3O91A

High resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
189
structure length
188
Chain Sequence
TKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDCFHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRERRVSTVILTGVLTDIVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAKLVDENLNELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nicotinamidase
publication title High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition by aldehydes .
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 70
structure length 188
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3o91A00
2H0RA 3R77A 2WT9A 3UAOA 4H17A 1XN4A 4WGFA 1NF8A 3TB4A 3MCWA 3HB7A 3TG2A 1ILWA 2WTAA 3OQPA 4L07A 2A67A 3V8EA 3LQYA 3IRVA 3O90A 3S2SA 1NF9A 3EEFA 4WH0A 3O92A 1YZVA 1IM5A 1X9GA 3HU5A 3PL1A 3R2JA 3KL2A 3TXYA 3O93A 3O91A 3O94A 3OT4A 4L08A 1NBAA 2B34A 2FQ1A 1J2RA 1YACA
chains in the Genus database with same CATH superfamily
3VZRA 4I6EA 1XCJA 3HPRA 2Q1XA 3OPXA 4PG6A 3RHZA 4KO1S 2WHPA 3ZJTA 1KEWA 3O73A 4OEHA 3TW6A 1HE4A 2HA6A 4P81A 4TMXA 1Q14A 1KYIA 4MV8A 5CT6A 2CHGA 4F1KA 1AF7A 2FG6C 1ZM9A 2NAPA 4URZR 3CO5A 3UA4A 2W43A 1Z17A 4E33A 1SELA 1P9NA 4ID9A 1FQJA 1X80B 1K5HA 1Z45A 4H31A 2VAMA 4OYLA 2IQ5A 3Q1KA 1UC4B 2QM7A 2ZSKA 2EW1A 2GMWA 4RACA 3NC1C 2C4TA 4AZ0A 3QITA 3U1BA 3CVOA 2MSCB 2X4IA 4AUEA 4EUNA 3S2EA 3D9QX 4NJMA 1I24A 2VUTA 3BDAA 4Y6SA 1ZJ5A 1JR6A 2BKUA 3VNAA 5FEUA 3FR7A 4PTYA 4B76A 2YTZA 8LDHA 3IMCA 1U7TA 4BKRA 2OQ2A 3D6FA 3DMPA 4L27A 4OGLA 4MCJA 5TVGA 4D3ZA 3QHPA 1G8YA 3E84A 3P26A 1Y9EA 3L8GA 1R4NA 1ISJA 2F1RA 4GLLA 5DOZA 5HF5A 4D0SA 2YFKA 5KTPA 2RBGA 5JJIA 2VKTA 1CR0A 2EJBA 2WUDA 5A9RA 5FWXB 3VTKA 1H2EA 1M75A 3FJ1A 1B2RA 1B8NA 1GSAA 2OMEA 2J59A 2NVUA 3TMYA 3P2EA 2PL1A 2B3DA 4CV0A 2NZJA 4P0QB 1M8KA 3U48A 5ES4B 1U7OA 1MW8X 5FUQA 2HQSA 1E2UA 1XX6A 2ZZMA 4G9BA 3NGLA 1DADA 1GDDA 3Q5EA 1I5OA 4NR0A 3ND6A 4IVNA 3MTEA 1BE6A 1DAEA 5KQLA 1U5CA 5C8YA 1SQ0A 1LW6E 1FMLA 1ISIA 4DV3B 5JQGA 5FNZA 4JLUA 3WMFA 2H0RA 1W9MA 4NL4H 1GKLA 4BQPA 1KEZA 3IRUA 4UCXA 2ONCA 2JEZA 3PC4A 3TCKA 1KQPA 1Z4OA 1TA9A 3IP6A 1FRNA 1PR0A 4BFXA 1V96A 4YI5A 1UT8A 2ZE7A 2YY5A 4MIEA 5A06A 4RDXA 2C96A 1A9XA 1NTOA 2WUFA 3ROFA 2O06A 2PRSA 3L40A 5TRTA 2GESA 3UENA 2DQZA 4LE1A 4UZFA 4WZAA 4B0OA 2ILTA 3R5SA 3QM1A 4E4YA 2C8VA 1HM5A 3LBIA 1LS6A 2GM3A 1A0OA 1WCWA 5LC1A 4CQMA 5A4JA 1L6IA 1JA0A 1GYRA 1NXPA 3UK7A 2C8LA 4ZAZA 3V7FA 1JXOA 4NRDA 5B58T 1HO3A 3A1EA 3GC6A 4D0GA 4UPEA 2ZI5A 4Q1BA 2APJA 4YASA 4G23A 4HYYA 1T10A 3ICOA 4NU0A 2YVAA 2BFBA 4OD0A 4XZ3A 2X0EA 1M3SA 3OO0A 5BQXA 3DA8A 5AK0A 4YPFA 4JNCA 1M2VB 1NL3A 4N9QA 3QX3A 2V4ZA 2ZXEA 3GDGA 5TEVA 5DHPA 5K0JA 3NPMA 2QMOA 3RU7A 1BNCA 5F9FA 4FZJA 2QW0X 4LIPD 2MCFA 1FRFS 2N75A 3CUTA 3RTAA 1YWGO 3W5VA 1D4AA 1IK6A 2NU7B 3JY6A 4QASA 1FYFA 1P2TA 1ZK1A 2I6TA 4QM6A 2YN0A 3TLGA 4R3WA 2JHCA 3HR8A 3MF4A 1Q91A 3NLLA 2ZJ3A 1CTQA 3DBVO 3RVQA 3N6VA 1XCPA 2X7JA 3O8BA 1AUPA 3H8SA 4G25A 2NQ2C 3EBPA 4FYIA 2QSUA 3E9RA 1P2DA 3NGMA 1IVNA 1S3GA 3QRWA 4O25A 2ZP1A 4PC6A 4QYTA 3CIOA 4RJKA 3KKQA 2D8AA 2VSNA 1XLTA 3OE5A 4D74A 2GZ1A 4P7FA 1D6MA 3FHLA 1R0YA 3FKQA 4ZD6A 3TNLA 4AKIA 4WX2B 1RRVA 1U1FA 2AZ4A 4OIFA 4OG2A 3NEJA 4GAEA 1TM4E 4EJ2A 2ID7A 2IJGX 5BN3A 2XKKA 1TEVA 4XGNA 1SKYB 4MVCA 4RM3A 4A2WA 3EA4A 2BCJQ 3AHDA 3E2MA 5EXSA 5A9SA 1YGYA 1O6ZA 3K35A 1A8IA 4F3TA 3GCGA 4WZAB 2F1IA 3ZBPA 3NVMB 3WAJA 2R1UA 4IHKA 4JP2A 4EVQA 4CQMB 4FDVA 3HGTA 3OM8A 5EIBC 1UEJA 1T4CA 2AG1A 2BDUA 4P3PA 5I4KA 1YDMA 3ET4A 4G5SA 4L5IA 2H54A 5GJWC 3SM9A 2P6RA 2MT9A 2DB3A 2LKCA 2H8GA 5GY7A 2Q07A 2VTDA 3MTAA 4O1MA 1L5QA 4O4HA 2Z9CA 4OQYA 4TRRA 3V1NA 4Z1MD 1F4PA 2XGOA 2YY6A 3MINB 2FP4B 4WKOA 5KOYA 2HTEA 1SXQA 2XH8A 4HKTA 1RCUA 1Y8AA 2AX4A 4JEMA 3RLFA 3BREA 2P6MA 4LI3X 2REQB 2WIFA 2IPMA 1HE3A 2B4TO 3B1JA 3K1TA 2WF7A 3SXUB 4D9FA 1SVWA 4P8RA 1FDTA 3TK1A 2ZLBA 2AXPA 3CG4A 3I4CA 3UFBA 2VTKA 1YKGA 5BN1A 2HV9A 4KIFA 2QUKA 3C8HA 1I9CA 2NSJA 1IJBA 2C1XA 4IRMA 1Y80A 4IHAA 2DHCA 2QT1A 1YKFA 3HB1A 1PL6A 1QUEA 1XZLA 3HZRA 1I4OA 4P38A 3VNUA 4NS4A 2DR2A 1RRFA 1Z7YA 3K5WA 3ZWNA 2HF9A 3L92A 2YJ5A 1EK2A 2F90A 2ZXFA 3P9QA 4GOMD 3RBVA 4QOJA 1V1MB 4WXEA 3ZTYA 1KIAA 3WIVA 5HKOA 3I3SR 3PNYA 4BU0A 2R5WA 1G291 1O9HA 2A84A 2W58A 1GGNA 1JIUA 3R3WA 1E9FA 3KT3A 1SBHA 4H7IA 5DIFA 5KI6A 5HF9A 2AG6A 1DFHA 4PVDA 2LP4Y 4TXHA 2OKGA 3HKEB 4RGBA 3S27A 4EATA 1PP4A 4AMUA 2QTTA 4C4TA 1ZD3A 1C7EA 3KQVA 5K99A 3LQ2A 1VMAA 1ZYUA 5KUTA 5CB6A 3V8BA 2ZIZA 4B80A 3CVXA 2WM9B 1D1TA 4Y2PA 5LUBA 3Q41A 3ZZNA 2D5IA 5BR7A 3ETCA 3LOUA 1T4CB 1IY8A 2VDKB 3NTOA 4OI4A 5J1SB 4JI4B 4MTCA 4WJZA 1I4DD 2WD7B 1CK4A 3BMCB 2VIIA 3MJSA 1QJ4A 1J24A 1GG2A 2BLNA 5C7IO 4DDHA 3O38A 2O07A 4KYIB 3ZDBA 1USUA 3KHUA 1WCXA 4U2FA 2CL6X 4C4PA 2FSUA 3T38A 1IXRC 5AKGA 2G1PA 4AYXA 3E6AA 3H17A 1IY1A 1UBNA 5C5EA 4DUGD 1Y1QA 1GTRA 2YWBA 3UC9A 1OLXA 4WBNB 4H1WA 2E7ZA 4I8DA 2PS3A 2AKEA 2Q9CA 4HAXA 1M2HA 4PZ9A 1UBLS 4DGSA 1CRQA 2AT1A 2HPVA 1D2MA 4KE8A 3BRWA 2YJNA 3WL5A 3DC7A 2ZRJA 4MWSA 3NTLA 4B9AA 2G06A 5DXFA 2QLBA 1ZJ4A 4HEQA 4CM1A 3GLIA 1EINA 1LH0A 4UHFA 1D6NA 1GQOA 3NBQA 1W19A 2QUJA 2X15A 5LUAA 1UP6A 1ZVKA 3FCYA 3BEOA 4LRTB 4QVKA 1Q5PA 1OXBB 5K3FB 3IPRA 3OZTA 1F3LA 3OZUA 3UJBA 4DM3A 2NSHA 1AZLA 2BTOA 4GPIB 1I2BA 1I10A 1LC0A 1TKCA 3HYNA 3NC0C 1AX9A 1KSJA 4KV7A 3VPDA 1RLIA 3CNHA 4IH1A 4KKXB 3TS1A 4UBIA 1O08A 1HBJA 2EWWA 2JGLA 3DTVB 3V3KA 5KS2A 4DR2B 3ODPA 4FCVA 1GTL1 1GTMA 2X86A 1L8QA 3D54D 2PZBA 1Y1TA 3L7IA 1EVZA 1JDBC 1MFZA 1ZI9A 1N57A 2BMWA 2Z95A 4JFAA 2QN3A 1Q1QA 3AUUA 4G86A 4YALA 4BC0A 4R2WA 1U2ZA 5F7XA 3L4KA 1E6LA 1TW3A 1Z5PA 2XDQB 4G9GA 2ZW9A 3CW9A 2G70A 1RCFA 2HA4A 1Z6GA 2JI4A 2X8BA 1E5XA 3AU9A 3SJCA 1K88A 3ENQA 3HBLA 5CFOA 2WNHA 4RA9A 3EOZA 4DQKA 1F0NA 2X5JO 5B1DA 5CA0F 1N2OA 2H4YA 5G02A 1Y63A 3DO6A 3KZNA 3S29A 3EAQA 3KLPX 1QO7A 2L2QA 1VI5A 2O2CA 1ZSYA 2FW8A 4IXTA 1RIFA 1BXZA 1D2CA 1HURA 4RE6A 3TDKA 1P4JA 2O8DA 1N0VC 1S1CA 3TDMA 4QYXA 2BKVA 1A8HA 1D04A 1DQSA 3BUSA 6PFKA 5JZVA 4AICA 1T9GR 3BMNA 3WX0A 4PIPA 4EPXA 2QA5A 1AQJA 3UCEA 2PWYA 4H4CA 5HIKA 3M6MD 5KKCA 3IH5A 3B1WA 1M7BA 1ECCA 1G8AA 4TL9A 4CQMD 3U4QB 3KJFA 2PZMA 4M38A 1YZFA 4E11A 3KSRA 3PSHA 4MMXB 3JRNA 2H16A 3GLIB 3GELA 4MLDA 1PW7A 2QGNA 3PTLA 4OVKA 3MD0A 1SJ9A 1P7VA 3ELDA 3FFXA 4X93A 3VR4H 1NYRA 4FC7A 5F23A 1LRKA 1VCNA 4KLNA 1XAIA 2PJRA 2F48A 3DV9A 1OF1A 5CDGA 3JZIA 2CSXA 3V8QA 4AP5A 1TEZA 3KWMA 2AOWA 1DJLA 1CUYA 1E6CA 3D4PA 3VSDA 3LM8A 3RASA 2WJYA 4ABYA 2GN4A 1H6BA 2A14A 2FZKA 3WZMA 1ZL2A 4ERNA 4WOCA 3WB2A 3K2EA 3P9XA 2G09A 4V1CA 5EIEA 5I4BA 4KR3A 2J0SA 1R4MA 2ETXA 4E2WA 1O5OA 2QP3A 2R7LA 1URPA 4WNAB 3KOZA 2ZR7A 4R68A 3GLGA 4NCAA 1BE8A 3F3SA 3GIDA 1N9KA 3GMTA 4OFBA 4R1PA 4WFJA 5GVSA 4V39A 1X7ZA 2XCTB 2ZANA 2JANA 4M8LA 4QREA 5J9FA 4KMMA 1VIDA 4Z4IA 1JIVA 1EK0A 2QTLA 2QRGA 2W6NA 1LI5A 1ZR2A 4C4SA 4BQIA 4PLGA 4DAOA 2QJFA 4I4TB 4D6PA 1XMXA 2A0YA 2WYUA 1P44A 1QH0A 2OCGA 1CUAA 3L0YA 3AY0A 3DPIA 2W2VA 4LBZA 4F7DA 4Y7CA 3EAFA 3OUUA 3ACDA 3ZE6A 1PGPA 3TM5A 1ZCAA 4XTCS 1ARZA 4XFKA 2VP3A 3HU2A 2ZM6B 1C1DB 4IJ5A 1GR1A 2ZAMA 3KWFA 1BXGA 3MIIA 3MTBA 3A9RA 4PZZA 4DQVA 3EISA 1NT2A 4KXXA 5I6DA 3RFXA 2J5BA 1RYMA 3EWNA 3I64A 4K9MA 4TWAA 2Z8XA 2DBRA 3RF6A 3PXDA 4K88A 3SYTA 3MGAA 3TJZA 3HUDA 3F67A 1ABFA 1JLMA 1XP8A 1Y9JA 4CODB 1DLIA 1FUYB 2VAXA 5ESXA 5SZJA 1M66A 1X6VA 4RK7A 4TMVA 4ZA2A 3K3PA 3NBFA 2FMTA 1MABA 1V16A 3KKPA 4DV1B 4JODA 4UCFA 5FFFA 2ZYVX 3KSAC 4CKYA 2VDOB 1L5FA 2XB2A 3COPA 2D0PB 2QR3A 3I9NA 4TZKA 5DP1A 4OO3A 4QEKA 3EGVA 2DX7A 4WLOA 5I5EA 2RH9B 5F3DA 1JWLA 1WKBA 3HZHA 1BA3A 3SLKA 3UOAB 3NFRA 3LVRE 5KVAA 3UPUA 2EVWX 1UDWA 3OCCA 5JQWA 1ISRA 5CIWA 1XVIA 5H02A 2QUIA 1YJXA 4Q18A 2VCHA 4NEHB 5IZ4A 1VBKA 1ZICA 2OAGA 2QIPA 3HYTA 4OHOA 5LJIA 2XT0A 2DF8A 1R16A 2DZDA 1RWVA 1P5HA 4J1NA 4KP7A 2EX1A 5AVKA 2D8MA 2EERA 5I7RA 5AHXA 1J0EA 2GBCA 4HGZA 2R9VA 3WKEA 3LRXA 4TL6A 1QK3A 2LPMA 1ZEJA 2C7GA 4H7KA 1X7DA 2DFDA 4PX3A 3N7TA 1TYCA 3IOYA 2W90A 3M1LA 5LQJA 3D3QA 1LK5A 3HNRA 4ARBA 3LHSA 1Y4UA 2J5QA 3FI0A 3QE3A 1D6JA 1P0IA 3EIQA 5JFTA 2IOFA 2VJNA 1G8GA 5L3ZA 1NF8A 4MPDA 3BC1A 5JS8A 1YZTA 3KELA 3PDCA 1LZLA 4Q48A 5CGQB 3OC0A 5KIAA 3IIKA 3SJBA 5DYWA 3U1VA 3U7EB 2JFQA 2IBMA 3N0TA 1EWRA 1WF6A 1MKYA 4Z3KA 5IG2A 2ECFA 2XMZA 3WLEA 5C8ZA 2LR0A 2PT9A 2WF8A 3ZNQA 3WGTA 4FYMA 4W5NA 3ZZUA 3HR4A 2M6RA 2ONZA 2ATEA 1BEUB 3MMSA 3ENNA 3TEFA 1WZEA 2GK3A 3LKVA 1C2YA 3ANNA 4GRAA 2X0RA 5ITVA 4PQYA 3CZ9A 2NU6A 4GXNA 4R7ZA 3K30A 4G4GA 5JECA 1JAXA 2LNDA 3F6YA 1T8PA 3HN2A 2W6CX 5BT9A 4BFTA 1J9GA 4DEYA 3IOMA 5KWJA 3KSDO 2QN2A 5LM3A 1SCIA 1XYVA 4HNVA 4B82A 4E5SA 3DNMA 4CF4A 3L93A 1LLQA 3O21A 4LDAA 1IOLA 4QFBA 3M6UA 3PQDA 3LL7A 4C2AA 1QFJA 1XIVA 3PPIA 4J9UE 1ODSA 4JJ8A 2QL9A 4J03A 1QYVA 3R09A 3N76A 4AJ4A 4UTRA 1Y6FA 3FOCA 4ZI7A 3P1JA 1G2QA 1HI9A 2FLKA 4D3SA 2UXCB 1Q21A 1FTWA 3GJXC 4FHEA 3F71A 3EJ6A 1UBRS 3RF7A 1YJQA 4J0GA 4W1RA 5DHRA 5EVCA 3LSTA 1II8B 2IXFA 3BRWD 2QZ9A 2IUTA 5HMMA 1C4XA 3NNNA 4OHRA 1DWOA 3JD1A 5L4LA 2BHLA 4AYTA 5LMCA 5A04A 3PV0A 1YCGA 1IN7A 1I1OA 2I65A 3U9LA 1TZMA 1FVFA 1X13A 1Q0RA 3AHFA 4EARA 1CU1A 1F4VA 2Z4RA 3AVVA 1Q17A 4D2IA 1NLMA 4EGAA 4JGGA 4EVSA 3FX2A 1PUXA 4QDJA 1K8YB 4AWBA 1G4UR 3A70A 1G18A 1P73A 4S3MA 3AEZA 3EMBA 3U7IA 4BUJA 3H1EA 5LZ5A 3QVMA 1NJFA 1M2FA 2POCA 1WLYA 1HT2E 3GQBA 5F1YA 1FC0A 1O2DA 2IT1A 2WM8A 1S4QA 3DVAA 2H1OA 1OYWA 1XK6A 3WNQA 2PPLA 3TL2A 4ZOLA 1EP9A 5ICSA 1OWOA 4WESB 4B17A 4KXNA 2WYOA 1N75A 2FZCA 3CNQS 1U0JA 1F3OA 2IYPA 2GN8A 3A58B 4FW9A 5I9LA 2QVXX 4E5MA 5A5DA 3PSAA 3MIZA 2FN4A 4OA8A 1Z7BA 1N5OX 1R1DA 3EZ6A 3ZBUA 4ETWA 2ZAYA 4JZYA 2X5NA 3GNQA 3L6RA 4W5TA 1E79A 2V6JA 3WK7A 2ID8A 4RWEA 1V5WA 4TTSA 5C1IA 1R12A 4OB6A 4E51A 3RVBA 3VO1A 5KYUB 3VMMA 4EHKA 4TWJA 3M33A 1KY4A 4MVJA 1MEJA 3X1JA 4G1FA 3BCUA 3L0SA 5ELLA 1U6KA 5IJXA 4BMPB 1HKHA 3DE5X 1GL9B 1NRIA 1NVXQ 4I4NA 4X1YA 1Y4SA 5ALHA 4NBLA 2E87A 1XXLA 3TTXA 2CXPA 4FNAA 2H65A 4R8RA 4CFYA 1JJ7A 3HGMA 1AUOA 4W63A 5T6MA 4CFSA 3RK1A 3IS3A 2PKQO 4KBYA 5TX7A 3OZXA 4MI9A 1SD1A 1VL2A 2F3TA 4RK5A 4NVRA 3SOZA 3NV9A 2OGZA 2H57A 4YS6A 5ERGB 4EI2A 1CZLA 1EKXA 3H0KA 4DS3A 3EQZA 1LDBA 3OCUA 2PT6A 3REFA 4YRPA 2EJUA 3VTZA 2PU5A 5B3KA 3MYRA 1XXHE 2XMPA 3RDPA 1XMPA 4DADA 2ID9A 5HCNA 3M4JA 4E31A 3BJEA 2CXUA 2IU0A 3TAUA 3A3KA 3R2JA 3P4UA 2Z6AA 4GPBA 5TV2A 3FUWA 3KJEA 2Z8YM 4MMZB 1CZNA 1N5LA 3CT6A 4EA8A 3TW8A 2QPOA 1T8TA 1HSZA 2ZTSA 3GQBB 3HYLA 1V2HE 3B5EA 2EZ4A 2GPBA 2YJ4A 2NV2B 2ZCVA 3DVAB 1Y3FE 2AHRA 2XUAA 3KR9A 4FP9A 4GXRA 4J0KA 5EEGA 3QF4A 3CUYA 3ELYA 2AG5A 3FTPA 4IYJA 1DG1G 1N6HA 2HR1A 3U7FB 2AIRA 3F7MA 1SIWA 2O8CA 1NGSA 5LDGA 3CX3A 3H7IA 3PGJA 3MWFA 3RBXA 5L7TA 1LDMA 1FUEA 2PJZA 3G89A 3KO8A 3H99A 4PR3A 3K1AB 2DRIA 1PUIA 1UK9A 2E6KA 3R76A 1JHRA 3WLNA 1Q11A 3ZV7A 4OP1A 3VYRB 4I50A 4OBXA 1DAHA 3O2QB 4HK4A 3H3JA 4BAUA 3HE3A 3V8VA 1YOVA 4M36A 1NW3A 1YJCA 3KKZA 4FC6A 4CW7A 4DCGA 3LZCA 2H2FA 1JE0A 5DBHX 2FPPA 4M0KA 1Z6PA 4QQNA 4H17A 1YRHA 4CL2A 3WFZA 4GS5A 1H85A 1KMQA 3QBTA 4OMCA 4X1YB 4B5LA 5LOVB 4YFYA 1YFJA 2P6OA 3LP8A 1M6NA 2ADFA 1GGKA 4BLPA 2GZ3A 4WL0A 2GS9A 4A8HA 4G5YA 3GVPA 4DLTA 3OOJA 4UHCA 4B33A 2ZKIA 3G49A 1ECJA 1N34B 5JZBA 1Z2EA 2EWVA 4KQGA 3TSYA 2WYWA 2X3FA 4D42A 3ZVKA 1P77A 2WJZB 3K2IA 4OK6A 2BV3A 3FVRA 2BCEA 2JHAA 1XLTC 4LX0A 3FYSA 4NYMR 4CL3A 2I7CA 2Q62A 1XMSA 2MSDB 2XWPA 3E5MA 4PO8A 1O8BA 2NUTA 4C5CA 3C41J 1JDPA 2XUFA 1ISMA 5D7BA 2NPIA 5KSZA 2QRNA 3W4JA 4QFCA 4BY9E 2YDYA 2ZB8A 4ZO9A 1KOLA 4Q5IA 3L0CA 1QE3A 1KYTA 4X1IB 4WZ6A 4ND3A 3X2EA 4JK3A 3V9PA 1G2OA 5KHAA 3ACBA 4DCPA 1ZY2A 1SNYA 2CEKA 5CLIA 3TZQA 5C8DA 1H2YA 3W2IA 3N74A 2Y1CA 3COYA 4M8KA 4NX2A 2QI9F 4PYMA 4RF2A 5ESWA 5HEKA 3SC6A 3F5MA 4C20A 2QX6A 3NTQA 3KZCA 5D84A 4GZ3A 3OWOA 2X0JA 4HAIA 4MV1A 5BQOA 4JV5B 1KXJA 5DNWA 2I71A 2VJDA 4FMDF 1A72A 2VZ0A 4JHLA 1H22A 1XDZA 1N0HA 2I6XA 5AXBA 4YQFA 5DEOA 1E7YA 4ZVQA 4EI9A 4DR5B 3O1HB 2I4TA 5LXTB 1IC6A 1NKVA 3ICEA 1O3YA 1BQ3A 4I50B 2A0FA 2V7TA 1WPXA 1Z4JA 2F8LA 3ESZA 3CLKA 3FYHA 3KT0A 4I1OA 4MIOA 1YASA 2PX0A 2Q99A 2C88A 3LKZA 2XNDA 3QW4B 4B3JA 1G1AA 3BGSA 3E9MA 3B3JA 3BVPA 4KE7A 4TUYF 3RR2A 3DZGA 3SJUA 3VO9A 4UNRA 3U16A 2FPPB 5INTA 1KBOA 1T5SA 2I4MA 4EG6A 2CBZA 1LK0A 4N5MA 4NEGA 4QGAA 4IXDA 3UGKA 1K2VN 1WLSA 3I2GA 1IHDA 2Z6VA 1JEEA 2JGMA 3IQZA 2JC3A 4Y2VA 4MI3A 2QIOA 1J56A 3FPCA 1KGSA 4B7CA 2FPRA 4J7XA 3EH1A 1JWAB 3Q0TA 4J6EA 3UT5A 4F8JA 3Q7SA 3PGMA 2VVTA 3ETNA 4K87A 2FUEA 1RWPA 1NBIA 4Q37A 4HMQA 1C30B 1H05A 2LWIA 1LS1A 2PRYA 2AC4A 5BSHA 4L4XA 5ALGA 4G4JA 5KINB 3OOYA 4LZPA 4AIIA 1RC8A 2ONYA 2WIBA 4BGVA 2W7TA 1QF6A 4GWLA 3KTAB 1SHLA 4NYJQ 1JJIA 3STHA 5ALFA 1KEEB 2JBWA 4ZRDA 4XQ9A 1N6NA 5AK4A 1J7JA 1OXUA 1D03A 3C24A 4Z0NA 1JYFA 1M6YA 5TEWA 3IO3A 2H5IA 5LQCA 1UXJA 3ZI7A 4JJIA 2BKLA 2XDWA 2Q45A 4IJQA 3IBSA 4P35A 2WIJA 5FCDA 2CLKB 4RH3A 3U40A 1NYTA 1NQTA 2Q0QA 2H06A 1YXMA 3LYLA 3PXXA 3QEAZ 4DMMA 2H00A 3X3HA 4AL4A 4B3BA 4EYEA 2O6LA 1AUQA 1OA1A 1W76A 2WV7A 4NESA 5JYEA 4ICIA 1QQAA 1UWKA 4ZQEA 1HYGA 2OYRA 4AJ1A 3VKGA 3C3CA 3VO2A 1RP1A 2CFCA 1GIAA 4PIVA 1NR1A 4GMDA 2W8ZA 1Z0IA 1I30A 3EVZA 5KX5F 1ZUNA 2B9EA 2WU3A 1ZNWA 3PE3A 4OUKX 4OUDA 1AZSC 1CQPA 1JHYA 3IDFA 3X1KA 5KMGB 1VBMA 4ARIA 1FXWA 4MVWA 3ZIAA 1FSFA 1U28A 2HBZA 3BG5A 1W59A 3L5OA 2EQAA 1HMPA 3FJYA 4WVFA 5GMOA 2XQVA 4MW4A 3Q40A 2PSEA 2JW5A 4C7KA 4MXDA 5JPCA 3B3QA 3TRDA 3MWEA 3NMUF 5LKAA 2AA3A 3HVHA 2FFBA 1G16A 1P0MA 1NXVA 4XWAA 1E3IA 5HG0A 5TGDA 3LAWA 4YMSA 4Y6PA 1Z34A 4DQUA 1LTHR 1SUEA 2GN9A 2GPAA 2VAVA 4S12A 1JTFA 3DHEA 4E4RA 3TM4A 4C5BA 4IXMA 4JQCA 5LN1A 1PBNA 4OGKA 1YJ8A 4D4MA 2ODEA 2YUTA 3TUIC 7MDHA 5K4AA 1XK7A 1OV6A 1JAIA 2AF3C 5B6IA 4HH4A 4B85A 1R00A 1VE3A 4MYUA 4G5FA 2AN9A 3DLTA 5ESRA 4BL5A 1RNLA 2G82A 4XXHA 2G76A 2PUCA 1NP3A 4B44A 1X14A 2VPZA 1NF2A 2OFXA 2FI1A 3AF0A 3CJQA 3FUCA 4P3OA 4PV7A 4X85A 4R6XA 4DQDA 2GWHA 3FPEA 4ZV4A 2O52A 4LTNA 3R7DA 1UF9A 2RSLA 3FYUB 1PVVA 2CDAA 2NT4A 3I9MA 3KWJA 4IV0A 1CNEA 2ZJ4A 3S44A 2L42A 2BT4A 2GEKA 3VOAA 2A9OA 4JI1B 1NWCA 5BQ5A 4JNKA 5B1YA 3AVOA 2RC5A 4RVOA 4QD3A 3ONEA 2O5RA 3IQFA 4XEHA 5BORA 1OX5A 4I9NA 3ZEAA 3EFEA 3RIXA 3KKNA 3O03A 3SPXA 1YH3A 3N7AA 2QYOA 1KVRA 3QP9A 2AB0A 3KEMA 4WCVA 4E5NA 1QRTA 4P4TA 2OXRA 4DL9A 1ULZA 3HN6A 1C3XA 1ZMXA 3N0XA 3OZWA 3PE6A 4MI1A 4Y8VA 1AK2A 5JCZA 1SOVA 4CLRA 4MPTA 3W77A 1J0BA 1X1EA 5BRJA 4PSDA 2O3RA 1AJEA 3BJMA 2WF6A 5K8UA 1Z8NA 1GA1A 2HWKA 3FI9A 4UMDA 2FPOA 4OUDB 5IJWA 1BFDA 1ORRA 2P11A 2P91A 2V3VA 4PZPA 3FMGA 2II6A 1VIMA 1DKQA 3DKRA 4Q9HA 1D0VA 1E6KA 4ZEXA 5U4XA 3ZLUA 3ZVNA 1MTZA 2CXNA 2G9QA 3X0DA 5F5XA 5JROA 2VHUA 3LX5A 3LRPA 4HY3A 3W7BA 2GCNA 3ABIA 2ZRKA 3G2MA 3TO5A 2REXB 3IUQA 4EL0A 4YT4A 1PFYA 5ALPA 1EFCA 4F6RA 4EA7A 5LD2C 3WIEA 2BEUA 2WVJA 1E9DA 5EUBA 4PNEA 4FZ3A 2ATIA 3GFSA 4NDAA 4WKCA 4MWBA 3BK7A 1KJWA 1TMGE 4J7UA 1PJ8A 3GFGA 4U3JB 4C0LA 4D25A 5E8JA 4J0EA 1CRZA 3VHXA 3DT8A 3VR2A 2ZCUA 4CMAA 3H5AA 3FGOA 1GO2A 1G8HA 3FWYA 2JFHA 4Y9SA 5DHUA 3AKZA 5ESDA 1MZVA 5B2EA 4UJ5A 1L4LA 2VF7A 1HETA 3TIIA 4DIKA 4BFYA 4MCHA 4NZMA 1W4CA 3W5IA 5CVVA 1L7OA 3A1UA 2VRNA 4EGFA 1YTUA 3GLHE 2QMYA 2W48A 4AY3A 1KI1A 2ZFUA 1ZH4A 2EFYA 5TJ9A 1EFDN 2P1RA 1MQAA 2XD9A 1PNTA 1W4BA 3CS3A 5DYNA 3FLEA 5EI5A 1HY3A 1NF3A 1RRKA 3AUSA 3U7QA 1MOQA 4ND5A 1ZH8A 2DPLA 4ZC1A 5A5FA 1XZKA 4LXTA 2I1VB 4OOEA 1RZVA 2O3UA 1X3LA 5B6PA 1L5SA 4KEAA 3LPNA 5LZ4A 4N41A 2IHYA 1Q7EA 2VXYA 3AHCA 3WISA 5E4JA 4IOKA 5FBQB 3AEXA 1PR9A 4W9MC 4Q16A 4Q34A 2XQKA 3EUFA 3HSSA 2PX2A 3CSSA 1VBNA 2OQRA 2PLRA 1B3BA 2C3MA 2XCIA 3FLMA 2EW8A 3H5TA 4Z8XA 3ZXXA 1Z0DA 3ASZA 5DCWA 1M1NA 5AQEA 4W5OA 1FLNA 3QPDA 2X9QA 1JVNA 4RAOA 4UAGA 4QLOA 3ZWBA 4B34A 1E96A 4MCIA 3V97A 3P27A 4FZVA 3A6KA 3OZRA 3H2KA 4KGVA 3PDIB 4XJTA 2HMAA 2IXTA 4CM3A 5FAKA 5GZ1A 2DYKA 2HA5A 2LXNA 2W11A 2HU8A 3AOGA 3DHNA 2HAEA 2Y0DA 3F1KA 4IHJB 4F72A 3WZLA 4RA6B 1F5NA 1QTRA 4RVCA 5CVCA 4WGGA 4B7AA 3KLMX 4L08A 5LZ8A 1B8OA 2A0WA 2IPAB 1CUBA 2QZZA 3AFNA 1VL8A 3AEKB 4B6RA 1AK9A 4EPWA 1WXIA 1WKVA 4RAQA 3SHOA 4XDHA 4DSOA 3ZH2A 5JS1A 4J0JA 1FBNA 5FWAA 1UJNA 3P4YA 3WP0A 4FR0A 4Y2TA 3SYKA 4CQJA 3G59A 4MUYA 3WQSB 5C7YA 2OZLB 2YWHA 4UUPA 2VDRB 5BSTA 5BN4A 1U7DA 2AR7A 3LJKA 3MRXA 2AQ8A 3H1BA 3AZPA 2UVQA 5A2QA 5C46F 3NHBA 5ULLA 4C07A 1WXQA 3TZHA 3VUEA 3GAFA 3QVGB 2IH2A 1OBVA 2Q1UA 2DFKB 5C7OO 1V8PA 2WWRA 1EQAA 3KR1A 4ZMRA 5FKJA 2DBZA 3I83A 4MR8A 3MB5A 4ZT2A 3WLSA 3ZVRA 1QGUB 4UM7A 3UUWA 1JSLA 1Q0QA 2CLHB 4X20A 3PD7A 4IGIA 1A76A 1T4DA 2PWPA 1HFKA 4PPQA 3U7QB 1DRVA 2G3YA 3W90A 5BP7A 3SICE 2V1UA 2ZYSA 4AZVA 3SBOA 3AR7A 3FUVA 3I3OA 4BKQA 4ALJA 1V6SA 4RLQA 5IZCA 3GFOA 2WAMA 1DMSA 4NHOA 1FIUA 1SKUA 4UD6A 4PG8A 1W44A 2X7XA 1TC1A 4D9EA 3OPQA 2C9ZA 3BB4A 4MS3A 1T36A 1A8PA 5LCXA 2EV9A 4EG8A 1XVTA 4ANFA 4BFWA 3LQFA 4H7HA 4ZRNA 4U4AA 3VU1A 4P5PA 1FFYA 4Q9IA 2ZRHA 2AWOA 5AI0A 1F1BA 4YCCA 5AKJA 3A6LA 4EEKA 4AJIA 3ASYA 2P68A 3TZKA 4GM1A 3MJVA 3IERA 3PWTA 3CFYA 4HZUB 3UXHA 1WF3A 1BHSA 4R5HA 5BWMA 5GIPE 1Z4NA 4OHWA 2QYTA 4TN1A 2Z58A 3GVXA 4J07A 5T3UA 2EFGA 3P7MA 4ZT3A 3S55A 3JQEA 3S40A 3WYFA 1MW9X 2K7FA 4CGYA 1RYYA 1GPLA 4MUMA 1XTIA 1CRLA 3F7TA 4FBLA 1POXA 5ARBA 1QTNA 1TD1A 1RZUA 3V42A 1BMTA 2HO4A 1E0SA 2QDXA 3M6VA 3WYGA 3ZIAD 5C80A 1ZAKA 1CX9B 1R9JA 1FRQA 1FSZA 1DEHA 2I6FA 3G5TA 2GBPA 3KAPA 4ED9A 5LWHA 1AHPA 3CPHA 1E2FA 2FXIA 1E8MA 2DSNA 4X7BA 3EIFA 5UKDA 3VR6A 3AHIA 5BUZA 5CG1A 3V6LA 3JR7A 2JFZA 5ELMA 1WDWB 3ZKWB 5JFGA 4JP1A 4Y9RA 2PBLA 1V8BA 5EMMA 3ZWCA 4A0HA 4DR1B 5FTKA 3Q3CA 3QVTA 1BDMA 4I9FA 2I62A 5LNK6 3P0IA 2JLCA 1GLVA 1M2EA 5BV2P 2BDEA 2RAFA 3L7MA 4LXXA 5KQPA 2QR2A 2CD7A 1D0IA 1GFWA 3MLAA 4C6HA 1FTNA 3NBMA 3BWVA 4NZNA 4BJ1A 1NUSA 3I5MA 4ZQHA 6CHYA 3H4TA 4MW2A 1PX2A 3V4LA 3EG5A 1NW4A 5FEMA 5TPWA 4JXJA 3MW8A 1WVIA 4KO4S 4MARA 3H1FA 1T9CA 4YN3A 5DHSA 5KZMB 1SG9A 1YMUA 2HWUA 3KVRA 3DZKA 4TRJA 4IHQA 3WLRA 2HK8A 3A3OA 4EEZA 1L8AA 2JAQA 4JSYA 5I7OA 2C4MA 1OXXK 3TZLA 1Q1BA 2EBUA 1XV5A 3R0QA 4I3GA 3G2IA 1OJ7A 4CETA 3ORYA 2WDZA 1HMYA 4WE3A 1Z2CA 2RH5A 2NTJA 2X14A 2PL5A 1DCTA 1DC6A 2RG1A 3SZ3A 1DIOB 1L7RA 2D06A 4GC9A 4MVJG 1XD8A 1VG8A 3MPUA 3RUPA 5IULC 3C1AA 2FMXA 1ZBQA 2Q6OA 4ARUA 4QE3A 4YV7A 1JZSA 4YCMA 3ZDDA 4A6EA 3NB0A 2MR5A 4ZDKA 4KSCA 3KETA 1P2GA 2UXBB 1Q95A 4XM2A 1GLNA 2IYVA 2XVYA 4E32A 1XZFA 2ZQYA 1QFMA 5L4NA 3TYXA 3WIBA 3KL4A 2A35A 4DMLA 3ZGZA 2HCJB 1SOWA 2YJ6A 3W5DA 2G5CA 4HDSA 4TV8A 5SV2A 3RU9A 1NW6A 3GVHA 3S6JA 4D8WA 3PBKA 3AY7A 4IF4A 2GAJA 4IM7A 3QIVA 3KZXA 4NAUA 4UAJA 3U3OA 4M9XA 3ZI0A 5E3HA 4EWLA 2LCQA 1Q7TA 3X1YA 3A6PC 4QC2A 2G80A 2DH5A 1E59A 1Z4QA 1I6KA 4FYXA 5DSXA 4FDTA 4IX1A 1KDTA 4X94A 3AX6A 1QV7A 3TPFA 2EFCB 1RKUA 1L5YA 4MICA 1SC4A 3EXFA 2HXGA 3F47A 3N8DA 4RTOA 2QZJA 1F2VA 5I9TA 2ZB7A 2C2BA 3F9CA 4EG4A 1KMHA 2UYHA 3BFKA 2HIGA 5H8WA 2DT5A 1YF3A 3DE3X 4J7CA 2YFYA 2PMBA 3BQ9A 3H2SA 2V7EA 2YVUA 4TMTA 1U11A 2Q2QA 3SDBA 1WXGA 3A31A 5CB0A 3KQQA 5DRYA 3VR2D 3C5CA 2ZTVA 4N18A 1PV2A 1QRSA 4JJEA 2O2EA 1IUNA 2GSDA 4AUNA 3EF3A 4EF4A 3GG9A 1PHRA 2Q2WA 3LTEA 1L5LA 3I5YA 1RQPA 1AVTA 1LBIA 3ZVMA 2ZU0C 3T1HB 2RGUA 1PR3A 2BBWA 4IGAA 2QNRA 4UFPA 3EDOA 2W0SA 3GDWA 1CY1A 2M2IA 4F12A 1B26A 1JB9A 1DZIA 3BPSA 4E08A 2UUAB 3HYSA 4HQ0A 3F3MA 1GTVA 3F1LA 5TMDA 1PDOA 4F2HA 2COEA 4KGXA 2R79A 1KSGA 3QUQA 4N5HX 4N5IX 2FX2A 3JSXA 5K6AA 3U60B 4NYIR 1M1YA 1X2EA 1GVNB 5FPTA 5HFJA 3VDQA 4YAJA 5C51B 1RHMA 1OAKA 3MJDA 1Z36A 3OLXA 1RM0A 2C07A 2VEOA 4KLAA 1QK5A 1VL5A 1SU8A 1COZA 4QYIB 5K0BA 4L5JA 1LF0A 4PZAA 1THMA 3MOIA 4K81B 5E6RB 5H82A 3OQ1A 3ZQUA 5FPKA 2P4HX 2IZ0A 2P6UA 4J8PA 1C4OA 1IEQA 1XFDA 2HWYA 4QU9A 4BRUA 5K09A 3AFHA 1MAVA 1MC5A 3QYJA 4TV8B 1HLGA 2FZEA 2R6R1 1DG3A 1XA3A 3IEIA 3D1VA 3HDQA 4DDUA 2HT1A 4DA6A 3DJYA 3KZOA 5K8LA 2CL5A 2H2GA 4INPA 3OCZA 2GILA 1NX9A 1ZQ9A 3A9VA 4X7MA 5ECDA 5GZ3A 1VHTA 3UQYS 1CUDA 1MF7A 1A9YA 3EPLA 1PV1A 1I1HA 2G25A 2YZGA 1MPXA 4BVEA 3GWZA 3IQEA 4PCUA 1EWYA 2VOJA 3EXFB 4NJEB 2WC1A 5A2GA 5KTYA 2BTEA 4BO9A 2WAOA 4OMFG 3CVYA 1M2WA 2W70A 1P3Y1 4N1AA 1DP4A 1BN7A 1T0IA 4F4DA 5IJZA 4XR4A 1QU2A 1J2TA 2WNSA 1HSOA 3T15A 1MC1A 3GQVA 3ZWOA 3KR0A 2GXSA 1B0PA 3JQAA 3E7DA 4FM9A 1Y8ZA 3G7NA 2AF4C 2KJQA 4KFTA 5J2TB 3RVLA 4P54A 1CY4A 3ER9A 4B48A 1B8VA 4OATA 3F5QA 2P8JA 1ZWLA 2G63A 4YB8A 3FOEC 3M9LA 1S7CA 1YZ3A 4JT9A 2OBXA 2AGVA 3GGCA 2J7PA 3K72B 1KTIA 2HU7A 5E0KB 3DBRB 3OEEA 1KRXA 2FZ5A 4IIYA 1Z18A 4Q47A 5JH7B 2FKAA 4A73A 2DR0A 4WFKA 4LPKA 5LMNB 3LZ6A 3HB7A 3ZGYA 2EQBA 5KQMA 5BXQC 2JIPA 3F2VA 3I0NA 5HS6A 3TZCA 2GN1A 3GR6A 4LK2A 5ED4A 1XRJA 3P9KA 4NMXB 1K9VF 3N2IA 3IRVA 4JBYA 2B6HA 2P9ZA 3MTQA 1X1AA 3VSCA 4JB0A 3BE5A 4CKCA 4KLRA 2Z9BA 3LWDA 2GN6A 1K7XB 3EQ9A 5TMBA 5J2UA 5ALWA 4LISA 4ARVA 4DSTA 4OGFA 2B1QA 3RTGA 2Q5CA 4MQLA 2HA0A 1USIA 3CLRD 5ALEA 5KTRA 1EVKA 1KRWA 1BIFA 1BHQ1 2IHKA 4H77A 1JPNA 2ETVA 2OVBA 3ROQA 1MN6A 2B78A 2EFJA 4UM8B 5F73A 3ITEA 5H9WA 2A8YA 1QH1A 4ER5A 3R6GA 2PNJA 3BMQA 1EDEA 2DHEA 3KJGA 3PQCA 4NCNA 4OHKA 2WHRA 5GV7A 2P9EA 5LZ7A 3R7LA 1N9GA 1W94A 3DCIA 2RK4A 1MHPA 4DLRA 4MK4A 4J4BA 2HH9A 4JFRA 2AN3A 4EHHA 3QH4A 4I55F 3WICA 4YRKA 1IG3A 3DCJA 4KOEC 1C0LA 1J9ZA 5CDTA 2QTZA 1G60A 1ULHA 2GPTA 3H5IA 3JQAB 4C7JA 2ZVJA 1K8QA 1T91A 4YRGA 3S1SA 4HEA6 4M7PA 2DLNA 1S2IA 2IPLA 4J9VA 2ERXA 3VR6D 3RHFA 4GX2A 2QTCA 1ILWA 1BH2A 3CE9A 3QYPA 1SVSA 2FZWA 3I92A 4NECA 1BN6A 5DW3A 3ZWKA 1UAGA 1WEKA 1CSEE 1JT2A 3IFSA 3IQGX 4XIIA 4RTRA 3OHSX 3BORA 4FGKA 4FVTA 3ZTTA 3MTIA 5D3MB 2HHCA 3D81A 4DZZA 3CZQA 5CHYA 1RXYA 1YQTA 1XQ1A 4ARZA 1KVQA 2M98A 5IANA 3TQSA 1I2MA 1TM5E 2WRZA 3RRJA 3L4JA 5LIRA 3HU5A 3NUZA 4CG2A 3R7WA 4V03A 3R0ZA 4BAZA 3AFMA 1OXTA 1U28C 4JBGA 4PYNA 2MTBA 1YBMA 2P69A 4F3KA 4NXMB 2OAQ1 3Q9SA 2CMHA 3DOFA 3IHWA 5EJEA 5AFSA 1Y7LA 1E20A 5JI3E 4PR0A 2J48A 1US8A 3MUNA 1T2UA 3DHWC 6ABPA 3U5ZB 1CEQA 8ADHA 2GNPA 2V7BA 2AFHA 2P4EA 4LGYA 5LB2A 3EXEA 2B61A 2A30A 1N36B 3H1AA 3BF8A 1F2UA 4RHTA 1U7HA 1VJGA 3EYWA 1W34A 3NUGA 5FBLB 4KWIA 3VKUA 5DM60 4BZXA 3MMPA 4JI6B 3E61A 4YRFA 3PT9A 3OZEA 1U7ZA 4TX1A 3KXPA 5KYYA 1JKJB 1KZ6A 3R0XA 3DPSA 1U4OA 3INTA 4TQ9A 4OXQA 4D9KA 2VQEB 2QMEA 5FPQA 4Q3BA 2J6HA 3VI4B 3BMQB 2E89A 1IOWA 1WXDA 4C0BA 1F2TA 2ZAGA 1Q16A 3GJYA 6YASA 3E9ZA 4ZTUB 3Q9UA 2OCLA 3IYLW 3C3PA 2QRQA 2H2DA 3UJAA 1CVRA 3RYHA 1IM8A 2CLIB 4LJ8A 4Q4AA 2AJTA 4GUAA 4XM0A 1FEZA 2DH6A 5E2AA 4MGZR 4S0ZA 3ZZ1A 3RVRA 5KDOA 4TT3A 1V25A 2ZJ8A 5DGXA 5L7YA 1XMIA 2PWAA 4QT4A 2XXAA 1U3WA 1R18A 2IYZA 3PIIA 3GEIA 2J5KA 1KC1A 3AB8A 3JU3A 1ZW6A 5FOTA 1UEIA 3KC2A 4UUAA 2EX4A 4MP6A 1NMQA 1OWLA 3QX8A 4LDPA 5HFNA 1JS1X 3CZPA 4TS3A 5EE0A 4C6TA 2IWHA 5ADWA 3NBYC 5LZ2A 4AZWA 4MVJE 2YWXA 4S1NA 2HGZA 2V6GA 2XIJA 3Q11A 3I39X 5L40A 3DXYA 4ND7A 2WJVA 4UVDA 3T7DA 4NEQA 4RK1A 1AF4A 2OHFA 1IE3A 2JD0A 2SKEA 1PFUA 4AY2A 4KIWA 3SQXA 3LT5A 1KI6A 1P60A 1DOZA 1G5QA 2IDKA 4G5OA 4JT8A 3Q0IA 3CURA 2BEVB 2FU5C 4GXQA 4AKSA 1JDJA 4OHZA 1MH1A 1OYYA 3A1TA 1P5FA 2H2HA 1K3FA 3AG5A 4G0ZA 2BBOA 4PS1A 4EYKA 5BSMA 1FP2A 3DOEA 4ND1A 1GV1A 3LPLA 5C3UA 4BZWA 2TECE 1GAEO 2P2NA 3CLTD 4HWGA 4D9HA 5LVAA 2WICA 1US8B 1Z4KA 1P3JA 1DIGA 2AFHB 1E1CA 1T9HA 2XNHA 4QO7A 2QJTA 3JARB 3SU8A 2ZBPA 2I7VA 2EBWA 2A0UA 4JJ4A 1F2UB 1JN0A 4GR9A 4M0EA 2ZPAA 2OUKA 4XFDA 5ALXA 3WQBA 2EFDB 1ZN8A 4I1UA 5FBVB 5J63A 5KYYB 2F8TA 4I0WB 2HF2A 4G1CA 5DOVA 4LVCA 4QFDA 4D5EA 3LLUA 3WTBA 1E3LA 1ZGAA 1K97A 4BX0A 1CB0A 1JL3A 1ZZEA 3OFJA 3ZDZB 1F60A 2XRFA 1A71A 4O2AB 5C52B 1I5RA 4GZ5A 1J8MF 1BMFA 1PZXA 1TM2A 2ZE6A 4JY7A 4J6FA 3C8DA 3ABSB 3P71T 4B35A 4AKGA 3FH0A 4R1QA 2BRUA 1LCIA 1TQDA 1Z25A 3YASA 3ZG6A 1OCEA 1RYDA 3R5TA 4Q24A 4Z9YA 1L3CA 2ZI3A 1GADO 4PZDA 4XA8A 4YRJA 2Q3FA 4LNUA 3OE4A 3KFXA 1NP7A 2CHUA 2G40A 1DO2A 3LECA 5CA1F 3IKTA 5J4VA 3DBLB 2GNAA 2O8FB 4BMXA 4B6QA 4BP8A 3RRXA 3W5CA 1C9KA 5KDDA 1XJ0A 1YR7A 5NLLA 4EITA 3KSUA 4QU5A 5CDYA 1C9EA 1D4FA 2OBLA 5DWQA 5EKTA 5JWRA 3QKSB 4D4HA 2C7RA 4IQ0A 3T35A 3GD7A 3VYVA 3RYCA 1Z0KA 2LDXA 1R0BA 1G8PA 1V8ZA 2NYRA 5TS2A 4M54A 3DZBA 3JQAD 2DY0A 4NDZA 3PJDA 2R5NA 4HDRA 5JATA 1DFIA 3UUFA 4JI5B 4CMHA 3JAKB 3AP2A 3JXEA 3P9RA 5AJYA 2YFHA 2AKAB 4WKGA 2XRMA 1P39A 1R4AA 5AW0A 1UXGA 4L9WA 4LJSA 2R7NA 4IFTA 2J7PD 4EHNA 5FT9A 4OLAA 3OEED 4CCSA 2QAGA 2QRZA 4JI0B 3OQVA 1CJBA 1RM4A 1UBMS 4WLUA 4GPZA 5C4IA 3VDRA 2G04A 4IS3A 2EGUA 2R6ZA 4YGXB 1EZ1A 3IEVA 3P45A 1CQXA 2WNIA 2I7XA 5CTJA 3OJLA 3ZCXA 1NDQA 2QE7A 3MBKA 3OM9A 3K9GA 4PY2A 2BLLA 1N7JA 4FR2A 3CB4A 4BLVA 5C35A 3ANXA 5BV0A 5MGBA 1WDMA 1NR5A 2C31A 4LSWA 4PLWA 5FO1A 5A4DA 4OQMA 2IUSA 1ETUA 1SC1A 2JIOA 3CVJA 4UE3S 5DBFA 1GGJA 4BX2A 3DMGA 821PA 1YL5A 2MSEB 3WA7A 4CHTA 5EJ9A 2QNBA 5ECWA 3AV0B 1KDRA 4YJ3F 4RV9A 1ISGA 2IS2A 4R81A 4PQEA 1GJRA 1EJ0A 2FPLA 1NQ5A 1ZK4A 2BE9A 2DBQA 4ZU3A 1XEXB 1SQGA 5F7ZA 3PKZA 2AE1A 1K68A 4K9NA 4KQ6A 4B0PA 1JB1A 1F0YA 2J8ZA 1V7PC 1QLHA 5BMVB 4RTNA 1DWQA 1YAHA 1B0UA 4YJFB 4TWIA 1V6CA 5CH8A 5DB4A 5TY0A 3SS9X 3LVQE 4LWPA 4GMXA 1PR2A 1MEOA 1JUDA 1EX6A 1UPAA 3OICA 3UF0A 4YR9A 1M5TA 4DG9A 3IUBA 4AF8A 4KR6A 3EZ9A 5ALTA 4CCYB 5IZCC 3HACA 4WLFA 4BVAA 3UTCA 2EG9A 4M83A 5BQFA 3IELA 1Q7BA 2IOYA 1RC0A 3ME5A 1Z5WA 2HHAA 1SOMA 3IPCA 1O5TA 5DRTA 1SHTX 1NAIA 3W8EA 4DUYB 2CUKA 4TZTA 4L0MA 2Y4OA 1EFLA 3RYCB 2MINB 4GQBA 1D3AA 1H1LA 2P41A 1ODFA 3RS7A 1LFDB 3K5IA 3DT6A 3CLRC 3KPUA 3LCRA 4PPFA 5DNVA 4B79A 5BV1A 1MJGA 4KXLA 4L5YA 4ENUA 3GFBA 3IVGA 3JZDA 4MI6A 1JEQB 1YB7A 2I3ZA 2FF5A 4RKRA 1J2EA 3ID6C 4W5JA 1IIBA 4C1BA 2VJQA 3TGWA 2WJWA 5I7VA 1NVVQ 3HCCA 3FNFA 4CTJA 1E32A 3ZWPA 1XNRB 1DBPA 1RQGA 1AXRA 5DTMA 3ZXIA 5GONF 1W2HA 3LKDA 2IS6A 2L82A 3PFGA 1E9RA 3E7WA 4RD1A 2P4QA 3DF7A 1QVRA 4JJ6A 5KU7A 2NTNA 5JD4A 1Z6QA 2NLOA 4FNGA 2Q7DA 4NCXA 5B1SA 3RT9A 2V4MA 3SZLA 4BV3A 3G9UA 5JCXA 2Z2ZA 1YVDA 2D2IA 2WTAA 1VJRA 3EF1A 4DXAA 1IHUA 5LYJF 4LOJA 1CUIA 3R3JA 3C7CB 3UK2A 2GERA 3QKUA 1NE2A 1R10A 4I36A 4YCBA 3NDRA 4AMZA 3F4LA 2DFLA 5CT4A 1PCXA 2K7ZA 3NOOA 3STTA 5IN4A 4NAHA 4DMHA 1NOIA 3KYCA 2F64A 1Q84A 2GRAA 3CHYA 1EAMA 3LXXA 3QXSA 3C8UA 4LX8A 5A3SA 2Q8QA 3TQTA 1J7KA 3GEEA 1HKUA 3QPUA 3VMFA 4BPRA 2RI0A 4RHCA 2QNIA 1QQ6A 1E1DA 1PWHA 5DK6A 1RW4A 3HLYA 1VPLA 4DLAA 1KA9H 5HZKA 1KJ8A 4X61A 1BRMA 1C1XA 3GT7A 3VKFA 1HLDA 3ZE9A 2HYIC 3DFIA 2HQ1A 5KJ6A 1E9VA 2Q49A 3B7GA 4GVLA 1AKYA 1OV4A 1VXRA 4JLNA 1Z68A 2NIPA 3UKJA 4OQQA 3NPAA 4NOMA 4RELA 4Z9XA 5F1PA 4ZU6X 3ZHUA 2C54A 1VGRA 1Y0BA 2VOEA 2BTQB 5C32A 1UMCA 4LUCA 2RHDA 4MW1A 1HH4A 1MG0A 1IXKA 4MS4A 2ZE8A 1TTPB 1H1LB 2VF8A 1XNHA 4N5NA 4TT3D 3UT5B 2ECKA 5ICMA 4IFEA 4YV1A 1M6EX 5HIMA 2OZPA 3VI3B 2ZYIA 2YICA 4N0MA 4N82A 3Q3IA 4UKDA 2RKOA 4C78A 1X94A 2XYPA 4BGDA 1Z6XA 1E6EA 2H1FA 3UJ9A 3C5HA 4B32A 2AI3A 2GXQA 1C7IA 5FBKA 1ZI6A 2GJ9A 1VPTA 3EEOA 4Z4FA 1D0SA 2HK9A 2F43B 2V6IA 3QXXA 4HNRA 2PGAA 3FXAA 2C9CA 3MAAC 1WQ3A 2DG2A 4LZJA 4A36A 3HADA 3D6MA 3OCJA 3LBNA 1SVIA 2RHLA 4TWBA 1XEFA 3AHEA 5JD6A 1ZRMA 2OWEA 3OECA 1D6SA 2BIFA 1GAWA 2YHIB 2PX4A 3QFHA 4OMUA 2WTEA 5EIWA 3T5TA 4F96A 3F2IA 1YU6A 1ZVJA 2HLDA 1XYGA 3DOOA 1SXJB 2C2GA 2FWIA 4ZHQF 4PYIA 4QGSA 1GNLA 4QEZA 1F17A 1XZHA 3H16A 1MJHA 1O03A 1UDAA 2WZCA 4RIFA 5EFOA 4JA0A 4V3BA 3H4IA 3EVGA 4JBLA 5IWAB 4PSVA 4KWEA 5DBOA 4CT0A 3DKPA 4ZVRA 4D8UA 5CVJA 3AETA 5DF1A 3JD4A 1ZGGA 3PITA 2CNWA 4DAEA 3OZDA 3IA2A 4YT2A 5L3SB 4OI0A 3FLBA 1EXMA 2CLFB 2J9RA 3KQYA 3T7IA 1Z56C 3ZPXA 4E12A 2C5HA 2IYEA 3ZN2A 3G8BA 3F73A 3KQTA 2B3TA 4KIUA 1NIJA 1BCRA 1GGMA 1KAGA 3I6ZA 1W581 2EKQA 5FJJA 1OX6A 1CJMA 1NBEA 4OF4A 1XDSA 1UPCA 5CVDA 3SSMA 5HIIA 2NO9A 3I8OA 1GPH1 4PCLA 5IWCA 4BRWA 4MV7A 1CF2O 2IXAA 3O75A 2MJLA 1KWKA 4B3GA 1BWPA 3GHHA 3I62A 3CLTC 3JALA 1Z37A 4FE3A 4BTLA 3Q5DA 4IX9A 4OAOA 4MV4A 5E6UB 1DKPA 4X00A 2V54A 4MS4B 1OBCA 4WAUA 1M0EA 1YCHA 3U9TA 3WGQA 1SUFA 2GVZC 3HDVA 3UFXA 1YVUA 1KVUA 4GYWA 1GR0A 4N7JA 2PYIA 4XB6B 1G42A 1L2TA 2BFEA 2I6GA 1FRVA 4HEJA 4W1PA 1IBMB 5H59A 1KO1A 3I1JA 2Y3IA 3RYIA 4L8WB 2I2XB 2ANBA 2FSVA 2Q7OE 2YL2A 4H7JA 1GN8A 5A62A 3W0LB 1J8YF 4GM0A 1R4ZA 1AA6A 3G5AA 3ROPA 1FFAA 3I58A 5CNIA 2OYCA 8MHTA 1SRQA 4H6PA 4EJSA 2NX2A 1V37A 2UZ0A 1BTOA 3JYPA 4ENWA 4NMWA 1ORDA 3R6WA 4UULA 3THYB 5ALJA 4HI0E 3KEGA 3T9BA 1DGQA 5T4EA 3S2ZA 1YT5A 5EXEA 2B2XA 4CIVA 1RT9A 2P62A 1ZM7A 1GXSA 3X44A 3BK1A 1CHNA 3OLCX 1RXIA 1VIAA 4YBRA 1OB2A 5LP6B 3HKDA 2Z2JA 3H6GA 3LX6A 3EW9A 2B7BA 1IN5A 2BMDA 5CA0A 4AY4A 3PGLA 2QSYA 3EVBA 3QKIA 3ORHA 3U80A 4I6JA 4R9VA 4D43A 3URKA 1I3OA 4DCNA 3RIYA 2IYWA 3LY8A 1H4TA 2GD2A 1MHTA 5C5DA 1WD5A 3CEHA 1TX4B 3R6TA 3WDSA 5I7WA 4L8VA 1FFWA 4UOZA 2VNKA 1JDSA 5G0UA 5CB4F 5ISMA 1QKJA 1VLJA 2Q41A 1T6XA 2R8EA 3CXRA 3DGEC 3F78A 3HB5X 4F4UA 2XZOA 3WLKX 4PIMA 1XCBA 4ZU1X 2JIQA 1NBME 4RTJA 3F3KA 4J0HA 1ZOSA 1SG0A 3HUEA 3KUXA 1QFZA 4UXIA 2FW9A 2QE7D 2QMHA 3WA6A 1BCRB 4UTVA 3RS8A 2A88A 4IZIA 4UOQA 5H83A 2C4VA 2XB4A 5FR1A 2G08A 1TVCA 2I2WA 3QV1A 3M3DA 4KVGA 4DLNA 4ESEA 5L3SA 5FPSA 3KUCA 4A23A 5J23A 4TLDA 1HYBA 1SHZA 3FNGA 3JALB 4IYRA 3DLPX 4BVKA 4C0AC 1A4XA 1QO9A 3OSZA 2EP7A 3AQ4A 1EHCA 3KP1A 2P3LA 3EH2A 4K7JA 1LRJA 5I7AA 3WQHA 3T1TA 1U02A 3K0HA 3HY3A 4QEDA 5CYPA 5I4IA 3TW0A 1SUBA 3FOFC 5CFRA 2X9LA 1VJ0A 3SVZA 2AG8A 3WL4A 4MUEA 1BWRA 2PEZA 3ZUGA 3CF4G 3GGSA 2JEOA 4I99A 2VPXA 4LRSB 4Y2XA 1G20A 3R8XA 1T2FA 1QX3A 2NGRA 2C5EA 3TR6A 3UANA 1BU8A 3VZBA 3S8MA 2I7DA 1RSZA 2Q3DA 4XUDA 4PZUA 4HFJA 1RLOA 2VDJA 3BTSA 621PA 2X23A 4G1BA 3WLLA 4HH3C 4YI3A 2VF2A 4HO1X 5FNVF 2BL4A 3U31A 2TMKA 4H35A 3PJEA 4IIXA 1RJGA 1ETHA 4TRMA 1QC5B 2EARA 3O7WA 4GBED 4L2IB 5B30A 3EEBA 3HKDB 3QSYA 1JHZA 5FBRB 4Q00A 3TDNA 1DPGA 2A4MA 2Z6UA 1FS6A 2GHTA 4D41A 3CMCO 3QGMA 3MWLA 4URXR 1VJDA 3L18A 3H18A 2OA0A 1WDLA 3BAZA 2FK7A 3OG9A 2ZRGA 3HCRA 4NK5A 3GIWA 4E6EA 2PZLA 1E5DA 1EM8B 2OV8A 4X90A 3BCSA 4M1KA 1AGXA 1TT5B 2C9DA 3BGOS 3UZUA 2Q3JA 1YZHA 2GEDA 4MGHA 2C2HA 3KLBA 4GGOA 1ODIA 1TLFA 4GWKA 5EJ7A 2R86A 4PICA 1YRAA 3NKFA 5JZMA 1L5MA 1L7DA 2XTJA 4DIEA 1H0SA 1PGOA 1G21E 3CUSA 4RD3A 4RENA 2HDHA 3WLHA 1OT5A 1MAWA 1NNUA 3O82A 5HFAA 2ZWMA 3FETA 2IFTA 2GEVA 4W7IA 3TLMA 4B43A 2AI2A 4L22A 3O74A 2XCUA 4W1SA 2SKDA 3HJTA 4UDYX 1W88B 1JILA 3GOHA 3SR4A 3ST7A 1CC1S 1EE1A 2ZWVA 3TLBA 1Z5GA 3W1WA 3ZUPA 8ABPA 5JHGB 3GN1A 2WVHA 3KL2A 2OENG 3GJ6A 3AIOA 4REQB 5JYBA 3K70D 2OMKA 2VSYA 2GFHA 5HX7A 2DWCA 3ET5A 3R9XB 3REQB 5TR9A 4NCJA 121PA 1PSZA 1GFSA 1AKWA 2IOFK 1VB3A 1GA6A 1BQ4A 2PH1A 2JJMA 2RIRA 3CPSA 3LV8A 4QZVA 5DLEA 5K3OA 2XB6A 3V4FA 1IOZA 4GSKA 1T9BA 3AGQA 4ZRMA 2P8SA 1YB6A 3K9QO 3GLQA 3LT0A 4DMFA 1EFPB 2FSHA 1IXZA 4ZYTA 3BULA 2WJGA 4ND4A 1V5GA 2BZ0A 2VBGA 2BKAA 1CVLA 5BT8A 2XWBF 3O9VA 1VL1A 4I9UA 1Q44A 4CQLB 3G2HA 1FMTA 2FCAA 1NQVA 1GY8A 4HL6A 4CIDA 2QTVA 1ICIA 2H7YA 1KBQA 2XMSA 2IEBA 2YZMA 1H2RS 4KQEA 1T2AA 1ESMA 2AEFA 3NUQA 4Y2QA 1V9LA 3BXXA 2GAOA 2OPHA 4EENA 1EJBA 1R8XA 4XVRA 5JSKA 4BNWA 4ENSA 1Q0HA 2IHTA 3NTXA 3T5PA 3ADBA 1PG5A 4R8SA 4U0JA 2GEFA 2VTBB 1B16A 2YNMA 3K0AB 2C97A 2CVHA 1T3LA 3MMXA 1KQGA 5BSFA 1VJCA 1BG6A 1S2OA 2RDMA 4IF6A 4KR9A 3JV7A 2L18A 5CXQA 1DMRA 1SQ5A 2O0KA 4M1MA 4Z0PA 4QBIA 2R68A 2Y2VA 1PWEA 2MSNA 1KVSA 3QVVA 1YIOA 1A9ZA 3HMKA 3QVUA 3ROEA 1SCUA 1JQDA 3AOEA 3EXIA 3QJGA 3SE0A 2E5LB 2GVDC 4MZDA 2JAPA 1EUZA 1ISHA 2E55A 4HB3A 4FIZA 1JJAA 3E2PA 4B6JA 3B6EA 1H2HA 2HJSA 5DM70 1TGYA 4BXOB 5CTAA 3BMOA 1JXQA 4WD3A 4WADA 4GIBA 1KI2A 4G1EB 4LQCA 1XCMA 2FHPA 1D9ZA 2P3OA 1EK1A 2HLDD 3FTCA 4JD5A 4MYTA 3U1TA 5AHWA 2V7UA 5KTNA 5L3RA 1Y1LA 1LF5A 5AJWA 2JLAA 3FKJA 1W25A 2HXSA 3FZEA 3MQ2A 4BEBA 5HRAA 1L5RA 3WGNA 2I2DA 2QP4A 3JYQA 2ZWOA 4FEGA 3STWA 2CNOA 1J07A 4HDMB 4HCJA 4U6QA 2XOKA 2W83A 3WI7A 2IHNA 2UZ1A 5CX4A 2CNWD 3IB6A 2Z09A 1G8FA 1QAOA 1XHLA 3AEQB 3P9CA 4ZZIA 4BNLA 3TSWA 4ENQA 1IPEA 1U1GA 3QPBA 4Q05A 4BP3A 4HB2A 3C7KA 4ND2A 4OQLA 1VTKA 3H8JA 4JA2A 4R31A 3IE2A 3RUFA 1WHTB 4TSFA 3KXKA 1DNPA 1KEKA 1UDRA 4XH9B 1E0JA 1I7PA 1OFHA 1YS9A 3SJAA 1E98A 3A1SA 3DEYX 3A06A 2RC6A 2A9QA 4HNGA 4BKMA 4S04A 2BFCB 2DECA 3KQUA 1U8EA 2G1AA 2H92A 4PZLA 4D98A 1S8AA 2QZSA 2JI9A 1X8LA 5H9VA 1BD4A 3SKVA 4CV1A 1XTVA 3AIMA 3PQ3A 4CRWB 4QBTA 4AFNA 1IMJA 1PAUA 4ZOBA 2H07A 1CUXA 1KJIA 1XTZA 2E4WA 2KPOA 4WCDA 3OX1A 1RABA 5ILQA 3TOVA 1TFUA 4UE2A 5E2BA 1B3RA 1W4LA 3H2GA 4KHPB 2Q29A 2ZKLA 3GRRA 3RREA 3HCOA 4F21A 1K6IA 2NUPA 3C3YA 4XGIA 1C1YA 1WXWA 2GAFA 3G9XA 2CFTA 1RHQA 1W85A 4EG0A 3I9FA 1DG9A 2ZPUA 4C87A 1P5RA 1Y4AE 2EOAA 4Q9LA 4KZKA 2C2WA 4XQGA 1DU4A 1X1RA 2BRUC 3VO8A 4JJ7A 4AM8A 4PLPA 4YAGA 4R1NA 4UU7A 3VC1A 1MORA 1QE5A 1P7YA 1KP9A 2G1JA 3F6BX 2IW3A 3C3JA 1JH8A 2M1XA 3ZWQA 4R3UC 2W2KB 3RC3A 5H3LA 2A1UA 3A6ZA 3OUZA 3TZ6A 4W9NA 3CRMA 2DQYA 2RHGB 3IIIA 1FDSA 1DWUA 3AUJB 1OH7A 4JDPA 2PS1A 3NW9A 3T4PA 3LTNC 2IEDA 2Y1DA 3P4XA 1PDWA 1T29A 4XFJA 3GLVA 4CF5A 1S4MA 1MXFA 2H4ZA 4JJFA 3W7VA 2AZMA 1MAHA 4UHKA 5IDXA 5TLSA 1VMEA 4MA5A 1PLJA 4WW0A 3ZBTA 2H2WA 5HKBA 1X7WB 1S1MA 1BROA 2C5AA 2DPHA 2XNJA 5EPEA 1JHOA 1AXEA 1MU0A 4XDZA 1MB9A 3BN3A 5C4GB 3ZHOA 2PKRA 3B2QA 3V46A 7YASA 4YIHA 3A37A 3B82A 3VHQA 4HP8A 3L6UA 5CM2Z 3H0EA 4NBRA 4D9JA 2CHVA 3L01A 2E82A 5EOVA 3K8QA 3MAGA 1O1YA 4FILA 5FI0B 1WZ2A 1GSIA 1GRQA 4MQ6A 4P22A 1Z8HA 4UUMA 4UTXA 4DV2B 1VHJA 3TLXA 4X8OA 2VWHA 4NBSA 4X5OA 1JLHA 2QAGC 1E2HA 2XPCA 2R1VA 3QSGA 5TGZA 3V1TC 2PKQP 3H9JA 4GZ6A 4JLKA 4OYYA 2GFIA 4WQMA 4PSCA 5COQA 3THXA 4FN5A 5CFQA 1J2YA 1LDGA 4RZSA 3ZQ6A 4V1CI 1WETA 4DLZA 6AT1A 2HEGA 1KQNA 2P9TA 2HMVA 3BWBA 1UBTS 4QGGA 5AVZA 5A0VA 1SC6A 5IDYA 4EJFA 3H9BA 1AS0A 1G6HA 4ME6A 3WL3A 4BC1A 4NAVA 2YV2A 5EKDA 1WQ1R 3G79A 1GYQA 1FX0A 1PNQA 2BFNA 3WV5A 3D3NA 4OHXA 1CS0B 1GQQA 1GDHA 1B76A 2XSZA 3MXOA 2CLSA 1NZFA 3OLZA 3MBIA 3QUTA 2XEDA 4WPGA 4LY3A 1KEUA 4K6MA 3MM4A 4X92A 3DMRA 2C3OA 4DVGA 1ODLA 4PLVA 1FX1A 3CNLA 4KNWA 4RQBA 1QX4A 3WGHA 4K46A 2FPIB 3WHLA 5JANA 4S35A 2IVFA 4HDKA 1YRWA 1B23P 3FYTA 1Z13A 3D4NA 3S1AB 2C20A 2W8BB 3ZBQA 1UM9A 1X8KA 3FTFA 1L4MA 2HJWA 1JG7A 2ZBFA 1KJYA 2P67A 4TKVB 3H1PA 4IQ4A 2ZR9A 4L0CA 1QXSA 1L8OA 5JDIA 3NCHA 3HLTA 4XYEA 1U8AA 2XJ4A 3IODA 2E3JA 3KCNA 4YJGB 1RMTA 1QHHB 2ZIWB 3MCAA 4FGSA 3FGNA 1G3RA 4NH0A 2AE2A 5B57C 3FMPB 1IYZA 3QHAA 4GLJA 3B48A 4DNFA 4WTOA 5CPFA 3GUCA 4J1TA 4P80A 5B4TA 3IUMA 4QU0A 2C7PA 3MFYA 3C3AA 2QLJA 4F5ZA 4RJJA 2BZGA 2PVSA 3OOSA 1WUIS 3HCAA 1N5JA 3V8MA 4B81A 3ND5A 3TTYA 3V4SA 1GTG1 2IITA 5G1PA 5FYDA 5B53A 4BNGA 4F86A 1UBFA 1QRUA 2ZCJA 3WRVA 2R1VB 2HZBA 5JVDF 4O5OA 2OAP1 4GOXA 2HFKA 4OI2A 2VZ9A 2VHWA 3MGGA 2VQSA 2ZBVA 2FVXA 4LXUA 4MVYA 2BN4A 2BP7B 5IEBA 1Q12A 4DIOA 4MKZA 1CDZA 1Q57A 1YZNA 4C4YA 3LVFO 1NPDA 4A03A 1FX0B 1M67A 2OEPA 4GXTA 1FY2A 3HKCA 2E1PA 2QAIA 2QY9A 3DXXA 4L15A 3K15A 2QTNA 2Q5OA 4RMNA 3LGSA 3WKAA 4OK3A 4ZGWA 4QHYA 2X0KA 3K70C 5G0TA 4RTQA 2D7CA 1UIRA 2ZGVA 2OQVA 2O19A 2YVKA 5LDHA 1XF1A 1XTUA 2J7KA 3A4NA 3OEHA 4G2TA 4TUYA 4HLUA 1Y8QB 2PU7A 4JL6A 4LCJA 2CNDA 2YNMD 3GFVA 3HXTA 5SZHB 4EHIA 2JASA 4FFSA 4HDKB 2R6JA 2YZNA 2XE8A 5TQ2B 3ZDCA 2RB4A 1TYDE 2PZAA 1L3IA 2JJ2A 2R8PA 3I34X 4NONA 4G4SP 4G1UC 5JOQA 1UM9B 1REQB 2VP5A 1E92A 2B21A 2O6HA 1ND5A 3M7IA 5HF8A 3KG2A 4XPIA 1QHSA 1XBTA 4XVHA 3WHPA 4WZZA 5K0LA 1Y6RA 2B34A 4PFSA 2UVPB 3S99A 1TJPB 3HGQA 4M0FA 4JP5A 1XKLA 3IE1A 5BVHB 3MT7A 1P75A 2QHXA 3WWDA 2HF7A 3B9RA 1OLOA 1XAGA 2PX8A 3A3PA 4Q93A 5GVRA 1Y4DE 2R8OA 4RE5A 4I1IA 4JKYA 2AN5A 4LOAA 4OKNA 4EYQA 1AQNA 3PUJA 4GEGA 2PZ8A 3H2YA 4KUEA 1UMBB 2HA2A 1XRNA 4XR9A 3JQGA 4MYCA 3UJ7A 5KVSA 4J94A 4CEJA 2MSLA 1R9MA 2XOKD 4OKIA 3NHJA 1FJGB 1JFFB 4ZOQI 1UANA 1ZJYA 2CHQA 2FSGA 2V7QA 2FAXA 3KE8A 2XKBA 5MF6A 1U3VA 1B74A 1XELA 3MN1A 3OQMA 4JR1A 1A2QA 2HADA 2OZKA 1N5IA 3VOSA 2GDZA 2BSXA 5KX5A 1YRQA 5EZYB 2C82A 2J3KA 2UAGA 2XUZA 4DLXA 3GX1A 4RV4A 5FHRA 4TSFD 4M0CA 3R9IA 4JI3B 2XXJA 3UMRA 2QDKA 4JR0A 1ADFA 1I0IA 1YCDA 4YRQA 4FZRA 3ZS8A 4C89A 1L1QA 2AFVA 4PZ0A 4RZ3A 4UQPA 5KYGA 3LDHA 4KJZA 2D62A 3DMDA 1VSBA 4MUNA 1VCMA 3C0KA 1RWKA 3JAWA 4BO8A 5D5HA 4P33A 2Y93A 3EQ7A 5HK9A 2E37A 2P6PA 4TKMA 4CE6A 2Q1WA 5CLLA 1V1RA 2IUFA 4FUQA 2A9VA 3QJYA 4CLHA 2R87A 3JATB 4P36A 1UBSB 3HWWA 5C7LO 3PHLA 1KSHA 2XUJA 2I1LA 3H3XA 4MV9A 4YT5A 5GJCA 4K6FA 1SCJA 1Y82A 5I7FA 2PZEA 2ZREA 4CI0B 1BRTA 1KHHA 4L6AA 1HTTA 2VSFA 1TFRA 2ZRQA 3IURA 3LY5A 3VOTA 3GCXA 1JA1A 5IF9A 2FUNB 1RBQA 1SBCA 5CT8A 4LKRA 3E7PA 3PQ4A 1SB8A 3IJRA 3KX2A 1LPMA 1HFJA 1JV2B 3DWGA 3EDQA 5HPYB 1Y5IA 4YAKA 2VDMB 5CDFA 3Q2IA 4Q7KA 2VKQA 1UR5A 2QRVA 4QQRA 5K6AC 1PFGA 4WZBA 2A57A 4MVJI 5G3ZA 2PHZA 3CRRA 1E1RA 1X9GA 2E6UX 1B00A 1SWVA 4BB5A 3AB3A 3CZRA 3ICVA 3IUSA 1A4RA 2FSVC 2E0IA 1V5FA 1KNXA 2XNCA 3Q1LA 4UM5A 5K3CA 2G9NA 3DSRA 1XT6A 2JH3A 2AXEA 5IDVA 1NURA 2A92A 4EJSC 4CEJB 1M0SA 1X3SA 4ZVUA 4H7EA 1EMDA 1T6BY 2OE2A 5CM9C 1SCBA 1YHNA 2O2XA 2ZTMA 4LY9A 5JHHB 1UOQA 3Q10A 3TD2A 3UMBA 4XAQA 1QF7A 4W8GA 1W93A 1DHRA 3O5AA 3DZIA 1XMOB 1IQ0A 1T15A 4GYYA 4PWZA 1L7PA 2IIQA 5MN4A 1JEYB 3PUIA 1Z35A 4ASUA 3ZD8A 5G1OA 3UMJA 4JAVC 3O47A 3AM3A 3OTIA 1R0SA 3JQDA 1T5OA 4DLBA 4R9NA 1YI1A 2GJ8A 1GPNA 2QY6A 2AN1A 3I2JA 1HYQA 3EIWA 5EZ5A 3WK6A 5A0TA 3PX3A 1XGKA 2ENWA 2IEAA 2V7PA 3OMXA 4IIDA 4MSUA 2D1QA 3UM9A 1KOJA 1Z4PX 4YJKA 4ZT7A 2CSUA 5KAMA 5T3YA 5AVXA 4W5RA 4PGAA 2P5YA 4CDGA 1LW7A 4M1TA 1CVIA 2ZAOA 3E15A 3FPGA 3JASA 1WTAA 3C6YA 1JDZA 4K03A 2H11A 4C3UA 1BXKA 1DJNA 4DRZA 1WCV1 3I2HA 3PGKA 3EZ2A 3B9BA 4N8EA 4UHEA 1FP1D 2PTGA 2DWPA 4RYLA 2PYDA 1CUWA 1F6WA 2OC9A 2R4QA 3CW8X 3UKOA 4KRYA 3CN9A 1RWBA 3NT2A 3WV4A 2J5RA 2XSZD 4BFLA 1N2HA 1HTBA 1VG9B 1FP4A 3EZ7A 3FNBA 3HPQA 5EWJA 2OD7A 4D5GA 4FKMA 3VSAA 2PL9A 2H2IA 4CGZA 1DAPA 4Q03A 5CP8A 3ZXYA 1CLEA 3B5JA 4MAAA 5L7WA 1YIAA 3KB2A 2YJZA 4BLOA 2QRVB 4QQKA 5I7UA 4QECA 5BNWA 1KDVA 5LQDA 3P32A 3AZQA 4O4IF 4REOA 3T94A 4HTFA 4GX5A 2C9MA 1DI0A 3IAM1 3JWPA 4J7AA 2WE7A 3X1MA 4CR6A 1FTQA 3RBZA 1XQ6A 3TMAA 1GPDG 3OIDA 4EGSA 1IOVA 1OLSA 2NV6A 1GT6A 5ERYA 5IKMA 4P7GA 2VDPB 4JSTA 1PEAA 3QEOA 4Q01A 3T9FA 1SU6A 1GTJ1 4H7PA 4X1OA 4TMKA 4MRMB 3E9NA 2CKMA 3QUBA 3NXKA 1QP7A 3PU6A 1C1HA 4HFMA 5EHIA 1JR3E 1IHOA 5BSEA 2I91A 1Y5LA 1G8JA 4D1YA 1HQCA 1HX7A 5FWNA 1THTA 3GAZA 4E1BA 1RJ9A 1FUIA 4D3YA 2P3SA 3BDIA 2AFIA 3FD8A 1QCCA 4NU8X 4S1VA 4DT1B 5JLJA 1H69A 1WUJS 4Q12A 4QDUA 3I5XA 3LC7O 1OIXA 1PGJA 5E1DA 1W6RA 4WEQA 4IDQA 5JRZA 3ZHRA 4CCAA 4UEJA 3ZU4A 2WOJA 5T5QA 2LE0A 3PYMA 1AKEA 1D2RA 1TAGA 3BERA 3FSRA 3UGQA 4DXHA 4YLGA 5IH7A 3ABQB 2P27A 2TYSB 3PNMA 1LZKA 3WB0A 1V5EA 1Y48E 2YDXA 4RXTA 5LP1A 4FPXA 3DAHA 4NE7A 5KVVA 4QXRA 3NHLA 1OJLA 3V1UA 5HRUA 1E7WA 4N5DA 3BT7A 2IU4A 1PZGA 3KQOA 1GA4A 3IULA 2FMKA 1NPTO 3AR9A 2P4SA 1GILA 3R5FA 4B46A 1J1UA 3L4SO 4YEDA 3M3HA 1QPZA 4LN1A 5CYOA 2HCTA 1N2CB 4Q9JA 2COUA 5K3AA 4EPVA 1FP4B 2EIXA 1WCIB 2FWRA 4QOGA 5EWJB 1XZQA 3BE8A 1E3TA 4K9SA 4HXGA 2WWIA 4CNBA 3V7YA 1U63A 1GPKA 2O54A 3MT9A 1UWVA 3FRHA 5COBA 3QVLA 1D7AA 2LD4A 4LF6B 1TUEA 4KWTA 5E2IA 3LNTA 4AG6A 1BA2A 1T24A 4OSOA 1U8YA 4OQEA 1C8BA 4NNJA 2O8BB 4KNYA 3WLJA 5EUMA 1GRNA 5AVJA 2X5OA 4MIKA 1PGNA 2EWMA 2AW3A 2JJ2D 3DE7X 4OQNA 4CV3A 2JGJA 1ULBA 4WXYB 4DPLA 4IO1A 4E30A 4Q7JB 1AN9A 2F3UA 3AYXB 3ENWA 2HJGA 4RLHA 3SHQA 1XKXA 2FFAA 2ZUVA 4TLEA 4GRDA 3LWNA 1D2EA 3G6WA 4Y2GA 3ZZTA 4YAUA 2CMDA 1DT3A 3HCWA 1QG2A 2QRJA 1EP3B 2BR5A 3F46A 3VH2A 1F0KA 4ER0A 1Z16A 2XX3A 1KGDA 1KMIY 3AKCA 1AS3A 3Q12A 3GH3A 1RPNA 4AS3A 2YNMC 3THWA 4CEHB 1H8HA 4ZT6A 2VJBA 1E2EA 3ZV6A 2PGJA 1OE0A 1PGQA 3ABZA 3CKMA 1A2BA 2GA9A 1LBQA 2V7QD 4DXDA 3AOEC 2EZ9A 2O57A 4TMWA 3V00A 4DA4A 3EPHA 1OD6A 2G0TA 3D0KA 4KPUB 2B7CA 2GKGA 5JBNA 1XO1A 1NN0A 3IJ5A 1OASA 1OAOA 1JMVA 2JGRA 4OJYA 2DQKA 3SE7A 1TF7A 3D6VA 3B6JA 2Q5LA 4DCTA 4DILA 1JPUA 5K03A 3D2AA 2ZG6A 4WFIA 4UAVA 4WMLA 3JVUA 1KBZA 2JGDA 2FHSA 2FLVA 3TKYA 1EGHA 1XKTA 2EQ5A 2JHGA 1EX1A 1Q6ZA 2CZCA 1LNZA 2I99A 1XNGA 5ITWA 1WEHA 3QUAA 4RPKA 4MKRA 1UJ2A 5M04A 1H6DA 2IF2A 4F45A 3HKBB 1E1NA 1EUCA 1YMVA 1FMCA 3M2PA 3UATA 4TYNA 2QVLA 3GZTB 4AT1A 4JH0A 3DZ8A 3KJZA 4L3VA 1QUFA 1VE7A 4LI0A 4S1PA 4WA8A 1I3LA 3TSCA 1CHDA 4LV5B 4AB1A 4BCDA 4C7XA 4FYJA 4CN8A 1ORVA 1PHPA 4EH1A 2P75A 1QQTA 4IIUA 4ZVPA 2PBZA 2Z5VA 1N8SA 3HO1A 1JP7A 2NZ8A 1KK1A 3CUVA 3RSHA 5DISB 4RU1A 1T2NA 4J0IA 3M4ZA 4HB4A 1A88A 1V9CA 5ALZA 5IAKA 4AF6A 3OVMA 3OM1A 4LVUA 1N8NA 1A7AA 2PCLA 2QMUA 1JXMA 3G0BA 4QM7A 5DKFA 3FAKA 5E8RA 4IOLA 4FEEA 4CQNA 2CLLB 1E1RD 1OXKB 3UGJA 1CDDA 2VQFB 3THWB 2CEAA 1K7CA 1TQ2A 3R41A 4S2EA 4KVFA 1XSEA 1PZMA 4JDUA 2ZE5A 3UMSA 3EVTA 4Z51A 1IXYA 1GQ2A 1DKRA 5JXIA 5FLEX 1ESNA 3PGXA 4G09A 2Q5EA 3OZGA 3TBFA 1F8XA 2H29A 5JW6A 1H1TA 5KJFA 1ZOIA 1EXWA 4BBZA 2XKAA 4Y9TA 4X3OA 4L50A 1AURA 4J3NA 3QPCA 4FEYA 1RP7A 1A9TA 4LXHA 3B1YA 4RNCA 2YOFA 4TQUS 3DKKA 3ER6A 3MJTA 4HC4A 3WL7A 3WKBA 3R5JA 3L77A 4MVJP 5KVCA 4AKHA 4CMIB 3H9GA 4B40A 1LK7A 1OVMA 2VAPA 4BO2A 2AMJA 2IUYA 4HDNB 1Z12A 4W9NC 1AO0A 4GBMA 1AB5A 4TV9F 4JKIA 1TM7E 2JIDA 2VBIA 3DMTC 3GLKA 5K4GA 2BEWA 3DW1X 2WFAA 1AKNA 1R66A 2CDCA 1MH9A 2WHXA 5IARA 4X1KB 4CKZA 3KK0A 1KH3A 3MMZA 1UM8A 4OSEA 3E0QA 2GCOA 2WG1A 4OCZA 3FMIA 1N2ZA 1ZN9A 4DSUA 2A5JA 3SG0A 4XM1A 3T4EA 3E8XA 4HMOA 1EFVA 4CM8A 2VDVE 3ASVA 3CZMA 4G41A 1CJTC 3SEQA 3KDSE 3ZZ0A 4O29A 5ES3A 2IKSA 2OGTA 2AW5A 3BXOA 3E5HA 4IIVA 2FUKA 2CLOB 4XX0B 5AKKA 1C7FA 2R25B 3IP1A 4EO9A 1FOEB 1ZGBA 2A67A 1MOSA 2UYGA 4KXUA 2R4TA 3ETDA 3PD0A 5IYZF 3NZEA 3RBAA 5AKIA 2Z2IA 3INNA 4I4IA 5KOHB 4G6ZA 2BM1A 1SBYA 1GAQA 5AD1A 3GGGA 2RGWA 3R4VA 4PYQA 4DR3B 2IZ7A 3FPBA 1PT7A 5JAPA 4FHDA 3TMKA 4TZ6A 1MO5A 1NJ6A 2JATA 4JC0A 1TAQA 3PD1A 5DZSA 1E3WA 3RQSA 2VK1A 3E7FA 1NA5A 2HA7A 2Q0SA 4FMCB 4ZVLA 1BHJA 4EG3A 2ZRDA 2GYVA 3FDFA 3Q8WA 4Z54A 3MJHA 4GI3A 5DYYA 4BMDA 1GHTA 1LNSA