 3MBIA 4ARCA 1T5BA 2NX2A 4RDIA 2JFBA 3E27A 5G02A 4EX7A 1HT1E 4DNXA 1AGYA 5IKMA 3DV2A 2ONYA 3JQ8A 3O4RA 1KH2A 3CPEA 3QRWA 4L22A 7AT1A 1AA6A 1YHYA 2FAXA 1AXEA 4X94A 1DRKA 2NZJA 2XQGA 3C6QA 5EJMA 5HF9A 4BBAA 4C4AA 1A2KC 1J70A 4FEEA 3RSSA 3GCZA 1A8UA 1XQ9A 3HYNA 3PRJA 1JDNA 2O3JA 4G07A 3U3ZA 3K8ZA 1MC5A 3RYFA 1UXIA 1Z45A 1RKVA 4QTTB 1G4UR 4YMSA 5ALHA 5TQ2A 1ZSYA 5CVTA 1G4HA 4HX9A 4ZYWA 1B73A 1Y6ZA 3WGMA 4XWAA 5HYVA 1ETUA 2V8BA 4N0QA 4D98A 1RQGA 1YS4A 2GJ8A 4DL9A 2NG1A 5IWCA 2ZYWX 4EMTA 3DLAA 1M2WA 1PWEA 5K8VA 2C7OA 5EIFA 3IBFA 1NR1A 3G1UA 4U7HA 1EMDA 2I71A 2FK7A 3QU7A 4I8XA 5CK4A 4CV3A 1FNCA 3HDHA 3SQOA 3A7EA 4DBVO 3PDIA 5IUNC 4DDTA 1WDLA 1G5HA 3C43A 3RG2A 4M7PA 3UAYA 1M7GA 4I99A 4DADA 1JIKA 2LR0A 3RS4A 4CPDA 3UJCA 4QRDA 4BVEA 4ARZB 5J2TA 1OI4A 3IXLA 3EZ7A 4IJ6A 3WX0A 3B3GA 1VKHA 5AKLA 1X1EA 3HH8A 1OLSA 2ZIVB 3HVKA 5HW0A 4Z8XA 2PUTA 1EUDB 3IHKA 4LMPA 2PV7A 4C4YA 8ADHA 2XTJA 4DW8A 1BOFA 2QR5A 2XUQA 4JS0A 4ZRDA 1NW6A 2DFTA 1V1MB 2IXDA 4K9DA 4DQVA 1J09A 2CVPA 3TDMA 2F3SA 2BRUC 3U4IA 1N6LA 3HCRA 4IR7A 4WZBB 1U2ZA 5JXGA 1PFGA 5A2QA 3IUYA 1HT0A 2O57A 3B5JA 5AI9A 5ECYA 3MYYA 1WMEA 2OCDA 5FNVB 4P93A 1OB2A 3VAAA 2JLWA 3K6RA 2WKPA 5BRJA 2OSBA 2PH5A 4DQKA 2EOAA 3DCNA 4CEIB 1DX6A 2XOEA 2Z9CA 4KNVA 3X3HA 1W36C 4A8JC 1W52X 3HUUA 4OSOA 2OO3A 1YZTA 3COVA 3PD1A 4MR9A 1ZINA 3FPLA 3ZCSA 5ALPA 4FJ2A 3GVIA 4EUKA 2QXYA 4W5HA 4F96A 3L4KA 2PSDA 4DMHA 1ECJA 5IJ9B 4MV4A 4NQRA 4TSFD 1RLMA 4WIAA 1LRLA 4D9MA 1HSOA 2K7ZA 2ZUEA 2NUAA 2Y1KA 2CWDA 3MLEA 4LJ9A 1EZZA 2HF7A 3UK7A 1H8HD 2PLFA 4RNCA 2GM3A 1V3QE 4R9NA 1YGYA 3T6KA 3JQAD 3W6NA 4OQ4A 2FG5A 4ALKA 1KVSA 2VXOA 5DYNA 3L0OA 3W90A 3CXUA 1X1RA 1PVOA 1V11B 1YL7A 1XKTA 2WUDA 1A0OA 4PXSA 3G7NA 1G21A 2AJTA 3C5HA 3KKQA 1GO2A 3L8GA 3R0QA 4GLBA 4JEHA 4JJIA 2HU2A 4LOIA 1UM8A 1MU0A 3VJMA 1B26A 1UJ6A 2PYDA 3FYHA 4BVFA 4LHYA 3DKVA 1AMOA 4KFRA 4J4HA 4LK2A 1CERA 3JQRA 2GZ3A 2X5OA 1Q21A 5IJXA 3QX9A 3PPYA 4I9NA 4DY6A 1U7OA 2F48A 4LYFA 4UQOA 4X20A 1XMXA 5IUKC 4CLHA 2HDOA 2P4SA 1DAIA 3O2QB 3WLEA 2KS6A 3CF4A 1EVLA 4OV6B 5C4GB 5A04A 1YXMA 5CB4A 5K8TA 1JDBB 4NBTA 1IY0A 2GZRA 3FHOA 4E12A 2F00A 4DM3A 1ETHA 1QUEA 2CL0X 2ZB2A 3GD7A 2NVBA 3JAKB 4E3WA 4MVJP 4NZOA 3KTFA 3ESDA 2WJ6A 1IJEA 4HN4B 4C2BA 4EF4A 1G5IA 1C4KA 4X8LA 3BJZA 2QL7A 1O3YA 3U4DA 1WP4A 1CS0B 1VJRA 3E58A 3OIFA 2H65A 2VP3A 3C98A 4KRXA 4UJ5A 4BLSA 3D5TA 3NDPA 3OZTA 1NTOA 2VWPA 3ETNA 5JS2A 5IW8A 3PUWA 4REQB 2XOKD 4JFRA 1N9KA 2PYZA 2Y1CA 1PR1A 4Y6LA 4BN0A 3TIVA 3EZ2A 3FMIA 5JSKA 5M3BA 2NSLA 3BMQA 2BGGA 4N6NA 1Y82A 5KJEA 3FTEA 4Q03A 3WQRA 1V48A 1FRZA 3PBKA 2I3DA 3BGOS 3DF9A 4JI7B 2JFVA 3A3YA 3OFND 4MQFB 2DQ4A 1U7WA 1WCV1 1XYGA 1UEIA 4XM1A 5B64A 4KAFA 4G2TA 4KGZA 2JAXA 3PPIA 3QEBZ 1WXXA 1JHQA 2ICAA 2QYOA 4X6YA 5KU1A 2W2VA 2QORA 3UWDA 2HRDA 5BQOA 1YA8A 1T24A 5JPCA 3M4YA 4RKWA 2OMKA 3UCFA 3ZLVA 2O8DA 4WT7A 3JQAB 1SU4A 1P7YA 2E49A 2UZ4A 1G5QA 3MF4A 2O1XA 2D1YA 1N5DA 2WWXA 1JA1A 2W8ZA 2YS6A 3ZIAA 2XT9A 1R16A 4R69A 4C20A 2BTEA 2G0NA 3CWCA 3QBTA 4FZVA 4DJFC 5HF6A 4M86A 3OZDA 3CLSC 4BPBA 1XMIA 3EZFA 3QU5A 1EP3B 4QDTA 4MV1A 1MH1A 1A7JA 3WMWA 3NUQA 1CP3A 1DAMA 1G3RA 3DJFA 3QYAA 4IKOA 1I3KA 1S2MA 1KOFA 4ND8B 3AL2A 3UB2A 3MTJA 1DBQA 2G9NA 1YBFA 4TKZA 3U19A 4RZUA 4L6CA 3BXOA 4RLHA 5HHTA 5CA0A 3RC1A 2H4ZA 1QRSA 1JHPA 3AZOA 3AHIA 2YJ4A 2CJWB 3MS7A 4LX0A 3RTGA 1GUDA 3O4IA 3AIMA 2N42A 1GQOA 5KCMA 2BEWA 2J0VA 3HFGA 4BAZA 3FDZA 3HLKA 1N2CB 1R74A 2WWRA 5CXUA 5I5EA 4YJ2F 1GHTA 3G1WA 1P5JA 3E53A 3TGPA 2O59A 3H1PA 3IDOA 1AN0A 4ZP1A 2ZQZA 4R68A 3CKYA 4MB6A 4C2AA 1MV5A 1VXOA 1R8JA 2OBMA 2F1RA 2PS9A 2ZANA 3KPVA 1XOIA 3WY9A 4ZK6A 1FXUA 3P2KA 4HWKA 4A2CA 3MRSA 1I6MA 1SH7A 4OFZA 3E8MA 1AUVA 1XBTA 1PX2A 1M5TA 3I72A 1SKUA 3I6MA 2PSEA 3QVVA 3LA8A 3TLBA 2G5PA 3P0JA 3T3OA 2FWAA 1X1TA 3I2KA 3SM9A 5LOVB 3IP5A 4G5YA 1SQFA 3P26A 1SK9A 2IUYA 3HI4A 1NC1A 1T0BA 3OIGA 3QLVA 4YMUA 5LP6B 4JXJA 3E3MA 2QD1A 1HNNA 4WOCA 1PK8A 3C3PA 4G8JA 4TL6A 2J09A 1ARZA 1X74A 2AMYA 3AHJA 4L9RA 1IAQA 1G1AA 1Q11A 2DJIA 1QUFA 3DT6A 5LB2A 3AVUA 1V26A 3I42A 1GP2A 1FDIA 3M2PA 1Z62A 4XVRA 3WWYA 3WIUA 3MSCA 3SVZA 4D7AA 3OOHA 2HCJB 4EJMA 3KZXA 2BMWA 3E7WA 2PD4A 4KYVA 3ZWQA 3D4LA 3KUCA 4LZNA 1DTSA 2FEKA 4X7PA 2YXBA 3GZNB 2P75A 3D5QA 3EWNA 1GLGA 5EZYA 3QPWA 2AA3A 2WJZB 3NWPA 4AO7A 4PQGA 1OU4A 2VP9A 2GPBA 4LVCA 5ICFA 4GFDA 2J5XA 4YP5A 4B9AA 2ZR0A 1EGMB 4XE5A 4ENTA 4URXR 4Q3NA 2BF7A 4B81A 2O3UA 2PKXA 1C7IA 1XXHE 3V1MA 4W9MC 2CHEA 3N8DA 2D54A 4Q3BA 3VMMA 1T5HX 2AC4A 1CZNA 4NZZA 3K2IA 4HAVA 3P9IA 1LFAA 2VPYA 5LZ4A 4FGKA 3D1LA 4HNRA 4L75A 3K1TA 1RRKA 1L5VA 3CNBA 1SEVA 4CCYB 1IBMB 4DV1B 1ZVMA 3BKXA 3R3SA 4EZEA 3PE4A 4MMXB 5J9FA 3TSYA 4NI5A 3AB7A 1CNFA 4IQFA 4AY2A 2ATVA 1NVWQ 4B3IA 4KQ9A 4D8TA 3UBTA 2REXB 3PC3A 3M83A 3JWGA 2XR1A 3OWOA 1RI3A 4LDAA 4Q48A 3U6BA 1NJ2A 2IUUA 3C6ZA 1EXVA 2WTBA 3CH5A 7YASA 1NXXA 3RVLA 4CLDA 5DNWA 2IXTA 1M6EX 1S02A 1ZD1A 2X9VA 1U1DA 3H8WA 4QPCA 2WY2D 1USUA 5JJBA 2QDKA 1R6XA 5C18A 4V03A 3LUFA 1YZLA 2XV1A 1W46A 2IUSA 4J1SA 3ZCXA 1HYGA 4NCXA 1E2IA 4MGYR 1R00A 3S99A 4Q9KA 5TSDA 1DDIA 2AD1A 3CIFA 4TX1A 1R4MB 1RXVA 2WT4A 4LRWA 3TEJA 1RWQA 1IWBB 4RBNA 2XSZD 2EW2A 4RAQA 2NTVA 4TMFA 2BCGY 4ZZIA 3SE0A 3HZHA 1QO7A 4MWCA 1MC4A 1TCAA 2B8EA 3TVTA 4YB8A 2HJGA 2XTNA 5GONA 1QGDA 4MV3A 1FLDA 4HNSA 5B3AA 5IVDA 4ZI7A 3R6TA 1RI2A 5ECGC 3OZSA 3GNQA 2A0KA 3A1SA 5HJ7A 3J7TA 1FYWA 3ZW8A 2MTBA 2MOKA 2YVKA 4FOSA 1ODJA 4QHTA 9LDBA 1RC8A 1N6HA 3PHCA 3PP8A 3CH6A 5BSTA 3AF3A 4F4UA 4IMJB 2VF5X 3GCXA 3IPRA 4H27A 1RLIA 4UE6A 5EWJB 5ULLA 2F2TA 5KJ6A 5GINE 1QK4A 1Y7HA 2OD9A 2J6IA 3NORA 4HVAA 4D02A 4LYJA 2YRXA 4TXNA 2CHUA 4N8EA 3ZE6A 5ILOA 3U7HB 2H1OA 3HKDB 1XUOA 1STOA 3JWPA 1ABFA 2AMFA 1P7ZA 3DFKA 3RVKA 1L5WA 4Q1VA 4F5YA 5JW6A 2FSVC 3D54D 3KKLA 1NUPA 4B33A 2RARA 4I66A 5TRTA 3DO6A 2XECA 3L82B 2E6UX 5BSUA 4DILA 3B78A 4DYDA 1FZQA 2AFHE 1I7PA 1ISGA 5C7YA 2XMPA 3HY3A 2C61A 1OBHA 4O2AF 4ESHA 2IL1A 4BVLA 3BILA 3Q0EA 4NMXB 2CNBA 2BEUA 2KX7A 4Q93A 1OPRA 1C8VB 1ZS9A 3QVWA 4M53A 4CGZA 2ZSIA 2VVTA 1JA0A 4XEUA 1ESZA 3IALA 1TT5A 1PV2A 1LX7A 3A6HA 4UMDA 1AX9A 2J3DA 2W6MA 4S05A 2AN3A 4GRAA 2QE6A 3I61A 1RBMA 3F2IA 3LLMA 3TL2A 1A7AA 3LT2A 1QLHA 4AWBA 4DZZA 4AJIA 5SYAA 1R15A 2VF8A 2JA2A 1MVLA 2C4MA 2G1AA 3GJYA 2ZYTX 1WBJB 2PCLA 1ZK4A 4HHEA 4KE6A 4QHYA 3VOSA 4HATA 3FOFC 3CF6R 3PCTA 3WE7A 1DEXA 1YC2A 4Q9LA 2JARA 3FRJA 1WSAA 3TQQA 1PJSA 1T8TA 4KQJA 1QVRA 5FORA 2Z57A 2PSFA 3WMGA 1ZM7A 1SVKA 3GCWA 1QIEA 3IILA 4DR1B 5ALGA 5FPPA 1NATA 1SY7A 3IPCA 1N2GA 4OHKA 3PNKA 4UPVA 1GG5A 2AQIA 3WVNA 4IYRA 2ORWA 3RBAA 5B1YA 5JLJA 4LOHA 3JD3A 5KNBA 1PDVA 2ZIAA 3I45A 4MGZR 5A1JA 3F97A 1JFFB 1U0FA 1ZRSA 1AKVA 1EWKA 1H2AS 1JSLA 2M9MA 3NDIA 4HLQB 4HGNA 4KNWA 4MWTA 4WEQA 3RD5A 2XXAB 1ZG3A 3O6VA 1Z5OA 4RANA 1XZGA 4TQAA 3GIWA 5FL7D 4J6EA 3QSGA 2MSWA 4OJKA 3PUHA 3ODGA 1T15A 1U5BA 4JU9A 2FMFA 3BGDA 2UUPA 5LDDC 2A9OA 1PR4A 2Z2XA 3RT1A 4CGYA 1N4AA 1OCEA 3IQGX 2CT8A 4DMKA 3HPQA 4XGRA 2FOXA 2FYTA 4Q1DA 3ICWA 1ZIPA 2GEBA 3D6FA 4XVHA 2BMAA 1WPQA 2EF1A 3NNDA 4GQBA 2X0IA 4UOEA 2Q8QA 1EXWA 3OTIA 5AI0A 5EIHA 2PUDA 2QUBA 2LIVA 5LLDA 1B8NA 2ZJ6A 3TCKA 1I5EA 2W37A 4QO7A 4B5LA 5M34A 2W4QA 3NRJA 4CR7A 1NXPA 2PG3A 4OLBA 2XCUA 4RCVA 1ISPA 3UAOA 4NCNA 3VKUA 2O8CB 4IIXA 3GFSA 3HZOA 3AXSA 5ALRA 1V8FA 3SC3A 3TJMA 3UQYS 1POWA 1K0FA 1DX9A 1UH5A 3BZUA 1W1UA 4UU1A 4OQEA 5HCUA 3U4AA 4IIYA 3WJ7A 2JLRA 3JASA 5IMBA 4BGIA 3PGJA 5JBQA 4E6EA 2PKCA 4QEDA 2RJNA 1TU3A 2NV2B 1SBZA 1Y5IA 3NM6B 4FFLA 4URHA 1IBRA 4KXNA 1P1RA 3SC2B 2XRYA 3P71T 4GMXA 3KT6A 1OJ7A 2VHXA 4D9FA 3IVXA 1VA5A 4LBYA 3KOYA 1U1IA 3EWAA 4M0CA 1RBZA 2J32A 5G4KA 2I67A 4AY6A 1NOJA 1HBJA 3UYLA 5K0FA 1IPEA 5G0WA 2NOAA 1N6OA 4XFDA 1F6WA 4CQMA 2AFIE 2XMDA 2D1QA 1JFLA 4HCJA 1GUFA 2FN4A 4TKVA 5DWQA 2PJUA 3O8BA 4EX6A 1E66A 2HPVA 4EMSA 4ZYUA 5BUZA 1NN1A 3IA7A 3AB3A 4JMPA 5C53B 4IIJA 3Q12A 1QHFA 1IBCA 3LX4A 5HDBB 5A62A 4BKPA 1TC1A 1YUNA 3OUUA 4LYGA 4C7XA 2MSCB 1R10A 1AUPA 3EXHB 4Z54A 2X6QA 5HQ3A 2VDUE 1YB6A 3ZHUA 1IM5A 3GZ4A 5DP1A 1ZGCA 4U7PB 4E5VA 2JBWA 2P2DA 3N07A 1CQJA 1G0OA 2Q9CA 1SC4A 2BY4A 3KQVA 5ERGB 4N49A 4BYMA 1M34B 1GPLA 3H1FA 1KFJB 3F7MA 1KK3A 4K46A 4BFSA 4ZJYA 5J2UF 2FLVA 3TRJA 3TMKA 5BT9A 4J2TA 3TJRA 1WDTA 4BB6A 1Z2DA 2X0EA 4DMLA 2R00A 3PVCA 4LSWA 4DOMA 4EW2A 3KWFA 1AHPA 1TUEA 3IAFA 5REQB 2C5EA 1T2FA 2CF6A 1JU4A 3GELA 1XTPA 2R96A 3OOYA 3UJ6A 2QQ5A 2QRVB 1T3SA 4BBZA 2ON6A 3U3MA 4PSDA 4F9GA 5ITZA 4F3KA 5GZ1A 3UB3A 5AVSA 2EKDA 8MHTA 2BFMA 3TLZA 3ISTA 4CV0A 4HMQA 2QM8A 4JEMA 3R5KA 2WSMA 4BNNA 2VJLA 5F5LA 2YWXA 2G1KA 1SBTA 3ABQB 1F2TA 3H7IA 4BLWA 1PV4A 2QLBA 3JARB 2HSZA 4FFOA 4DRXA 2XBMA 3KU4A 3ZV5A 3D3JA 2JDIA 1KYQA 1FRFS 1K5PA 1N5IA 1NF2A 1YHZA 1RRVA 3E8SA 3MGKA 3NUGA 4MR8B 4XZ3A 5HG0A 3V6MA 5IULC 1XZ8A 5GZ6A 4IJUA 3EQ8A 4KDCA 4ZT2A 2OAQ1 5KVCA 5CB6A 3PC4A 2R4UA 5CXSA 1VYHA 2OQRA 2ZRQA 3NOOA 2ZUFA 2F1HA 4CMBA 4P31A 2H6EA 2QTAA 2V8OA 4RVGA 1TJ5A 3EUEA 2C84A 2DKFA 4JMLA 4YLEA 1MT3A 2XVAA 4W9NC 5IAEA 4KYTA 3SKYA 3AKZA 5DEIA 5E4JA 2E4XA 1GRRA 3NPAA 4HY3A 2VSOA 4KRYA 1RYMA 2ZBPA 3VPSA 1PG2A 1ZNZA 1JDUA 2OFXA 4B4UA 3MMNA 3AL0C 2JIZD 1I0LA 3GJRA 3HM2A 2HX1A 4N3AA 4YUAA 4IRMA 1I4LD 1B0ZA 3HC7A 4R6XA 1MKYA 1EP9A 1Z6YA 5A1TA 1IBKB 3TGWA 2NPIA 4EI9A 2FPOA 1V7PC 4LXYA 1NQ5A 3S2EA 1A95A 1L8AA 3Q3HA 3K0BA 1QKKA 1NRXA 3T34A 5EJEA 2FJ0A 3HACA 1XZMA 1Z0DA 3HKBB 2HBZA 4PLWA 1Y7PA 4I0WB 4ML3A 4MVJE 4F92B 7GPBA 1DFIA 4BX2A 2BR3A 1TTPB 2RHGB 1WUJS 3AF1A 5EERA 4C4OA 5EHXA 1N6PA 4IUBS 5JFOA 5ITSA 1KI1A 1LXCA 2BSXA 3Q0IA 3BGIA 3H2JA 4DTCA 4MQBA 1LF5A 4ARZA 5DMHA 4MKGA 1NF3A 3UAXA 4KL8S 2D7DA 2E4AA 2ZRLA 4AJ2A 1RWBA 2EFJA 2FSGA 1FSSA 1R88A 2WV9A 3GB9A 4GLLA 4XX0A 4B6GA 4EF6A 1KMHB 2BELA 1NLUA 1MHTA 2GKOA 3B70A 1BIFA 1UFKA 2V97A 4MUHA 5F98A 1OKKA 1V1MA 1DINA 4KVAA 5TVGA 1YZFA 4B6SA 5CG2A 1TYCA 2DFDA 4MIKA 4MKXA 1KJIA 4WZBA 4F4CA 4UNIA 3BL8A 5J23A 2CZQA 3MMPA 1QB8A 1JT2A 1G42A 2VQ6A 3ZCPA 3H16A 2CLHB 3F9RA 1KI2A 1IUPA 4L15A 4JOCA 2D7JA 4FHDA 4TT8A 3ZBQA 5C7LO 4TV8A 4UCWA 3VFDA 4AUKA 3MVEA 3NEPX 4KPGA 4IDOA 4DSUA 4O2BB 4AZ3B 1PYOA 1V8OA 2CXXA 3PJFA 3ZS8A 1TZBA 1K8RA 3ZI4A 4AS3A 3PUVA 2GEFA 3PL1A 4H6VA 2COEA 1THMA 1U0TA 2YV1A 4P6VF 1I4DD 3AUAA 1HLDA 3WMXA 4TXHA 3ZDXB 3SHTA 2NNWB 1N2BA 4NC9A 5G2OA 4UULA 5IJ9A 621PA 3M6AA 3NV9A 4BMSA 4LC0A 4BWGA 3ITEA 1K8ZB 1QHHB 2EEZA 2CLSA 3IP1A 2ONCA 4J9VA 1H4QA 2O8VA 1LDNA 5I8WA 2V7WA 2QX4A 2ZK7A 1XK6A 4B3CA 2HD4A 1P8JA 5K3SA 4BO5A 3PLAE 1LF0A 3G8CA 1QBKC 4H7PA 1RAAA 3B2NA 4L9SA 4RVHA 3OD1A 3BXHA 4CI0B 3AUXA 2PNJA 4M0UA 4CTJA 2ZIUB 4OGLA 1JSRA 4XIIA 4XQ9A 1O6ZA 2REOA 1R5OA 2G71A 2BBSA 3CTPA 1AY0A 4N7MA 2LCQA 2IOQA 3C3WA 1U7DA 2JKYA 3GEPA 3KT0A 4PLHA 3O5AA 3HWX1 4PCLA 3FPFA 3BRQA 4L9WA 1YR6A 2TMKA 3PNLA 4QEZA 5F51A 5KYGA 1B6GA 2YZMA 1LNZA 4PRYA 2JAHA 4ESOA 3W5AA 1IHOA 2FPLA 4R8MA 3VX3A 4EO7A 3REFA 3COZA 1MGPA 3RBZA 1OFIA 3JAKA 3UMMA 3U56A 4J9UE 4TVOA 3X2FA 4GYYA 1X77A 3HLYA 4IICA 4P36A 4RESA 6CHYA 3GO4A 2CJYA 3IEXA 4XYMA 4MWSA 1RR6A 1PUIA 5B58T 3BK2A 3BXEA 3ONDA 2OZLA 5CYPA 2HA3A 4DXHA 1HFWA 2AI3A 4GMDA 3M9WA 2CEKA 2COKA 3V7NA 1ZM4A 3MW8A 2PMDA 1WD5A 3UJ3X 2F3QA 4GLJA 5IC4A 4GKJB 1DKRA 4GX1A 3ZDEA 2WM9B 1E5XA 4CR8A 3CNQS 1C3XA 1OJLA 1N32B 2P69A 1ONPA 2R86A 4YCCA 3W78A 1HL7A 1YRQA 1EKXA 2P9EA 3AETA 1U2EA 3DPIA 3G8BA 3RJMA 4MKFA 1HG0A 4K2HA 5IX8A 3LX8A 2JIRA 2R7KA 2E5WA 2IYUA 4OH1A 3JPWA 4DIOA 1XIVA 1Q7EA 1KO8A 4MQFA 4TXJA 2QVYX 3DVQX 3LTEA 3G13A 1TTTA 3RAFC 3IA2A 1LJUA 5CYOA 3VR6H 3NWEA 4FC7A 1C80A 3R3HA 4LF4B 2XUKA 3WIOA 1MW8X 3CSUA 1R0XA 4ISCA 4TSFA 1OX5A 4L16A 1T2NA 5ECDA 1WB9A 1N34B 4BMOB 1YCGA 4W1QA 2IBTA 4CKYA 2BYTA 2IYZA 3PR1A 3KXPA 1H8HA 4UEWA 1T3HA 3UOWA 3ZLJA 1HF3A 1I3OA 5SZJA 3RSCA 1H6AA 2HV9A 3JQAA 4TRJA 3VZDA 1CRPA 3N8HA 4GGPA 1H42A 1P2TA 4K1LA 1XCOA 3UEOA 1AGRA 2JF0A 3VXKA 1TRHA 3GLFB 5G0SA 1SK8A 2Q0SA 4ERNA 4Q00A 2C2WA 3NBFA 2PE5A 4U2EA 5GQSA 4K9PA 1T5LA 1TPZA 2FRDA 4BP3A 3AV0B 1Q7RA 2FR1A 4ZO6A 4J4TA 1ODIA 3W2EA 2VJBA 5JCZA 1QTQA 1YHNA 5AKXA 1T26A 2PRJA 3IE0A 2RHBA 2G70A 1QNFA 2VZ8A 3TZLA 2X6RA 1JJFA 4U8GA 5C8YB 3QKSA 2Q4RA 2VTEA 2CJWA 2X1MA 2ZSHA 4X1IA 1USGA 4URVR 1O4VA 2G4CA 3ASZA 3KZKA 1X0XA 2R79A 4IQGA 2QRKA 3TOZA 4F2WA 1N2CA 3HDVA 1NJ1A 3HXLA 1X70A 1FDVA 2WB2A 2H63A 4U0JA 4ZCSA 4AAYA 1ORWA 3C6XA 1KAMA 1ZL0A 2CVZA 4YAUA 2HRBA 2GRJA 3B85A 1T9GR 1FS5A 2Q9BA 5AK0A 1O54A 3PTAA 4CEHB 1RRPA 3OZFA 5U4XA 4WVLA 5ALFA 3TTVA 3T54A 2XOKA 3SY8A 5HFAA 4KR6A 4INAA 4YJKA 2VPPA 3GFPA 1A76A 4ILEA 5IJWA 5JBNA 3CZ9A 1JR3E 3ZKWA 3LHFA 1G4AE 5HX7A 3PV0A 1UJ2A 2EFEB 4JGIA 1HQYE 2UVPB 2RHLA 3MTAA 4YUYA 5J1SB 4X71A 1U6KA 1N2SA 2X2PA 1X1DA 3JAWA 1Y7TA 2N3ZA 3DXYA 3OFNA 1J2UA 3GNTA 4IY1A 2QIPA 1J90A 3V8PA 2O0LA 4TS3A 4AQDA 3LUGA 3ZW9A 2VQSA 1MB4A 1OTYA 3RFXA 4ER7A 5EVJA 1Q6ZA 3UMCA 1P5RA 1BW9B 1VJGA 3KS9A 5JCJD 1FTSA 2G83A 3TZQA 2R8EA 5K0TA 5JAPA 1WCIB 2LDXA 3QU2A 4BVKA 3GY0A 2O2YA 5HTOA 3WJAA 5AM4A 3E8XA 1FZTA 2ZXEA 4EK9A 5AKEA 5DTQA 2OXFA 3L6UA 4AZ0B 3CLRD 2JFZA 4RKYA 4F85A 1E7RA 4PSAA 2R1VA 4Q7JB 3UTDA 4NV3A 3H18A 4ZVLA 3GZNA 4D43A 4B2LA 2FJUA 1QF6A 2X0JA 3PA8A 2ZJ0A 4A9AA 2B1RA 2ZTHA 5E3JA 2FUCA 3TEFA 3E3LA 4WKBA 3ETLA 5K1ZA 3MGAA 3BPSA 4OM8A 1DWUA 2R2AA 2AZTA 3PR2B 3CMCO 3N8NA 5JXIA 4EB6B 2CV1A 2GB4A 1JIUA 1SUDA 3M49A 3H11B 2YWDA 3DBIA 1II9A 1Z25A 2A9RA 2BC9A 3MEQA 2BJVA 5AXCA 3TCNA 4B3BA 2ID9A 1BVRA 4L0DA 4QUIA 5TEWA 2WW8A 3AG5A 5KDLA 2XB2A 1GTSA 2R8RA 3FR7A 3BXFA 3MYRA 2YXLA 4AJKA 4CCYA 5JALA 1S9DA 1U7XA 3EHEA 3HCAA 5BW6B 4X84A 4F8JA 1Y8RB 2R11A 4AFNA 1RPJA 1HSZA 4WFKA 4NBVA 4Q1EA 1I80A 5C51B 1IXYA 4Y9RA 4D0SA 1R18A 2I9PA 4O4LB 1YDHA 3TLGA 3TXAA 3W7AA 3RWMB 5JY6A 5EWJA 1O57A 1A4XA 3FMFA 2WZDA 1SZCA 4K87A 4L8GA 2WD9A 4UNQA 4C04A 2VHCA 3FZGA 4MV9A 4FZRA 4MVJF 4LMAA 3ISVA 1JB1A 1Z88A 4YO7A 3AFHA 4LQLA 3ZY3A 1DZIA 4I08A 5HOEA 4L6AA 4EZBA 2HK6A 1E8NA 3FGPA 3THSA 4MWEA 2FF7A 2X40A 4KBYA 1IXSB 2ZUSA 2R62A 1F51E 2QTGA 4G0NA 1QC5B 1CP2A 2DPYA 4HGYA 4KB5A 5CGZA 3ZLTA 3H17A 4UFNA 2HSJA 3BULA 3W04A 1NULA 5KNCH 1ZWKA 2L2QA 3QF7A 2ALJA 3T94A 121PA 4D57A 2P9BA 1RKUA 4GSLA 4ZI5A 3ZGLA 2GEDA 3R9WA 3F7TA 4A92A 2QMYA 3HO8A 4MKRA 4KACA 2PEZA 2IIBA 4JSYA 3VDXA 2C0QA 2GFIA 3DONA 2OORC 5NLLA 3LQ4A 1ZUWA 5HIIA 4RA9B 4KBFA 5FPYA 3UTCA 4RHEA 5KTPA 3OJFA 1A8IA 1GA4A 4HNQA 3AY3A 3UXEA 3VPDA 2AI2A 2TS1A 4MIYA 3RC3A 5LZ7A 3TLJA 1N7IA 2ZI7A 3ZGYA 4B1FA 1K1EA 1N8KA 3AH8A 2FQXA 4NPCA 4OQFA 5HJ5A 4DQ0A 2FWJA 4P8RA 3LHIA 1SUIA 4XYLA 2V96A 4B75A 5B7PA 3FWNA 3ZOKA 5LWQA 4FGSA 3GLVA 2OOKA 1E60A 1H2BA 1ORRA 3N2GA 5JPIA 2R0QC 1V9SA 3I4CA 2DLNA 4W5NA 5HIAA 2Q9AA 3IUMA 3LVBA 5IDWA 4CEJB 4BZQA 1GQQA 1NI3A 1U0HC 1E7MA 1E6WA 1QCZA 2V7QD 3L49A 1RPNA 3HKDA 2BCEA 1J0XO 3Q2IA 2DF8A 4M9SA 1TCVA 3A1FA 4WJZA 5BN3B 4LDQA 2JD1A 3TW6A 4GXQA 4Q18A 4CNBA 4Z4CA 2HQOA 2EIHA 5K6RA 4UOZA 3WYEA 2VEOA 1HE5A 3EY4A 4XM0A 2F43B 3AZQA 1LJ8A 3IT2A 1DBRA 3SHFA 1PS0A 2EX1A 4DLBA 4LF5B 5CDTA 4C3OB 1QYVA 2I8CA 5KKAA 4A2QA 2G1JA 2X41A 3MTDA 5FBKA 4WKOA 3SSNA 4K86A 4BNVA 4XQEA 2H5IA 4CMJA 3JSXA 3ZPXA 4MB0A 2XMQA 3BZWA 5G3ZA 3SHWA 3F4BA 2H9YA 1KDTA 3ASVA 3I04A 1OBFO 3OQVA 4MQMA 1XDBA 4RJIA 3V4ZA 4R1PA 4YUZA 5C5CA 4ALMA 1ZBDA 3GWGA 1XF1A 1Z9BA 2I3ZA 1LU9A 4AVYA 4F38A 4JITA 4KQFA 5CLGA 1KMQA 3NKVA 4H7EA 3U61B 2XGGA 2AN1A 4KKXB 1VFNA 1M6WA 5E6SB 5IH3A 4JJGA 2R84A 4P4LA 5ALJA 1EH5A 2Q6TA 2YYZA 4LYYA 2UDPA 4EPVA 2G1PA 4B34A 3ZZMA 4PLFA 1QBGA 3PE3A 2OP0A 5U9CA 4E5PA 4YHBA 5JZBA 2Y27A 2Q7OE 3UPTA 1Q1EA 3ED5A 5T8KA 1QH0A 4UBIA 1SXQA 3LUKA 2AOTB 1KIAA 2YVUA 3KJGA 3WYFA 4E31A 2Q1UA 4Z4HA 3AR3A 4CM3A 3Q2KA 2QU8A 1QDUA 3B2QA 3I1JA 1TMGE 2XSZA 2ZBVA 5MFPA 4EVSA 1O8CA 4QZVA 1FQKA 4LJAA 4D46A 2FWNA 2OENG 2VKQA 1J8MF 3NHMA 3WP1B 4LQ4A 5FAKA 1D8AA 1JFFA 1FFBA 3DEJA 1UBSB 2XXAA 4PPQA 4MA4A 1I2BA 2IBMA 1BXRB 2KBFA 1T5DX 3CPJB 1XL0A 2VSQA 5LQCA 3ER9A 2OBLA 4OYRA 2IEYA 1NOKA 3ZXIA 2C54A 4LJ6A 1PT8A 4PTLA 4MVJH 4WBNB 2WRZA 3HJCA 3E9YA 1Y42X 3MWDA 3PWZA 4EA7A 1I13A 2WHQA 1NNUA 5GV8A 5KYYB 5L7TA 3MLBA 5JNUA 4YR9A 4HZUB 3LLCA 5D3QA 5G1OA 5DNUA 3C45A 3CR3C 3BBLA 1E3EA 1BX0A 3F49S 4BAGA 1JHOA 4C5BA 2Q5HA 3SXJA 1PD1A 4A0FA 1NP6A 4J8PA 3U0VA 3KC2A 4DQUA 1ZMBA 1P8AA 3UPDA 3K30A 1XTJA 4FCCA 5MN4A 3DAFA 2IU3A 4QXPA 3MM4A 3IKJA 5ALQA 1TLTA 5EZSA 2YR0A 1NJ6A 4C9BA 4IDEA 2PZJA 5I4KA 1FTYA 1FSFA 1MT0A 2IODA 3B82A 1E1MA 1CNMA 1OZGA 4BLVA 1WXDA 3G0HA 4JLAA 3EXIB 1N2HA 4CT5A 3ENZA 1FUIA 4XCXA 2BKEA 2YY7A 3KR2A 4D3YA 2FPUA 4Z6KA 3D3NA 4IKEA 1U0OC 1CPYA 3SC2A 3DDSA 5JCOA 3VTAA 4BX3A 1WW2A 2ZSFA 3CC8A 2JGRA 4RD1A 2XWSA 3KOMA 3CH4B 3LXUX 1NXWA 4FHCA 4N7JA 1U80A 4QOEA 3DA8A 4C14A 5B4TA 2XMRA 3F98A 2ZSEA 5ALOA 1PNRA 2UYCA 5B57C 3ZU6A 2I0FA 2EZ9A 4QVKA 2VDKB 4CFYA 5DGTA 4JU8A 5DO9A 2J67A 4C0BA 2GK7A 2FKAA 1MP0A 2IU4A 3LOPA 5CT6A 1II8B 1D7OA 3NJ8A 1T4CB 2ANCA 2V7PA 3H6KA 1JIIA 2C5FA 4DNPA 2VRWA 2G8NA 5ALKA 4WLFA 1HC7A 1XDSA 2WF5A 5HIKA 5HZMA 5DW3A 2C9CA 3C3CA 1U9IC 2QPAA 2VF7A 4QWWA 4WWHA 3RROA 2WUWE 2VCYA 1A97A 1BOOA 3OD5A 2QLMA 4FMBB 2P1DA 4YBZA 4J4BA 5GOTA 2Y9PB 5I4CA 1I01A 3HUEA 4H7FA 5CCEA 2D4AA 2B4QA 5LQDA 3DL7A 1X1CA 1HZZC 2MYNA 3S2UA 1M34A 4CN8A 5FL7A 4HDNA 3MWKA 3QBJA 4PANA 2Z98A 1A96A 1E64A 1CG6A 3DKIA 4TTSA 5HCIA 4EG3A 2FI1A 5GY7A 1P4RA 1N4DA 3TTWA 4MWBA 1U65A 1Q3HA 1E1LA 3GLGA 1PW7A 2BTQB 2F1IA 3H86A 3PU6A 4QGSA 3FFTA 3NAGA 1I2AA 2WWFA 3UWSA 4JNCA 2QRVA 1NSTA 3E18A 1LB1B 4RIEA 1KMIY 1TYBE 2BGNA 3KZNA 2HA5A 4ZOAA 3S55A 3AKEA 5H16A 3P9XA 5BQ5A 3QFHA 3JQ6A 1FSGA 1FC0A 4DC1A 3WGIA 4IDNA 4QU0A 4Q39A 5DX1A 4DG9A 4I4TB 4AU1A 3DG9A 3H1GA 5FD8A 2PKWA 5KQMA 1R6AA 2JLZA 3HJGA 5BQ3A 4FNAA 2PMEA 1Q50A 3ZC3A 5ENZA 3OX4A 1IWPB 4OO3A 1ZHHA 4IZIA 3Q88A 5TEVA 1WR8A 1XCGB 5EPOA 1KZ7B 1NVMB 1S96A 4I9HA 1ECBA 3L06A 1EE9A 4RZSA 1XELA 2ZYHA 1UFOA 3WBFA 3OE7D 3WA6A 3ZNNA 4WW0A 3DL0A 4JUFA 3UJHA 4G0OA 4P92A 4XTRA 4D4MA 5K01A 3C8DA 1J24A 1HDEA 2VYQA 3O1HB 3QE2A 4WXRA 1ZI8A 2C29D 4X3PA 1X7XA 5IMSA 2D1TA 4YRAA 4EECA 4FB4A 4O3FA 3WL6A 2OLJA 1M1NB 4W9NA 4PAMA 3ZJVA 4CBVA 4NYIR 1SUPA 3AFIA 3BFKA 1U99A 4M0DA 4KW7A 1UBOS 4UASA 1IMJA 3OOSA 3DZIA 3LLVA 4GL4A 1FFGA 3V2IA 4UHCA 1DO2A 3G2IA 3V4SA 3S1SA 3A1EA 1QH1B 1BDBA 1JHYA 3B2EA 5ITWA 1DWQA 2NZ2A 1QONA 2BDEA 2QNRA 3MT8A 5BN4B 3EW9A 3QBVA 3NVKI 1UOOA 1QB7A 4HDAA 3BTUA 1Z16A 1MVOA 2X9QA 1UPFA 3CX3A 1KIMA 2IOYA 5DU2A 5BV1A 4XB1A 1GRQA 4PHFA 4B43A 1TADA 2V9ZA 1NVVR 4BATA 3DD5A 5B30A 1YMVA 2QRGA 3H4MA 4D44A 1ODFA 3T99A 5FO1A 1ICEA 2AHRA 2O2SA 3OT5A 3STYA 4NYIQ 4PAQA 4A0RA 4AKEA 2VTBA 3HNRA 5FUXA 2IA5A 2JASA 4E5MA 2ZUWA 4QASA 2IUFA 2YMMA 4C07A 3VPAA 3D3WA 1G2IA 4ND7A 1AUXA 1JI0A 4ZARA 3KJXA 4F21A 5BVGB 4V3CA 2JA1A 3NHAA 5EMLA 4D3DA 4JLUA 1DEKA 2IGTA 3VC2A 1R6VA 4OKIA 4YMIA 2PLRA 1PT7A 2XAAA 4MYSA 4QSMA 4WA7A 4AJEA 3PDWA 4TWZA 3NBMA 5EUBA 2PT7A 3OI7A 3OWHA 2D8MA 2DCUA 4BZXA 1NVVQ 5HQTA 3HSSA 1OH7A 1KJJA 2J9XB 4I7EA 3R4CA 1RLJA 4QGAA 1ITZA 2JCYA 1C1DB 3HZZA 4TKUB 1MIOB 2PR7A 3NM4A 2C2XA 1PN3A 2DHEA 2WSBA 1IHYA 2AT1A 2J59A 3HCWA 3S7TA 5CR9A 1EGVB 1GTVA 5FAXA 1MOQA 1V16B 2OHHA 4AZ3A 1VFPA 1W4LA 1SOUA 3GEGA 4RK0A 4URUR 4J16C 3ZCQA 1P75A 2RFLA 3RUCA 3T9FA 3DBHA 4UMVA 1U8XX 3Q3CA 4OLJA 3LP5A 4ZJPA 3L7JA 3Q6IA 2D6FA 1WXGA 3CSDA 2YY5A 3CM0A 2XMBA 4M1WA 5KHLB 1JF8A 3QPAA 3ANYB 4CL2A 2R6DA 4IFEA 4FDTA 1JI3A 1QHSA 2WMNB 2FGKA 2Z9BA 3PNOA 4PBSA 5G53C 1N9ZA 3FTCA 2WF6A 3RE1A 2JIZA 5ARCA 2D06A 2EJVA 3DEAA 1P81A 1QHHA 4UBOA 4QHSA 4QQNA 3NT2A 2Z1NA 4TUYF 2QD5A 3KHKA 5CBPB 3KU1A 2V55B 2MSNA 3LD9A 4JBXA 4D9NA 2C2HA 3OE5A 5JZVA 5DSXA 1IYZA 3MB8A 5AJXA 2PEYA 2D4HA 3VVCA 1ZIXA 3AR8A 3R3YA 2ZRNA 2UVDA 2OWDA 1ZD2P 4I9GA 3LS2A 4RZ2A 1HNXB 2IPLA 3VC1A 3INGA 2MU1A 3VO1A 5D1NA 4C6RA 3ENNA 1G8FA 5LLSA 1V9LA 2YXEA 4NU6A 4LV5B 1S4MA 4EJSC 1ZP6A 1CEXA 2MSEB 2CXRA 3TIFA 4MIEA 1VIDA 2XY4A 1AURA 5FO0A 4YT5A 5FWAA 1XRLA 4PU0A 4W5JA 5JMOA 3CNEA 5F78A 4G4JA 3KR9A 1WZNA 4HQ6A 4IGAA 2GARA 4TV9F 3TNDA 2F8MA 5HRCA 3JYQA 2WTNA 5EE3A 4D4HA 4Y2YA 3ZNPA 4WLEA 4MVWA 4YAOA 4INZA 3H5TA 2WUFA 1SQ5A 4OP1A 2ERYA 2NO6A 1KQOA 3PPXA 3CVUA 4W1SA 3RT7A 3UMBA 2AQ8A 3RU2A 2HXYA 5IYZB 5ALYA 4NHEA 4V0SA 1YJXA 3EG9B 3MTBA 4MMZB 3MAGA 2XB9A 3CUUA 3QV1A 4BVAA 5JJIA 2E82A 4GL2A 1CDEA 4UHHA 1RCFA 2C00A 4CLXA 5AK4A 1G8PA 4J3FA 3P0EA 3HMKA 3ZWVA 1KZ4A 2A14A 2B4RO 2BKLA 2QTBA 3U7JA 5IVPA 1MBZA 1UWKA 4ZAGA 4QJ3A 1E4EB 1HFJA 2WFZA 4Z53A 4NU0A 2KYRA 2AHOA 1V7CA 4R8KA 3VU0A 1DQPA 2P2YA 1CR0A 2VP6A 2YCLA 4MRMB 4M8IA 3B3QA 3FUUA 4UUBA 1LBQA 4P0QB 1V71A 1CZHA 4DCMA 5AXBA 1YCFA 4KP7A 1EFPB 4ZKDA 2XVZA 3B6IA 2I5PO 4Q9AA 4BWVA 2EJWA 3QU4A 4GWLA 1SCBA 4L50A 1VSBA 4RGYA 1N1MA 1OF1A 4W7IA 4QJ5A 5DMXA 4FEAA 2O52A 2CY0A 5AKIA 2ZAMA 3CVOA 3OTWA 1E1QD 1YFKA 2BM8A 1QAMA 2WWGA 5KBYA 1EU1A 2Z5VA 3T3IA 1TPYA 3B1KA 4XD7D 3NLLA 2QYSA 3G79A 4KXYA 1SOMA 4WECA 2O7QA 4BP1A 2ZBEA 3GLFA 2EFGA 3WYBA 1ZI6A 2C7RA 4MW0A 5E3HA 1M73E 5A71A 2O4CA 4U6SA 4CYMA 1WPGA 5CJPA 1DOHA 2IZ0A 3URMA 5BRAA 5BSVA 3NATA 1LVUA 5I3CA 3O8NA 3JQ9A 2HF2A 5C8DA 3KWMA 3Q3IA 2GDZA 3ROPA 3W5UA 5KNCD 1ZNYA 4PO3X 1T1RA 2P6NA 3FMGA 1W5EA 3IVCA 5FH9A 3ANLA 3L7DA 3BFXA 4D42A 1AS3A 4ND1A 4X1KB 4PFSA 5C8YA 1L8XA 3DAPA 3OE1A 2B1QA 2IPNA 1J49A 3U81A 5B3JC 3EA0A 2BMEA 2ATXA 2R5NA 4LI3X 1T0PA 2RAPA 4ZQEA 4BFWA 2OTCA 1UEXC 2R8OA 3AUTA 3EHDA 3MS2A 3MQ4A 3VO2A 2ROQA 3A1VA 1XZHA 3DOOA 1TM2A 2P5SA 4K6KA 1IJBA 1ZSVA 2Q3MA 2QJWA 3NC0C 1NV9A 4OKSA 1BAPA 4UBNA 5EP4A 5CAEB 3SIXA 4EF5A 2UXDB 1GTG1 1L9XA 2I6XA 4MVJG 4DKJA 3ZHXA 3G2KA 4E4YA 1PHRA 4QU5A 3TSCA 3F1LA 3L43A 3O38A 3R7NA 2WNHA 3VJRA 4PG6A 2C4TA 4M60A 4XDGA 2NMVA 4AUNA 3Q7EA 1ACLA 4TMXA 5LBIA 4P1ZA 1S9HA 3R5TA 4BC0A 1VECA 2WU8A 4J3NA 5E4YA 5E0KB 4DG8A 3L02A 2LXNA 2GHRA 5E38A 2H8KA 2QMZA 1T8PA 3IIMA 3WK8A 5KC9A 4YUWA 2H7XA 1Q17A 2MYUA 2UVPA 4PLPA 4ZMSA 1AO0A 4LPKA 2ANBA 2WQZA 4G41A 4EQZA 3QX8A 1MB9A 3E9NA 4Q66C 3B1XA 1GIAA 3M82A 5AP9A 2A33A 2DFLA 1HORA 1MR3F 3OZRA 1BU5A 2C98A 3L0SA 3I5YA 4V0OA 3VUEA 4CM5A 2AXEA 1W36B 4F3NA 1GPMA 4IDPA 1U2DC 2AEMA 2VNSA 5B1IA 3JQQA 3JALA 5EXDA 1JEYA 2ZRFA 2AG5A 4NBRA 1WCIA 1A04A 2J07A 2W93A 1VE6A 3EUFA 4CUZA 1IY1A 1O95D 1EX6A 1ENYA 3HXTA 6Q21A 1ISRA 3C48A 3SSOA 2WHXA 3I3OA 4AZ0A 2IP2A 1XN4A 1UZNA 2JFOA 2VDVE 4LJSA 1DQZA 4LZLA 5A5VA 1P0FA 1NLZA 3MQ2A 3O7WA 3DMTC 3I2GA 1WHSA 1CJCA 3DUFB 5B3KA 3ZGOA 2VDJA 3LDFA 3NHJA 1JZQA 5BSHA 4F56A 1P62B 3TTXA 3NT5A 1YMQA 4NR0A 2WFLB 3CV3A 3KXDA 2IYAA 2KMLA 1YR2A 1SXJE 1EXMA 2Q6OA 3D64A 1E7SA 3DEFA 3PDCA 1TFUA 4COKA 5LKAA 1X1SA 1U8UA 4KWHA 1JALA 4RHUA 4W82A 3ZV6A 1BWSA 2PWZA 1CUSA 1N7JA 3DHWC 3WLLA 1Z29A 3W2HA 1UBEA 4BOYA 4TZ6A 3NOXA 3V2HA 2VAMA 5LYJB 4QGHA 2WICA 1ZY2A 2FMXA 2XA2A 5CVVA 1H6BA 3IP7A 5FPSA 2G5CA 4V02A 1TJ3A 4NFHA 1OLXB 4LWZA 4DKXA 5HQJA 3FYTA 1XZDA 2PO5A 4HMPA 2FKNA 4O4LA 1C1HA 1I2CA 1OGYA 3KUDA 3V33A 3ZQ6A 2LCIA 3SX4A 5A4DA 1KRXA 4M83A 4CKWA 4TVSA 4OJYA 3W3AH 1UAYA 2YUIA 3B1JA 5LSAA 1XEWY 3K1JA 4XLZA 4EG4A 3C8MA 3OM0A 4MVJD 3C1TA 2HHLA 3E1GA 4P32A 3MJRA 5KB3A 4KE8A 2XADA 3L7KA 4IGIA 5DTMA 3COPA 4GPBA 1XO1A 4W8HA 2D7CA 3UWPA 1KOJA 4V1CB 2K7FA 2F8SA 3JWHA 1J6UA 1S2OA 1VLZA 2AGVA 4TTAA 1QCCA 1OIVA 3BDAA 1YUMA 4MUMA 1RXYA 4F72A 2QMQA 3KT8A 2QMOA 4EL5A 5I7SA 1UKEA 2EGHA 3QHPA 4FCVA 2C1ZA 3SHQA 1BE0A 2CB0A 5E7JA 1H0SA 1O95C 1AZTA 4Y1RB 4ZC1A 5LDHA 3WZMA 2HBRA 5CX4A 1FU4A 4IV8A 5JCJA 1YH3A 4YYEA 3U49A 1T6XA 2H2IA 2IU6A 2R3SA 3NH6A 2ODAA 3C8HA 4P5PA 5CU7A 3I6YA 4ZZ3A 3H2KA 1SWVA 3EGEA 3LLSA 4Y2VA 2Y1FA 1M8JA 1HMYA 4A27A 4AKTA 1U4OA 1U11A 1TX4B 5H82A 4EUSA 3TG8A 1L5OA 5E7QA 4GS5A 4CEJA 5D3KA 3LPMA 1P0IA 3QLEA 4K26A 4ZU3A 3MNFA 3DHYA 4L0QA 3U5TA 2P3OA 3G7UA 3IP9A 2WWIA 3TQSA 3DHNA 1K3UB 3LHDA 3DBLA 2OHFA 2H1SA 4LE0A 4P83A 4FP9A 1L5SA 1KC3A 1TAGA 2GBGA 3KSUA 3UW1A 2GHQA 1ODSA 1KKMA 1W9HA 1ZRMA 2Q0HA 3UMGA 5IZCC 4BXOA 4DARA 3KV3O 4AG6A 1UBGA 2JH9A 2XMCA 4Q0MA 3ZWDA 1YKFA 3F5MA 3ITDA 5AHWA 3DZJA 1GPDG 1GPWB 3ICEA 5A7HA 1W0JD 3JTEA 1O97D 4DSZA 4M98A 2HCBA 4KWTA 1UJNA 5GJCA 3QLUA 5DTIA 5A5DA 3OE4A 4W8GA 4LHVA 4OHYA 2OAP1 1ISMA 4BV8A 4FQ8A 5F23A 5E6SA 3JQGB 3X1MA 2EBHX 1G20B 1T25A 4TLEA 4DLNA 2HJWA 3R4VA 3AVVA 3PR3A 2BMFA 1CDDA 3UKDA 1F3LA 1U3VA 2A5DA 3QNWA 3R2JA 4UUNA 3DEZA 1UJBA 4CQJA 2Y93A 4HPJB 2EAUA 3KOZA 4I1VA 1U0EA 3COWA 3DCYA 3LXRA 3ZD8A 1N0WA 1P73A 2AOTA 1P0CA 1EIZA 1IJFA 1BN7A 3EPJA 1WZ2A 2L17A 2GZMA 4ARSA 1LPAB 1T4MA 2NUPB 2VO1A 5FB3A 3VR1A 3HR8A 1WWKA 3QGMA 5CG1A 5K0EA 1QTRA 1K6JA 2JS7A 1AGNA 3T5DA 2OFPA 3JWIA 5A3VA 2FP4A 1S3GA 1NE7A 3MCWA 3WGLA 1LV8A 1Q77A 1XFAA 2CZGA 3AJDA 3BERA 4B40A 2XT6A 4KZKA 1NRJB 4TT3D 1WLSA 1OX6A 2B21A 4N5LA 5K3FA 5L4LA 2E6KA 1YWGO 2W8BA 1H5QA 1GOTA 1ZKMA 3AZPA 3TINA 1RAFA 3CE9A 4I50F 4K7JA 3X1ZA 4R9RA 4WBNA 4QXOA 1N5MA 2GESA 2V03A 3DF7A 4R1TA 4Y2UA 5GAJA 5JSQA 1DCTA 1TB4A 3RASA 5JCPA 1NUHA 2FEWB 3GLQA 4NJEB 4A2WA 5KYYA 1A1VA 1YQUA 2JHPA 5KTTA 4H9GA 2WVJA 2V7QA 3QEKA 5KZMB 4CL0A 1T1SA 2HYDA 4ZI2A 2F59A 3RS3A 1YJQA 4G6ZA 1WRBA 1YB5A 5JAZA 5DDIP 3RYIB 2RKWA 2F1KA 3PXEA 5KX5F 4C05A 1P2SA 3M6MD 3NTRA 3P45A 5JZOA 1BHSA 3QEJA 2XMGA 1T8RA 2FRXA 2NYRA 2NV0A 1ZA1A 4O33A 1LBSA 2JI9A 2Q5EA 2Z1DA 5ITZB 2ASEA 2ACVA 3C70A 4FMCF 3BVPA 4R8LA 5DASA 3RJ5A 4AZTA 4EA8A 4F71A 4RL4A 3EXIA 1VI5A 4JVMA 4XD2A 1C8BA 3I73A 3MCZA 5LA6B 3G2MA 2CXNA 1PL6A 2CLKB 4HWTA 2Z1MA 5F73A 3UGTA 4I8IA 3JRXA 2AYZA 5IEJA 3HVRA 1Z6PA 3R7DA 3RT9A 3RWOA 3QE3A 2BZ0A 5L3SB 3GBPA 1W73A 4KKVA 5GADl 1OBVA 2W83A 3A31A 3P9RA 3EEYA 3N74A 5CHYA 5GGYA 5B37A 4YNBA 5EXTA 5C5DA 2R4QA 2YHBA 3CYFA 1DFHA 3I0ZA 3LYLA 4JL6A 5GJWC 5KHAA 1BFDA 4FEGA 2C04A 1WNTA 3AHHA 3I8OA 5B6PA 1J1ZA 1TKCA 2I1LA 3TLKA 3ZEAA 4B3HA 1JPNA 1T4CA 5JAHA 5B5SA 4U7DA 1NVDA 1E1YA 3QKWA 3H9UA 3PFKA 4TPKA 1LSUA 4CTKA 2ODNA 3KKNA 1TUBB 2A1IA 3DNPA 3FYUC 3GGOA 5D85A 3V1NA 5HXAA 3AW9A 1BFUA 1AC5A 1OWLA 3M70A 2WG2A 4ZQFA 3G9XA 3I2JA 3M33A 1REQA 2GN4A 1TYAE 4GOJA 5EJ2A 4D0NA 4ENRA 1BCRB 1PWYE 2IC5A 4AMGA 4IZHA 2VYND 1VBFA 2ZWVA 2BWJA 3JD2A 4FN4A 3GLHE 4LXHA 4B7UA 5EHZA 3K9GA 1KWKA 3KKZA 4JROA 4H59A 4QTXA 3KCNA 2CNDA 3C7DB 3IB3A 3L6BA 5MN6A 2JIQA 4RPHA 2W58A 1YRYE 1Y9EA 1WZIA 3K0FB 3K32A 1JR3D 4JBLA 5LXTF 3E82A 2RGNC 3E9ZA 4BLOA 1B3RA 1C3JA 1HZZA 2BTQA 4XI9A 1P1HA 1XEFA 4XLLA 1YBMA 2Q1XA 1C1XA 2CHGA 1GSIA 4NICA 2ECKA 5KWIA 2QWXA 1E6LA 4FYKA 5I51A 1Y5MA 1WAMA 2BT4A 3GARA 4EGQA 4GZLA 1TJPB 4I3GA 1POXA 4H3KB 5BN5B 3GV0A 3P2EA 3W77A 5GVSA 1LS1A 1QVWA 3JPYA 1HE4A 3FUCA 3ZH9B 2MR5A 3A04A 4HXGA 4JI8B 3EZNA 5K8CA 3CQ9A 3HNOA 4YQEA 3UVEA 2VYFA 2VYVD 2IXGA 2H2DA 3T9EA 2YTZA 1J8DA 1Z22A 4ND4A 3LUDA 4W5QA 1YB7A 4E2ZA 2JD2A 3RFFA 2AX4A 2HIMA 5DIFA 3MILA 4B17A 5INTA 4M8LA 3VJKA 3UGJA 4KLCA 5H70A 2IHBA 4BLQA 3RVNA 3LU1A 3VZQA 4NCKA 2FZ4A 2IK8A 2NAFA 2RGYA 4FXPA 4NTZA 5DTJA 4WNYA 1Z5UA 4OHOA 2OYSA 4NENA 1Z39A 4NF2A 5FF9A 1PJZA 2G4LA 5KEIA 4IDFA 1G7CA 4REOA 5J5AA 1C7QA 4U2KA 4L4SA 5DGCA 1A98A 2JK0A 4N12A 4MQEA 3RSOA 3S1LA 5CURA 3B3AA 3EIUA 1KXZA 1M1NA 4BO3A 4KFCA 3SIRA 4KREA 2PMCA 2CDRA 2YRFA 3ET4A 3M1LA 1JIJA 1RQ7A 5D84A 2GO1A 3FXAA 1HYQA 1H65A 2RCNA 4BDTA 5BMVB 3S2GA 1N3YA 4E21A 1KEVA 1L4YA 2Q0XA 1WZCA 1QH1A 3TUJC 2IF2A 2IYEA 2AD5A 3SI7A 3SQMA 1AQ6A 4EVQA 1XU4A 1KI4A 1UF9A 2CXUA 3SJZA 3OT4A 1Q7BA 3R3VA 3GD5A 5AT1A 3RC9A 4JP1A 2RJ3A 3M9XA 1QQAA 5B3LA 3OTOB 2X76A 2D3WA 4I8DA 2H16A 5DYYA 3Q8LA 3FWZA 7MDHA 4AYWA 1EWTA 3UOAB 3GQBB 1UBFA 5T3UA 2GPSA 3SOZA 4KAAA 4YVFA 1JIQA 4GKBA 4D0GA 2GRAA 3T4PA 5I9BA 1SO8A 5IHXA 2X0FA 4DJEC 3AR9A 1ZA2A 4G4SO 4KNYA 1ZKDA 5JH7B 1MEEA 3D02A 2IP1A 5I9IA 2NT4A 2FDCA 3RLIA 2OUKA 4M0LA 4WZAB 3TS1A 4J49A 3VUFA 4YRMA 1KJWA 2XVMA 1RRCA 4MINA 1D6NA 1FDTA 5FTWA 3KAJA 3OOJA 1KDPA 4CHTA 4RY2A 2OHOA 3V42A 2DBZA 4BNKA 3BDVA 2J0SA 5SY6A 1DIAA 4M6WB 4G2NA 2YZGA 4X9XA 1L8OA 3VU1A 3AR2A 1XLTC 4E11A 2OQIA 2X8JB 4BKOA 4F04A 4R2HA 2F90A 4F2HA 3OURA 4KWIA 4MYTA 1RXWA 1ONOA 5JR3A 1K4MA 4P9NA 1QIKA 3HJNA 2HSWA 3ORYA 1A50B 1RI4A 2QMEA 2YY6A 1YS1X 4FNMA 4B46A 2Y1DA 2W2PA 1U90A 5JS7A 3O8RA 1XMOB 1KY5A 1X13A 2YV5A 4B79A 1V37A 3JX9A 2LKCA 3S8EA 2ZRCA 2ORED 1XXHA 1M6VB 2ENWA 3R0ZA 3CUTA 3L07A 4OX9B 3ZY6A 2ZQYA 4GBED 3FOZA 1IM2A 5DZSA 5H02A 1O94D 1TM3E 2IPMA 2R6FA 3AMVA 4R31A 3S40A 2ZR9A 3Q2OA 1BTOA 2C95A 4OVKA 3ECAA 1CR1A 3GFVA 2OHIA 5AI4A 4YXWD 1FQJA 4M9UA 5CBPA 5LPNA 4QBIA 4EZIA 4F9TA 2YHIB 3MUFA 1E9SA 1N1EA 4GE0A 4Z9AA 2Q49A 2WJ4A 1W4CA 3DTTA 3GGSA 2HM7A 5GM1A 1GQRA 4R8RA 4DV0B 1I5RA 4C76A 3WWZA 4J29A 1H66A 3VVMA 3QMMA 2B2CA 4Y8VA 5ES3A 4KFUA 1V47A 3DE4X 4Q12A 3TAHA 2YIMA 3TQTA 4C29A 1TYDE 2C77A 2Y05A 2Z2KA 1ZL2A 2W11A 3ABZA 2PL1A 3C1OA 3OSZA 3TRHA 2VPTA 5CHEA 5ALWA 3IE2A 2MCFA 3WWEA 4M1TA 4URZR 4F6RB 4ETWA 4MB2A 4G0ZA 1CRWG 2D74A 3DAGA 4HGRA 1XVVA 4RFSB 4LC9A 2FEAA 3J7AC 3S29A 4FDUA 2PUCA 1QGOA 2IOFA 4XFKA 5DVZA 4EEZA 1MXFA 1VYUA 2VJAA 4L5IA 1XK7A 2B3DA 3MAAC 1Y33E 1U8CB 3MS4A 4J2HA 1FTGA 3X0DA 3DDNA 3N70A 1CVIA 4BIIA 4JBNA 1UT6A 3EG9A 1FXSA 5FBHA 1D1PA 2WDPA 3AEUB 3Q15C 4QDJA 5EEGA 4ABYA 1G6OA 1YF3A 2IYSA 5TS3A 3HYCA 3DBOB 2O20A 3D43A 3MXOA 4JOQA 1AZWA 3F6SA 1IDN1 4KIUA 1ABBA 1OY1A 4UKDA 5BPFA 4KSBA 1GAWA 3HNPA 4FB5A 3HUDA 4M1QA 3SLRA 1PUXA 3R77A 1UK9A 4NSNA 2A1TR 4TRNA 3PEUA 2F55A 1OE0A 4DS3A 3BRWD 3D8SA 1L3BA 3QPCA 4LY6A 4NNJA 4MRMA 3GZJA 5WRFA 1MZPA 5FTMA 2CLLB 3OEYA 3WLSA 3EK2A 4P5EA 5AUNB 4IV0A 4LOLA 2LD4A 3F6YA 2PU7A 3GZTB 3GC6A 2W6QA 4L57A 4XJXA 4WAUA 4MUJA 3DM9B 5ICSA 4TM7A 1JAXA 1EFPA 1B1AA 2GA9A 2ZUCA 4JUAA 4YQFA 1MORA 5AHRA 4YJGA 5DX8A 5KVVA 1BMTA 1Z37A 3CS3A 1SHZA 2AFHA 3FOAA 3C8UA 4NKRA 4ZO8A 3H1AA 4B85A 3SQDA 1K75A 2Q1YA 3GH3A 2ZJ5A 4UBLA 4AYTA 4Q4DA 4GOOD 3HWSA 4GOXA 1R6TA 3BD7A 3DZGA 1QIHA 1TVMA 2EJBA 4K81B 1KKLA 2OCBA 3FAKA 5FLYA 3W3AD 4AJLA 1NDQA 4D6YA 4DG5A 2HREA 1VP9A 2R7NA 3ZJTA 3CUVA 3WGTA 5B4VA 3AESB 5EJ9A 3W2TA 3OQMA 1X80B 3AM4A 3N2LA 3HL0A 3IAEA 2OV6A 5IH7A 1VCMA 2CDNA 4LE1A 4RABA 1KP3A 2HMVA 1QG4A 4QUKA 3X44A 5TGTA 3LQRA 2GXUA 5KYVA 5HIJA 2A7QA 4X64B 2H5LA 3IH5A 1X3SA 3OJCA 2QRLA 1CJSA 4RKRA 2H06A 4G1FA 3P2IA 3PKJA 4HTFA 3UT6A 3NH9A 4HQRA 2PX4A 1T3LA 3LKZA 3A27A 1RC1A 3FUWA 1K68A 4NCAA 3CW2A 2RG1A 4W6ZA 1JDZA 2IQ5A 3M6FA 4Q21A 5CH3A 4E2XA 4EB0A 3BGVA 3VRHA 5GOZA 3OJXA 2N75A 5FI5A 4QQKA 3SS8A 9GPBA 2QTWB 3PIIA 2DY0A 3T0IA 2PGOA 3KYBA 4US1R 4OQYA 5B3JA 3AY6A 4V0LA 5TMDA 2ZJ4A 1XQVA 5CGQB 1KVQA 4A6DA 1Z3CA 2A0XA 2W2LD 1Z0KA 2C3UA 3FSRA 2WM8A 3IT1A 5G3YA 3RNLA 3U7IA 4UPEA 4UTVA 2RHWA 3VNVA 1XRRA 2QQGA 2XUJA 3TB4A 4QUBA 3OX2A 3MWJA 4U00A 5K2MA 3ZE7A 2CBGA 5CYGA 2L42A 1NVGA 4XUEA 4ZEWA 3RC8A 2OBBA 5BNIA 1VKZA 3X1DA 1V43A 3L0ZA 5T6BA 1IULA 4E6PA 2QN8A 1O6FA 2FUG1 2XVXA 4MLZA 3JVDA 2XZTA 4ZT5A 3QZUA 3A6KA 3W9BA 3W5IA 3ZV3A 3FR8A 4X66B 1QYXA 3GX1A 3S1AA 1Y6QA 1OTXA 2X86A 3DWEX 1HPLA 3P52A 4QQFA 2WNIA 3CHYA 3MFQA 2O2JA 4KDFA 4LYAA 3S44A 1Y8CA 2NVWA 4L85A 2IYNA 5IKPA 1T91A 3PQ4A 3HPRA 3ICQB 2DUJA 4EL0A 4NVRA 2I4TA 3SBOA 3BSWA 3IELA 3INTA 3KKKA 4AN4A 1B43A 1QOZA 3H5NA 1ZD5A 3ESXA 4FX2A 2QVGA 1YC5A 1ZCBA 2A5FA 2H4JA 2I1WA 2ZUUA 3UT5B 1UWCA 1E1QA 5K09A 1YNOA 1JW9B 1FUYB 2GRUA 3AYXB 1MJFA 4XD7A 4ZAVA 3FSJX 1OFUA 1E0AA 2QJTA 4PZCA 1KJ8A 3T9AA 5ESRA 2DSNA 3QKTA 4TWIA 3N9IA 2H1RA 2XH8A 4E4TA 5JYEA 2NTEA 1CZUA 5TMPA 1J8VA 3DUFA 1FF9A 4PNZA 5ESWA 4CG0A 1MOSA 2FUG6 4L6IA 4LVOA 1QDEA 2QE7D 2KB0A 3OKPA 4IUDS 2WFLA 1V5EA 1W88A 1AGPA 3OEWA 1CX9B 4OLFA 1RC0A 3DMTA 3L8HA 5E7MA 2FP3A 3SFTA 1ZRNA 4OL9A 1CU1A 3KXLA 4FYHA 4WN3A 4GMKA 2H85A 3VBCA 2AFIA 1UDCA 3H4TA 4FSDA 1XAGA 1DTWA 2NVUB 4HZGA 1TEHA 3V4OA 1Q15A 2XHZA 1G5FA 3NBUA 1TOAA 2DPGA 3I1YA 4BBPA 2I80A 4CDGA 4DEXA 3MJVA 4F4FA 4KPEC 2FQYA 3EZXA 1OLXA 3HJBA 2IZ5A 1UKAA 2ACKA 1SQGA 2B4KA 4GWKA 4NBLA 4MPDA 1K9VF 3L4BA 1QFMA 4HH1A 5KSPA 3I2YX 3WKDA 1J0DA 4C5AA 1SD1A 2VJPA 3EGOA 3QE0A 10MHA 4KX5A 3KX2A 4UBMA 4R9SA 3LX6A 3W6PA 2JKZA 2GD2A 4OFBA 1YR1A 1M2EA 2GBLA 2UAGA 3K16A 1K66A 2OAEA 2I8AA 3DNFA 3JZFA 1RWVA 2NV6A 3U7FB 4LUCA 2EJUA 4V1CA 1V5GA 1ADJA 4JHLA 4ZYTA 3HCEA 3LCVB 1HDCA 4B44A 4IXDA 1RSZA 4IHJA 4AECA 1YL5A 1Q44A 1QHIA 1W5BA 2H4XA 3DQZA 3QE9Y 3H1BA 1F4VA 1EK1A 5IFLA 3ZZNA 2JLQA 3KKOA 2H00A 5GTDA 2WZCA 5JI3E 4KODA 3SG0A 1Z35A 3HYSA 3KQHA 1WM1A 2YN4A 2OKGA 3QFRA 1K2WA 1N77A 1MTOA 4KFTA 5EQTA 1VJ5A 1YJBA 2QM0A 4AO6A 3UM9A 2E5FA 5DEOA 3SC6A 4BVGA 3RS7A 1N57A 4ZQCB 4ZCMA 3D4BA 4MV5A 4P7BA 4Z0PA 3ICCA 2OO5A 1S8FA 2RHDA 1V5FA 4JQYA 1T0JB 4NAVA 1O95A 3A0UA 4JB2A 1CY6A 4KRFA 1P7VA 3A28A 3E03A 2Y4NA 2C20A 4Y18A 4XAQA 3EH1A 4V38A 3KJEA 4Q5IA 3RVJA 1R50A 5D00A 4G36A 4MV0A 3NGMA 4K40A 5AO9A 4AZWA 3CNOA 3QWHA 1H05A 3MJDA 4HO1X 4NG5A 4U2FA 5AK5A 3V80A 3X1XA 4Q4LA 4F8EA 2WINI 3BH7A 1A5TA 4LZWA 1LQUA 1NVXQ 4RJKA 3OCUA 3I04M 2XGJA 3RREA 1WMSA 3ZG6A 3ITKA 4WXHA 2IHTA 2CV0A 3VU9B 1SIOA 2F9LA 4RELA 3ER8A 4R7TA 1JZTA 1C0PA 1OQAA 1UBKS 5H68A 1NXTA 4QATA 1XAIA 3B5IA 5I48A 4JXXA 3OBIA 4BFUA 2HRQA 1RWNA 1ULAA 4J76A 4OA5A 2EFHB 4CE6A 2PWPA 4M7OA 4MI1A 5DRYA 1DMRA 2G82A 3CX8A 4ZOBA 5JARA 4E07A 2ASVA 2O1WA 3ZHZA 4UDXX 2PUBA 3BL6A 1I1OA 1UZLA 2X7JA 3PUZA 3F8SA 4FSHA 2HWXA 4L74A 4GBGA 4R5MA 4LYDA 1OGIA 4G5FA 1KNXA 1LWNA 1TVKB 3DXZA 3JYHA 4L2IA 5CT5A 1RLTA 2LTAA 4CF3A 5T7BA 2QQFA 4GSYA 1WO8A 3JQGA 3BIJA 2QTCA 2FCRA 5C4IA 1UDRA 4C6TB 2X8LA 4ZCRA 1PR3A 4XWTA 1EGQA 3BHJA 2H7CA 2HMWA 4JJ4A 4A8PA 1FP6A 2XB8A 4QVGA 1NW7A 5EHIA 3TLXA 3KTOA 2W00A 3DEKA 3NB0A 2PBFA 1KA9H 1EDDA 2DRIA 3DB2A 1O87A 2J31A 4L5JA 1LY1A 3SHOA 1MB2A 1LTKA 1J2EA 4YV2A 2FR8C 1FA9A 4MYRA 4UNSA 1MRNA 5CIWA 3IFSA 3PXBA 4Q1FA 1CF4A 3HB7A 3IOEA 5AWFC 2OOSA 5A4JA 4KUGA 1MIHA 3SM3A 4KGVA 5BSMA 1U7TA 2NZ8A 4BBJA 3PL5A 1JQ3A 3HN2A 3D7NA 4KXQA 5J2TF 1SG0A 3GA5A 1B15A 2P68A 4S12A 3ESQA 1RHRA 2CUZA 5K0LA 2AKYA 2HRZA 3NHBA 4MW1A 3VVBA 2I2FA 1D5CA 4C4PA 1Z28A 5K5EA 3M81A 4DDMA 1DP4A 2QGFA 1BGWA 2Z2IA 1D1QA 1IVNA 4L1KA 4NJEA 2BF4A 1DKPA 1XQYA 2H59A 1HKHA 1H5UA 2AF3C 2GLXA 1I6KA 4YALA 1NF8A 1TK9A 4LRXA 1P9NA 4Y0NA 5IXSA 1DQSA 2EXXA 4UE2A 3RHFA 3VBEA 1J25A 1V3UA 4ZOLB 5DIZA 1SVMA 4CM6A 1N3IA 1XZAA 1MX9A 1ISHA 1GCGA 4O8CA 2NPOA 4C0JA 1I3LA 3Q3GE 4JSTA 4D3ZA 2WAMA 2IEAA 4HEHA 5ARDA 1HEIA 2BFFB 2Q4EA 1G18A 3BXZA 2GPYA 2JPDA 4HAYA 4CI9A 4O0LA 5KNDH 3IAS6 2A9KA 4PX9A 1DBVO 1CUZA 2XUIA 2I78A 2PH3A 2XQKA 4LF6B 2O1SA 1B23P 2DERA 2IIPA 3MRXA 3UAWA 3L4JA 1BVHA 1Z8DA 2P67A 3HB0A 4P3XA 3HYTA 3T9BA 4KWCA 3CLKA 1LSSA 2W2OA 2ZZMA 4UU7A 2P2SA 2H1VA 1KO4A 4PG4A 4WLVA 1X7ZB 3FNRA 5BQXA 1X2BA 3G8YA 4JYPA 1E3QA 5KQRA 1RMYA 4QRIA 2DXIA 4V0QA 2WSLA 2H92A 5DHSA 5AJYA 5IC5A 1W7AA 3O4HA 2QZPA 2C7GA 3KT3A 1KR5A 2D0PB 3V7YA 2E21A 1LTQA 1TE2A 2O3SA 4TXLA 3R5XA 1QMPA 1YDGA 3KJIA 1T43A 3HUFA 4XQCA 3QTBA 2O7RA 3KEOA 3ZJ4A 3CO0S 2WJ3A 3IO5A 1RIIA 1YRBA 2GD1O 1OREA 3KVYA 4FYIA 4IW3B 4ARVA 1PWZA 1JHDA 2G9RA 3BQNB 4NE9A 3BXGA 2P6RA 4OL0A 4XYBA 2E1RA 1XMJA 2E4WA 3REOA 4OB7A 4IQ8A 1BCRA 3CW9A 1J0AA 2G88A 5LU8A 1LSJA 4JXZA 4EHDA 2B36A 1XTVA 2R6HA 3EIFA 5TMEA 3OPVA 3Q6MA 3IP6A 5G1NA 3VX4A 3L7YA 4FKZA 3VYTB 3EQ2A 2XZOA 1G41A 1L4LA 5HKAA 1R1DA 4DQDA 1LRJA 5K05A 3B6KA 1N0UA 3T1NA 3CVYA 2WVHA 5PNTA 3VKGA 1X9GA 4WD3A 2HFJA 3Q4GA 2X22A 4C0HA 3PX7A 2J3QA 5BO5A 4MP8A 2JK1A