1PSZA

Pneumococcal surface antigen psaa
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
286
Chain Sequence
KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of pneumococcal surface antigen PsaA reveals a metal-binding site and a novel structure for a putative ABC-type binding protein.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Immune system
molecule keywords PROTEIN (SURFACE ANTIGEN PSAA)
total genus 109
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 1998-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA01
2MINB 2Q8PA 3BE5A 3MFQA 5M3BA 5KOHA 3AERB 2XQVA 1N2ZA 5JPDA 2XUZA 4UTOA 5HX7A 1H1LA 1M1YB 3PDIB 4HMQA 2M6KA 5FLYA 3AEUA 1M1YA 1H1LB 2AFIB 4DBLE 4NNOA 5BVHA 5KOJB 3MWFA 5I4KA 2R7AA 4K3VA 4HN9A 5M34A 1ESZA 2AFIA 2O1EA 4MDYA 3ZK7A 3HJTA 4TKVB 2OV1A 4XPIB 1M34B 2XH8A 1MIOA 1PSZA 1QH1B 1XVLA 2OGWA 4FKMA 4TKUB 5CX1A 1N4AA 3G9QA 2RG7A 3R5TA 2M6LA 4ND8A 5CX1B 3MWGA 1FP4A 5BVGB 3ZK8A 3AEKA 4GICA 1N2CA 1M1NA 4ND8B 4N01A 4WNAB 2YNMC 3TNYA 3PSHA 3EIXA 2PS3A 4B8YA 2XY4A 2PHZA 4WNAA 5CR9A 2PRSA 1QGUA 3MINB 2YNMD 2XDQB 5M2QA 4XPIA 4OXRA 3MD9A 1QH8B 4FI3F 4H0FA 3LHSA 4INOA 3HXPA 4UDOA 1G20B 3AERA 2Q8QA 1K75A 5B58T 5M29A 5JOQA 1N4DA 5BVHB 1K0FA 3R5SA 5BVGA 3AESA 3AEQA 4PAGA 5JG7A 1G21B 1KAEA 3PSAA 4FILA 3NU1A 4WN9A 1L5HA 3ZKAA 1K7SN 3AEQB 4TKUA 3TLKA 5KHLB 4LS3A 4MO9A 3MINA 1EFDN 2XV1A 2OSVA 2WI8A 3K1AB 4OVKA 1TOAA 3BE6A 4MLZA 3UJPA 4M7OA 3AETB 4G07A 2MINA 1K2VN 1KARA 4PM4A 4WZBA 3AESB 3AEUB 4WZAA 2ETVA 4FNAA 1QGUB 4LJSA 3ZK9A 4BBPA 3U7QB 5JJ5A 3PDIA 2PS9A 5GGYA 4WZAB 2OV3A 4UTPA 3U7QA 4TKVA 4OXQA 4CL2A 2X4LA 3TEFA 3CX3A 4HMPA 5AFSA 3EIWA 2AFHA 5HDQA 5KOHB 3AETA 1G21A 1M34A 1G20A 2PS0A 4HMOA 2AFHB 1KAHA 1FP4B 1MIOB 1QH1A 3AEKB 1N2CB 4WZBB 3LI2A 4UDNA 1PQ4A 2R79A 1M1NB 4NNPA 4INPA 5KOJA 4WESA 4IRMA 3HH8A 3GI1A 4H59A 2WHYA 1L5HB 4WN9B 3ZTTA 2QI9F 4WESB 5GGXA 2XDQA 4G09A 1QH8A 3K1AA 4MX8A
chains in the Genus database with same CATH superfamily
3L1KA 1E9FA 1JDUA 2PGNA 4NBWA 3ZXIA 3DNPA 2VTEA 2WWRA 3UK6A 5K0LA 2HM7A 2YN0A 3IO5A 2HA6A 4P4GA 2DUJA 2QJWA 1W87A 3S7ZA 3QPAA 4MQUA 3SQOA 3A7EA 1OV6A 3PEUA 4PZYA 4QUEA 1NJSA 3W8RA 2HO4A 1EYZA 4YI3A 1RE1A 4OCZA 4UUNA 4XIFA 4RTNA 4RA6A 4W7SA 5I4KA 4MQMA 4MWOA 4Q1VA 2PVCA 4UZEA 1XVTA 3IVMA 4EGCB 5BOSA 5MN6A 3OP1A 2HBQA 2CLHB 2AIRA 4WY5A 3SJZA 3WWPA 4HQRA 1N33B 4TMWA 3E22A 3TRHA 4CQMB 2BR5A 1BNCA 2HK9A 4P8RA 2G28A 4DV0B 1N4AA 3V5NA 2PL3A 1UKCA 3I6IA 1D4FA 3VUEA 1M76A 1XN4A 1MN6A 2WWGA 1P1IA 3EXIB 3OA0A 2F8MA 2J7PD 3HVRA 1V96A 3PEVA 1FUYB 4M8NE 1HXHA 4A7PA 1YF3A 1TUBA 1GRCA 5ICGA 1A82A 3MWDA 4BKUA 4LVNA 2NV0A 3TLAA 3P20A 1FFGA 3W04A 4TWAA 4JR0A 5JNTA 5EZQA 3ZWXA 2E0IA 3GB9A 4RS3A 1O6FA 3WQSB 2V5AA 3F5FA 1HSZA 3DVSX 1PFUA 4MJXA 4OMUA 5ERGB 2QRNA 3NIGB 3HCOA 2XI4A 5DYIA 2ID9A 2O52A 4Y2UA 2IHBA 1HDYA 3K3PA 4Q37A 4D57A 5B6PA 5J2TA 1J8YF 1X8KA 3FBWA 3JASA 3JWJA 5EKUA 1OAKA 3GNTA 1H2BA 4WLOA 4AKSA 1FJXA 4Z9FA 4ISCA 5CJJA 3ZBQA 5LQDA 2ZU6A 1GADO 1K7SN 5DYGA 4EW1A 2EARA 3UG6A 1M6EX 1GZHB 3QFHA 4EYKA 3R3ZA 3T1YB 2PMEA 5G0UA 1J0BA 3QLUA 2XUOA 1L4NA 2ID4A 4A73A 3QEKA 3OCZA 1E3JA 4A9AA 5CVVA 1VYVA 2FRXA 2RONA 2X40A 1ACLA 3MJ4A 3OHSX 4ILKA 1UC8A 1Z74A 4OK3A 4PWYA 1L8LA 4QARA 4JWTA 2YBEA 1WSAA 1SHUX 2ZULA 1ODIA 1T6NA 4LJSA 1KGSA 4C6TA 2A5YB 1GOTA 2ZATA 3NBQA 4IP0A 1AU9A 2BFDA 3VTAA 3D3WB 2ZG6A 1YZGA 2QUAA 4Q7QA 3AUKA 4ZYZA 1UZLA 1JLMA 3OMLA 3HB5X 1D8AA 1XDGA 3G1UA 3GELA 3N2KA 3TIGA 1EGVB 4GMXA 1AKYA 4MMZB 2DP4E 121PA 1DKRA 3SZOA 4MUIA 1JMKC 5IMSA 3WXMA 3NYQA 1LTHR 1VYUA 4HO1X 1DMSA 1P4JA 1VFNA 3L8MA 1I7SB 4ARIA 5IEJA 4LVCA 2WMYA 3AEKB 1V8FA 4KQCA 1SUFA 2NACA 2ZIGA 3AU9A 4M22A 4O4JF 3EUFA 3UV6A 1XTUA 4B0OA 2DR3A 2EJUA 3L8CA 1W2WB 2PUCA 2PBFA 1ESMA 1MB3A 2FEXA 2WJYA 2BM0A 3F4BA 1W94A 2M32A 1Z5ZA 1XBTA 2NU8A 3IGFA 5EIEA 1R4AA 2VEOA 4JD5A 2O8EB 1ZINA 4TL6A 3RU7A 3RIMA 5I9BA 1FEZA 1ZXLA 4PNPA 4BMYA 2R6JA 2VAXA 3F6RA 4R16A 5E1MA 2Q5FA 3QVOA 2WJGA 1E0SA 1C9YA 2ZIWB 4MVJD 3TNFA 1U6IA 1K9SA 2A9OA 4A6XA 2UZ1A 3AM1A 3L4BA 4KR0A 4I50F 1N5IA 2W2MA 4RPGA 3Q8WA 4F86A 2FOIA 4MQ4A 3VR5D 1Y8RA 5DTRA 2Q0HA 4AB1A 2PUVA 1Z0JA 3SHQA 4BP3A 1IYZA 1H05A 4BMDA 3WYDA 4RORA 1Q84A 3V8VA 3ABZA 1N8NA 2HPZA 3IJEB 3QH4A 5A1TA 1HWYA 2GAAA 5HXAA 2ODPA 4P5EA 3ZY6A 3WJ1A 4ZI7A 3AWDA 4B3JA 4EX7A 1DBIA 4G0ZA 2J85A 2YW2A 4HAUA 4JIMA 4XQGA 1IN8A 1JSXA 1D2RA 2C29D 2OFOA 2W00A 4ND8A 4R68A 5E38A 1EDEA 2EKPA 2DFTA 4BO6A 3QU5A 5K6TA 1CUIA 2LWIA 2NYUA 2ZKIA 5T7BA 5LMUB 1SOAA 3I92A 2ZT8A 2NUPA 1OFVA 2PZAA 1TMOA 5JJIA 1N78A 1QPBA 2UZAA 5GOZA 5L3SB 3MAAC 2MSLA 3D4NA 2A0XA 3B1KA 5DSZA 2YNMD 5KQMA 4ZA2A 3RSZA 3TOCA 4N8DA 4XPIA 2XCTB 3LU1A 4F04A 1XMOB 4MI1A 4CFZA 5K0NA 1X3LA 3FBGA 4WA8A 1YZQA 4INJA 5CMLA 1AC5A 2F17A 4YBZA 1N1EA 3NV7A 4LEIA 4KMOA 5D01A 3RAGA 2QROA 1NN0A 3A28A 4EGJA 3T5AA 3ZZ0A 4XVQA 3UPDA 5AUPB 1KIMA 3JASB 5TMPA 2VNHA 2C2MA 4AZWA 3TGLA 2R1TA 3F9IA 1HKHA 3B2QA 3EDRA 3VYRB 1F6WA 3QENA 3LX5A 4R71A 3TXXA 4RPLA 9MHTA 3VR5A 2OXEA 1T0HB 2J9RA 4MO2A 5IDYA 5T5QA 5DM0A 1U0GA 3WAGA 3IEMA 5I7UA 1HNWB 3DZHA 1K0UA 2FPSA 1EDZA 3F73A 5CH5A 4FZJA 1PQWA 4YTEA 4KREA 1BVHA 3B3AA 1QFMA 3JWGA 3TK1A 1OWLA 5DXFA 3FLMA 4N5LA 2VWHA 1GQYA 5D6NA 3IO3A 1KETA 1Q1ZA 4PAMA 4JUCA 1EUQA 3PPXA 5HIJA 2XMBA 2CHQA 4Y1EA 4F1WA 4GL2A 3SLKA 2D4HA 3EIQA 3WHIA 1FYWA 4DPKA 5HG0A 3RS9A 4OGFA 3QLJA 2YDYA 1ARZA 2IYRA 1GNPA 4JNCA 4K46A 1U3VA 1SZJG 2D0DA 3JQ8A 2QMHA 1EFHA 3M7IA 3FVRA 3S6JA 2EYQA 5IBCA 2GBFA 3BWMA 3W3AA 3AMVA 2QVGA 2DTXA 1LNSA 4TMFA 1N0HA 1UDBA 2W6CX 2X7JA 3KQSA 4LI3X 4E3WA 4QPJC 3UXMA 2RHCA 4WZBE 3F6YA 5LP6A 3QM1A 1GCGA 5CYOA 4LDRA 2EYUA 1N5LA 4HZGA 3VR6D 4U0JA 5DNYB 1R15A 4XUDA 3V9PA 4XB6B 2RJOA 3G82C 5FWXB 4R41A 3KKOA 1Y8QA 1YQGA 4KR6A 1P4HA 4E33A 3NEYA 2V1XA 5TX7A 4AY2A 4J9VA 3WLPA 1QVZA 2QW1A 5IVDA 4J0CA 4R1NA 3QX7A 3W5BA 1YUBA 1JHYA 1YDHA 2PQ2A 3ZJUA 4NZ9A 1PG5A 4MV8A 3LOQA 3CN7A 4NEGA 3PJRA 3BGIA 2O3QA 3P94A 1CUJA 2A86A 2WM8A 1TDJA 5HMLA 4DE5A 1RAGA 4MKHA 5IABA 2HK6A 1JHVA 2SHKA 4M87A 3KVNA 1RJ9A 1MQ9A 5A7HA 3RHZA 3ZHCA 1KRHA 1ZH6A 4TQ9A 1J90A 1DQZA 3D8TA 3KKPA 3CLRC 2J48A 1CDDA 3LYUA 4Q1CA 2XZLA 2WE8A 2ZI7A 4OQMA 5ILGA 4F5YA 4ML3A 3R6DA 3F6EX 5CVEA 2YHBA 4DSTA 4UULA 3M6MD 3UENA 1FZQA 4Q02A 2WBLC 3GFQA 4OMFG 1EVJA 1RI5A 1HDEA 1Q7GA 1NUSA 1H0SA 1P9LA 2M9MA 3L1UA 1WOMA 1Z29A 4HLNA 3OE7A 5LN1A 1U9YA 2UXBB 3OG9A 4B4VA 2CLMB 5BRJA 1I7PA 4OU5A 3HUFA 2X5OA 1UEIA 4EELA 3JD3A 1J9GA 1RJ9B 1MU0A 4AY5A 5JECA 2CJPA 5AHKA 2CHEA 3I6MA 3NEJA 4NG5A 3KAKA 4O33A 4GM4A 4OHFA 2GPBA 1LQTA 1PZHA 2NV2B 2BZ1A 1M7HA 3DKIA 1QV9A 1P3DA 1XZPA 3OX3A 1VIAA 1ISSA 3TS1A 1T15A 1JKMA 1N77A 1RD4A 4R2WA 4KQ1A 4NOJA 4A23A 4WMLA 3ROZA 4EW6A 1EFAA 2ZPTX 5B58C 4Q3AA 3H11A 3DZGA 1MEEA 4OBXA 5EUMA 8ABPA 2ACKA 4U00A 2HFJA 4XD2A 5DX1A 4Z9XA 4X91A 4XWKA 3IXLA 1KZYC 1GKIA 1SR8A 4REQA 2W7TA 1JJBA 3LUGA 4LS3A 4AUEA 4M7RA 4RTQA 3U49A 1N6NA 1PL0A 1P9RA 4B6QA 2FPUA 4KV9A 1W47A 5LOVF 2DY1A 1Q0PA 4JWKA 4EPXA 3K5WA 2Y1OA 3FVQA 3GUCA 3K1YA 4K7JA 1I7QB 1M75A 2C9MA 3CX6A 4M1EA 3SJAA 1LRKA 1Z4PX 3WO1A 2QZ9A 4MUHA 2P75A 1X86B 3SEFA 5JI3E 2HGZA 1JDBB 1VXRA 1RJDA 1DKLA 3CRZA 1Q16A 3JATA 1IOZA 1PEAA 2C2XA 2ZUUA 2R25B 2FW8A 4QZVA 3OE7D 2OSBA 3QE0A 2C20A 2GNOA 2IS2A 1US8A 1MXFA 1H2WA 4MWBA 2FWIA 1F06A 1JKJA 1SUCA 1PZEA 2QQ5A 1E0KA 2BKUA 2Q2OA 3IT2A 1WKVA 1QIMA 3I72A 4CJXA 5JE8A 1KH3A 2YRFA 5KNBD 3VX4A 3ISJA 1CUXA 2BEJA 4KI7A 4JXKA 1E3IA 2Q28A 3QLVA 4R7GA 3A6GA 5F51A 4MEBA 3SN6A 2FMUA 2JA2A 2Q2VA 1A69A 3GPBA 4R83A 1V4BA 1W6RA 2Y1DA 3B6EA 4Q5IA 2D54A 1P0PA 1ZIOA 3SYTA 2PWPA 1ZUNB 4N82A 4CF3A 1SM4A 4P3XA 3INTA 4O5OA 3UXHA 1HG0A 3HO6A 1AQLA 2NU9A 5FEMA 10MHA 2XXAB 3HKEB 1NT2A 5WRFA 5HIIA 3RSQA 2OZLA 4FW8A 3IDSA 3LBNA 5LBIA 5JAIA 2C4TA 4XVRA 2H18A 3PKZA 4AIIA 1GPWB 2CVOA 2PQMA 1FP7A 1UBFA 4LC1A 4RZQA 3A1SA 3TSCA 1W0KA 3ZNOA 4BN5A 1G5PA 4MAFA 1T4BA 3TMKA 2YWGA 4TYNA 1WABA 2O19A 2XUZA 1Z18A 3SM9A 1U6JA 2VBGA 5G3YA 4C01A 5A1JA 4GI7A 5D3QA 4G1VA 2VJAA 4GVPA 4EUKA 1OFUX 3TSWA 4D4IA 2QWXA 3E2PA 2LNDA 5J1TB 1EBFA 1SVOA 4JODA 4E11A 1E58A 1NFQA 2JJYA 5JDIC 3DDOA 2NU9B 3EXG1 1F14A 1O8BA 3S2YA 4D80A 1GR1A 5IZCC 5BSEA 1E5QA 4GQBA 2Q3EA 3AWIA 3JD0A 1EDOA 1P17A 1QCDA 3RASA 1BO6A 4R1QA 1HDCA 1SKUA 4ZKEA 4IO1A 2BH2A 1YQWA 5A5EA 4JU8A 5FRDA 4ZEVA 4CKCB 2Y93A 1D6JA 2R5FA 2X0EA 3SX4A 5JSHA 3ACCA 1UL1X 1RWWA 1EFVB 1CS0A 2RARA 4U2FA 1LDNA 2YZ2A 1CUEA 2X3YA 4WHMA 4GGOA 5J9FA 4C7KA 2Z2ZA 3WYEA 1JFLA 3QVVA 5IUNC 5JR3A 4OSPA 4YRQA 3A8TA 3O82A 2GNPA 3GFVA 3VM6A 4MS3A 1Q0SA 5G1NA 4Y2YA 1E2PA 1RI4A 1SCKA 1U0NA 1HNZB 1VLZA 5EVCA 3GUYA 2BUBA 2JAXA 4TMVA 4UUMA 4MVJM 4KPYA 3GNSA 4N47A 2AZMA 4TQAA 1WNFA 2FMKA 3P9ZA 3I05A 4BYGA 4KO1S 3K5HA 2C4VA 4CZ2A 1VL8A 3PSAA 5FPTA 1G3QA 3V3TA 4CR8A 4BAUA 2ZROA 3R9XB 4AG5A 3IV9A 4I5DA 3MC1A 2AT1A 4KODA 4J4HA 2X0IA 4DNQA 4QOJA 3PWTA 5ADHA 1WUKS 4MS3B 1NNI1 1YCHA 3GRAA 4NZPA 1PHRA 2O2SA 3DVRX 4ZQHA 5EGSA 1C30A 3T5PA 1U2DC 5LSAA 3IQIX 3BXZA 1VKZA 2CZGA 3NHWA 3EAGA 1UMBB 4FJ2A 3WTCA 3UEOA 1H6BA 2LGJA 4TLMB 1TM1E 2GFIA 3HRIA 5BWMA 2PZLA 2VPWA 4B7CA 4N18A 3V97A 2FPPB 2XB8A 3EFOA 4YGXB 5EKXA 5I7WA 1ZNWA 4JI8B 1KP9A 1FDRA 2B2NA 4QNNA 1UM9A 2JAQA 2YQ4A 3N8DA 4BKPA 1Z38A 4R9VA 4P3YA 1NX9A 1C80A 3IHKA 3HXQA 3CN9A 4BMCA 3JZMA 5K20A 4ROSA 1QO0D 3CEJA 1U8XX 4NESA 1KEWA 1OU0A 2WJIA 5BMVA 2GUGA 1WLSA 2PKQP 4ND1A 3UB2A 3C6XA 3KKKA 1RW4A 4ENWA 1HFKA 4AP5A 1ZK1A 4ZI7B 3AVOA 4QBKA 1MABA 4W4TA 1SD1A 3REOA 2JJQA 2YMLA 1L4EA 3OQ1A 1FX0B 3P4UA 3HH8A 2XWPA 2QYOA 3BCUA 4H59A 4IRMA 3H9CA 4FNMA 3OEHD 4JVSB 4PC6A 5KBYA 5KMGA 1AUPA 2DWPA 1HZJA 2QE6A 2Z9DA 1Z5NA 2LCQA 3CKMA 5SY9A 4OFZA 3O2SB 3QE3A 3NAMA 3ZIAD 3I8XA 3AYXB 2CDBA 2XVAA 1A8SA 3H1FA 4YC7A 1T9DA 4PFKA 5EKTA 2ZR9A 3HZHA 4E30A 5FL7D 7ABPA 2P9GA 2W9XA 3WLEA 4MICA 3UXEA 1BIFA 2X15A 3WV4A 1H1TA 2BGKA 2MHCA 5CB0A 1RLTA 4HJRA 3BD8A 4DNXA 1ZC4A 5TPWA 4EI9A 1F7UA 2YN4A 3KOXA 4E22A 3HJGA 1H1LB 3DJFA 1GRQA 4EA9A 2PGJA 1AF4A 2W2KA 3QOWA 1XB2A 2J3LA 1B7GO 4IICA 1QYIA 3PQ7A 3RVMA 3AG6A 1AK1A 4H0CA 3AUUA 1NYTA 1IIRA 4HWGA 2Q21A 4MS1A 1DGQA 4IIXA 4RJ2A 1FE8A 1M3SA 1TPYA 2H65A 3GFBA 3SEAA 3AI1A 5J4HA 2M6SA 3ZS8A 4A1OA 3LF2A 4BAZA 4LYGA 3MPOA 3TVDA 1UBKS 2VWQA 1YZUA 1O1YA 2FN7A 1HOTA 4YX9A 3CLUD 3U80A 1Z0AA 3H1AA 4TMXA 4XWYA 2GX6A 4DC1A 1AHNA 1ISRA 2FXVA 1XXHE 2RSLA 3HPRA 3G0GA 4D46A 1ZEJA 4MMYB 3WBBA 1HQDA 4NU6A 1U0BB 2J3DA 2OCIA 4A8JA 1ZK4A 2BPOA 5E1OA 3RSLA 1C8VB 2OZVA 3RG2A 4ER6A 1XZMA 4Z4IA 1FXSA 3A3NA 3L6RA 1I1OA 1PJ2A 1QZTA 4XB2A 1JHUA 2QE7D 4UJ5A 3COWA 3ZHTA 3UMRA 4WK4B 4IDQA 5DEIA 4YIKA 1DBPA 4Y0AA 1A9RA 3SBDA 3HWSA 4QXOA 3W7BA 1OR8A 3TF5A 3CU5A 2QKYA 3N0WA 5BUCA 4XUGB 5DYWA 1KY3A 5B3KA 1YD7A 4KB5A 1JU3A 1AKRA 4X71A 3OIWA 2IPMA 5EIAA 2P9CA 4DWWA 4Y8VA 2EF1A 2GO1A 4W63A 5DTQA 4BLRA 2ODTX 1GGMA 2LVBA 4EJ6A 5JMPA 3EXHA 3DUWA 3QTBA 1A88A 4BXOA 1G5FA 2CXPA 2OFFA 3KU1A 4CHTA 1LX6A 1B14A 4EUFA 1USGA 3P2KA 4G07A 4DLTA 4MR8A 4UMDA 3EA4A 3HWWA 1AG9A 1RWBA 3KPUA 4F5WA 2C2GA 4P4LA 1I2DA 5BV8A 5FKJA 3C3XA 3S70A 1N6LA 4CDMA 4G5YA 1UBOS 1ZM2A 2H1OA 1P60A 1JWBB 3L6OO 3HNRA 4KDEA 4JLBA 4UVHA 2MIIA 2CGEA 4JSTA 3H3XA 4DM3A 1UAAA 2L19A 1FY2A 1TK9A 1CUZA 1STOA 3SJBA 4P6VF 1GVHA 5H83A 3E5RA 5FO1A 3R9IA 2WUGA 3JQDA 3WISA 3I6QA 5A5FA 3F47A 3EIFA 4OP1A 5BSMA 1T8SA 4RK4A 5E4FA 2PS0A 3UT0A 5HSGA 2PZ8A 4PC2A 4WUTA 1BRTA 3R7BA 2R7MA 3FKSD 4UDNA 3PYLA 4MGHA 1X80B 1RM4A 3LQKA 2CMHA 2RDMA 3ETCA 3Q9UA 1NBMA 4MW7A 3VNSA 1PO7A 3OF5A 1MW8X 2XDQA 3LT0A 5HQJA 3FF4A 3LC7O 4L8FA 3U31A 4NJMB 3OWHA 1CQXA 3B51X 1HRDA 4BV2A 3FYUB 3QPVA 3EZFA 1RBYA 3K30A 1E2MA 4PQYA 5BYJA 3LLUA 1GPKA 1V16B 3CVOA 1PEKE 1TRKA 3HCAA 5DHFA 4U9HS 1L7DA 3IQDB 3GK3A 3R6LA 4ZOLF 4DARA 3AUJB 5C1OA 5L7TA 1J33A 2Q3LA 2VHWA 4RFVA 1F2TA 2IEAA 3PC4A 5CJ2A 1UBRS 2IYLD 3OEEA 3VVCA 1D8TA 2Q6IA 4MVJH 1CB0A 2CXTA 3N8HA 4RW0A 5C8YF 1JFRA 1MXHA 2GB4A 4Q66C 3FUTA 3CLUC 3UAWA 3W06A 4R0VA 1RHUA 3W0LB 1JIXA 5AW0A 4DLKA 4WADA 3W6UA 4DMCA 3GPDG 2BFFB 3DE6X 4LSZA 3VC1A 3QXXA 5FL3A 1A9TA 1TF5A 4YMHA 5C8ZA 4BNIA 2FSPA 4L9AA 5K05A 2EGHA 2WK1A 2QRMA 5DTJA 3G59A 1FK8A 3CNQS 1Q7CA 4P9NA 4OX9B 1MC1A 1OPXA 3GLRA 4NX2A 1RNLA 4RWZA 5KZMB 4ZCQA 2DQYA 3DF9A 3OLZA 1PZMA 2GD6A 4YI5A 1OMOA 4WINA 4TLDA 1UC4B 4I4CA 2JG3A 3EXG2 3QWFA 1HLPA 5I4CA 3I6BA 1B3BA 3V1LA 2MYNA 2FQXA 4QT4A 1N6PA 1S2GA 4AJ1A 1DX6A 2VAVA 2WTEA 4QODA 3U7RA 5A03A 3SY8A 1F8XA 5BQFA 4W5QA 3OT1B 2D5IA 4A0HA 1NVDA 5FLKA 5FX2A 3DPSA 4YJ3A 3RNOA 3RRZA 4DYVA 4DLLA 2BONA 3ECCA 3PITA 4LK3A 3AR9A 3ICCA 3VFDA 5TJHA 5C5DA 3EG9A 3RVBA 2OG2A 4LRTB 4Y6LA 3RO7A 1C4KA 3I1YA 2FFHA 4XYLA 4BQRA 3ZGZA 1RR6A 2VDQB 3PQ3A 2DGDA 5TPWB 3EQ6A 2O5CA 4BP8A 2W37A 1TKCA 2JZOA 1XELA 2HGSA 1IBMB 4IYRA 4C6SA 3Q9NA 3MCUA 3VDNB 3PNQA 3KSZO 4KWTA 5BNTA 3C87A 1Z17A 1JWAB 2IT1A 3OJCA 4HXYA 4ZVKA 4UTPA 4CT5A 2PUAA 1UKBA 1C7FA 3KHKA 5DGXA 5J5CA 2VDVE 3BSSA 3CX3A 4GE0A 2XXJA 3RM3A 3CR8A 2F3TA 4RJJA 3LX6A 1YA4A 5I3ZA 1OZAA 5EJIA 3W1VA 1NMYA 4W8HA 3ESXA 3IBCA 5AUNB 2P0YA 1BXGA 1DJQA 2VHEA 1EFKA 5A05A 4J6EA 2O7QA 1F0NA 3BGVA 4ALLA 2ZB8A 2YW9A 3V4FA 4QLAA 5IEBA 2QMQA 4BFZA 5JATA 3NRCA 3BCRA 1PQ4A 2SKEA 2WTMA 5HJEA 4INPA 2F59A 3L1VA 3MMNA 1SPXA 3LIIA 3LWNA 3OPYB 4IFEA 5ADVA 1VB3A 1ZWLA 3PHJA 1IPHA 4OD0A 4TLAA 4I8DA 5L51A 1G3IA 3OSZA 3QX3A 1JLHA 4D26A 1Q19A 1KJ9A 1T13A 4R5HA 3DFMA 5DYNA 5B6IA 3LBFA 3E9CA 3GW8A 3SDZA 3I32A 3GLHB 5AK5A 2VF5X 2ZBGA 3KRTA 3GZNA 4MUNA 2IIVA 5IC6A 1USWA 1VRCA 2GQ0A 4IBOA 1T8RA 2HQ1A 2PMWB 4Q4HB 4G1MB 4YRFA 3UJDA 3U4MA 4PG5A 3I2GA 2O8BA 4AX8A 2YXNA 5KREA 2QUBA 2ZBUA 2YV5A 1NOJA 3AFNA 1U2GA 1X8XA 3H42B 5DBFA 4ZVMA 4K3VA 2I54A 5JCXA 4YHHB 6YASA 2FLVA 2JIZD 3L43A 3NETA 4H4EA 3FLBA 3IBGA 2CUKA 3U3RA 1NW7A 4N48A 1OCEA 2W48A 4AZ3B 2MSNA 4Q9JA 3DHVA 3W78A 1R1DA 1WXHA 4HDSA 1ISFA 4FONA 3CZ4A 2QMOA 1YS6A 2GN9A 3MUEA 4LXTA 4RKWA 2GAIA 3BRWD 3MERA 2JCGA 4HN2A 1K06A 2XTZA 4CGYA 3ZDDA 2HYDA 2XHZA 4R2JA 3EY4A 3UMJA 2R65A 2RHOA 4BBZA 5CDHA 5LXTA 1YGYA 3ZNQA 3O4FA 1OKKD 2C5SA 1GAWA 3DAGA 4Q47A 1KVTA 2QS9A 3CZAA 5DBEX 4D81A 4LHXA 4QXAA 4UD2A 4ZOLA 5CLHA 1CNMA 1MDFA 2KQUA 3KKQA 2XDQB 5G4LA 3DG9A 3QEJA 3PQ8A 3IL2A 4PIPA 3GUZA 5DRYA 1C3XA 3CZPA 1PCXA 2ZJFA 4YJDA 5AKXA 3WK4A 4BX9A 5J4YA 2MU1A 2ZSAA 3H1EA 5KNCD 3S1SA 1TCAA 5A0TA 4JLMA 2ZRCA 2CLCX 5K3OA 1FXUA 4U2KA 3W2HA 1G4HA 1S1MA 2OCXA 2QPAA 3AP3A 2KSQA 3TWOA 2OAQ1 5H1YA 1DRWA 3PZRA 3CSUA 3ZBPA 4HVLA 1KZ4A 4PBSA 5DGCA 5JPIA 4TXMA 3ZVNA 2ZQYA 3K7EA 4BXOB 5IWAB 1ZOSA 1JBKA 3UJPA 4Y9RA 3NASA 3NUZA 3H0EA 1I2CA 3MS4A 1GEEA 3TR5A 1E2BA 2NVOA 4HAYA 1KEEB 1YHYA 4MVJP 3CLTD 2QL6A 2FMIA 5DNAA 1M8GA 5FWDA 1U0RA 2R1UA 2OO5A 5IJXA 5JXWA 3BRWA 4HXEB 3QKTA 2A1UB 4IKOA 4XARA 3ABRB 4LE2A 5LQNA 1WW8A 3BCHA 5EVJA 5TLSA 3OWXA 1NQXA 2OGTA 1H2XA 3CTMA 1UDCA 2PYIA 3PWKA 4NU0A 2OYCA 4FZRA 4CLOA 1TT5A 4E5NA 1E7WA 4EHBA 1WXDA 1HE1C 2AFHA 1QHFA 2F90A 4M83A 3V1YA 2B1QA 1UQRA 2IKQA 2QF7A 1F5NA 4K40A 4WW0A 2BD0A 3AETA 3UWKA 5KYTA 3PA8A 1KFBB 4O6VA 1GFZA 3ZWQA 2CFRA 2EEPA 4PV7A 4UCWA 2CNLA 2Z3WA 1N6KA 4P3KA 4D96A 4Y9DA 3TGPA 2P6MA 3H4TA 3HY4A 3PNSA 1TQ6A 4EPVA 5IN5A 1Y3CE 2QN1A 5T57A 1Q6ZA 5FTKA 2IYZA 4X1KA 2B4QA 4EY7A 4FQ5A 2JZNA 3M0EA 4FFVA 2RHRA 2AEEA 3B70A 4YDQA 2C1EA 2PS1A 5F98A 2C5EA 2C78A 2DBZA 1Z2OX 3ZCSA 4CKEB 3C6QA 4RA9A 5EE1A 4CM8A 4U2EA 3KT8A 3IEKA 3ND8A 4KGZA 4DCJA 2P2LA 1GPUA 1QE3A 3KZKA 2AOTB 4G01B 2IYPA 4LHZA 4GZ3A 4F06A 1R16A 4UNIA 3KWFA 2NUTB 4MIOA 3SZGA 2NWQA 1HDGO 2R97A 1B0PA 2ZSIA 3OLXA 1CULC 4GR4A 4JYAB 4HAOA 1DJNA 4S2UA 3SQMA 3T5CA 2BL4A 4X1OA 3H2IA 4LV6A 2BFCB 4PBRA 1PVOA 1NXPA 2F43B 5DMXA 2JFGA 5E8RA 3ILYA 3FPHA 4IV0A 5D3MA 1ZVKA 3WIVA 5DB4A 5GM1A 1PG2A 3NDJA 1UAGA 4RA9B 2YZMA 3CUWA 4URZR 4B2LA 3AI2A 3MWGA 4V0KA 1J5PA 4KUEA 1YR8A 1BE6A 4MPDA 3CBGA 5DISB 4CNBA 3IA7A 5BV2P 1ZXBA 1IY0A 4HADA 3R7SA 4IOJA 3V33A 1FFWA 4JP8A 2VJLA 5E6UB 4CYMA 4D6XA 2VDWB 3TMYA 4JJ7A 4ATNA 2E48A 2VH1A 4F4DA 4EJ2A 5LLDA 4RD3A 4J76A 2G6TA 4MR7B 1R5JA 4CI9A 1YK1A 2VUIB 4M1WA 4RVNA 1Z2NX 2AXEA 4UE3S 1I4LD 1N5RA 3QMWA 3TBFA 2R6GA 3ZDYB 4LJAA 2G88A 4RD4A 3LO5A 1REQB 3IUMA 1J9ZA 1ZNYA 4K6KA 4O8CA 1BHO1 1MFZA 3E7PA 1AS2A 1NPYA 4RF3A 1H42A 2ZYHA 4C4OA 2Q8QA 2JH3A 4F46A 1U0JA 3CRRA 1HE2A 3CPHA 3VV3A 1YAHA 2NUAA 2J87A 2ZE7A 4OMDA 4PZ9A 3KSRA 2GZ1A 3RPEA 3VAAA 2VYCA 2ZYDA 3HNPA 3ZZMA 5B36A 3RABA 3TECE 1G5QA 1SIWA 2QI9C 1L7VC 4YHBA 4PANA 3TR6A 1NN3A 5BQOA 4EARA 5GVRA 2RHJA 2GXSA 3RDPA 2JJ2A 4QU5A 1W5BA 5H9VA 4K8OA 1VCHA 3GDOA 4CTNA 4TYQA 2CK3D 3MLAA 1KI1A 2PWBA 3AVUA 2FFQA 3MJTA 3BMNB 3KDPA 4GR9A 1Z6TA 4JB3A 4JLJA 4J07A 4OHXA 4O2LA 5DSXA 5B7GA 1KRWA 1DOHA 2A0YA 4PC1A 4F9GA 4BGDA 4WQMA 4YCBA 1ZZGA 3LBYA 2AOXA 4K9NA 1P3Y1 2IZ7A 3FMGA 5FR2A 1Z4NA 4MWTA 4NOKA 5BNFA 4GRDA 4MW1A 1HT1E 1Y6QA 3IXQA 2HZBA 1SEPA 1QOPB 3GLVA 1BOFA 2GM4A 4RY8A 4DG9A 1TAHA 4R8KA 5FBVB 3WVNA 3DVQX 1T6YA 2D5BA 2QK4A 3IJ5A 4JEHA 4RTSA 4NCBA 2PMDA 1ZLYA 4JA2A 4ARBA 2WQZA 1TA0A 3HTXA 3PGA1 1E3TA 2B2XA 4P5PA 4BNJA 5KYGA 4R9SA 5K0ZA 1S01A 1VI6A 2H0QA 2P62A 3MXOA 2NPIA 3E58A 4KW7A 1DJOA 2OHXA 3HXLA 4US1R 1Y0BA 4G0UA 3ZWYA 1RMQA 2QOEA 3GJXC 1B73A 3G2JA 1U7OA 4P58A 4WLUA 4DDMA 5THXA 3QJGA 2EX0A 3A3OA 1VP9A 4WESA 3W3ZB 3FWNA 4WJZA 3RSSA 2OGUA 1NVUQ 3ZW9A 2B78A 1F7VA 1FDIA 1UPXA 1V41E 3NW9A 1QPZA 4F92B 1QH8A 4XOUA 1NNUA 3EFHA 3A6KA 3OQVA 4NBRA 5DLEA 3WTBA 4UEOA 1V2GA 4QPZA 1CUYA 2XA9A 3AC0A 3TRJA 4YBRA 4AWXA 2H8KA 3MVEA 5I4IA 3B2EA 4QASA 4ZVOA 4RIFA 3JWIA 1JIKA 4F3YA 1JPNA 1JUDA 2EBFX 2WLTA 3AUAA 3LT2A 2UUOA 3O3OB 3PHCA 4OM7A 5EEGA 1MTZA 2PGDA 1FNBA 3TTWA 4JEUA 4EFLA 2OG1A 4XTCS 2R7NA 3SC2B 1IUOA 3LPDA 3OEHA 2ZKLA 1WULS 2F9FA 2R7AA 2ZR8A 1ENZA 3L7LA 3QXJA 5EPOA 4G86A 4HN9A 3ZJYA 1QRRA 4S0ZA 2I7DA 2K4MA 4ZAVA 3ZK7A 4OAPA 1J6UA 3C8UA 1SKMA 1QC5A 2H4XA 2IUFA 2O3UA 3F6BX 1ZMXA 3I6YA 1DRJA 3M9WA 4WLVA 5D3KA 4ZXPA 4LY0A 1Z83A 2GPJA 1E20A 3AB8A 1G6OA 3LHFA 1H0KA 1QMGA 3DW3X 3RBXA 4D3YA 2FN3A 2XMRA 4UCFA 4E4RA 3W2IA 2IUYA 4QO7A 2PBZA 4NENA 1MEJA 2HMAA 4L6AA 3X3HA 4IJ5A 3DMGA 2E4WA 5IFLA 4BY9E 1L3BA 3E8MA 1JDZA 3PXCX 4RDCA 4B35A 5HNKA 5F9FA 2D7JA 4IJ6A 1L5NA 3R5JA 3G23A 1BCRA 4FR2A 4NV1A 3BXGA 3EASA 4YAKA 3HKDB 4HRYA 2QBYA 1P0FA 4NWIA 3I76A 4FINA 3VYSB 1YKGA 3NJ4A 4BRUA 2J46A 3I4CA 5LXTF 4IAOA 4DIOA 4PRZA 4D98A 2JHFA 4DNPA 1DIRA 1VTKA 3CGWA 2ZJ8A 2IJGX 4IGEA 4YJ2B 2X0DA 4LDQA 4NBTA 3WGNA 3OTWA 3O84A 4RESA 3W2TA 3GN1A 4MRPA 1R6DA 3ERCA 3PXEA 2F4NA 1VIVA 1CUWA 2JKYA 1YE8A 1OBHA 2DAPA 2GK3A 1F9AA 2P27A 3FUCA 5NLLA 3VPCA 3NG1A 3U4HA 3TLKA 4JUAA 4F6RB 5CCBA 1G8AA 1OI4A 3ZW7A 4OI2A 3RTCA 1KSGA 1XRPA 3CISA 1Z4KA 5CPBA 3QUAA 4B31A 2VQSA 1SNYA 2VUUA 2PH3A 2ZRHA 1U9CA 3B8HA 3I5XA 2K2QB 1ZD1A 4OREX 1CF2O 4J7UA 1K2VN 2I71A 2D62A 3RRYA 1MHPA 2GAFA 4JC5A 3SHFA 1BEUB 4CCYA 4JC8A 4UJ3A 1N3IA 5ERXA 2H7VA 4C4SA 2VC2B 4F71A 1O94A 5DBHX 3ZI0A 1HFWA 3ETGA 3O7MA 4JP5A 1OH7A 3PNVA 2Y1FA 4I55F 1HEIA 1PG0A 1ECLA 1G2IA 1CY0A 1Y3IA 3RH0A 3A9CA 1P2FA 4TYYA 3D0RA 4E2WA 3COSA 4P31A 3EZYA 4PF1A 3T3IA 3UT5B 4BB0A 5A62A 5JFTA 1L5VA 3ESCA 2YKGA 1Q1EA 2BGRA 3Q7RA 4ENQA 1WMAA 2D2VA 4BJ5A 1FIUA 4E5DA 1FP1D 1Z7BA 3QVWA 1P72A 3EXIA 1UXOA 1CY8A 4Z3DA 4IF4A 5KDOA 1G7CA 5IVKA 4LXYA 3NH9A 3OM9A 3DBIA 1SJ9A 3OKPA 1QO7A 4ZT2A 3MM4A 5ICEA 4FFDA 3WBKA 2EAUA 4FS8A 1L7PA 1EGHA 2IHJA 2W98A 4X45A 1IQ0A 3D5TA 4HZIA 2VHXA 3NWOA 3DCIA 4EH1A 5CNJA 3N8GA 4CTOA 4IPTA 2XB4A 3A1CA 2C5FA 4B4KA 1KK2A 1R64A 4JT2A 1P2SA 4JMPA 4Z4HA 4C7OA 1V25A 1YJXA 3CGGA 3N0XA 1E2KA 3E0QA 3ABIA 3FR7A 4D44A 4EUEA 1Y7IA 1TCVA 3OCUA 1G55A 1EUDA 1ORRA 2A14A 5JRDS 4N9QA 2NO7A 1NXSA 1Q6YA 4BGIA 3P2OA 4R1LA 1WDWB 3D1LA 4FTWA 5BW8A 2FI1A 1LBQA 1WU8A 4L27A 2WYUA 4MDYA 3D8UA 2QG6A 3OZWA 4JSRA 5CYFA 1IBLB 4QICA 4Z2AA 1AZWA 1XAIA 2Z3ZA 4LYFA 5JZ9A 1KIAA 3FKQA 4OIFA 3TXAA 1UK9A 3I2IA 4D9BA 3PFKA 2Y0PA 3B12A 2JGFA 3D43A 4MXDA 3WLSA 3TTSA 1Y6RA 2QZPA 1PR9A 3FB4A 4EFDA 3T3MB 1TTQB 1VSVA 3MJRA 4Z2YA 1ZSNA 4IXTA 3M2TA 4RAOA 4F96A 4JKOA 4OHUA 1IRXA 2LKCA 1FRQA 4I9HA 3RSHA 3U9LA 4RA6B 3T5BA 1U90A 4FYVA 2Q0QA 1XLTC 3B52X 5E6SB 3T61A 2CNKA 4MH0R 4YAIA 1QRTA 1T3LA 1XJ5A 2B1JA 3AF3A 1FTSA 1LQ2A 4WNYA 4FXOA 4Y2VA 3U1VA 3TCKA 3KDSE 4Q7EA 4W5HA 4UNSA 4F11A 1SHJA 2AZDA 5H7XA 1JL3A 4MKXA 1EXDA 2XB2A 3TRFA 1P7ZA 2XMZA 2AG6A 5ED0A 4EX6A 2H2DA 1Q0UA 1FMCA 1V9LA 4GOLD 3DLPX 1H2HA 2XTMA 4FYYA 1GLNA 3ADOA 3EGDA 3IJPA 3NWPA 2UXDB 2D1TA 5JH7F 2BMAA 5E7JA 4G25A 4MWCA 4CW7A 4UNRA 2Q6VA 4JLWA 4OQNA 3MGGA 4UD6A 2FFJA 3BC1A 4FZ3A 4ZCIA 2K2WA 2PO7A 2WI8A 1A71A 3NONA 1TVEA 2A78A 1GSAA 3BEDA 1NM5A 2IZ1A 2PQ6A 4H6VA 3L1HA 3M81A 4OK5A 3I2YX 1IB0A 2IGTA 2R6AA 1J5XA 1I1QB 3GRZA 1FYFA 4R2XA 5FOTA 2NPFA 4XLTA 3GGOA 1JLLA 4QJIA 4X6XA 2NZYA 2O6LA 5K4AA 1KQ3A 2P9FA 2HBZA 1LSSA 1PFWA 3PHBE 1N75A 2RC5A 1ZL2A 4K6OA 1EJBA 2CDAA 2ZYIA 4UHJA 1V1MA 5JZSA 2BCJQ 3L6CA 1FUKA 3N2GA 4FWBA 1DIHA 4L2IA 2XYHA 4TWRA 3TZHA 3U7QA 4PYIA 1MAUA 2ONZA 1LDBA 1BKDR 1CLUA 2BHLA 2P1DA 2R7KA 4M54A 4TRNA 4BZWA 4PAQA 2VUTA 1FA9A 3TOSA 4IGAA 5K3AA 4KOEC 4GIBA 1C7RA 4J1SA 1H2EA 2JC3A 3UYLA 2BFNA 4JJKA 4K3UA 4L4SA 2X4DA 3CXRA 1T8WA 4DQVA 2I3DA 1FFHA 4J2TA 4EY8A 4AJLA 2D06A 2Q6LA 1GCAA 1UXHA 5HDBB 1V4VA 4U6NA 3DWEX 3RKRA 3TNLA 3UXYA 3W9SA 5LM3A 4NU8X 1DTSA 4UFPA 1JQKA 2PGIA 1OV4A 4GLFA 2OILA 2A30A 3IAUA 5HIAA 1U2PA 4HGZA 4R84A 4RYLA 2X41A 1U3DA 2ATCA 1YVEI 4L9RA 2IPXA 2QZZA 4H7DA 4P93A 4PYQA 4UZSA 3UUFA 4ZCMA 1TVKB 2CHVA 5F1YA 1P1HA 3R9KA 5KC8A 5MFZA 4MYHA 1OLUA 2BHTA 4U7JA 4XDHA 4QREA 2YUIA 1JA1A 3QKSA 2ZDGA 5ALVA 3FOZA 4CQLB 4BNNA 4UBJA 2ZETA 4NCHA 2Y05A 3Q1KA 2Q07A 3BHIA 5FOWA 3UCEA 2FUG1 3THXA 1FFXB 1IM5A 2CNBA 4UHKA 4ZI7F 4IDEA 4LOJA 5DNDA 4OHVA 1JEAA 3KZCA 3OZSA 4JBLA 3WMFA 2GYYA 1EZ1A 5L40A 1PK9A 2XH8A 5I5GA 3RLIA 3VDXA 4E09A 4ZO9A 1FSGA 1MJFA 2G5CA 1H1DA 2ORYA 3NT5A 4RIGA 4GX2A 5BO5A 2X2OA 4US2R 4HDSB 3KKEA 4K6GA 1V5IA 3P0EA 2YXDA 2P67A 2CLEB 4KR3A 4AS1A 2JHCA 4KZKA 2Z0MA 3DBVO 2R44A 3G9UA 3HDVA 4FCVA 4C88A 3PICA 1VKRA 2JIMA 3W3AH 4EM6A 2GLTA 1NGSA 2GH1A 2XY4A 2Y68A 5L6LB 1FUUA 3QELB 1QTRA 3HLKA 4NYMQ 4JBYA 5EMLA 1NV9A 4AG6A 3DPIA 1TU0A 2IY7A 4UMEA 4Q4HA 2WG2A 1TZ2A 4D97A 1GGEA 3PIDA 2J5XA 1N1DA 2QN7A 3CFYA 3DMTC 3H86A 4I6GA 3USES 2ZE6A 4D3DA 2H3EA 3CM0A 3F0TA 3QLVC 1D04A 1Q0LA 4FN5A 2RB4A 3L6UA 3MS7A 1QJ4A 4OM8A 3WK6A 1ADYA 5E8JA 4BJ1A 1IOLA 3EHEA 2C2HA 4JDPA 3TVTA 1K1EA 3I2HA 4P0PB 2E4YA 1SEVA 3NXKA 5TQ0B 2OB1A 4DNFA 4R8SA 2EZ8A 1NVGA 3ZEIA 3STUA 5EMHA 3K9WA 1JHZA 4AULA 2XYPA 2NZVG 2HLDA 2GZDA 4DUYB 1EP1B 5KVQA 3KOYA 4A0GA 4YWHA 5AXCA 2WWWA 1OVGA 1TT7A 2XMGA 5C1IA 2I3BA 3M3HA 4BNKA 2W6OA 5AVQA 5HGXA 1NVEA 8MHTA 3I1JA 3BMCB 2NV6A 2C88A 2XGJA 1E5TA 4N7JA 1KOGA 2I3GA 4M6WA 4L4YA 3ETEA 3KAPA 3QMPA 3BM5A 2NYVA 1Q22A 3EVFA 3CNLA 3AR5A 1ENPA 1I7DA 3L84A 4NYIR 2IEBA 1I10A 1EFTA 4P98A 4ZVQA 4HWKA 3T5TA 3CNOA 4EL0A 1DEXA 2VSNA 1LC3A 4IMRA 4WEQA 3ZE0B 2RGAA 4EO4A 1AKMA 4G2NA 3VVBA 2IPNA 3GMIA 4G8DA 1ISJA 3I52A 4GBED 4HAVA 1YOBA 4E5YA 2EJBA 2QRKA 4M8SA 4MCHA 1GKLA 5EUBA 4TTIA 2B83A 5FI5A 1N6OA 3GJ7A 2WHXA 5I48A 1KMMA 1RT9A 3A3PA 1B6SA 3MCZA 5DT2A 1FBTA 1Q12A 3REGA 1ODFA 3U61B 1SQ0A 2DUNA 2IH2A 2WNIA 1OX6A 2OYSA 4YV2A 1AGYA 4BVGA 2DBRA 5JSZB 1BE0A 1OJLA 2GCIA 1JDJA 3C5VA 1NVKA 3NFRA 4OQDA 2J6CA 4DJJA 1YBFA 3IVAA 1A9XA 1EUCA 3QKUA 4X62B 1KYVA 1KKUA 2Y0CA 4WLFA 2V65A 1C5KA 3G8YA 2YXPX 4HDKB 1H2RS 1Z6XA 1E3LA 5DCWA 2DSTA 2OV8A 4B2PA 2QSYA 1E6CA 2WHPA 3HO8A 4NOLA 3QMMA 2RHDA 2PX4A 4L0QA 4L50A 3N2LA 2PGOA 3WGGA 3ZV3A 4BO9A 1XA0A 1GKUB 3C8MA 1I2ZA 1MIOA 3K4QA 3ZGYA 2YOHA 2BHSA 3HPQA 2GUWA 4I4TF 1XZCA 2ON6A 1BXRA 4RPJA 1Y5RA 1AGPA 3EJWA 3IULA 2CL0X 3H6GA 1M2JA 1X77A 3DKPA 4JLSA 1NVBA 1BJKA 1JAHA 1ML3A 4PLHA 2IS4A 2Q4DA 3PCXA 1HM5A 5DGTA 1XZIA 5LZ5A 3MJEA 2XT6A 1YI0A 4HAWA 1QRDA 1SBNE 5LIRA 3QELA 4ZMSA 3VU9A 3TSYA 4Q4AB 3U7FB 4A27A 4HNAA 2Q4EA 3DDHA 6AT1A 2QRLA 3KR9A 3P27A 1VG1A 4Y9SA 3RVDA 3SDBA 4II2A 3HU2A 1GL9B 1ZIPA 3KK0A 5F9HA 1U7WA 4KHPB 2BKAA 3N39C 1FLDA 2VWGA 3JZDA 4L02A 2BFFA 3O8BA 1LX7A 2GN0A 2V4MA 2WJ4A 2V7VA 1SPBS 2BGIA 2GEKA 2OBLA 1NURA 4I4TB 3WYGA 3ONEA 2REXB 3FFTA 1F4VA 1T9ZA 4G67A 3SBXA 4GI1A 4E5VA 1ESEA 3WWDA 1LDEA 2BM9A 1LBIA 4NS4A 5HVNA 1I2MA 3H83A 5ALOA 2ECKA 4XX0B 2P9YA 3D6AA 1RKQA 2ZW9A 4NECA 5C18A 4G8BA 1PDVA 5DYTA 4YLYA 2VT3A 3D31A 3DV9A 3KBOA 2FK8A 3RCBA 3ZHOA 3PU6A 5AI5A 3LLMA 4YJ2A 1UOQA 1LSJA 4H3VA 3AHJA 3HP4A 2HK7A 1ZW6A 4WZAA 1CUHA 2UYGA 5JPCA 1EQUA 5J2UA 3PC6A 2HDWA 1TFUA 3LGSA 4LRXA 1UADA 4X41A 3VDMA 2GXUA 4N0PA 1XDSA 1FF9A 2QP9X 4HNHA 1KJZA 16PKA 3D4OA 2H1RA 4GSLA 3DMDA 2IYXA 4IJQA 5BSTA 1ZVVA 3ZCUA 1W7AA 4CEJA 1L5YA 1A72A 2QA5A 1KXZA 3LA6A 2B3DA 4RPIA 1ZZEA 3IP7A 1NRXA 5CXXA 3W6OA 4MVJG 2W2TA 3TOXA 1QVAA 3TLGB 2C03A 4R2HA 2C8JA 1KVQA 2FPMA 2IGBA 2X9LA 3DL7A 4QSHA 4KTVE 4NNPA 4Q00A 4KQMA 3H9QA 3NDPA 2WC1A 2ENWA 1M72A 3QW4B 4MUXA 4PSCA 3DAOA 1OB2A 4EHLA 1AZLA 4F0JA 4RLQA 4JJ4A 5F23A 3QEMB 1JX6A 2WW8A 5HFJA 3PA6A 1NXXA 1NOKA 1YKSA 2FEPA 3K8QA 4UDXX 4JBWA 4AJIA 3DONA 3IQFA 1JIVA 1QQ6A 1KR5A 3UM9A 2YR0A 1YVUA 3I0MA 4I7EA 1V6AA 4V1CI 1GTMA 1MOSA 3GJQA 1H0RA 1Z7YA 1K86A 2GJSA 4M9CA 5AWFC 3W6ZA 1IVSA 1R0KA 1ZH0A 4BVFA 2FFBA 5JADA 3ZLUA 4QPPA 1WG8A 5KTRA 4EYGA 2XMSA 2ZFUA 3DW1X 1YBAA 3KQVA 2NVUB 1ZRHA 4J1NA 3TIFA 1AQJA 1MVLA 2VUHB 2ZJ1A 2OCDA 1JR3D 2HOQA 3DOJA 3HUEA 3VSDA 4FR5A 3PE6A 4F4FA 4KITB 3P9KA 4NARA 5HQTA 1RXSA 1RM3A 2ZS8A 1C30B 1Z35A 1R5OA 1AQUA 1WUHS 3CPEA 4M0PA 3QKWA 3ANNA 2FWRA 2X9GA 3QUBA 1P77A 2WNSA 3H4MA 2B6NA 5T6BA 1EG2A 3UMYA 1F8UA 2OLJA 2PS3A 1T25A 4CCWA 2VF8A 2EKQA 4U7HA 4HP8A 2VHCA 4YMWA 3THRA 1BTOA 1TVCA 4Q3KA 2UUPA 3WO0A 4CLRB 2ASEA 4W5TA 4NIMA 1DXYA 2REQA 3BWVA 2DJ5A 2J6HA 2LR0A 3BKXA 1RXUA 2QN9A 3EWIA 3WWYA 3LLSA 1GYRA 2NLOA 3ESBA 4O29A 4C05A 4CMEC 1LXCA 5BUSA 1O7JA 4C22A 1O54A 4LWOA 4NK5A 1KDOA 1WY5A 1RYDA 4EB3A 3PQEA 3DMNA 5CFZA 1J8DA 4EFNA 3VPHA 2P9JA 3PFNA 3VPBA 1G7RA 1TTTA 4JXZA 4W1QA 1IZ8A 5JHGB 3DHYA 4ZVTA 3HHEA 3NWBA 4BKMA 1ZGGA 3GAMA 2VHUA 4PO1A 1CQIA 1VGQA 4RXTA 3TUIC 5JVDA 1XX6A 2RH5A 3HN2A 4K2HA 5KU1A 2BFWA 1XROA 2QAIA 1U8AA 4BLSA 1OC2A 1WA5A 3G0CA 5K0EA 3A26A 4PYRA 2FZVA 5DW0A 4M6WB 4CCSA 2IV7A 4TL9A 2XMPA 3WKDA 3BBLA 5AVTA 3A58B 8GPBA 3WICA 5IDWA 4KQEA 1UIRA 2ATIA 2G0AA 1QIDA 5JAMA 5TGZA 1KI8A 4JSYA 4JY7A 2A59A 4EI2A 4RMNA 3UJCA 3IE0A 4UMFA 2PUGA 1B93A 5GJWC 4Z7OB 1JSLA 1Y7HA 3V2IA 3HDYA 4GP7A 2XJ9A 1J99A 1RLOA 4ZHSA 1PWZA 2HA3A 2ZUTA 1C1HA 4EG0A 2QQ0A 5LNK1 1VLVA 2GKSA 4IS3A 3V8EA 1I3MA 1JHAA 2QRVB 4IQ0A 4C1BA 1UMBA 3K0CA 3QWBA 1RAHA 4TSRA 1U0TA 3KQHA 1OH8A 3Q6NA 2CWDA 2R8ZA 3F7NA 2BGJA 2ZSBA 3TZBA 3P9IA 2B7CA 4ID3A 3LQQA 5REQA 2GA9A 3AJ9A 1EE9A 4HYEA 1E9RA 2WHYA 1UMKA 3FXAA 2D13A 3T7KA 4DSAA 3BREA 3I6ZA 2C7OA 4DW8A 1L1FA 3NAZA 3B1YA 2JBHA 2RK6A 1G66A 3ELUA 1Y4UA 3FPLA 3C3DA 1OXVA 4EYQA 3R3VA 1FTGA 5KTKA 4RNDB 4AP6A 5LMZA 1K6XA 3R7LA 4EY3A 2AFIE 1GPMA 1TZCA 2CYAA 4FEYA 1CJTC 2B8JA 3HR7A 5DM60 1TE2A 3NGMA 4TUYB 2P0EA 3FUUA 1M2KA 1IPEA 2IDMA 1QNFA 1GIAA 2MTBA 3F97A 5DTMA 5EHGA 4CRWB 4DBLE 2WAXA 2X0NA 4QNMA 3ROPA 3R0QA 4CHGA 1U5BA 4IOLA 2LCFA 1L9KA 3CTPA 4KGXA 4MVCA 1VL2A 4MV5A 4WEOA 1SHLA 4L28A 4M0CA 3K6SB 4MUYA 4OKNA 3UAOA 2WIJA 2ZYSA 4NH0A 2PUBA 2F7SA 1ECPA 2A5GA 3IELA 1Z12A 4MGIR 5AKYA 5DFAA 5AW4A 2WTUA 1GQFA 1KEPA 1NXQA 1U4NA 4KK3A 4PZLA 5F4BA 2ZTHA 1YQ9A 4NYIQ 5JXHA 4XWGA 2AN4A 3H4VA 4L4UA 1W4LA 4B6JA 1N25A 2QG4A 3B78A 3KXPA 1PGJA 4KLCA 3A3YA 2HCJB 3X1DA 4KPUA 1TO1E 1M2EA 3GVIA 3OKAA 3L49A 3R20A 2J41A 3FUWA 2XUHA 4MYCA 4R2KA 4UAGA 5GV8A 4DF3A 3UHPA 2W0SA 1FFSA 3A6EA 1CCWA 5ILOA 3V4LA 3X0DA 4LRQA 1NKSA 2GF2A 1T34A 1YQTA 2UV8A 3GWZA 4L5BA 1QGDA 2P5TB 5ALKA 5KYNA 4M86A 4L3OA 3I04A 3DH0A 1PNVA 3THWA 5LLTA 2JLUA 4IW3B 1QHHB 4TT8A 4EKEA 2OOKA 4KOAA 4BQEA 1KQGA 3LQ2A 4KFSA 2F1JA 4A15A 4RDXA 1DIGA 2PL5A 3IRUA 5AW9A 1UWLA 4IV5A 1D1PA 2EQBA 1JI3A 1TYEB 1TJNA 4PC3A 1Q44A 2VXYA 4IQFA 1ISGA 1WDKA 3SNKA 2P79A 1QV7A 1OFGA 1P5JA 3KTOA 4BMNA 1DELA 5J1SB 2BUCA 2BY4A 4A5SA 1WB4A 5A3RA 1X13A 5C7IO 3AF6A 2Z6UA 2HXGA 2I91A 4WBNB 1D2AA 4DWVA 3M6FA 3PUWA 1E1QD 2FZLA 3M6WA 4IY1A 3ZQ6A 1VJRA 3CVXA 1POWA 3F71A 1IE3A 2FZ4A 2JDIA 1XKTA 2Y1KA 3CG4A 3MZ0A 4MYUA 5F7JA 4DIMA 5AVRA 2ANCA 4CUJA 4Q9HA 2QYSA 4GZ6A 4RTOA 1MAHA 4ZHQA 1SUAA 4MVJI 3AY6A 4QOFA 2L18A 3E1KA 3LBIA 4RULA 3SS9X 4W6ZA 4UBOA 2B8TA 4Z1OA 1KY4A 1MRSA 4W7HA 1OGIA 3C3EA 4J0HA 4BNMA 2AK2A 1F6DA 4Q7LA 4WXEA 4GX5A 3ENVA 3GVPA 2P7IA 2ISCA 3ET5A 1Q91A 3JYPA 1ZY2A 4KNVA 2H4ZA 3T7EA 1GPDG 4WBNF 4DYDA 5HJ5A 5CT8A 3MUOA 5M04A 1SQSA 4N5MA 3A6ZA 3VU1A 4UU8A 3J81k 1OZGA 1TKAA 3CLSC 1MO3A 2BFCA 3WLTA 4DOMA 3DF7A 3S1LA 2ZUEA 2IZ0A 3DO5A 3U5ZB 3V3KA 1RACA 5C5IA 1VSTA 3ZZTA 2OV4A 2OFWA 4JELA 1VHLA 3R2JA 1GQSA 3LSYA 4FSDA 2VNKA 2XZTA 3D4LA 1WPGA 3LMKA 3S2UA 1WKCA 4CT4B 3BFPA 3P4XA 4IIYA 3ZCXA 2IYEA 4U3JA 2BMFA 2O2HA 5DE3A 4WACA 4MINA 3L5KA 1DSSG 2HNBA 2VCHA 1ULTA 4PGFA 2RHMA 1SD2A 2KW5A 1I6MA 4JK3A 4MVWA 2QJFA 4QWWA 4EA6A 3BN3A 2XCRB 1HNNA 2AOVA 2WIDA 3I5AA 3VHQA 3T6KA 2PD4A 3LQRA 5BN3A 1Z6GA 3DOHA 3TE7A 4MKGA 2ZJAA 3OPQA 5CDTA 1EH5A 2YJNA 4MRNA 5KWIA 1YSCA 2P2ZA 2M6LA 1AKTA 2OCAA 4JCCA 1FLAA 3KSMA 1CVRA 3ZQ4A 1RFGE 5EJMA 4CWAA 4MPJA 3WLKX 2DMRA 3BZBA 3KZXA 5E2BA 5EIBC 5K6RA 1L4FA 2II6A 3KYCA 4AVYA 4NMXB 3VU3A 3EIXA 1ATIA 3DZJA 4MGYR 4ABYA 4P36A 3P4YA 3ROKA 1Z5PA 2XIQA 4BNDB 1N0VC 1S3SA 7MDHA 5I7FA 2I4IA 4CUKA 1CY1A 5HILA 1RHQA 2H2GA 2WFMA 2XEDA 3I64A 4AKGA 3BIOA 1CIVA 3EBOA 1UPCA 5GQSA 1DT3A 5ADWA 3WGMA 2SKCA 2Y2VA 3KLNA 2HJHA 3R5SA 4OJYA 3NP7A 1JRLA 3IAS6 4BFVA 2ZDHA 2K6GA 3RW9A 3O4HA 4GOMD 3NH6A 5J5VA 3OX4A 4KVAA 1ZISA 3EWSA 4Z4EA 3DCJA 4N3BA 5EHIA 3IKTA 4ES6A 4M88A 3AIMA 1NDQA 1DQRA 1U7PA 3SJCA 3JQRA 3C45A 1VG9B 3ZE7A 1YFZA 3EDCA 3OTHA 2I3AA 1VL1A 4M7OA 2JLVA 2BCGY 1XJWA 3L9XA 2E5WA 3UHAA 3KEQA 4QBFA 2IIQA 3ANLA 3G9ZA 5CDUA 3FTQA 1CUBA 3DL0A 2BN4A 1XQYA 2AF3C 2ZVPX 3L4JA 3GGPA 4EZIA 3WJ2A 1DXOA 1V39A 5J43A 1WVGA 1JFSA 3IEVA 3RC8A 2DC1A 1Y8AA 3HACA 4O1HA 4XM1A 5JSUA 1DPFA 1HQYE 1OGYA 4YLGA 1FPQA 2J3IA 5COQA 4BO2A 2Q4RA 1L8XA 2GYVA 1RPTA 4B33A 5EJFA 3K20A 4Q3NA 3GZTB 4MRMB 4UHDA 3O4JA 1C3LA 5BT8A 3CPSA 1C2TA 2I9PA 2O2IA 1FS5A 3DOFA 3NKLA 2QD3A 1QH1A 3NO4A 1Z8HA 2V3VA 1EG7A 1V45E 2A9JA 1U8ZA 2W6ID 2XBUA 3PVZA 2I3ZA 4WPGA 4BQIA 5KPDA 3QV2A 3WZMA 3FI0A 2H16A 4DDWA 1GL7A 1IJKA 1UDWA 3AKCA 5HX7A 2A88A 4B2YA 5J4KA 3EXHB 4BASA 4EG6A 4XVCA 4RQBA 2PD6A 4ETIA 3IQWA 5BWCA 1ZX1A 5MGNA 3HCCA 1ORDA 1E94E 1R5BA 1ZIYA 1ZS9A 4B8ZA 3GDGA 5FOUA 3C3AA 1TCUA 2FZ5A 5HYVA 2BFEA 1XU9A 1CP3A 2J7KA 3E8XA 4D2IA 3BILA 4S3MA 5B7QA 5DI3B 4PR3A 2IPLA 3VPGA 4HDOB 1M1YA 4HVTA 2I4TA 2NU6A 3I8SA 4DV4B 3OCCA 3DA8A 2FN9A 2DKFA 5JJLA 3EXEB 2BFDB 2G63A 2Q5JA 3B1WA 3BK2A 5L8VA 4KGVA 4TS3A 3TINA 2I03A 1ZD3A 3NPAA 1L8OA 1DAKA 3COPA 2AGVA 4H7JA 4UNQA 4UUOA 3FWZA 1X3SA 4TWJA 1PV2A 1OXTA 5AOVA 2VHQA 5EYPB 4LXXA 3WE7A 4FC6A 4KN8A 3S2GA 1E4EB 5A71A 4HLUC 1GNQA 5ARDA 3S5JA 1DEOA 4U02A 4OJNA 2AVDA 3V7UA 1ZI6A 3BXEA 2OECA 1RPZA 1CK4A 1IHXA 5JMTA 1NBAA 3GGGA 1FX0A 2XSZD 2X2EA 1QO9A 4OGLA 1I6LA 2JW5A 3AHCA 5D51S 4B74A 1RXWA 1NDUA 2VNSA 1J2JA 3F46A 5ALWA 2EQ5A 1W2GA 2OWEA 5ICSA 1TF7A 1Z6QA 4DLBA 1L7EA 3FYSA 5HTOA 3OZRA 4UM5A 4DA8A 2E5FA 3NPMA 4BGEA 1VHWA 2PSDA 5A3VA 3RYTC 1MT0A 5KSYA 3P9SA 2O3RA 5CVJA 4M0UA 4DR4B 1UBJS 1K63A 4FGJA 4CV3A 2YH2A 4OB6A 1UZMA 2P5YA 4O4HB 5CXSA 4CG2A 1CT9A 1DJPA 2VTDA 3OQJA 3ICEA 3A1TA 1W36B 4L7VA 1OBOA 5HW0A 4DR2B 1XT6A 2PT9A 2VTKA 1J0EA 1CJUC 4ENPA 4LXIA 3U17A 1OREA 3TPFA 3HFSA 1Z3CA 1J06A 1W88A 2Q5EA 1O0BA 4OO3A 5KMGB 2O4CA 1HE5A 1E96A 3FDIA 4G0WA 2Z5FA 3EAQA 4L0CA 1FP6A 4MV0A 4XX1A 5CB4F 5AP9A 5AW1A 1XCMA 1AKUA 3LUJA 2P3QA 4YPFA 5TF4A 3UA3A 1PJLA 3KB1A 3AESB 3UJHA 4D43A 2J4DA 1ZR4A 2YMMA 3I3OA 4M9UA 4ZYWA 4H4CA 4JZYA 2FSVA 3EVNA 4G0XA 5B4VA 1E69A 3GCDA 5LCXA 3M4NA 1SG9A 1YU9A 3O21A 3VMFA 3TX6A 1JNYA 2RE8A 2CB0A 1VLHA 1ZG3A 4OXQA 1E79A 4FDLA 1C0KA 3N7AA 2KB0A 1BEZA 1NP6A 2ZRDA 3CV3A 1DNPA 4R51A 5CLJA 2W5UA 3JSXA 1TYCA 2OBBA 2IYUA 4BV9A 3KJFA 5A7GA 2ZYUX 4J0IA 1SHTX 4I2VA 5EEHA 4C4XA 1UKZA 2BZSA 4I0WB 1W59A 5ALTA 1MA3A 4UXHA 1X2BA 4CI0B 2YYYA 4YCJA 7ADHA 1ICEA 5KOJA 1BA3A 4Y1RB 1P7VA 1V5EA 3LWZA 2AQHA 4LN1A 3RUPA 1WQ3A 3G1WA 5EESA 4QLBA 3AEXA 1V1MB 3PDWA 4A4DA 3U48A 1EP2B 1P4SA 3SMVA 3W2GA 1T9CA 4LHVA 1OILA 3E82A 3P0HA 4RADA 3IUBA 3WK7A 1DJMA 3R3SA 2QG9A 1SCIA 1KJIA 3Q12A 1KK1A 1EJ2A 1X42A 4UUQA 4RBNA 2QXYA 1W2HA 1UBCA 1J24A 2C4WA 2FGJA 5LUAA 3PDIB 4EI7A 3PB3A 3O95A 2EOAA 1KPHA 3A9VA 5I9NA 2P3SA 6GPBA 4DIDA 4GYJA 1YR6A 3BWYA 4LBZA 2XUQA 2F9MA 3GLTA 1LDYA 2XCUA 3RK4A 4A6DA 4UE6A 1U94A 5ALYA 4GDMA 2B8WA 2BVNA 3K96A 5IAOA 3TEMA 1QF6A 3H2ZA 3H1BA 2G25A 5ALPA 5G53C 1VECA 3T3GA 3OY7A 4QPNA 3WQQA 2GJ4A 3O38A 4CMIA 3II6X 3MTIA 1B2LA 2ZIAA 4QQNA 4DM4A 4M9SA 1FNMA 5JQGA 3X44A 4KN6A 4YAFA 3ZKWA 2PWZA 3PRYA 4TGLA 2QJRA 2P78A 2DXIA 2QX4A 2GOYA 3LJKA 1T26A 3WYFA 4C5CA 3EGXA 2JAOA 5CG2A 1NU8A 5AVYA 4LGYA 2OZLB 3WSTA 1EWQA 1LQUA 2WPDA 2G7ZA 3LPAA 2QD5A 2O1XA 3AR2A 1JZTA 1V95A 1N7HA 2YWXA 3FNQA 2VXBA 3QX9A 4NCAA 1UZAA 1BHSA 3GD5A 2Q8NA 3CO0S 1L1EA 1RQXA 2FOLA 3D6UA 1CNFA 3K2IA 4X5OA 4DQ0A 5FIUA 4BLVA 4N8EA 4CLRA 1IG0A 1I13A 1YQEA 2HWUA 1EDBA 2YOFA 3P32A 4QFBA 3PIIA 3R41A 5B64A 1KO5A 2VJOA 1DO0A 1A5TA 1K6JA 1UZUA 2QTVB 2V4UA 2ZIFA 3C14C 2ALJA 4WASA 2POCA 5IYZF 1PS9A 3ZGLA 1KO4A 5DI3A 2OL4A 1TW2A 4N39A 2DEUA 2BMWA 1XRRA 2LIVA 3G79A 3NU1A 2YRXA 2CBGA 2WWVD 2HWWA 1OXXK 4HH1A 3FOCA 1AN0A 3T38A 3UAGA 3C2QA 3RWBA 3W8EA 2WU4A 4LSMA 1ZAYA 2QW8A 1EFDN 1NXTA 1QZ3A 4NHOA 5C8VA 1LB1B 1L5MA 2FEAA 2C9YA 4BE9A 1R6AA 4F3CA 1Y7LA 1GARA 1KOLA 2OXRA 3W6NA 4F4JA 5DHPA 3EDYA 2CF5A 5KEIA 4RJIA 1KPGA 3DDWA 4FHDA 1M66A 4HDMA 4WLNA 3SM3A 1Z08A 4DZTA 1QDLB 3DTVD 3T7IA 1NYRA 2VJYA 4CV2A 1W0JD 5AKZA 3D6VA 4RUKA 5DF1A 2HRBA 4GS5A 3AVXA 2EW8A 1U80A 4BO7A 1PQPA 1SOMA 3IAEA 1CS4C 2B0JA 2GKOA 3DVAA 4GZMA 3CZQA 4ND2A 1IBRA 1DHRA 4P32A 3T9BA 2PFSA 1PR3A 1X1DA 2F1RA 2UU9B 3QVGA 3TCXB 4DTCA 3A1FA 3PJGA 4LZZA 1S2DA 3A6HA 3LW8A 1DHTA 5A2GA 5G3ZA 5IM4F 3EHDA 1RPJA 1KE2A 3W2FA 3T54A 1VMIA 2G17A 4QRDA 4XH9B 1HFJA 3HB1A 3TVYA 1KSFX 1ACJA 4DRXA 3OFNA 5BN5A 3DZIA 1XNGA 1BMQA 4A2QA 4E1AA 3DEFA 3IH5A 2IYOA 3K9GA 2W83A 3AXTA 2AOWA 2HRQA 2QI9F 3ZH9B 2RD2A 3VJRA 2X2PA 4EIWA 3AINA 2E49A 1D1QA 3O4GA 5JTUA 1Z5GA 1XHFA 2XZPA 1L1RA 3V6MA 2SCUA 5CW1A 4DM7A 3W5JA 2QZ4A 4NE2A 2Q3BA 3NOXA 2FVXA 3HR8A 1XDWA 3HJBA 1T4GA 3DLTA 5HK8A 4ER5A 1ZUHA 2VP4A 3H11B 5E4TA 5K2MA 3AZOA 5CT9A 5EQTA 3O91A 3SYLA 5SZJA 5EUCA 3IBTA 4ARUA 1ABEA 4DCUA 2BF4A 5KX5A 2P9TA 4IIGA 1G5TA 3FFXA 3WLOA 3MJHA 4D92A 5HKLA 5J58A 1U9IC 3F8WA 4UCXA 3RARA 3DEIA 2AG8A 3HBLA 2EGUA 1NPDA 3K31A 3SLGA 2AKEA 3FLAA 2OGWA 1M1XB 3G9QA 1IUPA 3SD7A 5KAMA 1N8TA 3FYUC 1QFYA 3KTFA 4L16A 2Z1MA 1Z22A 4D9CA 4P86A 1JR2A 1RU3A 3VYWA 3AR6A 1CV2A 1FP4A 3LVRE 2C9OA 3L4EA 4FOPA 4BMOB 1DU4A 5BWNA 4N9WA 2VP6A 1UXIA 4OHKA 4NCIA 3FPFA 3H8JA 4RHFA 4C6RA 4N0EA 2ZUDA 1E9BA 1PR6A 3IYLW 5LZ8A 2ZITA 4L0DA 4Q9KA 2IHUA 1L6RA 1M34E 2W4MA 4Z7JA 2YJ3A 3DE0X 1I7LA 4YRZA 4IG4A 1FVXA 1D4OA 1PU2A 3MFYA 3VJMA 4LIPD 3VZQA 4ZYVA 2CXNA 3ZY4A 4LYJA 3LUAA 3AERA 1V5WA 4GLOA 3V80A 1T35A 3VDRA 1C3JA 1U99A 2H07A 3SR3A 1CWUA 3U3DA 2ZUWA 5ENDA 1PEDA 3SHTA 1M0EA 4KI0A 4CL3A 3QXCA 2WSSD 3LQ4A 4ZOAA 4RIIA 3I2FA 2I7TA 4PYMA 1EP9A 1CVIA 4P7FA 2GBGA 3MSCA 4BNYA 2GPWA 4EJ0A 1NE2A 4IIJB 2W2NA 3PNLA 1SUEA 2VDNB 3QBTA 2X8BA 3A6LA 4IDHA 4PX2A 2IOYA 3HN7A 4AYWA 4C4ZA 5LJIA 5CTAA 4YRBA 5E4JA 4I9UA 1B26A 3BIWA 4QELA 3SKXA 2B94A 1RFLA 2YCBA 2RGUA 3O8QB 4NLLA 2D5CA 4BWVA 5CDYA 3E1GA 1GUBA 5C1DA 2AN3A 2PR2A 1CY7A 3L7MA 3P0FA 3D7MA 3U81A 2OE2A 4GOND 4I3FA 3KHUA 3NC4A 2O4UX 4FVTA 4M55A 5AJYA 2X42A 4IKEA 2WUWE 1PIWA 3T9EA 2IP4A 2J31A 4QD3A 1T0PA 1NJGA 1RRPA 3CT6A 1QOZA 1OWNA 5HKKD 2QENA 1PD0A 2W93A 2EFDB 4NRDA 1ABFA 3TLJA 1WCV1 3OP4A 4C9BA 3AOEC 5F73A 4C7MA 4YALA 3G2HA 4M7PA 3RT1A 3KNZA 3DFIA 4WK2B 3BTSA 1NWCA 1KDYA 2AI2A 1KIFA 3WGTA 2DPMA 1T0UA 2QRJA 4GEKA 2FP4B 3DT8A 5F12A 9LDBA 2Q6TA 4ALMA 4Z4QA 2WSSA 4RJKA 4D5EA 1XZKA 4KQ6A 3BMOB 4U2CA 4Q4CA 1XVIA 4YUYA 4C2TA 2YVQA 3ETLA 1OASA 4FCCA 1M6VA 4D02A 5J40A 1H9CA 1T6XA 1MC8A 3OQNA 1XNQB 4LGVA 3IHTA 3WLJA 1VZ2A 3JVVA 3OIFA 3F5DA 4Q82A 4Y67A 2AQKA 4YB8A 4EO7A 3TO5A 2YY5A 4OLBA 3OBBA 2ZWIA 1R12A 1DKUA 4D3FA 4XVUA 1EHYA 4HNSA 3A2KA 3ZDZB 1Y63A 2QAGA 4JITA 3EZNA 4YMTA 2BV3A 1Q74A 3BK1A 1ZN7A 4TYWA 1DBSA 2XHEA 4D5GA 1UXKA 1ESZA 2VK1A 3O73A 3Q0EA 4LCJA 4BS9A 4CETA 1Z6AA 1B8NA 3L18A 1Y8QB 5AJUA 3UJAA 3VR6H 3PQ6A 4OQLA 4R1MA 4S1PA 3VBCA 4ND4A 3SC4A 1TM2A 3FJOA 2VCEA 5JNLA 1IK6A 1Q57A 4I5GA 3W05A 1RZRA 5IH7A 2BELA 4ZT5A 4F8YA 2ZZNA 2P2DA 3DXZA 4J29A 2A0UA 3RSFA 3H99A 4RU1A 2WG0A 4ND8B 1MOQA 3GYGA 3WQBA 1TUIA 4I2NA 4ZEXA 3WY9A 2GGSA 4KH0A 1A04A 4FDMA 4N6NA 2WKSA 2G1UA 4IFTA 1PUXA 4IM7A 4KE8A 4M49A 3NCTA 4YA6A 4TT3A 4BFTA 5F35A 1Q1BA 1NRIA 2QRQA 4YAEA 1G42A 2XUKA 5ENZA 1YTLA 3MJCA 3NBKA 1TQ8A 4FMDB 4K9KA 3A4LA 1KFKB 4WCFC 2QE7A 1ZVMA 5TVGA 2E21A 1LA2A 3KG2A 3L6EA 4CDGA 2P6UA 3A4MA 2ZBPA 3Q10A 1RPAA 2O57A 2X23A 4GOXA 1XTRA 4L5CA 4BQFA 3ZKAA 1E64A 3AB3A 3MF4A 3OM1A 1TQ4A 4QTXA 4URXR 1HURA 1K98A 2DKOA 2O8EA 3DE5X 1G5IA 1C3EA 4AQYB 4A82A 1LTKA 2X1HA 3CLVA 2FAXA 3AR8A 4Y1FA 5AKHA 3ER9A 4AS3A 2ZTUA 2ZB2A 4AMBA 1TD1A 4IRXA 7YASA 2IYWA 8ATCA 4YR9A 3EFOB 1PR4A 1TF2A 2QMUA 4BJHB 2QTRA 4WRRA 1VE7A 2FPGB 2N1BA 4D4GA 4E07A 1UODA 3WL5A 5AHOA 5AW2A 2HMUA 1P4AA 1UH5A 2WYVA 1BFUA 1NUQA 4RPKA 5E7IA 3U7QB 6REQB 1QRUA 1MO4A 3KX2A 2BBWA 2AXQA 2NO0A 1UAYA 1Z39A 1KDTA 2PXHA 3DTTA 4TL8A 3RREA 3S5UA 1F0YA 1MJGA 2FPIB 1ZMBA 5IBQA 2DULA 3SC6A 3SBEA 1ZKMA 3JRXA 2Z56A 3V7NA 2XD9A 3LNTA 2CLSA 3RYFA 1Y48E 1ZVQA 5LQAA 3TCNA 3H2BA 1Z15A 1B8VA 4HMOA 3SSOA 4B71A 3EEYA 5LFAA 4KEAA 2JFQA 3R3WA 4J49A 4PLVA 6CHYA 4HRXA 1M7GA 1M1NB 4OQPA 421PA 3K1ZA 4F12A 4EG1A 4FZ5A 4KV7A 1SUWA 3DHEA 1RYHA 2CLOB 4AMUA 2PRYA 4EPTA 3JQ9A 5HOEA 3N75A 1XD2A 1TUBB 4XAQA 2WHQA 2I6SA 1TIPA 1GY8A 1IQPA 1MNQA 3M49A 1JKJB 1KQPA 1I3CA 1D2CA 1ZM9A 4M2LA 1N8SA 4K81B 4TS9A 1ZJYA 3JQAA 3RWOA 1I51A 3K2EA 1NTOA 3CINA 4BO5A 1T5IA 4XSHA 3K1JA 1IWPB 3QYJA 1BQ3A 2W6IA 4PS1A 3HR4A 3E15A 1PJ4A 1U8UA 3GH3A 5AD1A 3Q98A 4R8MA 3K15A 4YO8A 3FDJA 1R9JA 3N87A 3HUDA 2HT6A 5J5AA 4AMZA 1UXGA 1SKQA 3SIWA 3D6HA 3B1JA 1TRHA 3D7RA 4Q7KA 3HDHA 3VNBA 2SKDA 5E6SA 2DR0A 5FI1B 1XP8A 2GRJA 2VZ9A 4ZODA 1IRIA 1BGWA 3D7LA 4JLOA 3S7TA 3UV3A 1KNXA 2ZI9A 4RXUA 4TXJA 4QECA 4FKMA 1QH1B 1K9VF 1WXFA 3CHYA 3B7GA 4AICA 4AN4A 3LDUA 4PEVA 3PT9A 5CLGA 2J0QA 4RVGA 3GJTA 1QHIA 4WZ6A 2WVAA 1KEVA 5CT6A 4MZXA 5IAJA 4QPDA 5A5VA 2J6BA 5ESXA 2GJ9A 1T5OA 1XZJA 2ATXA 4CLDA 4EENA 1PT5A 2A57A 3X43A 4CQLA 1L7MA 1VPWA 2LP4Y 3LK7A 2HSEA 2YZNA 3LZDA 4Y6OA 2P4EA 3K2BA 4KL8S 3V48A 3NJRA 3DZBA 4JC0A 2NU7A 1G3MA 2VVTA 3KUUA 4MVJF 2REOA 4X3OA 1FVFA 4KQKA 2ZI6A 1VJ0A 3KKLA 1E9VA 4FI3F 5L7YA 4BLPA 4WECA 1RSZA 2IS1A 3KL2A 3VKHA 4EHKA 3HLTA 1T91A 1I3KA 3T9DA 3T9FA 3DULA 1QHYA 1L8QA 2C57A 2NO5A 4PLPA 4D0GA 4PLFA 1W581 2HMVA 3CKYA 4WFIA 3RANA 2IXTA 5EERA 1RWOA 2WJWA 1ESCA 3R6GA 4HDRB 3AK4A 1D2MA 3PYXA 5JS1A 3JD4A 3ZV7A 3Q3EA 3U4IA 4HKTA 2BKVA 4PNHA 3E9MA 1HSOA 3LXXA 1RM5A 4OVKA 3P9XA 5K51A 4EQZA 3OE4A 4HRAA 1BFDA 1FYVA 1H6CA 4AO6A 1WB9A 3W5IA 4K2AA 3VO1A 1L4BA 2XEXA 1Z34A 3G2PA 2D8MA 2VDPB 4QQRA 2DQZA 1DFGA 1BX1A 2MSWA 2PT6A 4O4LF 3TBHA 1PR2A 3VPAA 1OWMA 2KYRA 1LDGA 2ZSKA 1KC3A 4P35A 1ODKA 1ZNXA 1M8PA 1SBHA 3I42A 3TJMA 3THWB 3O93A 2DPYA 4JGBA 3RRBA 3SVLA 1K5PA 2HA7A 5IT9A 3T3HA 4Q93A 4TWZA 1VJDA 2FW0A 4ZARA 1FFBA 2JCYA 3PJFA 4TPKA 4U8GA 1TFRA 1WWKA 2VHJA 5FTMA 4C29A 2YHIB 1FNNA 5I5EA 1Q7RA 1KMQA 1Y37A 4FEEA 1M54A 1F1JA 2Z9CA 3EUEA 4H77A 4NP6A 4C03A 2VBIA 1K97A 3ES9A 5JY1A 1EWKA 4W5NA 2XRYA 3SK0A 4XUCA 2C3UA 1QDEA 3RUDA 4JB2A 4NMLA 4DT1B 2HQRA 4Q4LA 2QR2A 4FMCB 4N0DA 1AK9A 1B15A 2ZEJA 2Y66A 4WN9B 5TF0A 4FX2A 4QBTA 3R7FA 5TNXA 1CFJA 1Y4SA 2FPLA 3RC2A 3VR6A 4C2UA 3AHFA 3RKUA 4HHEA 4BYMA 1NBHA 3IKMB 3U3KA 3WHKA 3G02A 4PGGA 2X6RA 3EVAA 4BUCA 4FLEA 3KTAA 4D0NA 2AXPA 1ZCZA 5EHXA 1PWXA 2ZRBA 5HGJA 5DZSA 2NQ8A 3HUUA 4CM6A 5C37A 4LE0A 2H7YA 5E7QA 3LUBA 1WCIA 3HUTA 1NN5A 3NB0A 1UPUA 1E2IA 1LWNA 4FDAA 8OHMA 3PWSA 5AOAA 1KRXA 2YJ5A 3NALA 2DJIA 1RRMA 1YB4A 1IY1A 3B1VA 1U9JA 3C70A 4M0FA 3SZUA 3T06B 4I3HA 4X94A 4X9XA 1Q1GA 1WW2A 1FC0A 3NTUA 5L4SA 4BKQA 2HIAA 5LUBA 2HK8A 3LT1A 1SU4A 1AE1A 4G8CA 4HVAA 2IUSA 5MF6A 1GPH1 2J9FB 2VJCA 1NVVQ 3FTCA 4L8WB 5BY2A 5IJ9B 3WBJA 3MHTA 1WMBA 3RYFB 4D9JA 5J2TB 1XVUA 1XZGA 2A9PA 3B36A 4J7AA 2JCXA 1G41A 1YS2X 4GXTA 3TIVA 2WJPA 3VNAA 2OD7A 3PFBA 3E0XA 4C20A 3PLAE 4Q12A 4EKNB 2VPIA 4B40A 2W6NA 2ZRPA 1XEWY 1HR0B 2A1IA 1G6Q1 1HGXA 1M1NA 3MWJA 3B9PA 3HKCA 1ZN8A 3IDQA 2G83A 3OPMA 2XT9A 3U3XA 2HX1A 1ZN9A 1NR7A 5BUQA 5HHTA 3TI7A 5IKOA 4JBNA 3ZD6A 3F3KA 3O1JC 4RLHA 4PSUA 1U7XA 4ERNA 4UNNA 5JSFA 2R6DA 2H4HA 2Y67A 2XVXA 1GSIA 1L7QA 3U37A 2DPGA 4AD8A 1MO6A 1KXJA 3PHHA 2I2AA 1BEEA 3HCDA 4ID9A 3NC0C 4IIFA 4LOAA 4BNTA 3VR4A 5C81A 1QK4A 2DQKA 5TQ0A 4QJ3A 1GXSB 4KRXA 2HWYA 1SXGA 4DWOA 1PYDA 4FDTA 5LU9A 3O8DA 1QPGA 2FSVC 4DNOA 2CB9A 5LLSA 1BG6A 4FLFA 2ZZMA 1WHSB 3C74A 3M1YA 3QYPA 1DKMA 4KMSA 3P2YA 3JXEA 2OKCA 5ESRA 3OQHA 1XNJA 4ZO7A 3B2NA 4WVLA 4HS4A 4DLRA 2OEPA 3C0KA 3A6DA 1FFYA 5DLDA 5C2JB 2FUKA 3NZEA 3K72B 2J59A 4M9RA 4PZAA 3R24A 2PSJA 1GNTA 2WA2A 3JVDA 3K05A 3O3MB 3BKWA 5IZ4A