1PSZA

Pneumococcal surface antigen psaa
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
286
Chain Sequence
KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (SURFACE ANTIGEN PSAA)
publication title The crystal structure of pneumococcal surface antigen PsaA reveals a metal-binding site and a novel structure for a putative ABC-type binding protein.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 109
structure length 286
sequence length 286
ec nomenclature
pdb deposition date 1998-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pszA01
5CR9A 5JOQA 4ND8B 5M34A 1KARA 4LS3A 1PQ4A 3R5SA 2PRSA 5GGXA 1N4AA 5FLYA 1L5HA 4INOA 1M1NA 5KOJB 1K75A 1M1YB 1N2CB 4PM4A 5I4KA 1M1YA 1QH8A 3BE5A 3AEKA 2WHYA 4NNOA 2XDQB 4WESB 2XQVA 3MINB 4WESA 5JG7A 2PS0A 2Q8PA 4WN9A 1G20B 1FP4B 3K1AA 5BVGB 3AERA 3R5TA 3AESB 1KAHA 3ZK9A 1G21B 5CX1A 2WI8A 1QGUA 1K7SN 3ZK8A 3AEUA 4TKUA 5B58T 1M34A 1K0FA 4G07A 2PS9A 2AFIB 2XY4A 2OGWA 2AFIA 3HXPA 3LHSA 4H0FA 4K3VA 2M6LA 2OV1A 4MO9A 2AFHB 2PS3A 5HDQA 4UTPA 2XH8A 4ND8A 1MIOB 2X4LA 4BBPA 3TLKA 4CL2A 3AEQB 4B8YA 3AEQA 4TKVB 4XPIB 4N01A 3HJTA 4G09A 5KOJA 1N2CA 4UTOA 1PSZA 5KOHB 2XDQA 3BE6A 4GICA 3MINA 4M7OA 4HMPA 1G20A 2YNMC 1FP4A 5BVGA 1EFDN 2R79A 3AESA 1G21A 5M2QA 1XVLA 4HMQA 2MINB 2QI9F 3ZKAA 3PDIB 3PDIA 4OXRA 2OV3A 4UDNA 1TOAA 3EIXA 3PSHA 4WNAB 5KHLB 2O1EA 3PSAA 2AFHA 4HMOA 1K2VN 2OSVA 4UDOA 5GGYA 1KAEA 1MIOA 4NNPA 4MX8A 5M29A 3TNYA 5JJ5A 2ETVA 2RG7A 4TKVA 4XPIA 3UJPA 4MLZA 1ESZA 4WZAB 4WZAA 3AETB 5BVHB 5KOHA 1QH1B 1QH1A 3HH8A 1H1LB 2Q8QA 3LI2A 4MDYA 3U7QB 1N4DA 3MWFA 2MINA 4DBLE 4FILA 3MD9A 2XV1A 1L5HB 4WNAA 4PAGA 4LJSA 3CX3A 1M1NB 2PHZA 1N2ZA 3NU1A 1QH8B 5M3BA 3AEKB 3TEFA 3MWGA 4H59A 4FKMA 5HX7A 2M6KA 2XUZA 3GI1A 4WN9B 4IRMA 3K1AB 3AERB 4OVKA 5CX1B 1QGUB 3AETA 5AFSA 3AEUB 4FNAA 4TKUB 4INPA 5BVHA 3G9QA 1M34B 4OXQA 2R7AA 5JPDA 3MFQA 1H1LA 3ZK7A 4WZBB 4WZBA 4FI3F 3U7QA 3EIWA 4HN9A 2YNMD 3ZTTA
chains in the Genus database with same CATH superfamily
3V2GA 2QTLA 7GPBA 1N2EA 2X77A 1RNLA 4LOIA 4Z0NA 5BOVA 3HCNA 3EWSA 2WJ6A 3PR3A 4JXXA 3DCJA 2Q2VA 4KVGA 5JS1A 1RJ9B 1NVVR 2HRRA 5JATA 4US0R 3HKDB 2O2CA 1K4YA 4M1WA 3PXGA 3UAOA 2PWZA 3WE7A 2NU8A 1LSUA 3B7GA 2HLNA 2K87A 3B8EA 3ELUA 3ILXA 1KJQA 4KOAA 5EJ7A 3USZA 4ZVTA 3EVDA 2CNDA 1WMEA 3OZIA 1GNQA 1I2ZA 3REOA 4Z0HO 2DPGA 4YFYA 2R8EA 3WV5A 4P4SA 3IAS1 2YOGA 2OCGA 3UGJA 1XDWA 2BFCA 2CXHA 3RS7A 1SXQA 2ZIXB 2GEJA 5FWXB 2OM6A 1J0EA 3H1TA 4KGZA 2ZVPX 4PO8A 4FFBB 5CFZA 4IJKA 1W35A 3A1SA 4QTXA 5FWAA 1BS2A 1K7FB 3ZHZA 4KNYA 2NU6B 1AUOA 5FQOA 4NMWA 3AVTA 5JDCA 3UCXA 1XYVA 4M1ZA 3BJMA 5IKMA 1Q1NA 3GJ0A 3AEQB 5BWOA 2K2QB 2ACEA 3A27A 3PC8A 5JASA 3L1HA 2FMTA 2Q99A 3R6GA 2XUOA 2ZM6B 2QD1A 3RSZA 4J4BA 1B2RA 1JVSA 1FF9A 3MGGA 2A9VA 4GL4A 3R7SA 3VKVA 3L9WA 4C4PA 3EPHA 1UFQA 4EVQA 3F67A 1Y7TA 1FP4A 1VMDA 4HGQA 3I2HA 1G21A 1O94C 1LPBB 1DC7A 1UWCA 3QTBA 4N0EA 4RVHA 4EKEA 3OTHA 3HY6A 4ZHSA 4UCWA 3O4VA 4BP9A 5HIKA 3PLRA 4C0BA 2IXBA 3JQBC 4MQFB 4OSEA 2YV1A 3CX7A 3KC2A 3QXHA 1H2ZA 5B3LA 1O94A 3I1FA 3DVAA 4RXMA 1I3MA 2GESA 3I01A 2NSLA 1NNI1 4YGXB 3TDKA 1ORRA 1O77A 1ACLA 2B2XA 2JIBA 3JQBA 3I0ZA 4FN4A 3P9IA 4G67A 5IYZB 4N3AA 2BEUA 2DLDA 5I7EA 4N7JA 1AXEA 1CIJA 5TT1A 3H16A 1CUJA 3HUFA 3GV0A 1KRWA 3FOZA 2DYKA 3HV0A 4JBGA 1LY1A 2GEBA 2GS9A 2IGTA 1B2LA 3RKUA 1EFRD 4MV0A 1ZLYA 3GWZA 4KK4A 3C45A 3FRJA 4FFPA 1YR9A 4MVJM 2ZJOA 4FS8A 4TSFA 3AG5A 1PWHA 4X8MA 4ZT6A 3F5MA 1UKAA 4EH1A 3FVWA 1BHJA 4G1EB 3THYB 1K92A 2HI0A 5TNXA 1H8HD 3LC2O 4L27A 4TYQA 1U9IA 2WJPA 4UZSA 3GDFA 1L4EA 4NBNA 1OWPA 2RBEA 1ZH4A 3IT3A 2PGOA 4X91A 1YHZA 2F3SA 2LWIA 3K6RA 3ZY6A 4HP8A 3FHJA 3I8OA 1PV1A 1W59A 2QX4A 3RVRA 3ZZ0A 1NNEA 1PFGA 5IJWA 2DFNA 3A28A 4RENA 1F8YA 2ORED 3IBSA 1NR7A 3L7LA 3OX3A 4RHFA 3F73A 1NX6A 3VOBA 4FIDA 1UZNA 2LV8A 1LCIA 3NHAA 1FK8A 2AOTB 2A3RA 3EEYA 3OJXA 5G41A 5B3JC 5FPKA 3VJRA 3B12A 5HOQA 2E89A 1T9ZA 2IT1A 5D5QA 3ODPA 4FCTA 3VAYA 1R00A 1MENA 4WINA 4YMUA 1TA0A 1X13A 5B3JA 5JNWA 2C0PA 1BEUB 2QX7A 3PPWA 2Q6OA 1K88A 1IUOA 2C5SA 2HSJA 2EEPA 3O21A 1VKRA 1E8DA 1T3GA 3JXEA 9ATCA 2ZAOA 4RLFA 3OOYA 2DTXA 3LW8A 4X1KA 4I1PA 4YNBA 1KIFA 4UMEA 3U4GA 2J3HA 3AUXA 4TMYA 5LVAA 4H31A 1G6HA 4IX1A 4Q03A 2OCBA 5DRYA 4A8PA 3LW7A 4RS3A 1Y7IA 3PEVA 2G9VA 3C3CA 4HR7A 2ZE5A 4K6KA 4II3A 1ISMA 1UOQA 1VZ2A 1R2QA 3A4NA 3FUWA 3IMEA 4KQ1A 1XVUA 3G5LA 4MCAA 5ALVA 1H2FA 3D4BA 3GF4A 4DSOA 4Z4QA 1UZLA 2B1JA 1GUFA 2W2KA 1MDFA 5CT9A 6NULA 1TJNA 2RGAA 2H5JA 1Z16A 2NXJA 1MB9A 3LDUA 1IZ0A 3Q15C 4NATA 4AXXA 3HU5A 4JP5A 1OR8A 1E69A 5JSHA 5EJ4A 2BHSA 4KNVA 3R9WA 3EZNA 4IEFB 1UXKA 2WJZB 4EI9A 2XNCA 1DPGA 5IKEA 3I72A 3JVVA 3H9EO 1WPXA 2B94A 4H6XA 3OKAA 1FDVA 1RYFA 5H68A 2FPMA 3EQ2A 2Z2XA 1A7UA 4JLWA 4MA5A 2AMVA 3ZKWB 1UAYA 3EY9A 1P4JA 2F43A 2IXDA 2WEKA 3P5SA 4W7IA 4QBHA 4URHA 2GM4A 1U2EA 4MS1A 1DIAA 1ONBA 1S8FA 3DTNA 3B1WA 2BGMA 3TQTA 2W5UA 2X13A 4HEHA 5D3MA 5FNZA 1I0IA 2FR8C 4I4TF 1I4TD 4RH1A 1B6RA 1Y1TA 1K68A 3JQCA 2Q45A 2WTNA 3LCVB 4L5CA 4MULA 3U9SA 1WZNA 3KYBA 4LRYA 1NV8A 4RAQA 4LYHA 1UBFA 2AFHE 2WJ4A 3B3QA 3N70A 1J49A 1OI3A 2Q5OA 2BDUA 2K4MA 4I9HA 4BFCA 3BK2A 4PZAA 1XBTA 4CV1A 4KOEC 1O95D 1E5QA 3AUJB 1NZJA 2J7PA 5PNTA 3ZGLA 1QIJA 5SYNA 4AU1A 1C9EA 4D98A 1J97A 2CHEA 1IXZA 2R4TA 2I66A 4HVAA 3V5NA 4IKEA 2UUBB 3LUDA 2G1AA 3PX7A 2AVDA 3GC6A 2I4MA 1Y3CE 3R24A 3HCBA 1BJKA 5CDUA 3GJXC 1CUGA 1PUXA 3O8QB 4MIKA 5FI0B 5TF0A 1KWKA 1CIVA 3M5DA 1E9RA 2YICA 1CJTC 3TQIA 1P1KA 1Z8DA 2A35A 2IKQA 3CRQA 1CY6A 3DDWA 4OJTA 3UJ9A 1T2AA 5DM70 2W6ID 2W2NA 2WWVD 5D86A 9MHTA 4CM7A 3FWKA 4BNWA 5CA1A 5EPEA 2BH9A 2V74B 5KNCH 2HA6A 4JFRA 2OHHA 2PMKA 4Q7EA 4RCVA 3AGPA 1UMCB 4WADA 5H02A 3WKBA 3QX9A 4G9EA 3ZUPA 3AIKA 5HM6A 1OJ7A 2XUZA 1M0TA 3NPAA 2YHIB 1YZ3A 2JGJA 3JRNA 4HBGA 5C7LO 2VNAA 4J03A 3V80A 4HGRA 3PA6A 4E88A 1GTSA 3ZGNA 2OGUA 4OXQA 2ZUFA 5IJ0B 3L6OO 5KNDD 1Z2AA 1ZZGA 2IE8A 1C9YA 2GBGA 3BGOS 5J1TB 4QXRA 3TL3A 3T7IA 1ORWA 2DWPA 4GOJA 5KSOA 1KQFA 3N6RA 4FPXA 4J2OA 4M9CA 3KSZO 3PQ4A 1B00A 5JZOA 2PXAA 4YRSA 4INOA 1RBYA 5L3ZA 4X84A 3VPBA 4MVJF 2HHJA 4JKIA 4RXUA 3UK6A 2FPIA 5BSMA 3TQRA 4LXQA 1VFNA 4D8YA 2UUPA 4TXMA 3PC4A 5KCZA 1S2MA 4WLOA 1U63A 2C2WA 3WHIA 5DRTA 1OYVA 5TQ2A 5A0FA 3MTQA 1PQUA 5ALPA 3EDOA 3QKRB 3UWSA 1Y6QA 2WIFA 4G5GA 4TVKA 4XX0A 5AVTA 1MOPA 1W1UA 4RE6A 2H4XA 1OXMA 1JKJB 4LKOA 2FR0A 4WIAA 3FMGA 3FMPB 4AS2A 2QP4A 3TRDA 3K8QA 1GZ5A 1VGQA 1FUIA 3VAZA 4EG4A 2Y1XA 1DQYA 5BMVA 1Y8ZA 3JQEA 4AP5A 1T9GS 4IV0A 4BX0A 4ZU1X 3KZCA 2OPBA 3O4GA 3PXEA 5HF6A 1H2YA 3VC3A 4GM4A 4ZQBA 1P18A 3GLGB 3B9BA 3KHKA 1FTYA 1S0UA 2IDZA 4NIMA 3R9IA 1R8SA 1PT9A 4TS4A 2BGUA 2GJ4A 2RAPA 5FBKA 5HGJA 2AZTA 3NBUA 1SBNE 3U60B 2B78A 4O3MA 1P72A 3COVA 1K8RA 3LPNA 1SGWA 5M2QA 4ZYZA 1P7VA 2ZJ3A 4ZODA 3U09A 3L0DA 1I5RA 2XCSB 5JS7A 2ZCJA 3AUAA 1TFRA 1QTRA 1YIAA 4M6WA 4MI6A 5DCUA 2XXBA 1I36A 5DM0A 4I4TB 5CM9C 5AM4A 3PGVA 4M89A 3V8BA 1ITZA 2ZI5A 4FNMA 5AICA 1PTJC 1R6UA 2W4QA 1RMYA 1W2HA 1TMKA 4FS3A 5CMLA 3KSBC 4JEHA 3S7ZA 3R3YA 4NDNE 5I7HA 1QUEA 2ORIA 2GCOB 1SEVA 5A9SA 1YA8A 2ZRJA 1PTJA 3PVZA 1BJRE 3HRKA 5JDIC 3T5TA 4Q3AA 3EGCA 1HDOA 4P4TA 2CVHA 1AKEA 1G7CA 1SG6A 1QF7A 3PKIA 2OKCA 2WVAA 4KKXB 3SE7A 2HLHA 4GO1A 3DD1A 4D9KA 2OO7A 3WOHA 2PJRA 1K4KA 2A92A 2IUSA 3VR3D 4IR7A 3L8GA 4F9EA 2IIVA 5JPIA 5SZKB 1THMA 1CWUA 1OFVA 1W0KD 2H31A 2GJ8A 2PU7A 2W2TA 3LCCA 2PHZA 4HDSB 3SXUB 5C2JB 5C35A 1M74A 4AKIA 1D1TA 5M3BA 5EIXA 2VBIA 1V3TA 2BDTA 2VZ8A 4B3TB 3NKVA 4QYMA 3K5PA 4LEIA 2HY7A 5DYTA 2UZ4A 1H5QA 1R0RE 4IH9A 1Z17A 3WMWA 4JBYA 2A9KA 2VWPA 4RZHA 3ABRB 5ALQA 5AOAA 2ZETA 1LJ8A 1J90A 3OPXA 1OD6A 2E4YA 3PCRB 1JRLA 4DDMA 2VEOA 3UO8B 1Z4JA 2FG5A 3VC2A 3CCCA 1N34B 2WY2D 4CMCA 5CLGA 1TVMA 2VHWA 2Z6VA 1BWRA 1F8GA 1SXGA 4OIFA 1GCGA 1MEOA 2Q41A 4QHYA 4BMYA 5FNVA 3T9FA 1QE5A 4LKRA 1FDSA 5EG5A 3U7IA 1W87A 3AEZA 4N41A 1L8QA 3B20A 4KLRA 2I1VB 3ZG6A 2QTNA 3VR0A 4CETA 3PKJA 4IJUA 3MT0A 1OH6A 4LVOA 2RE8A 4J2TA 4DMHA 1V8PA 4JYBA 1RP7A 4LTDA 3L0SA 3QBDA 1SJ9A 4M38A 1Z4LA 2GH1A 2IHZA 3RSCA 5HKOA 4JYCA 4TLLB 4M0FA 1L7NA 4XWAA 5ICFA 5H8WA 5BNWA 3IX7A 4X94A 4DA9A 1E61A 2AEJA 2FWIA 3IQDB 3KLPX 4FKZA 2W8ZA 3A2LA 2CNOA 2GARA 2JFVA 5DOZA 5I4IA 4KR3A 2GM5A 3ZZ1A 3JW8A 1QGAA 4CQJA 3K6SB 2VT3A 1FPMA 4A7PA 3IULA 1G18A 4CHTA 3O5AA 1QYRA 3BH7A 1HE5A 1AU9A 1FFGA 2OC9A 5ALZA 2QD5A 2CN1A 3NHWA 5FUBA 1FMFA 2ZCVA 5A6SB 3WFIA 4GD3Q 1TTPB 3ZLUA 4V03A 1RCTE 4PHHA 3GAMA 1K0UA 3I5XA 5KYUA 3WGOA 3A6FA 1JLHA 2F1KA 2DC1A 2FW0A 2F64A 3BBLA 5H1YA 4DY4A 3UUGA 1LNQA 2A1TR 5IG2A 1EFVA 2M2IA 1NW4A 3NM6B 3R0JA 4FB5A 5DNUA 1ELOA 1BE6A 1VC2A 4N7BA 5J5VA 3RIGA 4WN3A 4JGIA 4K7JA 3M82A 2R85A 3R8CA 2B30A 3RSHA 5JAIA 2XB9A 3PEUA 5JNRA 3C85A 4KK3A 4DADA 4EJSC 3MLAA 3ZBUA 1EXWA 4QU8A 1NQUA 3T41A 2BZGA 2P3SA 2DKNA 3DEAA 1B41A 3ORYA 4RADA 4YEDA 5JWOA 3U6KA 1J7KA 5FA8A 2AEEA 3JARB 4BVHA 2VSQA 3T35A 1YMQA 3Q85A 10MHA 3F8WA 3RVLA 5I7UA 2GO7A 2O3TA 5EEHA 3EA4A 3LF1A 4BLWA 3LGSA 4MI3A 2NVOA 4K6HA 4W9NC 1E2HA 3C7CB 3GPCA 5JIBA 2XTZA 2G1KA 3LUHA 4KSCA 1RI4A 2VK2A 3P96A 1PD1A 3D1LA 4KV9A 2R47A 2PD6A 5CDGA 3FFXA 5HZGA 1XQ6A 2JK0A 5LDHA 4JELA 1U7WA 1GNRA 1HH4A 3VU8A 1EJ6A 1XEWY 1ZSNA 3BKWA 2OV2A 5I47A 4U2CA 5I7FA 1U7DA 2BL4A 4AQDA 1AH2A 1KSJA 4LZAA 2I2XB 5BR7A 3O0TA 2A9FA 3PHJA 3DUFB 1JJBA 1Z68A 3IDQA 4V0MA 4MYTA 4Q0MA 1QKIA 4NR0A 3ESCA 4LXTA 2XQGA 3TL6A 4YUZA 3HL0A 1YBHA 2HMWA 3U26A 1DKQA 3N7TA 2J7KA 4KWIA 1LW6E 3WGGA 4JEUA 4KXWA 4CKZA 1P7CA 2YRFA 3T0IA 5KPDA 2Q0XA 4ZAWA 1KMCA 2REOA 3LECA 2XZTA 5IF9A 2H1RA 1ODLA 1WLYA 2G28A 4L5AA 5F7JA 4ESHA 3KVVA 3PGMA 1HV8A 1U5BB 4B80A 2OV6A 2B92A 2BP7B 3C8ZA 1P7YA 4Q3CA 5C5IA 2YXLA 3LC7O 5CFMA 1THZA 1T8YA 3RSOA 2CHGA 3AOGA 3NV7A 3TB6A 4HN2A 3UW3A 4ETNA 1UAGA 3KE8A 4QPZA 3SMQA 1AQ6A 4OXIA 1KVQA 3ZD8A 4XI9A 1QRRA 3L92A 4QUGA 3I32A 3ZDYB 1ZK1A 3ENKA 4Z7OB 1SUFA 2AR9A 4MRVA 5EOVA 1NVWQ 4F06A 1KMQA 5LQRA 1RQRA 2OLKA 3H05A 4UNRA 1D9XA 1T4MA 1UJBA 2WJHA 1XZQA 3LQKA 1QNLA 2Z4RA 5E1OA 3HN6A 4ZK2A 3G0GA 1OWNA 1ZH2A 3GOHA 3L7BA 3E82A 5FAXA 4ZMBA 3CF2A 1OFIA 2H0RA 2IOHA 1JZQA 3O9MA 1L0BA 4RQUA 4ZQIA 5FIUA 3BEDA 5SICE 421PA 1BHSA 1JMVA 1G7RA 4B3GA 1PYOA 1UF9A 3INGA 4L0CA 1CQXA 4DT1A 1LDGA 1N8SA 4N0DA 5AI6A 3Q3IA 4OGLA 3QA9A 4J1SA 3WJAA 3MTIA 3OPYB 5KOYA 2DMRA 1ESDA 2QHXA 3DHYA 2FI1A 3KUUA 1YS9A 4NICA 1Z73A 4NJEA 4IIGA 3DXFA 2A1UB 4FGZA 5KI6A 4DANA 3HEBA 4PG7A 4QX6A 5F2NA 3BTVA 2DR0A 4OLJA 3U56A 2R4QA 3NETA 2BFEA 1JEDA 5G1PA 4Z1MA 3QY0A 2P40A 3VNSA 3WYDA 2IQIA 1IN7A 2WWTA 4I4NA 4ZDKA 2O2ZA 1NUQA 2FSVA 1M10A 4H6PA 1NUAA 2Q3MA 2Z5FA 2PUDA 4OQQA 2ESRA 2PX2A 4HPJB 3ADOA 3LD9A 3TI9A 4R4JA 5M29A 2UZ0A 2E3JA 2B34A 3I58A 3JQ8A 4L95C 1AZSC 1WKVA 2QYHA 1EM8A 3CMCO 1NJ2A 4MLZA 4E5VA 3EARA 4O4JF 1MU0A 2ZYUX 2PNJA 5LZ9A 1LDEA 2GF9A 3KWFA 4U8HA 4DA7A 3U44B 3SEAA 4G0QA 4D4MA 4EECA 4GDFA 1QX3A 2X4DA 2WTBA 2Q1TA 4HPWA 1G41A 4LY0A 1SVLA 2R8ZA 4XIIA 1RKVA 2BCJQ 3GFFA 2GCPA 4ZV4A 3JV7A 4HPXB 1TGVA 3U3JA 1LPAB 4GOMD 3DB1A 5IASA 4URWR 2OP1A 4TMXA 5CCXA 5CUQA 5C7IO 2X9LA 1EX1A 1QHNA 3G6KA 4FOPA 1EXDA 4LECA 4MR8A 1PJ3A 3L02A 3NHFA 1QH0A 1NMEA 2JJ1D 2N42A 1J9GA 4L7QA 3ILHA 1FPQA 2RHCA 4BRWA 4I36A 1LPSA 1YACA 4MITA 5IDYA 3G0HA 4YV0A 2FSFA 2DUMA 1GZ4A 3RUDA 4W5HA 3KFLA 1L7QA 2OMKA 1HMPA 1NLMA 3Q0EA 1OBVA 5CG2A 5ITWA 4BATA 3DE2X 2X0FA 2V97A 4JJIA 4CR7A 5K0GA 2QI9C 4CL3A 1TM4E 3TSAA 4KGVA 5CJPA 3H4TA 1F3OA 4KVFA 2BKAA 2ZT8A 4YWHA 2YZKA 3TRFA 5ITZA 1UWLA 5GV7A 1CB0A 4J6EA 3HRIA 2DBRA 3BYZA 4EQ6A 2F1JA 4L4RA 3WYGA 3IEMA 1ZD1A 4AJKA 2FFJA 3MLEA 2JIZD 1Y9EA 1T6YA 3UMMA 2XUPA 2LP4Y 4QXAA 2XEXA 4L2IA 2R68A 4TS1A 4JX8A 4AMVA 5JZ9A 1II8B 3HGQA 4RMJA 1ICIA 2JAWA 2DRIA 2RGGA 4DGSA 1V3UA 1N1DA 1G16A 1DMRA 2PBZA 3C8MA 4Q4AA 5DNVA 2IXAA 4L4SA 3A25A 3IC5A 4AG6A 2FFQA 2QTZA 4IDDA 3VJLA 2NO6A 5KWVA 2RGRA 3HL4A 4B79A 4DPMA 3NTXA 4AUEA 2CLSA 4PTZA 3HBNA 3WGQA 1H9AA 3GRCA 2C9DA 4NC9A 4X64B 3ONFA 4ADSG 3PGA1 5AR1A 3TLCA 4JGBA 3RUFA 3I12A 4DYVA 2RG1A 4UHJA 5K0SA 3OF5A 2QB5A 3HJTA 3Q40A 1XJ5A 5CXSA 2YIJA 5L3RA 2DVMA 1GXSA 4TV8F 4B5LA 1JJAA 2BMVA 1A98A 2A0WA 5TVKA 1CBUA 1C1DA 3CBQA 4R81A 3W5SA 4NI5A 1E1RA 2APJA 1T3HA 1JIJA 3LHFA 5C52B 5T7BA 4PNHA 3M9XA 5AW1A 1NP6A 3TW8A 2ZUUA 3L43A 3RS8A 4ZZ2A 1D6MA 1OVGA 3IODA 3MT7A 3BF8A 1YTUA 1JLRA 1OTXA 2P79A 3NC0C 1ZW6A 4U9HS 3VMMA 2X1MA 1O6GA 1QHHB 3PSHA 2C4WA 3T1OA 2EHDA 1KETA 2QGFA 3ZGZA 2H9AA 4JU9A 3AV3A 1QHEA 1MQ9A 2QR3A 1IJBA 2Y99A 5AW5A 2IU3A 1KMHB 2P1RA 3RRZA 3ZH9B 5JZMA 5F12A 4L85A 1FTNA 1E2QA 4M9QA 1NBMD 1H0RA 5EKSA 2C5LA 2FUG6 4IF6A 3X0DA 3I9KA 3ABQB 2AJCA 3TIVA 1POWA 1DRWA 3KTAB 4OHKA 5ALOA 2WPDD 5DEOA 5T6MA 1EP1B 3OAAA 1HDRA 4JNKA 5C1DA 1P1IA 4O4JB 5K6RA 5LIPA 3QEJA 3SEZA 1VPDA 1P4SA 3A7DA 3LIIA 4OIMA 5FPQA 2XECA 1ENYA 2GRJA 1QOPB 1O5OA 4BVGA 1M2NA 1BVUA 2HM7A 4OB8A 3F98A 1AZWA 2DBZA 4WDRA 2R87A 1CZNA 1CS0A 1HLGA 2JGAA 2OVBA 3IV9A 2PO7A 4MW5A 1LSOA 4MAFA 2HADA 1WJGA 3L40A 2J07A 4PU0A 2GPYA 1Y42X 4JEIA 4NRDA 4U6SA 5AK3A 3KYDA 3OURA 4MEAA 1SB9A 2H51A 2DECA 1UDWA 2RIPA 1WZIA 3WAKA 1L2TA 1EWVA 3F8SA 2Q4RA 1R0SA 3ADKA 2G7MC 3O73A 4K40A 1YBAA 4W5TA 4XD7D 2E21A 4XLLA 2VQDA 1EG7A 1RP1A 1GPKA 1T9CA 2ROQA 1TU0A 4I5IA 4IVQA 2AXPA 2FX5A 2IOQA 3FLMA 4KN5A 3CG4A 2IL1A 1I4WA 2P7IA 4QDOA 2Q3HA 1F6WA 5C0OE 2V9CA 2QTAA 3K20A 3LCMA 4WZBA 2IIQA 2PUVA 1NGSA 1KYZA 3DE5X 3SP1A 4V2IA 4OKIA 5FWYA 1IBSA 2VPIA 1ULZA 3AF1A 5HA5A 3IQWA 4IHJB 4LSWA 4EPVA 1Q0TA 4NFHA 1HETA 1JEQA 5I3ZA 1HE2A 5KOJB 5JZVA 4BNVA 3ZGYA 1PR6A 1C0IA 4YJHB 1Z74A 1Q0HA 3HEAA 3MXTA 4ZRNA 3OLQA 3E4CA 4HF7A 5F1YA 1E1YA 3RTAA 5A2GA 3KELA 4DREA 1I2MA 3NVAA 4H6WA 2ZSAA 4WESA 4HRYA 1POXA 2EFCB 4EHFA 2C2ZA 4GQAA 1FTSA 3RNOA 3D2LA 2H4FA 4P3OA 2HEGA 2IYNA 2OA0A 1NBHA 4W5RA 4LJ4A 2HU7A 3ELWA 4N8SA 4O1MA 2J0QA 1OILA 1B8VA 2ODTX 2WNSA 3PA8A 4RZ3A 2FEAA 3ERCA 5CEJA 2AFIA 1V9SA 5K0EA 1T91A 1M34E 1U65A 3AEXA 3IR7A 4CEJA 5IT0A 1ZMBA 3FTDA 3AINA 3T9DA 3TW0A 1J8MF 1OKKD 1UZUA 3I1YA 4OHFA 1GG9A 1FFSA 3GMIA 4G5RA 4REMA 3TE6A 3UK1A 4EYOA 3G79A 1XQXA 1YONA 4RJIA 2AJBA 5BV1A 1FL9A 1YULA 2HF8A 5AVVA 3KOMA 1E99A 3ORHA 4AY2A 1QRTA 1X15A 3JWEA 3UMRA 2BM1A 1S2GA 1QKJA 4KJZA 4BN0A 4IGAA 4TV8B 4MHSA 2RC5A 1RXVA 1O6CA 3JTMA 1IJFA 3OJ0A 4G5SA 3UV3A 4JMPA 2SCUB 1WQ1R 3IXQA 4L5BA 3TFWA 2WIJA 1PHPA 4U6NA 3NFRA 1RDFA 4EMSA 2JEYA 2PD3A 2WWIA 3QFFA 4ND3A 5BSEA 4MXDA 3T3HA 4OA8A 1QFXA 5BN1A 3T34A 3LHIA 1UT5A 2Y71A 1UL1X 4JI0B 1IYZA 4MPJA 4NK4A 4E11A 3N2GB 3GT4A 4U0KA 3T7TA 3OLWA 3DOJA 3NATA 3P0HA 2GD6A 4G8JA 4Q3OA 3CSDA 3CS3A 2AE2A 5HCIA 3SD7A 3L07A 1NXSA 4D9JA 4KR7A 4PTLA 1BRMA 3QPBA 4HN4B 1JW9B 4G0MA 1GZHB 2AYZA 1XRLA 1G5PA 1OIWA 1VJ1A 2XOKD 4EQZA 4WZAB 2FE4A 4MWBA 3UAGA 2YJZA 1RWKA 1U2SA 1NUPA 5EIAA 3DGEC 2UXBB 2YINC 3VSDA 3HWX1 4WXYB 2G07A 4YFVA 2E4WA 3EGXB 1WKBA 3LCUA 2PT9A 1RWQA 3GEEA 3ONEA 3P7MA 4ME6A 3BBPA 4MV8A 1CE8A 5D3ZA 1JR3E 3HBAA 5JWHA 3T5GA 1S4QA 3TTYA 1SOAA 2IHBA 4FILA 4X1YB 1ID1A 2FN8A 5J3JA 3I39X 1Y1PA 3OZRA 1JQDA 4OU4A 5FPYA 3Q3JB 1FNCA 1GGKA 3MUEA 2X7JA 4IV5A 4MYCA 1K3UB 4KXNA 4PAGA 4FYWA 1OCEA 3UAWA 3U19A 2C3OA 1Z5NA 5B2EA 4YQZA 2BE7A 2ZB4A 2IXTA 1VJ5A 3CJQA 3TF5A 1GNPA 5D1HA 5L3QB 1XDBA 3OJWA 2J3LA 5DBHX 3QE9Y 2VJDA 2HSGA 1QPBA 3HYLA 5LQKA 3PQ7A 5AW6A 2BI8A 3N75A 4FJ1A 4CN8A 1OVMA 1KR5A 3DLCA 3TLYA 2VTBA 4I1OA 4H1WA 2CW5A 3FTNA 2YMPA 4IDNA 1NYLA 3DCNA 2DLNA 2HXYA 3QLVA 5EINA 3VZQA 5AKXA 4YI5A 3LUGA 1K2WA 3F7NA 2JGDA 4B40A 3UA4A 4YV2A 1Q0QA 2NOAA 1LEHA 5KMGB 2IEBA 4ZZIA 3HO1A 3VPFA 1QS0A 2GB4A 2X0EA 3K05A 3MT9A 2AA3A 2F3QA 3BIXA 4BFSA 4CIDA 2A78A 1X94A 2JFOA 1TGYA 4DIEA 3QOWA 5IM4A 1NWHA 1EVLA 3DBOB 4PRZA 5LLDA 1GZDA 1LTHR 2WSSA 3OJEA 3Q0TA 4RSGA 2VP0A 3RHZA 2O1SA 3ZVNA 1T6ZA 2X2FA 4Z0PA 5KYTA 5AW9A 3WWZA 5IUKC 1ZNYA 4L74A 2IF0A 2JGMA 4MINA 1WQ3A 4FCWA 4G25A 1IM5A 2FU5C 4NV3A 4GMHA 4R1OA 5DTMA 5IFKA 2P6RA 8GPBA 3WMFA 2XY4A 3WB9A 3NV9A 1KWGA 3UJBA 1ZC3A 3EIEA 3FNGA 1KFCB 3FBTA 4RPHA 3UXEA 5LPNA 2FLKA 1KY5A 1MH9A 1TK2A 1VSUA 5C4MA 4RKFA 1JALA 4RD2A 3NDBB 2MSWA 2A0FA 2QLLA 3M1YA 2EERA 2J3MA 2BGRA 2XMQA 2I80A 2QF7A 1K8YB 2NTEA 2GPWA 2PZEA 4J4TA 4QHSA 4MYRA 3I04M 4XARA 1VE5A 3EXEA 4MPPA 2J6CA 1IULA 5A3SA 4J9UE 2ERYA 5AO9A 3WLPA 1SHZA 4U7TB 5C8YA 8LDHA 3RABA 2VKQA 3PEWA 2Y92A 4XVQA 5REQA 1KJNA 3FWYA 3B1FA 3TQCA 2F48A 4F1KA 4NYIR 3ZWBA 5J9FA 2O8DA 4JVLA 5KTNA 3C3DA 2WMOB 1P74A 3RJ5A 1KDVA 1K97A 3R5XA 1F1JA 2YJTD 4WNAB 2RSLA 2CNWD 2H48A 3PRJA 2FR1A 3RPEA 4IIJB 4DC1A 1A5BB 1FTGA 3KR0A 4YMIA 3SJBA 2ODQA 4X3OA 2A5YB 4A91A 2BH2A 2HLDD 4K9OA 5DN6A 4A0QA 2IEGA 4RORA 2H85A 5L45A 5DXFA 2IODA 4H3VA 2HWYA 1QR2A 5H16A 2J4FA 4MUKA 2LZ0A 3K96A 1OT5A 5HKBA 2FMFA 4XUDA 5IANA 4MGHA 1CUYA 3VU1A 3Q7PA 4F85A 5K9ZA 3KNZA 1WAMA 1XV5A 2R6CA 4EJ0A 1NLFA 2Q07A 4YAFA 4CODB 1KO7A 2FA9A 1X14A 3N39C 2X8JB 1U2DA 2IWHA 1OWOA 4NH4A 1XTRA 2ZWMA 4EY8A 2GAFA 3SIPA 4D6XA 1YCHA 4UEQA 1GOTA 3M83A 1S2DA 3EAFA 3N7AA 1RXWA 2YN0A 3EUEA 1ZK2A 1KDPA 4K9NA 3MCTA 3SKYA 1PW7A 1Z62A 3PHHA 1GR0A 3H2HA 3JU3A 4TLBA 2ZZNA 4WXHA 4CLOA 3N87A 5HE8A 2EAUA 5G40A 1RBQA 1C3LA 4I50A 5BSFA 3AC0A 2ZRFA 2FWMX 1I7NA 2J67A 3UUEA 2AW5A 1Z3IX 5SY4A 4BZXA 4Z4HA 2CFRA 4V24A 4MEBA 2DFDA 4IICA 4DR5B 5JSUA 1JXOA 1C7ZA 2D1TA 3CH5A 2JKYA 3HZHA 4B3HA 3MJSA 2HYIC 3H42B 3K9FC 5MF6A 2JCGA 1PLKA 3ZTTA 4P5PA 2MSDB 3VNAA 3IKLA 4BV2A 2PRYA 2FRDC 2JD1A 3CZ9A 5ULLA 3ROGA 3TLGA 1EGAA 4ODIA 3GJSA 2IPMA 3QOXA 5LC1A 3I2YX 2VK4A 3BDAA 3PC2A 3TLJA 3ABIA 1SULA 2ONYA 2DETA 5C32A 2FRDA 2HZBA 5JE8A 1M6EX 1PEKE 2ZVDA 4DQDA 4EKIA 5FAKA 4IQGA 2VPXA 2Z2YA 4LG1A 3FB1A 3WDLA 3UWOA 5SV2A 3TUIC 1SVIA 1KAMA 4MGYR 4TOIA 4E31A 2XCIA 3WP1B 1XG5A 5HILA 3OM8A 3ZXSA 4EG7A 3CVYA 5TDHA 1APBA 1M5RA 4Z99A 4EG3A 2IS4A 2IBMA 4BBZA 3MJTA 2ID7A 4PC6A 2H2FA 1ZGHA 2R66A 3EE6A 2B6HA 3CLKA 2JGLA 4RH3A 4YRIA 2QBYB 2WJVA 4IIEA 3UV7A 5KNBD 2UYQA 1JX6A 2FN7A 3C87A 3RFFA 2GI4A 2I6XA 4UEWA 3JQFC 4MW4A 4ZCSA 2ONJA 3T4UA 4H1UA 2IRWA 3LK6A 1EE9A 3HI4A 4GSYA 4NQRA 4BEBA 4MRPA 2NNWB 2XUIA 2XYPA 4GKKB 1MX3A 2OZKA 2MTBA 1J56A 1Q0RA 1XTKA 2QW0X 2AC4A 4XAQA 1N2HA 1S2LA 4RHUA 4B4OA 1E5LA 1VL5A 5AK6A 1B42A 3QF4A 2EIXA 3GW8A 4HMPA 4ER0A 2Z95A 2PX0A 3W6PA 3DV0B 5CLFA 5LD2B 3G13A 3HUEA 3Q3VA 3EXIA 1DCMA 1JLLB 4GNKA 5CB0A 1SVNA 3FRIA 5F76A 3ER9A 3BCSA 2GLXA 3HYNA 3KQPA 2JLXA 5JCJD 2CCJA 2E18A 2NUPB 1LC3A 2ZS8A 3BRCA 1JLKA 3QFRA 4EHJA 1EUDB 1TMYA 1NPDA 2JBHA 1RJFA 3EOBI 4HT3B 4Q3DA 4CQLA 3KFVA 2GEKA 1KH3A 2XBLA 1KRHA 1NAHA 1GUYA 2A5GA 3FIUA 1G8GA 1BHQ1 1UKEA 2ZJBA 4LOKA 2PWAA 5EJGA 4NWIA 4XFKA 1XRMA 4I5FA 4DC0A 3UWDA 4E5SA 1HG0A 2YMMA 4LXYA 2CVZA 2O20A 2PQ0A 1RWPA 2I6FA 3S8EA 5FTWA 4ILEA 1CP3A 3PFHA 1D4OA 5AXBA 1HURA 3TVYA 1XQWA 3HH8A 5B7NA 1W6UA 3OPYI 1E0AA 3AVVA 3VYVA 3E6AA 4BNDA 4RZQA 4QVIA 4U7GA 2HXSA 1HA3A 4C30A 3TRIA 5A1TA 4YDHB 1SXPA 2D5IA 3LDGA 1EH5A 2ATVA 2CL6X 5F2OA 2H1SA 1C0PA 4MVJP 4RU1A 3AHIA 5IK2D 1D0SA 1QV6A 3AI3A 3OQOA 3NH9A 1V3QE 1YC2A 3NHMA 1MHTA 2ZRIA 3ZCQA 1QONA 4BN5A 1BS1A 1NATA 1ISJA 3QK7A 4G56A 4UM5A 4W8HA 1XVAA 1QZTA 3TQSA 4JOSA 1UKBA 2X9QA 3UMGA 3EAGA 3EGWA 3O1HB 3QKTA 3ML1A 3IP9A 2AN9A 4FZVA 4XIGS 1M2VB 4I3HA 2HPZA 3GZ4A 2AEMA 3DSRA 3OM1A 3QE4A 4A5SA 1GA6A 2IYZA 3H8JA 4I6GA 1JSLA 1PT6A 2C4KA 1F1BA 1KH1A 1TO2E 3KZXA 4CTOA 3VYWA 4U39A 2BPOA 1K8XB 4BEJA 1LZKA 2AJDA 3FHCB 4UUMA 3W3AD 4UEKA 1U0EA 3FLAA 3HHPA 3EZ6A 1OGJA 2FRXA 1ZVKA 2QM8A 1Y7PA 1YR3A 1Z6AA 3BKXA 2FPSA 3H6HA 4KYTA 4AECA 4CFSA 1FTQA 3ZD6A 3IMKA 1STOA 4H3KB 1M1NA 4JLBA 4EHAA 4F8EA 4BNXA 1NR1A 1CNEA 1ZN8A 2FDXA 3AY3A 3IBCA 3TG2A 3UUWA 1R0KA 2I2WA 1I33A 3PXCX 3HFRA 1MTZA 4P0PB 2CK3A 2F90A 3E35A 1N0IA 2Q6VA 4BFLA 1KY2A 3SCZA 3HQ4O 1JDNA 5D5HA 3CPSA 2XE4A 5DIZA 1PO7A 4EJ6A 5I7VA 3SVZA 2ZWPA 1M0SA 3VOTA 2JIPA 1O3YA 2VK1A 3OLZA 1TUBA 4JOCA 3VHXA 5GZ3A 3RAFC 2PAFA 4F4IA 1RXEA 4ARVA 4XIYA 3LOUA 3REQA 1FX0A 4FT2A 4KYIB 3TSZA 3VISA 2JHCA 3G17A 3I2FA 1PR4A 2F8MA 1XNGA 4L8VA 2ZJYA 3D8SA 3KP1A 1GUDA 3L9XA 1O96A 3NALA 3NVKI 1VHTA 1FDTA 5G0WA 4BLVA 2VYVA 2PANA 4O2BA 4A1OA 1PX0A 1N2CA 4E3WA 4A8JC 4HYYA 3E5HA 4IIXA 4ZVKA 3RO7A 4WUTA 1HYGA 3B85A 4CHGA 1B26A 3VO9A 4LRSB 5DN9A 1DBPA 2IY7A 3EGEA 5FPHA 4ZYUA 4O2LA 3SYKA 1SUIA 3L79A 5ERYA 4PLPA 5FEMA 3SDBA 5A0TA 1Z0JA 1TQ4A 2R5NA 1URPA 2YFHA 1XCOA 4M9XA 1D4FA 1E4YA 1V8ZA 3SYRA 3V8NA 5BSGA 3HP1A 3R8FA 4YA6A 3SC2B 2QRLA 4EGAA 1NG9A 4C4AA 4UUNA 4MMZB 2ERCA 5HG0A 1WU7A 5K0FA 4DLXA 3GEPA 2JFFA 1QQAA 2EYUA 2D7JA 1SOUA 4BYGA 3IMFA 4J8PA 3I01M 4B34A 5LQUA 4TKVA 3H18A 4JX9A 4G41A 3WMXA 3YASA 1QH9A 4CKCA 4DNXA 2ZJ0A 3RYCA 3VXKA 1IAVA 1RYEA 2EGUA 3OH8A 3E15A 5M34A 3ZJTA 1DIHA 4I5GA 1NXWA 1W1WA 2W48A 3F6SA 2H9IA 1BXRA 4IIDA 3TRKA 1D0VA 1W25A 3EVFA 4CN9A 3PFCA 5JBQA 3BRQA 1ZGJA 1Y6ZA 3MHPA 4Y9RA 3CUVA 3I73A 3NBKA 4MP3A 4WCFC 1TT7A 5TJ9A 1WUHS 1GG5A 3CCBA 2AEFA 3OPNA 1HY3A 3GLFA 1H22A 1JDPA 1P19A 5FXMA 1M3SA 1L5FA 1GSAA 2D1FA 3UHFA 3TGLA 3F1KA 4TVSA 5BNTA 5EI5A 1O7JA 2CLMB 2QL9A 3AUUA 3MMPA 4J16C 4OQNA 5HBRA 2ZVJA 1TK9A 5E3IA 4I6JA 2NN3C 4F7WA 2LPMA 1XLTC 3GQBA 4B71A 4LFAB 1JJFA 1C1XA 1XD2B 3O2NA 5LA6F 3AO0B 1E4EB 1HLPA 3GT7A 4Z6KA 3AFIA 3PRYA 5BY2A 3EMKA 4KNWA 5FI3A 4OQZA 5JALA 2Z9CA 3OQVA 3MTAA 3G2KA 2YYAA 4HWRA 4LIPD 3T1QA 1J9EA 2BFWA 3QLUC 5AM2A 4KR6A 2OD9A 4OM8A 1JDSA 2ENUA 1ZONA 1HYQA 3QM1A 1EFTA 3PTZA 1U7XA 1SVOA 2ODNA 3JQPA 1AKQA 4IXMA 2Y68A 3E2PA 2O4CA 5C8ZA 4RULA 3L0CA 3SX2A 1I32A 3ILVA 1KZGB 1PZHA 3GIWA 4IM7A 3IAAA 3ASYA 1R5BA 3EQ6A 3IVMA 3D3EA 2QROA 3QI2A 3P27A 4TS3A 4EFDA 4I5EA 2WDPA 2IELA 5I5EA 3FR8A 5JAZA 4BO9A 1SXJD 3DA8A 3DDNA 4DXAA 1C7RA 3KTDA 4ARCA 1U0SY 3WHPA 4RKQA 4JBWA 1Z2CA 2WP0A 1G20B 3P2YA 2CXPA 4RK4A 2HGSA 2H59A 1UWVA 2JFYA 1LLCA 2DSNA 2LGJA 4XJVA 4RL6A 4G4GA 4H60A 5INTA 1F12A 1JG6A 3W6ZA 1FFHA 2FPXA 1MVOA 4PG4A 4Q1BA 2WAXA 3IAM6 1RXCA 4YMWA 4AMUA 2IZ0A 1WHTA 1TJ5A 2EL9A 3K94A 3OF2A 4GT1A 4EUNA 5K7SA 4QJIA 3FCEA 4O63O 4OB7A 2BI4A 4X66B 3D0QA 1I4LD 5DI3B 1I7PA 3U3ZA 1NRWA 1UFVA 2J9XB 1U8CB 3JALA 5BQOA 3WLSA 4QXMA 3K09C 3AY0A 5LYJA 1K3TA 1MH1A 4YCMA 3CKYA 4C9BA 1N78A 1SBQA 2VXYA 1D4ZA 4XSGA 1T10A 3PL5A 1ZRMA 3I64A 4HFRA 2WZCA 5A5EA 2VJNA 1DXHA 4F9TA 2XUAA 2W2VA 4RUKA 2OYSA 3GOQA 3HP7A 4OL0A 5AHOA 4AYWA 2QTBA 4R0NA 2JW5A 4C4ZA 5T6BA 4RDCA 3E7DA 1YIOA 1AN9A 1YVDA 1NVKA 4HQRA 4KN8A 4BEWA 3ZW8A 1G7SA 2I1QA 4K1XA 2P69A 4RV4A 2Q1WA 2HQOA 5GJBA 4UVEA 1UP7A 1NF2A 4GGPA 4MKIA 3ZVKA 2IY8A 1PL8A 2NQ2C 2H3HA 2XYRA 2GASA 1DQSA 5BRNA 5ITSA 3PQ6A 2V3CC 1U3TA 2EP8A 4KIJA 5FQNA 4GI2A 3WIUA 3WL5A 3H0CA 1T1JA 3WIDA 3IKJA 4KYVA 1L1RA 3Q3GE 1OZAA 1UXHA 2GN4A 3LH5A 5ALHA 4NOLA 1KOGA 3EBOA 5FBHA 1A04A 3LFHA 4I81A 3Q2KA 2DHCA 4QSHA 2W2LA 3FYCA 4WZZA 3NHPA 3WS7A 1SM4A 3P9KA 2BSQA 2MJLA 1DWOA 2O05A 1KQNA 2RK6A 1CW2B 3MERA 5E4FA 4HEA6 1I8TA 2VHJA 2VTVA 1Y8QB 5ALRA 3IXLA 2P62A 3FGOA 4KUEA 5TMEA 3LVFO 4LNUB 2XADA 2OFOA 1UT8A 2X0JA 5TS2A 3PGKA 1KEZA 2B8WA 3WGZA 4XIFA 4AO8A 4QGBA 4L9SA 1IM8A 4IH4A 3R4CA 1RRMA 1EGHA 3B6JA 1KZHA 3TEFA 4D0NA 4QOHA 1X0VA 4N76A 1HORA 1XWIA 1U4NA 4P35A 4OX9Y 1RYYA 2QAJA 4F2HA 4CM4A 1EDEA 4LA4A 5MGNA 3A7EA 5EXTA 1ECBA 2R5FA 2OD7A 3FDIA 5CBKA 2VC2B 1UMBA 4IIYA 2SICE 4CLRA 4ESVA 4C2UA 1UJ5A 4ZOEA 5ER6A 2WU0A 1PNTA 3SQDA 1T1IA 1XDSA 1YKSA 4DCCA 3LA8A 2FNAA 3G1TA 3U40A 4AM8A 1PQ4A 4BNLA 1GA4A 3EPPA 4C22A 3WK9A 4EW1A 1YS6A 4L16A 4JDUA 2KHZA 2IDMA 1QO0D 1SKAA 1YRQA 2HA7A 2XGSA 1RQXA 4AF7A 3KAQA 2VXBA 4UQOA 1T1SA 3ZHQA 3J81A 1Y5LA 1JHXA 1IN6A 2ZT5A 3BHJA 1VKJA 3O8DA 4P32A 4AJIA 1PSDA 1GFSA 4QEZA 4KR9A 3IOEA 4BNHA 1JG4A 2X1VA 3M9LA 3DZCA 4URXR 2XCRB 4H77A 1SURA 5KSYA 3LY8A 1PWXA 2VK8A 3LQFA 2QTWB 1P4AA 4CM8A 2Z4SA 1L4LA 2BBOA 4FT4A 1N0HA 3PWSA 1DJLA 4EHBA 3FWNA 3GLHE 5B1YA 2K7ZA 1PGQA 2D0IA 4EDFA 2HF7A 2H2HA 3QEBZ 4MSUA 2O1XA 4HZUA 4PO3X 4F6CA 1GPBA 2OLJA 3OE7D 4ND8A 4XPZA 3BFXA 5GOZA 2OFPA 3B13B 2CSUA 3GFSA 2RAFA 2JVKA 1IWBB 2HJVA 3EC1A 3WNQA 4BMDA 5K0CA 4Q9IA 2FSIA 5HGXA 4Q34A 2V1UA 2A9JA 4NQZA 1TIBA 4QEDA 3FYUB 4UJ5A 1TI7A 5FL7A 1F8UA 3FDFA 1J07A 2B35A 4UBOA 1R9NA 1HWYA 2Y27A 1WVIA 2HWWA 3EYAA 3K8YA 5K4AA 4HGYA 1WCYA 4LWOA 2HU8A 4DIBA 2Z2JA 5CG1A 1T4GA 4P7GA 2BTOA 3BIJA 1NLZA 3MCAA 3QW4B 4PYKA 4MDEA 1L4HA 2O0JA 1XIVA 3FDZB 3D59A 2Q6LA 3N9IA 4G0ZA 4J7XA 4W5JA 4LBYA 3HXTA 3D5EA 1QFJA 4IDHA 1I1QB 4AJ4A 2JATA 3KLOA 3ZVRA 2IHNA 4JBNA 4QE3A 1JXMA 1SD2A 1VMEA 1PZMA 3SG0A 3M1IA 5EWMB 2RKOA 2W93A 5BUZA 2VCEA 3IMGA 4JASB 1DFIA 2B5OA 2IXFA 4PYQA 5JJKA 1FCJA 4GLJA 3N76A 1NT4A 3FSEA 5LP1A 3H97A 1AURA 4DUGA 4D92A 1GFWA 3BSYA 3DXYA 1OIVA 3JYPA 4XOIA 3FYDA 4O4LA 3KOXA 3GXBA 3IPLA 5H9VA 4F2PA 1TCBA 2PK3A 1SBCA 3QEOA 2RFLA 5BUSA 4E21A 5LLTA 1Z6YA 1ORDA 3AFNA 3B6KA 2ZWOA 4MVJE 4QOJA 4MV5A 3DLIA 3FJYA 1R6BX 3H5OA 3RGGA 3AY7A 1HKUA 3FOAA 1KEVA 1PZXA 3BGSA 3I0NA 3H5AA 1FXWA 4KYUA 2W37A 4Q47A 2VDVE 3VYRB 2XWBF 4DHEA 1TJ3A 1XDZA 1JA1A 1GGJA 1T3SA 2NVWA 4ED9A 4LY6A 5HMMA 1A9XB 1KOJA 1PG5A 4YUVA 2I4TA 2VSFA 9LDTA 5ILQA 1EMDA 1J24A 2XVAA 3AM4A 4PR3A 2O5EA 5K03A 4U3JA 1QG2A 1NV9A 1SHUX 2GNPA 5EKTA 2RI0A 5H81A 3TFOA 2QIPA 3NTOA 1U0HC 3O6VA 1KMNA 3NYWA 1E5TA 4D3DA 3NUQA 4FDMA 4FEEA 3AI2A 2QPOA 2DPLA 2XW6A 3B5JA 2XMSA 4MQEB 1FNSA 1EQ2A 1QFZA 4XYBA 6ADHA 3EEBA 3DDUA 3DT6A 4WASA 1PV4A 1C4OA 1YZUA 3WJ7A 2I2FA 3F9CA 3I9V6 3G82C 2CMGA 3U49A 4DDWA 1P1FA 3GP8A 3DGFC 3CIFA 4U7DA 1SXJB 4KBGA 1OFUA 1P2UA 1TM7E 4DNOA 2Q7OE 3FM9A 1ZU5A 4C88A 2JHGA 2YVUA 3ORRA 3ST7A 4EYGA 2QLFA 4KQKA 5DNCA 1BE1A 1NVUQ 1Z12A 2B36A 2HJRA 2OVFA 4D42A 4RWZA 3ETDA 1L5YA 5DASA 3MBKA 1YZGA 3B1JA 4F2WA 5DXJA 1I5OA 2OWEA 1KKMA 2PS1A 2M9MA 2V59A 5CNIA 3TOSA 5KJ6A 4TKUA 4F3KA 3T7SA 3JY6A 3DCYA 2ZU0C 3IUNA 2A58A 3QELA 3T1VA 5KJFA 4HB4A 1ZSYA 5A3VA 4JR1A 5IHPA 3EVZA 5BSTA 8MHTA 5CURA 5DTEA 5KX5F 4O33A 4B74A 1WMFA 2N47A 3EIFA 5HDQA 1E2KA 1RFGE 4KQXA 4KUGA 1S7CA 1Z0SA 3M6UA 4UBLA 1DELA 4G2NA 3N0TA 5EESA 3TLKA 2O8BB 1TRKA 4KB5A 3RD5A 1DTSA 3ZV7A 4AJOA 2C96A 3NEJA 4YRLA 4RD1A 1H8EA 1WPQA 5JAMA 5ABPA 5KQLA 2XRZA 4EYEA 3DAPA 3WFJA 4A6EA 3LQ1A 3KEFA 2AQIA 3DDCA 4B2LA 1HE8B 4BC1A 4NFYA 2G9NA 2NTVA 3P9NA 3ZWOA 1ORVA 2EP7A 2GZ2A 4C21A 1F14A 1TUGA 4P58A 2LTAA 2H4WA 3VPHA 1UBTS 1I7SB 2FCRA 3UT5B 4DBVO 1E60A 4DAOA 2OENG 1LBEA 3EWIA 4J0HA 4N7RA 5CYFA 4ZAXA 3MRTA 5JBNA 3HB4X 3VX4A 4C29A 1IN5A 3CRNA 5JNSA 1D2NA 2VHQA 2V6FA 3Q6IA 2CXQA 3RUHA 3I5UA 1BDBA 3CINA 3T5PA 3ZWAA 3DFKA 3PVCA 4L8GA 4PSDA 1B93A 1RT9A 4J29A 4D8WA 1QIDA 1V7PC 1WXIA 4F4UA 3EVTA 4NPHA 4RNCA 2OBXA 4JH0A 4GX0A 2DWOA 3TXAA 5JD4A 1XP8A 2GSDA 4J76A 4NABA 5AQ1A 1Y37A 3EEFA 1Z39A 3NDJA 2YVKA 4M21A 2FWNA 1VCIA 4YMLA 3IP5A 3QEKA 1HEYA 3PHIA 4RO0A 3LKDA 1FYWA 3T7EA 4A0HA 2ANCA 3BM5A 2TYSB 2W2MA 3EFBA 3NHRA 1BSVA 4N18A 1B7GO 3HCAA 1IL0A 1ORIA 1YKFA 3AR4A 1XNHA 3QPUA 4ILKA 4RD3A 3REGA 2OBFA 4U7JA 1ZW1A 3MN1A 1KORA 3V2IA 3AFHA 5CBPA 2UYOA 2YBDA 1H2AS 2J9RA 4MR7A 3C5EA 1QM5A 3S6JA 4RZXA 1R74A 5JFTA 4PFJA 2I7TA 1ADYA 3GJTA 2IIPA 5KAPA 5HSGA 1VL1A 1A3CA 3T54A 2X6TA 3KKPA 1OYWA 5F9HA 5ILGA 5TQ0A 4JJ7A 1P9OA 3C41J 5AFSA 2X5KO 3KYIB 4HYQA 4AN0A 4QOIA 1MCZA 1NUHA 4Y1RB 4FOSA 4H9GA 2ZROA 5L7TA 1VL6A 1JFTA 3AHHA 2P4EA 1A1SA 4LYGA 5JAPA 2V7QA 3DEKA 2B3DA 3CE9A 1U2GC 1NVAA 2Z8XA 4YJ2B 3KT8A 3LG2A 3UJAA 2WNIA 5KKNB 1H4QA 1MRZA 1XXHA 2Y1OA 2G1PA 4X61A 4CEIB 1R16A 3CU5A 2ZB7A 4QDXA 4CTJA 1IY0A 4OSPA 1YR7A 4JIGA 3VPSA 5LKRA 1HGXA 1U2GA 2BFAA 4MCIA 4CTKA 1MG5A 4EMBA 4GYJA 1WMAA 4B4KA 1YA6A 1G66A 4KO3S 1J5PA 1FXSA 2BBTA 2D13A 3OT5A 2O8FA 5HJ5A 1D09A 1NW9B 3E9MA 4YRDA 3Q87B 2JIMA 4UFNA 1XN1A 1NDUA 5G1NA 1JNXX 1SQSA 2N3ZA 3QWHA 3ZDFA 1EFPB 3KHSA 2V1XA 2GT1A 4E6EA 1M8GA 4QFBA 2IOYA 3BJEA 5DHFA 4K1LA 4G81A 1NMYA 3GPDG 2DUWA 2WSIA 1FNBA 5CVVA 3LV8A 2PIDA 4JQCA 4TXNA 1F8FA 3KWLA 5KX5B 5L3SB 4A27A 3KYJB 5F7XA 3DT8A 4Z7NB 1WF3A 1PBTA 4YBZA 1YD7A 2Y1FA 3CVJA 3VUEA 4ZEOA 3ZHRA 3W9UA 3AHCA 4GP9A 4YH1A 3A1EA 1NP7A 2BEWB 3BE6A 2WTXA 1P0FA 2KI5A 3OZFA 1V48A 1VLHA 3U1TA 4YDQA 1T36B 2C4HA 2D62A 2OCAA 4XWOA 2CXRA 2NZWA 3U3XA 2Q2NA 1OX4A 1K9SA 1ZN9A 2JASA 4HWGA 3AHFA 4CKWA 3GBVA 2C31A 3C6QA 1OA1A 4JNCA 1J8DA 1Y1SA 3OE1A 4PHCA 1X7HA 1XZGA 3I8XA 3M7IA 1M9NA 5FNVF 5F1PA 1E2UA 1AC5A 1I4EB 3EVEA 4MJLA 2BEVB 4N0PA 2BE9A 2JZOA 1H2XA 1HKHA 5JBIA 3A32A 1IY2A 2IE0A 2WR8A 3BMNB 4DCOA 4DJDC 4YQYA 4RTPA 3SVLA 3N8KA 1WCWA 2PUBA 2RG7A 4UATA 3LBFA 2GWHA 4KW7A 4YPFA 3UBTA 3ON5A 2CF5A 4EK9A 1MUUA 5CVDA 1JG2A 3CG0A 1VXOA 5F1OA 5BW5A 3EUAA 4Y0AA 3OCZA 1I3NA 5AJUA 1Y5RA 4N3CA 1ZDMA 1EDBA 2GUGA 1T3ZA 3GLIE 3LTEA 4UPEA 3TX2A 3FGPA 2QAGB 1CG6A 2W2QA 2QD4A 3MJ4A 4KITB 1IMOA 4LGMA 5AKEA 4DSZA 1CEXA 1T1EA 1MDBA 2V7PA 1L7BA 4Q9DA 2B0JA 3ITDA 3SM9A 3WRVA 1SOWA 4F6LA 5A3QA 1CY4A 5K0JA 1Z7WA 1U98A 5ECGC 4TZ6A 4IV8A 4E5UA 2EG5A 4ICIA 4FHZA 5HP4A 3L0PA 5AWFC 4FHFA 4ZP1A 1MNQA 3F6YA 3A4TA 2H17A 4NFLA 4RZ2A 4AYTA 4DDKA 1EWRA 1CLEA 1E6KA 1D6JA 3R9XA 4UE3S 2WMNB 7REQA 4WHMA 3PJRA 2JVIA 1XCJA 4PO9A 4TQGA 1GGMA 1ADJA 2ZYHA 4LHSA 4XGIA 1P7PA 2LXNA 1L5LA 4AZSA 1AB6A 1C9NA 2FPGB 2VXCA 3A2MA 3DBLB 4FNOA 3QU5A 4Z4EA 3UMFA 1AKUA 1H1LA 1YCFA 4BNKA 3OQHA 4GVLA 1OREA 3W79A 4TSKA 3SC3A 1PDVA 2OC4A 4FGJA 2JLZA 1RRKA 3TINA 3O8OA 5EERA 1MOQA 4B3SB 3EBLA 4AZ3A 1FQJA 4GSLA 2QZZA 4PG5A 1MNAA 1CULC 1Q7GA 3GJYA 4GLOA 3ODGA 1V41E 1RPTA 2I71A 2CYAA 1U1IA 5EP1A 4GWKA 4JB2A 3BMCA 2WKPA 2NTNA 4CG3A 1E6UA 2Y0BA 3MINB 1UBCA 4IDAA 1TAUA 4B83A 2IJGX 3T9CA 4YQFA 4IF4A 1P62B 2VDJA 3LXXA 3OHSX 4NV1A 4E5DA 1QZUA 3DWGA 4UVHA 4KE6A 5B6JA 1DNPA 1YK0A 2JGFA 2YY6A 2JFGA 5B4UA 3QWIA 1KK1A 2P4HX 4DLUA 4R9NA 4U2DA 2PUAA 3L93A 3DYIA 5JSZB 2R7MA 4GR5A 4JJAA 1GTVA 1MB3A 4WT7A 1D2HA 1WEHA 4HATA 4YUYA 3RASA 1E0SA 5E7MA 1RAFA 2L18A 3OFJA 4H7DA 1EBBA 1Z5PA 2NT4A 2MSEB 2OXRA 2FPPB 1ZCBA 1V25A 3FR7A 3BMQB 1J2UA 3GHHA 4PZEA 2WYHA 3TOZA 3V1TC 5EWJB 2CL0X 3LKVA 2FMHA 1Q1AA 3DPUA 3EF0A 3IEIA 4GMGA 4TUYA 1GKLA 2HL6A 3HR8A 5DW3A 2A4MA 4BQFA 3TG8A 1T5TA 5E38A 2FVYA 2FG6C 5KVSA 1E62A 3OWOA 1UUFA 3B3GA 4XEUA 2WMYA 1JHMA 3U39A 4DG5A 5H4GA 1T4CB 3URMA 4B0PA 1TZCA 3EOAI 3HCRA 2RIRA 2O8CA 2VF5X 3KR1A 2D1SA 4FTWA 1C3OA 4GNRA 4ZO9A 5JSYA 5DNEA 1DKOA 2VHVA 3SVTA 4UE2A 1N6IA 2I4OA 1KJWA 3BFPA 3CPEA 3TTSA 1OLSB 5IH3A 1KVUA 3W7BA 3SZUA 3OVMA 1LGYA 3ZCVA 2WE8A 2PUGA 3FPJA 2QWXA 2CV2A 1PF7E 3Q7RA 3ZDXB 1YZFA 4ZIRB 2V58A 1ZMRA 2AK2A 1XNJA 4IJQA 4CF6A 1W76A 4FW9A 5J4LA 3HSSA 5ECYA 2HRZA 1B23P 2WT9A 3QU2A 4AKEA 1PJLA 4A6XA 1ONSA 1A82A 2ZIWB 4EUFA 4IGFA 4MKRA 3LVQE 2ZSJA 4N5NA 1QFYA 4B6RA 4OXNA 2P35A 2R0QC 2YY7A 1BFUA 1SCAA 2QP9X 1V5GA 3OY7A 1T6NA 2C8JA 4FLEA 4IDEA 4CKBB 2Z58A 4E13A 3N6VA 4AZTA 1N36B 1FFAA 1KJ8A 4E2FA 4YUXA 1HT1E 2NZUG 3LE8A 4N6NA 4C4OA 1SA0B 4WJLA 4BAUA 1SU7A 2GJSA 2R25B 3ESZA 4KQ9A 4MIYA 1KKLA 2QTHA 5T4HA 1TZKA 5BV8A 2HHHB 1BFKA 3N59A 4X6YA 5F3WB 3U9LA 2ZJ6A 3THXB 4U6QA 4E2WA 3EDRA 1C1YA 1CZKA 1CR1A 1KS9A 1P1JA 2HK9A 2XNDA 3P2MA 1DS6A 4M1YA 3HB1A 2I4IA 4JVOA 4YALA 4BWYA 4PW0A 2WU3A 2RK4A 1JZTA 4KZPA 5DWDA 1MQAA 1EX6A 2F4NA 3I1IA 3BXPA 3WWYA 2JHFA 2GKGA 4C6TB 1V6SA 2WAAA 1E1RD 4H6VA 2GILA 1FS5A 1W4ZA 2JBWA 3L7DA 3CW2A 5IUJC 3E8MA 3I1JA 5CVUA 5AW4A 2LE0A 2YMQA 2GVDC 2VH5R 2Z5VA 1LX7A 3ZXUB 3BWYA 3ZIDA 3LSTA 3IJ5A 4MMYB 1R8XA 4KUHA 3TR5A 5MHTA 4HN9A 1ZLXA 2QJRA 4G97A 3WADA 3ZBQA 1A9YA 1CR6A 3C3XA 3BILA 6LDHA 8ABPA 2QQ5A 4Z2AA 3IQGX 4DFDA 2ZJ2A 4K6CA 3HABA 1HDCA 3H11B 3ZJUA 4CGZA 5JRZA 1CSEE 5LR6A 3K8ZA 3DUWA 3LYUA 1AGXA 1KY3A 1MIHA 2DJIA 4X44A 1A7JA 1HF3A 3JRWA 4CFZA 4LVCA 1TEZA 1VL2A 2PZLA 4EJSB 1JDUA 4UHFA 2FW1A 5CJJA 4KDFA 1O03A 1NOIA 5MDHA 4AJ9A 2VYCA 3OAAD 3AQ4A 1AHHA 1B0UA 1GTRA 1E2BA 5THQA 2DERA 3S8MA 3AVPA 3KZ1E 4ITUA 1VE9A 2RKBA 1CZOA 3H2JA 1E2JA 1BXGB 2JARA 3SZLA 4II2A 4O02B 4P0QB 4FE7A 1O0SA 3DW3X 1TZJA 2GF0A 3CUYA 4LZLA 4XOUA 4EATA 1I1NA 1LQTA 2QJOA 2AXQA 3CNBA 4OFBA 4Y9UA 3MOGA 5LUBA 5LZ7A 4KSYA 5AUOB 3Q8MA 3ZDDA 4UTPA 3TZCA 1PS9A 4B6SA 2XRFA 3HCPA 2OOSA 4FINA 4M60A 1QQBA 3O03A 3J80A 1AQYA 3WQHA 3KOYA 3FTPA 2GFIA 4YACA 2Q0SA 4WX2B 2P3QA 3HKDA 1IK6A 2VLBA 3ZI0A 1NJ8A 3GUUA 2QXTA 3GJ6A 5E6UA 3UZUA 4E2YA 3SF0A 4B2YA 1USWA 1NHGA 1I0ZA 1OXXK 2VAXA 3NC4A 4WEOA 5HJEA 1CS4C 2CJXA 3KJGA 4ETWA 2WP8J 3CQ9A 4YPVA 2QQEA 4UM7A 4AFNA 2QI9F 1H05A 2DAPA 3OBIA 2PSDA 1R0ZA 1P4GA 2RKWA 3IEKA 3ICPA 4P4UA 2ZIXA 5DNWA 1AMOA 2BV3A 4FFBA 4RY2A 3ZWMA 1NL3A 1VIVA 3C8DA 3K0AB 4ZJZA 3LY9A 2CY0A 2NU6A 3EZGA 4CIVA 2CFSA 4OTZA 5L51A 1BIFA 5DJ5A 4CTMA 4TV9B 1C30B 1DKRA 1FE8A 1KZ6A 3WQSB 2DPMA 3QWFA 1JDJA 3R1IA 5C31A 5HXAA 3SQWA 2CNNA 3AOEA 5T67A 2WINI 4PAMA 4TKMA 4XDZA 1P5RA 1VLQA 1Y80A 2Y4OA 2HO5A 4Z3OA 4ZCLA 2JA2A 4E4TA 4RF4A 5L7YA 3Q7IA 1U6JA 4RVNA 3N2LA 5I7OA 3RBAA 3L7JA 2G1JA 3ISVA 4PIVA 1Z25A 1JG1A 1ZIDA 3GCWA 3B51X 1U5CA 4RWEA 1E4VA 3OX2A 3QNMA 4HWPA 3C43A 2WJJA 3ZOKA 5BR4A 2NUTB 1ILEA 3AIOA 5IYZA 3L8MA 4IFIA 2KWIA 5FA5A 1PR1A 4AN4A 1HSZA 2PXCA 4NYIQ 1SFRA 3IRVA 3V4ZA 1NFQA 4X1OA 3STWA 2JGIA 3QJGA 5CX1B 4F72A 2OM2A 2Y1CA 3M0EA 4OHZA 2QVXX 1P1RA 3L4SO 1PBNA 3AR2A 3L77A 4OXKA 1QUFA 1PGPA 1JI3A 1IHUA 3S2GA 4DA6A 2FDCA 3CN9A 2NPIA 3INYA 5IDQA 1NUUA 1G60A 3THYA 3BICA 1OSNA 3B82A 4J6FA 4JUFA 3I0MA 1Z75A 1XCBA 2VL7A 1KY4A 3SYMA 5KCMA 2H29A 2IXGA 2XNKA 4QRIA 3BZBA 3UJ6A 5JI2E 4PVCA 1CYDA 4J91A 3DZIA 4QG3A 1R9MA 2JJMA 3WGVA 5A5DA 5AKGA 3F7OA 3RR2A 5HKKA 3QUCA 2EQBA 2NYRA 2WHPB 5DLDA 3TTXA 4EFKA 1CY8A 4KH0A 4O08A 4B6PA 3WFZA 4L5IA 2FK8A 3DOHA 3H2IA 4EPWA 4FYIA 2ZJ4A 4DY6A 4ZICA 2AOTA 3ANYB 4X85A 5CYPA 3PNSA 1QBKC 1MD9A 3CJTA 3WYFA 2NVUA 3FKJA 1W0JD 3AUYA 5TMBA 1JHUA 7YASA 3QKWA 3CF0A 3PYXA 3UJ7A 5FX2A 1RLTA 1SUBA 3OX4A 4JENA 4K81B 4FGLA 1XZIA 1EUYA 5GIOE 3D8RA 3KSRA 3L0IB 4H3HB 4M8NE 2GR9A 1JEYB 1JE0A 1M2OB 1R9GA 2Q3BA 2VJCA 3LQ2A 4CCSA 2Z2ZA 4EARA 1PV2A 4NZYA 4Y0NA 4BNGA 4YRRA 3U3DA 3V1MA 3C2QA 3C6YA 3GPLA 5BMOA 3OQBA 4S1WA 4E4RA 3RKSA 3PPYA 2V7EA 3RYIB 4Z3DA 2A9PA 2W70A 4K6GA 5F7ZA 5E6RA 3DZBA 4RGQA 4B4UA 5T8KC 5CYOA 1EJBA 2OL4A 5EXXA 5FR2A 3TCXB 1S3SA 4BL5A 4JC8A 1NHWA 1CR0A 1OU4A 3CZQA 3DS8A 1AM4D 3GT3A 4JT9A 3KWJA 4JJZA 2WD7B 4QOFA 4RJJA 1A9SA 1AK1A 1BMQA 3FKSA 4JXKA 1AUXA 1XTBA 4A6PA 3AUFA 3OLXA 4IDBA 2IEIA 3VU0A 2VNKA 3GFGA 4P53A 4YRJA 5GP1A 1COWA 3X43A 4HZIA 1IXYA 2R8PA 4DIUA 2O7VA 2PTHA 721PA 2YMLA 1CNMA 4M46A 3DO8A 4C4YA 4HQOA 2IX9A 2PX4A 5CIQA 1VRWA 2HJWA 1Y48E 1ZH8A 2QNBA 3ZKWA 4NU8X 1YRBA 4Y6SA 2H7VA 4BN4A 1FJXA 2E1PA 2QLBA 2PYIA 4O0LA 3OA0A 4GBED 4E4YA 3CWQA 4ZYYA 4KPYA 2SKDA 3ZDZB 2IYWA 2QE7D 4UM9B 4ZZ1A 1XAHA 2FMXA 2ZJ5A 3F74A 3D5TA 5GAJA 1EK5A 5AVXA 1JT9A 4Q16A 3CXUA 3I5AA 1UR5A 3QG1A 1LPNA 3RSLA 2IGBA 4E30A 3L8DA 3FPKA 3SQNA 1JIKA 3GXOA 5E4TA 4MARA 5C3MA 3UWMA 1FVFA 2AHRA 3L2OB 2BVNA 4L0MA 4LF6B 2O8EB 3K1AB 4KLCA 1QB8A 3RUEA 3E81A 3FGNA 1E6MA 4U9UA 1KDYA 3W05A 3PWTA 4ZI2A 5JSQA 3O4IA 4KQHA 4FGUA 1AQIA 3EGDB 1CY1A 4NX2A 2IYSA 4TTJA 5BSKA 1JG7A 4CQMD 5KDDA 3RLFA 3IUQA 3T0GA 4G3XA 1P6UA 2XZPA 3IEPA 1GDHA 1EGMB 2VHYA 4JI4B 4LRQA 1H4TA 3DE0X 2I3GA 3O8QA 3HNOA 2C2MA 1JDVA 3H5IA 3CUEF 2OMEA 4G5YA 4NPAA 1DIOB 4WSOA 4R7GA 3QH4A 1NU8A 2VYFA 2FMKA 3E22B 5EFZA 3RRNA 4D5GA 4GE3A 4NY1A 4E7OA 2VZ9A 2GZDA 2GPBA 5A7GA 5J4VA 2GN2A 2KLHA 4OHWA 2FN9A 2JHPA 1XVVA 4TRNA 4WBXC 2OXFA 4NCKA 4WECA 2RH9B 4PQEA 1XU9A 1JN0A 2GXQA 3QMWA 3W5BA 1ZS9A 2YHIA 1ADCA 3KOOA 2GPAA 3C6ZA 3QWAA 2VF4X 1QLWA 3WK5A 1UK7A 2V6IA 2XQFA 1VA5A 4Z9FA 4X0EA 1H1TA 1PN3A 2NYUA 2CFOA 1XU4A 3LWBA 2A33A 2CJPA 3WDMA 5FT9A 3RV3A 1T8SA 2W2PA 4HYTA 4M98A 4B6FA 3IDFA 3TZ6A 4Q1DA 2YYSA 3OQMA 4OGFA 4QPCA 1TD1A 3AJ8A 1RXIA 3LUJA 1RFLA 4BBPA 3DM9B 1FBNA 4TLAA 4JR2A 1ZUHA 4ZD6A 4DILA 4N8EA 3CZAA 2PWPA 3RVSA 3BA6A 5FPTA 1FYDA 3U17A 3U7EB 1BG6A 4PX9A 1RLUA 1RYNA 2GPJA 1CETA 3K9LA 4QGFA 4QGAA 2CL7X 4AZVA 2SHKA 1CJMA 1XLWA 1KSFX 2B7LA 2WYWA 5IAKA 1JQKA 2K7FA 2D7DA 1Z4IA 4EPTA 1DG1G 2ZAYA 3EYWA 3PPXA 5FADA 3QKRA 3DLHA 2E5FA 4Q6WA 1YNSA 1VCHA 2FW9A 2Z43A 1K9VF 2PRIA 3TOVA 1IN1A 2Q5FA 5K8IA 2AZDA 5DSZA 4G0OA 4Z53A 2EIHA 3KAKA 4YP0A 4C4RA 3UMYA 3TZQA 1GVNB 5EHGA 4JROA 4D0RA 3IGFA 3X1ZA 4UDOA 5IM4F 1MABB 3PGJA 2HIMA 1Z6PA 4RTNA 4DA4A 1J4AA 5K99A 1DJPA 1MHPA 2E82A 5JNTA 1GD1O 5CT5A 3OU7A 3C7DB 1IQRA 1XRRA 2BTQB 2Q3DA 3CEAA 4R2MA 3GLGA 3U80A 2NW6A 1EGQA 3IUMA 3FMIA 3OOEA 2XLCA 2KBFA 4QQFA 1FNDA 1NMQA 1P1BA 1K7EB 3QE3A 4RTSA 4DV0B 4CG2A 3UFXA 4LE1A 1Z29A 3M5WA 4MGKR 1PR0A 1Q11A 4QBTA 3P20A 2A5LA 3PQ3A 4R9VA 4D44A 4D6YA 1QCYA 2DPHA 5TGDA 5BNIA 2D1YA 1BMTA 4G0NA 2NQ8A 3F96A 2BONA 1KZYC 1W48A 2DHQA 4LNHA 1QORA 2I3ZA 4LV5B 1K66A 2XQKA 4PGAA 1P0MA 1E4OA 3BQ9A 2PKCA 1DBRA 3KL4A 5D6OA 1WTCA 2FQXA 4U8GA 5E8JA 1QIIA 1R0LA 1VRVA 3AFMA 4I4TA 3ZCRA 4BFZA 3AI7A 4CKXA 5DSTA 3JPYA 2C2XA 2ODEA 3UC9A 3S2IA 3AXSA 5CK4A 3DJFA 3ZV4A 4EY5A 2JIRA 2AJ8A 1Z6TA 3LDFA 2CB9A 1VA4A 4WL0A 4F4JA 2DE0X 2GCOA 2NUBA 4C0KA 2XA2A 2BTEA 1EFRA 4X95A 2W6MA 1YI8A 2BSXA 1O4VA 1WXHA 1YOBA 2C98A 1NI4B 2UZ1B 2WFZA 4ZCMA 1J0CA 1H8HA 1BDHA 5THKA 1ZUNB 4W6QA 3W34A 2GRUA 3WLJA 1KARA 5SY9A 4LQLA 4EKGA 3UCFA 4MA4A 4CM1A 5AI8A 1E5VA 3E23A 3NONA 1MOSA 1RCFA 3QVLA 4FZ3A 5ER9A 3SXUA 3SZMA 5IC4A 1VCNA 3N74A 5C5EA 4IL5A 3O9VA 1J5EB 3RS3A 3OPMA 4TZKA 4DOMA 5HIAA 1M1YE 2WYVA 2DB3A 3AVXA 1L6IA 4CMEA 2PRZA 2HIGA 3AP3A 1LI5A 2C9OA 1U0RA 2FMUA 4QTZA 3QNWA 3KIPA 4PVDA 3LT4A 5FBWB 4RPKA 1DL5A 1OFUX 3D54D 3M6FA 3OZGA 2ADMA 5I8ZA 2HOQA 5DHTA 3VSEA 2QMUA 4LDRA 5FO0A 3C1TA 3SOZA 1RHQA 3LC1O 4MV1A 2QLJA 1QSGA 1AKWA 4MS4B 4A8HA 1VE1A 3Q6MA 4OAPA 1G1MA 1RACA 3RRFA 4ECAA 3GJRA 4P2GA 2JK1A 3LM8A 3J7TA 2A86A 3BGWA 1TK3A 4ZYTA 3IP7A 2I7DA 2JGNA 1QG4A 2V7VA 2J3KA 4I9FA 4XWGA 1C4KA 4BLSA 3EDMA 4FFWA 2DT8A 2OXIA 2QSUA 4G23A 1F4VA 3RC3A 4BQPA 1EFDN 4JL8A 5DHPA 3H3JA 4AJ2A 3LS2A 1TKRA 2OBYA 2VUTA 3ZZMA 4EBBA 3WAGA 2JCBA 3Q41A 2CBGA 2G88A 5H70A 4E5KA 1L4UA 2XWPA 1OUMA 3G9ZA 3Q2OA 4YCDA 4K9DA 5ENDA 3TN7A 2BF4A 3LNTA 1PNVA 1RCUA 4MWCA 5FUYA 4TTVA 3K6SA 1P5FA 2Y1LA 4ZALA 3FZEA 3BXGA 1C0EA 3RROA 4OFZA 1SCJA 1N6KA 2HK7A 1RAHA 2MSLA 1BHO1 2B20A 4TKLA 4DNPA 4UTVA 1XMXA 3FSGD 1N0VC 4H7IA 4ZOCA 2GXAA 1RS0A 4ND4A 4KR2A 1VLZA 1UIMA 2G70A 3ZU5A 4M3NA 4UASA 1YA4A 5EE5B 2A8YA 5A6SA 2CWWA 2QN8A 2EFYA 3D1VA 1YBFA 3LNCA 1G64A 1N6LA 1E92A 1ADGA 3O4RA 4MP6A 4RPCA 5DK4A 3PWKA 3UA3A 1DV2A 3K2IA 5LWHA 4DXDA 3U81A 1X77A 1K7CA 3OU6A 4YCJA 4DBLE 3D4PA 5LYYA 4M99A 4R05A 4ZDIA 5K5EA 3KHUA 4V3CA 4IHKA 5CB6A 5JH7B 1L1EA 3LBAA 4YJFB 3MJVA 1FSSA 2HQSA 3PNKA 3CPHA 1TQ8A 3THRA 1T24A 2GJAA 3BGVA 4BBAA 1BWQA 3MELA 4H59A 2QL6A 3A4YA 1O95A 1UK8A 1TCCA 4QARA 1LDNA 2I99A 3J7AC 5CLIA 3ZCSA 5LZ8A 4WDQA 3V55A 1Q0ZA 1KJJA 1UKZA 3WR5A 1F2DA 1BXKA 3MW8A 3PJEA 3TMKA 2Q21A 3JARA 3KZMA 2E1RA 1RC8A 1L3IA 3MQFA 3OECA 4WXMA 4M37A 4OV6B 5CIWA 4DVGA 5JC1A 2YX1A 2Z1DA 2EFJA 3CCFA 4G4SO 4NECA 3RIXA 3UB4A 5NULA 3WZLA 3E9NA 4YRKA 1M8JA 4S2EA 5K2OA 2W6IA 3DKIA 3ZVLA 4ABYA 4Q3BA 1QVAA 1YT5A 4QLOA 5LBUA 1WB6A 1XVIA 1WQ4A 3BSSA 5ALWA 4PHGA 1UBRS 2V0CA 1ORHA 3CXRA 5CDFA 4DIMA 1JFFB 1I2BA 1Q1QA 1X74A 2J5KA 2OILA 2YJ4A 4JL5A 1ZD3A 4J43A 2PVCA 3BE5A 2MYTA 2VUUA 4UUAA 3S4YA 1N5DA 1SELA 2ZU6A 1HL7A 3PPIA 3GG9A 3AW8A 4HDMB 3S1LA 1MVLA 2RJ3A 2PFKA 2CZQA 2PL5A 2OR3A 3WJ1A 4ZCTA 1W30A 2V96A 3WXMA 4DPKA 3ND5A 1NXQA 3SBOA 3TI7A 4E09A 5KNDA 4ZDJA 1QFMA 2AQ8A 3MGBA 3ECCA 1J7JA 1MEEA 2WU8A 1X8KA 3GAAA 2AG5A 1A8UA 1KOFA 1UBKS 1YS1X 1HFWA 4Z9AA 4H0FA 3ZIAD 4YY3B 4DR2B 5L40A 4P33A 3BWDD 3CX8A 3TPZA 1VLLA 1W5SA 4N48A 3DEJA 3D5QA 4ER5A 1MAAA 4FMDF 4R5HA 4ASUD 3WL3A 4HNUA 4R40A 2QMHA 4ROSA 4UBKA 5JAUA 3GFVA 2RDMA 4RD0A 1Y4DE 1L5WA 2GHRA 3EODA 3P2KA 1FP7A 3LZ6A 1KC1A 4HFMA 3BT7A 3W5JA 1U5BA 1PW5A 3JZIA 2BP7A 2QN3A 5B2ZA 4UVIA 2VT7A 1QDEA 4HADA 1E0KA 1MJHA 4A5OA 2NM0A 1VKOA 5IEBA 2AG0A 3WIVA 1U9JA 1RZVA 3E7FA 3ZQKA 5A2QA 1E7SA 3EGOA 4C0QC 3HLTA 1XVLA 1P60A 2PCLA 1G8FA 5ALMA 4AS1A 4M83A 3FUUA 2AVNA 4BFWA 3TNJA 1G59A 5HKLA 1Q57A 3N8NA 1F2VA 1HOTA 5AM5A 1LXCA 2AXEA 3HFSA 2RGBA 3DTVD 3HB9A 3BE8A 1YZKA 2ZS7A 3THSA 4D9BA 2OE2A 2A3NA 2Q49A 3V8RA 1Q1GA 2UYCA 1A9ZA 2B4QA 2YVAA 1DAIA 1X80B 4B7ZA 2FWRA 5TSDA 3HHEA 5KNCD 2ZUCA 4LK3A 1RLIA 2HJ9A 4IOJA 4ECEA 3AVWA 1V9CA 5EE9A 4E2ZA 1U8UA 2JA1A 5EXDA 1N2GA 2RB5A 4PLFA 4OK6A 5AP9A 3INRA 2EHJA 4A15A 3VSAA 3ABZA 3D4IA 4HRVA 1ZWKA 3E58A 1L5RA 1RYMA 1UPFA 1QO7A 1ISSA 2YASA 2G40A 2NLOA 3G8YA 1G8PA 1T9BA 1ONNA 2FN4A 2ZAIA 4LSGA 1Q22A 3Q6NA 3PRHA 4CM5A 4MV3A 2PGJA 5FBQB 1GG2A 3QLEA 4R98A 4RIHA 4KIWA 4EFLA 1YC5A 2J3QA 1BYUA 3DOIA 2VJAA 3EMVA 3NLLA 4IWXA 4PS0A 4PBTA 2EDCA 4UNQA 5I9SA 3VKFA 2G80A 2IBSA 2WHQA 2E4ZA 2VQFB 4KVAA 3KB6A 2IX3A 4EFMA 2NXCA 1V8OA 3M9WA 4KV7A 1A5SB 1DUVG 4MAMA 1PI3A 2PAAA 4KBYA 1X8XA 3O2JA 3SSNA 4HGOA 3ZGVA 1ZH6A 1GGFA 5CDTA 4CL8A 1TLLA 1XLUA 1E98A 4LDAA 1SZCA 2BFPA 4XGKA 3U44A 1RAAA 1BQ3A 2R65A 4DM7A 1TVCA 1DSSG 2ACVA 2G0AA 2FWJA 4J75A 4EWLA 4EHIA 2VPQA 1XB2A 3EW9A 4UEJA 1NM5C 3HM2A 3VR3A 4YRZA 1SPBS 4R9RA 3GRZA 3A3KA 4B43A 1HZZA 1JL3A 1K5HA 5IABA 4EGSA 3E3MA 4X62B 1W0KA 2DG2A 2FSPA 3KQTA 3MBIA 4HH4A 5E8RA 2EJWA 4ABTA 4M0CA 3RS5A 1M1YB 4UD6A 1CJBA 1O9HA 2OWDA 2WW8A 5FTMA 3TEJA 4YHBA 4AJLA 4X65B 1UKVY 1E89A 1I51A 3P97A 3C5CA 2HWKA 3RAGA 4NU5A 1J0DA 1E1QD 2X7HA 4EVRA 4QJ4A 2AKEA 4E5YA 3FCYA 5DH9A 1PD0A 1YJXA 1Z4OA 2LD4A 2PZJA 3VBCA 1N8KA 4KWHA 1EHYA 3IVAA 5JROA 2P6UA 1K7YA 3N0XA 4ZK6A 1ZIYA 2V0GA 1NNUA 1NN5A 1UXIA 2NTYC 2XRYA 3LHKA 5JV5A 1FSPA 3RWMB 4XM1A 4B3XA 5EZ6B 4ZT7A 5B2FA 2B8NA 4BZPA 4C5AA 4INAA 3EXFB 2X4LA 3EMDA 1DIBA 2C54A 3CA8A 1WX1A 3N0WA 3O92A 5TQVA 4FMDB 2IV7A 1U7HA 3VTFA 4LYDA 1E1KA 5IULC 2Y9PB <