4WKOA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with hydroxybutylthio-dadme-immucillin-a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
b'VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wkoA00
5CCEA 2AI2A 4LNHA 1PK9A 3UAWA 3IOMA 4F3KA 3KU4A 1T8RA 1Z36A 4YO8A 1Y1TA 2A8YA 4TXJA 3DJFA 3EMVA 1PW7A 1JP7A 1NW4A 3UAXA 1ODJA 1NC3A 1OTXA 5F78A 4GKAA 1V41E 3MB8A 2QDKA 1U1GA 2A0XA 4L5AA 4I2VA 2OC9A 3C74A 4NY1A 1RFGE 3MMSA 3NM6B 4D8XA 1RXCA 1RXYA 1YR3A 3BGSA 1WTAA 4F1WA 4YMLA 4UC0A 3D1VA 1OVGA 2AI3A 4GLFA 4GMHA 5CCDA 2P4SA 4QFBA 3U40A 1A9PA 4WKOA 4QARA 4TTAA 1CG6A 4OY3A 1JDVA 4PR3A 1U1EA 1CB0A 2B94A 3BSFA 4F3CA 1Z39A 1JDSA 4OEHA 1SJ9A 4D8VA 4MARA 1ULBA 1C3XA 4MCHA 3GB9A 3O6VA 4K6OA 1PK7A 2IQ5A 3EUEA 3LBAA 4DA8A 5CYGA 1ZOSA 2A0WA 5B7GA 1NC1A 3ENZA 1RSZA 4LZWA 3LGSA 1OTYA 1LVUA 3INYA 3FWPA 5ETJA 3UT6A 3OZEA 4DARA 1LX7A 4RJ2A 4H1TA 3NBQA 1TGYA 1JPVA 4PNPA 1PKEA 1Y1SA 3UAVA 3KVYA 1JDTA 3LA8A 3OPVA 3E9RA 1QE5A 1V48A 4E1VA 1PR2A 3FAZA 5F7OA 1Z37A 3FNQA 1PR0A 4TXLA 3K8QA 2ISCA 3NM5A 3P0EA 5IFKA 4NSNA 5C80A 3OCCA 4X24A 1Z35A 1Q1GA 2AI1A 2Q7OE 1YBFA 3EUFA 3DPSA 4F2WA 3EEIA 1RXSA 1OV6A 1YQUA 1PBNA 4L5CA 2OC4A 5EFOA 1FXUA 1RCTE 4TYMA 5K1ZA 3KHSA 2QPLA 1K27A 3IEXA 3F8WA 1Y6QA 1PR4A 1V45E 3FB1A 4TXMA 1SQ6A 4TTIA 3KUKA 4L0MA 1K3FA 3E0QA 1Z5OA 5FAKA 5EPUA 2QTGA 2I4TA 4TTJA 1Y1QA 3GGSA 3NM4A 5F76A 1I80A 4TS3A 3OF3A 4P54A 1N3IA 4M7WA 3BL6A 1PWYE 4D9HA 1RXUA 4G41A 4IP0A 1ODKA 3OZCA 2OXFA 1T8SA 2HWUA 2PGAA 3PNSA 1A9TA 4JWTA 3KVRA 1RYZA 1U1DA 5DK6A 4YJKA 4OGKA 3DDOA 5F77A 4WKCA 1M73E 5B7PA 4WKBA 1A69A 4EB8A 4DAEA 1A9QA 1ODIA 1Z38A 1G2OA 5F73A 5F7ZA 1T8WA 1PR6A 2QSUA 4OGLA 4TXHA 1VHWA 4MCIA 1JDZA 1T8YA 3P0FA 1TCUA 4KN5A 4LNAA 4D8YA 3SCZA 4R2WA 5I3CA 5B7NA 3PHBE 4D98A 1YQQA 1U1CA 1JYSA 2GUWA 1PF7E 1Z33A 4LKRA 3E9ZA 3PHCA 1B8OA 1RT9A 3FOWA 1V4NA 3BJEA 4JP5A 5F7JA 1ZL2A 4BMZA 1JE1A 1TD1A 5CXSA 1PR1A 3T94A 1T0UA 1PR5A 1OUMA 4FFSA 3ODGA 2I8AA 1JE0A 5JPCA 4DA0A 1SD2A 3OOEA 4TXNA 3K8OE 4OF4A 4DA6A 1B8NA 1OU4A 2AC7A 4G89A 4WKNA 1JDUA 3QPBA 2RJ3A 4BMYA 4L6IA 1U1FA 4BN0A 1V3QE 3OZBA 2H8GA 5CYFA 2HN9A 3OZDA 3KVVA 4DA7A 4QASA 2A0YA 1A9RA 4BMXA 4G8JA 1A9OA 4M3NA 1TCVA 4R31A 4NS1A 4GLJA 4ECEA 4DABA 1VMKA 4TS9A 4DANA 3OOHA 1Z5NA 4EARA 4DAOA 1SD1A 1YRYE 1RR6A 4L5YA 1VHJA 4QATA 4U2KA 2OECA 3TL6A 5F7XA 3DP9A 1TGVA 2HRDA 1LV8A 5B7QA 3O4VA 2ON6A 3DF9A 4WKPA 1V2HE 4M1EA 1XE3A 4JOSA 2BSXA 2HSWA 3UAZA 4F2PA 4QAQA 1K9SA 3ONVA 1ULAA 1ODLA 1Z5PA 4QEZA 2QTTA 3UAYA 1A9SA 1VFNA 4YNBA 1Y1RA 1Y6RA 3PNPA 1ECPA 4LDNA 5CXQA 5IU6A 5KB3A 5EUBA 4R2XA 1Z34A 3FUCA 2XRFA 4OJTA
chains in the Genus database with same CATH superfamily
2DJIA 4HZIA 4RHXA 2VRBA 1IOWA 3BXGA 1T9BA 3BWCA 4B82A 1J2JA 2E18A 2HK9A 3ER6A 1P4AA 4OHZA 2GI4A 1FP6A 4A5SA 1DLJA 3E3LA 1I3NA 1M7BA 4E3WA 5ITZA 5THXA 1L5HB 3WWEA 5HM6A 5JAMA 1PYGA 2BMAA 2R25B 4UHKA 4AX8A 1ZHOA 4Q4AA 2C8VA 5LNK1 1M66A 5H81A 5HMLA 3DB1A 5ALDA 1PR3A 5FDFA 4MVJP 3AY7A 1AU9A 1A71A 1MT3A 1WPQA 3HCCA 4NDZA 1GDHA 5E9JA 3L7MA 1UFKA 5K6TA 2V5AA 1B1CA 4PICA 4O2AB 1ODJA 2O06A 4JVNA 1NC3A 1OTXA 1DIBA 1EFUA 3X1MA 5BV8A 3D3KA 3DMFA 1Y6ZA 4OJNA 1R9MA 3ZYCA 2FQWA 2WOOA 3HEAA 3FMGA 3OIUA 2IYLD 2DY1A 3QKRB 3OLXA 5GONB 1JWLA 1D1QA 1H05A 5FTWA 1VDZA 4QQRA 3EOZA 4FNAA 4RABA 1AQ6A 3V6LA 4ETIA 1KDOA 2OC9A 2XZPA 3KJHA 1EP2B 1EUQA 2C07A 4JY7A 4PSCA 1CCWA 2V97A 4ZI7B 1YJCA 4R9NA 2RCYA 4BLUA 5A4MS 2M6LA 5KOYA 1P0FA 1JR3A 3HA5A 3IBGA 1HNXB 1YACA 2LIVA 3BFXA 3LPNA 2CXTA 4KUHA 4LOKA 4PNHA 4RXUA 3AFHA 1CUYA 2ENUA 1SKQA 3GFBA 4H1VA 3V1KA 2J46A 2RC5A 4G5HA 1X7YB 4N0QA 4ZOLF 2RH5A 4P4TA 4BCCA 4AECA 4EW1A 1ZGZA 3G2OA 5ALWA 5AOCA 3HXPA 4OBXA 3WZMA 2VDWB 4Z7QB 5D3ZA 3NIWA 1S2MA 3ADOA 4W1SA 4DR2B 1HDYA 1NT2A 2PT5A 4U2BA 1BMQA 1ID1A 1NUTA 2NZ8A 3E3AA 2EWWA 1AHIA 3NRCA 4CE6A 2YNMD 2PUTA 3PVZA 1K4MA 3E1GA 4X63A 5C8VA 2VHCA 1ZIPA 3LHKA 1QH1A 1Q50A 3UWMA 4QU9A 4GECA 4I9UA 1CY6A 1MMFB 2N42A 2WW8A 4M9XA 1Y3FE 5HKLA 1X86B 1XQ1A 4QARA 1ZMRA 3D7LA 1U2EA 2WHPB 2W6JD 3N6RA 4F04A 1YS9A 3B3QA 3WRXC 1SUIA 1E6CA 4RVUA 4YRMA 3TQSA 4DR6B 5E3JA 1NE7A 1WXWA 3GUHA 3MCVA 4QWWA 2B94A 4TTQA 4LGYA 1TECE 4IIFA 3B1FA 5BSEA 4AF6A 4B6FA 2ZT8A 1W7AA 3QP9A 1C7EA 1VP9A 3MXOA 3DNPA 3PQ8A 4M9CA 5BVHB 3ZI7A 3SC2A 2O2CA 3NHFA 4CHGA 1RCFA 4ZP1A 1UOPA 3PCRB 4ARBA 1TQ6A 2JLQA 3P8ZA 3QE2A 1V5WA 2HJ9A 3JQ8B 3KZVA 5ARBA 1HDZA 5HKKA 1ZLYA 1ZNYA 3MAAC 2CDAA 3QV1A 1L5WA 3DXYA 4JB0A 1ONBA 4QRDA 4HN9A 1GLNA 4J2OA 1TJ4A 4JA2A 4HEQA 3G2PA 3HADA 3SSOA 1IEXA 1TU0A 4R1UA 5CLJA 2VUIB 4FEGA 4OX9B 3TRFA 3HA2A 3Q7QA 2AKAB 3C6QA 2ZEJA 2WV9A 2C04A 2RHMA 2Y9MB 1E1CB 4QYSA 3DP7A 1NHGA 1TTHA 2OV1A 3V32A 3E22B 1GZ5A 1YJ5A 2XE4A 4D9BA 4BIIA 1IULA 1H0RA 4ENQA 2HXYA 1NXVA 3UFXA 5BQPA 1E9CA 3BQMB 4W9NA 4EG4A 1Y0BA 3S44A 1JMYA 3IUEA 1IHPA 3LHIA 5J2TF 2X1VA 1DAFA 5JG7A 3SHWA 3AF6A 1FXWA 1EUYA 2UZ4A 3EF0A 3WGLA 3SDSA 4YCNA 3JSXA 1G18A 2FZCA 3F9IA 5FA6A 4R54A 5DHSA 4Q3BA 8ADHA 3N6XA 4GI2A 4NYMR 1K4YA 1DIGA 3E9DA 2WF5A 1JPVA 4ENRA 4E6EA 2A2ZA 3L1IA 5B6PA 1CYEA 1B7GO 4PHFA 1VKOA 2J3EA 4BMCA 2X4IA 4CIXA 4DG8A 2VCHA 3F47A 4OLFA 1CVLA 1Z4QA 4TROA 3DTTA 3KVYA 3WL3A 5FH9A 1L5ZA 3CNOA 2X4DA 1ZVQA 2AHOA 4HLCA 4OQQA 3DE0X 1LUAA 3IR7A 5FAXA 4RTMA 3UOAB 1XRMA 3CZPA 1R4MA 3WB0A 5ICEA 3BDVA 1PJQA 3AR9A 2MWMA 2PSEA 1EPUA 1ZXBA 3EODA 1ULTA 4L27A 1C29B 5HPYB 3U09A 1KEEB 1NZDA 3NYQA 4FK8A 4JLSA 2DSTA 2GQ0A 5HUHA 3QLUC 4MUNA 3T5GA 3OMLA 1JZTA 2IPMA 1JEEA 2CLEB 3F6PA 3K94A 3VU9B 5IUNC 1IM5A 5KJ1A 1TVMA 3EEQA 3TL3A 3CCBA 4QELA 3DZFA 4G23A 3ZU2A 1L3CA 2QTVA 2R5FA 4BDSA 2Y1WA 3RGWS 1OI4A 1MW8X 3PNQA 4OLHA 2HCBA 1XCOA 3JQAD 4F96A 3QEAZ 3V8MA 1ESMA 2B9VA 2GSWA 1DO0A 2A35A 2V1XA 1WZIA 3BL5A 4WHMA 3NBZC 5IRCD 3QWFA 3IAS6 1Q0QA 1PVDA 3LFTA 4IH9A 2PCLA 2NSHA 3RHSA 3A1WA 2AA3A 4WACA 1YQUA 4TT3A 2DZDA 1LPSA 4ZVPA 2P79A 4D9GA 4DRXB 3B6MA 3KLOA 1ECFA 2EEPA 2UZ1A 2CJYA 2W0SA 1V5EA 3S2YA 3U7IA 4NE7A 3FFWA 3G5LA 3IT1A 4QBIA 5FI1B 2O54A 3DL4A 3KHSA 3O8BA 4ZCQA 2AL7A 4KN8A 3W2FA 1SU6A 1CLEA 3KCQA 2QTMA 4URYR 1AHHA 1VE9A 4XGIA 2P2ZA 2WPDD 3EZLA 3C0KA 1EIWA 3H2BA 4GYJA 3MEQA 3R0QA 4XOUA 4ZOLA 3SWWA 2ZWIA 1CF9A 1J2UA 1K1EA 2A9VA 1A2BA 2CJPA 2LD4A 1GNLA 4LNUB 4M1OA 5C51B 4PY2A 1WXQA 1OYWA 4LF7B 4G01B 3LVBA 1U9ZA 2QN6A 2XXJA 2ZDQA 2IVFA 3EDCA 1Y9DA 2WZCA 3N2IA 3SIPA 3DVQX 4F9FA 1Y1LA 2YMPA 4UFOA 1D1TA 5EPUA 3SX0A 2IZZA 2RGXA 3DWGA 3WLNA 1Y1QA 3S7TA 3WJ2A 3R6DA 2BF4A 2V0CA 2VT6A 3OTGA 1GLGA 2ONJA 5AD1A 3H5VA 2PJRA 4C3ZA 1N9GB 3GMTA 3K5IA 3TWOA 4DDKA 3OAAD 3UWPA 2EIHA 1GPJA 1O0CA 1H2RS 4BFCA 3OJ0A 2C7QA 4JCOA 1SG0A 4AF7A 5IWCA 2J0UA 3MYRA 4ARAA 1WW8A 2QW8A 2W6CX 3A27A 3DMPA 4HMPA 3IJPA 5BW8A 2FFJA 3KLMX 3KQTA 5C1PA 3UMSA 4N54A 4H17A 3ZHBA 3CSUA 4W9NC 1YZKA 5CW2A 5ENVA 5L53A 2UUAB 3IPYA 4JLPA 3Q2KA 3BB4A 5AKIA 4EG3A 2BIFA 2I4MA 2PGAA 4IXTA 3THXA 2XUGA 4IJUA 3IPXA 4K9QA 1V8OA 3PIIA 1F4VA 3KAQA 1N2IA 4Q82A 4QOJA 5DB4A 5L3QB 2BTQA 3FKSA 2ANCA 5JSUA 3K2IA 4PAMA 3HSSA 4ZTZB 1T36B 2LR0A 1XVVA 1Q7EA 4JJIA 4OP1A 2YIVX 1EWKA 1S3SA 4OGKA 2E5FA 5FQOA 5TQ2A 2AMFA 4AIIA 5CXUA 2AYYA 2Z4TA 1NL3A 3GMIA 3TZKA 1M73E 2Q0XA 1QTRA 3VM6A 6REQA 3D64A 1DGQA 1XYVA 3QLJA 3UWSA 3SI7A 3N6VA 1NQVA 3KQUA 2DPXA 2O0KA 3C3YA 5SZJA 3AUUA 1T2UA 3JQCA 2WSSD 4MQ6A 2WWWA 4JC8A 4LGVA 2D8MA 5DX8A 3I5UA 3TQIA 2V54A 4HDSB 4B87A 5J2TA 3K96A 3T4EA 1VDMA 3EC1A 1KSHA 1FX0A 1WO8A 2OP0A 3HYRA 4TQUS 3RW9A 3MS2A 2ZE8A 4B9EA 5A4DA 4FHZA 6AT1A 3CZCA 1I7SB 1FNNA 2HF8A 1KXJA 3D4BA 5DSXA 2OSVA 4AZVA 5A2QA 1NBEA 1U5BB 2GM5A 2WB4A 5IS2A 2JCSA 5LQSA 5BVGA 1YNSA 3IDSA 4KV9A 5TEVA 5CX4A 1Y7TA 1TVCA 4GDMA 4FUQA 2YRXA 1QVAA 1US8A 3DZIA 4Q4LA 1DG3A 1N6KA 3ZY2A 4WCVA 2Y1DA 4KGZA 3EF3A 5JS7A 4EHIA 1AKUA 3FVVA 3CG4A 2NUBA 1R9NA 4HPJB 4H1WA 4YALA 2HNBA 3QRWA 2X7JA 1JFVA 4KWIA 1UZMA 4OGFA 3ZE2B 3E82A 2GRJA 3QI2A 1KK3A 4MR7A 1JRLA 1YQQA 2VDKB 2YV1A 3KT3A 3RO7A 1HMPA 4P86A 3KVOA 1PF7E 5ALMA 1YS6A 1DS6A 3WK6A 4BV2A 1J0BA 1GVNB 3R0ZA 2AOUB 3QTTA 221PA 3K0AB 2CJXA 4XDHA 3DF7A 3A11A 3IH5A 1BQ3A 4KFUA 4LC9A 3ZQKA 1EDDA 2PQ0A 1E3WA 3SZUA 1AKYA 3RS7A 4HDMA 1AURA 1WX1A 5K51A 1A5BB 1LBSA 1MPXA 2BTOA 4OUKX 5AK4A 3LK7A 3S28A 6GPBA 3V4SA 1KARA 2OFPA 3LUFA 4KC0A 4D4LA 2BCEA 4M22A 2AMVA 1GTVA 2H2HA 4N3AA 2AW5A 2GEJA 5CTAA 2JI7A 4K2HA 3UIEA 1GVHA 4BQSA 4D3SA 2MYTA 4K05A 1ZGAA 1ECBA 1YE8A 3WFIA 2FF7A 4RORA 4YQZA 2R0QC 3HCWA 1LBQA 3V4PB 3GD7A 3HO6A 4BLSA 1KYWA 3LO5A 1VGQA 3DEKA 3OQHA 5BUZA 4TYYA 1V7QA 1A2OA 1A5AB 1BTOA 3N3AC 3M5CA 4YI3A 4MKZA 2JK1A 3KJGA 2R6ZA 4F38A 5AKYA 2BMVA 4RLSA 2IKSA 2CFRA 2PIDA 2CXRA 3N2ZB 3RS9A 5HZKA 3ZE8A 3KOYA 4NEQA 4O4HB 3B52X 2B2CA 3U4HA 3OFVA 1LDBA 3SKYA 4MQFA 3RFVA 4WL0A 4YUXA 5LU8A 3J81A 4AS2A 1H2EA 3U61B 4JHXA 1U8AA 1ZG3A 1Q95A 2CNWA 1ZNZA 2C58A 4LK3A 4OFZA 3WSVA 4EEXA 3AVUA 1J1UA 1FYFA 2H4JA 2VH5R 2JANA 3PD1A 4RVGA 3SK0A 3VPXA 2QGFA 5CYFA 3C41J 4MW5A 5AW5A 1PL8A 1E7WA 3BXPA 1QFMA 1RWBA 2PZFA 3AVQA 4J90A 3U3XA 2FMKA 3ONFA 4NBRA 2PT6A 3H7IA 4A8JB 2D00A 4HFJA 1TCVA 5HF8A 3R2JA 3ORHA 4NS1A 4ECEA 2YICA 4F6CA 5B12A 5LQCA 3DBLA 3UMVA 2V45A 1BX0A 1RHJA 1C14A 1JS1X 2XVYA 3ACBA 5E9QA 3WRVA 2Z6VA 2FNAA 4FYKA 4EY4A 2OYRA 1C7QA 2RIRA 3EVCA 2PCJA 3NI2A 4N3CA 1YRAA 1UUFA 4N03A 4BFVA 2LDXA 3DV0A 5BRJA 1GRRA 2FMXA 4NK4A 3L07A 3VKWA 1KI6B 2O57A 1C1XA 1GNSA 2OCGA 2XD4A 4MUFA 4NOJA 3RC7A 1CZRA 2JAUA 2Y0EA 3CX7A 4RDIA 3RQIA 1UANA 1MDBA 5C5IA 1S2OA 1YHNA 1Z3IX 5KYUA 4F3RA 4MP3A 4B46A 2Y1GA 3NTRA 3IMFA 2E9SA 1U9IA 4ZU3A 1AKQA 4A5OA 1CUHA 2BMEA 2PAFA 2XEXA 4OQMA 2XA1A 4CMEC 1CR1A 1B43A 1C7RA 1W8IA 1WTCA 3FI9A 3OZIA 4ZARA 5GVRA 2I1VB 3NEJA 1CK4A 1S3IA 3TSOA 3ZOZA 1I7LA 3DOIA 1RE0A 3NHAA 4NBLA 3BD7A 3FWKA 4DUPA 3EC2A 2O8CB 1M7HA 4BP3A 3CFYA 4LISA 4YVFA 4BQNA 1E1RD 4A16A 4BX0A 2ZPAA 5IANA 1L5NA 2B3TA 2NUAA 1QGZA 1LPMA 2P4HX 2WJHA 2QD4A 3SS9X 4CL0A 4BEBA 3FNGA 4U9HS 2NMVA 3L4BA 3GAMA 4HNUA 5CAEA 2JF0A 3ONVA 3UQYS 4BQRA 3FNBA 3VHRA 3LK6A 1KEZA 1UMBA 1VLLA 1RD4A 5KTPA 4YJFB 2QMOA 5KMGA 4DNPA 4AWBA 1PFGA 4R1PA 3NP7A 3OA0A 5H83A 5KQMA 4NDNE 5ESDA 3LQKA 2BFEA 1U65A 1ZW1A 4UCXA 1FJ2A 5BSTA 1WQ1R 2B5VA 2HADA 1VC2A 3JAWB 3I83A 4ZK2A 3RVMA 5ES4B 1JHUA 2BHRA 2BR4A 2CHQA 2IODA 2OMEA 2SCUA 3RVRA 3QTBA 4ZHSA 5K0FA 1G0OA 3E48A 4O29A 2C83A 3WAKA 8LDHA 2FPIA 1Q1ZA 1OKKA 1LH0A 2O5RA 1NVGA 4ZDKA 3ONEA 5CCEA 1U8UA 3D9QX 1S2GA 4C08A 1N5LA 1H5UA 4PTYA 2Q3JA 2Q1XA 3K92A 1RHMA 3ZW7A 2Q1YA 4M1SA 4GW3A 2I1QA 1ZDMA 2QPOA 5E6SA 3L7LA 1ZOOA 3RIMA 3HJBA 1IVNA 1ZGJA 2XCIA 4EFNA 3MTAA 4RD1A 2WUWE 3PWTA 1G98A 3INTA 1CRLA 3DC7A 1Q2UA 1P18A 4CTJA 5AVQA 1CVRA 1VIDA 1W5FA 1RJEA 1SXJA 2HDOA 4QEKA 4XVQA 1E1NA 2FN4A 3A4VA 1MRZA 1A8UA 4QD3A 2HQOA 4ZANA 1XHLA 1PEAA 1YL6A 4OK6A 4RHCA 1U0RA 3AEUB 5DYNA 5JEEA 3KJIA 5CH3A 2H06A 3KCNA 4FSXA 2HH9A 2WA1A 3EN0A 2LDBA 4WV3A 2GF2A 4L7QA 3V4OA 4ZDJA 1F0PA 1PEYA 3VKVA 2GKSA 3BMXA 4I4IA 3W9SA 4ZCTA 1E20A 1K8QA 1DWPA 1SHZA 1VBNA 1Z15A 2OHFA 3DFUA 5DBFA 4EY8A 1X7WB 2ZIXB 4ZYVA 1EMDA 3MT7A 1T1RA 3BUSA 3MK31 2WUDA 1I2BA 3JYNA 4MUIA 4B4WA 1KDRA 4BZWA 1Z82A 2JH3A 3INGA 4IZ6A 2R11A 1JSCA 1ZVJA 1TQ8A 5FUWA 1F5NA 2X9VA 4G5GA 2BSAA 5FIUA 1UJCA 1UK7A 3BWDD 4XX0A 4EPXA 1ZD2P 3IUYA 2QU8A 4D8XA 1GUBA 1DKLA 3BJRA 3M6WA 4MUJA 2PQMA 2CJWB 1A8HA 2AK3A 3CCFA 3C1AA 5ITVA 3OWXA 2P75A 4TS4A 3KLPX 5FBZA 3NVMB 1LPOA 2FVXA 3LJKA 3FUUA 3OCVA 2Y1OA 3QYPA 1D2EA 4A8HA 5KC8A 4BZQA 1U9IC 2TS1A 2CT8A 3BXHA 2BGMA 1S0UA 3ZDDA 4EKIA 1QWOA 3UW3A 4HJRA 4MS4A 2ZBPA 2A5JA 2QU7A 3COJA 3SF8A 1JR4A 2FSPA 5C1BA 2AJLI 2GCOA 3O9ZA 5A71A 4O2BB 5C7YA 3A1SA 2WM3A 3PQDA 4IGEA 1QFZA 3DZCA 2PZEA 3NIBA 3F97A 2XGGA 3AKZA 1O97C 4OUDB 2XT9A 2OV2A 4KFCA 2YWRA 2N47A 2H2AA 4OKNA 1HXHA 4KXMA 5TB5A 3WVNA 4BL5A 5IXSA 2GZSA 1G17A 2FN8A 2YYYA 3L4BC 1YBMA 2XWSA 4FOLA 4UBLA 3IV6A 3T95A 1U7PA 4TLAA 3X1XA 2QB5A 1IY1A 1LCIA 1XJQA 1Z39A 2CNLA 1ORDA 3UG6A 4C0JA 3SM9A 1C0KA 3I23A 3V3KA 3KZOA 1SJ9A 2MSLA 4OI2A 4QX6A 2WIAA 2A0FA 3JQBA 1QSGA 2BKUA 2JRCA 4EPYA 3CLRC 1UBSB 4FT2A 4TMWA 4WA7A 3JR7A 4EG1A 4F71A 3T5AA 5IAOA 4YPOA 2B30A 4B3XA 5F35A 1N6IA 2XOXA 1OSNA 4PXYA 1AB5A 1Y9ZA 4TZKA 1NVEA 2WYIA 3C3AA 3ESYA 3IPLA 3LPDA 4LTNA 2FFHA 4A0QA 1C1DB 2QAGB 4DLWA 1N2HA 2WU0A 3CN7A 3Q8WA 2R1TB 4G37A 1DFIA 3TIGA 1AK1A 3L5KA 2A4MA 2BKLA 4CWAA 2PX2A 3C3MA 3CY6A 4UFNA 1YQEA 3ZCUA 3IBFA 2KI5A 1XJWA 2BM8A 3EGWA 8ATCA 4TVBA 3ICEA 4JI6B 1P4SA 1LPNA 2J5RA 2CKMA 3QWBA 1MPTA 5A6SB 5B4VA 3KEMA 3R44A 2ACKA 4Q4JA 1UXKA 2CXPA 1BDMA 1IAQA 1GL6A 2JGLA 2BFBB 2R8XA 1GGEA 5AI0A 2ZJZA 1VM6A 2OCKA 3OQJA 5JS8A 3QEBZ 4ZXFA 4B34A 3C7KA 2AEFA 2ATXA 1A7UA 2DH5A 3MGBA 4HPWA 1W0CA 2ZE7A 2QMHA 3T52A 2AFHB 2WP0A 5DX0A 3W6PA 1E69A 3KQQA 3U1VA 1SB9A 3WL4A 3M4ZA 4MGHA 1USGA 2E87A 2A1UB 3L3BA 3WBBA 2ZSKA 4CU5A 4ZXPA 2Q4OA 1OXUA 5CT9A 3GPLA 2CV2A 2A1TS 2YZNA 2ZUCA 4Z4CA 3JVEA 2JVIA 3RWOA 3A9TA 4P3YA 4PAGA 4MUBA 3R7BA 3VPAA 3FOEC 4R6WA 2Q3EA 1COWA 2YVLA 3A6ZA 5HX7A 4EI8A 1X7XB 3BRWD 2GN9A 1V48A 1YU9A 2Q62A 5LL6P 2VIIA 2AW3A 3S81A 4F5WA 1ZK2A 1M6WA 2O5VA 5DNEA 3ESAA 5FNVF 3ZDAA 4FR5A 2VT7A 3Q88A 3SG0A 2XBUA 3NHZA 1ZUIA 3H8JA 1I9GA 1BE8A 2GO1A 3IIKA 4FE3A 2J6CA 4HAZA 3UA3A 4BU0A 1DAGA 1PL0A 2BPOA 1TJ5A 2HTFA 1MTOA 3O1HB 2DSNA 4TTRA 4X0EA 2VTBB 3B1YA 4ILKA 2H0AA 2WF9A 2WTEA 1HLPA 4YAFA 1N2SA 1L4NA 3BTVA 3N53A 4DM7A 1YWGO 4X24A 2ILTA 3PXDA 4LSGA 4HH4A 4F6RB 3OZUA 1AKRA 2QTZA 2W42A 2WFZA 1RNLA 3RC8A 1G5RA 2RGUA 3E35A 1GRNA 3KB1A 3G6WA 2P2LA 1W6RA 5DNAA 4A6EA 4E4YA 3FZNA 4O25A 1IY8A 5KBYA 4HEA6 2HCTA 4KR0A 4BPBA 1Y82A 2FLKA 3BXFA 3NIDB 3SE7A 1XMXA 4B73A 3E5NA 1X8LA 2PZKA 3UHOA 4GBGA 1RI3A 2VLIA 1L5OA 2ZIZA 3N2EA 1LJ8A 2NUTA 1XEXB 4BGUA 1LFAA 4YHHB 4JI0B 2ZZNA 1PJZA 1QANA 5EFOA 1I4EB 5G0TA 4PWZA 1IJBA 2WHQA 2XQKA 5GJVC 3AW9A 3IOBA 4KLCA 3FMFA 3R7WA 4CQMD 3KPUA 4YFYA 4A4DA 4N3GA 4Q1BA 2JW5A 3LOPA 2I7XA 4H60A 4TTIA 1R0SA 3JQAB 2Z2YA 2GBIA 4PHCA 4IFTA 4RXTA 3H1EA 3PC8C 2VPYA 4FINA 3BB1A 5E1DA 5C1DA 3HN7A 1OLSB 1WKCA 2PFKA 1XN1A 4WW0A 1TCBA 3QBJA 4NMMA 2FJ0A 3ESXA 4IFBA 3TQFA 3TPCA 1OJ7A 5CG2A 3NEAA 4DBLC 2DWUA 2J5BA 2J09A 2QTCA 3OG9A 3W1VA 2PWAA 3FYTA 4XAQA 4QDKA 4CV2A 1K63A 2ZRLA 4CR6A 1M6EX 4FOSA 3WYEA 1FA9A 2BEUA 4R05A 3ZY6A 3F9CA 1OFVA 1SCJA 2UAGA 1MNQA 1YB5A 1THGA 2XY4A 3D6NB 3ZKWA 4EEZA 2B36A 4LOAA 1RW4A 4R8KA 4D9HA 1AQNA 3O7MA 3IL2A 4XKJA 4A2CA 1HYHA 3FMPB 3SN6A 3DW3X 5C4GB 2PRSA 3OZCA 2Z8XA 4ZCIA 1RRVA 3KD3A 1GSHA 4J2TA 4OSPA 3FOZA 1P0MA 3P9NA 3VJLA 4DRYA 1SHLA 3PXEA 4A6XA 5AK6A 4FN4A 3TKAA 3A10A 3CF4G 3KVNA 1Z7EA 3BG5A 4LRSB 4PZZA 1A9TA 4BBPA 3Q2IA 4KB5A 2WEKA 2XWQA 1GFWA 1W0KD 1WQ4A 3NRBA 5UKDA 4II7A 4I3HA 621PA 2JNWA 4GP7A 2B9EA 3TVTA 4L4ZA 5EUQB 3ZD6A 3PRKE 5A4AA 1VHLA 3VFDA 3RYCB 1J7JA 4L4UA 4KODA 4CKWB 1A9ZA 1BJRE 2H1SA 5EP2A 4W82A 2PFGA 3B36A 4B0OA 4YUVA 2ZRKA 4IQ8A 1ZUHA 5BN5B 2GGSA 5I9BA 5LZ9A 1KJJA 3AHJA 1QWSA 2FEOA 2W6PA 3OX1A 4ETWA 2Y6VA 2QMZA 2YWBA 1FPMA 2ZS7A 4NU5A 4KWTA 2FWIA 1ZITA 3B38A 3KYCB 2VLBA 4C7OB 2ZYUX 3HU2A 4FCVA 4P35A 1PDVA 4Z86A 1IQPA 2NOAA 2BBTA 1HDRA 4PC6A 4YACA 3HGTA 3FNRA 4MVJE 4MK4A 4JUBA 4RHFA 5AJVB 3GZJA 3L6OO 4IW3B 1Z6YA 2ADOA 3AERB 1JEOA 4EX7A 2D0DA 5EWJA 3VNRA 1IJFA 1UZNA 5IJ0A 1J8DA 4GM1A 1O3YA 1QPGA 1TCUA 1CEQA 3CO0S 1R2QA 2HSDA 2APJA 1DADA 3KZNA 2FEPA 3GJZA 3QVXA 5J63A 1EX1A 3D54D 1I3LA 2HJRA 2ZJBA 1BHSA 3OEYA 3WGKA 4IDEA 3T7EA 3RRMA 3JWEA 2G36A 3ZE7A 3PCXA 4I19A 4UEQA 5C5DA 5C81A 3GVPA 4X5OA 3S27A 3Q72A 3V42A 3V48A 4BY9E 4D9NA 3QPUA 2Y0CA 1DOZA 3RFUA 5FNVA 4GL2A 5G3YA 1OASA 2X41A 5SV2A 4AXBA 1UDXA 1CE8B 2FRDC 1JTFA 5I7SA 1LJUA 1Z4KA 2QL9A 4YH1A 4BWYA 1SCBA 3RSSA 5DGDA 3GZNA 4X97A 2AKYA 3KZCA 2V7GA 5A0FA 3ZNQA 3E9QA 2FWBA 3ZDYB 2CVZA 3R3YA 2IW3A 2F8SA 3PQCA 3C3JA 2XV1A 4YP5A 3WR5A 4MKXA 3ZHXA 4DT1A 1XZQA 3HUFA 4JP5A 5FLEX 1UBEA 4LOHA 1GARA 5EQJB 3O4HA 3FCCA 1NATA 2VYCA 3JQFC 1QFJA 1KJZA 4R8MA 3G2IA 1JHVA 4D26A 4QT0A 3JASB 4JJ8A 4RC9A 4RIIA 2OD7A 3W5SA 1KOFA 4G9BA 4NK5A 2BCGY 3BC1A 3P2OA 4RLFA 3DR3A 3M70A 3BZWA 2BFMA 4WPGA 4KHPB 4M88A 4O4IB 3MS4A 3FXAA 1GFZA 1JFFB 2MINB 4NNOA 3Q0IA 1R18A 4GOKA 3RK1A 4KWHA 1YB1A 3HUUA 1U3TA 2J3MA 2QP3A 3V1LA 4ZZ2A 4CMJA 5KNBA 1Q6ZA 3LYHA 4HQLA 4Y18A 1E1KA 1DIAA 1UM9B 1SAYA 4IBOA 3D81A 2GK6A 1Q2XA 4KGDA 2B83A 4MMZB 4YROA 4BNLA 1KO1A 4MPTA 3DM9B 3TYXA 4FOTA 5AJUA 3VKFA 1J6UA 5E3HA 4JMPA 2GETA 3K2QA 3ZS9A 1CF4A 3AK4A 1CQJA 2O8NA 3PLNA 1XVUA 3KL2A 3ENKA 4LI0A 4DDMA 4DFDA 4ZGBA 5EGNA 4GXTA 3C98A 3A9SA 2QGNA 2WG2A 3IHKA 5CB8A 3TXYA 1DBRA 1U1FA 4JBIA 3UN1A 3OQVA 5KUTA 3AFMA 4KDCA 1CS0B 3WK4A 3EWSA 3ST7A 3I58A 4DADA 1ZM7A 2ORED 2H8GA 4RK0A 4OHMA 1ZIYA 3ZWVA 4MHOA 4MVJG 3TSYA 3TKYA 1AZLA 4LMAA 4CKCB 4IFIA 3B89A 3S1LA 5K45A 3IX7A 1NY6A 3GNLA 4TKUA 2LBPA 4EABA 1RYMA 2JHFA 3VISA 4KO1S 1V3TA 3GY0A 5LOVF 4YDRA 3MPOA 3AI2A 1WAMA 1EE1A 4KCGA 3KKKA 5CT5A 4DABA 1DQZA 3TDKA 4JYZA 2BD0A 4JC0A 4U7DA 4XEHA 1C8LA 3NHPA 4Z99A 2F7SA 2LKCA 3DMTA 5GMOA 4EIWA 5JNUA 3K73O 4R1QA 5KX5A 1W36D 2WILA 3T7SA 4BO0A 1OILA 1RR6A 1N36B 3AONB 2KS6A 4RY9A 3P4YA 1MJGA 4IWXA 3LUCA 1UMKA 3AUJB 4AO7A 2W6QA 4WXRA 2WHYA 4RIFA 3WP1B 4HNVA 4ALIA 5AIBA 1BOOA 1UKEA 1UMCB 3EGVA 1VCIA 2O4CA 1YASA 3NOOA 3OCUA 4B35A 1G66A 4F72A 4F4JA 4LUCA 2OWDA 3QEOA 1T0PA 3IVAA 2JBHA 4DCJA 4HQ6A 1NU6A 2Z2XA 3QNWA 2Z9DA 5AO9A 5AW4A 4PCLA 1HDEA 2KWIA 3OT5A 2V98A 4XCQA 4BYGA 1W2GA 2I1LA 2O0LA 1XD2A 1G8FA 2J85A 2P77A 4YDQA 2WAOA 1GY8A 3QKUA 1M75A 1PG2A 3DHWC 2HMWA 3ITNA 4CKXA 4CHTA 4C04A 1ISHA 3UAZA 4BMVA 4F2PA 5LKRA 3LOUA 5KQLA 6ADHA 3CB2A 4FHGA 4KYUA 5JNRA 3FY4A 3JQQA 3D2CA 2Y05A 3GA0A 4IM7A 4QU5A 1W581 4PZ9A 4Z1MA 3VVCA 4BFUA 4Q9DA 1Y4SA 5CBPB 1SULA 2IPXA 3N8DA 1M2OA 4JSTA 1U4OA 4J49A 1E5DA 2VYND 1V71A 3V1YA 4FFNA 5D01A 3WDKA 2B34A 5DN6D 3GP5A 2X2PA 1WBJB 4KN9S 1FUEA 4PYIA 4CMHA 3FYHA 2EP8A 1V5FA 1U3DA 1A5ZA 2J48A 4MLZA 1D0SA 3Q6MA 3ZZMA 3P2IA 4AMGA 3G2JA 1KHHA 5EFZA 3WB9A 1IG3A 4P7JA 4GQBA 2RE8A 3JALA 3ENVA 2IZ6A 4K6MA 1KMQA 2B20A 4NYIQ 3CVUA 4FDMA 4KNWA 4AIRA 1KHTA 4J0KA 2A59A 2ZIWB 2VS1A 2ZRAA 1QCDA 2FG5A 4AY5A 3ETDA 4GT1A 1VHDA 2DPGA 2V7TA 4IWNA 4L4RA 4D4KA 3W2EA 4EJFA 1I7PA 2OZEA 2ZRDA 3BWXA 3JVIA 5KYVA 3N8HA 3JATB 3R5FA 3A2LA 2IBTA 1PFUA 3WKEA 3KDPA 1MO6A 2Z6QA 3ZGNA 4H2DA 1QR6A 1K5DA 1PD1A 2FEAA 3S0JA 5K99A 1WSWA 4S24A 3ZXIA 4TRNA 5HP4A 1CZKA 3AR8A 1Q1NA 2J7PA 3BFJA 5J23A 5H3CA 3IRVA 3FCAA 1V1JA 2XWBF 3BCUA 3TDMA 4Q3LA 3VNQA 3WLKX 5B1EA 1KNXA 2OD2A 3VPFA 4IIVA 4XQ0A 2WE8A 2CCGA 4LGCA 4W1RA 4C4XA 4QHTA 1ADBA 4UZFA 3PFHA 1PSDA 3WS7A 5EIOA 3W2TA 4MCJA 5DBIA 4Z2AA 4KXFB 1NFRA 1D6NA 1R5OA 3GRYA 1JLLA 2HR1A 3QE4A 2Y1LA 1Y4DE 3GUCA 4LHSA 3NYIA 3UK7A 3DMTC 3ZCVA 4RESA 4TVOA 4HK4A 5GGXA 4OM8A 1QC5B 4XGNA 3KQKA 4LE1A 4UZEA 1B2LA 1C0LA 1EX6A 5J4HA 1FK8A 2Q45A 3EWNA 1T0JB 3R20A 4YCLA 1FSPA 1RXCA 2IYTA 1OOEA 1DC8A 5LD2B 4CMKA 4L5JA 3BGSA 3FPBA 3BIWA 3LM8A 3IQEA 1JR6A 2WIDA 1O5OA 1S2DA 1YJBA 1V16B 4MKRA 1NBME 1PZEA 2BZGA 2E21A 3ZLJA 4JT8A 5DHUA 1Z0FA 4L07A 1J1ZA 1G19A 1SZPA 2VAVA 1LX6A 2ZUUA 1GQYA 4OQLA 2IYNA 4TMTA 4DV4B 3TTSA 3S2UA 1BW9A 2VP0A 2CMHA 3EUAA 1S8OA 3OM1A 4GXQA 5AUOB 4EGJA 3ZK7A 5HIAA 3CVWA 1HR0B 1BQ4A 2CGEA 2Q6VA 3HUEA 1WVGA 2JDID 2WM2A 3TBFA 2YDXA 3FPLA 2YHAA 3W9YA 1IUNA 4FMCF 1ABBA 1OXXK 3F7TA 1G8AA 3E4DA 3IT3A 3LQYA 2VDVE 4ZO4A 2Q4EA 4KMSA 3KKOA 4ENTA 4CI0B 1XZDA 2HWWA 1YMVA 4EY7A 5CP8A 4IRXA 1UJ4A 2Z98A 3BSFA 1OH5A 2P2YA 1XAHA 4FVTA 4MO9A 2FPMA 3P9IA 2EERA 2A5GA 2FKAA 3X3HA 1MJNA 1WW2A 1IUOA 1GHTA 1NX9A 2SKCA 2XMPA 2FGKA 2GEBA 4MARA 3K31A 3CA8A 4IRMA 4ZRNA 2P9JA 2Z1NA 2MSKA 1JHDA 4JBXA 4XEUA 3ZDQA 5IVPA 1B73A 4DMCA 2P6NA 2PD3A 3AOGA 1FYWA 1AN0A 1DUIA 1XROA 1QONA 1RBQA 2DBZA 3CWZA 3FFBA 4DW8A 1JUDA 3A7EA 1AHNA 3MTBA 2VHVA 4ZK6A 2QD5A 3ITKA 1VCHA 1CUVA 4AZSA 2RI0A 1ZQ9A 1DEKA 5EJ8A 2QM7A 1L4YA 5CD9A 2CEKA 3FCEA 4DY4A 2W2VA 3QHPA 1OU0A 1W29A 2I6UA 2IHZA 3H2HA 2W43A 4JEIA 3QUAA 4J0GA 4P3XA 1M76A 2B61A 2F2TA 4DN6A 3IILA 4F4IA 2QNIA 2OHGA 1K7CA 1PFWA 3UBMA 1KVQA 2PLRA 1IY9A 5JAUA 4UVEA 5AHRA 1NC1A 4U6QA 5ITWA 3BK2A 2P9QA 4HS4A 5G0SA 2HF9A 1OC2A 2JFBA 2KMLA 1ONSA 3DCYA 3PEEA 1MW9X 1JG7A 5FFMA 2EATA 4B8YA 2YYSA 5B36A 2OPBA 4QJ3A 4TV9F 4TUYA 5IDVA 3PZBA 1DARA 1TJPB 3ZCRA 1KEKA 3LDGA 4C6HA 5HCUA 2LW7A 4MLCA 4OAPA 3NAZA 1XMJA 4P98A 2PANA 4R6XA 4GM4A 1M2VA 1SOUA 2R6DA 4K8OA 2YJ4A 4JELA 1P0CA 4C6TA 4A36A 1P2GA 2BFDA 4B7UA 1HUQA 1G7SA 3ZI0A 1ESCA 5DHQA 5AM5A 3R75A 3GLIB 3QA9A 1P9NA 1KI4A 3KYDB 1P9OA 2ZUVA 3QELB 5YASA 3CZMA 1HNNA 4NKRA 1ESEA 1RI1A 2BZ1A 5F21A 4YAKA 2VJAA 1JIKA 4L5BA 2QQFA 1AV6A 2OVBA 4LOJA 1JHYA 1HC7A 3T99A 3WIVA 4A03A 2XNCA 1H3NA 3DAPA 3GDHA 3BEOA 2PMEA 1ZZGA 5SY9A 4D6PA 3FNQA 4RX1A 3AEXA 5B64A 1HFKA 3KELA 5CMLA 4I66A 4P32A 3D6UA 3TAUA 4EF5A 4NC9A 5CA1F 1BA2A 2BGKA 2PH3A 4XPZA 3I62A 5IM4F 1OFUX 2QQ5A 3MTQA 5TGDA 1JKFA 3SYTA 5BT8A 1N4DA 2Y68A 4I3GA 4LECA 2VK1A 1VYVA 5KWIA 5LR6A 4L1KA 4X62B 2VRCD 4E13A 4AQ7A 1Z5VA 3BIJA 3IP3A 2AG1A 1J23A 3DD5A 3L7CA 3QX7A 1NNLA 5FBLB 3O74A 2QV7A 4ZQEA 1OB2A 1PT5A 2J3KA 1EBUA 4XLLA 3ON5A 1D07A 3D8HA 4R16A 5JTUA 4D0NA 4DPLA 1NU8A 2XCSB 3BMCB 3K15A 3RH0A 2CNNA 3NOXA 5JQGA 2L19A 4W7HA 4Q9HA 1ONNA 5DLPA 4P7FA 3EZXA 4C0SA 4ZI5A 2XQIA 3AZQA 4BNKA 1X1QA 4NVRA 4HT3B 2EX4A 1JMVA 3W6ZA 2JIZA 2L17A 4X7PA 5A5FA 3RKUA 1F2UB 5FUYA 2I66A 4LF4B 1NKSA 1BEUB 3NW9A 2Q9CA 1XLWA 3H1BA 1F2TA 4B6EA 3ROQA 1NW9B 4RADA 2O8DB 3B9BA 4ADSG 3L4SO 4XWYA 3IDAA 4B79A 4C0XA 5K5EA 4OYRA 2GT1A 2QN8A 1JSLA 1YS2X 1VGRA 3EJ6A 4N18A 2R6JA 5CEFA 4RVSA 2JGIA 1E2FA 4LS3A 4DSUA 1R15A 1YQDA 2MSNA 4H35A 2J8ZA 2HWKA 4G0XA 1P9LA 3LDAA 1DU4A 2EYQA 1CQXA 3PPIA 5MF6A 1P7PA 4RCVA 1NVFA 1NVVR 1G3UA 1TL7C 4L15A 1SIOA 3D6FA 4CQMB 1JA1A 4JLMA 2A94A 3NJ4A 1NQXA 5EKTA 3ZUPA 4TS3A 5ERGB 2B7CA 4IDQA 5EHZA 2XUKA 2O8FB 4FGSA 4LJYA 3BL6A 5DW3A 2HA0A 4I1RA 2R1VA 1S9DA 2CXUA 4G41A 2VO1A 2RGAA 3A1DA 4LMRA 3ZOKA 3H9CA 4CG2A 4XX1A 5F3WB 1AY0A 1CUAA 2W2QA 3L7BA 1LDMA 3CISA 4PYRA 1OJLA 3OHSX 1CETA 2HHHB 2FG7C 1RLIA 4P4GA 2W2MA 1J1IA 1PV2A 1BN7A 3MMPA 4H0FA 4YP6A 3WQSB 3G79A 3LGAA 1E0SA 1Z0UA 4P53A 4OL9A 4Q1AA 1RKUA 2X5JO 2E82A 3QW4B 4BNTA 4EO7A 2G25A 4XA8A 1OXVA 3I9OA 3DFZA 1JG6A 1POXA 2JJ1A 4KKVA 3D0KA 1P1FA 4IJ5A 4RUKA 1CJCA 2ZBQA 3VMFA 1FDRA 4RBNA 4UHHA 4UM8B 3U49A 1XTKA 1DIOB 1NI4B 1XVIA 1YCFA 4DBZA 4J0FA 1IPHA 5I3ZA 2VXCA 3F74A 4NAVA 4PSAA 3X2EA 3WGOA 1J5XA 1Y6GA 4OXKA 4AG5A 4EM6A 1QG4A 3PGJA 4B2PA 1NVAA 1PE0A 5ECGC 1G2OA 3DLIA 3LSYA 4R4JA 1IUKA 3VPGA 5KNDD 2AD1A 1ZBDA 3F2IA 3H6HA 3SQNA 5HDQA 2RBEA 1T8WA 1NXTA 1TKCA 4JLKA 4YQFA 4K6FA 5A5GA 1SEVA 4AJ9A 2GZ1A 1XUOA 4TV9A 2DHDA 2A5LA 1W49A 4G0OA 4MA0A 2ZK7A 5GINE 4ALLA 3QBEA 3R8XA 1E2GA 3OOSA 2X7HA 4HGOA 2GPWA 2XSZA 3R3ZA 4KN5A 2QXTA 4Y2XA 5D5QA 1G4AE 2CDNA 1QLJA 2Q5FA 4ND8A 5G02A 4ZCMA 2RKBA 3LA6A 4MVXA 4ZREA 2ZIAA 5AJXA 3CB4A 1RMYA 1CIVA 4FXPA 5SYMA 3IP5A 2K6GA 2QTBA 3DKRA 3UO8B 4UUAA 3ZU3A 3KAJA 1U94A 4PE5B 4C7JA 1AOXA 4HEHA 4BQFA 1TVEA 1C0IA 1E2LA 3UGKA 3THWB 2FGJA 3QBVA 5KTRA 4HYQA 3UMYA 2G9VA 2R8BA 2DGDA 2V6BA 3ZWCA 4YUYA 1OH6A 2AZ4A 2PXAA 2IZ5A 1WCXA 1QQ7A 2Z8YA 3RRYA 1SA0B 3U60B 3T1NA 3WP0A 2C99A 2C88A 2FU5C 2HJWA 3MMZA 3SXJA 3H0KA 5JCPA 1XZJA 2E4WA 4UOEA 5JT1A 3DDNA 5EKUA 3MS7A 2COEA 4S1VA 1CZUA 2EBHX 1NXSA 1OPXA 2FWPA 2VPXA 4NE2A 3E4CA 2Y1EA 5IM4A 1AX9A 3L7JA 4GOXA 4E03A 1JAIA 1HV8A 4GYKA 1VRCA 2K2WA 2NADA 2XMSA 3FHJA 4QSMA 4FSDA 1O8BA 1K3UB 3FOWA 1GILA 4G9EA 4W5JA 5C8YF 1M2NA 3BKWA 3CNHA 3PFIA 1RAGA 4PGAA 5K01A 1DG9A 1KOJA 4NNPA 4QNNA 1R8YA 1T6BY 5SZHB 2G6BA 1F60A 2Z83A 1ECJA 1GTRA 3CURA 3ADCA 4NBWA 4XFDA 2CHUA 1EUCB 2IL1A 4D0RA 1QB7A 4E51A 1L5RA 1D4FA 3R3VA 2ZSHA 1UIMA 1N2ZA 4FIZA 2D7DA 3WRYA 1JH9A 2WYUA 3ND9A 4DQKA 1I2CA 5I4IA 4C0LA 2JG3A 2H29A 3TEFA 1ZH0A 2EFGA 3D4LA 2C1ZA 4O4JF 4B45A 3VKHA 1WDLA 2YINC 4X1YB 1Z2OX 3VH3A 4DCOA 2OCIA 1P0QA 4CKEB 2Q1WA 1DFHA 1HE1C 1L6RA 2C0QA 3MUEA 4C76A 2QUBA 3I61A 1G59A 5G4KA 4P4NA 5JBIA 1CV2A 4M0EA 4FQ8A 4PCAA 1HH4A 1I3OA 2AXPA 3DD1A 1MABB 2LGJA 1VSQA 2BC9A 2GD2A 4DQXA 3WL8A 4QUAA 4DEVA 2CDBA 1EGMB 1UBHS 2XOKA 2G80A 3WLEA 1GZDA 4Q05A 1KDZA 2GZ2A 4PFKA 2QUKA 1EH5A 1QCZA 3SJAA 4KBYA 5CEEA 5JXWA 2QI9C 2DR0A 4LN1A 4YJGA 3T7RA 3ZV6A 1B8PA 3EE6A 2H52A 3KNZA 2IHBA 4FX5A 2PKXA 2NM0A 1UEIA 2F1OA 4X1KA 4XYMA 1M1YA 1NQAO 5LYYA 4D56A 1DEHA 3HYSA 4F2HA 4IKOA 1MLDA 5C7IO 4FKBA 1T3LA 1UWLA 2FX5A 4WZAA 1YBVA 5LLDA 4J1QA 3K0FA 2XHEA 1YU6A 2H3EA 2P7HA 4F93B 2YBDA 1RWXA 4NTZA 1NWHA 2FXVA 4QVIA 2A9QA 1DXOA 1WCIA 2P3LA 1EFDN 1JBKA 2JFGA 3PFWO 2ARKA 4FYJA 2ZDGA 3SIRA 3FOBA 1NGSA 2EKLA 3CPEA 5FCDA 2OV6A 1HI9A 3CRRA 3G0BA 3PDUA 3QI7A 4KAFA 3S2ZA 1Y9AA 1O1YA 2FZ5A 2DE0X 4KFSA 5GIPE 1HKHA 2JJYA 1VP3A 3HXKA 4G0MA 4TRMA 4UE3S 5EZYA 2VQSA 1QCYA 5K0GA 3KUDA 4RHUA 3SHFA 1J2TA 2C5SA 1K92A 3OEEA 1MHPA 4IQ0A 4YCMA 1RPJA 2WB2A 3LC2O 3O8QA 3IVMA 1IXZA 3Q7SA 4G5RA 1DIHA 2HRDA 2MHCA 3PJEA 3CPHA 3RLFA 1U63A 3RV3A 5J2UF 1KORA 4BKRA 1FVXA 1QBKC 4RFLA 4YRSA 1W36B 4HJXA 3TTVA 4EPWA 3DMGA 4TX1A 1WJGA 3DTVA 5H9WA 3OU7A 5JXJA 4R1MA 4ESOA 4WLVA 3Q2OA 4QYMA 1L1QA 1G21E 2X40A 3EVGA 2G08A 3COVA 2H57A 3IVXA 3OE5A 5ALJA 4D4MA 3CLUC 3X1KA 4Z9YA 5HBGA 3CZQA 4HXYA 4FQ7A 3E5RA 3EGDB 1NHWA 4ARZA 4DHWA 4AQYB 2I0FA 2UU9B 1YFJA 4UJ5A 3D7KA 1IXRC 1N1GA 2OGSA 2VH2A 3QFRA 4EGAA 3CZ4A 1O96B 4UM9B 2QTTA 3OLYA 2IU3A 4MWZA 2GZMA 2MIIA 1A9SA 1KO8A 2VDLB 3CLTC 2Y2UA 4E5YA 4QLOA 2ZRCA 2C82A 2ODQA 1RPTA 4KNYA 4D1YA 2DLCX 3D8NA 4LDNA 2VQEB 2RGYA 3WRYC 1GKYA 1ZD3A 2CSUA 2QS9A 4RF3A 3ENQA 5KDLA 5SY6A 3DTNA 3ROPA 4DJ5X 4MMXB 1J8VA 1WSBA 4Q4DA 3EZYA 1SUEA 4EL5A 3C6XA 1FP1D 1H9CA 5F9FA 1UPUA 2CXNA 3B1ZA 4IVRA 5BMVF 1PJBA 1KZ9A 4K2AA 3VNVA 1SO8A 4J0JA 5IDWA 5CTJA 1QGAA 2PKCA 5BMOA 3K4HA 4IQFA 2FSVC 3KU4A 3RFFA 3BMNB 5C8YA 2QMUA 3Q12A 3TR5A 4DMHA 4ZO8A 4XI9A 4CM7A 1MJGM 1MRSA 5SZKB 3HLKA 1OBOA 1NOJA 5DHPA 1NW6A 3L7DA 1RRPA 2ERCA 2X42A 1LU9A 1FVHA 3G5UA 4ICIA 4MR9B 1UPBA 2GRAA 2W8BA 3GYBA 1I7DA 2PUGA 2XZTA 4PZPA 1OHHD 4C87A 4GL4A 1ZKMA 4ZJZA 5CA0B 1K4KA 2QZSA 3GELA 2JD2A 2OGWA 4R7GA 1ECGA 3SBEA 1AGRA 2X6RA 4ED9A 3UT5A 1C2YA 2ABWA 5BYBA 2GBGA 2XQJA 2AV6A 3IV9A 1JAZA 2VAWA 2JI8A 3PHIA 2PMWB 5A7GA 2AFIA 1B0UA 2HA3A 4Z3DA 3EG9B 1GTMA 4O4JA 3W8DA 4D8UA 4X1IB 3OFND 2GNAA 4TKLA 2IYOA 3ZQJA 1X14A 1YJAA 2I62A 3GUYA 3P27A 4KK3A 1E0AA 1UJ2A 2ZB8A 1ORWA 3LY8A 1LSUA 2FMIA 4GEKA 4HRVA 4NMLA 4JI8B 1ORVA 3J7AC 2FX3A 3H9UA 4NAHA 2H08A 2XW6A 4WUTA 4PAQA 3SBXA 4L74A 4J1SA 1HURA 4BS9A 2PXXA 2BHLA 2PO7A 4CF7A 3HO1A 1UAGA 5TDHA 4Q3OA 2YZKA 2G88A 2JAHA 2OGUA 1Y8QA 3S8YA 1B2RA 1HORA 5AVXA 3BVPA 1X42A 1VHQA 2IT1A 2FV8A 4JBGA 2ZB3A 2Q5OA 3WKDA 2DB3A 3QQ5A 3TRIA 1WV0A 3FLEA 4G07A 4KXLA 1NJFA 4X91A 4BNNA 3O2NA 4DDWA 3PUXA 3C3PA 3IB6A 3STXA 4IIUA 1RZRD 1PVOA 2P4SA 2DPYA 3FTNA 5F9HA 2WSYB 4Z53A 3IEUA 2I80A 4ODIA 1S4QA 3THYA 1SOAA 3R4CA 3U7QA 4AJ1A 4ZN6A 1WXFA 5AUNB 1DXYA 1JDNA 4XQCA 5CVCA 5KHAA 1UINA 5J59A 2XNHA 4ZYYA 1W75A 4XGQA 1RBYA 1J49A 4O3FA 5BR4A 5AW8A 1SU8A 1ULHA 3V2HA 3L8MA 3OKFA 2QF7A 1XTQA 3OLQA 1K6JA 2CF6A 3MA0A 4I1IA 3EZ2A 4NU6A 3RSOA 4FFBA 3A36A 1I9CA 1YA6A 2HV8A 3ED5A 4MPPA 1YQ9A 4IMRA 2G04A 1T26A 4V03A 3ELBA 2NVWA 2QRHA 2JLUA 3WMGA 3FLMA 4S0XA 4ECAA 2H3HA 4M6WA 1NLYA 1PNVA 1Y89A 5T4FA 4AS3A 4FBLA 4FX2A 4C07A 4RANA 1T0IA 2IEBA 1URPA 1V7CA 2BI7A 3SSNA 5JCXA 1LC3A 3TTXA 1BN6A 2HMSA 5IEJA 1CNFA 5J2UA 4FTWA 4V39A 1NP6A 1TQHA 3CF0A 5JAOA 3GLUA 2AYXA 3CJTA 4N6GA 5AKGA 5BSGA 3EUEA 1S2NA 2ZB7A 3DL0A 3RB8A 5K3AA 1JR3D 1RLTA 3EVFA 3PDCA 2FXIA 4IRUB 2GBFA 2PT9A 4BNFA 3AESB 5HFJA 4KZPA 4R51A 4ZVUA 1N7JA 5AYVA 1N8NA 3EVEA 5FHRA 3UYKA 2WUGA 1NXXA 3DE3X 3GLFE 4F45A 5G40A 1C81A 3NBFA 1G6KA 3FDFA 3L01A 1QKKA 2I4IA 3RRXA 1XFDA 4I8XA 5FPHA 3G8AA 3BILA 5BQ3A 4ND6A 3Q3CA 5B2ZA 4QUGA 3S1SA 2QNBA 3SAJA 3FHLA 3D3EA 2HO4A 2RAPA 3I1YA 1KVRA 2TMDA 3UK2A 5ILOA 2F43B 3EPHA 4RTOA 3ABQB 1H8HA 3E7PA 5FTJA 1B26A 3LGXA 5BXQC 3T4UA 3CKLA 1A88A 3GRVA 3ROGA 1XZIA 2BGTA 3RRFA 1CJTC 3GK3A 3CKYA 3IAM1 4FU0A 1IN7A 1R5NA 2EP7A 4CKZA 2LTAA 3PFGA 3NTLA 3SBDA 5HJEA 4JJGA 3WDLA 5EJMA 1BCRA 4JP8A 4QGHA 2G3YA 1XEAA 4RTJA 5IKMA 1M10A 1MAHA 3PPVA 3ZYZA 1M2KA 5HSGA 2CLFB 1E1QA 4KQ6A 4B9AA 3DKKA 2H4FA 1I01A 4NV0A 4EB0A 1N5MA 2PYDA 3OIWA 5ANRB 3E8SA 1QE5A 3Q9LA 1E7QA 3KDSE 1P29A 4FS8A 2GJKA 3AVWA 2DAPA 2YX1A 2G06A 1L8AA 4PQRA 4PR0A 2CVPA 2EDCA 3KQSA 3PP8A 5SZIA 1Z08A 3S4YA 1AMOA 1JLHA 3BJMA 4BZPA 2B6HA 3QMPA 1TIPA 1ADFA 4GAEA 3W6UA 1XZNA 2IOFK 1IXSB 2YMQA 3WMRA 1DJLA 2WU4A 2OUIA 3AI1A 4ND7A 1G64A 5HKKD 4TMZA 1QFYA 1V1MB 5AJTA 1E4EB 1E94E 2C3MA 3P2JA 3ILSA 3L1HA 5EEGA 2VRNA 5JO9A 3REFA 4DSZA 1Q1GA 2PA0A 4MUGA 4WNIA 4E30A 5C8XA 1YZNA 2J07A 1JWBB 4EA7A 1PQ4A 3F6RA 2AZXA 5ESXA 5FV7A 1L7XA 1AUXA 3E7WA 1DJOA 2I55A 2A92A 2I3ZA 1G9TA 2LZ0A 3RTCA 3BAFA 4OBBA 2CB9A 2NO1A 2PLWA 3DDZX 3TG8A 1PKXA 5K3FA 3A1UA 1L8OA 1W1IA 3P4UA 5B1HA 3T1VA 3VO8A 1E5TA 1PU2A 3NXSA 1MZPA 2Q1TA 1CNMA 2VK2A 3CVOA 3ZDRA 2P6MA 4PX9A 5DTJA 4QTYA 2DWOA 3OP1A 1O95A 5LXTB 4QUBA 3UEOA 3HNOA 2XT0A 1MN6A 2W83A 4H4CA 3PIDA 1RYFA 4WVLA 2PX4A 4YFVA 2O2XA 1VE3A 3RG8A 1EVQA 5IAKA 2QD3A 5DTQA 2IS1A 1OI7A 3R3WA 2XDWA 1EEXB 1NLZA 5LA6B 2GPJA 1K3FA 2R8OA 3FI0A 2UUBB 1O58A 2UYCA 1L8QA 4HDRA 5DHFA 1P7ZA 3LI2A 4RY2A 5EPEA 3ZJYA 4KXXA 1XAGA 3QKSA 4WY8A 5D6OA 1L7MA 5E3IA 2OR3A 1QTIA 1T29A 2QYHA 3FJYA 4JJ6A 5HGXA 1J0XO 3G7UA 3WLPA 5DTMA 1RBZA 1Q16A 3K0CC 4O6VA 5AKZA 4OG2A 3DQQA 5DHTA 4N8EA 4P54A 4G0WA 1LNSA 2E0IA 4WGGA 5DXFA 3WWOA 5INTA 2Z0MA 2E4XA 4RF5A 3ZGZA 1W2WB 2LE0A 3I3OA 1KZHA 3OJOA 3VYRB 1AQUA 4ZVVA 1P0IA 3VDQA 5FPKA 2F3SA 3H9GA 3N2LA 3RK4A 4YT2A 1PUIA 3F8TA 1QGDA 2QX7A 4U8GA 4CGYA 3PI7A 2V0GA 2CLOB 3G5MA 3HXQA 4ALMA 1RQRA 3P9RA 5FWYB 1WCYA 1PZXA 1YQGA 3RBXA 1JIXA 3LTEA 3BYZA 4IJKA 3T3IA 5C5EA 4TT3D 1GPLA 8MHTA 5F77A 4BFTA 4Y6RA 2JK0A 5SYAA 2I71A 3SM3A 2IKQA 5IARA 4EG7A 2PU5A 2Q3MA 5LQDA 3CF2A 2EGHA 1DRWA 3E9YA 2DFKB 1SCUA 1WB5A 3IERA 4M1YA 3PEYA 4ISBA 1QV7A 1CU1A 2DWPA 2MJLA 3OLCX 1EX9A 4KAXA 1AG9A 2CL6X 3MD9A 3GAZA 4LZPA 3DBHB 3WLAA 4L3OA 1RHKA 1NW7A 4HATA 5AOVA 3PJDA 4D3XA 2I4LA 3GRRA 1II9A 4X61A 3W5UA 3W7VA 3DE7X 2WTUA 1PR6A 3FNHA 3AH8A 1KYVA 3EZ6A 1U8TA 2WE7A 3TLCA 2YJNA 4TXHA 1R3DA 1EAYA 3GVCA 1KI9A 2F6RA 2Z6AA 1JQEA 4HAUA 4RKRA 1CFJA 3RIEA 4RFSA 2NT3A 3N28A 4GPTA 1QH0A 3IRUA 3QF4B 3EXFA 5FUVA 3SFTA 1XA3A 4B43A 4X94A 1YE3A 5HF6A 1WE2A 1XVAA 3THYB 3FYSA 2Q3FA 2H5LA 1I0IA 2AZMA 1QCCA 4NARA 3AVVA 1GPAA 3GRKA 3P4XA 4H3KB 3AR3A 2ZRPA 4FI3C 1MB0A 2BEWA 5DI3B 3QZUA 4E5VA 4BFZA 1YR8A 4PRZA 4AY6A 5ED4A 4HNQA 4LCEA 3FDXA 2P2NA 5LDGA 1A4UA 2EX0A 2HPAA 5KKNB 2NIPA 4XQGA 1EM6A 1GNTA 2XB8A 1Z75A 3PHBE 4HEA1 2JJ2A 3RUDA 2CL0X 2YMMA 2WWVD 3FKSD 1KAMA 3W1EA 5FWXB 2QAIA 2RHGB 3QY0A 4RACA 3KXPA 3T1TA 2VP3A 3TFOA 4LQ4A 3MTGA 5DV9A 3K09A 3KU1A 3WLTA 3LBYA 3REGA 1FUUA 3A26A 3TGPA 1S4MA 3HBJA 3LT5A 5KYYA 2QOEA 1U9JA 1TM5E 3DLCA 3L8HA 1Q92A 4XJXA 1KMHA 1XJ0A 2G67A 3BSWA 3S29A 1DV1A 3ZX4A 2XF2A 1K7YA 4YRCA 3ZHVA 4I8DA 2REQB 3TD6A 3IIMA 4H27A 5IAJA 1MRNA 3URMA 5K8CA 4KIJA 4AYWA 3PS9A 4PLZA 4EQ6B 2NO5A 2UUOA 4QUDA 2W71A 3K5WA 3GPCA 1NI3A 3OSUA 4EHAA 4L7VA 4EECA 4TLCA 5CNKA 7MHTA 3SF0A 3HI4A 2ZIGA 1HZZC 3M6IA 4LKOA 5EJ2A 4AO6A 3GLKA 3I6MA 5CUQA 4AYTA 4REOA 2Q9AA 4EMSA 1MQAA 2ZBEA 1Z88A 2QVYX 2DHEA 3TNLA 2CSXA 3VHXB 1HE3A 5IZ4A 2IH5A 1TEVA 4RJKA 4FLMA 1RWVA 4GR4A 1OX4B 3UY4A 5L7WA 2Z56A 5EJ5A 1SBNE 2X6TA 4UDNA 3HK2A 3V34A 1GAJA 2IXEA 1VKHA 2DC1A 4N82A 4X6XA 3HCFA 4JL5A 3JD2A 3GOQA 3SJ7A 2B2NA 1R5JA 3ADKA 3F4KA 2C3OA 1W4BA 1IFXA 1NBOA 1YQWA 3KKQA 4D8VA 5HS6A 1E4VA 3HFRA 3WXBA 4R1LA 1A8SA 2ODEA 1B41A 1YONA 2QA5A 1TVKB 4PAOA 5DLEA 2Q8NA 4BO7A 3LUKA 5E38A 2BP7A 4HGNA 3V46A 3MBIA 4U7HA 3TLGB 1V3QE 1UXGA 3VVLA 3N7UA 5TV2A 3AGQA 1RLOA 3OPNA 2G9NA 3ZBTA 3IJ5A 2EHJA 1RZVA 3NC4A 3JCZA 3NETA 4RV5A 3E5HA 3ZGVA 3PYLA 3H5AA 1K08A 3MJEA 1SK9A 2ZRNA 3AETB 5DMHA 1FFHA 3H0EA 2VDRB 3WIEA 2H16A 2J9ZB 4FUTA 2FP4A 1OZGA 2QN7A 3HDVA 1P2UA 3UG7A 4AUKA 2O14A 1MQ8B 1Q22A 5JRJA 2XNDA 3HCPA 1J24A 3OOHA 3UJAA 2D62A 1SHKA 3IHLA 5TF0A 3B9RA 5CFMA 3CIOA 1GPH1 3GF4A 3H9BA 4DAOA 1EDEA 1E2EA 4M7PA 4QXAA 4J1TA 4N5DA 1E92A 4URZR 2WMNB 2HF7A 4HAXA 1CD5A 4ZT4A 2OLJA 3ZXYA 4Z0HO 3P97A 4NONA 4AKSA 3PICA 2QBYA 3ZWMA 2O52A 1KI8A 2ST1A 2GAFA 4X1OA 2GXAA 3CNQS 1HF3A 1QJ4A 1V8ZA 2HYDA 3EDYA 4WOKA 2ZBVA 4R1TA 2BKAA 2YN4A 3KLNA 4G5FA 3VH1A 3CMCO 4RY0A 2TECE 1IONA 2PGDA 3R0VA 4Q1VA 4GSYA 5JI2E 2D2EA 3C43A 1WW3A 1GDDA 2NV2B 2JLXA 3U4IA 1V8BA 1CP3A 4CI9A 2C9OA 2FMHA 1DRJA 1SBCA 1E62A 1MQ9A 3ABIA 4O4IF 3OCJA 4UMEA 4X20B 4DLRA 1Q91A 2YFQA 3OFJA 2B92A 1MX1A 4D97A 4FFWA 1W4LA 1ODCA 1Z8FA 3DFMA 4TLMB 4DIEA 1YV9A 3W5CA 1KRHA 3K09C 1BS9A 3OH8A 3W6OA 4PSUA 5B5SA 3PD0A 3SKVA 2CNWD 1VMAA 3WNQA 8OHMA 1VCNA 1CUBA 2NZUG 2P5TB 1NM5A 1HDGO 2CNKA 3OOYA 3AT1A 4MUMA 2ATIA 1O6ZA 1WUJS 2BFOA 4XB2A 3WKAA 4EY6A 4J07A 3QMMA 2YYAA 4RZIA 5IAGA 2C8JA 4O5OA 1TLTA 5ALOA 1WZ2A 1DP4A 2BUAA 2PUWA 1DTEA 1VYTA 3G8BA 3IKLA 3RODA 2BJHA 3H5RA 1E6UA 5JOQA 2NWQA 4H77A 1YK1A 2RCNA 4D82A 3U81A 4I4TB 3VPDA 1RI2A 3A6LA 3HR4A 4J7AA 3AF5A 2ZCJA 3BXEA 5EUBA 3TQCA 4GBJA 4NYMQ 4OMDA 3UKJA 2BN4A 2FQ1A 4QJ5A 1HYBA 1W46A 1PS0A 4UEKA 1KFEB 3AR7A 3G2MA 1Z16A 2ZT5A 3L79A 2Y1CA 3B2NA 1GU0A 1HG0A 2AI2A 5IF3A 2YKGA 4HNAB 2FW1A 5HF5A 3NDPA 3R9XB 2XYHA 4LPSA 4J2HA 2VTVA 1BKDR 3D6AA 4LJRA 3H04A 4OHKA 4B0PA 1VA5A 1YI1A 5KAPA 1GNPA 2COUA 2CE7A 1BXGB 1TRKA 2ZXFA 2ZG6A 4BGIA 3T9FA 3X1ZA 3JAKA 1YB7A 4TPKA 2BM9A 1RADA 3FRIA 5TS2A 1ZRHA 3L2OB 4OYLA 3T3GA 4AJHA 1PDOA 2FF5A 4XXHA 2DVMA 3PUJA 2XD9A 4N0EA 1CUWA 4KOAA 4CEIA 2WAMA 2WJ6A 4K6CA 2JI4A 2ZI7A 3R6TA 3C3WA 4FILA 5F1YA 3U80A 3HJTA 1O97D 1Q77A 2DQSA 1TUBB 4EJSA 1JWAB 2Q0QA 4U9UA 1Y7PA 2DH6A 3M4NA 4Y9SA 5B37A 3KTFA 1Q7CA 5A6VA 4LVNA 1M34E 2G83A 2Y0PA 3TGLA 4CCYB 2RHDA 3EXAA 2EAUA 5F4ZA 2RGNA 2FUG1 4WXMA 3HB5X 5LLTA 9MHTA 2BHSA 2EQBA 1SOVA 3D6VA 2ZJ0A 3NR2A 1QIDA 2C8LA 1TOAA 5JVDA 1RFGE 1O89A 3STVA 2M1ZA 3GA7A 1NW5A 1BE6A 1ZUNB 2YY5A 4MW6A 3TW6A 3FMVA 4KTVE 1PWHA 1DDOA 2ZYIA 2QMQA 4M55A 3VHLB 4J1TC 4B3JA 1NLFA 2VJDA 1FDWA 1T4BA 3TOSA 3IUBA 6Q21A 1OXMA 1RXYA 1XXLA 1NASA 1KSGA 5BSMA 3EEBA 4F1WA 1R0YA 2DT8A 2Q28A 5K4AA 4EQZA 3AM4A 4YMLA 2GK3A 3JY6A 4U02A 2AGVA 3NCTA 1PX2A 1NQTA 3SLGA 4KPUB 3HGMA 4DHEA 3ABRB 3KTDA 1SWVA 1OKKD 4M36A 4Q02A 1V43A 5HS4A 1YGPA 3FRHA 5IKPA 3SEAA 3UJNA 1YR7A 4QAJA 3SR4A 4CM6A 2C2XA 3ETLA 3A7DA 1R0ZA 1O94A 4XLZA 3JWJA 2XTMA 2JAOA 3CLSC 4R9RA 1XALA 1JHRA 4DTIA 4DYVA 5LP6F 3W78A 1Y37A 1CZLA 5EESA 4GLOA 4M76B 2R65A 3H9EO 2XBLA 2XUIA 4N0DA 3FZEA 3QE3A 5AVUA 2AWOA 1SXJD 4ZQGA 4D9JA 1C9KA 2HCJB 1Z28A 2AQHA 1T4CB 3W5AA 4OIMA 1X1CA 1DQNA 1JJAA 4XWTA 2BWJA 2OBNA 1UXOA 2MR5A 3KJXA 2JATA 1NF9A 4N3NA 4HLDA 5AXBA 1ZI6A 2AXEA 4BNVA 1KAEA 1J21A 4JR0A 5JDIA 2WR8A 3WV4A 1Y8CA 3A3KA 3DE6X 4K3VA 1XCLA 5D84A 5ITZB 4ERXA 1VYUA 3I2GA 4JSYA 5KTYA 1KWKA 1U5AA 2HSZA 3W3AA 4IF6A 1RJDA 4KMMA 2YRFA 2O2SA 4Q4AB 5CHEA 3Q1LA 4YRGA 1JYFA 2LRHA 2RH8A 2QW1A 3BF7A 4GOMD 4DV0B 3IBCA 1FCJA 4P0PB 3H5NA 3TR0A 2FPOA 2XUFA 3I30X 3ZDXB 4TQ9A 3MYYA 3U7FB 1KSJA 5TY0A 3VOSA 2JLVA 3ESCA 2EZUA 2NSYA 2HBRA 2XEDA 3AEZA 4UE2A 4UU7A 1U8YA 1SGWA 3AJDA 1VHTA 3JARB 1MAUA 3L8YA 1CERA 3NYRA 3GIDA 4G65A 1JA0A 2QL7A 2WINI 4R7ZA 3CE9A 5DBOA 3B51X 2OHXA 1WU7A 3T3PB 5CDFE 3FD8A 4ZV4A 2RSLA 1FFCA 4OOFA 4I9GA 1V96A 2BI4A 2WTXA 3MOIA 3UT6A 3JYQA 4GMDA 5EP3A 2E3JA 4RSGA 4EW3A 3NDBB 2X7XA 5LMUB 1I5EA 1E7MA 1LX7A 4V2IA 4URFA 1KETA 1XLUA 2PMBA 1XRRA 1CHDA 1X70A 4LJSA 1LBEA 3FX2A 4Q9AA 2C8KA 4RKEA 5FLKA 1O54A 5LBUA 1N5RA 3RM3A 3V8PA 1A76A 3VR1A 3WLHA 3U26A 4J0DA 4WASA 1G60A 2O1SA 3OLVA 3FMOB 3FGOA 3OCYA 4O0MA 1WXDA 3N05A 5EP1A 1ODTC 3D2AA 2E5WA 2MYNA 2YQZA 4CV1A 4ACBA 4HMQA 3F4BA 3TSAA 2ZVQX 2X76A 2GM4A 3A9WA 4XSHA 3UMCA 1GWNA 4B44A 1JHXA 3PX3A 1C7JA 1JNYA 3PE6A 2GJSA 2RHHA 4N01A 4BGVA 3AUXA 1JXAA 2P9EA 1RABA 2CYAA 4HRYA 2SICE 3P32A 4GFDA 1K6EA 2DQ4A 4O33A 4OB6A 4OD0A 5EIBC 1NAIA 4OL0A 3QUQA 1QH1B 4S0ZA 3LAWA 2Y0BA 3NZEA 3H9JA 2WQ6A 3U4QA 3H3XA 3MBKA 1YQTA 1OT3A 1RACA 2XB2A 3GLVA 3LBNA 1UXJA 1PLKA 1PR0A 1SCKA 1U7HA 4II2A 1V4BA 2G40A 2O0MA 1MP0A 1VGVA 4TXLA 5DWVA 3RANA 1WV1A 2C7GA 1G63A 3NM5A 1AXGA 5GY7A 5ABPA 3U44A 4QDTA 4TZ6A 3D1JA 1UBLS 2PUAA 4JA0A 3NCHA 3TW8A 3T7DA 2C2BA 6ABPA 3F73A 1MGPA 5TVKA 4KP7A 1JIUA 1QGOA 5DW0A 1SKYE 3I32A 4XCVA 3RJ9A 3SXPA 2PUBA 3I9V1 3MTDA 3SC2B 2OCAA 3ORSA 2ZBUA 1WS6A 3BHMA 5AMXA 5DWDA 3AHCA 4HQRA 2PSSA 3AXTA 1YB6A 5EMKA 1BZYA 2ATEA 4YASA 3LQRA 1D09A 5GV8A 5DYWA 1Q14A 2J32A 4LRWA 1V4VA 4DSOA 2BYTA 1KOGA 3C3DA 1AB6A 3EQ2A 1R7RA 3TZQA 4O2RA 1TXGA 4DS3A 2WUEA 3Q8LA 1EDZA 4YRNA 4TXMA 1AKMA 3HWX1 4Z8XA 1HNZB 1EXMA 5AI6A 3GU3A 4L72A 1YZLA 2GX6A 1RMQA 1OA1A 2WWHA 4FW9A 4RMHA 5JDIC 5JNTA 2EGGA 3LUPA 2B8NA 5JTTA 1B4DA 3ZHYA 4LJ5A 2CFSA 2QM8A 3H19A 2D7CA 3INRA 5C1OA 4CMAA 3UFXB 4NOLA 3F98A 4RTPA 1GL3A 1COWD 4PGHA 1ONPA 4IOLA 3HDYA 1IB0A 1PGOA 4UAJA 5E0KB 3ZCXA 3VDXA 5BV2P 3BICA 1BWSA 4IIEA 1XELA 2Z5LA 3ZZ1A 1NVWQ 5C8ZA 2PA3A 5LP6A 4EB6A 2YXLA 4AZTA 3L1VA 4RPJA 2IIVA 4HDKB 1I32A 1WXIA 1HEUA 1YZTA 2IHVA 4V38A 1PGQA 2WKQA 4GC9A 4KO4S 4XIIA 1X7HA 3FFAA 4R8LA 4NV1A 2ZDHA 4XIYA 4EYKA 2P1DA 3LBIA 2PUDA 4W5NA 1G9XA 4IDDA 3VO2A 3VC7A 4ZGGA 1AZWA 1U0SY 1YIDA 2FW0A 4REMA 4KJXA 1M1NA 1YO6A 5FI0B 1OWNA 4RNCA 2J5QA 3P9XA 3V1TC 1Z0KA 2HWUA 5L9AA 2AS0A 5CLQA 3PNSA 3ZVLA 1PNTA 1R4MB 2HHJA 3GEBA 3RBAA 4DVGA 5K6AA 5H8WA 1TM2A 2PBRA 2PX8A 1WUHS 2A5FA 4JUDX 3ROKA 2ZAGA 5HQTA 2OWEA 1Q0LA 1R4NA 3OZTA 4FZ3A 4Q00A 3UMFA 3TPFA 1T4MA 3GQBA 1PJ4A 2RGRA 1EVZA 2ZYRA 2BFFB 4AMBA 1Z8DA 1C9YA 2MSWA 4QSHA 1Z7BA 1SUFA 4XSVA 1E1YA 5LQMA 2IZ7A 1KMNA 1AD2A 3C6YA 3KXKA 4LSMA 4MYCA 3RCBA 3LECA 2QTVB 4JLOA 5EXXA 4NG4A 2ZI6A 1Y81A 4DLZA 4UEJA 1MOSA 4NCXA 3NONA 1L5MA 4OQYA 5FEUA 2E4UA 2HB6A 2QRPA 2ZM6B 4JP2A 1N9KA 2H54A 4OLJA 5BNTA 5ALNA 1QFXA 3G49A 2M9MA 3FIJA 5JNSA 4BTEA 3V8VA 1RP1A 2HMYB 2R4QA 3EVAA 1N1MA 2P9GA 3FYUB 2UZ1B 1ZSNA 3G0DA 4BNUA 5JEDA 3K70D 2FPUA 4AN4A 1D6JA 3SDZA 2V3CC 2V7EA 4P38A 4C7VA 2HSEA 3QFFA 2AXQA 1FYDA 3KR2A 3DMHA 3OBIA 2POQX 3DOFA 4JVLA 4LNAA 5DT9A 4AMYA 1FMCA 4BOYA 3LIPA 5HW0A 2WV7A 4UTPA 3TGWA 2CEAA 2OO7A 4ZOLB 1ISMA 3CT4A 2P41A 3FSGA 4PG7A 4RL4A 2B5OA 3ZWNA 5LPNA 3VOAA 1VSTA 1QIIA 3AUYA 4R2WA 2JVJA 1S3FA 1WXGA 5HZMA 1KZ4A 4K6GA 5A02A 4JUAA 1CZHA 5KQSA 4NICA 3ZY4A 1KI1A 4HMOA 2RHOA 3AKCA 4L28A 2NLOA 3TOVA 4C1BA 3VR6A 4ZPXA 2J30A 1ADYA 1OF1A 3PNVA 1QOQB 5T6BA 4MQ4A 3P0RA 2ADFA 3QNUA 5LQRA 3OTOB 4QDOA 1R6BX 2V5VA 4QLAA 2VNIA 1XZMA 5A3VA 4DWJA 4K0KB 2GJAA 4IHJA 1QIGA 4FW8A 2JFYA 4HI0E 2Z1MA 3TTWA 4MW2A 4X44A 3ET5A 3G8DA 3GRAA 2J0UB 1BRTA 2IH4A 1HT1E 1N7GA 4KR6A 5I6DA 3BJEA 1I8TA 3CX3A 2J7KA 3F6CA 4KE8A 1G20B 4DMLA 4NCAA 3AP1A 1W30A 5A05A 2D0PB 1ZAKA 2FN3A 1M7GA 3U3KA 4JLAA 2C2GA 3RIGA 1MX3A 3L0PA 5F2EA 1TPZA 3DYIA 3BZBA 4FWIB 4ZHQF 2OZKA 1IH8A 2WSLA 3DSRA 4MWGA 9ABPA 3THXB 1UDBA 3T94A 1AGXA 1BU8A 3O92A 3O4GA 2P8SA 3WLRA 3ZCSA 1KTIA 4MJXA 2BTQB 1THZA 2VNJA 3IUNA 2GYVA 5GM2A 3NLLA 4EG8A 1DCTA 5MN5A 4C2TA 5TQ2B 2Q3BA 1IPFA 1JHAA 4V0KA 1IHOA 4XOIA 1RWPA 4Q1EA 1P3DA 1P6QA 1JPNA 3H6GA 3L02A 4QFMA 4TXNA 6REQB 4RTKA 2VDNB 4MV4A 1BKSB 4LYHA 5EC8A 3WV5A 4BLPA 1OZFA 1ADJA 3NUZA 4MRMA 1B8NA 4Y9RA 3UVEA 3ZHCA 4KWEA 4YP7A 4WH0A 1O57A 1FSGA 2ZWOA 3O38A 4EVRA 2XCTB 4LF5B 1ESZA 1IHDA 2CKDA 4MTCA 2FMTA 1VPWA 3OQBA 5K6AC 1SUBA 3TUIC 5KQPA 2PRIA 1C4XA 1QLHA 5EWLB 1L7VC 3SSMA 5J2TB 1N1EA 3IDFA 1FX0B 4BNZA 3NTQA 1IBRA 3NAGA 4CU2A 3L92A 3WAGA 5HA5A 1A8QA 2Z95A 4F5ZA 5KHLB 3RNLA 2Z58A 5BVGB 3EDOA 1JXMA 3R3SA 1QYIA 2CUZA 4JVOA 2FOLA 1A9RA 4ALKA 3C8ZA 4B47A 3E9MA 2C2MA 2WWIA 4BMXA 3E27A 3G17A 4UU0A 1A97A 3CBQA 3KXIA 1K06A 1CJSA 2QSJA 2UZIR 3HLYA 4LTDA 1MCZA 5DCYA 1W88A 1YULA 5A04A 1F06A 2XVXA 2DT5A 4XGKA 4IV8A 3FUWA 4MUKA 5IJWA 1FNMA 3UQZA 4D6YA 5BR8B 4E32A 2XGOA 1JI0A 1F8GA 4DDVA 1UWKA 1WR8A 1CDDA 4BE9A 1E2JA 4EDHA 4MR7B 1MVOA 3VU8A 1OLUB 1JGTA 3KPYA 3WZ2A 2C5EA 4ER7A 1F14A 2JRLA 1C8KA 4E5MA 1XZPA 1PL7A 4UEWA 5FT9A 5BWBA 1I51A 5K0NA 1NNI1 5JBNA 1FYVA 2NTVA 2KPOA 4K86A 3EXHA 4ZV7A 3GEEA 4Y2VA 5JISA 1MR3F 5G1NA 2Q2NA 1SBQA 3U7GA 1YS1X 1E3WB 2CDRA 2I2XB 4FCTA 4AWAA 4PW0A 5KINB 5FLXA 4B3DA 2NO7A 1R6DA 4EO4A 2UV8A 3MTJA 5KNBD 2AX3A 2AFVA 4RV4A 2VUTA 4PO8A 5FWDA 3T9DA 2F90A 3GFFA 4D43A 2I7VA 4MGEA 4HH0A 3BMQA 5GJWC 1QQTA 6PFKA 1G8PA 3HNRA 3I0ZA 1PFQA 4O1HA 1QHEA 3IAFA 2I22A 1MFZA 2Y1FA 3AIOA 3THSA 1PW5A 2JAWA 4IUCS 4YIHA 3FNIA 2YYZA 3WC4A 3D59A 4PRYA 2ETVA 2HSGA 3RT1A 1O6CA 3OP4A 1XL0A 2V0NA 3CLHA 4N7MA 1MJFA 3PFCA 5EYPA 2ZWAA 4GF5A 1VE1A 4NZZA 1Q83A 4JQSA 4E88A 2XTNA 1BJKA 1FQJA 3ILVA 1U7WA 3GEMA 1RC0A 2D13A 2WVGA 3K1ZA 1ZN7A 3PWSA 2GAIA 4JLVA 4BO1A 3ENWA 3HBLA 1IEVA 3KHTA 3RHFA 5B3LA 3OKCA 3EIOA 4YAEA 3KOXA 2AF4C 3EQZA 4MQFB 1HGXA 3HYTA 5HK8A 4OOEA 1DKOA 3T7IA 3ZWQA 3ZWBA 4ZVNA 2NPIA 1KZYC 5ALHA 1BDHA 1ETUA 1VYHA 3F8SA 2XRFA 1F5SA 3QGMA 1IYZA 2C7BA 5ALRA 2JLZA 3QFCA 3DOUA 5IC6A 3H4IA 5KSYA 1QBGA 4IWYA 5I5GA 1SM4A 3S2FA 4B3MB 1D1SA 3RHZA 3SPXA 1EJBA 1LQUA 3SVZA 1V37A 3F5DA 1C1HA 3B8HA 1I24A 1L4LA 2ZANA 3DT9A 2CY0A