3O91A

High resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
189
structure length
188
Chain Sequence
TKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDCFHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRERRVSTVILTGVLTDIVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAKLVDENLNELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nicotinamidase
publication title High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition by aldehydes .
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 70
structure length 188
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3o91A00
3TG2A 4L08A 2B34A 1NF9A 3S2SA 1IM5A 1X9GA 3O94A 3O92A 4WGFA 1ILWA 3LQYA 1XN4A 1NF8A 1J2RA 1NBAA 2H0RA 3O93A 2WTAA 2FQ1A 3OQPA 1YACA 3R2JA 3IRVA 3UAOA 3EEFA 4H17A 3O91A 1YZVA 3KL2A 3TB4A 3MCWA 4L07A 3HU5A 4WH0A 3R77A 3HB7A 3PL1A 3O90A 3TXYA 3OT4A 2WT9A 3V8EA 2A67A
chains in the Genus database with same CATH superfamily
3QPUA 2PL9A 4UASA 1Z6TA 1QX4A 2EERA 1E4VA 3OIFA 2NU6A 4I9GA 4W99A 3JD2A 4FLEA 3F4KA 4LJ9A 3HO1A 1HYQA 4IIUA 1QRSA 3S5UA 3SWWA 2QSZA 1W8DA 2X7XA 3QBEA 3MW8A 3WI7A 1GN8A 4OOEA 3PD1A 4LNAA 4OCZA 5DJ5A 4AKEA 4G5GA 4K1XA 4PICA 2A0UA 3TGLA 2IIBA 3P9QA 2BEJA 5TARA 3DDSA 3RS0A 4MQ4A 4AT1A 2ILVA 2IYRA 3D0OA 3OZDA 2JI4A 4PHHA 3R9IA 5AK0A 1DOZA 3UK1A 3KQSA 3UT0A 2E21A 3VU9A 1TPZA 1SOVA 4J0FA 2ZITA 3EFEA 3HJNA 4L4ZA 3AM5A 3IDQA 5C7YA 1A8SA 4B8ZA 4AF8A 3EHDA 3FVQA 4LK2A 4YO7A 2QAIA 3SKVA 2QVXX 4QTXA 2C7PA 2AFHA 2G6BA 3BEOA 4Q82A 2BGJA 3ETCA 5G53C 4JN6B 4R9NA 2YQZA 4FGWA 1K1EA 3JALA 4PC2A 4ROSA 4PNHA 2ACVA 1BJKA 3G7NA 4TXJA 2ATVA 3FHOA 1ZUD1 4YI3A 3AZOA 5G1OA 1PFWA 4YRBA 1RHKA 5H4HA 4FC6A 3A1DA 4RKEA 5I7OA 4LK3A 3TEMA 1ADFA 1PWXA 3ADPA 1IXYA 1X6VA 2FKNA 1A2KC 2DQ4A 1ZAKA 2BFEA 4P5PA 2ZQ5A 3OF3A 4B17A 1AZSC 3LQKA 2NV2B 5K3SA 1CUBA 2WWXA 4PO9A 4XLLA 2HTEA 5IXJA 3K4HA 3T1NA 3GJSA 1YBVA 3NUQA 1ZL2A 4JODA 1DKNA 1NUTA 3D6HA 3C6MA 4I1OA 3MWLA 3Q5EA 1NAIA 3H1BA 2PCLA 1KI8A 3KQQA 2AXQA 4EP1A 2Z5FA 1NOIA 3QVUA 3GVXA 2ZRPA 4RPIA 4TS3A 5I6DA 4AJ4A 5HIAA 1ULAA 3AEQA 3E0XA 1XLTA 2IITA 1NHGA 4FFWA 1CVIA 1I6LA 3T4XA 1T8WA 1BGWA 4HWTA 3GJ6A 2CMDA 2KLBA 5CB0A 2YHBA 4QDZA 1JHRA 2PH7A 3HBFA 5FD8A 2Q9AA 4OL0A 5LA6A 3TQRA 4BN4A 5EJ5A 2XQJA 3T3HA 1Z68A 1DNPA 4JGGA 1VGQA 4CKCB 5LKRA 5A6SA 3QU7A 5HF6A 3IOYA 3NQ41 4NHEA 1RFLA 2VXBA 4GLBA 2BJHA 2H07A 2NSHA 3FWYA 1N1EA 2WFLB 2FDRA 1ORVA 2O57A 3V3KA 3GT7A 3Q2IA 4RMJA 3W6NA 1NF9A 1YI1A 4BEJA 1T2EA 2HTFA 3CKYA 2FZKA 3MUEA 5EZQA 3FPKA 1JFVA 4JP5A 3DO8A 2O8DB 2TMKA 2AXEA 3AM4A 4AI6A 1Z34A 1UBGA 1JLKA 3BIXA 2Q46A 1D0SA 1ZYUA 2DT8A 2FUEA 3C3KA 3BKWA 2FLVA 4K6HA 1FJ2A 1AVTA 1I2BA 4P08A 1NJSA 2QTBA 1HNZB 2R00A 3EQ7A 5AP9A 3WIBA 1UPCA 1YIAA 1TVKB 3KTFA 3KD3A 3RVJA 3TN7A 1KYWA 1XDZA 2ZGVA 1RQ2A 3L0ZA 5KQGA 1D2EA 1YJ5A 3H2HA 4ZVVA 3D7NA 3U4QA 1OLXA 2V74B 4J76A 3P27A 2YNMA 5JNRA 3TECE 3MTAA 3C4JA 5FADA 5DM1A 3E7FA 4BCBA 1D8AA 3HYLA 3LS2A 1QYWA 2B21A 2ZE8A 4XQ0A 3FHLA 3G2LA 3TINA 4MLZA 5T41A 3BWBA 2ZJ1A 3IV6A 3O1IC 4L6IA 1T91A 1WZIA 1ZH8A 4JNKA 5DTRA 3WFZA 4BPRA 5LQNA 1F17A 2NYAA 2AUTA 4JYCA 2CXHA 2UZ3A 1DFHA 1WA5A 1R5JA 2EIXA 2YWJA 3FUUA 1OYOA 2QG4A 4GQAA 1IIBA 1ZK3A 4IWXA 4RY2A 2ZI5A 1G9TA 1O96B 2FV8A 1X7YB 2KBFA 1KE2A 2PD3A 1O89A 1PT8A 1VBFA 1NJ6A 1YI8A 2D0DA 2XF2A 2XUFA 5HZMA 3UGJA 3SP1A 3ZX4A 2OE2A 4S1NA 3WJ1A 1XMSA 2VDMB 3C1TA 7ABPA 1K97A 1OIWA 2OVBA 4AJOA 4GT1A 2HSDA 3NHFA 4KJXA 1KI3A 2YWHA 2ZBRA 1EXWA 3IB6A 3ZHBA 5AW0A 5MN5A 1DRKA 1F8YA 3TRIA 4CEIA 1PR4A 3OPXA 3SIXA 3ON5A 3PTAA 3A58B 1NTRA 3NG1A 2XVZA 2ZIUB 2BM8A 1GCIA 2W22A 3QI7A 4LHXA 2IHZA 5T6MA 1CV2A 3RAFC 4BV2A 3AFHA 2ZUEA 4BMSA 2HK9A 1OWMA 5ELMA 1SC3A 1TAGA 2R2AA 1GPAA 4FYIA 3TQHA 4EQ6B 1BZYA 1IOLA 3MXOA 3PXDA 3MTBA 4KQIA 1KOLA 3HMKA 3F9CA 1DAFA 3LWDA 3W5JA 1C14A 1SQ6A 1XTIA 3AI1A 5TLSA 2VIIA 4G23A 1SG0A 4DCCA 2XEXA 4G9BA 4X8LA 2JEOA 3M3DA 4I55F 4GHWA 2CL0X 5JNUA 4PLWA 3D8RA 3WLTA 1KQ3A 3N8HA 3I9KA 4UTXA 1PYGA 2WMYA 2IYWA 1ENOA 1IHPA 2J3EA 3FYTA 3RV3A 1T0JB 4L73A 3SBEA 2YY5A 3EDMA 3I9V1 1ZVVA 3DE6X 2C04A 2R48A 4DADA 4TRMA 5H3HA 1LVUA 2FUCA 3GRKA 3CYFA 5ECYA 1G7CA 1F8GA 4US1R 3HNPA 4QOFA 4BQFA 4JP2A 3D6VA 2UZ1B 2F1HA 2XMZA 2XYGA 1RC8A 4TLAA 1VA5A 3EF3A 1R50A 5K3FA 3E22B 1DKOA 3DYVA 4ARUA 3VH3A 2VK2A 4ZVLA 1M5TA 1NPTO 3NNDA 3EVGA 4E4RA 2AKEA 3LBFA 4RKFA 4S24A 5J4VA 3P9ZA 2DRIA 2PGNA 2RB5A 4G8JA 1TB4A 3WDKA 1BS1A 3EUEA 4DR6B 3I04M 2QTLA 3IUMA 4LHVA 3A6JA 1Y80A 3G9QA 3HXLA 2UYQA 3GFBA 3WLPA 4HRAA 4FYPA 3KZCA 1W52X 1VCIA 2ZSKA 3OY7A 1D6MA 1GU0A 1HMYA 4LBZA 4B43A 3GNLA 4R2IA 3W2TA 1JJFA 4ZDJA 3IL2A 2D1FA 4AKIA 1BW9B 4FE7A 1YZTA 3EIEA 1J2TA 5CHEA 3OUTA 3BJEA 5DW0A 3G1TA 2COEA 3VJMA 4NBKA 3C3JA 3RS5A 4CHTA 4FS8A 2AX3A 4C0XA 4C4OA 3EXEA 1Z22A 5M34A 1R0CA 2HNKA 2PX0A 3D7LA 4URYR 3IUJA 4ZC8A 2XJ9A 3RE1A 1XZLA 1L1EA 3HKEA 2BHRA 4EVSA 3CRVA 2GK3A 2A94A 4DLAA 1RHMA 5JCXA 2WG0A 3WNBA 3PF9A 3DAPA 3JVVA 4BZPA 1MC8A 2GCOA 1A27A 1ZMRA 3A9VA 1GQQA 4IIBA 4NYJQ 3SZUA 2X40A 3KZ1E 4L3WA 4TWRA 3E81A 1H2HA 2PVCA 3NM6B 4AS3A 2IK8A 1E92A 1FK8A 1XZIA 3ITDA 5ECGC 5HEKA 2FPIA 4ZJPA 2GAIA 3IHWA 5DN9A 5F3WB 2EZ8A 1W94A 3OQVA 4KRFA 3D64A 2AMJA 1E8MA 2A0XA 2D13A 3F7MA 5HJ2A 2XRFA 3N6RA 3UAXA 1IVYA 4BAGA 2H9AA 1EUDB 4DM4A 4ETNA 2QUJA 3DDHA 1P80A 1AKTA 3WA6A 1T3TA 3BUSA 4ZCRA 4WSOA 3D8HA 3T9CA 3RYCA 4G5SA 2HHHB 3A6GA 3PTZA 5C4GB 2V65A 3ZS9A 4LDNA 4CYMA 4UM9D 4PN7A 1A4IA 2YC2C 3A70A 5HHTA 2X1VA 5H81A 4WJKB 2F8TA 1GTVA 5CAEB 1XC7A 2G17A 3U7GA 1EK1A 1IG3A 1K6IA 3VGJA 2PSEA 3V4SA 4MVJD 1IOZA 2WW8A 3R9WA 3WK4A 3WK7A 1DLIA 3B9QA 3K0HA 3KR1A 4ND6A 1R8XA 3SSOA 5EIFA 1VE9A 4K9NA 5HE9A 2V0GA 1IJEA 1KAOA 1PZFA 3WNDA 1L5KA 1Y1LA 3ZZMA 2APJA 2QJOA 4Y0VA 2WMDA 1JI0A 2H1IA 1XHLA 4FDVA 4ID9A 3TFQA 3UANA 3ZCQA 4DQVA 2BZ0A 4AMVA 4YAKA 3OT4A 2B4TO 1OXSC 4RV4A 1K8YB 3H87A 1QFYA 4DQKA 2DFPA 2VJKA 3LQQA 2ZYGA 3KJQA 1KEWA 3UW3A 2ZJ7A 3BB3A 3M33A 2BEWB 2FR8A 4HN4B 1KI4A 4KI7A 1F1JA 5FJJA 4I6GA 2IP1A 3GX1A 3QXCA 4QTYA 4FZRA 2FJUA 5AW5A 1QYIA 1MA0A 3OFVA 2A0YA 3Q5GA 5EEGA 1N3YA 3VHRA 1KYQA 1MAHA 1TD1A 4KMOA 3ZK8A 4YVFA 5BV0A 2QN2A 4RS4A 2PGDA 1L7XA 3VPAA 1U65A 5HSGA 3T1HB 2H7CA 5FWNA 3UJNA 2AOTB 3FZYA 2GBCA 1G8MA 1SXJB 4Z9XA 3WK5A 2OQRA 1Y6GA 5KVQA 2H5EA 3VSDA 4TV9B 6YASA 4GUDA 3UG7A 4ABYA 3FKJA 3RUEA 4UATA 1R4MB 1IN1A 1QZUA 1UMBB 3AHCA 2HA2A 3HFGA 3ZY6A 2JS7A 3I45A 4OJQA 5JRDS 1RXCA 1R0YA 5JASA 2HXGA 1F8FA 1Z13A 5DTQA 3AERB 1ZUIA 2ACEA 3HKBB 3T9EA 3WFJA 1U28C 1CK4A 1D0IA 5ITWA 1WPQA 1HE5A 1BKSB 1GQYA 1LPNA 1NWHA 2A7XA 1J0CA 1NR7A 2I91A 1I3OA 3F5SA 5JCJA 5IKMA 3GFGA 4WBNA 2FW6A 4E09A 4U9IS 1O94A 4DA0A 5ITVA 1QFSA 4DLTA 1GU1A 2Q1TA 3U13A 4G5QA 2VN8A 2COKA 2A4KA 1DPFA 1Y81A 3EVDA 3GZNB 4UMDA 1X7HA 1Y1PA 4CGZA 3JTEA 2DUJA 1Q14A 5IYZB 1UKAA 2C3PA 3H42B 4I5GA 5KJ6A 10MHA 4QUKA 2ZROA 3KFXA 4ONEA 3DH0A 2GI4A 4F4IA 2PAAA 2VAPA 2X86A 1TM5E 3GT3A 3T54A 2WILA 3EXG2 3UWKA 3PR2B 1JG2A 4EJFA 4DAEA 4GG1A 1L7MA 1Z5GA 1ABFA 1C0EA 4ZXFA 4NU6A 2QD3A 4MWCA 3N9IA 2LD4A 4H1UA 5AXBA 3VZQA 5JD4A 3K2QA 5EIWA 5K05A 3AHJA 4GNRA 3FWZA 3JZDA 1GNSA 1SHJA 3AF3A 1EX6A 5DYTA 3OM1A 1R5BA 4PLFA 2VT2A 2RGBA 1G8HA 1OI4A 3L49A 4M53A 3ZNPA 3ESZA 1Y5LA 3KX2A 5JQGB 1VPEA 1YTUA 2NSLA 4PXYA 4Y7DA 4ZTZB 3LCMA 4W8OA 4GPD1 4DBZA 1SK8A 3THXB 1K3UB 3QU4A 2QSYA 3O1JC 1XXLA 3DBRB 4Y6GB 4XDGA 2Q5IA 1IPHA 1ND5A 1N3IA 1PNTA 1TKCA 3B12A 3F6YA 5FTNA 2QT1A 2XD9A 2N46A 2BMEA 3RC9A 3QUTA 1H5NA 3UC9A 1A96A 4LCBA 3VI3B 4CKXA 1AQJA 1JA9A 1AE1A 3E6AA 4EITA 4RVHA 3EPPA 4PANA 3CEAA 3LU1A 1KYIA 4YFYA 3W1EA 4BKPA 3WV5A 5LOVF 1SXJC 1NP3A 5HZGA 5L4NA 2NZWA 3FDXA 4Z4HA 1RYEA 3SYNA 1EJ0A 2D3TA 4RPHA 3TCKA 2AQKA 3W06A 4A0GA 4X7RA 3G6WA 5KTTA 1W5SA 1WDLA 2FUNB 5AKZA 4CPDA 4KG7A 3K70D 4JP8A 1YAHA 2ZSEA 3AGPA 1C3JA 1GWNA 1YVRA 1Y33E 3LUFA 1MOZA 2F3TA 4YMIA 4DDVA 5K0TA 1NN0A 1FLNA 1RQNA 4YCAA 1D6JA 1GHTA 3AQIA 1NIJA 4LX0A 1I2CA 1TA4A 4OXNA 3SF0A 5GZ3A 3ECAA 1DKMA 5FEUA 1DZIA 1RACA 1UMDB 4WKOA 1L5RA 3T7KA 1QRUA 4NOKA 3JQPA 5AKYA 3M6UA 2O7SA 4AP6A 2O3TA 3EC1A 1LY1A 4UUOA 1W34A 1CUAA 2ZSHA 4WLEA 3ZK9A 3V42A 3V8RA 4DLPA 4TMYA 5EHGA 3ZZ0A 3BX1A 3SJCA 4QKQA 3ZWAA 1FDVA 2H8GA 3VKVA 3L6UA 2ZIAA 4RFSB 5JOQA 3GP8A 2QWXA 1MO3A 3GWGA 3IAM1 3WMXA 1SOMA 2JAHA 2X1HA 2ZYRA 4O4IF 1PVOA 3LVFO 1GZSA 2IIVA 4HDRA 4C04A 4I55B 3G23A 1E66A 1W88A 3BSFA 4OP1A 4WWHA 1VOTA 4WZAA 2JFYA 2HU2A 3D0RA 4R2WA 1ZW1A 2HADA 4RC9A 1BXZA 3KBBA 2JFHA 3TS1A 2PX3A 4UXIA 1G6OA 1GOTA 1TRKA 2QN1A 3GC6A 2QA5A 2H4HA 1JHPA 1U5BA 2I6GA 2Y27A 1AKQA 3ESYA 3OIGA 4JGBA 5HMLA 4KQ1A 3A0UA 3FKSD 1H2WA 3U2QA 1Z36A 2DG2A 2DHCA 3HI4A 1F14A 1UDCA 4GW3A 2B37A 4OLJA 3DYBA 3CRRA 3OZEA 5F7XA 2H65A 1TKAA 4D9BA 5KYTA 3T3DA 1AKVA 3FYUB 1GKLA 2G63A 3MG9A 3VX3A 1OX6A 2CFSA 4KV7A 1ULUA 4V0KA 4Y2YA 4QNNA 2B8JA 2F64A 4R1NA 4ZVNA 2Z08A 2G07A 1J2YA 1G2IA 1GRQA 2CNBA 3OTQA 5E6SB 5EWMA 5H82A 2LW7A 2W2OA 2EP7A 4R68A 2UVPA 2W6ID 4K8RB 4P7JA 4TN5A 2WPDA 2X13A 3L7KA 1XPUA 1P4SA 4ZIRA 4OHKA 3ZY4A 2UU9B 1H0SA 1YR9A 221PA 5EPEA 1MRZA 4RH3A 3AOEA 3WADA 5F78A 3VH1A 3R77A 3ZDXB 3QKSA 1JR3A 2Y2UA 1K0UA 4CKEA 2IEYA 2IHUA 2NACA 3IUNA 2G08A 4HGOA 5FWYB 3B9RA 2ZBUA 1YVDA 2VC2B 3ZHZA 4YJFA 1I1NA 1M8PA 5L53A 2IYAA 3UFXB 2JVIA 5CFNA 3RU3A 4RA6B 3HYCA 1JA0A 1F3LA 3CKLA 2P6PA 2UYOA 1LDNA 4WA7A 4DLWA 1L3BA 1QHHA 1QV7A 1TVEA 1I1HA 1V8FA 2GVNA 3W5AA 1GZ5A 3K5HA 4OEHA 1XD9A 4GOMD 2B8NA 4N5LA 2DT5A 3UPDA 3HXQA 2MU1A 4ZV7A 4FTWA 1I0LA 2FGJA 5EVCA 3H1AA 2XOEA 4RPJA 1XAJA 5AFSA 4JLVA 3ADOA 2C9OA 3DNFA 1Q7GA 1NR5A 3H9EO 3HABA 3HU5A 4C7MA 1XZHA 4GGPA 3VC7A 2C9CA 3IQWA 1SBHA 2QSJA 3RYFA 4F9GA 2XKKA 2YVUA 3L7LA 3IMEA 3LNTA 3M9XA 4ARBA 5KOYA 1BTOA 1EDBA 2Q5FA 1L4GA 4KBYA 4F1JA 3H2SA 3HBNA 1MQSA 5FI5A 3QVMA 2PZEA 1QH0A 4RHYA 1S3SA 3RVMA 3E27A 5ELLA 3WTBA 3UWDA 3AHFA 3H1GA 2P68A 3VSEA 1TYDE 2EJTA 2PQMA 3EXHA 5IABA 2ZXUA 1CQPA 1H66A 1T4CB 2J8ZA 3OM0A 1U98A 2X3FA 4C3VA 9LDBA 4JV5B 1B8OA 3KZOA 1TZMA 3PGMA 3URKA 4EELA 5LWHA 3KNZA 4RVUA 2GCPA 3HR4A 2B2NA 4H3KB 3O0TA 4LSMA 1UWKA 3AIOA 3GPIA 5A0FA 5CX1B 3IALA 4QA9A 1EE1A 1HT1E 3VNAA 4B3RB 5TEVA 4OA8A 2BZSA 3WB2A 4QPJC 2HJSA 3PFFA 2LR0A 5EHXA 2E1PA 5E2AA 1PSDA 1W6UA 5IZCC 2H1WA 2OHGA 4P86A 1RRGA 4M1TA 1KFJB 1Z2CA 1R8YA 4KZKA 4TYNA 2FG7C 1UEIA 1PJTA 2QPTA 1AZWA 1ZA1A 4KZPA 3LOUA 3UJCA 3VR6H 3UPUA 5CH8A 3C16C 2RC6A 5BNTA 1AXGA 1K7SN 2BEUB 3DLAA 4PC3A 2I9PA 2HYIC 1P2UA 1XD8A 5LIPA 3K5WA 5ECDA 2A4MA 4E0BA 1JHAA 2BZ1A 2C92A 4KXUA 4YC7A 3PYLA 4G24A 2TMGA 5AOBA 1B23P 1B6GA 4IH1A 3G8YA 4AM8A 2V4MA 4JT9A 1IL0A 2XECA 1IBKB 1QKJA 2ECPA 3EJ6A 3EC2A 3N6XA 1P18A 1UKZA 2CUTA 1Y5NA 4FLFA 2IQ5A 4ZVTA 1JEJA 1WPRA 4DEYA 2A5LA 2EBUA 2ZJAA 5EZSA 3K2BA 3WDSA 1IB0A 5JZMA 2I4MA 3RTGA 2FCAA 4IMPA 4QU5A 5TT1A 3U7HB 3HSSA 1IFXA 1YJAA 4K6FA 3BHMA 3EE6A 1PR6A 1LDYA 4MV1A 5T4BA 1L2TA 1QDEA 3C24A 3CX7A 3EGDA 5DK4A 2QX8A 2JLRA 1T0PA 5E4YA 1R0RE 3AJ9A 4DSNA 3N8IA 4C20A 4OP2A 2XT6A 2GVDC 2WZDA 3JVEA 4K40A 1G1AA 2RARA 1NXSA 3BWXA 5BUZA 5KNDA 1GGJA 3MVEA 4ENVA 1DQYA 4NAUA 5JQWA 2R1VA 4JXXA 3C3PA 1RBZA 4MTLA 2D1TA 2I65A 5FO0A 1WEHA 5A71A 2OMKA 4ITUA 4MI3A 3ECSA 5TNXA 5A5EA 3PDHA 4HK4A 4BLOA 1UK8A 3JAKB 4F4HA 3GJTA 3W05A 1PU2A 3IP6A 2BI7A 3EQ6A 1RPZA 1BMQA 1KZGB 1O4WA 3J7TA 3CFYA 1ND6A 1DV2A 1MFPA 1WUTA 1D4OA 2HJ9A 1CNEA 1QFJA 2WWTA 1H2BA 1WPGA 3BGSA 3QVTA 4FZ5A 4JHXA 1FC0A 1XTVA 4Y2PA 3TNYA 1Q95A 2Q49A 3GJZA 3AI3A 4PLZA 4GBMA 2G5CA 3OZBA 1V25A 4TV8A 4BEBA 1GVHA 1UZAA 5JNWA 3G89A 4XVCA 3NV9A 2OCIA 2AMFA 3ACCA 4EKGA 3L1KA 2RHRA 3U6BA 3D6UA 2UUCB 1ACJA 2Q2VA 1CR4A 3M4XA 3PGXA 3PNPA 4KCGA 1KDOA 1PS9A 1W0JA 4IEEA 5E3IA 1OXXK 5TS2A 3G0HA 2XAAA 2QY6A 3E9CA 4PHGA 1YV9A 1D4ZA 5REQA 3R7WA 3VZDA 3DV0B 3U4DA 3OE5A 3L7NA 1IOWA 5J58A 4FK8A 2V7WA 1CUEA 4M38A 3A11A 3RYTC 4CTJA 1HSZA 1H65A 1KI6B 2BFBB 2SKDA 4UW9A 3FPJA 5DK6A 3CPEA 1ZI9A 5L45A 1OWPA 3LI2A 3PFCA 2BOVA 5JDCA 3H8SA 2DWOA 1IHOA 5GZ6A 1ZNZA 3SX2A 2HZ7A 1X2EA 2JCYA 2ODPA 2O2CA 3AUFA 1RPAA 4JMPA 3Q1LA 2X2PA 2QX4A 1C1DB 2CXTA 2J3DA 3D0KA 3UJ7A 1OE0A 3FPFA 3WRXA 1PWHA 5FAKA 3FPAA 5LOVB 4B31A 5B1YA 1LSOA 3GCDA 2ZREA 2Y4OA 4GOLD 5J5VA 1DKQA 2AN1A 2OCLA 5TQ0A 3BXHA 4CMJA 5TRTA 1I5EA 3HU3A 1S2LA 3OIDA 1Q57A 2HA5A 2QT0A 2WJIA 3ZI7A 4D98A 1I4EB 1WVGA 3E61A 2Q5HA 4YWJA 4HNGA 4NZNA 2X4IA 4MARA 4BEVA 1GZUA 2YJ5A 1SXJE 2HCJB 2QNIA 4RGVA 1S3IA 1SBQA 1ITZA 2OL4A 5JSYA 4Q4LA 1LDGA 2GN8A 4RA9B 1E6LA 4DT1A 2FMKA 2QJWA 3ZW9A 2G40A 3AVUA 3OE1A 1U8XX 5CB6A 4PX9A 2BUBA 3QV1A 3BFPA 3VU8A 1F38A 1MEJA 3V7FA 1QBGA 2HWXA 2Z57A 3A1NA 1HH4A 2GNOA 4JKIA 4OQEA 1KO5A 1OYWA 2QRHA 1QFMA 1XZCA 1G63A 1UC5B 3BCUA 3I0NA 4OSOA 4XWKA 3AC0A 3TG2A 8OHMA 1OASA 1RPTA 3K8QA 3U81A 5FB3A 1HMPA 1QHXA 2VQEB 4RVNA 2NN3C 4UQOA 2A58A 4B6GA 3PQ3A 4PFSA 4YRMA 3L2OB 5CFLA 2P69A 3G1WA 3JASB 3D54D 4UBMA 3CZ4A 4E3ZA 2FW0A 2QTVA 4UHHA 4F2PA 1Y1TA 3FCOA 3HJGA 3O38A 4JLNA 5BSFA 3ZV6A 3I2HA 4RQAA 4B09A 3B1JA 3KM0A 4CQMD 4F8EA 2J46A 3NEYA 4R5MA 4OA5A 2I3BA 3OLWA 1EA5A 3IAHA 4KR3A 4BAZA 1LPSA 3PJEA 4IINA 4FHEA 3NAGA 3WR5A 3B1WA 2OKGA 3KQPA 1C7IA 5HFNA 1UIRA 2DPGA 1YB6A 2RGXA 1NV8A 1SOUA 1XDWA 1N0HA 2FQQA 1RWOA 3NRCA 4J0HA 2DU8A 4RO0A 3ILYA 4F93B 2R0QC 4BFLA 3S29A 4JA0A 3F98A 3PEYA 3GEBA 2G7MC 4WESB 2C4UA 1T4GA 4S2UA 4ZYWA 5CDUA 1KSGA 4MEAA 3LTEA 4XXHA 3T3NA 3BMQB 3WGKA 4ROTA 1XP8A 5LJIA 4N0MA 4LQDA 3BQMB 1ZH2A 1WNTA 2HMUA 3G2OA 1FSPA 1VYVA 3HA5A 5CGZA 2R7MA 1HYGA 721PA 2Z8YM 2OYCA 3AR6A 5ESRA 1KAEA 1JN0A 4QUDA 5CVDA 2IDZA 2XX3A 1QK4A 3CEPB 4NSNA 4IM7A 1P4AA 2XUAA 1ZZEA 1J23A 2ZXFA 2IU6A 1TRHA 5ICGA 3MCVA 4MJLA 4QVGA 4AMUA 3ZWBA 3LY9A 1VDZA 2DCMA 1RYNA 2WFLA 4MW6A 1Q1EA 4V2IA 1NKTA 3C43A 3PXAA 4X95A 2R6DA 2O8DA 2ZRCA 1F7VA 2BFAA 2MR5A 3TL6A 3VHXB 1NA5A 4Y6SA 5AUNB 1YZQA 4DB4A 4XYGA 5CU7A 5LQUA 1PJLA 1LEHA 3Q7RA 4YAEA 1I0ZA 3BWMA 4PFKA 3QJYA 1C50A 2WG2A 4KLRA 5CM8B 2XYHA 5I51A 2WJ6A 3ROZA 2PYIA 4NLLA 2CB9A 4Q3AA 3P9KA 5AXAA 1NVVR 5ADUS 4H7FA 1MC1A 1TU0A 3RVLA 1TVKA 3OX4A 4PZUA 3EVAA 1BN6A 4ND2A 1PQ4A 2X1MA 2JZOA 1YS9A 5JXJA 4B4KA 1L5FA 3TNLA 2AG1A 5IMSA 2HU8A 1EGQA 3KSDO 3VZPA 5JMOA 3LDHA 1C9EA 1M1NB 4KN8A 3LGSA 3HEMA 4BNZA 1TKRA 4KLNA 1H9AA 1ZO8A 1Y48E 1XMQB 5BSRA 3GHHA 1P77A 1BE1A 1XQ9A 4FD3A 4GPBA 4JU8A 4LHZA 3IOBA 4S0ZA 5D1HA 5ICFA 3T8YA 1CZRA 3MWYW 3W2IA 1EEHA 1U1IA 3UJAA 4EFDA 1NYQA 1XPRA 1SVLA 1SU4A 3AO0B 4DJ5X 2ZCUA 1U7XA 3HBJA 2C5AA 3KUXA 5C34B 1E3IA 1WLSA 5C8XA 3Q6NA 5KTKA 2GJ4A 2O2YA 4YJ3F 4W9NA 5JS8A 1BHJA 4H17A 3WGMA 4XR4A 2SNIE 1S1CA 1UDBA 2YBEA 3ZOZA 2OZLB 1RLOA 1WG8A 4I1IA 3TBKA 3S70A 1TYZA 2MSDB 3IKMB 2FR0A 4RSMA 5T4FA 3A1CA 3VI4B 1ID1A 1LZLA 1N75A 4L08A 4OMUA 4RLSA 1Z29A 5FPPA 3KYCA 1F2UA 3GXOA 1UJ6A 4PC7A 1NW8A 2P2GA 1WUYA 4CIBA 3K30A 3KUUA 5FTLA 3ABSB 1DFIA 5C80A 2V54A 4JLSA 2ZSFA 1N0WA 4MUBA 2C9BA 3DLIA 1STOA 1T9GS 3MD9A 4QXMA 5JJBA 5KDDA 3U4CA 4GUAA 1Z2PX 4QUIA 1PQWA 3C3AA 1Q15A 2FPGB 3PWTA 4QHYA 3WKCA 2OGUA 3U7JA 4BVLA 1IZ7A 5GQSA 2G1KA 1JPJA 3DL2A 2ZCJA 1RAAA 3DFIA 3NEPX 4KV9A 1R7RA 4KXXA 1EXMA 1MR3F 4OBWA 3GCXA 2ZBDA 2O3RA 5K6AC 1D6SA 4TMXA 5JCJD 1QP0A 1E2JA 4IHKA 3OETA 1Q6YA 1T8PA 4B5KA 2UUOA 3IBSA 2QL6A 2GXAA 3M82A 2CDRA 1EINA 1U8FO 1V1MB 4X0EA 4YEDA 1G9XA 1M8KA 1KDPA 3PC8A 3TVTA 5EXSA 2QM0A 2XMBA 4UPVA 4M7PA 3R7FA 4DLZA 3THYB 1J4AA 2BBSA 2NSDA 2VZLA 1X3SA 5ARCA 1NC3A 2VXOA 4EATA 2E4XA 3PNQA 3GNQA 1H6BA 1SG9A 2IOFK 4EHDA 1JALA 2XMGA 4CR7A 1GA4A 3CKKA 4XGIA 5ISMA 1YVUA 2PL3A 2CLLB 2RJNA 2HUPA 1I7QB 2UZ1A 1M2OB 1JSXA 3QOWA 3NYRA 4RW0A 4B4WA 3PUYA 2X2FA 3N7AA 5EJMA 5IVDA 1JH9A 4AC9A 1N2IA 3E22A 4YCMA 1OXKB 2OBLA 4YRPA 2J9YB 1CU1A 4WFQA 2WE8A 1UFRA 3PQ5A 4INAA 5KYXB 1NLMA 5KCMA 4Z3OA 5K7SA 1QYRA 3WLJA 3VXKA 5HZKA 4CM5A 4PLYA 2FUKA 5CNKA 2GT1A 1AMOA 3UPTA 1HQDA 3D4BA 1FTGA 3MXTA 4H7IA 4BFVA 5KSZA 3IV9A 2A8YA 3LF1A 2K6GA 4OMDA 1QRAA 3QHAA 4RDIA 3NBMA 2OBNA 1C4WA 1S7CA 2K2WA 1G7RA 4OB8A 2WWWA 3ZDDA 1IN7A 1DKUA 2B61A 3IQFA 1SCBA 4UHBA 2WSMA 2ATXA 2CVOA 1NGSA 3S2FA 3T9AA 5JJLA 5L9AA 2FETA 1GNVA 2BMFA 2DF8A 3QK7A 4PZAA 5CA0A 4FW8A 3IUPA 1KQGA 4M8NE 4RFLA 4B9EA 4IJUA 2G8LA 3L6BA 1T8YA 3IR6A 2D5LA 4YJHA 1LPOA 2W2KB 1E2HA 2V6IA 1XL0A 4XQCA 2DTDA 4X1IB 4D3YA 5KQPA 1PJRA 1KEVA 2A5FA 3EF1A 3ZD8A 1FP7A 5FNZA 1OX4B 1IB6A 1ST3A 3OJEA 1IN8A 2EW8A 3DVSX 3NO4A 4L8FA 2J31A 4RMNA 1TEVA 4MPTA 4W82A 1RXUA 2IHYA 5C53B 1MBZA 1HDCA 2XH8A 4DCNA 2XQVA 2MYTA 1M8JA 1WP9A 2AG8A 2R1TB 2QE7A 3D8UA 4YBRA 3OKAA 1UJ5A 2AQIA 4F04A 1UADA 3TW4A 5KU7A 5KJ1A 3WLIA 3OQNA 1FTSA 2F6RA 3I01A 1OXBB 2C58A 4HQRA 3N76A 3OEHD 5GONA 2ORED 3AF0A 3I1FA 3RRJA 2ET6A 3Q6IA 1VXRA 3Q8WA 4KEAA 2QTHA 3DVAA 2L82A 2ZBFA 4CWAA 4DJFC 5DCUA 4JJFA 1JWBB 2VSOA 5CAEA 4NESA 5JD6A 3JWHA 3LLUA 2FGKA 3FVTA 2ZE7A 1E18A 3EH2A 3MK31 5DTJA 3TQFA 1JDPA 1I8TA 1T3GA 4LE0A 1CUFA 4KMMA 1JVBA 3MRSA 1N6LA 4HL6A 1OAAA 1M6HA 1Y1KE 2BFCA 4JDUA 4X8HA 3IYLW 1FUEA 4RENA 4MQ6A 2F3RA 2P5UA 1TTHA 4G3XA 4TWBA 1V43A 3Q7PA 4DIUA 3ASUA 1DXHA 1SY7A 3V4OA 3DE0X 5ER6A 4ZZ0A 5LZ8A 4R2LA 3VVMA 3K16A 2H29A 2ZYAA 4D0GA 1D1QA 1HKHA 1CNMA 1GV1A 1NLFA 3EAQA 3P32A 2ZIXB 4N7BA 4NK4A 3F49S 4MUKA 2FFAA 2BEWA 1NVTA 2RH5A 3H8VA 3JWIA 3VYUB 2H4JA 4EHAA 2QRZA 5HP4A 1XRSB 2LE0A 3ND8A 4RJIA 2W2PA 2V9PA 1ES9A 4MKIA 2B78A 4POAA 1DQRA 4B32A 4B7ZA 4EIWA 2O2IA 3Q98A 2WJYA 2LXNA 4MYHA 3WKAA 5JJIA 1CEEA 3RPEA 5I7AA 3AKDA 1E1KA 1V41E 1DSSG 2H2IA 4JDPA 2AOTA 3PENA 2P91A 5DWQA 3U62A 3ZZNA 1G6HA 3H6KA 3CWCA 1GAEO 3EWSA 1BDBA 1UXHA 4AO7A 2OHXA 2AT1A 5EHNA 2WVHA 3LXRA 1CEXA 5AMXA 1Z2AA 1UXJA 1ZK0A 2LTAA 1O08A 3H04A 3HKDB 4TRRA 4MVJM 3PC4A 1U0HC 3QBDA 1UMBA 1AG9A 3ROKA 1OH8A 2Q07A 4QWMA 2PUGA 3IP7A 1DBQA 4UHEA 5ILOA 3CZPA 4MW9A 2W4QA 4XVRA 3VPFA 2JCXA 1GUZA 4TTSA 3HKBA 1UOPA 4F4UA 3CH6A 2ZYTX 3TSWA 5DNWA 3DSRA 4AIIA 3EQZA 2GYYA 4KHZA 1LSJA 1C0PA 2V1XA 3KD2A 2Z9CA 1B00A 4NQRA 3FTDA 3ZNQA 3K0SA 4MINA 5H83A 4LAFA 1XNQB 4U2BA 4OQFA 1CUSA 2ISQA 3TQSA 1YBHA 1IJKA 5E38A 1PJCA 2NAPA 2BT4A 2OXFA 3GZNA 3MRVA 3PJGA 1RM4A 1V3TA 3C14C 2DPLA 3CNNA 3CURA 3HUUA 2I4OA 3SN6A 1SR8A 4XGNA 2J3MA 4HDQB 1WABA 1ZGBA 3QH4A 5HMMA 2O23A 5ALDA 1OGJA 4OK3A 5E7JA 5KTMA 3QELB 1W7AA 1PWEA 2J30A 2ZJFA 1DS6A 2FSVA 3FCXA 4LJ4A 4MYUA 2Q3MA 3IAUA 1QVVA 4PFJA 3PJFA 3UC5A 2HRBA 1A5SB 4DQUA 4J7UA 3HFRA 3TX2A 5BW5A 1F8UA 3OZXA 1JBQA 4CM9D 3F8SA 4L5AA 1XQ1A 1RXSA 3AL3A 3KPYA 5I8PA 3EX7C 1JDZA 2BVNA 4L85A 3SEQA 5BWCA 1VZ2A 1OD6A 3AHIA 2OPHA 3WHLA 3ZC3A 2HMYB 2XPCA 1EVZA 5K8LA 2GRJA 3N75A 1GUFA 3ND9A 4OLFA 3PKZA 1BKYA 4CM4B 5LDGA 3UGQA 5CTAA 3CX6A 5AOAA 1I2DA 1MJNA 2YYYA 3DBRA 1F51E 4ETIA 3NC0C 5BWMA 4IKOA 2EZUA 3QMVA 4GI7A 2B30A 3SSMA 3TDNA 3A3OA 2XTNA 3WA7A 3ETDA 2XWQA 3OEYA 1G42A 2NPIA 1PLJA 1IU9A 4HWOA 5CEFA 3NNSA 4CCYB 5BWOA 4KQEA 4DEVA 3UWOA 1CP2A 4RZIA 1CJVC 2D8MA 4I4TF 1NUHA 4KWHA 2PQ6A 5ALOA 1NVBA 1IY2A 3SE7A 4U2DA 1DVRA 4ZYXA 3EPJA 2PUEA 5F5NA 3A2LA 1YRWA 3HV2A 3E58A 2G9RA 1NE7A 5TPZA 3G0IA 4XGKA 5FUMA 3GJ7A 3ITEA 5K6RA 3Q9SA 1JBKA 1Q50A 2JGDB 2Z3ZA 1CY6A 3HLTA 4LNHA 2C88A 4FOTA 1HL7A 1CKEA 4LPSA 4G9EA 5HOQA 4J1TA 1UR5A 2J3IA 2OWEA 2IEBA 1G98A 1YDFA 2QIOA 3MSXA 4QBFA 5FUWA 3KVNA 1ZSVA 5CBPB 2IE8A 1ZBQA 3AKYA 3OEWA 3A27A 4L8YA 2ZRAA 1FCJA 1UMDA 4Q9JA 2D0PB 1AKUA 5LLDA 4HPJB 3ONDA 4KK4A 4LFBB 2B1GA 1MG5A 1Z7GA 1JAYA 3TFWA 4HGQA 4UE3S 3DOIA 2PIDA 4P3YA 4OHVA 5BW6B 1JLSA 2C4NA 1ODTC 2VNSA 1RT9A 5IAGA 4MA4A 5CYOA 1A4UA 2IPOA 3KKPA 4AROA 5K2MA 3DXFA 4KJZA 2VP2A 2NVUB 4RFSA 2ADFA 3U1VA 1UFKA 2E55A 3CIOA 1PV2A 4CJXA 4YRTA 1HORA 2O1SA 1E1QD 1S4QA 2P3OA 3RK1A 3NBQA 3KSRA 4U7FA 4X7PA 1QBKC 4A0HA 2QZJA 2I54A 2H4YA 4I55A 1C9DB 1HT3A 4YWHA 3ELBA 5AI0A 4OGKA 1MNQA 4Y6QA 1YIDA 3B52X 3RC1A 3WGTA 4OGGA 5KNCD 1CYEA 3FG9A 1A7AA 4E33A 4I4NA 1V8PA 1J5PA 4TTTS 3MTEA 5LBTA 3TNFA 2DAPA 5FOWA 5ITZA 3KJFA 3F73A 5K3BA 1KZ6A 1EVLA 5DCLA 4KWCA 3Q72A 2FMXA 4EJ6A 1JILA 2J7PA 2QRQA 3H2GA 4JJ8A 4DYDA 1BHO1 2O06A 2ID9A 2R6AA 4M6WA 3AVYA 1HO3A 4BL5A 1D2CA 3D6JA 4GU5A 3CUYA 5TGZA 3U3OA 1BX0A 3L1UA 3EGOA 2HF9A 1PCXA 4O5AA 2CXSA 4OXYA 3WWYA 3ZWPA 3FYUA 4CG1A 1PR2A 2X3YA 3L4EA 4KXYA 5DIFA 3HR7A 1T24A 2WAOA 2CK3D 3C3XA 4TXHA 5BXYA 1HR0B 1Z16A 1HX7A 4HBZA 4BKOA 1DINA 1KNXA 3OQIB 4I5FA 3OMWA 1BXGB 3LBHA 4X9XA 4Z9FA 5IK2D 1EM6A 1RZ3A 1Z6QA 3NNNA 3O8CA 2VJOA 5EL0A 1OXUA 2C4VA 2YXLA 2XUDA 3BL6A 4B6JA 1MQAA 1UDXA 3F1LA 3JD1A 2GZRA 3Q9UA 1JIIA 1Z83A 3AG5A 5G1PA 2JLBA 3WB1A 2PH3A 2PXAA 4F4DA 4OTZA 5EXXA 4CDGA 4ZU1X 1GKKA 5FWYA 4IEIA 2GD0A 2JG3A 1T8TA 4BU0A 4AECA 1VKOA 3QKTA 2DX7A 1OI2A 4GPEA 4KP7A 4OJMX 3UFXA 5E7MA 1X3LA 3GLVA 3OI7A 5A3SA 2Q0QA 3T3PB 1YTLA 4ZT7A 2DPHA 3ICPA 1ENPA 2GBIA 2I22A 1XJ0A 3BJMA 1SBCA 2AEFA 4L5IA 4EI2A 2XUKA 4TM7A 3MCTA 4QPNA 2CN1A 4ZOLB 3RS9A 1L9XA 2BD0A 3DQQA 1FUUA 2C5BA 2AYXA 4PCLA 821PA 4PZ0A 5E1BA 3CLUD 5I7HA 4LZPA 2JFQA 1UH5A 2PUTA 2E4ZA 2VKQA 1A2OA 4OHFA 2IIPA 2JGAA 1V16B 3GFTA 3LH5A 3BL8A 1MJGM 3AB8A 1YHYA 5KQMA 3X2EA 3MUNA 1SNYA 1UDWA 2WT9A 4TT3D 4CM3A 5CP8A 2HNBA 4XEUA 2X5NA 4OXKA 5DIZA 4K3UA 3VH4A 5HUHA 1FFXB 3GRFA 4MH0R 3F8WA 4LWOA 3KR0A 4Q3DA 4DXHA 2CVHA 4B6PA 3TI9A 1FPQA 2H0RA 1T9BA 3A1FA 3DMNA 4J4TA 3ICEA 3E3AA 4C2BA 5GADl 4B45A 1DIBA 4QNMA 4R8KA 2C31A 2PR7A 2IW1A 2C54A 2Y0CA 4KQKA 4TTPA 3BK2A 4UBLA 4UMEA 3USCS 1U3DA 1Q3HA 4D9JA 1XCGB 4QUJA 4DW8A 1Z5ZA 4JAVC 5JEDA 1EFAA 2DSNA 3OA2A 4Q1CA 2GPWA 2OCKA 3TBFA 1S8AA 2QORA 1XCOA 4X1KB 4P36A 5DLDA 1TO6A 4S05A 2ZS9A 4OI1A 3SZRA 1YA8A 3EW7A 1JDSA 4KVGA 5E7QA 1AHPA 3MQFA 4YXFA 2GZMA 2IU4A 2IVFA 1CT9A 4MKHA 1T3LA 1CRPA 2BF7A 1DTEA 1J06A 2HIAA 3CJRA 4PAGA 2ZU6A 3KKOA 1Y7PA 4MW4A 5KHLB 1HE8B 1JHVA 5EP3A 4EB3A 1MB0A 4FZJA 5LP6F 2PGAA 1QQBA 1ONBA 3U4AA 4N41A 2FEWB 4BNJA 1X42A 3EZLA 3KVYA 1O9GA 4ZV9A 4PPFA 5G2OA 3NGXA 1C8BA 1Z82A 1EWRA 4RTSA 1K7YA 2FW9A 3TVYA 1QK3A 4AY4A 1T1RA 4BLQA 2KX7A 5FPKA 2IXFA 3AIMA 1WCWA 3G9UA 1MV8A 4R54A 2DFNA 4FX2A 2JNWA 4NWIA 4OHOA 5DCYA 5JS2A 4X92A 1E8NA 4KLCA 4AB1A 4CG2A 4I5IA 2H52A 3A4TA 3DE2X 4MKFA 4O4HF 3RFCA 1LNSA 3SMQA 3CT6A 5L7WA 4MCAA 2NU9B 3VA7A 2PQ2A 1M73E 4HYEA 1E7YA 1FDIA 2ZSBA 1SVKA 2R7NA 4WKGA 5I7UA 5E9JA 2VTBB 2Z2ZA 4XB1A 4PCVA 2IXGA 5DHUA 1AT1A 2PEYA 3EDOA 2IVZA 5LU9A 1I9GA 3N6VA 4R71A 4LF5B 2YFKA 4TLBA 1QC5B 2F1RA 1I4WA 4ZICA 4M36A 2G4CA 2H2GA 3T41A 4MWEA 1LRKA 1UCFA 4ZO9A 3WLQA 4Y9UA 4GLFA 1KEZA 3BB4A 5BN5B 2H06A 1JLLB 5EFZA 3TKYA 3BWYA 2AGVA 3KV1A 4H4CA 4TKUB 5B3AA 5SZJA 1C8LA 3TH5A 4BJ3A 3DV9A 1ISMA 1VPTA 1UPFA 2OHVA 5MFZA 5KINB 2KYRA 3EUAA 2LKDA 2NWQA 3TNDA 2OGSA 4YUVA 5GZ1A 3EZ6A 1QG4A 3V3TA 2PT9A 2PWBA 1V48A 1EFVA 4KFSA 4N0PA 4WY2A 1G5QA 3K0KA 4PX5A 4YQFA 1GUBA 2FR1A 4MYRA 4W9RA 4R9VA 3AJDA 1F12A 3AI7A 2H1LA 3OSUA 4UJ3A 4XPZA 3N0TA 1JMVA 2D2EA 1UDRA 4GWGA 3ZK7A 4H3SA 4NCIA 3MWDB 2IV7A 3CPHA 3DO6A 4B80A 4CEJA 5HIIA 1Z4OA 2W6JA 4B6SA 4Q7MB 3U4HA 5DGHA 1U2EA 1P6UA 3HWSA 2XNDA 5F1KA 3GPCA 4C22A 3HBMA 1BMFA 1VIVA 1GZVA 3STUA 3FTCA 2OOSA 2OLKA 2Z6UA 2VTVA 1EBUA 3COPA 1WY7A 2Q6VA 2BFMA 2C3UA 2X8LA 3GIDA 3OG9A 4AULA 4BNTA 4IF4A 2PBFA 1K4YA 4HDSB 2JJ8A 3QQ5A 1F2TB 4L0MA 4R1PA 3LA8A 1WULS 4RIIA 2NXNA 3LM8A 4OAQA 3DV0A 4PGHA 4QRDA 4IIXA 1QS0B 4QSHA 1VJDA 5IU6A 3W3AD 4B71A 4E2WA 1OI3A 3O2JA 4PSKA 2VK8A 2ZYDA 3FY4A 2BFBA 3VR2D 4ZJZA 1QIDA 4LHEA 2Q3FA 2YUIA 1YR7A 4NEQA 3LXUX 2GCNA 1JRLA 2X0NA 2GYVA 4E5SA 3DBHB 4X71A 1CYDA 1OW3B 2GPBA 1ENYA 2X9LA 4IJWA 1JB9A 2W90A 1C1DA 4MJ3A 5DHFA 4DF3A 1G8GA 5DGCA 1ZM7A 3E7DA 1G2QA 2AFIE 5LOVA 1C5KA 4I4TB 1KIMA 3IVCA 3EIHA 4J91A 1KPHA 3KLPX 4WJLA 1TMKA 1XZNA 1J5XA 3OJWA 1JMYA 5FNVF 1QLJA 4FFDA 3FMPB 3GF4A 3NCTA 1G0NA 1W581 2ZS8A 4YP7A 5J2UF 1FLAA 1R0WA 2HL6A 1NYLA 1ZY2A 4MULA 2XRYA 5BSHA 4FI3C 3O3MB 4Y1EA 3JQ8A 4TS4A 4X63A 3TFOA 3QFSA 1G17A 3KSMA 1P2VA 4HDKB 1Q0QA 4E5YA 4DR4B 5K1ZA 3H18A 5LZ9A 1DAGA 1UPXA 1CQZA 3BF8A 1J0EA 2QQEA 4K6MA 4RA9A 5ABPA 4C2TA 4OQQA 4ZI3A 2EF1A 3P4XA 2FJ0A 4XUEA 3ICOA 1UZMA 2WBLC 3QFCA 4JKOA 2X4DA 5T4EA 4M98A 1VGVA 2PRZA 3VJKA 5IKXA 4DMFA 4H7JA 2Z9DA 3VOTA 2BSQA 3NHJA 1AA9A 4INPA 3VHLB 3ABRB 3WYBA 1RADA 1RS0A 5EOVA 1L4NA 4BZQA 5KTRA 1GG2A 1X1EA 4B84A 4O4IA 4FYMA 3Q3VA 2FG6C 3W8RA 4EA9A 4FDAA 3AFGA 3I2YX 4KFUA 1PNRA 1Z45A 3OPYB 2O8CB 5JSQA 2QXTA 1O54A 2HNAA 3E3NA 4I3GA 3QTLA 1A50B 2XB2A 3GNSA 2EP8A 3RSFA 1KL7A 1YCDA 1GARA 3ZXIA 4CQLB 1GL9B 1YB2A 2VHUA 2WIKA 3QVSA 3F2IA 2E6UX 2QD5A 1NV9A 1FVHA 2EX1A 3A1TA 1W46A 1N6OA 4W6ZA 1TEZA 4WXHA 1GVNB 4F0JA 4KVZA 3FD8A 3DE1X 3H13A 3JAWB 1HNNA 4BB0A 2GJSA 3KOXA 3M6LA 1VG9B 6REQB 3C6XA 3EZ2A 3C8DA 4BIMA 3UA3A 4XQEA 1DAIA 2ECQA 4EMBA 2VSNA 3L7IA 4IKPA 1T1JA 1E9DA 2FW8A 3D2BA 1RLMA 2HQRA 2Q5JA 1ATIA 3GBVA 3CRW1 2II6A 4MICA 2WFAA 5AJYA 4JYPA 2JZNA 2FQXA 3C5WP 1NDQA 2NM0A 3L84A 3VOAA 1UXOA 4F6RB 5I7EA 2I2XB 3RS4A 1VPDA 4FNOA 5F7ZA 3MPOA 4C21A 1ZESA 3DZDA 4H08A 3GLTA 1RJEA 3SZMA 3TTXA 3LUJA 3R5SA 4X66B 1EESA 5G4LA 2H5JA 3NDJA 2X42A 3TUJC 5KVSA 3Q2OA 1R00A 1XD2A 2NUBA 4WQMA 1EXNA 3MHPA 1UFOA 1HYEA 2HLDA 3C6QA 3HR8A 4Q4HA 4DCPA 4EGJA 3GLIB 4YRDA 4AKTA 2PUDA 4AVYA 4QOGA 2HMTA 5HIMA 5JMPA 3SIWA 4EDHA 2HGZA 1SKBA 2GHIA 1JX6A 1OZFA 4GIBA 4HQNA 3RDPA 1FS4A 5AIAA 3WNZA 3EHEA 1UQRA 1OT5A 3IR5A 1TJNA 4GBGA 1DOHA 1N1GA 1H4TA 1Z7WA 5CA1F 3WGZA 1W96A 4JOBA 4HWGA 7YASA 2PUFA 1SVWA 4QT0A 2QAGA 4O2LA 3TRFA 3R7AA 5SZIA 1U4NA 3KJXA 3P52A 3W34A 1UPAA 4V3CA 1ISGA 4Y2VA 3GUCA 3OE7D 2G36A 1H6CA 1JZSA 2YW2A 4M89A 2VPZA 3EOZA 1M3SA 2GAJA 2RK3A 2WD7B 4WBXC 2JK1A 2IEIA 1KZ1A 2P2YA 4N0EA 5TR9A 3SMVA 1N5OX 5U1PA 4QOJA 1SZJG 3TPCA 2WZCA 1AQYA 1SHKA 1J56A 3ZJYA 4EECA 2EFHB 1NBME 3KKNA 4IDHA 2REQA 3OZUA 4A6PA 3HGTA 3U19A 1TTTA 5DB4A 1H69A 5GP1A 4AZ0A 3FWHA 4KNWA 3Q40A 4ZVSA 3V8PA 3DUFB 2WM3A 4OF4A 5IAEA 2VF2A 3ORFA 3ELUA 3HXPA 1L4KA 4RVGA 5DN6A 1YIOA 2VNKA 2OZLA 4MCHA 3TLCA 2PTHA 4HEA1 5CVTA 5FCDA 1ODFA 4FR0A 1LQUA 5IWAB 1PS0A 2P5YA 1LVHA 5CLGA 4CZ2A 3KQYA 2P77A 2ZUVA 1ZXXA 3AILA 3VU0A 4FDTA 3RV4A 2WF9A 5FYDA 2P8JA 3S2GA 2BW0A 3ZWXA 1JEYA 1SIOA 4BE7B 4LZLA 1NX9A 2YH2A 2Q1UA 4IPTA 4NCHA 4DPLA 5I7WA 4CFSA 4N9QA 5LP6B 1E7WA 2GJ9A 3IUEA 2R6GA 5ALFA 3EYWA 3UJ6A 4GSLA 3G2PA 3AKCA 4N48A 1KJZA 4ZZ1A 3QEOA 2YN2A 2YRXA 2AK2A 4MAMA 4HNSA 4IYJA 1XRMA 2GBLA 2WIJA 1MO4A 4PRLA 2I80A 4IQ8A 2W2VA 5A4AA 5HM6A 1XU7A 2OK7A 4JUBA 4HDOB 2O8EB 3TM5A 1GFIA 4G41A 2CUZA 4JWTA 1GSIA 4AICA 4KQXA 2ZQZA 2P67A 5KTSA 1BVHA 4O4HB 1FLDA 3F46A 2BEVB 3I8OA 2Q50A 1Q7RA 2ERCA 2JLAA 3UXHA 3UICA 2HHLA 1JG3A 2O8BA 3VPHA 1ZK1A 1GYQA 4TSRA 1GY8A 4W8HA 3TIFA 3GLFE 2K5UA 1E0AA 5EMHA 4BQQA 3MJ4A 3TW8B 1IN4A 3I5UA 3N2GB 4R9RA 4KXLA 1P0PA 4UCQA 2I1QA 1EWQA 4UOQA 2PZMA 4QFDA 1UM8A 1JW9B 3VMMA 3U6KA 3V8NA 2D8AA 1KH3A 4O5OA 4WASA 2FUG1 1DXOA 1JHUA 2C1EA 4EMUA 2FDCA 4EA7A 1CE8B 4IUBS 1WHTB 1BYUA 3G6KA 1MJ5A 2XIJA 1U6IA 2FZ4A 1ZJ6A 4P9NA 3WMEA 4AJ1A 5GJBA 1OBFO 2TRSB 3ET4A 4RY9A 1GKIA 3OTWA 4RIFA 5IKPA 3ACDA 1PP4A 2NO1A 2ZBPA 3C5CA 5FP0A 4BJHB 4D44A 5EIOA 4W7HA 5KYXA 2WKPA 4HJRA 1YR3A 1JIQA 4OK6A 5EYPB 2JLYA 4WXPA 3IURA 2ZANA 3IP5A 4AG5A 5CLQA 1RC1A 3QPDA 4Q0MA 2WF5A 3KYDB 4CUJA 5KTOA 3AW9A 1BVYF 3L8YA 2UYHA 1V96A 3SQDA 2HU7A 4HVLA 3RG2A 3HP7A 1WEKA 4Y30A 3UT5A 4AU1A 2IP2A 1Y5RA 2HQBA 3FFBA 2XZLA 4RQBA 4TL7A 1G64A 3K73O 1NQWA 4U7HA 2C7RA 3JQFA 5DRTA 1X19A 4YROA 4HTAA 3V4RA 3V2HA 1JTVA 5HPYB 3RIHA 2FP4A 4BJ1A 4DVJA 3D2LA 3W5SA 3G5TA 3U0VA 3NRBA 1P5ZB 1U5AA 4EJ0A 5FPTA 5AHRA 3VR5A 5KNDH 1FUKA 1WSWA 1YJXA 1S0UA 3C74A 1JQDA 2FFBA 2VDVE 3SR4A 3A6HA 3R9KA 4B3JA 5K0GA 4FQ8A 4H9GA 3ZS8A 3VDNB 1MX3A 2JI8A 3Q11A 3A1UA 4RETA 4X1IA 2NP6A 1A2QA 3M2PA 2R7AA 1UUFA 2ZAOA 1OX4A 4YTEA 4UNSA 5H1YA 5EWLB 3RKRA 4CLOA 1WMEA 3PUZA 1U9IC 4I8IA 3EPHA 4OBXA 2GEKA 1O95A 2WU0A 4RK4A 1XEWX 4AJ9A 4RTOA 2BAGA 3DC2A 1AHIA 3OEEA 3KE9A 4LJ8A 1QHSA 2WJHA 2P7HA 4YV0A 4BNGA 3C7AA 2OAP1 3ICQB 4LJ5A 2WIFA 4BVAA 1E63A 1U7ZA 1WETA 4JEMA 2I2BA 4XAQA 3RKUA 1VM6A 3AUXA 3DB1A 4KFTA 2IEZA 3EG9A 5FNVB 2H1VA 5CRIA 5I8WA 3CZQA 3WK8A 2LDXA 1T25A 1ZISA 4R8LA 2W00A 5J2UB 1KGDA 1GNRA 4BUZA 3MYRA 4BX9A 2ZLBA 4MUNA 5CT5A 3TE7A 1LI4A 5B1HA 3WZMA 4AZ3A 2DKNA 4AKGA 4XSGA 2ZR9A 1GFWA 4RPLA 4IOKA 3UK6A 4YN3A 2Q5EA 1Q22A 1PJAA 2JAQA 3BDAA 3TR5A 2FWNA 1DCMA 3W6PA 2GAFA 3T38A 2ADMA 1JE0A 2PNFA 4D80A 4MWBA 4MI6A 1K68A 3W7AA 1JYFA 1VBNA 3M5DA 2JJ1D 1Z0UA 2QVGA 3R8XA 4R0MA 4H1WA 2YOFA 5EJ6A 2ILTA 4NS1A 1R9NA 3NOXA 3F96A 4Q05A 4L8LA 4TVBA 3WTCA 1WS6A 5F12A 1QIHA 4EW1A 2ZIXA 3QNMA 3QY9A 3FBGA 5EMNA 4PLCA 3K6SB 2YOHA 4DYVA 1TW2A 3BREA 3DS8A 2C2MA 3MTGA 3N7TA 5EESA 3PHBE 4J3NA 4UMFA 3VSAA 4G56A 3SXUB 5CXXA 4GE0A 1RVV1 4MA0A 2BP7A 4P53A 4CMIB 2ZI3A 3FSGA 1VG8A 4FZVA 1RD4A 3ECCA 1RM5A 4NARA 3NGMA 1BOOA 1LPMA 5DM70 2NTJA 3BXEA 1EUCB 3PCXA 3ESCA 4Q4JA 1HFJA 1HE2A 2WUDA 2XJ4A 4E31A 2IFTA 4QOIA 2ZDQA 4FC7A 1E9BA 5EGNA 1VL8A 3U80A 5KJCA 3WRYC 1RM0A 2NUTB 3ZJ4A 3CVVA 2J3JA 2ZDGA 3I6ZA 1DB3A 3MUOA 2JFGA 4KVAA 4JXZA 3DT9A 3ZN2A 4M99A 4NU8X 4V0LA 1X1AA 3O93A 2ODAA 4WEQA 3ZXXA 1AN0A 1U3VA 3CMMA 1XRNA 3E2IA 5A4IS 1ABBA 2R3SA 4KR6A 3A2MA 5JLAA 3UAOA 1CZNA 5GV7A 5AM4A 1O2DA 4BX3A 1BFDA 1X38A 1I3KA 3IE2A 5ARDA 5H70A 1Y9AA 4JQOA 1E3WB 4DTCA 4DMKA 1J49A 2PFSA 2XF8A 3GW8A 4F8JA 4PPQA 3W9SA 1W44A 4ND4A 1K63A 4ZVQA 1E2NA 2B92A 1TJYA 4MJXA 3K0AA 2HY7A 5G0WA 1GUAA 3RARA 3L4BC 3IEUA 3BCSA 4GMDA 3SS9X 4YRIA 3PDJA 3N5CA 1TZCA 2QTMA 5CK5A 4TTAA 1Y4UA 3MTIA 1MU0A 1S8NA 4ER0A 2QTWB 5JR3A 2INGX 2X6TA 4GMFA 4BHTA 5JAPA 4EBFA 1NDUA 5IP5A 3MJTA 1W19A 2G77B 2HWUA 3I83A 2JIOA 5EZ6B 1P7VA 1XYVA 2KLHA 3DCIA 3X1MA 2ZWVA 3QELA 1CCWA 1ZSYA 2RG7A 2ZEJA 4MQLA 4BMNA 1OBOA 2H1CA 4D97A 5BURA 1WXWA 1J8YF 1UF9A 1WW2A 3V4FA 5FV4A 1H4SA 2QYOA 2JLZA 5A5FA 1YZNA 2KSQA 1V35A 1NN5A 5CA1B 3FCCA 1ONSA 2QHXA 1CF2O 2Y77A 3ONVA 4A9AA 1JQ3A 3NBAA 4RXUA 4FHFA 5IN5A 5A3RA 1T9GR 1OY1A 1P9WA 1A82A 1HWYA 2CBZA 3MFYA 3SS8A 2FXIA 3N59A 3R7LA 1VRCA 4G1UC 5J1SB 1X7ZA 5TJ9A 1VIDA 4CM4A 1FFCA 3HWX1 4HPXB 3W2GA 4ECEA 1V7ZA 2E48A 4BCCA 1KP9A 2J3KA 2I7XA 3TJZA 2F17A 1R8QA 1U2QA 1DGQA 1L4HA 4OQNA 2IGTA 5F73A 3UZUA 1E1DA 1WMAA 2WVGA 4C7XA 4FB5A 1Z5NA 1YE3A 3GT0A 4J0KA 1F48A 3GLQA 1ZL0A 4UTVA 1G7SA 2P9QA 2HXSA 2IW3A 4MKXA 4Y6RA 2FMHA 4N7MA 3BH0A 4BDTA 1MDFA 4AXXA 4FGJA 1NSYA 4Y9SA 5CNMA 4A5SA 4YJ3A 3M6WA 1G20B 3S68A 3P8ZA 1A4XA 1VLVA 3OKCA 3LFHA 3F9RA 1MHTA 2EFJA 3OAAD 4XCVA 1SELA 4IV0A 2J48A 4MRMA 3ZR4B 2TS1A 3I6BA 4Y7CA 1M1YA 1WMBA 1XROA 2YMLA 3E5RA 2IU3A 4MV4A 3T9BA 3LUPA 2WT8A 4I66A 1PJ2A 2JGDA 5CT8A 1K98A 5KX5F 4CT0A 2ZIZA 5FULA 5CH3A 3OC0A 4ZAFA 5CBPA 2I1VB 4HXGA 1DIOB 4P0QB 3LP5A 2P4HX 5HKAA 4MKZA 1I4OA 4MMYB 5AJHA 4NJMA 3OLXA 1ISPA 1T5SA 1R0KA 4Z9AA 3NKVA 3DF7A 3HGMA 4LTMA 4FM9A 1HRDA 1KVSA 1DDOA 1YQQA 2HRRA 1YB7A 4NMHA 4O1MA 2G0AA 2JFPA 3IODA 5EXPA 3SE0A 4UNRA 5KTPA 3OPMA 2XOKD 3GLFB 2VT6A 1PJ3A 2AA3A 2OD2A 1FMCA 3HCFA 1RLJA 1X13A 2OECA 2QMHA 5F7OA 2WM2A 2FSGA 1MX9A 3WOHA 2TSYB 1Z08A 3HCAA 2QQFA 3E7PA 4HVTA 3OZRA 2C7QA 1OROA 4FD2A 4ZCMA 3E70C 2CL6X 3MMZA 1E58A 2I4TA 4KODA 4MSUA 4P5EA 4QXPA 1VG0B 3ORSA 2ZIVB 3OU2A 4QPDA 2VLIA 3CWZA 2XQFA 2RG1A 3BRWD 4E30A 3ZHSA 4BXOB 1JR4A 2WNSA 3N0WA 1S2DA 3ES9A 3GEEA 1UBTS 3C8MA 3WMFA 4QGFA 4JSRA 4EW3A 2DUNA 4Y6LA 3QW2A 3KT0A 1FP6A 1SEPA 3DEZA 3K6JA 3LZCA 3ORRA 3QOYA 5HJ5A 1Q1GA 1PJZA 3GLIE 1NQVA 1M7GA 1NBIA 1DAEA 1KNQA 2XXBA 2X15A 4QDUA 1JA1A 1QO9A 2IXDA 1S9DA 3IELA 4TYYA 2I87A 2NXEA 3DOFA 1TYEB 1HL3A 1N2BA 2AN4A 4D02A 2V7QA 4CKWB 2VCHA 1UQUA 2XMSA 3JYLA 4U5XA 4UUQA 3WLOA 5IF3A 1P5FA 3ADCA 1DUSA 2AS0A 2XMRA 4KL8S 1VPWA 3O4RA 4GMHA 4IHJF 2XDAA 1FMTA 1Y4SA 2D2FA 2F00A 3IO3A 3L77A 2LCIA 4KE9A 2B2CA 2CCKA 4LI0A 3C4VA 4YQYA 1HT0A 4B2YA 1B8PA 3VOSA 2I8AA 1LJLA 1E1RD 2RHGB 2RH4A 4KQMA 4RESA 3T5BA 4C3ZA 4WNCA 4C76A 5JDIA 1IWPB 2BGKA 3G02A 4RIGA 5IEJA 6ABPA 4QXOA 2YMPA 1FE8A 5EQDA 1QDLB 3GPLA 4GKKB 4CCAA 2OVFA 4RPKA 1LPBB 1K6EA 1LU9A 2A9FA 1B0AA 2YFHA 4ZAXA 4A8HA 4B73A 4JEHA 1E9AA 2AW5A 5JSHA 3IIIA 3TRDA 4L1KA 1GT6A 4PQYA 2PX8A 1M10A 1QORA 4BUCA 3WB0A 4BECA 4FUQA 4D42A 2WP0A 3QX7A 4Q16A 1GKYA 1QANA 1KJNA 1OSNA 2I67A 2DERA 2R4QA 3NYQA 2W37A 1XE3A 2C5HA 2ZUBA 3JARB 5BNFA 2OQIA 3PGLA 2VG8A 3AEYA 5TQVA 1SURA 1CRWG 3O95A 4GZMA 3NUZA 3RFVA 4DMUB 1OAOA 2Q1WA 4DANA 3WSWA 5B55A 3RYHA 2IDJA 4QDKA 4PBRA 2Q2OA 2OGWA 1AO0A 4HNAA 3MS2A 1K9SA 5DKFA 3SVTA 2D5CA 2H63A 1ESEA 4NBVA 1TAHA 2A5DA 2IZ5A 4E2ZA 2BF4A 2LWIA 3PUWA 1FA9A 1XJQA 4CM6A 1IBMB 5IXYA 1KARA 4B2LA 5AVYA 2J0QA 3O8OB 5F1OA 1ZEJA 1FMLA 4P4SA 1W48A 1QR2A 1J42A 3E3LA 3QE0A 1E3EA 1SKYB 1W2GA 1XEFA 3PQ2A 1ZNWA 5JXIA 1E69A 3BDVA 4IGFA 4OFWA 1Z6XA 3IEIA 4MPPA 5GJWC 5CCXA 3L8MA 3MELA 5THQA 3W8DA 4NG5A 1CS0B 3UB3A 1YDHA 3K5PA 1CR1A 3QUAA 3B6MA 4JB2A 2R9VA 3K9BA 3AJRA 4YJ2F 2O7NA 1MVLA 3O4VA 3ELDA 3VR3D 3U5ZB 3D6MA 1S3FA 2Q5OA 3VHQA 3M4ZA 4X1KA 5HR5A 1FFDA 3GB9A 2HO4A 2OESA 3OLQA 4OFBA 4WLVA 4YB8A 3T52A 4ARZB 4D82A 5CFQA 1WY5A 1VLMA 3D5EA 2AK3A 3OCJA 5EQJB 3GMSA 4WACA 1MKYA 1ZFNA 3Q3CA 1M67A 2H0QA 5TS3A 1P0QA 3C8UA 4WHMA 1WHSB 2JIDA 3ZIAD 5KWSA 2VYNA 3DO5A 5IWCA 2QU8A 1TYAE 1U0FA 4RE6A 2BR5A 1XTRA 1GG8A 3A4MA 4QQNA 4EAAA 4U02A 4UEQA 1XOIA 5K0BA 5G1NA 3ESRA 3SICE 4I1SA 2D6FA 2AZMA 3K15A 2LBPA 3TG8A 3GOQA 3S8MA 4DE5A 4CN9A 3AVXA 4KWIA 3TLKA 3B6EA 4K9KA 4Q66C 2HDNB 3O4IA 4QOHA 2YV2A 2LP4Y 1NJ8A 2VJMB 1VJCA 1K5DA 2W6PA 3A06A 1ZIYA 2P3QA 1U02A 4LNUB 1BDJA 2NU9A 1TUGA 3BPSA 2C8KA 2QQGA 1Y7HA 4J6FA 4LVUA 2VTBA 1HK7A 3AOGA 1MRNA 1P7CA 1W49A 3HCWA 2IUSA 4X41A 3X1YA 1VRVA 2W9XA 5ALXA 3P2EA 4P3OA 2B83A 5JT1A 4QUGA 1EGVB 2FAXA 4ZO6A 5LPNA 1KMQA 3FMOB 3OZCA 4URFA 1SCUB 3I72A 4ZVPA 2PZ8A 3OSZA 1A97A 3DJFA 4MVJF 1RTTA 4IF6A 4JJAA 1WDWB 3L0PA 1YQ9A 2P0EA 3FI0A 4NDAA 4TKUA 4U7PB 3UAZA 1YB4A 3BCRA 4P4LA 4QYTA 1OH7A 3BGVA 3BL5A 3LZ6A 4F06A 2EJBA 4PRYA 4B3IA 4YPOA 1NMYA 2IF2A 4YX9A 1IY9A 2Q41A 2BTEA 3MRXA 2QUIA 4ZTBA 1OZAA 2GEBA 2CXPA 1ZW6A 1RIFA 3BVPA 3GAZA 4HSEA 3ASYA 4RX1A 3T3IA 2QM7A 3CA8A 3AEKB 5IBQA 4CDMA 5D51S 3SJZA 4D8XA 4ZHSA 3KL4A 4R3UC 5BQFA 1QB8A 1ML3A 5A2GA 1FYVA 3B51X 3IB3A 4BWFB 1GGNA 2R2GA 3KUDA 3OLCX 4XASA 4ZCLA 2EHJA 2CGEA 2XDYA 4FONA 1Q3TA 4M55A 5CUQA 5JNVA 5TE9A 1KU6A 1W1WA 2JLCA 1PJBA 2BJVA 2GRUA 3K6KA 4AJLA 1QTQA 2DWUA 4CV1A 1Y4DE 5LXTF 1PTJA 1OLSB 1M6EX 1XCMA 2BGRA 1XRLA 2O6HA 3KLNA 4OFZA 1DEOA 1WUHS 5DFAA 3UAVA 2EIHA 2BI4A 3GARA 4WMLA 1A95A 4N0DA 5IKOA 2J59A 3B6KA 4HDMA 4MS4B 3S2IA 4OYLA 1XMJA 1YGYA 5CXUA 4WK0B 2PD6A 3N8KA 3UK0A 5CB8A 4BLWA 4XGQA 3WFIA 4IO1A 1A9XA 3WV4A 1IQUA 3BN3A 1DTWB 3AUYA 4DCMA 4PG8A 1YQGA 2ZJ0A 2B4QA 4WI1A 5BMVA 2DH5A 3TL2A 1ZIPA 2H59A 1N9KA 3A9TA 2H1FA 2B6HA 1IBRA 2YRWA 4LXGA 4NMWA 4NZMA 2QP9X 5B3JA 2H1OA 2JH8A 1JV2B 3PFNA 4BVHA 3W4KA 2ZB7A 2D62A 4IAOA 3H5AA 1K86A 1Q17A 1ZN9A 4I4TA 1HOTA 2WRZA 3IS3A 1RIIA 1KY5A 1L8XA 1E1CB 4WCFA 4WZBB 3NU1A 4BNDB 1EFTA 3QKRA 4KR7A 3NBYC 1MOSA 3PGVA 2A2ZA 4WNAB 4F2WA 1P4JA 3JWJA 3ZE6A 1FUIA 2F59A 2V7GA 4M83A 4R1UA 4ZD6A 1LSUA 2JFZA 3I05A 3WO0A 4Q9AA 3NJ4A 1S9HA 3EFHA 4JR1A 4LRUA 5BVHB 1T43A 5KX5B 3IBFA 3KZVA 4IV5A 5ILGA 3Q3EA 4UAUA 1ONPA 3NDBB 1TJ4A 4G63A 1V0JA 1G60A 3NXSA 5I01A 3WLEA 5E6RB 4LGVA 4RPCA 3ZWNA 1KJIA 2JD1A 3USES 2G5GX 3DC7A 1S2IA 1ISFA 2CFCA 3Q88A 2IA5A 4PR3A 5H16A 3HYNA 2OFFA 3E23A 2HWYA 1N2CA 4J0CA 4YUXA 1AURA 1NN1A 3R74A 1XZDA 4Z4CA 2EBFX 1H1LB 3V7WA 5H4GA 4IVQA 3F3YA 4G8CA 3S1LA 5K3DA 2QJFA 3ZWCA 4DV7B 3SHFA 4Q00A 3ENVA 3PC3A 4MR9B 2ATCA 4Z6KA 3ADDA 3CLVA 1FW8A 3KT3A 2YYSA 3EXFB 5J9FA 5KHOC 1Q77A 5BN3B 1MN6A 1T6BY 2JGFA 3FZQA 2XYPA 3C3EA 3EGEA 2RJOA 3OPYA 4PAQA 1KH1A 2EZTA 1P3Y1 3NHUA 2Q29A 4Z7NB 1E2LA 3UXYA 2Y6UA 2DPYA 1M34E 1P75A 1CZKA 4IDDA 4G0UA 2QLNA 3KTDA 3WE7A 3AF2A 5JLJA 1E0KA 3TDKA 1P7PA 3TXAA 4IDGA 4KPYA 2Q4TA 1E5XA 4YK7A 4EARA 2C7GA 5A4KA 3I0ZA 3ED5A 2VP3A 3MWFA 5IAOA 3ZDBA 2QMQA 3EBOA 3LCJA 4Y2XA 3PK0A 4GX2A 5H9VA 2C5FA 1P9NA 1P5JA 3DPUA 3FGNA 1CFJA 3Q8MA 5EE1A 1UBHS 1R6XA 1PG0A 1Z4QA 4Z9BA 3JAWA 3S44A 1AUVA 2C00A 3LLSA 1P8AA 3MCAA 4IXMA 3AFOA 5HFAA 3QNWA 3F9IA 2DETA 3CCCA 3H0CA 1ZNXA 2RHTA 3DT6A 1YUBA 5A4DA 1BRMA 1IXSB 3Q7IA 2ZKLA 1N7GA 1GPNA 2WQ7A 4FFMA 1JVSA 2G9QA 3N07A 4W5RA 1GTSA 4ETMA 2TMDA 2ZRIA 1U2RA 4LTNA 3U09A 3I5YA 3DHNA 5TVGA 4PNEA 1K88A 2GEJA 1H4QA 1T6NA 1UC9A 2ZPAA 3ET5A 2DUWA 2HA4A 1IZYA 3HVJA 3OWHA 4HGZA 4PBTA 3H2IA 4BJ5A 4F6RA 3MOIA 4AJKA 4LWZA 3KIPA 1MRSA 1L5SA 1N1DA 3GYBA 3JTMA 2CL5A 3LKVA 4QGHA 1RJWA 4TMZA 3UV3A 4C89A 2VAVA 1NMEA 4ZXPA 3RAEC 3N7UA 3HYSA 5FHRA 3TLGA 2AJLI 3I04A 3UAGA 4PCUA 3OD1A 3KC2A 4FDMA 4QATA 1GZHB 2CKMA 4L6CA 4QELA 4G5OA 4XH9B 4MR8B 1QRRA 1TECE 1UZUA 4JCOA 3U0BA 1H5QA 5BN4B 4N3NA 2PCJA 4Q1FA 3E9ZA 3W2EA 1ORRA 2J9ZB 4J03A 1G20E 4P2GA 4Q3CA 3R3SA 2BBWA 4BZZA 1E62A 4DMLA 3SD7A 4N7JA 5K0LA 3LUGA 4BC1A 3TW0A 4Z5XA 2OORA 3M9WA 5DM4A 3TZEA 3RC8A 1T26A 3LPNA 1BROA 4MPRA 5CM9C 4H0NA 4OHZA 3U40A 4V1CB 3FPGA 1IN5A 1FSGA 5LD2B 2Q8QA 2IOYA 2GK7A 3V6MA 2FMIA 1DE0A 1NJ1A 2GSDA 1GD1O 3MJHA 2I66A 4B83A 3VPBA 3F5QA 4CM8B 3OP4A 3HEAA 3OKPA 4EPWA 1TIPA 2CNKA 2QYTA 1BWPA 3ANLA 3D8SA 5K0EA 1QLHA 1U9YA 1ZCBA 2OCBA 3E03A 4WK2B 1SC4A 3Q8KA 3M6XA 4J75A 1EWYA 4XI9A 1M2FA 1Y9DA 5KO2A 1H5UA 2B5OA 1GPLA 3LIPA 5KNBD 3WWDA 1MJFA 3LHFA 1LDMA 1SXHA 1JDBC 3NM5A 2B5VA 4YJ2B 5KMGB 1GSAA 1PDVA 2ZM5A 1G8SA 3X1JA 4YONB 4R2XA 2F62A 3NONA 5L7TA 2JH3A 3GUHA 2K87A 1KYVA 4DIMA 1P2FA 2Q6KA 1N2SA 2VRCD 2DC1A 3L8HA 1EX9A 1TQ2A 2O3UA 2G1UA 2ZJ3A 5AO9A 5AK3A 1FMJA 4WZ6A 3PFGA 5BQPA 4C7KA 4EPTA 3EPKA 3L07A 3FOCA 3SR3A 1OWLA 1TLTA 2IY8A 3PZBA 4WOCA 2YIJA 4DCJA 4J7XA 4PS1A 4JQYA 2IYZA 4HLUC 3S3TA 2RGNA 2I2AA 1YKFA 1LK0A 3SGLA 3WXBA 4F91B 3IIJA 5TEWA 4MGIR 2B1QA 1WV1A 1U1FA 1RQ7A 3LT5A 4LC1A 5SY6A 1H6AA 4EENA 2ISCA 2I71A 4JYMA 4PCAA 4HX9A 4ANFA 2O8EA 3KSBC 5JWOA 2DCUA 1P3JA 4TOIA 1OLUB 2QMOA 2Q5QA 2C3MA 4O4HA 1FX0B 3VDRA 3V1KA 3QG5A 1OPRA 4XWYA 5K0NA 3UJ9A 4A2CA 2JLUA 5GAJA 2HYDA 3GQBB 1ZGCA 2O0KA 4WECA 3ZNNA 4ALNA 4BRWA 2I3AA 5B7GA 2DWQA 3ZGNA 3WBKA 4BEWA 1PZXA 5TT0A 4WAUA 1H2YA 3N2GA 2P7IA 4IZ6A 1QGDA 4FGKA 1XR3A 2FOIA 3FUXA 3IKTA 2XWJI 3HH8A 1CUUA 3WNQA 2CDNA 1RHRA 2P9CA 2QTTA 3LQ2A 3BK7A 4NYJR 1W4LA 4RELA 3I9V6 1ABEA 4ZREA 2IZZA 3OT1A 3SVLA 3F3KA 2A92A 1AN9A 5F1PA 1B6SA 5HGJA 1FVFA 2VQDA 4NICA 3PB3A 1MDBA 1V6AA 2FFRA 4BO2A 3K0BA 2JKYA 3LECA 1NONA 5AKGA 3ISTA 4DCUA 2IPXA 4DR3B 1D8TA 5IVHA 3AF1A 5EJEA 3GBSA 1NJFA 1R0SA 1WU8A 1V5FA 2GAAA 1VQ1A 3T0GA 4GZLA 1NI5A 3IOMA 3UHJA 3OTOB 3KHTA 5CYGA 4X85A 3DLTA 4RKYA 4HH1A 3K32A 1QH1B 5JD5A 2EKBA 2JCBA 2M32A 3JCZA 2QVZX 1E9EA 4PLTA 1XMVA 3VYRB 3T4PA 4YDSA 4M0PA 3MAAC 3MIIA 2VCYA 1E3TA 1M0SA 1PYOA 3B1XA 4XSHA 1A1VA 1LV7A 1EZ4A 4LXQA 2XQIA 1OC2A 5B2ZA 4O2BF 5CCDA 2EU8A 2PX2A 1FYWA 1L8AA 2V3CC 4TM8A 1G8FA 4G09A 1KVTA 5DX1A 4DUYB 1OZGA 1U2TA 2EFEB 3AYZB 1Z5VA 2CDBA 3JR3A 3QVGA 4EQZA 4ZCPA 5BYBA 2HPHA 3KZMA 4JLBA 3R6DA 5HJEA 4EAQA 4E4YA 1U0BB 4EL0A 2JLSA 4BO8A 4CLRB 3CLSD 4LF7B 2P9GA 2ZJYA 1AIPA 1ZXLA 2O2XA 4FQ7A 1JHOA 4RU1A 1DRVA 3M9LA 1FP4A 4B0OA 1E0DA 1YT5A 3AETA 3M5PA 5EWLA 3WJ2A 4CL3A 3KJIA 4NYIR 2BPOA 4D8TA 1N2EA 1GTRA 2P2ZA 1A04A 3IKLA 1RPNA 2N1BA 1EGHA 2YZNA 3NVKI 3C7CB 1I10A 2HSEA 2JGRA 2ZSUA 3EN0A 4GWLA 4O1IA 4ALLA 4BV3A 1Q3KA 2FYTA 2V3VA 3R5KA 3RI3A 1T15A 4KMRA 5EZ5A 1JJAA 1EHCA 1KRHA 3DWIA 1S02A 1C1XB 3QFFA 1MO5A 4WCVA 5E0KB 5FNVA 5JCPA 3QI2A 3VNBA 2AJDA 2DZDA 2XZOA 1I3CA 5J2UA 1XEXB 1U3GA 1RWKA 2KQUA 3JVUA 5AM1A 4H6WA 4GDMA 4UMVA 2JJ2D 2QLLA 3I6MA 1SCJA 1VRWA 4EY3A 3RIYA 2VWHA 1N9GA 1YUMA 5IHXA 4Q3EA 2P4UA 2ENUA 3NT4A 5E4FA 1PT6A 4XIYA 5ICEA 3SC2B 4I4CA 2RAPA 1GL7A 1XFAA 4B3TB 3M2TA 3GMDA 1FX1A 4QC2A 1C9KA 1SUDA 2GTPA 3FYCA 2QP4A 3X1DA 3LIIA 4KAAA 1GZ7A 6Q21A 2J67A 3R5XA 1WCYA 5K0ZA 3HUDA 3MJRA 4Q9IA 1U81A 2CJXA 2IY7A 3GEIA 3L7AA 4JLJA 4TMVA 4QJ3A 1L1QA 1UM9B 2EGHA 3ST7A 2XOXA 1KSJA 3VTFA 4MROA 3UT6A 2OCPA 1JP7A 3AFMA 4M8LA 4DRYA 3K6SA 4ME6A 1HGXA 1Z37A 2H3EA 3HKCA 4QYMA 2RE8A 5ILQA 5EQTA 3HTXA 4LDQA 2AOUB 1D04A 4BBJA 1COWA 4KAFA 5B7QA 1KQOA 4CMIA 2P27A 3ZWKA 3BT7A 1JYEA 4PZZA 1G9SA 1QH8A 4L95C 3WNVA 3TB4A 5G0UA 3KDSE 3OFNA 3UJDA 5BSEA 5LQRA 4A15A 1CQXA 1NNUA 3IERA 5DP1A 5DGDA 3AUSA 3PDWA 1QGAA 4CMAA 4DCTA 1EUCA 2VPPA 4MUJA 1BOFA 1L5VA 3G7SA 3D2CA 4HY3A 4EHJA 2QRKA 1KO1A 3WRVA 3GJQA 1ZH0A 3U3KA 4AUMA 2ZYUX 2Z4RA 1JNXX 3U7QB 3VVLA 4DUGD 5HCIA 5BOSB 4B85A 2D1RA 4Q6BA 2A1UB 5AI4A 2FG5A 5FKJA 4LYFA 1YA4A 1GL3A 4F6LA 1KHTA 1VJTA 1YK1A 3AR8A 4MUFA 5IX8A 1T5IA 1QG6A 4FCCA 4XDZA 2OBBA 3SXJA 2QN6A 4ZEWA 3EA5A 3LUCA 1E2DA 1LA2A 2JFXA 2G9UA 4Y1RA 3K70B 2YS6A 2IYXA 3L6DA 5FRDA 4B3SB 1L4UA 2WA2A 4CT4B 1KA9H 4ZTUB 2OK8A 3EYAA 2OP1A 4LXYA 1BN7A 1XDGA 1W1UA 5KPDA 4GC5A 1K5HA 4FIDA 3P0IA 4DB2A 4ENPA 3WYDA 5D2CA 1E3WA 1DTSA 4I3HA 4IRUB 4D9IA 3CKMA 1SUEA 3V9PA 2H7YA 1RLIA 2O2GA 3Q1KA 4RM3A 2FEPA 1NT4A 3K09A 3JVIA 3FPHA 3P2KA 1Y5IA 3WLAA 1Y1RA 1ZP6A 3K9FC 3QYFA 4PGAA 4EYOA 4UU7A 2BDTA 3FNHA 3NORA 1VE6A 1T3SA 4UBJA 1CERA 1HA3A 1MX1A 1MB4A 1SUBA 4LIPD 1B26A 3HXMA 5CD1A 4Z8YA 1KI7A 3DDCA 1KK3A 3S28A 4P0PB 4EI9A 1KAHA 2LKCA 1XHFA 4E5PA 1A98A 4Z4QA 1Q0ZA 3FBTA 3HACA 3QENA 5L95A 3GLRA 2IXBA 1TADA 3ONEA 6GPBA 2X77A 1BJRE 4GXTA 1NTOA 1W9HA 1T4BA 1V8BA 2WU3A 1E6WA 4Z1MA 3ZU4A 5FWAA 1TYCA 2C2XA 5DYYA 2VSYA 1POXA 4EFLA 5CA1A 5KKAA 1UMCB 3GA0A 3OTHA 2P1ZA 4TSFD 1BEEA 4U9HS 3ZIUA 4YH1A 3TAXA 2O3JA 4U7JA 1BJTA 2HPAA 5DF1A 2HREA 4AQ7A 4MRRA 2QI9C 4FYKA 2IUUA 4KBGA 1KBZA 3CC8A 4FVTA 4EEKA 3UMRA 4CF7A 2ZRMA 1ODIA 3AH8A 4MVCA 2X0KA 4DSZA 1NW3A 1UBJS 2XWBF 2Y1CA 3F0TA 4DV2B 1U0LA 4CL8A 4YMUA 5FOSA 4BNXA 1YZKA 2DEUA 4XYLA 3R5FA 3ZJVA 2VZ0A 3FFWA 4UBNA 5J1TB 3UG6A 1XA3A 4CMKA 3GLHA 2HPVA 3CGGA