1PSZA

Pneumococcal surface antigen psaa
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
286
Chain Sequence
KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SURFACE ANTIGEN PSAA)
publication title The crystal structure of pneumococcal surface antigen PsaA reveals a metal-binding site and a novel structure for a putative ABC-type binding protein.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Immune system
total genus 109
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 1998-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA01
4MX8A 4B8YA 5GGXA 2MINA 3AEKB 3BE6A 4GICA 3UJPA 4TKVA 5BVGA 5JPDA 5M2QA 2XV1A 3TEFA 2YNMC 3HH8A 1M1NB 3GI1A 5KOJB 4HMPA 4HMQA 2R7AA 3AERB 4IRMA 4WZAB 5KOHB 2R79A 4WESA 2O1EA 5B58T 1PSZA 3MWFA 5M29A 4XPIB 1N2CB 2AFHA 4TKUB 1M34B 3AESA 1KAHA 2OV1A 1FP4A 4LS3A 4UTOA 3AETB 4HMOA 5GGYA 4DBLE 4WZBA 5BVHA 2PS9A 4UDOA 5CX1B 3G9QA 4MLZA 3AEUA 2XUZA 1K75A 5M34A 1M1YA 2PS3A 4WN9A 2PRSA 3PDIB 3AEQA 4OXRA 4G09A 2WI8A 2MINB 4NNPA 1G20B 3PSHA 1H1LB 1N2ZA 4NNOA 2AFIA 3TLKA 5KHLB 3LHSA 1MIOB 1K0FA 1QH8A 2QI9F 1QGUB 5HX7A 3MFQA 3AEKA 4MDYA 5JG7A 3U7QB 2X4LA 4FI3F 2OSVA 3R5SA 1ESZA 3ZTTA 1XVLA 5AFSA 4UTPA 1K2VN 2M6LA 1M1NA 3R5TA 5KOJA 4WNAB 4ND8B 3K1AA 1EFDN 2XDQB 1G21B 2AFHB 3AERA 4H59A 3AESB 5KOHA 1K7SN 5CR9A 1L5HA 1FP4B 1QH1B 2OV3A 4PM4A 3MD9A 4FKMA 4XPIA 3ZK8A 1N2CA 2ETVA 3EIXA 4HN9A 4TKUA 3MINB 2YNMD 4INPA 3BE5A 4TKVB 5BVGB 4PAGA 1PQ4A 4BBPA 3ZK9A 5JJ5A 3AETA 5M3BA 5CX1A 2Q8PA 2OGWA 3NU1A 4FNAA 2PS0A 2XQVA 4H0FA 4WESB 3PDIA 1QH8B 1KARA 2Q8QA 4FILA 5I4KA 1G20A 4LJSA 1H1LA 4WZAA 3CX3A 1N4AA 3LI2A 2PHZA 4M7OA 1MIOA 3TNYA 4INOA 3PSAA 1QGUA 2XY4A 3HJTA 3K1AB 3U7QA 4CL2A 3ZK7A 5BVHB 5JOQA 1M34A 1N4DA 4WZBB 4MO9A 2WHYA 1L5HB 2RG7A 3EIWA 4OXQA 5HDQA 3AEUB 3HXPA 3ZKAA 1TOAA 4WNAA 4ND8A 4N01A 2M6KA 1KAEA 1M1YB 1G21A 2XDQA 4OVKA 4G07A 4UDNA 3MWGA 4WN9B 3AEQB 1QH1A 5FLYA 2XH8A 2AFIB 4K3VA 3MINA
chains in the Genus database with same CATH superfamily
1I33A 1JR2A 4RHYA 3JYHA 5HMMA 1XRNA 4Y6PA 2P90A 2ZJ1A 3B3FA 4TSRA 3RIMA 2ZRJA 2CB0A 1ACJA 4JBNA 1IBRA 3EB9A 3IR6A 4CM1A 4EY6A 4CKZA 5JPIA 3WBBA 1HYHA 4BQPA 1W2GA 3AXSA 3QPCA 1Z25A 4E14A 1K5HA 4R9NA 1AQUA 3WHLA 1ZVVA 2GZRA 2C5AA 1SU6A 2PSDA 5E9QA 1GEGA 2X3UA 3ELUA 3QFRA 4H17A 5TLSA 3MUOA 3TTWA 5JQGB 5I9MA 2OO5C 5EYPB 1KI9A 2H3HA 4QIHA 1LW7A 4LDPA 4NU8X 2VT6A 3RO7A 1CVLA 3N1UA 4EKNB 3HDYA 2KBFA 3RVBA 4J0DA 4GE0A 4GLFA 4RSMA 3HUFA 5CLJA 5HQ3A 3OCUA 3WWDA 1PVVA 3K0CA 3FUUA 3GRCA 3Q85A 1TCAA 1GCUA 3GEGA 1RIFA 3H5VA 3L07A 1RHUA 3P2EA 4ALJA 4QZVA 4RLQA 5KNDD 3LCCA 3CONA 4L07A 3QVMA 1G2PA 1BA2A 3PRHA 4F9EA 3L8FA 4LHWA 1CE8A 2C4WA 4LXIA 3Q6IA 3VAYA 2I4MA 4B09A 4JB2A 4CPDA 4D4MA 4HB4A 2AE1A 5ALIA 1BN6A 3FVTA 3K5IA 4LHZA 1P2SA 2BP7A 1PN3A 3FH0A 4G0OA 3PRYA 2VYVA 4TSFD 5IDVA 4CLOA 4NR0A 5HWSA 3JQ7A 4J7AA 2JFXA 2ZZNA 3DV2A 3GJ0A 4F3TA 1KK1A 3QOWA 4GKAA 2ZS9A 3JCZA 2XBLA 3G9UA 3JATA 3ZWWA 2QVZX 3UAXA 4A2QA 3QOFA 4DMUB 2XMBA 1PLLA 2PL5A 2HF9A 4KQ9A 5EMNA 5FHRA 3IQHX 4NZNA 3X0DA 4YV1A 5AVQA 3EDCA 3S1AA 2PX2A 1RWKA 4R6XA 4HZIA 3VV3A 4O4LF 4CNQA 3ND5A 1L5VA 2BBTA 3OPQA 1W5TA 2AQHA 3V5NA 4HGOA 1LPPA 2OZPA 4GMXA 5KQLA 3VPXA 1ZOPA 4LPSA 1AF4A 1FSFA 5HTKA 4BNYA 4K9MA 1SM4A 1W30A 3IT0A 2WQZA 3N2KA 1FS4A 3V8NA 1E32A 4BQIA 2CBZA 3C8HA 4IQ8A 4QARA 3SLKA 5CH5A 3BULA 1KDTA 2EP5A 3GQBB 4AMUA 2AJTA 4KMMA 3JZIA 4NZMA 3QFSA 3AZQA 1MAVA 1Q7GA 4LGMA 1MDBA 2A30A 2AI3A 3G8YA 4PO3X 1XJCA 3L1VA 5KREA 1QGUA 2O7RA 4KE8A 3HHEA 3KPWA 4E70A 1QDEA 4E51A 5IVHA 5ESWA 2WJVA 3QX8A 2HA0A 1RXWA 4KDRA 3P5SA 3V4ZA 1B8UA 1KAQA 4A1OA 1PGJA 2DWOA 5FPHA 3WYNA 4D46A 1Y3IA 3P4YA 1G38A 3TD2A 2D4AA 1NF2A 2QL5A 3AEQB 3JR3A 4HB0A 5FUVA 3WKDA 4B8ZA 1RZUA 3F7OA 2MIIA 1GR0A 1NHGA 2CXHA 2XUAA 3GDHA 3GEDA 3LWDA 4LPKA 2N1MA 4MUJA 2YJGA 4YP7A 3RYCB 3D1VA 1H2FA 5BN1A 4M49A 2NQTA 3PXAA 2ZI3A 1DQNA 2LW7A 3O4VA 3RS7A 3GRUA 4X6UA 4TQGA 3FW1A 4AVYA 1UT6A 2QQFA 1QLWA 1T2VA 4MA5A 3WB1A 3O2JA 3ZNPA 4LK3A 2ZITA 5I48A 1YS4A 3V8EA 1TU0A 4II3A 5FWAA 1C3LA 1QF6A 3JQAB 2RKWA 4EVQA 3QYAA 3JTEA 4PBSA 2GTIA 4EPYA 3IBCA 2X8JA 3R24A 4NPCA 1ZMXA 4D9NA 3TDKA 4HDAA 1X13A 1CF2O 3EHEA 2C4KA 3P96A 1ZMOA 3W9SA 5BV2P 4Q7QA 4I4IA 1FP7A 4YMSA 4BNXA 1ONPA 1XE3A 3MIIA 3VVCA 3QPAA 2XMGA 1M67A 3CY6A 5BR4A 2VK1A 2IYEA 4DSNA 1QRTA 2D1TA 4C4ZA 3NC4A 2CBXA 2HA7A 2IYPA 4BEBA 4JT2A 1JJFA 1ZRHA 3EVBA 2V45A 2AJCA 1MFPA 1T3HA 2HL6A 5DNVA 1W47A 1A9ZA 1KNQA 3TSCA 5ISMA 1O3YA 5CG2A 1GITA 2H48A 4XJXA 1Z73A 3WFIA 5JH7F 3DV0A 2CNBA 1Z5GA 3FSJX 3IQEA 5FLXA 1S7CA 2UZ1A 4JOCA 1KQNA 1HGXA 3UK7A 3QX9A 4FD2A 1LZLA 3E8SA 4ZQCB 3GEBA 4Y0VA 1L4MA 3UXEA 4HZUB 5FWYA 5LD2B 1R6BX 1P72A 3P4XA 4BNWA 1PR1A 2IXFA 4MV6A 1LTHR 1Y1RA 3G2NA 3ABOB 1ATZA 3WBKA 4U7DA 3G2HA 4OHRA 1XU9A 1QYVA 2QT1A 5CXSA 3KWJA 5AI6A 5ALTA 4H08A 5SY9A 2H00A 1M2HA 1XAJA 2W98A 3W8FA 4ZZ1A 1X7ZB 3SS7X 3L1IA 2KYRA 4QAQA 1TL7C 1XDGA 1JDPA 1DAKA 3PXCX 3QPDA 5DOVA 5I7AA 1IN1A 4K87A 4II2A 4NAHA 3IT3A 2OG2A 3BXXA 5FWNA 1YFKA 3EQ8A 2ZKLA 3IPXA 5BMOA 4H18A 3K6KA 4DMCA 3FAZA 1E99A 4LCBA 5KWEA 2WYOA 1D1TA 3A4VA 3JQGA 3JQ6A 4WX2B 4BMZA 2JGRA 2R6FA 4CMEA 1GZDA 3DFFA 5F51A 3RU2A 5J2UA 2WM2A 3V9PA 2I7VA 1SB9A 1Z8NA 1LTKA 3L7AA 1LLQA 3SYKA 1L4NA 4LGVA 2W2QA 2X1HA 4EF4A 2QX4A 4DANA 4L4UA 4G97A 2NM0A 3DKIA 1X94A 1DSSG 1BX0A 3FMFA 2BJWA 3GFVA 3LBYA 4M38A 3AEUB 4OXQA 5GPBA 4ERNA 1I7QB 3U4AA 4QOSA 1DBPA 1EX6A 4RD0A 2X9NA 2Y6UA 5IHPA 3KHKA 3ESQA 1JNXX 3ND9A 5DIFA 3ZQKA 4HS9A 1G8MA 3CVOA 2ADMA 2QF7A 3JD2A 3Q87B 4QVIA 4S1WA 2AVDA 4V0RA 2ZIAA 3OUUA 2C2ZA 1FDTA 4Z3DA 2FZ5A 4QBIA 3D7LA 2XMPA 3EFEA 2Q62A 1VLMA 1TDJA 2H92A 3FNEA 1I36A 1C2YA 2ZIGA 3HCCA 3LO8A 3ET5A 3TEFA 1N6HA 4H3SA 2P4HX 4WACA 2P9FA 2PR7A 4JC4A 2VAPA 2EF1A 2FXVA 4L8FA 3C41J 2R7AA 2EKPA 2BR5A 4ZEWA 5D86A 1I0ZA 1ISMA 2RK4A 4BX3A 5DK6A 1MX5A 4E13A 3WQRA 3ILVA 5GADl 4UMEA 1PNOA 2XDAA 4Y1RA 1TQDA 4YMGA 4XUGB 2P3LA 4PLPA 3PNLA 3SF0A 2QN9A 4I8XA 1MAWA 3E3NA 3TTUA 1U6JA 2QVXX 2EL7A 4ZHQA 1EIZA 1M7BA 1KDOA 1FSZA 3M4XA 4CKXA 5TS2A 3R7NA 2QT9A 2MCFA 1N32B 1E7WA 4PC6A 2D6FA 4P4LA 2P3SA 5EJ9A 5JDCC 1H1TA 3RVLA 3LL4A 2C9MA 3VTZA 4CDMA 1W4CA 1W94A 2YRFA 3W3AH 5KEIA 5DU2A 1NXXA 3WNCA 4E11A 1Q0QA 2I6XA 4BYMA 5CFRA 1TK3A 3A6EA 4Y2XA 5LVAA 3LLSA 4OHKA 5DXAA 2VBFA 3L6BA 3KPYA 4YBZA 1TZJA 3BWEA 4ER7A 3T3EA 1TU3A 1JDBB 1M73E 3MK31 4G4IA 3ZBUA 2IWRA 4C0JA 1UOEA 4C4OA 3O95A 4O4IB 3DXXA 3IYLW 2A9FA 5L51A 3KWFA 2YOGA 2A0FA 2CXTA 2DHQA 5DTQA 4ENVA 2O6LA 3N8GA 4RS3A 4W6ZA 4D3DA 1S4QA 5A05A 3A58B 1VHDA 1WSBA 1WL8A 1SCNE 2WIJA 3N8IA 2RI6A 1IOVA 3GELA 3UY4A 1BDIA 1DDIA 3E7FA 4MI9A 4JLJA 1GZHB 1KZ1A 1VE1A 3GUZA 2VQSA 3RYFA 4X1OA 4XX1A 1OWPA 5TJ9A 4FYPA 1XA3A 4DLXA 4B6QA 1LH0A 4EDHA 2LD4A 4H6WA 1AKTA 3AFHA 1XTUA 4RZIA 5KS2A 2HNAA 2RAUA 3WISA 4K5QA 1KFCB 5JBIA 1II0A 4K6FA 4JL6A 2UVDA 4GOOD 5HILA 2OFOA 4M37A 2EWMA 2PX0A 3HJCA 3O9ZA 3R7LA 2H0AA 1OJLA 1KJIA 1NKSA 2VDWB 3LYAA 1RWXA 4KE7A 4HADA 4ODIA 7ABPA 3AP1A 2E2WA 2H5JA 2VHCA 1YTUA 3C15C 1YNSA 1SELA 1ADFA 3QKRA 2OQIA 3H16A 1MB2A 1YXMA 4RPKA 4XVHA 1EK0A 1PFGA 1CZNA 2A1IA 1P5FA 2PLAA 5FTMA 3ZE0B 3M3HA 2XTMA 3C14C 3OZAA 1CB0A 4MUKA 4AZSA 3U4IA 3FJYA 4MSUA 1XJWA 3KHTA 4FCWA 1RW4A 3QHQA 2ESRA 4GSKA 1PF7E 4L16A 5ICFA 3U62A 1SBQA 1ZAKA 2CNOA 2DU8A 2ZP1A 2YXPX 3BB1A 2FSVC 4NULA 1XYGA 3GCXA 4NE7A 4YJ3A 1IXRC 4AO6A 1PJ2A 1D6NA 5EZ6B 2H1RA 1TF2A 3T5BA 1DHTA 2AXQA 1Z0DA 3D43A 2VI5A 4JOQA 2OWEA 2QLFA 3K2QA 4BCDA 4Z7QB 4AS2A 1U65A 4PPGA 1DFHA 4AMYA 3NORA 4TTTS 1DUIA 2HMWA 1EBUA 4XGNA 4ALLA 2VWHA 2G36A 5LDDC 1O4VA 3NHLA 1IY8A 1U7OA 2Y92A 3NETA 5EP3A 4ZEMA 2ZJ6A 3C87A 3RQSA 4MROA 3TRHA 1Q3HA 4QRHA 4NJEB 1XQVA 4QHSA 3GLGE 2QTRA 4BFSA 1XG5A 2GBIA 2OXRA 1N8SA 1Q0RA 2HDOA 3GZTB 3RASA 4V38A 3O75A 1JDVA 3TAXA 4UHKA 2AW5A 1EWRA 3RNLA 5JC8A 5A0TA 3IUBA 2FQXA 1VJRA 4L72A 4UUQA 1A88A 4MJ3A 1ONBA 5EAIA 1PJ3A 3PR1A 2DE0X 3AVUA 3WICA 1TJ4A 1KC3A 2HEGA 1QX4A 3F5DA 4AG6A 4C87A 1XF9A 1MPXA 3MJVA 1FLAA 3I6QA 3K1JA 1JT9A 4OKNA 1YBHA 5JS8A 2HRCA 1HT2E 3CVVA 1EFRD 5KHLB 3O8QB 1NNSA 2J85A 3ZD7A 2ZI5A 2CJWB 3WO0A 3ENKA 1L8QA 2VCHA 1LZKA 4J1TA 2E85A 1O77A 3V7FA 4ZQFA 3OWOA 1YBVA 3CN7A 1GKUB 1XRQA 3F8WA 3H1GA 4Q01A 3V32A 5AM0A 1DJQA 1PHRA 1XCLA 5FBLB 5TQ0B 2WIDA 3FOCA 3D0KA 4R51A 1Y1QA 3IE2A 4BECA 4LDNA 2H5LA 1RE0A 3I45A 4KMSA 4BJ3A 2P6RA 3R40A 4Y1EA 2UYGA 4MYTA 2V0GA 4N7BA 1O6CA 1VL5A 4Z9BA 5BSKA 4BFUA 4D2IA 3F78A 3TVTA 1ACMA 1Z62A 5TPWA 1RM0A 3AETA 1K8XB 1RYHA 5AHKA 1Q74A 2IYYA 3EGDA 1BOOA 3PP8A 1EM8B 4ZOLF 2VCYA 3WLMA 3KVOA 1ZUWA 4OMCA 4E6EA 1YL6A 5CJPA 3LRPA 1YQQA 2R1ZA 4ER5A 4F9TA 2PUDA 3OFJA 2DY0A 3P94A 2J0SA 2CLHB 2ASEA 3Q2KA 4XUCA 1XDDA 4JQSA 5AUQA 3EZGA 3BRWD 4MMXB 4YACA 4AJOA 1K3FA 2DQZA 1DUVG 3KSUA 4DUGD 2IBSA 2NUPB 4P1ZA 1K6IA 3OFKA 4UHHA 4TQ9A 1P2FA 1P4SA 4G81A 5D85A 3B3GA 3SX4A 2Q0XA 3R0IA 4W5JA 3TIXB 4DCPA 5BNIA 2HRBA 3MMSA 3WOVA 4KV7A 3HB0A 3H2GA 4TMFA 5FH9A 1E1DA 3I5UA 1IUNA 2QHXA 4ROSA 4RTSA 3IOMA 3JVDA 4JJ8A 3LPMA 2FWMX 2DQSA 2FWNA 2Z1DA 3ZXUB 4BGEA 2PXXA 2JF0A 2Y4OA 3OE4A 3NJRA 2EATA 3Q3HA 4JASB 1KEEA 4AJHA 4U9HS 2XADA 3L0ZA 2AFIB 5EJ2A 3P0HA 4X7MA 1I30A 3FTDA 4ARIA 1G9TA 1K06A 4G1CA 1P4JA 4DJTA 3Q11A 4FFPA 2XV1A 1WCV1 1OBHA 2QTGA 3MMNA 4FHGA 5FPPA 1OV4A 4ENTA 4IW3B 3PLRA 2V7GA 4ETIA 3CURA 2UUAB 5K20A 2HCJB 4TLEA 5I8PA 2MSCB 4WA7A 1QLJA 3T3IA 2ZATA 1E9DA 4CUKA 3B1VA 1U0RA 3HCWA 4YT5A 1NW8A 2V6JA 2JJ1D 1GG5A 1SHKA 2DWUA 2JLCA 3ZIUA 4DC9A 5KWIA 3U44B 3HCEA 9ATCA 3CX8A 4FHFA 2CVZA 2DAPA 3JRXA 3IT2A 3L0PA 2OT3B 3D8UA 4U2CA 1U3TA 1PLKA 5LZ9A 4BE9A 1BTOA 3SKXA 2AEJA 3A3PA 3U9TA 2Q2WA 4ZT5A 4CKWA 2XE6A 1IZYA 1K7YA 1RAGA 2P4QA 4GT1A 1KJWA 5DOZA 2ZK7A 5FX2A 5IWCA 2IVZA 2C7VA 1RWMA 4IMPA 4C07A 5KJEA 9LDBA 3WRYC 3L6CA 4X6YA 5CFNA 1T9AA 3KZOA 2CLFB 2FP4B 1JEJA 5ARDA 5J1SB 1Y5LA 5FOQA 3E35A 2BHTA 4CG0A 2O8FB 2GK6A 4RENA 2V9PA 4UW9A 2IHTA 2F90A 4AZWA 2PMEA 1MA0A 2QRNA 4RNCA 2OSVA 4QU5A 3HYNA 2FJ0A 3AUYA 4B85A 3RG8A 1W6UA 1DI0A 3TLZA 4AYTA 1SXJA 1EU1A 3I9MA 3CX6A 4AQ7A 1IK6A 1YZGA 4DG5A 1I2AA 1F0PA 1SWWA 1BYUA 2QY9A 4FUTA 2YWEA 4EB8A 1YZFA 2NIPA 4HVCA 1MO6A 5LL6P 4X44A 1UJBA 4Q7KA 1M8KA 5LZ7A 3G17A 3K0FB 2XYGA 2C31A 3MILA 3MOIA 5DXJA 4QVKA 4ZCQA 3ZDRA 5LJIA 5HW0A 1L1RA 1DX4A 2R751 3N86A 5A02A 2A8YA 1SCKA 3L0DA 3U0VA 1VIMA 4PXSA 4IZHA 1TMYA 4QOJA 4IX1A 1C81A 3D8HA 4KEAA 4DA0A 5TT0A 2AUTA 1E5TA 1QMPA 3NV9A 1TVKA 4FGJA 1REQB 3M6AA 2YVKA 4IHJF 2CHQA 5IAKA 4CM7A 2VR1A 1F9AA 1NXWA 2OM6A 1XTTA 2WTMA 1EVYA 1JR3A 2ZB2A 3RVPA 3PX7A 3GFTA 4WCFC 5FL3A 2W22A 2XRFA 4XXHA 1Z39A 5F64A 4U2BA 5B4TA 1IG0A 1JLLB 2ZBEA 5COQA 3K2IA 3RUFA 2V6GA 4XIFA 2XUOA 3FMPB 3IPYA 2OL4A 4KYUA 4MWTA 2I8LA 2X9LA 1MBZA 5DBIA 3WNZA 1IB0A 1ZM7A 4MO9A 4KGZA 1EZZA 4LRQA 4Y1FA 5IZCC 4EVSA 2NYVA 4EJ2A 4W5QA 2ZRNA 1HLDA 2WUFA 4M6WB 3FCUB 3JWIA 3DEFA 1MEJA 2DX7A 3H9UA 3H5NA 4G01B 1SZPA 3A4YA 3BGDA 5DEOA 2P2SA 3G0IA 2CEAA 3SVTA 4HEA1 1QFMA 2BKVA 3C7AA 3T5AA 3A6JA 3Q10A 1XD2A 3UC5A 3K4HA 2OY0A 4GMHA 3VKVA 3VOSA 4D92A 3KZXA 5E9AA 4IFBA 1RHQA 5CURA 2JCBA 1J1ZA 1DKRA 4V2IA 5EZ5A 1YO6A 3FMOB 3IQGX 4YONB 5LOVB 4RVDA 5L4NA 3GMDA 1AJEA 5DNAA 1U7UA 1G8GA 1TJNA 4MLPA 5DSXA 4Z0HO 4ENQA 4QEZA 3ADCA 3N6VA 2HEIA 5KYXA 1FVOA 4FWIB 1AGYA 4P3KA 3LBNA 2VDQB 4ZOBA 4YRGA 5IF9A 2GCOA 1CJTC 1ZU5A 2J8ZA 3O26A 2V6IA 4QNMA 2YUIA 2BFEB 4O4JB 4EHDA 6GPBA 4PS0A 1GEEA 4PPNA 3THYA 1IZ0A 1EVQA 3AZOA 3HFGA 2DR0A 3R76A 1RYNA 3MERA 4EYGA 1LBTA 2IGBA 3CRW1 3LQFA 2V5VA 1R27A 5I7UA 2V6BA 2ZR8A 4R2LA 1KMHB 2GNAA 4AMZA 5CP8A 1XZPA 1WMSA 1QUEA 3VGPA 1PJBA 3WA6A 1TT7A 5HUJA 5JZVA 4FFMA 2QN7A 2G9UA 3WLSA 1GG9A 5LP6F 1C9MA 1ZFNA 4M21A 3O82A 5JD5A 2GK7A 4NATA 2QZZA 3BM5A 4G4GA 1DXOA 1KYVA 3LZDA 4Y2SA 3RSZA 5ITZA 2KMLA 4KNYA 5AJUA 2SKEA 2JVJA 3DZBA 4J7CA 3DHNA 3EMVA 1KQPA 5LWQA 1M1NA 1KEKA 2A4KA 3DPSA 1UXHA 1X86B 2AFHB 1N5OX 3KWMA 3AESB 4PYOA 1DBRA 4P34A 2R4QA 1GGFA 1ZBDA 2VYVD 4TTPA 1HURA 1WVIA 3MJ4A 5KIAA 3FKSD 4HAUA 3L6UA 2UYOA 4WLOA 5BYJA 4IS2A 5KCZA 1XP8A 1JA0A 2XUHA 3IMFA 5HQJA 5T5QA 3RVNA 4ER0A 5KVCA 2JLZA 5FUYA 1P2VA 2O2JA 2AV6A 4RGQA 4QODA 3VNQA 2Y6VA 3IOCA 5FRDA 1M6WA 2WICA 4FD3A 4KAXA 5HGJA 5CT6A 1P29A 3I1YA 1U80A 2PS0A 4RYLA 4Q18A 3G0CA 1RYYA 3CPJB 3B12A 3LHDA 4R1NA 5FTNA 1RC0A 4L02A 2M1ZA 3RS0A 1S01A 2V3WA 2ZS7A 3CEMA 1MOQA 3K96A 5AKKA 3W90A 1JU4A 2GPTA 1II8B 1CC1S 1KNXA 1NJ2A 2PGJA 2R84A 3ESZA 4BNLA 4BO1A 1QB7A 4HGRA 4IMIB 2O2YA 3FHOA 3HG7A 5KTSA 3IGFA 3PX2A 4ZMBA 3C6BA 2CDNA 4LX0A 4OGKA 3N2YA 5FOSA 3EW9A 4D9FA 5JQWA 1BRMA 4LMRA 4Y2JA 1D1SA 3D1LA 5T4FA 4W99A 1J5XA 1JKMA 1RJWA 1JG1A 1DXHA 2PLRA 2ZDQA 2XIJA 1NW5A 3C3DA 2HBRA 2I34A 2Z09A 1ZS9A 3MPOA 1E6EA 4P08A 5THXA 4H77A 4XSGA 3WKAA 4IICA 1G20E 3RARA 1FMFA 1UMKA 2QP9X 4L6CA 3F46A 1X8JA 4P7BA 5IBQA 3AG5A 3L0OA 4B8WA 3MYYA 2BUCA 2QRUA 4JHXA 3ZEIA 4JI2B 1ORIA 2H9IA 4MVJI 4J16C 4B0PA 3KQPA 4CF7A 3A32A 2OYCA 2FWIA 4F3KA 1QHXA 4DLAA 4FZ3A 3BHNA 3L1UA 5MN6A 2OMKA 4E5NA 1FYVA 2GBCA 4M55A 2PEZA 2BM0A 1WQ4A 4H6PA 2P9TA 1E66A 1YKGA 1C1HA 1LX7A 3ZWCA 4YT2A 3BIXA 3GPLA 3TOXA 1ADJA 3FWZA 5T4EA 5ERXA 4FN5A 1EQ2A 4G8BA 4IMRA 1RM4A 1ULUA 3WBFA 5KSYA 1VPTA 5IVIA 2IK8A 5C34B 1XVIA 2WP0A 4KQEA 1NT2A 3H5LA 3KZKA 1SXHA 3O3OB 1VMAA 4LZZA 2VK8A 3D3WB 2B98A 3CCCA 3F3KA 2D7JA 2HC9A 4M1WA 3MJDA 3KLNA 1U3VA 4TL8A 5TPZD 2DULA 3GEIA 5JADA 3I8XA 1RHMA 1SUDA 3VPDA 4DL9A 4UBMA 4D0LB 1LU9A 1SQ5A 3WIDA 2DPLA 2Q5IA 2HYDA 2W2OA 3DAHA 3ZH9B 4QUIA 1RVV1 4Z3OA 1JMYA 4Z4IA 1V25A 2QRJA 4PW0A 1UK9A 3Q72A 5FI1B 3V4OA 2JA1A 1W1UA 2PZ8A 1YZHA 4MO2A 3HLKA 1LQTA 1XTVA 1ODFA 1QGZA 3KKZA 2WWTA 1HT1E 2GJ9A 5HUQA 1C3EA 2GEVA 3T1QA 4OB7A 1QGOA 1G21B 3GUVA 4Y6RA 5GQSA 3RVJA 1D0SA 4MVJP 1V35A 4IX9A 1H3FA 1TB4A 1R9MA 4PFJA 1JQEA 2EEPA 3GNLA 4LUCA 2JD2A 3RSHA 4EUSA 3HXTA 4CE6A 1S3SA 1JFRA 4YCLA 2O4CA 3KKMA 1RM5A 2JGEA 1GUFA 1XEWY 1VSUA 5JSQA 3T3NA 1FJGB 4HQOA 5FOTA 3LPDA 3TOVA 2YVQA 1I6LA 5LYYA 3RS9A 3W2HA 4BTVA 4QTXA 2XAUA 5CX1A 1NIJA 3C0KA 3PENA 5FUWA 3EOZA 1BW9B 2A92A 2WT8A 4GZLA 4OQQA 1IOLA 1LPOA 2CVOA 2P0AA 3BCUA 3O92A 4HN4B 4TROA 1T8SA 1QR6A 3UB4A 4DCGA 4EKDA 4ILEA 4ZV4A 2O8DB 3EZ6A 1PUIA 2Q6IA 2OXCA 5C1DA 3FWYA 4Q34A 1T0HB 3VDXA 3WXBA 4D25A 3UT5B 1I9CA 3DW3X 3RSQA 4J4TA 3WYDA 1XYVA 3QVGB 4YRQA 5FTKA 2V98A 1ZHHA 2II6A 1JYFA 2UDPA 4TN1A 4PSCA 3S2SA 2FU5C 3OZXA 3ROMA 4F5WA 3CF0A 2QQGA 3GJ6A 2WZCA 1M6VA 3EIWA 3G8BA 3WX0A 4IVQA 5JAOA 2IUTA 4JHLA 2Z04A 1X7XB 2GEDA 1M2OB 4DXHA 1R12A 3G2MA 4EJMA 1HK7A 3SBOA 4G0ZA 3PEUA 5I7WA 3Q2OA 1DADA 2H4XA 3A25A 2Z98A 1QWOA 2GOYA 1QU3A 1IK4A 3QXXA 4WKNA 2JZNA 1XKXA 3TIIA 5JFTA 1TJ5A 2B99A 4OA5A 4WEOA 3A9CA 5EJMA 2VK2A 3IVAA 3D5QA 3T7CA 3IA7A 3VR5H 2W2MA 4ROTA 3T3OA 4DMHA 1E9VA 1T2AA 4W6QA 2I67A 5KOJB 4CKEA 4JT4A 5ILQA 2PMBA 1U0GA 1JTVA 4CV2A 5DF1A 5KOHB 4J0GA 4D9HA 1S02A 1HQCA 1IEXA 3H17A 1DKNA 3MWLA 3EQ9A 4PYQA 5DZSA 4OFZA 4BMYA 4EKIA 1E79D 1KF0A 2IVFA 1OH5A 4C4XA 4CF6A 3OT1A 4TKUB 2BKUA 3UANA 1IUKA 4J3FA 2RB4A 4MUYA 2W93A 3ROXA 3U5ZB 1ZRNA 4MWGA 2IDZA 1CQJB 1QO9A 1RZVA 1OZAA 3JY6A 3LUDA 3BF7A 2A78A 4J2OA 5J2UF 2VTDA 4P4UA 4AZTA 9LDTA 2B37A 4YX9A 2LCIA 2X2EA 1XF1A 2AKAB 3DDUA 2GK3A 2JLQA 3V9AA 2FCRA 3VZPA 2W0MA 4WFIA 4BNDA 4IVPA 4OFWA 3HUEA 4GO1A 2PA3A 3GZ4A 4OLJA 4E5UA 3CF4A 4JU9A 3FE2A 1KFJB 3OTIA 2EQ5A 4V0ME 5JZBA 4LQDA 3NPAA 1X70A 3W7AA 5BURA 4LF4B 2RGGA 4N5MA 4Y2UA 3GGJA 1H2RS 3C7TA 1EFCA 2QGFA 2R1TA 4M54A 4F2DA 2H4YA 1JDSA 3OKFA 3SGLA 4XIYA 2FK8A 4CMHA 1ZRSA 1K98A 1UWKA 2Z5GA 1L7MA 3A6LA 5ALKA 4E3WA 3ILHA 2CKMA 4BZQA 2TMGA 5K0GA 1T3ZA 3LRTA 3PJFA 4WNAB 3HL0A 1EG7A 1A4UA 2YH2A 3PWSA 1GA6A 4BL5A 1EUYA 1SKQA 5LYJA 1FX0B 3D2LA 2IWHA 5BW4A 1FP4B 1VSVA 2EKZA 1YSCA 1KDPA 2JHFA 2WWXA 3FDZA 2AXEA 5GY7A 4AQDA 2H2HA 1LVHA 4RFSA 3SN6A 4WJLA 3OQIA 1XTZA 1L9KA 1EWQA 4A15A 2P8SA 3R6DA 2C1EA 3G7UA 3KYDB 1BCSB 1P44A 1PTJA 3R1IA 1NVTA 3R3XA 5LQCA 1P5JA 4L2IA 1FY2A 2DJIA 3JQBA 1A7UA 5DM2A 3T7KA 1ZCFA 4J29A 4N5HX 4DMFA 2O23A 1F2TA 4LF5B 1XVVA 2DHDA 1NN3A 3EA0A 1U1EA 3O9MA 4ZHQF 3IPCA 1WBDA 2GB4A 2PDAA 8MHTA 1XAIA 2FN7A 5KAPA 3RUHA 1NUHA 2DWQA 1BQ4A 4IDCA 4Q9JA 3WLEA 5LXTA 1O1YA 1WZ2A 3VO1A 1A82A 1ULHA 1UQUA 2PJDA 5E7QA 3T52A 1M7HA 3RRXA 2RD2A 2CV2A 5CYPA 2V7TA 2CFRA 3AM3A 5SY6A 3LPCA 3S27A 3GEEA 1Q7TA 4DUPA 4CL2A 5E6SA 1JEDA 3HB4X 3V7NA 3TWOA 2K87A 1GTVA 4M1KA 1E98A 3L7CA 1HNNA 3I58A 3OF5A 3PGA1 2X2OA 3OSZA 4H35A 2R3SA 1U5BA 3O8NA 3R8FA 4TSKA 4C1BA 3MWGA 5ALXA 3K16A 3COSA 5T64A 3VR4A 1SBIA 2OENG 4S05A 1UFVA 1Z0JA 4PGHA 3NYQA 1AKYA 3IUEA 1OGYA 4Y9SA 3RVQA 1ZZEA 1BE8A 1YOVB 3PPIA 3QTBA 2AOUB 1UAGA 1SVUA 4GC9A 1IHPA 3INRA 1GL3A 3KQWA 1QRRA 1UC9A 2ZWPA 5IRCD 2B21A 5MGBA 1JDNA 1XLVA 1VDMA 1VPVA 4NU6A 1NP6A 5KNDH 4RPCA 1DQRA 2BF7A 4RVUA 4G1VA 3LP8A 4UVDA 5H16A 3TMYA 4KQMA 4BMOB 1M10A 2Q29A 2ZUUA 2AL7A 4LZAA 3B85A 4ZEXA 1YBAA 4C30A 2NTJA 4AJ2A 1F51E 2PTHA 5KC8A 4D8YA 2OLEA 2WJPA 3RTCA 3COJA 3G82C 2Y0PA 3T1VA 3V7YA 3LQQA 2O2SA 1UP6A 2ZIXA 3FZNA 4J0EA 1NY6A 4QYSA 4N0DA 3RUEA 4BO2A 2ZIEA 2WF7A 2ZANA 3BXFA 3LCVB 1U2DA 3NWOA 4UTZA 3SC2B 4Q7MB 3A27A 4RDHA 3D59A 4URXR 2GHTA 3ODGA 1A8UA 5GZ3A 5KSZA 3GXOA 5ALJA 5KQRA 1X1AA 2LXNA 4X8MA 5AVWA 2ZRAA 1N2XA 3VSDA 1F4VA 2ZIZA 4L9AA 5E0OA 1WUYA 2XLCA 2DQKA 1E4EA 4R9SA 1UXOA 1AURA 1XMQB 1G5FA 2HMVA 2GVZC 3M2TA 3AY6A 4RJJA 4KFSA 1NUUA 3DTVA 3OF2A 3VR3A 4ARAA 3HDTA 1G2IA 3WQHA 4WA8A 2J45A 4AJJA 1J20A 1N6RA 2I6UA 4BMCA 1HE4A 2CUTA 1ETUA 1V71A 3QKIA 3ANTA 2XF2A 3QLUA 2DH6A 3KZCA 4FT2A 1VLJA 2LCFA 4OH1A 4OYHA 4YMIA 3U3RA 4JODA 1U8AA 3HPQA 1Y9DA 1L5RA 4FC7A 2GPNA 4YJ3F 3ROQA 4TRMA 3PFKA 3BHMA 3FGOA 1ES9A 1J00A 2VHTA 3N2LA 4FBMA 2YDYA 4I9GA 2QE7A 3D7SA 3T7JA 1D4ZA 1ISJA 2J3DA 3G6WA 4GE3A 3CZPA 4PRKA 1DX9A 2MDTA 4E5DA 5KB3A 2RE8A 5AVXA 1TM4E 4XFKA 4E5VA 5K4HA 4ARZB 5DCLA 1SK8A 3R44A 1QOZA 2CLIB 2NTNA 3D3JA 1YQDA 2V7QD 3P2MA 4C4PA 1AX9A 2PXCA 2EQBA 3LQYA 3PA8A 3EXIA 4S24A 1DT3A 1XMXA 3GCWA 4ARCA 1DTSA 1WPRA 2ZZKA 3L9WA 3NBUA 4HFMA 5HM8A 3THWA 5DYGA 4CRWB 1W581 4TN5A 3WSTA 4G4SO 4WUVA 3TDMA 1K2WA 2P5YA 4I50A 2Q1XA 4D43A 2J5BA 4D0RA 5D01A 1HNWB 2VJAA 4EGFA 1GQ2A 3VC3A 1KERA 3GGGA 3M8KA 4XVQA 1EBFA 3JD3A 2YW9A 4GMFA 2AXNA 3VM6A 4B5LA 3R20A 1I1HA 3DMHA 3EXAA 2GBFA 3ZHZA 1DIAA 1TA4A 1XQWA 3U7RA 1IPEA 4Z4EA 2YHBA 3DE6X 4KFRA 1WIWA 4Q21A 4TPKA 5K0EA 3GLFB 1W88B 2F7SA 3AL2A 5EN4A 2IDKA 3EEIA 4LHXA 5EIHA 2DYKA 4JI0B 1UOQA 1QHNA 3AH8A 2Z6UA 1UJ2A 5DO9A 1JRLA 1BJKA 3DWEX 3ITDA 4NS4A 1NNI1 1ULSA 1K6XA 2YW2A 4G41A 1BNCA 1JXOA 3EC7A 3TZEA 4ZAWA 1E1QD 2PS1A 1TZ2A 1TTHA 2DFLA 4NS1A 4RF3A 4B34A 4FSXA 2HLDD 4DDHA 4JNKA 1WW2A 4R4JA 4U5XA 5DP2A 4WPGA 3TLJA 1J0CA 4EBBA 1NJGA 2PQ6A 3EUWA 2W6ZA 3W7VA 4BYGA 1ZICA 3ZXXA 3ZWBA 1ULAA 3ZHSA 2GNOA 3N2ZB 4HVAA 2P1DA 3Q4GA 4GZ5A 2EJWA 2C5SA 1T15A 4G2NA 5DCWA 3W4IA 4BEVA 4UFPA 5ICEA 1Y0BA 2GFHA 4EW1A 2NYUA 4KO4S 1W85A 4KU4A 4PQYA 4LOJA 4PLFA 4WASA 2Y0EA 1Z4JA 3NUGA 3L7OA 2YV3A 1ZUNA 2YJ4A 3GUCA 5HF9A 2DJ5A 2AMFA 5DTRA 4QDJA 3PUHA 1F9EA 3F9IA 5AW4A 1FLNA 1WSAA 4MTLA 7REQB 5K01A 3SQLA 2FPMA 1ZWKA 3GRKA 3T9FA 1W4RA 5CB4B 4MVYA 1XU4A 2PH3A 1IPHA 1LQ2A 1PJZA 2XQFA 4MDHA 4BLPA 5KWJA 5ED0A 5BYAA 2B69A 5JTTA 3PDIB 2GLUA 4BX0A 2GYVA 1W52X 5ANRB 1G3IA 1B00A 1TRHA 2Q5JA 3PQ4A 4IDOA 4GI7A 1V96A 2QZSA 5JFGA 4ICIA 1B14A 3AM4A 3PFCA 3QX7A 1J9EA 2FYTA 1E7QA 5KJ1A 4IUYA 3OM1A 3DH0A 3M5CA 4MIKA 5EE3A 4JB3A 1IHDA 4W1RA 4FM9A 3VFDA 1KBZA 2D5BA 3DMTA 5E38A 4FX5A 1Z6PA 5KYUA 1YUMA 2ZJ5A 4M8NE 2ZW9A 4HWOA 1GZVA 4NOLA 1U98A 1EUCB 1DX6A 1PL0A 2QLMA 3BSSA 3A4NA 4HXGA 4IP0A 5THQA 3ZX4A 2IH4A 1QH1B 3DE3X 5J58A 1U1FA 3R3VA 3PL5A 3DOIA 4IOKA 1VYHA 2CUKA 3DF9A 1YBFA 4Q3AA 4W9RA 1C7EA 2X3YA 1PR0A 5JBQA 2WIKA 4B76A 5I7HA 4YCAA 1E62A 2XYRA 3KSBC 2DC1A 4K81B 5MDHA 4RZQA 3JD4A 5K09A 1JQDA 5ICMA 1DO8A 2A3RA 5GONA 4PYLA 1OIVA 3DUWA 4OAQA 3SU8A 3CLVA 4M9SA 2NO9A 2WJHA 2H2DA 1EM6A 3HJFA 3W06A 3W5AA 3GZNA 3R7WA 5B1SA 4RPHA 1P74A 2RH9B 3FPHA 4BNJA 1Z26A 2NQ2C 3ZUGA 2D1QA 1B0AA 3QKSA 3MWDB 1D2NA 4JBHA 4EMUA 1U8UA 1Z0ZA 3TLGB 1ORRA 1E2NA 1PSWA 1TLTA 4DCNA 3CNBA 1STOA 2B1JA 1WXEA 3VBEA 1JR3D 4J4HA 1AXRA 3U3MA 1SCBA 2BEWB 4ZREA 1KJJA 4L76A 4ETNA 1KAEA 5JEEA 2TMDA 2VP0A 4D41A 5JD4A 5KTRA 3DD5A 2CLOB 4KL8S 3SEQA 1JQBA 1QYIA 2ZUEA 4JJKA 1IVNA 1HF3A 1L6RA 2QRVA 5FPSA 3ZTYA 1OAOC 1BS1A 1SB8A 2F3RA 5EZYB 4CG2A 2DT8A 2EEZA 2PD6A 4CMAA 5JROA 1RZRD 3AL0C 2RI1A 2SKCA 2X13A 3T99A 2D74A 2FPLA 2H18A 4J75A 1JP7A 2JIRA 1FW6A 4RKQA 5BRJA 2ZRFA 5JCJD 4R9RA 4CJXA 1PDWA 3SP1A 2CCGA 4IGAA 5EI5A 4UE6A 4XARA 4FS8A 5DM60 1D0IA 2G80A 5H4GA 4Z4QA 1DPGA 1LPAB 4XIJA 1FLDA 3TNDA 3STXA 3TZCA 4B3GA 2UXDB 3OH8A 3KR9A 4TLBA 3QOXA 1H4QA 3PXGA 5JSYA 3S2ZA 5DTIA 4AG5A 1DFGA 4GPTA 2PN1A 2SCUB 2Y3IA 1SCIA 1L8OA 2ZJ7A 5ALHA 4EYEA 5JYCA 1DBVO 2W4MA 4DWOA 1FS5A 2B1QA 3QIVA 2CXRA 3Q3CA 3QJ5A 1UXKA 4JSTA 4Q9NA 1Y4AE 4YV2A 4C4TA 5DN9A 1JQLB 1XC7A 2R44A 4OI1A 3HB7A 3AILA 1L4HA 5E1MA 3ABZA 2JGDA 4NCIA 5HF5A 1SULA 1M1YA 2GF2A 4F4CA 3RKSA 3U6BA 1MQ9A 1V7ZA 1DRUA 3K73O 1W29A 4BB5A 1KMNA 2FX3A 4CR8A 4G56A 4XVUA 1D9XA 1BC5A 2QEQA 4BBZA 3PGVA 5JVDA 2PJRA 5FPTA 2HIAA 4L0MA 4M8KA 2ZBFA 3WWEA 4GFDA 2ASVA 2P11A 3D7RA 3IAEA 1KMMA 1SIUA 1NP7A 1W2HA 3B2NA 1EGAA 4Q7LA 4UTPA 3THXA 2YMQA 3PGLA 5FTJA 3UMBA 1L7RA 5KDOA 1GY8A 4BZXA 3C8ZA 4GMKA 2JLAA 3E61A 2Y9PB 1TMGE 1X8XA 3JSAA 2GEJA 4R8MA 3SBDA 4ALKA 3Q0TA 4PNZA 4C4YA 5EP2A 2I99A 3UG7A 2QMHA 3NOXA 2VK4A 1PGPA 3BD8A 3QBVA 4RYDA 3AKZA 1Z06A 4QNNA 1MRZA 1WKCA 2JEOA 3F7TA 4BLQA 2XWJI 4URFA 1RXSA 2QWXA 3R6TA 4NIMA 4BVGA 3N75A 4FONA 4NLLA 2NZVG 1MJGM 5BN3B 3Q6MA 4YJGB 4MS4B 2D0PB 1EFVB 1VHTA 5CM2Z 2QZ4A 4J9UE 4KO3S 4EG8A 1CDOA 3CBQA 4U1RA 2WUGA 4UXIA 2OCIA 3QFTA 4E7OA 4ZCIA 1E1RA 3H83A 2JFUA 1U4OA 5F76A 5IH7A 1TD9A 2ZJ8A 4I4TB 4D8XA 4QYMA 3FX2A 1DXQA 2KBEA 1TZMA 2HPHA 4P0TA 1MO4A 4C76A 1D6MA 1ML4A 5BWLA 3MF4A 3IB6A 1NW4A 3RWBA 4QT4A 4BP3A 1JMVA 2AX4A 1VG9B 3OIFA 5DW3A 4QDUA 2AQKA 4INOA 4OSEA 5K3DA 1TFRA 4J0FA 4JI8B 3AUTA 5JS2A 5G3ZA 4DIKA 4FGLA 5CAEA 4LW8A 4TV8B 2ZRBA 3AUJB 3WR5A 2ZWAA 4QDTA 1GUDA 4H1WA 1PFVA 2UV8A 5A4JA 3K70B 1LS6A 3PE4A 2G76A 4C7XA 3S8YA 1JX6A 3EOBI 2NSYA 3ZLBA 3W6NA 4Y6GB 4OVKA 3K1YA 3TRJA 2O8CA 4MUAA 2BI7A 1T9ZA 1KVRA 4PYKA 1DKOA 1F8UA 1PNQA 4U2KA 1V95A 2BEUA 1PS8A 3IBYA 1EGHA 1XCGB 2WAAA 3E03A 3KLOA 3R5FA 5BWBA 2PYIA 2CNWA 4GXNA 5HJ7A 1C3OB 3Q15C 4Z53A 4NQZA 3EPRA 3TUIC 5BVGA 3CLRC 2NXNA 5MN5A 3ORFA 3KKLA 3JYQA 2NWQA 5BSHA 3RGWS 4X7RA 4EAAA 2PUVA 3BJRA 1T6XA 3NHBA 2IIVA 3REFA 1QLHA 3L7IA 5CDSA 2YHIA 1DWQA 1XMJA 3ZZ0A 4BFYA 3A9SA 3FPJA 2VUTA 3CWZA 3OM9A 4QQFA 4JY7A 1RP7A 3EZ7A 4R2IA 2WHEA 4Z7JA 1D9ZA 2WIBA 1GNLA 4JR2A 4RD4A 4MDEA 1I2MA 3U1VA 3MMXA 2PLFA 1DV1A 2ZAIA 3KP1A 4OOEA 4TZKA 5TMBA 3UC9A 4E6PA 4TL9A 2WTUA 1J8DA 2Y1DA 3JAKA 4J8PA 1HSZA 4YCJA 5DHRA 3ZQ6A 1EPUA 5FD8A 4C7KA 1LDMA 4X20B 3DOJA 3D1JA 4D4LA 4GVPA 1TIPA 2O5RA 5U4QA 5AJYA 2XE8A 4M3NA 5FBWB 3RHSA 3M89A 1FFYA 3CO0S 2R85A 2GKSA 1B7GO 4JIMA 3JARB 1C9JA 1SCJA 4MA0A 4D6PA 5BV8A 2G1PA 1PFYA 3K9QO 3AU9A 4FUQA 3G5UA 5BN4A 4XI9A 3GL9A 3AFIA 3Q41A 5KNCA 1I5OA 4FI3F 1GA1A 4LY6A 3TEMA 1LD3A 1L7QA 5TQ2B 1U0TA 2OQ2A 2FKNA 1P7VA 3IS3A 4FDVA 4M60A 1V4BA 3BN3A 2PH5A 1JR6A 5ALQA 4FOLA 3PXBA 4BX8A 2AVNA 2YYZA 3TFQA 1OYVA 1AE1A 1FFCA 3OM0A 4OHBA 4ZOLB 1VXOA 2IYSA 3IKLA 4NCBA 1UFKA 2ZYVX 2FE1A 4FMDF 4XB6B 4M1TA 3U7GA 4DJ5X 1VCIA 2WIFA 2JBAA 1BA3A 1NW7A 3Q5GA 1UDBA 1V5IA 1WUHS 3TH5A 3W05A 3H9QA 1P39A 4KSCA 3B3AA 2VBGA 3TW8B 2DUUA 4OXXA 1A95A 4R83A 2UKDA 4B32A 2D06A 3QRWA 4EENA 2XQVA 3DZFA 4Y2HA 4MI3A 5A9SA 3NHUA 1QP7A 3AONB 3BHJA 4P9NA 4QM7A 2HTEA 2YCBA 5F5XA 4LSWA 1L8XA 1P1HA 3AKDA 1PG0A 3EY9A 4W9NA 4FEEA 4WZAA 3VSCA 3WBJA 1V3UA 1ZISA 3W2GA 4TVKA 5K7SA 4RAQA 1QO0D 1CEXA 2VP4A 4LTDA 1XMPA 4CM6A 1QHYA 4MGHA 1H4VB 3I2KA 3LOQA 2FFBA 4DSZA 1XK6A 4QXOA 1X1TA 1PS0A 2WF8A 2ZRCA 3CLSC 5HFAA 4EX7A 2XZPA 4FFLA 4FZJA 1AM4D 4HNVA 2VSXA 1Z5PA 1VE5A 5G4KA 2A86A 3SI7A 1T2UA 5REQB 2AN9A 3IUYA 4ZMRA 3DDWA 1SCUB 2YWGA 2PAFA 1Z7YA 3NJ8A 4ZKDA 1JMKC 4JVMA 3OSUA 2IDMA 3JRNA 4H7KA 4MX8A 1GTRA 2H52A 2ORYA 2XOKA 4NFLA 5ADVA 4JBGA 2AW3A 3TQCA 1MGPA 1ZK1A 5AVJA 1I6MA 3B1WA 1ADBA 3CT6A 2PSSA 4YI5A 1GL6A 2I7XA 3MXOA 3FFWA 2LWIA 1HTBA 1WCYA 4A03A 4WEQA 1G41A 4YRDA 1CP3A 5AI4A 5FI3A 2P2NA 2RIRA 2RHBA 2YZMA 4XSVA 3GBVA 3GFBA 2IKQA 3H4TA 4D4KA 3ENWA 3OLZA 1GTJ1 3UMGA 1YR8A 4BKMA 4Q03A 5CNKA 5F2OA 1NQAO 1UM9A 2J0QA 3QENA 4W1SA 4OQZA 5B6JA 3KSDO 4WHMA 2XCOA 2WOJA 1ECCA 2MHCA 3FR8A 3NDIA 4AECA 2SKDA 3R5JA 1TXGA 1Q7RA 1Q2XA 5JCOC 2OP0A 3CRZA 3OPVA 4BAUA 3HM9A 5IN5A 4RZHA 1HKHA 1IH8A 1Z6TA 3GRPA 1LWOA 1RPZA 2QIOA 1N7HA 1RWOA 4LK2A 2YS7A 4NTZA 2D59A 5IAAA 3FSGD 4OGFA 3DCIA 4TV9F 4JI6B 1QHGA 5J2TA 2PUAA 3LCUA 1Z22A 4QGSA 1JA1A 1PQUA 3T1TA 5H83A 5IW8A 3HCRA 5C8VA 1ZIXA 2RAVA 1DO2A 4B3DA 4LVOA 3T1HB 3WJAA 1NLYA 3UICA 3O8RA 4ON9A 1FW8A 2F4VB 4GYJA 4M76B 2EFDB 3IX7A 1PVDA 1E3QA 3WZMA 3M3PA 4J49A 1F2UB 4XASA 2Q7XA 4WDRA 2Z58A 1EFDN 3BSYA 4D3SA 1RQ7A 3A7DA 4QGFA 5FOVA 4LE2A 4Z9YA 2W6JA 4HXFB 4AP9A 3DFKA 2IY8A 1FXWA 2GDJA 3RSGA 2I4OA 1ECBA 1U8FO 1OI4A 2B36A 2ZCUA 3A6FA 3GAMA 1Z68A 2HREA 4IIJF 3CVJA 4KE9A 5H4HA 4CT4B 3EIOA 5CFLA 4B6PA 1W25A 3DQPA 4HRVA 1FFBA 3EWSA 3KEFA 4A7PA 1TYCA 1EFUA 4PZUA 13PKA 5FPYA 1QAOA 2L42A 3K8ZA 3QPWA 1VFPA 1C0IA 4HQRA 1ZJ5A 4OI4A 4C20A 4EFLA 3WKEA 1QCCA 4MYSA 3TM5A 5IJ9B 1AXGA 3M2PA 5DM70 1AQNA 1AUOA 1DU4A 1HE2A 2PZBA 3KPJA 4L95C 3RRNA 1SXJE 3SDSA 4EEKA 2W8BA 3K8YA 4I7EA 5IUJC 2CJFA 3ORSA 4UULA 3ASVA 4ZJPA 5C5CA 2W8ZA 1E8NA 4PSVA 5KYWA 3H9JA 1NWCA 5SYMA 1NX9A 2NO1A 1XAGA 4PG5A 4PHCA 4ZQGA 2EFYA 2QR3A 3SZGA 5HZHA 5EPUA 1C1XA 2V96A 3AC0A 1JIVA 1FDIA 5CEEA 2QB5A 2QYHA 1E5LA 1LBHA 1T0PA 1PQYA 2ZR0A 1B41A 2JFQA 4Y2VA 3EEOA 1J42A 4MCAA 1DARA 2C2BA 2QD4A 1YRAA 2H54A 4MKRA 3FZGA 3SC3A 4PE5B 3V97A 2ZROA 3VNRA 3VU0A 1W4AA 5JMTA 2R0QC 1P2GA 1E4VA 2OO5A 1NTRA 3FYUB 3IQZA 1CS0B 4NH0A 4LWZA 5GM2A 5EXEA 4MV5A 4CCAA 2I78A 4RTKA 2XDQA 2DUJA 4C2UA 3JVIA 4EMTA 2J6IA 4JUCA 5AHWA 3FDFA 4PEVA 4GBED 4YRSA 1SJ9A 4NBKA 1Y4SA 2C9BA 2H3EA 1JR3E 3BWMA 1FDRA 4NJMB 4B4DA 1X2EA 4FXOA 5LYJF 5JO9A 3AGPA 2G3YA 1DZIA 4JVLA 4X63A 1OSNA 1OFVA 1I4OA 1UFRA 1WHSB 1SD2A 3O5AA 3QELA 2RHJA 1H05A 1DBIA 5TMPA 2ZS8A 4JJ4A 4X61A 4DXDA 5FUQA 1PJAA 1BQ3A 2WYIA 4XDGA 1IY1A 3MAAC 5EIFA 3KXIA 4P36A 5ALLA 3RBVA 5DE3A 4FYKA 4UHFA 4G26A 1S2GA 4F3YA 2JARA 1C0KA 4YJFA 2VWGA 1UBTS 1WKVA 3MGKA 4MVCA 3TTVA 3ULKA 2FB9A 3ISVA 4LJ5A 1U9JA 2DQYA 3LBHA 4MR8A 2AS0A 1RI5A 5LXTF 3WQQA 1R66A 2PIAA 3NBAA 3STHA 2PGOA 5FLEX 3DXZA 1QFZA 2X0DA 3R9IA 4PONA 3WIBA 4AZ0A 2FPSA 3Q0EA 1AQLA 1OQAA 2E37A 1CQZA 4CT0A 3EXEB 4LRSB 1U0OC 3QYPA 4HGNA 3CKMA 2PS3A 5BWNA 1CR1A 1WW3A 1W0JA 4WN3A 4GGPA 5CDYA 2Q1WA 3NG1A 3JU3A 4ENPA 1D5WA 3GT3A 3QEOA 4AKTA 1SVKA 1I80A 3WGNA 2KI5A 4OGLA 2W6MA 4CHTA 2NXEA 2OB2A 1KWKA 1XQ6A 2Y76A 3HB9A 2VDRB 3SS9X 1E5VA 2F48A 3MFQA 3G1UA 3U7QB 3VOTA 4AM8A 4C01A 4ND4A 4QYTA 1XHLA 3KQQA 3AW8A 2VN8A 3DTVD 3M34A 4LJ7A 5HCNA 4JUBA 2I3BA 1GLNA 3SSMA 3UT6A 3ZE9A 4YUYA 4R8VA 1OXVA 2GAIA 3F4BA 2CFTA 2PJUA 3B53X 3GB9A 3PVSA 4W7HA 3CGGA 3OTWA 2V0NA 1P1FA 3QG1A 4IZOA 5ECWA 2OXIA 4XPIA 3SS8A 3EK2A 4QPNA 1IWPB 1IWOA 2YVLA 5EWJA 3GCZA 4DV4B 3HHPA 3HU1A 1YC2A 1C7IA 3BWDD 5DN6A 4DIFA 4PXAA 3TNJA 4TWJA 1MB0A 1WPXA 2QG6A 2I4LA 3EVDA 3O1LA 4MQEA 1UINA 1WCIB 1L3CA 1MABB 2GN2A 4GECA 4HUQA 2G5PA 3W6UA 4B5KA 1M5UA 5EXDA 3LUBA 1LDNA 1SMKA 4QT0A 4G9EA 4LN1A 2N75A 1VP9A 4WV3A 1R18A 1MAHA 4LRTB 1HY3A 2HQBA 4HKTA 621PA 1A7AA 4Y6SA 5KYKA 1A5SB 4X6XA 1ZGGA 1SKYE 5U9CA 3WLLA 4CLEA 1KH1A 4NYMQ 3TFOA 3NHRA 3NIBA 4R8KA 1N8TA 4JQZA 5FNVB 3PSAA 2BFBA 3QUAA 3EDRA 4J1SA 4NCNA 3TW4A 2WJIA 1IHOA 4M88A 1M34A 1Y5RA 1JALA 4E12A 4KIGA 3ZKAA 3KTDA 1ZK4A 4CGYA 2PKEA 2JAWA 5E3IA 4P7GA 3A31A 1L7NA 4ML3A 5KAMA 3S8EA 4RXMA 1V2GA 2JLYA 2AGVA 1J33A 4LVUA 4N9QA 3FB1A 3EDYA 1A9YA 1PRYA 4D7AA 1G42A 4WLFA 1RDFA 4YDRA 5F7XA 1Q0ZA 1OX4A 3GLHA 1IN7A 1V5FA 3P1JA 4F21A 1I4DD 5BUCA 2NOAA 3EEBA 1KI8A 2L2QA 4TWAA 4YAGA 1BH6A 1JJ7A 4U7FA 2NVUA 1JGTA 4FYYA 1HTWA 1EFPB 1QOPB 4HMQA 4F0JA 3HR7A 4P54A 4KRFA 5CT9A 4EKEA 2F9FA 1Q0TA 2R79A 1GTZA 3JYOA 5IJWA 1N33B 4KWCA 4AZ3A 4M4SA 3L92A 4WFJA 5H3HA 2XVAA 3W2FA 5AKIA 2Q4BA 3L2OB 4M99A 4I50F 1DKLA 2ZRDA 4MS1B 4MCIA 4ESHA 2IU6A 4FHZA 3FPGA 3K4PA 4GU5A 3MEQA 3QVVA 4ZRDA 5LLSA 1HWYA 1ST3A 4NNJA 2WWGA 2FKAA 3LZCA 4L6IA 2L0XA 4B6OA 1AUXA 3GJTA 4Z4GA 4X97A 1XWFA 3FVVA 1TMOA 2VT7A 2XITA 2FPOA 2EX0A 2X41A 2YUTA 4W7SA 4DT1A 1LK0A 2OOKA 5CDUA 1HE1C 4WSOA 1KI6A 1Q1BA 2C3UA 4RKFA 2PRSA 3C43A 4YAEA 1NVKA 1PD1A 5E7JA 1NPYA 1M83A 1X39A 2CYCA 1X0VA 4Q4HA 4DV6B 3ZGXA 1H1LB 2WSBA 2D2XA 4OYLA 3AO0B 3WGTA 2XNHA 3ZGNA 3M6LA 3KEGA 1PNTA 2V5AA 3PQ7A 3WA7A 1PGQA 4YHHB 4BATA 1O6ZA 2Q4DA 2WA1A 4EKGA 2WPDA 1EEXB 1FNCA 1JLHA 2PTGA 5C5EA 1OH6A 2ZE6A 1EHCA 4RA6A 2GESA 2H4WA 1LBQA 4PSUA 1TADA 4RKEA 5I9BA 5C18A 4WCDA 5FWXB 1E92A 3RIYA 2G9VA 4N76A 2RB5A 2XODA 3FGPA 3HJHA 3WGQA 4KLAA 4FB4A 2QRLA 5K2OA 2V1UA 4L4SA 4DB2A 1M33A 4HGYA 5CFMA 3M1LA 2BI4A 1Q91A 4FEYA 2VSFA 5FFFA 4I2VA 1I1NA 4IGEA 4E7PA 3LTEA 1RTKA 1EUDB 1EK1A 3K9GA 4I1IA 1E3EA 3H97A 2O5VA 4EO7A 2I7CA 2XUQA 4NYJR 4EJ6A 4F8EA 2X9GA 3DZ8A 1PQ4A 2FG7C 1JVNA 2HQ1A 2VWQA 3O3NB 4LZNA 4ZI5A 3U3ZA 4BFWA 1NONA 3DBLA 2FG6C 1BN7A 3C7KA 3NHSA 4C7OB 2C0PA 1ZEJA 2G71A 5C8YA 2IC5A 3VDQA 4OXYA 3TCXB 2WWYA 2X5KO 4MKXA 3RC2A 4FLMA 2ZRLA 1WRBA 1ZI8A 3E9NA 2D1FA 5FBQB 3TMKA 3N8HA 2HHLA 4DOMA 2I3GA 4ERXA 5KDDA 4IZIA 3HPRA 1A2KC 1M5TA 3MOGA 3BGVA 4WKGA 4YMLA 1Q22A 2TMYA 2NUTA 1A69A 2N1BA 4GGMX 1XMOB 4NPAA 3EGIA 3HJAA 3K1AB 2R7KA 4C03A 1W34A 4NK5A 3JV7A 2E49A 3EZ9A 3L1JA 4K6CA 3T12A 1SOAA 3QLJA 1YR1A 2J7PA 3HP7A 4N8DA 4ND8A 5IM5A 1GPWB 3CHYA 3A3OA 2O2DA 2Q5EA 3A1UA 4U2FA 5AR1A 1RLMA 3SHOA 5BR8B 5DLQC 1PJSA 1QH9A 3H2ZA 2VCEA 1HG1A 2IYXA 2B4KA 2O0HA 3ANSA 4OJTA 5JCZA 1Y1TA 3EMKA 1UBCA 5FQNA 2EBFX 5AOVA 3F96A 3KOOA 1Y6RA 1GLVA 3O31A 4ZQBA 2XRMA 3AEKB 2MSNA 2HJRA 4IL5A 3TFWA 2UZ4A 1JEQB 4WE3A 1XROA 2QDKA 3L18A 2GERA 4WINA 1O9HA 4K6MA 3UMJA 4DW8A 5F3WB 1TJ3A 2J3HA 2EW1A 2Q3HA 4MVJD 4BB6A 2QD5A 1NR1A 5DTMA 2C7PA 2EL9A 2CNNA 4JL8A 3WK5A 3HVJA 4K7JA 3UJ7A 3WDSA 1WMBA 1MDFA 1H5QA 1TK9A 4KQ2A 3BD9A 1TM2A 2HIGA 4FINA 4LV5B 3U2QA 2ATXA 3DCNA 3RU3A 3VTAA 4BNUA 5K8VA 5MGNA 4YY3B 5BOSA 3AJDA 1C3VA 2ETXA 1GCOA 1FU7A 2OV1A 1A50B 2J9GA 3E70C 1GA4A 1V47A 3E18A 5CVJA 2JH9A 4CDNA 1LFAA 4TWBA 1P91A 8AT1A 2P9QA 4RZUA 3AF3A 4XQCA 4WERA 1GP2A 2PYZA 3FHLA 5CFZA 4C6TB 4Z6KA 2IP2A 4HEA6 5IVKA 3ZJVA 1ID8A 1Y9EA 1E2MA 4Y7DA 4YR7A 4BQSA 2JFOA 2WVHA 3CLHA 4QTYA 2X19A 5B3JC 3I2IA 4PNPA 3PBKA 5C35A 2QD3A 4ZU3A 1DCKA 1TVEA 5DNEA 4MMZB 3CGWA 1K0FA 5DX8A 1FXUA 3WDMA 1E9SA 2P3OA 4UBIA 2NUAB 4EGSA 6YASA 3ZD9A 3D3QA 2A6PA 4BJ1A 1NJ1A 3PNVA 5CFOA 3OPXA 3MW8A 3SEFA 4YQFA 3GPCA 5C3MA 1T1SA 3V1MA 4AJLA 1JH8A 5AK5A 1Q7CA 4UAVA 1U5CA 4GZ6A 5CXXA 4D6XA 4Z54A 3PFIA 4UVIA 3OWHA 4AIIA 2ZE7A 2HJWA 5LDGA 3UPTA 3KPUA 1LK5A 1TJPB 1SUIA 3T7SA 4ZI7B 5KQMA 1KETA 5I9SA 3BJMA 3MTIA 4YCCA 5LLDA 2EZ4A 3AHCA 1DLJA 4PG8A 3DOCA 2ZBRA 1K6MA 2Q5FA 1GJRA 3PQ2A 4M22A 3VH3A 1NOKA 1QRAA 4C7JA 4HDKA 5CT8A 3H9EO 2M32A 3QEBZ 1YAHA 1C0PA 1G5QA 2WFLA 1GN8A 2Q9CA 4HPJB 4OBEA 4FDAA 3FGNA 1CNFA 2I5PO 2HBYA 4X7BA 3UMSA 3ZTWA 3RFVA 3HXQA 3KHUA 5CVEA 5IJAA 1NKTA 3LY9A 4Z4CA 1QKKA 4D81A 4Q47A 5JC1A 3T06B 4TMKA 4NV1A 3SOPA 1BG6A 1HQYE 3D6FA 3IUSA 3OT5A 3Q5EA 1IBKB 1CUDA 4Q4AA 1D2MA 3EMBA 1LCIA 3MT7A 3LO5A 4J1NA 2ZSIA 4MPDA 4AWBA 4L8VA 4LJSA 2GHQA 3AINA 2AMLA 5EHGA 2V59A 3WYFA 4S3MA 1TUBB 1R0SA 1DAIA 4QWWA 2FY8A 4IV8A 4I99A 2JGIA 4RQTA 1E1RD 2OBXA 1G7CA 2BMDA 1MP0A 3E5MA 4HNSA 1OFHA 3C3MA 1BO6A 3DXFA 3EULA 1ZH2A 1J2YA 2A88A 3A2LA 2XB2A 4F92B 2Z43A 1Q1NA 1YKFA 3L8ZA 3V55A 4A91A 5JVDF 3ZEAA 3RT9A 3CH6A 4BFCA 1OVMA 4QECA 2WJ6A 2M98A 1ZIYA 3SKVA 4JL5A 1ANKA 2YHSA 3ZLTA 4IJMA 3LVBA 2EZTA 2O2IA 2EJBA 1P6UA 5JNTA 1GGVA 2Q28A 3F6RA 4N8SA 1I2CA 2NZUG 1NLFA 5IJ0A 3S2YA 1MEOA 3B7WA 2C78A 4S35A 3H8SA 4Z3KA 1W0KA 2FX5A 2F8SA 3NDJA 4H7DA 4GUDA 2GSDA 4NECA 3E53A 3ZI0A 3HJGA 4MIYA 5L4SA 2E82A 3O4FA 4ZD6A 3B38A 2XKBA 4AMBA 4D3YA 1P9NA 1Z56C 1LVGA 3DPIA 2CNWD 4U7TB 2V4MA 2W6CX 2PIDA 2OSBA 3PHLA 1Q11A 4K9OA 4WZ6A 1Q21A 5AUNB 1Y3DE 4CCYA 5FDFA 4BRUA 5A04A 5JLJA 2Y1LA 2YV4A 3DJYA 4IQ0A 5EUMA 5HBGA 2VPZA 3BC1A 3IBSA 2JI7A 2IYAA 4PNHA 1YVDA 4CV3A 4DABA 4MUNA 2XBUA 4PANA 4RD2A 3VKGA 1ZJ6A 4J9VA 2JFVA 2YV5A 4P4SA 3TS1A 3VYWA 2KSQA 3ZLVA 1KAMA 5EHIA 4QXQA 3SQNA 2H4HA 3ZV4A 2JKZA 4NK4A 1RT9A 4CEJA 1WDKA 4C3ZA 1Y42X 1IUPA 1E1MA 3U16A 3F0TA 5M34A 2K7ZA 3NHJA 5MFPA 1QPZA 5F1YA 1SXQA 4X5OA 4XJTA 2VP5A 3KQKA 2NV2B 2HUPA 3IDQA 4Q1BA 5CITA 2P5SA 1G20B 4FBLA 2PKQP 1E61A 1MXHA 1N57A 2PL1A 3SZRA 3ORHA 3MRTA 3PXUA 2DRIA 1UMCB 3BGWA 5TVGA 4YRBA 2Q5LA 2J5XA 3A70A 4M8SA 3S44A 3ZE2B 2F6RA 4DLRA 5HPYB 5KPDA 1JWAB 2C4MA 1TM3E 1EIWA 1G0OA 1ENOA 5A1JA 4OBXA 4JZYA 3U1BA 3BJEA 3WB0A 5FR1A 3GU3A 3R7DA 1E3DA 3TLBA 1ZBQA 4C5AA 4U8HA 3WB2A 5KNCD 1L4EA 1CYDA 1HOXA 2XECA 1EWVA 3ZOZA 1WXDA 2DGDA 3FIUA 1Q57A 5F5LA 5AXBA 4BNKA 3JALB 4JEIA 4BNZA 1C5KA 2CYBA 3KJXA 1E6CA 1HMYA 1GPYA 1ZXBA 2A9KA 2B8TA 1VG0B 2C96A 4LBZA 1P1BA 3VZSA 2IJGX 1JHVA 1UBJS 3LC1O 3NWJA 4LDZA 3JQ9C 3T9DA 3ZHCA 5IUKC 4EARA 3FMVA 3QP9A 4BGIA 2XTZA 2YYAA 3I05A 4XD7A 3U3OA 3V8BA 1QQ5A 1SC1A 1W9HA 2B3DA 4JCOA 4R0VA 4Y2TA 5AKGA 5GZ6A 4MKGA 5K3FA 3WLTA 4CEHA 3A6ZA 3GRAA 1DTWA 1VP3A 4WTOA 4D8WA 4JJFA 2DSNA 3TR6A 1J90A 3QMPA 1JBEA 1ZGZA 1RVDA 2YN2A 4N3CA 1G18A 1WQ1R 1T1GA 4BX9A 3A4IA 1UF9A 4NARA 3K6SB 4DXAA 1NNEA 1MO5A 3OICA 3C70A 5EE9A 2OD2A 3NAGA 2IUFA 4ALMA 3EFBA 2I3AA 2IX9A 3IH5A 3KYCA 3MMZA 1Y7PA 1Y82A 4LVNA 4R8RA 4TTAA 3O9VA 4OBWA 3ZZ1A 4BNTA 2JHCA 1QVRA 1A8HA 2R11A 1QE5A 1D6JA 3B89A 1MOSA 1U4SA 4MLDA 6ABPA 4WN9B 3EXHB 3C6XA 5IT4A 1RBZA 2I71A 1HT0A 1T5DX 3JVEA 4HR7A 2AC7A 5EJ4A 2Q6VA 4XB1A 1M2GA 4RW0A 1U7PA 2VHVA 3VBCA 2QAGB 4HI0E 2D4HA 2DUNA 1DOZA 1Z7WA 2WHRA 1X6VA 1Q0HA 4MVWA 4Q7JB 1WB4A 5FV4A 4IIHA 5TT1A 5LBIA 3WRYA 1JPVA 1JYEA 1MNQA 3O1HB 3KOMA 3OQHA 5DI3A 1PZGA 4RHEA 1IEVA 2I6QA 3TSOA 1IBMB 4MS3A 2PMKA 3I9LA 4R16A 3OJ0A 4YK7A 2X0KA 1UIRA 3DEJA 2CF5A 3NRCA 3D6NB 1ZJYA 3GX1A 3WRXC 3KNZA 2V7EA 5IH3A 3PQ8A 3RSOA 2C84A 7YASA 2OCYC 4QXRA 3BMQB 3FIJA 3JASB 4ZJUA 4C78A 1GUAA 2QX8A 2E9SA 3H13A 3F8TA 3ETJA 2HCBA 1MO3A 2O0MA 4UTOA 1FMLA 2ANBA 3RK4A 1ISPA 2C3OA 3E81A 2BFMA 3I2FA 5TQJA 4TS9A 5DBHX 4IV0A 3LWZA 4NRDA 4L3VA 5EIBC 3SFVA 1VCNA 1KAGA 5P21A 4D45A 3RS5A 3FNBA 4ZK2A 1CT9A 1E0JA 3OJWA 3PUJA 4XQ9A 2VZEA 1PW5A 4U6NA 1WMDA 4BKQA 3MRXA 4Q82A 1NXTA 3ODPA 2IV2X 1G6HA 2V7UA 2X6QA 2Z8XA 3LRXA 4HEJA 2AOVA 2UXBB 1C7FA 1J8QA 1I7PA 2IYZA 5DLDA 2JEZA 1KHTA 4WT7A 3WFJA 1RJ9A 1SZCA 2JHPA 3PEVA 2QSYA 4B6SA 2O8EB 4N0MA 1YKSA 5K45A 1BMFA 3EBOA 4IDDA 1NE7A 1U7HA 4RY2A 4TXLA 3ZTTA 4TTVA 2BVNA 4WCFA 4A3SA 2P9ZA 2H31A 3G0GA 4JZKA 4O1HA 1V1MA 3IIIA 3TZQA 4F45A 4J1TC 2H5IA 2RK3A 1JL3A 3AB7A 1IQ0A 3D6MA 4LIPD 3TCNA 1U1DA 1ZUD1 3E5NA 1MA3A 2HV9A 1UDAA 5AW9A 1GKYA 4BUCA 2V3VA 4Z0NA 1NT4A 5IZCA 1E3TA 4Q4LA 2EJUA 1MHTA 2MU1A 4XW2A 1V0JA 4XGKA 4YUVA 3NM5A 3QMWA 1JJBA 2QTTA 3C16C 1QIFA 2BMEA 4ITVA 1OU4A 1VG1A 1MX3A 3SE0A 2QRPA 1HFEL 3ESYA 3U19A 1ZY2A 3NNDA 3PG5A 1PVOA 3E2PA 1T6YA 4KN9S 3FBTA 4XX0A 5LMNB 2GN6A 3O94A 3RREA 2ACWA 2CVPA 2WD8A 4B3HA 2JVIA 3OURA 2BM8A 5LQDA 3B6JA 4PRZA 1O54A 4CMBA 3HBLA 2A1TS 1O95D 1SVOA 3A1NA 1YDMA 2FQQA 1GPNA 4YDSA 1M0SA 2EG5A 4B3RB 1OOEA 1MNAA 5HFJA 1PI3A 2C77A 5J2TF 4FJ2A 3OETA 3P45A 4OHXA 4Z1MA 4NKRA 5PGMA 5H70A 3T7TA 3GLRA 4R1SA 3U4QA 3PHCA 1MFZA 1N7IA 3ZBQA 4G0YA 1IN8A 5I01A 1MCZA 1V8BA 3MUEA 4HRAA 1XZGA 4Z8XA 1IC6A 3GNTA 1HDXA 5HXAA 3ILSA 4Y2PA 2J3JA 3IHLA 3SHQA 5FLYA 3YASA 1MRSA 4AKHA 3E8XA 1G5IA 4BP8A 1LPNA 2Z4RA 1MX1A 2OCBA 3RYIB 5J9FA 4M9ZA 1Y6GA 1OB2A 3OJCA 1B0ZA 1S2MA 4AUMA 3HXKA 2A9JA 2RFLA 4IAOA 1FXWF 4JP5A 2REBA 2WAXA 3KJQA 3ZPXA 2Y1GA 1N3IA 3HXLA 5J4HA 2HT1A 1XN4A 3MWYW 3JYLA 3WMXA 4JKYA 4FFBA 4IPTA 3IVXA 2AOTA 3E0XA 3AR8A 4NYMR 2CHFA 1JR4A 1ZW6A 3NEJA 1YE8A 2JBHA 3UAVA 4XKJA 3U4DA 1L1QA 1SEPA 4BFLA 4YUWA 4P84A 2Z2IA 4QNRA 5JD6A 1G7TA 3O21A 2FR0A 4PG7A 5IPFA 4N8EA 5EZSA 4S1OA 4KOAA 2ZIWB 3PGXA 5E4FA 1EXWA 4GL2A 1PZMA 4Q3OA 3WAKA 1TYBE 1HDRA 3C5HA 4KWTA 1QG2A 2XD4A 1L5NA 2QR2A 1S2NA 1TCCA 2RONA 2XT6A 4YC7A 4C2BA 3CKLA 1GARA 1Q0UA 3CXRA 3R5KA 3TJMA 1SU7A 4NE9A 3SZMA 5EMLA 1NJSA 5DBOA 3R3WA 5EFZA 3ZS8A 4EX6A 4KJXA 1K9SA 1UM8A 2FRXA 3O90A 4JBYA 3OO1A 4RHFA 3N6RA 2IF0A 5ALFA 4R9VA 4DC1A 3RH0A 3WVNA 3WGUA 2O2XA 3PNKA 1S9DA 3CO5A 1NI4A 1GYRA 1JDTA 3DONA 4FS3A 1FUUA 3QY9A 2AF4C 1UC4B 5IT0A 2B8NA 4GPEA 4OSOA 1O0CA 4UBLA 2MR5A 2GEKA 2YYSA 4Y2RA 4A6DA 1W0JD 3P2YA 4C29A 4AI6A 4Q37A 3M70A 4HGPA 1CY4A 3UOAB 1CS4C 5HIKA 2R1UA 5TSDA 1YDGA 3I5MA 3UWPA 3QW2A 5A7GA 5LP6B 4DRXB 1NW3A 2PWPA 1VYTA 2VBCA 1Q16A 2UUOA 3SM9A 4X66B 2VPWA 4EG1A 3SXJA 4ZYLA 1PNVA 1M1YE 3OAAD 1M2VB 4O1MA 1KE1A 3KYIB 4BQEA 1GYQA 2CDBA 4AURA 2ATVA 4JROA 2YJZA 5AM4A 1FFAA 4CM9D 4EG6A 1WO8A 3KFLA 3B78A 4G86A 1P61B 4CETA 5JZMA 3BMOA 4WOPA 3FCAA 3JW8A 3IMGA 1UBHS 4D96A 5E3HA 4ZRNA 1JSXA 4G8CA 3CC8A 4B6RA 1LDEA 4PY2A 3EYAA 4KNVA 2NNLD 4B71A 5FJJA 3X2SA 3N5CA 1K08A 2B34A 4DR4B 5DN6D 1ZL2A 3DSRA 4EYSA 1KDRA 1BWPA 1O87A 3MCVA 1L9XA 4J16A 5CLGA 3UA4A 3CX3A 3V46A 3KQHA 4AF7A 2DCUA 3CRVA 5D2CA 2AWNA 3RUDA 3EVTA 4PSKA 1WA5A 1OH7A 1UDRA 4JGIA 3CBGA 4M36A 1M2FA 3TINA 5EYPA 5BR1A 3OQMA 1P8JA 2ZG6A 3I01A 3TSYA 1TUIA 5K8UA 1RI4A 4JXXA 4ZCPA 3NVAA 3FCSB 4OQEA 4YNBA 5LC1A 4LYGA 3GT0A 16PKA 1FBTA 3W0LB 3AFOA 2FEMA 5JI2E 1XLTC 4X92A 5T67A 4RJ2A 4YXWD 3GMTA 5A4AA 3DMRA 1YZ3A 4QO7A 1OZFA 3WK7A 3RKRA 4X8HA 4RK0A 1EDDA 3SOZA 4JLKA 1MD9A 3ZKWB 3Q7IA 1FMCA 2J08A 4CLOB 4WWHA 5CM8B 1VL2A 2EC5A 3JQ7B 2BFDA 2YNMC 3DTYA 1F8GA 3JATB 1K9VF 3BMNB 4ND3A 3L82B 1RXUA 3EF3A 4OD0A 4K03A 3WP0A 4ZAXA 1FFEA 4E21A 3DHYA 5EIEA 4KNWA 4JBXA 4IZ6A 1DJMA 2NW6A 1CTQA 3S1AB 1JQ5A 4B82A 4MP8A 4RLHA 1R4AA 2J3IA 1N3LA 1B0UA 1S2LA 3PFFA 4FC6A 1QYCA 1VKRA 1RLIA 3CZMA 1O6FA 1UJNA 2GF9A 3D3EA 5FA8A 4FOPA 2WWFA 1Y1LA 4IJWA 4F72A 3E22A 2C54A 2VRCA 4MQ5A 4Y98A 5FOXA 5K4GA 2VFAA 1KZ9A 2QYOA 3NYIA 1FDOA 4R2WA 2ZAMA 3LBFA 3N2KB 3VSEA 1N6PA 3ZVKA 4ZGBA 3NVKI 4AUKA 3ELDA 1T8PA 4RWEA 4U3JA 4N49A 3PQ6A 3C4JA 2OFPA 1V48A 1AUVA 1SWVA 4NH4A 1V37A 1SIWA 2GO7A 3LU1A 4FEAA 1E8MA 3PC4A 4CDGA 1Q17A 5BQ3A 4QC2A 4KWIA 1QGUB 4YN3A 4EFKA 5SZJA 1OF1A 3WG9A 5I9LA 5EKDA 1WKBA 4M53A 3PNPA 4JU8A 1KZHA 2GZ3A 3GD7A 2HIHA 5DNWA 5SYNA 1R7RA 2W71A 2WU8A 4EUKA 2HMUA 4LXQA 3RHZA 4PAWA 4JR0A 4JCCA 3AU8A 1YASA 3UZUA 3K9BA 4F6CA 4F11A 1AVTA 2JATA 3N53A 4IIBA 4LMPA 2OXFA 3OIWA 2JS7A 1T2NA 5FF9A 5AM5A 4DLVA 5KVQA 2WD7B 2IP1A 4I19A 3IESA 3GIDA 4P6VF 5PNTA 4D4HA 1Y5MA 4KJZA 3RYCA 4ES6A 1CUJA 1NU6A 4E1AA 5K0SA 3ZVMA 4KO8A 2H2IA 2X7JA 2TYSB 1AQYA 3MCZA 4R40A 4UEKA 3KT0A 4FGZA 3L6RA 5LA6A 2COKA 3L04A 4RKRA 3X1ZA 1M8JA 4XAQA 2P4UA 3I9FA 1UBEA 1RQRA 4OJMX 4E4YA 4GOLD 1BKDR 4O3MA 3EEYA 3S1SA 4KXWA 2X8JB 1SUBA 4TUYF 4QFBA 4Q3NA 3T1NA 2TRSB 1QRSA 1Q83A 3LC2O 2G9QA 2IXDA 1LV7A 4QU9A 1RWNA 3BWVA 1RPTA 3HP1A 2YMLA 2C4NA 2CJXA 2PGIA 3G9ZA 3N59A 2XUJA 4JLVA 3CX4A 2IYQA 4MRVA 4KV9A 5BSGA 4ZC1A 4N1AA 5IKEA 2ERCA 1EINA 2BSQA 5CXQA 1OW3B 1JLSA 4RVOA 4UATA 5F1OA 3W5JA 1XCMA 3DV0B 3NOOA 4EJSA 4MINA 2LV8A 4WZAE 3SYNA 4Y30A 2UZAA 5F23A 1CUXA 3G8CA 2VHUA 5AYVA 2UZ1B 1RWQA 3CUWA 3SY8A 2GCPA 4GEKA 3DAPA 4JLBA 5F78A 4EHAA 1YV9A 1CZLA 2Z2ZA 4Z7OB 2HRQA 3EFOB 2JGNA 3P97A 4DG8A 2NADA 2OGUA 1QVVA 2IU3A 2EYUA 1QG4A 3OY2A 3PX3A 4NYIQ 5FWYB 4UNRA 4IR7A 2OHGA 4DSTA 1RAIA 4QJ3A 2O07A 4EG7A 4HAIA 1CDDA 1Z2AA 2Z2KA 3H4IA 3K92A 4HZUA 5AW8A 3D6HA 3VR6A 1ECFA 1G5HA 1DDOA 1GO2A 5CVUA 4PLHA 2AF3C 3EF1A 3FYDA 5GJWC 2IEGA 3SK0A 2RGNC 2J48A 3GN2A 1KO1A 3JYNA 3W1VA 4DBLE 4BVFA 3H7IA 3KSZO 4CI9A 4ZV9A 2OZKA 1F4LA 4QUBA 3C6ZA 4DTCA 4FGWA 4TXMA 1X9GA 2XQGA 1AGRA 5GAJA 2QJTA 3GVCA 5DGTA 5DGIA 3NDBB 1YB5A 3HTXA 4NNPA 5J2UB 5EESA 2HSJA 4KAFA 3O8CA 1BRTA 1FEZA 2DM6A 2PUWA 4M7WA 4XQ0A 1R10A 1O2DA 1XTQA 2SHKA 4XPZA 5DNCA 3C7CB 3R77A 3TD6A 2BMFA 1PT7A 5LJLA 3U09A 3PCXA 2GFIA 2BGTA 2EFGA 4ONEA 4EPRA 4HNTA 1L4LA 1T5SA 5EOVA 5DH9A 2GYUA 3HU2A 3RUCA 1TFUA 3RUIA 3FWPA 2W6OA 3VV2A 2WT9A 3AIOA 2F3UA 5EQJB 1T26A 2ALJA 3TL3A 2TECE 4P4TA 4UEQA 2GEUA 1U2TA 3TLCA 5JW6A 2FTKE 1T10A 1G63A 3D4LA 3LYUA 4BLVA 3WAGA 4MQLA 2BSAA 1K88A 3E2IA 2CLMB 3RVOA 1TYDE 3RV3A 2HJVA 5E9WA 1DRKA 3ITNA 3NGLA 4IWYA 1RMTA 1V16A 2C5HA 2QM8A 4M86A 4Y2GA 1RWPA 2NYRA 4ZRMA 5EXXA 3DKKA 5TMEA 1ONNA 2I62A 1L5WA 4OMDA 3ZK9A 5J63A 1L5YA 2OBLA 2IEBA 1N9ZA 2VDPB 2B82A 2WV7A 5LA6F 1MORA 1WV1A 1JEYA 3WLFA 5EVJA 4XYBA 3ESXA 1CIPA 4NABA 1L5QA 4CKBA 5BYKA 4F06A 4YREA 4HQFA 3DTNA 2ZM6B 4G5HA 5UKDA 4Y1RB 3MHPA 1BJRE 2O0KA 4GLLA 1KZ7B 2YIVX 4K26A 2IEAA 1M66A 2X0NA 3O93A 4IG9A 3BRSA 3MCUA 3I53A 4ZHQB 3CR3C 2A14A 5TF4A 3WWZA 4CM4A 4A9AA 5AKHA 3RT7A 1E9CA 2H7VA 1Y7HA 3I9OA 4J0CA 2WVAA 4RHTA 4R8SA 1MMFB 2YRXA 2ZJBA 3C98A 4ED9A 4ZGGA 3CPSA 2JGKA 1A96A 3G3EA 2YMPA 2C88A 4Q1EA 1S8OA 2Y8EA 1NC1A 1XN1A 2YINC 1NZFA 3N76A 1PX0A 1R6TA 3WDLA 4CIVA 3KV1A 1BE1A 3GUYA 3AOEA 4V03A 3VYRB 1Z4LA 2BGWA 1E58A 3IVCA 4HH4A 4J2TA 3O4RA 2JK1A 4L78A 1KI2A 4UMFA 2P1ZA 3MT0A 1NBIA 3Q1KA 4GLJA 1FTGA 5K3AA 4NSNA 3TW0A 2WG0A 5IK2D 4JS0A 1QV6A 4P3OA 3I9V1 3ZYCA 2BM1A 1YVEI 2GGSA 4O4IA 2XD9A 3DEKA 1SKMA 4QFDA 1KGDA 2C8KA 2YN0A 3PQ3A 4P5EA 2PUFA<