1PSZA

Pneumococcal surface antigen psaa
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
286
Chain Sequence
b'KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SURFACE ANTIGEN PSAA)
publication title The crystal structure of pneumococcal surface antigen PsaA reveals a metal-binding site and a novel structure for a putative ABC-type binding protein.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Immune system
total genus 109
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 1998-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA01
2QI9F 4LJSA 1G20B 2PS0A 3EIWA 5AFSA 1M1NA 1K2VN 1G21B 3K1AB 2XDQA 4H59A 3AESB 1L5HA 1N4AA 4WESA 2PS3A 1N4DA 4NNOA 4UDNA 2MINB 3AERA 4WZAA 1H1LB 1KAHA 5M3BA 5KHLB 5HDQA 2R7AA 5BVGA 1K7SN 3HJTA 3K1AA 4INPA 4FILA 1MIOB 4CL2A 4LS3A 2MINA 4OXQA 4WN9B 5B58T 3HH8A 3MD9A 4PM4A 2XDQB 1QH8B 4ND8A 1L5HB 3MWGA 4TKVA 1MIOA 3U7QB 1PSZA 1QH1B 2PRSA 4WN9A 4WZAB 5JOQA 1K75A 2M6KA 1FP4B 3MINB 4HMOA 5BVGB 4WNAB 1EFDN 1QH8A 3BE6A 4UTOA 5KOHB 3PSHA 3U7QA 2ETVA 3TNYA 5KOJA 1QH1A 4NNPA 3NU1A 2PS9A 3AEUB 4XPIB 4MDYA 4ND8B 1FP4A 3MINA 4HN9A 3G9QA 4TKVB 4WNAA 5I4KA 3AEKB 5M34A 3BE5A 5KOHA 3R5SA 2AFHB 2R79A 2XH8A 3R5TA 3PDIB 4FKMA 5GGXA 3EIXA 3AEUA 5JG7A 4XPIA 4WZBA 2YNMD 5CX1B 4DBLE 1PQ4A 5M2QA 1TOAA 3AEQA 2OV1A 3AEKA 2O1EA 3AETB 1M1YA 4IRMA 5KOJB 5GGYA 4MO9A 5JJ5A 4BBPA 2AFHA 4N01A 2M6LA 2WI8A 3PDIA 3MWFA 1QGUA 1ESZA 3LHSA 4M7OA 5CX1A 2RG7A 3GI1A 5JPDA 3AETA 2Q8QA 1KARA 2XY4A 4GICA 4PAGA 3HXPA 4B8YA 4WZBB 3TEFA 3AEQB 1M1YB 2OV3A 2AFIB 2Q8PA 4FI3F 1QGUB 3PSAA 4HMPA 2XQVA 4INOA 4TKUB 4OVKA 3MFQA 4OXRA 1XVLA 1M34A 1N2CA 5M29A 2YNMC 4G09A 4MLZA 4MX8A 3LI2A 2AFIA 4H0FA 5HX7A 1K0FA 3ZK9A 5CR9A 4TKUA 1G20A 5FLYA 3ZK8A 1G21A 3ZK7A 5BVHB 3TLKA 2WHYA 3AESA 2PHZA 4K3VA 2OGWA 4HMQA 4G07A 4UDOA 1N2ZA 3UJPA 1M1NB 3CX3A 1M34B 1N2CB 2X4LA 1H1LA 2XV1A 4FNAA 4WESB 5BVHA 3ZTTA 2XUZA 3ZKAA 4UTPA 3AERB 1KAEA 2OSVA
chains in the Genus database with same CATH superfamily
3KVYA 3F4BA 1UBSB 4HDRA 1EAMA 4MSUA 4PNPA 1CY7A 1FJHA 3QEBZ 1MA0A 2OHGA 1A71A 1AO3A 2BM8A 4IIJF 1AUQA 1RWQA 2AYXA 1J0XO 2F3SA 4CF7A 2W71A 3CVXA 1ZR2A 1WZNA 2CSXA 2W2OA 4NJEB 5LPNA 2IEGA 2G71A 1T13A 1IQUA 3MMSA 3GJ0A 4MRSA 4WACA 2VRWA 1EQ2A 3L7DA 4LHEA 3IKJA 4E15A 4X91A 3FVQA 2PWPA 4YT8A 3MRSA 1K6JA 3AWIA 3IOEA 5KTYA 5D8DA 4KO8A 3PC3A 4ZVLA 1KF0A 3TD6A 3WYBA 1W0KA 3QOYA 2YJ3A 4B3FX 1AS3A 3KPWA 3SLRA 4D0LB 1MJGA 1PL8A 2WAAA 3IPLA 5HW0A 2GJ8A 1NQUA 2VHXA 3F5QA 4HQ6A 3U9LA 1OROA 1LRKA 4PPNA 5KVCA 4L57A 2XQFA 2JAUA 1XEFA 2IYWA 4JEHA 1R74A 3KQKA 2V4ZA 2WOJA 1IEVA 3A9VA 3JRXA 3KKMA 4YASA 5EQDA 1JDBC 4QPCA 4OK5A 5AVSA 1H4SA 2XCUA 3EDCA 1FDUA 2XMQA 3BF8A 4UDYX 4CKWB 3KKQA 2YJ4A 2VPPA 3NT4A 2H1OA 2R7MA 1SO8A 3B6JA 3O74A 4K6OA 5FPSA 3JYHA 5FYQA 2QENA 5HJEA 2FUCA 1U9JA 4IEEA 1ZGBA 1M72A 2ZYVX 3PQ2A 1J9ZA 2QVBA 1T9HA 4TMKA 5EE1A 4L4XA 4ZQCB 4EM6A 4FMCF 2J3EA 3H6KA 3GLGE 1ARZA 5B7PA 1YVUA 4MYRA 1R0WA 1U1FA 2XNDA 3HZZA 4I2VA 4AZWA 1D1QA 2Z8XA 3P1JA 3EPHA 5CM9C 2ZB8A 3C74A 2Q6IA 3TFWA 2QLFA 4Q21A 3RBVA 3W1VA 2PY6A 3D4PA 3IB6A 3PPXA 3V8BA 3T9FA 3TLGB 4BBJA 5FUQA 5JCPA 4GKKB 5EFOA 3CUWA 1U1CA 3ED1A 4UHJA 3EMBA 3WGZA 2JIQA 2O8BB 1C5KA 4YC7A 3IJ5A 3QWHA 3BWMA 3KHKA 4BMVA 2X7JA 1DAKA 4V0SA 4F8YA 2RGUA 3OFSA 1OT3A 5JSQA 1SG6A 1CLUA 3AEQB 4ZJUA 3AVWA 1U6IA 4C0BA 3IHLA 4KZPA 4KPEC 3PT9A 2IGTA 3PXBA 4HWGA 4I8DA 5HJ2A 3RNLA 2AX4A 5K0JA 4AUMA 4ZDWA 2XRZA 3ZKWA 1H1DA 1QDUA 4HDNA 2B8NA 2WEKA 4M9RA 1FQWA 1HE5A 2UZIR 3PXXA 1UZUA 2ID9A 1H2HA 3USES 2Q3MA 4QU0A 3PC8A 1W1UA 3TW4A 1U5AA 3AX6A 3K9HA 1K0FA 3GX1A 3TJZA 4AL4A 1QO0D 4JC5A 2ODEA 3ZLTA 3AF0A 1MP0A 4F71A 3MCVA 3PC6A 3H5LA 4ANFA 2JG3A 3PLNA 1ECGA 3TZ6A 3I53A 3GFVA 3EA0A 4EFNA 2XE6A 1SZPA 3FSGD 4E7PA 2F90A 2ZWIA 4TYPA 3LBNA 4NOKA 1BO6A 3H9JA 4TRRA 5CEEA 4TN5A 1BRTA 3O8OB 3UCEA 4B44A 2O59A 4UNPA 3OOJA 2JD1A 3TZLA 3ZUPA 4DMKA 3A3KA 3HQ4O 3RBZA 2CFCA 2EFJA 3DYVA 1PYDA 1SXHA 3NEPX 4FHFA 4K9SA 4PFJA 2NN3C 2C2YA 4RKEA 4TLEA 3GRFA 1XNQB 4W7SA 4GFDA 4RABA 1V1RA 4IKEA 2PUBA 1R6TA 4DLZA 1DJMA 3MTQA 1U2DC 1DJOA 3QVUA 4DIEA 4P0PB 2N3ZA 1IZ0A 4RF4A 5TT0A 4WLOA 4GQIA 3MJRA 1H9AA 1ZIXA 1L4KA 3T7TA 3EIHA 3EQ2A 3OO0A 2H48A 1Z8FA 1G2QA 4PRLA 1L4HA 4N3GA 1CD5A 5EJ5A 5F4ZA 4BLPA 5BPHA 4XM1A 4A8JA 2BBOA 1A9SA 2GEJA 4B76A 3IA7A 5JXWA 2A1UA 2QUAA 2Z5LA 1X1EA 4RTKA 4FJ0A 3FBWA 4BLVA 4ND1A 4KO3S 4N65A 1AO0A 5BOSA 1DEOA 1T2CA 2C78A 4IWXA 1FOEB 1Z0IA 4ITUA 1EUQA 1PZHA 1TYEB 5DHUA 5J2TA 5AKXA 3MT8A 1SCQA 3SF8A 3NU1A 1DEXA 1XTTA 4NCJA 2B34A 1FLVA 4HX9A 3U6BA 2C3OA 4MPJA 1QIFA 1T9ZA 1XZAA 2R8BA 1I2ZA 4CLEA 3H2ZA 4DR2B 1AK9A 1OXVA 2ZCJA 3OX3A 5I4IA 4GR9A 4GG1A 1RXVA 1U2TA 2X7XA 1N3LA 1NFRA 1JF8A 2WBLC 5J2UB 1EWQA 4I5FA 1CUUA 2RI0A 1G9XA 2A3NA 3NWPA 5CVTA 4FT4A 4PLTA 4EO7A 4YDHB 3UC5A 2AFHA 2JKZA 2QRUA 4DSAA 4D74A 3MOIA 5J40A 3WL4A 4C5BA 3MZ0A 3TXXA 3GLIA 1Y6FA 2MIIA 1E2IA 2P2NA 1R0ZA 4U39A 1ODIA 2X0FA 1QRTA 1TEXA 5LUAA 3FTFA 5C34B 2W2XA 4PAGA 5IFKA 1R6AA 1FVOA 2Q3CA 2Q4BA 2QP3A 3FHJA 3T1YB 5F1PA 2AKAB 2GX6A 2IZZA 2IYTA 1GZ5A 4MKXA 3CF4G 3RYFB 4BZXA 3P9YA 4ENQA 2VP6A 3HWRA 4DJAA 1NVVQ 5FV7A 3CR7A 3FI9A 1MC4A 2VBIA 3O93A 1Y5IA 2GT1A 2Z4RA 4FZ3A 4Q3EA 3ZX4A 4E5MA 1SVUA 2Y1KA 3WV5A 4E0BA 1U7XA 1DC4A 1UPUA 1AU9A 3NM6B 2C31A 2GLXA 1TAGA 3BOSA 2CT8A 3Q72A 1CSEE 4PIPA 1RCUA 2VHEA 2I4TA 4IXMA 1VIVA 3B48A 5LZ2A 4CM7A 2QIPA 4H27A 1N8SA 4Z4CA 1TAUA 1NBEA 3N53A 3JZIA 5KHOC 5KYWB 4HAWA 3F3SA 2X4DA 3UGJA 1TQ4A 1DELA 5BQ5A 3DDHA 3ZI7A 3TNLA 1NOJA 3SX2A 1L7MA 2PCJA 4HL6A 3FBTA 3QXGA 1EE9A 1V0JA 2BLNA 2XQGA 2XQKA 3AIIA 3DOUA 2GXQA 5NLLA 3TTYA 5DI3B 4FFOA 3E1KA 3M3PA 4FGJA 3U16A 1UXOA 5HFAA 2ZIEA 3ASVA 5KNLA 1KMHA 5KYTA 3F2VA 2BSXA 4ZT3A 5JCZA 3QUTA 1N77A 1G5QA 1SUAA 4Y2RA 5DZSA 1G3RA 2V5VA 4P82A 3ROEA 4DJEC 4X7BA 1CVRA 1O3YA 4NBUA 1Q12A 2BZSA 3ECAA 4ZREA 4RH3A 3HXMA 1P0PA 5CD9A 2YYYA 3A9RA 2WC1A 1ZOOA 2X58A 4JVNA 4NFSA 4FT2A 3RG8A 3TVYA 4RDHA 3CW8X 5IH7A 5IULC 1WULS 4FM9A 3EXEB 3EZ6A 5E6UB 1DFHA 2Z9BA 2HO4A 3B85A 5C8VA 4PSUA 4JJ4A 2HJSA 5COBA 2GXUA 2QTGA 3K1AA 4LQLA 4M0CA 1KJJA 4CL2A 4R40A 4HX5A 1RI1A 3L7YA 1X38A 2N1MA 4QODA 4P92A 1QFJA 1B42A 1BCRB 2NO6A 1U7OA 1KVUA 4PAWA 4CPDA 4F3CA 2R7NA 2QR5A 3T3EA 3R6GA 2ID8A 2NSLA 1ZVMA 3OU6A 2E37A 2D0PB 1K9SA 1YBVA 2HZ7A 1ZLYA 2OV8A 5EAIA 3OZAA 5FJJA 1RYYA 5G2OA 1I32A 4I36A 1BMTA 2I33A 1EX7A 1OAOC 1D6JA 4ZAZA 2C5HA 2PXHA 4I7EA 1NNLA 1EVKA 4RTRA 3ITEA 1WZ2A 3I5XA 1W0CA 1SVOA 3DTVB 1GCGA 3NHYA 1AM4D 3CJTA 4P4NA 4Y2JA 4G0UA 3RS3A 4YRAA 5THQA 1WNFA 1ZH4A 5B1HA 3H11A 1U7UA 3IBCA 4K40A 3EIFA 1Q14A 3RS5A 3D02A 5H81A 3O2NA 1XXHA 2SKEA 5KOHA 1E99A 1H6CA 4IL5A 4CV0A 3D81A 3RHFA 3UJHA 4IDNA 5C32A 2FEPA 2FEKA 2XZDA 5FWXB 4PC1A 4I19A 2QOEA 1H8HD 2FOXA 4I1PA 1RCFA 4TVKA 1RWXA 4FQ5A 5M04A 1JG7A 1IHUA 2PGXA 3C87A 2I03A 1GUBA 3OBIA 2C8JA 2IS6A 2NM0A 4X1YA 1RQNA 2DR3A 1YI0A 4UUMA 5BRNA 4R7GA 1CQJA 2WVHA 3QSGA 4OO3A 3IMKA 1LQUA 1Y34E 3RC2A 2O0KA 2AS0A 4HPXB 4KV9A 5AYVA 1UPTA 4RVCA 4M9ZA 1RKUA 1T4CA 4JUAA 4F45A 5DM1A 3I2JA 3MJ4A 3U60B 3REFA 2B7BA 1GNLA 4UM8B 3P4UA 5HEKA 3F78A 1VE5A 2JLSA 2JBAB 3WBKA 4EMBA 1C7EA 4QDXA 5AVVA 4NK4A 4FEEA 2P0EA 3WBFA 3EEQA 1QP8A 4OFXA 5IUJC 2L69A 1A76A 1FVHA 2O0JA 3AG5A 4FYPA 4UJ5A 3HKCA 5AHWA 1P9LA 1RD4A 2IZ1A 3VJMA 5FTMA 5TX7A 2VQEB 1IBMB 1AY0A 4NS1A 2IPMA 1B0ZA 4R68A 3ZWBA 2Y2VA 3DDUA 3I62A 3IQIX 3N0XA 3WLEA 2CNLA 1ULBA 3IXMA 4N0MA 4BE4A 3ZWWA 2PVCA 3K0FA 4QUEA 4L16A 4Q39A 4OAQA 2JGLA 1LC3A 4BVAA 1IMJA 4L78A 3QI2A 2O8CB 1RYBA 1XMJA 3G1TA 4EY5A 2A9RA 3O3MB 3AESA 3BJIC 1UJBA 4I55A 3VR2D 2HQRA 4R84A 5LD2B 3L02A 1FYWA 3PJRA 2NZ8A 5IZ4A 3RK0A 1JU9A 1J2EA 1XMPA 2ZBQA 4NMWA 1EMDA 3DULA 4YIHA 3ZE0B 1E61A 1J0CA 4NBKA 2XV1A 4TL8A 5EMHA 3V97A 4DLKA 2VHTA 2M9MA 2WWHA 3U1VA 4PNHA 3B1KA 4F5DA 1PKXA 2QRKA 2PGAA 3L8MA 4LF4B 1WMBA 4P3NA 1IXZA 2EKLA 4B17A 5TF4A 3BL6A 2HV9A 3V7YA 1JQ5A 3UMMA 2OZLA 4R4JA 3LLCA 4AJHA 4JFAA 1C8VB 4A2PA 4W9MC 1R8QA 1Z4LA 4YMIA 3THXB 1TCVA 1IJKA 4G65A 1TKBA 4QLOA 4GXRA 1T9BA 5L7YA 3FCCA 4O2AB 3ZDRA 4JJAA 1Y7PA 1J06A 4TL9A 3DAGA 1MIOB 2ZT7A 1AMUA 2BFFA 3O0DA 2VJMB 3BILA 4KXMA 1KAGA 1UFOA 3GA5A 1E3MA 1NPDA 1YR9A 2XVAA 3UWDA 3T95A 4M21A 4U7GA 3V46A 1GUAA 1V6SA 3UJ6A 1XMXA 3NPMA 3BIOA 1A9ZA 4TT8A 5B5SA 2CJWA 4B6FA 4PTLA 3RVNA 4AYWA 1RHMA 1WDWB 2H52A 2AEFA 2GNOA 3IULA 1QR6A 3LUAA 2XODA 3MUEA 3CKLA 2FPGB 1UF9A 4U6NA 3RJMA 1GCIA 1SXPA 3GLUA 1U6KA 1R10A 4Q3CA 2PFKA 3LY9A 3SP1A 4C4YA 3H86A 5FOQA 4UTOA 2CJXA 3K4PA 3ZIAD 4CU2A 3ROZA 3QXCA 1PLLA 2B9EA 2QRLA 1SUIA 1JXMA 3KU1A 4GC5A 4F12A 2HFKA 3GP5A 4TXNA 1RKBA 1X1BA 2D2IA 3WLQA 3HUUA 1W36D 1Q0ZA 4YRBA 1TQ8A 2Z6QA 2B8EA 2D2EA 3FA2A 4UPEA 2AD5A 3NHLA 2OCBA 3OZUA 3AVUA 2VBGA 3ZWDA 2HB6A 2Z1NA 3W05A 3M9XA 3IIKA 2D1RA 5EXXA 2G63A 2HSEA 1JTVA 3GBVA 4XWGA 4W5RA 5B2FA 3ROTA 1RJGA 5FCDA 3ZDXB 4PFQA 5D6OA 3ZWPA 4B83A 1DIBA 3C8DA 5JCJA 2EGUA 4XX0A 3K09C 1DMRA 3M1YA 3I04A 4F93B 4QDJA 1IZYA 2H4JA 2H9AA 5HZGA 3MAJA 2IYPA 5ALFA 4E5NA 4HAZA 5A62A 3VU0A 5LD2C 2O8VA 3JVIA 4FS3A 1S1CA 3LKZA 1U8UA 1AMOA 1OTHA 3SICE 3U09A 2WWRA 1A27A 1W4BA 3AFOA 1RADA 4HQRA 3ZDBA 1UBHS 2RHHA 2FFJA 3FYCA 2QTFA 1QIGA 2YXEA 4Q1BA 4ZD6A 1BWQA 2I3AA 4KNVA 1ODLA 3QITA 4LOLA 5B4TA 1T1JA 2G7MC 3TLAA 5ES4B 2J7KA 4QD3A 5BUQA 3VR6D 2YYSA 1P0CA 1ULTA 2VPXA 1GZDA 1EBBA 2M2IA 4XW2A 5LOVF 5B3AA 3OX4A 4Q9JA 4FGSA 2AZ4A 3EUEA 3O1JC 3QLEA 1MW9X 1AGRA 1BKSB 4NARA 1JDJA 4XARA 3NUZA 5TPZD 3VSDA 4AURA 3U7EB 5BVHB 5HHTA 3NASA 4HLNA 2W2NA 5J9FA 2EQAA 5FOTA 5ESXA 3DL0A 1PV2A 2WSSD 3EQZA 1S2DA 4NATA 4MCIA 5A2GA 2QRGA 1YOVA 4ZOBA 4LFAB 2O7SA 3TQCA 3A1SA 1PT9A 1Z0KA 3BKWA 5TEVA 1PSDA 5FX2A 5DX8A 4UCXA 3ZKAA 3DC2A 4HQKA 4FYXA 3ETHA 1JEJA 4Y1FA 4D4IA 1J0DA 3U6KA 3V6MA 4HRYA 3GJ4A 4IJQA 1YRQA 4YBRA 1G59A 4O0LA 1GL3A 2B0CA 4MVJD 3AGPA 16PKA 3LW7A 4ZOLB 5FOUA 5LWHA 2GD0A 4KIUA 1Z25A 2C88A 2XRFA 2OSBA 3A1VA 3WYCA 4LHWA 1HFKA 1Z7YA 4CLXA 2AG5A 3FHLA 1R5BA 4PYQA 2NVWA 3GC6A 1QX3A 4FPXA 4JB2A 4K6CA 4DHWA 5C46F 3GFQA 2CXNA 4LOIA 5H70A 2DTEA 5JYDA 1J2JA 1ECPA 1UINA 2V6BA 1KZYC 2CHEA 2DYKA 1ZN2A 3DBOB 3I8SA 3QE4A 1PN3A 4FFMA 3PLRA 4MQMA 4U9UA 3W7BA 4DAOA 4L7VA 1QIHA 2FYTA 2J46A 3O73A 4Y9UA 2ORWA 5B6PA 2QUBA 1MOPA 1KR2A 2WJGA 3AM5A 3FCEA 1T9GR 3L7AA 4TVOA 4F84A 1L7VC 1HDCA 2XJ9A 3MINB 4NR0A 4ZC8A 3AUYA 4NIMA 3FJOA 3BRCA 4YWJA 4KO4S 4Z53A 4D0NA 5KQRA 4R3NA 1ENPA 1K86A 1LW6E 3QRWA 2PKEA 5T8KA 5DBEX 1VA4A 4Q6WA 3C6MA 4Y9RA 5D5PA 3PJGA 3P9SA 3UAGA 2H1HA 1S9DA 3JSXA 2NOAA 1X15A 2P5YA 3HYSA 4OTZA 3QEMA 4MWZA 4NPAA 5HMLA 4FX2A 3VISA 1NNEA 1EXNA 3AUXA 3NRCA 4X66B 1ISPA 5DNWA 1RC1A 1CJMA 2REXB 3TJRA 4L75A 3ZHSA 3CZ4A 3N9IA 4OQMA 4ENUA 3T4PA 5LQJA 2C4HA 3ETDA 2BFEA 4P53A 5CJJA 4BMDA 4CMIB 5F98A 5HS4A 3IKVA 3PUVA 4US1R 4F4DA 2CVOA 3IALA 3I2GA 5H82A 1UBJS 3R0IA 4PPYA 5M2QA 1AXRA 4MDEA 4B7ZA 1QYXA 4OQEA 4I1VA 2BEUA 2F1OA 5C1BA 2CK3A 721PA 2ILVA 2QK4A 3GUUA 4JJ6A 1ZSYA 3PC2A 1E6WA 2YDXA 4J0QA 1N3BA 2ZJFA 5BT8A 1RWWA 5T3YA 4MR9A 3VU9B 1W49A 1A8PA 1C9YA 1U04A 2Y8EA 3HNRA 2VHQA 3I30X 3PQ6A 4TOIA 4XLTA 4BYGA 5A4IS 1WJGA 1EG2A 4DA4A 4IH1A 4AQYB 2RAPA 1RXCA 1M1YB 4GLOA 4AI6A 3OG9A 2ZEJA 4M9UA 3OLQA 3KOUA 4ETIA 3LY7A 3FCSB 4LQDA 4RANA 5LQAA 3HB1A 1P4JA 1KFBB 4KB5A 5IDVA 4M87A 1JFFA 2QU8A 4RVOA 2HIGA 3OIFA 2DLDA 1M2WA 5A5GA 3SI7A 5D3ZA 4DV2B 5DSTA 3W6OA 1R0RE 1EVQA 3CZCA 4KQFA 2O4CA 3WTBA 1Z6GA 2H59A 3WK8A 2ZJ7A 2GZ1A 4UREA 2ZB4A 5DB4A 3ZLUA 1ACLA 3R24A 1Y8RB 3BHIA 3JARB 1K8RA 3FYUA 5CJPA 3H4VA 5CK5A 5C8YF 1CC1S 3BMQB 3CM0A 4BNVA 1NXXA 2Q99A 3IIIA 1BWSA 1WB4A 3ORQA 4UUAA 1J97A 4BGUA 3EZLA 2WZBA 4NG5A 2ANCA 1Z17A 4DNFA 5AM3A 3VOSA 4PN3A 3EK2A 4Q7LA 2WWGA 1YCGA 4P6VF 4UARA 3UHJA 3B53X 4K46A 2YIJA 1Y3DE 1J4AA 5EJMA 1XB2A 2KM1A 3Q9SA 2NU9A 1U0TA 1YDGA 2I55A 4JA0A 5AM4A 4CQJA 2O2GA 4MQFB 4XDZA 4CIYA 3RU3A 4DW8A 3W2GA 1OTYA 3BWBA 5BNZA 1M2OA 4U7JA 2XRMA 5I7FA 3SEZA 2GRJA 3TNFA 3NGMA 1FBNA 4INPA 1V41E 3K1ZA 4IUDS 2JAWA 4J4HA 5KPDA 1AKRA 2CUTA 3VNUA 5TPWB 2FN7A 1NVTA 1QRDA 1PWHA 4FP9A 3CNNA 1B14A 1XTZA 4O4JF 1EK1A 4WKBA 3WIEA 4E5YA 5JNUA 3TW0A 4E4TA 1FP6A 1GPWB 5J5VA 1JIXA 1EFAA 2JHCA 5BSVA 1SC4A 4XIJA 2W37A 1HNWB 4BCBA 3S44A 4LJ9A 4XJVA 4AJNA 4OOEA 2B69A 3PIDA 4AZSA 1SBYA 3M82A 5IWAB 4MWEA 3JQQA 1GPAA 3RF6A 3FOWA 1NUTA 1CW2B 1QHHA 1KEPA 2D5BA 2VSNA 4U8HA 5AKJA 5ER6A 1FNMA 4NK5A 4PVCA 3VTAA 2PRYA 2D7CA 3HVHA 4M1YA 4XWTA 4RXTA 5K05A 1CKEA 1OLXB 3O84A 4Z6KA 1XVUA 2A1IA 3A2KA 1ZQ9A 1OFGA 1U3TA 2CDCA 1VGVA 3QNUA 1EI9A 2Z1MA 5JD3A 4EUFA 4B5KA 2W8BB 3FMOB 4YRDA 3GEMA 2XVMA 5FIUA 3ZY3A 3MN1A 3D6MA 1QAQA 2RGNA 3BL8A 1AUVA 1PTJC 1E3LA 3ILYA 4X97A 5G3ZA 1OF1A 4JQSA 4QPDA 4TMYA 3WK7A 4YAUA 1N0WA 1X9GA 1MO2A 5K01A 4YCMA 1NFQA 1HQKA 2ZBRA 3HUFA 3KB8A 4A1FA 4B9EA 4P80A 5IVPA 2L0XA 3FB1A 4ZOAA 4C6TB 3ZWVA 3NBQA 3G5TA 3QBDA 1XCOA 4ZDIA 2DB3A 1FFYA 1UKYA 4EG8A 4A16A 1KC1A 4TLCA 1N5DA 2BMAA 2J6BA 2BZ0A 2J5KA 2K4MA 3AETA 3B6ZA 3O4HA 1E98A 4FEAA 4FHZA 4J07A 4JJ8A 2ZBFA 2PJUA 3D2BA 3HL0A 2CFSA 3KSUA 5A9TA 4NSNA 4JI5B 1OI3A 4YAGA 2AHOA 1GZ4A 1ETHA 1ANKA 2G77B 4OJKA 5FHRA 1LUAA 1N7JA 2I71A 2G08A 2XCSB 1G63A 2FMKA 2A4KA 1MF7A 1V11A 5ER9A 1BEZA 1GRNA 1OH8A 2IF2A 4IDAA 3IIMA 4JITA 1TJYA 2IYEA 3H42B 3W8RA 1EZZA 4OP1A 2D00A 1WKBA 4FN5A 4K9DA 4I9FA 1H4VB 4D8YA 2JJ1D 4G85A 2GNPA 3ORFA 3WNQA 2AJLI 5CH5A 4WE3A 2NUTA 4WJLA 1WD5A 3G9UA 4AP5A 3ND8A 1B8PA 1QRAA 1PJBA 2ZETA 4L8GA 5DGIA 3KKOA 5E8JA 2FVXA 2QB5A 1PK9A 4GEKA 2FR0A 2I4LA 4EP1A 1GN8A 1WAMA 2QE6A 3LO8A 4JLOA 4K3VA 4R1NA 5AHKA 1WY7A 3R6TA 4BVHA 5JMWA 3W2HA 5HPYB 3VJKA 1V5FA 5K0EA 3JQ9C 2PV7A 4QAQA 5JH7A 4IOJA 4DAEA 2C1EA 1JKXA 1I0IA 2ZIWB 3I9V1 2JFHA 3KLPX 2IWHA 2IX3A 3PTAA 5GJBA 5B55A 3VGPA 3MGCA 4FWIB 2BWJA 3CU5A 3O82A 4KQWA 2BR4A 3D4BA 3WB1A 4F2HA 4ZHSA 3EGVA 1TXGA 3LUFA 3IAM1 5BMVA 5HA5A 3DZKA 4FFWA 5J58A 3T7RA 3UJ8A 1TNDA 4BKRA 4D8WA 4RV5A 4BLTA 3H5IA 1QIMA 1P6XA 1GQ2A 2GF2A 3VM6A 3WYFA 1CUIA 4V0OA 2ZRCA 3S8YA 1SH7A 4B71A 3EPKA 3H2BA 3M4YA 2VTVA 1NTOA 2BONA 4PLCA 2OZEA 4J76A 1LVGA 3F6BX 3FETA 3JASB 1FSFA 1UKCA 1UXGA 2AC2A 2PU5A 1BHO1 4PIMA 2HK6A 3HH8A 3MD9A 4UJ3A 5ALDA 4Z4HA 1W36B 3EY9A 3HEAA 4ZYWA 1ZJWA 4HDSB 4JYMA 1O87A 1GDTA 1ODCA 2C9DA 5K2MA 3TF5A 1NOIA 2WPDD 3P2KA 4L9WA 1EFUA 2BM1A 3WQRA 1ABFA 4WGFA 4R69A 5CDFA 1UKBA 2P9QA 5BSEA 7GPBA 1Q2UA 3AFGA 4E6PA 2VSFA 3LDAA 1VI6A 2GKGA 2SNIE 4ZVSA 3SZ3A 4F2GA 2ZSAA 1J0AA 1ZI6A 2ORED 5CFQA 4GZ5A 1MVOA 3DTYA 4BFCA 4EI7A 3KELA 3GJRA 4KVGA 1L5WA 1SHTX 3HI4A 2OCDA 5CH3A 1J8FA 2UZ4A 3VHQA 3AUUA 1CR2A 2DM6A 2WK1A 2WVAA 1PE0A 2GK6A 4KOAA 1OBVA 3QVTA 3H5AA 2AF4C 4MIOA 3TKYA 2VUUA 2QN6A 2ZIGA 2GLUA 2ZAMA 2ZK7A 4M1QA 4ME6A 4NZNA 1U8CB 3PXGA 3FR8A 4OYHA 1X7YA 1XALA 4CM4B 1GCOA 4G4JA 4YT5A 5FWYA 4K81B 2RH9B 4HH3C 2X5XA 1XCGB 3LXXA 4UEOA 3ABQB 4OYYA 5LZ7A 3NATA 1JKJB 4JUDX 4NKRA 3TRFA 5D51S 3D5EA 4HP8A 4JUIA 2WTAA 3RB8A 1JG3A 1L7QA 4TVSA 3C3XA 2Q1WA 4BP1A 5JPDA 3AF4A 4BKPA 4UBLA 3FTQA 3TB4A 2WT9A 1T3HA 3FDJA 4W5QA 1PZXA 4GR4A 4JC8A 4KI0A 1GFIA 3SC3A 2V1UA 4WK0B 1II0A 1M8PA 1O8CA 3IUEA 5FXMA 3IH5A 1TVCA 2A9FA 3WXBA 1HNZB 3QVJA 1NGSA 5FPTA 2RHBA 3KJXA 1RW4A 4RGVA 2H1LA 2LCQA 4BEBA 5E38A 2PKCA 4ARAA 1IB0A 1DIOB 3CEJA 3ZI4A 4MP3A 4EUSA 1O57A 1A4RA 1QHXA 2XIJA 3AB8A 4OGWA 1A82A 4YNBA 4Z9FA 3UT5B 3V2IA 3EG9A 5AI9A 4INZA 1EGMB 3K70C 2WWXA 2W2LD 1QLHA 5ABPA 3JYQA 1OZ0A 1XAGA 4HNUA 5DT9A 2Z6AA 4TKUA 4B3MB 4D9HA 2EZ8A 4OG2A 4LWOA 2BLLA 4Y2VA 4LWZA 3U4DA 1LBIA 2YOGA 2JFXA 5DLYA 1U8EA 1IEWA 3D8TA 3OQBA 2VQSA 5H02A 1NU6A 4IILA 2CYCA 2WICA 4CN9A 1NI5A 2VSOA 1MT0A 5HE8A 1R8YA 1FTGA 4WESB 5FPKA 1W36C 2JVIA 2WOOA 3NTQA 1JE0A 2QTTA 1UC5B 2IU4A 2AZMA 3F7OA 2YQ4A 4OIMA 2HMTA 1Q1AA 3R0JA 1Z15A 2FF5A 2NYRA 3UV6A 1UH5A 3H97A 4ZYVA 1LJLA 1QONA 1SHUX 2R5NA 2HBQA 2OWDA 2YUIA 3IJEB 4XIIA 3DLCA 4WXYB 2W11A 5LZ5A 3DUFA 3AERA 4OQPA 3SK0A 4YUYA 1E9BA 3CX4A 4EG4A 4O2BF 4QBTA 4UVHA 3AY6A 3R9XA 4CM9D 3M4JA 1SG0A 1XWFA 1YJ8A 1RVDA 2BBTA 3T7SA 3BF7A 4CGYA 3EXHB 5BN3B 3MJTA 3A4YA 4GWKA 3MTDA 1VTKA 4ZI7B 3N76A 5H1YA 2LNDA 2PX8A 3C5VA 4CQNA 2G9UA 2RK6A 5LQRA 1EFRA 5ISMA 1OAKA 5LXTA 1KZ6A 1BDBA 1Q0TA 4JI3B 1E2DA 3Q7QA 2QYTA 2WTUA 3RIXA 1M8KA 2CXUA 2J9FA 2PZGA 4Z4QA 2HH9A 3F9IA 3TRKA 3I34X 4P4SB 3CUKA 3JY6A 1E7RA 1RRCA 4MROA 4PRZA 1F2UA 4RC9A 3WO0A 4BY9E 1CRLA 2EHJA 1OFUA 1ORRA 3DCYA 4GM1A 3N0VA 5I01A 1CS0A 1H85A 1L7OA 3LCCA 1SIUA 3JVDA 4B48A 3O95A 2IT1A 3S81A 1Z7WA 2QIOA 3LX8A 1U2EA 3JQBC 4XUDA 1IC6A 1CK4A 4MP6A 1RMTA 4JBXA 1C7RA 5LYJA 1Q74A 2PLRA 1WF6A 4GVXA 5CXQA 1TU3A 4YRQA 1OZAA 4U8GA 3TVTA 3FFXA 5T57A 4A6PA 2FUEA 2V0GA 4RTPA 4B3HA 1W34A 1NJ5A 2JGKA 3AEUA 3IT0A 1OVMA 3PT5A 4KN6A 3EMDA 4GWLA 4EF4A 3KAKA 3L0SA 1HE8B 4X65B 2NSJA 4X6LA 4HDOB 5ENZA 1PGPA 2HIAA 1OTXA 5HRAA 3KSAC 3B3QA 1WABA 1G4AE 4E70A 4G26A 1VG8A 2AC4A 4KP7A 1EDZA 4GKJB 1RYFA 4M1TA 2GM4A 4RLSA 3GI1A 2P4QA 1RWNA 2HLHA 1JGTA 3KVRA 1TEZA 3OCUA 1FRZA 3QMPA 1G5FA 5SZJA 3C14C 1GXSB 4FQ7A 2ZI3A 2B83A 2R1ZA 5K99A 3TFOA 2DT8A 3HCRA 1R4MB 1PJAA 3E48A 5JDIC 4DY6A 5EPEA 5B3JC 1X1QA 1CBUA 3RYHA 3V55A 4BO9A 4PGAA 3BMOA 2I99A 3JAWB 5A71A 4BMYA 2R2GA 2C04A 5JDCA 1I13A 1GTMA 3UWPA 2C5AA 3N8IA 2IZ7A 2VWPA 5IARA 1T9GS 2QAGA 4NU0A 4CLRB 2IY7A 4HNQA 3RFTA 4A92A 2R751 3KYCB 4BXOA 1GA1A 1P2TA 4HFJA 5AKKA 3KYJB 1Q84A 3MCAA 3PA8A 3LLMA 1XTBA 5FWDA 4EKEA 6REQB 3AHEA 1AK2A 2ON6A 2FZLA 1G60A 3QOXA 1L5KA 4POOA 1FX0B 4X6YA 2NZVG 1R3DA 1PQWA 1THGA 4PG7A 4K9KA 2NZ2A 4KTVE 1E2KA 3EGEA 1TT5B 3N7UA 2YTZA 4TXHA 4ZO8A 4P0QB 5IM5A 1C4OA 3MJFA 3P0HA 3EXHC 1JS1X 1O95D 2FV8A 3IL2A 3TLZA 5JSFA 1UP7A 5L51A 4Z1MD 4DJ5X 3C5CA 2ZI4A 1AUOA 4PX2A 4OBXA 1SBIA 5LDGA 2ZYHA 1VIYA 3JWGA 5JTUA 3RSGA 1FMTA 4TXLA 4BPBA 2Y4OA 3VUEA 4FB4A 4BFZA 5KTKA 1I3CA 2O2DA 3UV7A 3CZPA 3U1BA 3QW4B 1JG4A 2AF3C 1P77A 2XE4A 3CJQA 3OPYI 4LYJA 4Y6RA 3ESYA 4D0SA 5IJ9A 4UBMA 1O5TA 1R18A 1J42A 5LKRA 2WUVA 3T41A 3AR2A 4G6ZA 3PKIA 3UK2A 4LHVA 2VSYA 1IZZA 3SSNA 1BVRA 3NGXA 2ZQZA 5K3AA 2GAJA 3LY8A 3U2QA 4O08A 2KE5A 1I0ZA 4GVLA 4P7FA 2EERA 5F1KA 2NZWA 4HLUA 4AWAA 5IDQA 4E11A 3FOFC 4XGIA 1DPFA 1Z26A 2GYYA 2ESRA 3AJ8A 5FI0B 3UK7A 5AW0A 4EF6A 1HX7A 4YI3A 3ZCQA 1YZ3A 2OO5A 1KH1A 2JW5A 5E9AA 2RIRA 4Q3BA 3SM9A 4BX3A 3EOZA 2IS4A 3HBFA 2A0FA 3N2NA 3HPRA 3U7QA 4J43A 1AV6A 3GGSA 4UNRA 2GJ4A 5KOJA 1J56A 1KH2A 2GBPA 2RDMA 1N2SA 1X13A 3B2NA 4IKPA 4NNPA 1J33A 2P3OA 1GYQA 3GVXA 1Z07A 3GCGA 4RXUA 3I1IA 5IYZB 4ARZA 1FRQA 2WJIA 2ZYRA 1E79A 2EJCA 5BWBA 3R5TA 4L4SA 4XCXA 4F6RB 4I3FA 1X3LA 3OX1A 4LZOA 2PS1A 3E9EA 2DPMA 5LMNB 2NUAA 4A8TA 4CKXA 2XBLA 3BT7A 3UOWA 3I1YA 3PF9A 2O23A 2F48A 3THYA 2XWSA 4QE3A 4FYWA 2PRJA 4JVMA 3PPWA 2FX3A 1E66A 2FSHA 2VUSA 3R8CA 3UJBA 3EUAA 4RU1A 4XSVA 2DFTA 3PX2A 1VJTA 5HF9A 2HYIC 3I9V6 3R0ZA 4H6WA 2UYQA 3IP3A 3N8HA 3A7EA 4KK4A 2HC9A 5KUTA 5JY1A 1I94B 1JJ7A 4U0JA 4EITA 2AZTA 3IEVA 3DZIA 4LYEA 2N0SA 1B6SA 1C7FA 2VP3A 1VMKA 1QJ4A 2X9GA 4HMPA 2AG6A 1UXIA 2WD7A 4IMRA 1PT6A 1XTQA 2CDBA 4WXRA 3ROKA 4A3SA 5L53A 1AXEA 1DXOA 2JJ8A 1HMPA 1WP9A 3PFIA 1WPRA 1JIVA 1PGQA 2ZYDA 3PWKA 5J23A 2MSWA 3E7DA 3HSSA 2O6HA 3HCWA 5JJLA 1DQYA 1PVVA 1PUJA 1ZGJA 3JPWA 3MOGA 4MVJM 4Q47A 4IGIA 2CMGA 5P21A 1GL7A 1YMQA 1EB8A 5FTJA 3W5HA 2PMKA 4V24A 5JS8A 3RVMA 4LJYA 1FIUA 3QVVA 4KXVA 2REOA 2DETA 1WQ4A 2C82A 5BSUA 1ZUNA 1T25A 2WB4A 1II8B 1A5TA 1CY8A 1THMA 4IPTA 2DWCA 2C5EA 1CQPA 2EJTA 2J9YB 3FGNA 2ZE6A 3A05A 5CM8B 1KEUA 2OKGA 1UEXC 4NNJA 5AW6A 2Z56A 4ZRMA 1I24A 2ZT8A 1N1GA 1BW9A 1JAZA 2F9LA 3R7WB 4PF1A 1HKHA 4Z9AA 3GZJA 3J7TA 2UYCA 4DLAA 2A5FA 4DLYA 1SHKA 2BI8A 3LUBA 1G3QA 1B8NA 4HTFA 4N0QA 2QWXA 4CDGA 1RHJA 4MV3A 1W52X 4B81A 1A95A 4MITA 5B3KA 4QUBA 3TH5A 1GDHA 2XUIA 3TX2A 3CE9A 4EZIA 4PYJA 2Q1TA 3AI2A 2EVWX 3LGAA 4OP2A 1IXSB 1XE3A 1DADA 4FDMA 2VBCA 1U0NA 4Q0MA 3RT7A 2UXDB 1QFSA 2A0KA 1RAFA 2FQ1A 1O9GA 2VCYA 3S8EA 3H4IA 2QN3A 3VU8A 3BEDA 4ZCSA 4EQZA 2C4WA 2FSPA 2II6A 4O8CA 1YA4A 1NJ2A 2ZU0C 3D7SA 4HUQA 4OM7A 3AOEA 2O7QA 3KJFA 3PXUA 4E88A 1J2RA 3JV7A 3AF1A 1M1UA 3BULA 4FKZA 2BH9A 3LF1A 5I9MA 4YCNA 1SOVA 4YY3B 4BU1A 1V1JA 4ZGGA 4IOLA 3L77A 3WNDA 1ZC3A 4GW3A 1DCMA 1KP9A 4A9AA 1HV8A 1X6VA 1I7QB 1PFGA 4L3VA 1FSSA 2DSTA 4RADA 3ADPA 1GYPA 1TA9A 3LDHA 2X9VA 4FUTA 2HPVA 5A7HA 2VVTA 1LFDB 2K6GA 4D8UA 1QB8A 1IJBA 2VP4A 1JSZA 3HCFA 2O9JA 1ZN8A 2ZANA 3GVPA 2DOKA 2NADA 1RABA 1WG8A 1PG5A 2PZLA 4EG6A 4JI4B 2EZUA 1E2MA 1XP5A 4NH0A 3IEPA 3CEMA 2BRUA 1HMYA 1GNTA 3K0BA 3KUUA 4JR0A 2Q9AA 2HIHA 3PFNA 1PGNA 3V7FA 4EOGA 3SHTA 3MEQA 1MABB 4MQ4A 3E70C 1ZH8A 5AJVB 3FGZA 1BXGA 2R0QC 2HXYA 1XPJA 3L1IA 5KYUA 3FPEA 4RK4A 1PTKA 2BFBB 2FCAA 3FNQA 3M0EA 4HEJA 3REQA 5KTOA 3O7WA 4EYQA 3OMXA 4TX1A 4FLMA 2QVXX 4W1QA 3ZWCA 1CY1A 1YJXA 3K15A 3L7OA 1K68A 4MWTA 4NZOA 4WA7A 3TZHA 5D87A 4JEIA 5I7SA 4EMTA 4GGOA 1JKFA 1RWVA 1MXFA 2X42A 4G8CA 4PV7A 3HJAA 1BFKA 4L76A 1XRQA 2GO1A 3THOA 5COQA 4KLZA 3ZVLA 4EJSB 4DUGA 3IUSA 1Z2NX 4DEYA 4Y2YA 2VJLA 2ZBUA 4HWOA 3GQBA 1Z6TA 1UK8A 4BGDA 5J2TF 4C6HA 1WU8A 1OBHA 1RLJA 2IY8A 3KB1A 4DABA 4IVRA 4HNTA 3IPRA 1R6VA 1T8TA 1BMQA 2Y9MB 4UD2A 3QLJA 3A36A 1SC6A 3OA0A 4AMGA 3ZY5A 4KXQA 4D97A 3W5IA 4ZFNA 2Y0CA 4TKZA 4OLBA 3E8SA 1L8LA 3L43A 1Q3KA 3LBHA 4QQKA 1IVYA 1GPH1 4I0WB 5DJ5A 5EINA 2ZPUA 4MVJI 5I9LA 1YS1X 3VPSA 3T0GA 2P2ZA 1J8YF 2DH6A 1BAPA 1MGOA 1T5LA 4F4JA 2FQYA 5GZ1A 2Q3EA 1XEAA 1GNVA 2AJCA 5JT1A 3JZDA 2FMTA 5HZKA 1OX4B 5IX8A 4DRZA 1OXBB 2UUAB 1TF5A 1VPEA 3TL6A 3G9XA 4FXPA 2FEOA 5BR8B 5CMLA 1Y0BA 2R85A 1N4AA 1QQBA 4V0NA 5CT6A 4D9JA 3ZYZA 3IEUA 1KMQA 3FCOA 2EFGA 1T9DA 4PZYA 5AQEA 3TRIA 4F72A 3TMAA 4H1WA 1B3RA 4IHJA 1R6XA 4G81A 1I7NA 3C70A 4HNAA 4O0MA 3QLTA 4MW4A 4ZK6A 5K51A 3TOZA 4JBHA 3VO2A 2DUNA 4IIBA 3QF7A 1A7JA 4S35A 2I6QA 2JVKA 3NBMA 2XD9A 3DBRB 3C3MA 5C5IA 5JATA 4BMOB 1HH4A 4O1HA 3MHTA 3WNVA 1NDUA 4KFSA 1SD5A 4OU4A 4C14A 1PQUA 2VP2A 3R6WA 4KODA 3T12A 4ARUA 1F8GA 1DGQA 3KAPA 4JN6B 2JS7A 1X9IA 1PUIA 4LDZA 4U2BA 1N78A 4RTMA 5J43A 4RD1A 1M75A 1P7WA 4YQEA 1ZS9A 4IDBA 1FPMA 2JJ2D 4IGAA 1LBSA 1Y9AA 5LBIA 1E2BA 4AIRA 4CT0A 1PR1A 4GBED 1KU0A 2XYQA 4UTNA 4I50F 4XI9A 4DCOA 1PEYA 5AI8A 3HCNA 3HP7A 1P7CA 3NAMA 2Z9CA 3N58A 3VHRA 5ICMA 2JJMA 1MOQA 2BP7B 1Y7TA 3OCXA 5B36A 4Q7KA 4KVFA 5KOIA 2N9UA 3ELDA 2ZB3A 4GP9A 4JAVC 2DPYA 1VLMA 3MJHA 4LMBA 4MA5A 1OYWA 4EJSC 1DZ3A 2Q07A 5JG7A 1PR9A 5FAKA 3EFEA 4KR3A 2P41A 4E1VA 1O94A 1WHTB 2AL7A 2DF8A 3H1FA 4DILA 1XU4A 1DKRA 5KJFA 1T5OA 1LRJA 4UUBA 3RUEA 4HDKB 3VYWA 3OHPA 2XUFA 4BLQA 4DLTA 3VKFA 3BRQA 3RWBA 5KQLA 3DVQX 5T4EA 1V71A 3A26A 3B78A 3NHKA 4HHEA 3WO1A 1CFZA 1CUVA 2AMVA 2OVFA 3AIKA 3ZJ5A 3KCQA 1MAAA 1E63A 1Y5LA 1N5IA 4NBVA 4CG0A 3U4QB 2D0OB 3F6EX 1K7YA 1T1EA 1TK2A 1M10A 1XHFA 2Z2JA 1X7ZA 3NB0A 4QRDA 4AZ3B 4G0OA 4LXHA 5DW3A 3AVYA 2PRIA 3V5NA 4GUAA 4JT9A 1F0PA 2RBEA 1RR6A 4QOGA 1RM4A 2Q8PA 2Z8YA 1CHDA 4CLOB 1IVSA 3R20A 2MCFA 2AOTA 3GA0A 1N5OX 1RYMA 4LBWA 3W2FA 4EO4A 1UMKA 4OLFA 2ZSEA 2BC9A 3ONVA 1CIPA 3N2EA 2F8MA 1FP1D 3ZW8A 3L1KA 1BVYF 3DEZA 4F9FA 3DO8A 5KI6A 3SQMA 3D64A 4DNXA 4EHLA 3F8TA 3HACA 2WQ6A 2IC5A 2X76A 1X7WA 3CX7A 3FJ1A 4TTJA 4LN1A 1VP3A 1K8QA 5G0UA 3WICA 4PGFA 1K3UB 2YXBA 4MQEA 2WWTA 5K6AC 2XTNA 3G9ZA 4PZAA 1FNSA 5C3UA 4WX2B 1HDGO 2EG9A 3AFHA 1I6MA 3L8DA 3C6BA 2AOUB 1NLZA 2IKQA 1SVKA 3KTOA 4C1BA 3T6KA 3MGBA 3CUTA 4AIIA 1E1MA 1KDOA 1S3FA 2WUDA 4U2FA 1BHQ1 3C24A 2O50A 2XOXA 3GY0A 1J22A 3Q6NA 3TLMA 4OHZA 2APJA 3K0CA 4BX8A 2EHDA 4G0XA 1I2DA 4E46A 3DWFA 4II2A 1TM7E 2MU1A 3IXQA 2LCIA 2MMGA 1HDZA 2XT6A 5JRDS 1VPVA 3G2PA 3ML1A 5HTKA 5JEDA 5FADA 3DE6X 2R6DA 2IHYA 2JIBA 2Q5OA 4JLPA 4RNCA 5FUXA 5LJIA 1DKMA 2PPLA 2BJWA 3BAFA 3OQIB 5HZMA 4JSRA 1BJTA 2IOYA 1LTHR 3WQHA 4COOA 5CFOA 5IJ0A 1F7VA 1SQ6A 1ULUA 3QH4A 4H7HA 4MUJA 4WCVA 3V8QA 3P94A 2HBYA 3AHFA 3C15C 2G9RA 3CVWA 4D82A 3CLTD 1AXGA 5FORA 2FR8C 1DUVG 4JUBA 1EKXA 2DEUA 4LV8B 4M7WA 2XMGA 2DR2A 3DV9A 3DT8A 3OUUA 3TIIA 4AMYA 1C3LA 1HNXB 2HT6A 2Q27A 3QE0A 2P8SA 2AYZA 3QA3E 3IBFA 1KO5A 3L0ZA 5DGDA 3U4MA 3U48A 5J4HA 2IPXA 5K3FA 4MPPA 4GAEA 4P4TA 4GP7A 3OE1A 1QVRA 4NV3A 4OF4A 1C41A 5BO5A 1RZRD 1PT5A 3D0QA 3FTNA 1SRQA 1UUFA 1JEQB 1KDPA 1WNTA 3LQ2A 3NDJA 4GRDA 4LXUA 2FN9A 4RAOA 4PLWA 3JQ7A 3HVIA 4HN9A 2Q5CA 3U26A 4DVJA 3GBPA 3TLXA 2WJWA 4P5EA 4ZVRA 2G9QA 2I4IA 4L5YA 3A6GA 3TW8A 4C04A 2C5SA 2Y6UA 1T9KA 4H7FA 1EK0A 2EJUA 4P35A 5C53B 3E1GA 2IXAA 2XA9A 3FMFA 3OOHA 3T1OA 1O95C 1R6DA 3ZWYA 3FTEA 1NKTA 2DSNA 2QTAA 3BIFA 4EPWA 1H93A 5L7WA 4RHXA 1C0KA 1MHPA 1OX6A 3SC6A 3ZWQA 1SELA 4OKIA 4ENVA 4IIVA 4DV0B 4HBGA 2HK7A 2QUHA 5EI5A 3UT6A 5DLDA 1CUHA 1JQ3A 3I6MA 1CF2O 1EG7A 1WCIB 2IU6A 2QROA 4NI5A 4MICA 1QE3A 4XWYA 4GD3Q 4YROA 5EEHA 2YKGA 2A78A 2FRDA 2NYAA 3FPAA 1GGJA 1DJNA 3CHYA 5FV4A 3T38A 4RJKA 2EEZA 2P6RA 2W2MA 5KX5F 2ZTVA 4PLVA 4CMAA 1D8TA 2ODAA 4XYLA 2PLFA 2RGXA 2W6ZA 4F1WA 2RJOA 4D92A 3NMUF 4QNMA 3HJCA 4NXNB 5A4AA 1KJZA 3U0VA 5BYJA 4RA6B 3BA6A 5D1HA 2JEZA 1C3JA 1TQ6A 3OJXA 3VOBA 2JNWA 3KYDA 3KLBA 3RVRA 4ADSG 2AN1A 2OB1A 4BMZA 4ZV9A 3G02A 4A2QA 4S05A 1W59A 4RIIA 4YN3A 2F1RA 3ADBA 3ERCA 2OXRA 4MARA 5AQ1A 1T5DX 4M9CA 2FZEA 2GN4A 1M2KA 4HDQB 2FSVA 3M2TA 5T7BA 3NLLA 3E7PA 1U28A 2PHZA 3T9CA 3ZBQA 3O31A 2Q0HA 3DE4X 1Q0RA 4F2PA 2WYUA 2H8KA 3LDFA 3WWPA 2JEYA 3C3DA 4DDWA 5F7JA 3RRFA 5B1EA 4M1SA 2W22A 5FQOA 1XQXA 3AC0A 3CB4A 4GOMD 4KUGA 4F38A 3ZWAA 3H0CA 2NP7A 4MS1A 4G0PA 4E5VA 1GZSA 1ZXXA 4WVLA 2PAFA 4PYNA 1MVLA 1K4KA 2GPJA 5GVSA 1L5HA 3QQPA 1KK1A 4ZTZB 4Z2YA 3H9UA 3AT1A 1RTTA 1Q16A 4WZAA 3SC4A 1EQUA 1GY8A 1TVKB 3QMWA 1QIKA 2V7VA 1WHSB 3QVSA 3UAOA 1Y1PA 5BVGA 3EZ7A 1S96A 2PLWA 1MB2A 1I30A 2HPAA 4I9NA 2M98A 2YWJA 1T1SA 2MINA 1T1IA 2E4ZA 1N2OA 2W6PA 1XDWA 5DBIA 4C4PA 1U3DA 2XYGA 4EJFA 2IS1A 1MXHA 5FTNA 1JEOA 1F9AA 3EDRA 1S89A 4INJA 5HGXA 2X8BA 2HDWA 4N0DA 5FOVA 5TQ2B 1HKUA 1NI4B 5K3CA 4YJ3B 3RVOA 4A91A 4X20B 3DEKA 2VZ8A 3JQRA 3G2KA 4K6MA 4WK6A 4CTMA 1QM5A 4W5TA 4HPJB 1BE0A 2I7VA 2FEXA 5KCZA 5DMHA 3LHIA 3W5VA 3BWXA 1ZGGA 5B4UA 2C7VA 2TMYA 1KVSA 2HEIA 3CN9A 3W3AD 5HK8A 5LZ4A 2XR1A 1KYTA 4O4IB 3HN2A 2GN1A 4JLKA 4M36A 4OIFA 4N9WA 3MWDB 4FFBA 3KIPA 4AKSA 1FQKA 4CKBB 4G0WA 3HDTA 3GD7A 3DM5A 3LQQA 4D4HA 2HDNB 2YWEA 1WY5A 2JJQA 3CZRA 2H7YA 4Z51A 1NUQA 3H5OA 5DWVA 1KJWA 1DAFA 1Z8NA 2GMWA 3G17A 4LZPA 1WDLA 3LAWA 3BRWD 3UJDA 3X1WA 5BP7A 3RARA 5ECWA 2FPXA 3ILHA 1U63A 5DN9A 5G0WA 3ZU4A 4O4LB 5JR3A 3OCYA 1RLUA 2VZ9A 4N54A 5KNCH 2IHTA 5K0LA 3HV2A 2JDIA 3GFGA 3DWEX 3R8XA 3IBGA 1URPA 1K7XB 1BDJA 5LIPA 5EWJA 5J3JA 2GQ0A 3VNBA 1QCZA 1QGOA 5A7GA 2NV0A 2CMDA 5D6NA 4HQFA 1HNNA 4PGHA 3SNKA 5K8IA 2WWVD 1G8FA 3JQFA 3JSAA 1Z12A 2IU0A 4AJIA 1DLIA 2RSLA 4DA7A 3MGKA 3KFVA 3U3DA 4BWGA 4ENTA 3M5CA 3R44A 3Q15C 4HOYA 4L0CA 3SXUB 3TBFA 4C7XA 7ABPA 3G0HA 3K9LA 3HYNA 4MX8A 1NLYA 3NVKI 5JE8A 1RFLA 3ZNNA 3EDQA 4IJVA 1PEAA 3AGQA 4XJTA 1TYDE 1FFEA 2E4AA 2IF0A 2NO5A 2IEYA 3T06B 1C80A 5LQUA 2PBLA 2QW8A 3OZIA 4I9GA 1B1CA 2R6FA 3GCDA 5DGCA 3OQJA 3QX9A 4N47A 1I6KA 4UPDA 1YZKA 3BXZA 2ZM5A 4OB6A 4DV5B 2BMEA 4UDOA 1QRRA 5IK2D 4OXIA 4MYUA 1W35A 2HSDA 1YBHA 1FZQA 4JYZA 2G67A 2P11A 2KX7A 4A73A 5IAGA 1D8AA 2C83A 2ODTX 4ZHQF 3SU8A 2WFLB 3QPDA 4IXNA 2OV2A 2Y1OA 4KMOA 4LY6A 1DTEA 2QNIA 1X94A 3QVXA 1H23A 1CUSA 2P9JA 2AK3A 3LUDA 3IP9A 3HB9A 3Q3CA 4G5OA 3QJYA 3DKIA 3RODA 1JB1A 2JFBA 3B52X 3DEYX 3NIBA 1RSZA 4N7JA 3I3OA 1N4DA 2DWUA 3NBXX 3OT1B 4Q19A 4ER7A 1PGOA 2PUGA 2YHBA 1NBIA 5FI5A 4C30A 2WHPB 3KX2A 4DC1A 1E9FA 1NY6A 1QORA 1SGWA 5IN5A 3VDMA 3ZU5A 3U9TA 4RF5A 1Z29A 1OH6A 4K9LA 2CFOA 1HETA 1LJUA 2YJ6A 5B58T 1H2FA 3GRRA 3B82A 5SICE 1OXUA 2JFGA 4YREA 4RSHA 2CHVA 3ETCA 1X1DA 3S1SA 2A9VA 3MWGA 4YJGA 3Q98A 2CD9A 1JEYB 3DLAA 3ESAA 3K2QA 4HFNA 1W88B 1GYRA 2YJTD 1GNPA 4IG4A 4J1SA 4MLDA 3CIFA 4A6XA 3AEYA 5JTTA 2WWWA 1QXSA 1E2EA 3AZPA 3GOQA 2Q5EA 1V2GA 3QEJA 4HZGA 4WCDA 2QPAA 1XD2B 3Q8WA 4KX3A 5EKTA 2Q1UA 5CAEB 3ZNOA 4V0LA 4RIEA 1Y4SA 3P97A 4W82A 1IIRA 1W4AA 2GN2A 2QTVB 2OYRA 3DAFA 1NMEA 3DXZA 3O3OB 4G8BA 3RK4A 5KBYA 3ICVA 3FFAA 3NW9A 3UANA 4LGVA 1HDRA 1RQXA 1W1WA 1SIWA 2QEQA 2E89A 3MS4A 4JOQA 5BSTA 1OKKA 2JGIA 4K6GA 2ROQA 1E2LA 3OT4A 3B6KA 4ZQEA 4H17A 3ZOZA 1OWOA 3TLJA 4P34A 5DO9A 1L8QA 3PR3A 3QI7A 4M7PA 4LY0A 5BWNA 4B33A 4V3BA 2NQTA 2E5LB 4F91B 1IQ0A 4G0NA 1UQRA 1KI3A 5JCXA 3PTLA 1T8RA 1CUFA 1P1CA 2IZ0A 1E9DA 4X9XA 5AK4A 1ZHOA 2F9MA 1NASA 1VCNA 2H2GA 1O4VA 1G5HA 1W0KD 3P32A 3QVKA 3TJMA 1VXRA 4FGKA 3O8CA 1LD3A 1WLYA 4TPKA 1T5HX 3Q5EA 3KE8A 2WWFA 5FI3A 4TL7A 1PDWA 3EBOA 2ZSFA 1D0VA 1DBQA 2QUIA 4DADA 2J3DA 1JSCA 2EFHB 4PO1A 1P74A 1QCYA 1UMBA 3LUKA 3W7AA 4I6JA 4QREA 3HVRA 2JATA 2P68A 5A4MS 3ZVKA 4LOAA 2YHIA 4IH9A 4WOCA 3FNBA 4U1RA 1SEVA 3WLFA 3WIUA 4X6UA 2E5WA 4O29A 2J6HA 3RHSA 4EW1A 4ZMSA 4TTQA 5AVWA 4KNWA 1MO4A 5B30A 1X7GA 2F3QA 3INRA 3OTQA 1E64A 2HHAA 4WKNA 4X8HA 3QSYA 1C7QA 1N3IA 3V8RA 2Q3LA 3L06A 5EMMA 4R9UC 2BFDA 2ZM6B 2XNDD 1RQ2A 1NUPA 4L9SA 3TDMA 1JR3E 1BKYA 3O3NB 1T2EA 3CY6A 2I2BA 3GLHE 2Q2QA 2AR9A 2J48A 4L3WA 4FJ1A 1TCUA 4G5FA 3VO9A 1DX6A 4KQXA 5AWFC 1YUBA 1WVGA 1NYTA 1VKJA 1VJGA 4TRJA 2ZULA 3HBJA 3OVMA 2QUKA 1JMYA 1QZXA 1W48A 2OD2A 4RFSB 1E2FA 1NONA 2Q6OA 4XA8A 4BEVA 4DLUA 1ISHA 1QB7A 1Z7BA 2PBZA 1L4MA 1N9KA 2PUJA 3ILVA 1V1MB 5E4YA 3HTXA 1EFKA 1C9JA 2FQXA 1FVXA 1XP8A 3CE6A 3WGIA 3OF5A 4RH1A 1S8NA 4K0KB 2E55A 2Q50A 4WCFB 4WD3A 4FILA 4TYMA 2PX5A 2JLYA 2J0VA 3L0OA 4R05A 3RTAA 2BGIA 2VA9A 4E4RA 5K2OA 1ISMA 2DKFA 4MW0A 1LXCA 4WOPA 2Q4OA 4GPAA 5GY7A 1FEZA 2O0LA 2OGTA 2Q8NA 2E4XA 4LY9A 4FNGA 2ZYUX 1KPIA 3G89A 4N3NA 1BQEA 4JKOA 1IN7A 1UODA 3PTZA 1W581 4KUEA 2A3RA 4DM4A 5IKXA 3NHMA 4OHPA 3OMWA 5ALMA 1FP4B 4G9BA 3BFXA 4WNAB 3B1XA 4MLCA 3S29A 2W2PA 4UFPA 5JNRA 3CLVA 3NALA 1XQ1A 2WJYA 1Y5NA 2E4UA 3TLYA 1BDIA 2VCHA 2O8DB 1E4OA 4TS1A 1P9NA 1EDEA 2FW8A 4I4TF 1DKNA 1NE7A 2HO5A 4URUR 3CJRA 1YK0A 4ND8B 5ETJA 4KXUA 2F2TA 5HIIA 2BZ1A 1QFXA 2MDTA 3WP1B 1L1RA 4IQFA 3RJTA 5KEIA 3GBSA 2B1GA 4FDVA 4UAGA 2QBYB 4O8ZA 3FUWA 1Z39A 3RFCA 4PFSA 3BGIA 2IW1A 3HYLA 1VL6A 1SVLA 2DMRA 1RQLA 4C78A 3IIJA 4QBIA 1EX1A 1KI2A 2FGKA 4E12A 3B9RA 3AEKA 1DKQA 3BJZA 4OQQA 3K2BA 4K05A 2X19A 2OAQ1 3IP5A 1CE8A 2JA2A 2P0AA 3EB9A 1FXUA 3PX3A 5BUZA 1BX3A 3CW2A 3AVQA 4IF6A 5EP2A 1L5GB 3U61B 1LDMA 2VQ3A 2GPAA 2ZSUA 5DXFA 3A6JA 2V7XA 3JQDA 5KPJA 1DX4A 1XIVA 1AGPA 3GJTA 3GRAA 2WKPA 4Q4JA 2YN2A 3A2LA 3UWSA 3DFUA 3GJ7A 4Y0AA 5C1OA 5CA1A 2NVUB 5LQKA 1ZM9A 1GRQA 1Y5MA 1SA0A 4BNNA 3EHEA 4FMDF 1B6TA 2VR1A 3I9LA 4UXHA 4F86A 2DLCX 2P3QA 2PL3A 3S5UA 3SZOA 1F12A 1OXMA 1ZKMA 1UT5A 1O54A 2RGCA 2JCYA 3P45A 4J90A 4KGZA 2I7DA 2X7HA 1B6RA 4K2HA 4U7WA 4LX0A 2XQJA 3CH6A 4KUHA 1Q1GA 1Q19A 2FMFA 5JD4A 4ZKEA 3TTUA 2B98A 2IHZA 4C87A 3IVGA 3HJGA 1V96A 1YJBA 3OKAA 3FD8A 4GYJA 5HBRA 1AMNA 3ZCUA 4RLQA 3A1TA 1U2SA 2W48A 4YYEA 1RCTE 1HLGA 4D3FA 2UZ1A 1AHHA 4NBSA 4WCFC 4DR4B 1H2YA 1C3OB 4YDRA 5GIPE 3ZJTA 5EJ8A 4UEQA 1HA3A 1N2CB 1XDSA 3L6CA 4ER3A 1G5TA 4ER5A 1MAHA 5ALIA 1ZQ1A 2PD3A 3U4HA 1GA6A 4QXRA 1R0LA 2JFQA 1BD4A 4GKBA 1E3JA 1SKUA 3EBPA 3W90A 3K8OE 4TYYA 1NM5A 2PS0A 4RSRA 5HYVA 5AKIA 1G8JA 3MGAA 3MLAA 1N5MA 5BN5B 3SKVA 3JQAA 3FY4A 3GAZA 1QOZA 4L4ZA 1B74A 1RRFA 3QNMA 4ECEA 2A9QA 3ZV7A 5E9WA 3BFJA 3GW8A 3OF3A 4P5DA 4PZ9A 1R2QA 3UXMA 4DNQA 1J8MF 3KVVA 3TLCA 2GJ9A 1H1LB 1WXGA 3V80A 4V1CA 2ZG6A 1EEXB 1YJCA 3C5WP 3DZBA 3LJKA 3V1TC 3MWYW 2P9FA 2CF6A 1VCMA 2M1ZA 2W6OA 3ICCA 4ZU6X 3NNDA 3DVAA 1UAAA 4DXDA 1QQ6A 3EXG1 1R12A 3ZXSA 2GCOA 1CF4A 4U0KA 2WNIA 3OETA 1UXKA 5JHGB 2IXTA 4PEVA 3CO0S 2CUKA 2QL5A 1KWGA 3BPSA 3GEEA 4U4AA 4D3DA 4L9AA 4L2IA 3WQBA 1BCSB 5I7HA 2PUCA 1NATA 4K5QA 4JJKA 1I7SB 3WZLA 5G1NA 1G21E 1NIPA 4RZQA 2B1RA 2LKDA 2XCLA 1BKDR 1BTOA 2OLEA 3A1FA 3IDZA 2NW6A 2I29A 1DAEA 4WKPA 4BB0A 5U9CA 2YFKA 5F9MA 4CMCA 5JZOA 5ILQA 3EZYA 3HGTA 3PIIA 5DTEA 4DYVA 4KQ2A 2AB0A 3CUUA 3FI0A 4I9HA 4MV1A 2D4AA 3LUJA 3DMDA 1E77A 1JLLB 1H6DA 1BX0A 2ES4A 3ACBA 4G97A 3WGGA 5BYAA 5BURA 1SK9A 4D46A 2UYYA 1UAGA 5HP4A 4HF7A 4U63A 4BJ6A 1REQA 3D1JA 2Q7OE 3HWWA 1B8OA 4KAJA 1DHRA 4ER6A 4KITB 2A59A 2AN3A 4A36A 1PW5A 3O3CA 4Q9NA 2XADA 1RMQA 3A1CA 3K8YA 5JVDF 3EVGA 1OXTA 3FZQA 1T34A 4WBNB 4NJMB 5TMPA 1QOPB 4G1VA 1XYGA 3LUCA 4M8SA 5LXTF 3R5KA 3HXPA 3UF0A 1GHTA 2IOFA 5SZIA 1CY2A 2WJJA 5CDUA 2FPUA 3EXFB 2D2XA 3I2YX 3N0WA 3PS9A 1T2DA 1IWOA 5I7UA 1IHYA 3PQ5A 2EXXA 2VAXA 1U94A 3G2QA 2ZUSA 1JR3A 4ZXPA 5HCUA 1ZOIA 4O02B 4EJMA 2B0JA 2W2TA 1QJCA 1Z8HA 1NYRA 1IPFA 1C1DB 1EEHA 1S4QA 3WS7A 5BW5A 5JZ9A 1MG5A 1MIHA 5JBNA 2EWVA 1USIA 1YE8A 4OH1A 2PXAA 2O8NA 2BFNA 1KDZA 3L04A 1XQYA 5JI3E 5LYJF 3IODA 3QKSB 5BSMA 1AN0A 4QXAA 4B4WA 3OQNA 2GEUA 2EL7A 1IEQA 3ESQA 3H2JA 3H83A 3TQHA 2ZRDA 4C6SA 2NPOA 2BM9A 2NNLD 1V39A 3OJ0A 1LDGA 4RY9A 4XB2A 3ZE9A 3RAPR 3NHRA 4QBKA 3HUEA 3P20A 4MW1A 4KE7A 1XHEA 2P27A 1NF9A 2PA3A 5ERYA 4PTZA 2JCGA 1C1XB 3AINA 3K6SA 1QRSA 1G7TA 4LDQA 5SY4A 1K5PA 1CUYA 2W7TA 3GLTA 1JR6A 2DJ5A 1XJQA 4MUHA 3NT2A 5ARDA 2XKAA 5G3YA 4B3SB 2OYSA 3HY4A 1N9GA 3ORSA 3PQFA 4CEJB 4NPHA 5KSZA 3VPDA 2D4HA 2HSGA 1D6MA 3C6QA 4YH1A 5I45A 4AX8A 1HGXA 3F5FA 3VHXA 3MLEA 4KQMA 1L5NA 2JGEA 4F3KA 1JT9A 3T4EA 1E3WB 2VXOA 3SYLA 4FZJA 3JWJA 2H1SA 1YBFA 5EG5A 3OZXA 4IFBA 1M1ZA 7REQA 3B7WA 4OJYA 1RJDA 4U5XA 3QKUA 4J1TC 3LM8A 3GHYA 3DW1X 4FZVA 4UNQA 4DOMA 2GWHA 1THTA 4HI0E 1CNFA 3LVFO 4JUCA 4MZXA 2PGDA 3NV7A 3DYIA 1IHOA 5I9TA 2KLBA 1NYLA 2VPTA 4ASUA 4KXXA 3FOEC 4AMUA 1FDTA 1H0HA 4DQ0A 3GH3A 5K0BA 2FKNA 4ZPJA 2NT3A 4HVAA 1BH6A 2RKOA 4Z9XA 3BG5A 2WAMA 2JCVA 5EPOA 3U1TA 3WRXA 2V9CA 5GONA 3PNLA 2VRCD 4NYMR 2H4ZA 1SQFA 1KAMA 5L6MB 1SXJE 5FWYB 4UD6A 3K4HA 1RRGA 1DOZA 3NKLA 4MDYA 4YMLA 3FCAA 4KWHA 1QF9A 1A4IA 1JMKC 1LBTA 1QK4A 2AVNA 1Y1SA 1L6IA 4MK4A 4EHKA 4MIEA 2PZ8A 3GQVA 1R4ZA 1E2JA 2OT3B 3RTEA 1ODKA 2VP5A 4RZUA 3NEAA 1ZCAA 3MJDA 4BGVA 2J33A 4B75A 1P60A 3ID6C 5AW7A 5B57C 1FXWF 5DRYA 2TRSB 2BL4A 4CJXA 4IDHA 5JJBA 2I8LA 2VTEA 3TGWA 2CYBA 5IH3A 3EVAA 1HYBA 4TS3A 1LZKA 2I76A 4Q7MB 2DFPA 3C16C 1I3OA 4OFWA 1GNSA 1I14A 3VR0A 3ZY6A 4FS8A 3ISJA 2OTCA 1WLSA 4X6XA 1Q1QA 1FFGA 1ZIOA 5CFLA 1LY1A 2NTJA 2BH2A 2NSYA 3HR7A 4ML3A 3WKCA 1CEEA 2PJRA 1CDOA 4WFJA 5FOWA 4J9UE 3BH6A 2QJOA 2JH8A 2WV7A 3NBZC 4Q4HA 3DKRA 4QGSA 2AFIB 1W5SA 1RHKA 1A04A 4HS9A 4YS6A 4AULA 3KT3A 4BECA 1RWMA 3VYTB 4AY3A 1FSPA 4R9SA 3CCBA 1E69A 3BSSA 2ODQA 1BYIA 2BEWB 2X1VA 3CRQA 3DE1X 3QE9Y 2H2DA 3FPCA 3O38A 3MYRA 2QPTA 1FB5A 4J0JA 4JJ7A 1CJSA 1XCPA 4KCGA 4BVGA 4Z7OB 1P29A 4MIYA 4DA6A 4ZP1A 4EHIA 3MQ2A 4LW8A 1RLMA 1UDWA 1V25A 5K45A 3A6DA 3DS8A 3MD0A 3WYGA 5LMUB 4MPTA 1JE1A 4KR0A 4WZBE 2ZAIA 1GPYA 3FWZA 4Q34A 4JEMA 1L4EA 1YT5A 2QD5A 2P2YA 4LJ8A 4JHXA 2H54A 4OD0A 4XEUA 5C81A 1ECBA 3RS8A 3FFTA 3IGFA 1EX6A 3I9NA 5EXSA 3AL2A 4AMVA 4XJXA 4F1JA 4EGJA 1OV4A 1OUMA 1HDIA 1TZMA 3OUTA 4EEKA 2IDMA 2C95A 4QM6A 1KP2A 2XTMA 4RK1A 4P4LA 4QOHA 4UDNA 4ZRDA 3VBEA 4BDSA 4BQPA 1SM4A 1RC0A 2QSZA 5THKA 2UVPB 1KQFA 1DLJA 1W8DA 4W1RA 1Q0QA 1NLMA 2BE9A 3CSSA 4UVEA 4GE0A 3ABRB 3TM4A 4ZYUA 1JJVA 3B8HA 3NTRA 3OIVA 1QGZA 4UBNA 3CURA 4YFVA 3GJQA 3VJRA 4LF9B 1EFCA 2ZBPA 5CP8A 2YZMA 3CKYA 4PZPA 3F67A 1V1RB 2HBRA 3K53A 5CFRA 3QVGB 1SU4A 5B4VA 2GEVA 5DN6A 2J31A 4EG0A 1UBTS 1GG2A 4RKYA 3ESBA 2P2CA 3DG9A 1Q2XA 2XYHA 3PVZA 5JNLA 4PZCA 1E2HA 5ALVA 4DLNA 3T3NA 1GAXA 1XAIA 2FSSA 3NEJA 4XSGA 2JCSA 3RC3A 4A15A 2Z09A 3AR5A 1BXRA 4U3JB 5FBZA 3W79A 3TE6A 1VGRA 2DR0A 5EP3A 4URZR 2RHGB 4B3BA 2JI9A 4EX7A 1IYZA 3E9RA 4H60A 4A8JB 5CB0A 4DZZA 2BUAA 1JHZA 4JJGA 1W96A 3INYA 3OLXA 3NWBA 3P9CA 3TOVA 3AP3A 5E2AA 3LZCA 5F12A 1RQ7A 2QRMA 1AB5A 3BC1A 3PDIB 3BK1A 1LBQA 1Z0AA 4DCPA 4DQKA 3PQ3A 5BOSB 4Q1EA 1Z4PX 2HY7A 2CD7A 5JCOA 4DN6A 1SVSA 2H0AA 4C3OB 5KQMA 1U0HC 2PPVA 2JGFA 3PXAA 3RT1A 2A58A 4EVQA 1DXHA 2HXGA 2YWCA 3QG1A 4CMEA 4AZ0B 3QZUA 3PFWO 3SY8A 2G09A 3AR7A 3KJIA 1A8UA 1C4KA 3CONA 3ZWNA 3SXPA 1U2QA 4PQYA 3SQLA 3ZJ4A 4B0PA 4QG3A 3EUFA 3SIXA 1YGYA 1VECA 2Q5JA 3FNFA 1U2GC 3F74A 3NUGA 4GR5A 4W1SA 4D25A 4OJNA 2W5UA 3ACCA 3L6BA 3WL7A 1V7ZA 4NOJA 4LC9A 1HYHA 4TLLB 1T2UA 3M81A 3AM1A 4EGSA 1SWVA 3DDCA 2BKEA 3GEIA 1OBFO 2ZRLA 3P2MA 3TD9A 2ZIVB 1Y9JA 5ALTA 4ALMA 5AW9A 4OQDA 1PEDA 3UN1A 1YNSA 3SC2B 2Q7XA 2QVGA 1L8OA 2PT7A 3ASZA 4HEHA 4K6FA 3WLTA 4LOKA 3DR5A 4WKOA 3K0KA 3LF2A 1MVNA 2FLVA 3GNTA 1P7ZA 4JP1A 4RVUA 4CQLA 4DRXB 4AP9A 2H0RA 3KB2A 3REGA 1PV1A 4XQEA 5A05A 3X44A 4FE7A 1XZJA 5BT9A 1NBHA 3GRPA 3HV0A 3PUKA 4WTOA 3M1IA 3OWHA 2XIQA 2H7CA 2Y71A 4Y2TA 3STYA 3S2ZA 1TO1E 1Z2PX 1QYRA 1OV6A 4M88A 5HQJA 3THRA 1PS0A 1ST3A 4RVDA 5HS6A 4BB6A 1IOVA 1VJCA 4WGGA 1SQ0A 2FEMA 1RXIA 1I7DA 2CK3D 1JDSA 3JQGA 3VZQA 4AJKA 3A6LA 4EIWA 1WEHA 4FNAA 1KH3A 4H7IA 5KYYA 2XNJA 3H2YA 4OH7A 3M2PA 3N7AA 1EDDA 1UBUS 2B94A 4BJ1A 4Q48A 1IAVA 4PZLA 3UUFA 4BVJA 4M9QA 2ZRPA 1JZTA 3CLKA 4MUIA 1XRLA 3ECSA 5HF6A 3UMGA 4BEWA 3O1IC 1WZIA 3KJNA 1TC1A 3LOQA 1QIJA 1IK4A 1KR5A 2HKIA 4J16C 1Q95A 4ZODA 4DWJA 2K7ZA 1DEKA 2FPPA 3MFYA 3SJUA 3OEHA 4GI1A 1HDYA 5TQVA 2VJPA 2VWQA 2EDAA 2FPIA 2QHXA 3F47A 3PDCA 4MA0A 1KMHB 4QATA 5AT1A 1Z5VA 2CXQA 3HJTA 1UPAA 4DPMA 1R0CA 3T1VA 1EFTA 3UXEA 1D1SA 3BD9A 3LPCA 1FLDA 1CJUC 2ZWAA 4Q16A 4WN9B 4CNQA 1SXJA 5KZMB 2PE5A 2G9NA 1N6LA 4CKEB 4U7TB 3IP7A 1EWVA 2QDKA 1M34E 3MTGA 1WU7A 2WHEA 3KKNA 2ZRJA 1XNGA 2XSZA 2OESA 2W6NA 4Y7CA 1XV5A 2PUWA 2VZ0A 3Q7EA 5AM5A 3WAGA 1R66A 1EXWA 1N7HA 2O8EA 3BA1A 3OTGA 4J7UA 2JGRA 1F60A 2CXTA 5ENVA 2VH1A 2R6R1 4L73A 3V00A 1SZJG 1D0IA 2AI3A 3AONB 3EXIA 4C4ZA 4PZEA 4N7RA 4O5AA 1JDTA 4ZO7A 4AICA 2OPHA 4MKFA 4IIJA 1U2ZA 3PFHA 4NZMA 4OJMX 2J3MA 3G9QA 4WMLA 5DFAA 1GA4A 2H3EA 3Q40A 2V7QD 4FGUA 1VBKA 4C5AA 2Z6UA 5KJCA 1TF7A 1ULHA 2AGVA 4MUFA 3CF6R 4B2LA 1QCCA 4JT2A 1GUDA 3I2IA 5G4LA 3WAJA 2XB8A 4IRMA 1M2GA 4IHJF 3CG0A 3H11B 3OCVA 1P81A 4DR6B 3HJFA 1NBWB 2UUBB 3P9ZA 2AT1A 1R64A 1XXHB 3FPHA 1ELOA 4YACA 3HL4A 3EFBA 2H4WA 1XZCA 2LW7A 4BLOA 2OBNA 1I2MA 1R8JA 1BEEA 2XUJA 3I9JA 2W6MA 3SQNA 4REQA 2EF1A 4ZYYA 1RP1A 2B36A 1VSUA 2OO7A 4EGQA 1Y8CA 2OCKA 2WSYB 1GGEA 2H8GA 3COJA 3D6JA 3WGVA 1GITA 3FNGA 4IV8A 3T5DA 2G0NA 3QV1A 1J9EA 2NZYA 5MGNA 3I8XA 4X1YB 2HHJA 3ONNA 3WMXA 1P61B 4INOA 2B25A 4WXEA 4PHFA 3A0RB 5DTQA 1KMMA 3MQ4A 4UCWA 3W9YA 5KDDA 4D4KA 3DJYA 4LEIA 4CR6A 4JJZA 3KTFA 1RWPA 4PYKA 1JZSA 3PEFA 4UPVA 1WUTA 2O0HA 4ND5A 3D8SA 3BICA 2QW0X 5IN4A 3KOXA 2FMXA 1O0SA 2QF7A 1VLHA 4Q12A 3SHVA 3DVRX 3VI3B 5LP6A 1VB3A 2WFZA 3FRIA 3LT4A 4BNLA 1DIAA 3HKCB 1J24A 1TRHA 4KEAA 1B6GA 1UC9A 3DBVO 4K9PA 1X1AA 1Y6ZA 4MI9A 1U11A 4IW3B 2HSZA 4JB3A 4R6XA 1UBEA 2GZRA 2GBGA 1QGDA 2YS6A 2OHHA 3CKMA 1DWPA 1L9KA 3K0FB 3TTSA 1NU8A 3WSWA 2IEIA 2IIQA 5J59A 4KDEA 3HJHA 3AYXB 4OXYA 1J2TA 4OBBA 3AESB 2IHBA 1WQ3A 4I55B 3DKPA 4G01B 4HD8A 4N8EA 4R2LA 3SMQA 3VR4D 4JBGA 4ZICA 3SFTA 2BOVA 3BCSA 2PWAA 5FUMA 4J3JA 2H9YA 3A1DA 1AQJA 2IU3A 3LSYA 2ODPA 2QZ9A 2G9VA 4ISCA 2RGBA 4DR3B 3QX7A 4TT3A 4MVJP 4DCUA 4IO1A 1TQDA 4UHCA 5EHQA 4OPMA 5CA0A 1P9OA 2R6CA 3NBKA 1WDKA 2REQA 2Q9BA 3CH4B 2B2XA 3ELBA 3BWEA 2QV0A 4RV9A 1PFWA 5LQDA 3CEPB 2PT6A 3OX2A 4XLZA 4EATA 3A1EA 4YMUA 3V9AA 1T4DA 2VYVA 3C39A 3GEPA 1XNRB 4HSGA 4ZALA 5CFNA 3MGGA 4DLRA 4LZNA 2YC4C 4MV4A 3RUDA 2RD2A 4YV7A 5EUCA 3RAFC 3L5OA 2VIIA 1XVTA 3LIIA 4I66A 4Y6PA 4M1OA 1VL8A 2X0DA 1IY1A 3IRVA 3NOVA 4CL8A 2O2EA 1G9TA 3H9GA 2PS9A 4M1KA 2NZXA 1K66A 1OCEA 4FN4A 1QF7A 2O14A 4UFOA 1EM8A 4D6XA 4QJ4A 3R3HA 2CJWB 1IQRA 4ESOA 4BV8A 1RDFA 2V6MA 3HCOA 4W9NC 4EUNA 2XD4A 2QN8A 2QW1A 3FH0A 5EHNA 4JV5B 3WIOA 3KTAB 2QD1A 1DRWA 1II9A 1CP2A 1K1EA 3GCZA 3HKEA 3PQ8A 3FPFA 4IQ4A 1Q1ZA 1UKAA 4RQAA 1VKNA 4IQ0A 4WUVA 4A0RA 2ONJA 1GGMA 1AURA 1K6MA 2X6TA 1UCFA 1Z74A 3NBAA 4KBYA 4JOBA 4OSPA 2JI4A 1PVDA 3TRHA 1LPMA 2WRZA 3KZMA 4JD5A 1Z45A 1E3IA 3VTKA 4C0SA 2WV9A 3UIEA 4G0MA 5ULLA 1E7MA 1Y4AE 5T5QA 3GMTA 4B3RB 2NO1A 3Q41A 3OQMA 5C8DA 4EAAA 2ATCA 2PQ2A 3MHPA 2D62A 4G1CA 5ES3A 4BP8A 2WA1A 2DULA 1E9AA 2O1XA 4GBGA 5HKLA 1MX5A 3VV2A 1OBOA 2V0NA 2Y2UA 3UVEA 4YR9A 3SQOA 5FD8A 1XZPA 3DE5X 3EFOB 4V3CA 4J0FA 1USKA 1WMDA 3BTOA 3C2QA 1WMEA 1NSYA 3N28A 2Q7DA 3OBBA 3EZNA 1WZUA 3WIDA 4N49A 4AB1A 2VI5A 1ID8A 1JR2A 1YB4A 2EKDA 2YW2A 5A3QA 2W2KA 3BCUA 2XXAA 3GMIA 1ORTA 4UM7A 4GMXA 1DEAA 3NGLA 2FFAA 2PG3A 1JV2B 3TGPA 2V65A 2VQDA 4M1ZA 4EA6A 1JHUA 1I6LA 1O08A 1GKIA 2VP0A 2WB2A 2JF0A 2J5RA 3QGMA 2XGOA 4QGHA 3TLEA 1TYCA 4LRYA 3GLFA 1XMOB 1QQAA 4NJOA 4UQOA 3MWEA 3TSOA 1KOFA 2X8WA 4AJPA 1CNMA 1YIAA 4CIAA 2HA6A 4Q37A 3IAS6 2GCIA 2CGEA 2W83A 3LBIA 1THZA 4DJTA 4DLVA 4KRFA 3B2EA 3FXAA 1UMDA 4HWRA 4HAOA 3F4LA 5EZYF 3N5CA 1VSVA 4FW9A 2D2FA 4MW7A 4R3UC 3Q8LA 1J6UA 4LJ7A 5JAZA 3UG7A 3RV3A 4X54A 1E32A 3JATA 1G8KA 4KH1A 3CEHA 4F4UA 2V9ZA 3TI7A 3TTTA 2EJBA 4EKNB 5KHAA 4EB3A 5IP5A 4CTOA 5C7OO 2XKKA 3IBYA 3P0IA 3SVTA 2W4QA 1B41A 5DH9A 5LB4A 5GOZA 3ZE7A 3QEKA 3HBLA 2AOVA 3QPUA 1HZZA 3AZOA 4FCWA 1VLQA 4PZDA 3UW1A 3L8FA 1QH1B 4MR8B 1GL6A 3RD5A 1IPEA 3D8HA 2CNOA 3IDSA 4INAA 3JCZA 3F46A 4UDXX 3KV3O 3TR5A 4R2WA 4JBNA 3BZWA 1U8YA 3GDWA 3C6KA 1ZXBA 4C43A 2NU8A 1DRUA 4KAAA 3E5NA 1FDIA 1U90A 3BGWA 3OLCX 4PX3A 4CF3A 1KE2A 1RE1A 4MXDA 1VCOA 3PWSA 4S1OA 1RQGA 1N6HA 5D2CA 3K96A 4RGBA 3U40A 4OXKA 1K8XB 1RACA 1IUKA 1ORIA 3OP4A 2YR0A 5MDHA 3LYHA 2X8LA 1T29A 2VZEA 1IOLA 5LDDC 1LZLA 1MMFB 3NIFB 3KLNA 2UZAA 5L3SB 3ODGA 2OHJA 1GSHA 4QBHA 4GUDA 2OY0A 3CF2A 4KFTA 4P81A 2P9YA 2PVPA 5FUWA 3C6XA 2HMAA 3UGQA 2ZROA 4A1OA 2HQ1A 2YJNA 1X80A 1UJCA 1EFRD 2G1JA 4DMRA 5EUBA 2I9KA 3C3YA 3LQRA 3VR5A 4PXYA 3QM1A 2BFEB 3BHMA 2JEOA 1ZINA 4KWTA 2A5JA 2FUKA 1UWKA 4B1FA 3DE0X 5CCXA 2R