1S1CA

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein RhoA
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s1cA00
5FPTA 1Z0FA 3PENA 4JLVA 3AKCA 4TQ9A 3RWMB 1X1RA 4RKEA 1E9BA 3AF0A 2HLDA 2NIPA 1KZ7B 3RHFA 5HPYB 1CR0A 2NTYC 3W3ZB 5H1YA 3R20A 3TUZC 2O8BA 1CTQA 1F2TA 2GILA 2Q9BA 1N5KA 3QG1A 4EKDA 4P4UA 2XTZA 4PO9A 3P4YA 4O3MA 1T8TA 3VMFA 1E9SA 1AJEA 4KJZA 4YC7A 4KFUA 1N6PA 2Z43A 3D31A 4V0NA 3A37A 5KSYA 4N0DA 1EWRA 3EWSA 3T61A 4P3YA 5FTMA 3GLHA 2QBYB 1NLYA 1P2TA 5B58C 2WWXA 2WHXA 2PLFA 4HAUA 1U2RA 2FU5C 4EPVA 5L3SB 1E0JA 3RS4A 1H8HD 1W49A 4IFBA 4O2RA 3OFND 4UNQA 5H70A 3FMFA 3CX7A 4D0GA 4ZKEA 4Z54A 3AKYA 3L2OB 3EZ7A 5JZVA 5E7JA 2QMOA 4LDJA 5EZ5A 2FWRA 3KQUA 1P4SA 2QSZA 5JHHB 1ELOA 2R8RA 4L15A 3NBFA 2A5GA 3VQTA 4QM6A 4RD6A 3P4XA 1XMVA 5C1BA 1G291 1II9A 5CYOA 4M9QA 2YNMA 4DIDA 4XWKA 1EFTA 2FE4A 1XCGB 4EJSB 3LFUA 3K9HA 5FTNA 1J70A 2PBRA 4IOMA 1NNEA 1FQJA 2Z6VA 3BC1A 3MWYW 3FMIA 4Q4HA 8OHMA 2GJ9A 1OH6A 3R7WB 5G53C 3CO5A 4Q7MB 4URXR 2QSYA 3NEJA 4LZZA 5J40A 1R4AA 1C1YA 3BBPA 2AD1A 2IYWA 1KSHA 2GF9A 2QP4A 1GM5A 1KO4A 3ZZUA 4QBIA 5GVRA 1BH2A 3K70D 3U3RA 1ESNA 4GP7A 1KDTA 5HE9A 1XEXA 3ASZA 3WP1B 4LSGA 4G0NA 1P9RA 1TL7C 2YC2C 3QXXA 2BM0A 1P9WA 1QVRA 2F7SA 3HJNA 4LHVA 2JJ1A 1R0YA 1E69A 1E9AA 1LTQA 2V3CC 1MO3A 1KI2A 2RGCA 1W0JD 2A5JA 2D2FA 1VECA 3BORA 3CH4B 1RRFA 1AKYA 4CW7A 5EJEA 2WWYA 3EX7C 4Q4JB 2BBWA 1E9RA 3W6PA 4M53A 2CXXA 2ZSEA 1UDWA 1Y3AA 1KI7A 4JL8A 5JS8A 2ZRMA 3F0TA 4BEBA 5FR1A 3UMSA 4OQXA 2VP4A 5LBIA 1XEFA 4YONB 1Z6TA 1CJTC 1L8QA 4ZCIA 2CCGA 3OHMA 4BFTA 2NGRA 2QGNA 2ZE7A 3BK7A 3KTAB 4YLGA 2XJ9A 3HYRA 4YMSA 3AV0B 1S2MA 2JGNA 2QE7A 1WMSA 1KNQA 2XSZD 2C98A 4P0TA 4IJMA 1KI4A 1O87A 1OXVA 3QF7A 4AYWA 3NTUA 2XZPA 3O8DA 3PUXA 4Q9KA 1TQ6A 4JLAA 4LPSA 4DCUA 2ZSBA 3B8HA 1EX7A 3GJ7A 4JVLA 2Z4SA 1F60A 2QP9X 1W36D 1OPXA 2ZRIA 2PEYA 4URUR 1RZ3A 3K9GA 1DS6A 2Q21A 2O0JA 3E5HA 4QGGA 4DSNA 3KQHA 4JLOA 2WJGA 3OF5A 4C7OB 1G8GA 2RGNC 3IDQA 1E2PA 5JHGB 1NVVR 3CZPA 1JR3A 2QRZA 3LBIA 1DPFA 4TSFD 1FW6A 1RFLA 4BLSA 4ZV4A 4IKEA 1N5JA 2CBZA 4B6EA 1SXJD 4IOLA 4Q18A 2P5TB 3OESA 1OKKA 4B3CA 2FEOA 1UBGA 4JYBA 3VR5A 3BS4A 3WY9A 1NRJB 4GNKA 3WRYC 1QG2A 3VKWA 1KMQA 3H1TA 3DEFA 3BFXA 4M0LA 5EP4A 4DLXA 1N6HA 1XCPA 1OT3A 4UXHA 2Z0MA 4FWTA 5FOWA 1H8ED 1YZQA 2IUUA 3QPWA 4KCGA 4R2HA 3SU8A 4DVGA 4ZCMA 3THXA 2V55B 2HF8A 3WMEA 1XMJA 5JI2E 1CF4A 2HV8A 1LFDB 4DSOA 1KDOA 1A4RA 1D5CA 4A2QA 3HPRA 2GEUA 1SQ5A 1E96A 3KXIA 3W6NA 4OK3A 2W00A 2ZRAA 3TSOA 3I8XA 4K81B 2CHGA 3EIQA 3WRXC 1ANKA 1FP7A 3DDCA 2GXUA 4W7SA 3LW8A 4HB0A 3B7GA 3KX2A 3M6AA 1BO6A 2XZLA 4RVCA 2EYQA 2RCNA 1P75A 4JBYA 4TYQA 1UKEA 3WHKA 2WTUA 5SZJA 5KPJA 3TSWA 1VIAA 2FX3A 2JEOA 1J90A 5JSZB 1FNNA 2GZDA 5JRZA 4KXFB 4C0JA 1R0XA 1LF5A 2GHIA 3ETLA 3PUVA 4C0AC 3AVYA 4B3BA 3B1YA 3T06B 4L8GA 3H84A 3GCGA 1M8PA 1BS1A 3A4MA 1NLZA 2HCJB 2VLIA 3X2SA 3ZVNA 4II7A 1XPUA 5FI1B 1JJVA 5F9HA 5JWRA 3RSLA 1ZM7A 2RGNA 2N1BA 3FGNA 3LX5A 4K46A 4K8OA 3FMPB 4EUNA 4OQFA 5D3MB 2JAQA 2IHBA 3NVAA 4GOJA 4PC2A 2IT1A 3PITA 3LH5A 4ARZA 1F5NA 3H0KA 3SJAA 2IS6A 2HT1A 3RRNA 5GJCA 4A0GA 2HYDA 1U99A 1T4GA 1GNRA 1CJVC 1UDXA 5DNYB 2VPPA 3U4QA 2EFHB 2HXYA 1VCOA 1VKJA 4X8OA 4TLBA 1UJ2A 5DYIA 3SFVA 5CDFE 2NO6A 4JVNA 1X86B 2BCJQ 1PJRA 4DLTA 1E2MA 2GWHA 4QBGB 2EW1A 2I1VB 4ACBA 3AVXA 4HUTA 3RNLA 2OV2A 1XB2A 3VNUA 1DG3A 3KJIA 1G17A 3JVVA 4GZLA 4LJYA 1KAGA 1V5WA 4CGZA 2C96A 3RS0A 1K5GA 4NZYA 4IEEA 1OE0A 1LNZA 1XTQA 5BN4A 2IK8A 2B6HA 1SZPA 3A8TA 4KODA 1HT2E 1GITA 1G6HA 4KLNA 5CM8B 1QDEA 3M0EA 2VHQA 2ZUCA 2D06A 3UG7A 1TQ4A 3SJCA 3FE2A 5DN6A 4DHEA 2C9YA 3ND8A 3AGQA 3JZAA 3TQCA 5J4YA 2WWHA 4NBSA 4TL8A 3VR3A 2OO7A 1KI8A 2ORIA 2J59A 5DO9A 2WJIA 1HT1E 1ZM3A 4MKHA 4ZCLA 3BAFA 1CXZA 3THYB 3QPVA 1V43A 2ZR0A 5EXSA 4R7ZA 3RLFA 1EFRD 2F43B 2QAGA 1W5TA 4NKRA 2PX3A 4BLQA 2FSIA 3LRPA 5D3QA 4DUGD 5ANRB 4LBYA 1N6NA 2CK3A 3L0SA 1PUJA 2R6AA 3IIMA 1B0UA 1NN3A 1E79A 1NMZA 1FPMA 3EC1A 4JZKA 3IQXA 1Z0JA 3LQRA 3AVVA 1KAOA 5SZHB 1GNPA 3GQBA 5L3RA 5LPNA 2H16A 1E9CA 1X8LA 3BFVA 4LHWA 3LV8A 2IC5A 1U8AA 1P62B 1CIPA 3AP1A 4C4PA 3I4LA 2IS1A 1MABA 4XWAA 2XNDA 2CEAA 1Z6GA 1H65A 3THWB 4LJAA 4L16A 3AVTA 1G3QA 1A82A 1DE0A 2E87A 5EE0A 1F6BA 3NBXX 4CF7A 1GZSA 1OV4A 5EUQB 3TH5A 4HDOB 2HJGA 1SVOA 2J45A 4JYCA 4D4MA 4HYYA 2W58A 1WP9A 2WSSD 5HKKA 1SVSA 5L3VA 5SZIA 3SQWA 1X8JA 3EAQA 2REXB 3W90A 3C4JA 5UKDA 1XJQA 2VP2A 4NCKA 3C14C 1VYUA 4V0MA 1Q1EA 3MMPA 4A15A 1G8YA 2VL7A 3N70A 1P61B 1P60A 1K5DA 2J46A 2YYZA 4XD7A 1TF5A 2WVJA 3IIJA 3O8BA 3CF0A 3GLHE 5KDLA 2KJQA 1D9ZA 4JLBA 3EA0A 1RRGA 4UKDA 1P5ZB 4UNSA 1IN4A 1EFHA 2IYLD 4RD1A 2GKSA 3SZRA 5AJWA 1G5TA 2ZYVX 1Z2CA 4YDHB 2NPIA 4RD3A 1I4LD 4LY6A 4R71A 3GLGE 3VR2A 3TK1A 3D3QA 4LJ8A 5B57C 3RANA 1DAIA 3R9WA 4OI0A 2WKRA 1FX0B 4QKQA 1AZSC 4MGZR 3K0AA 3RWOA 3L8YA 4BPBA 1ZRHA 1AN0A 1BYUA 3TKLA 1GOTA 3QXJA 5TDHA 4OHZA 2O8FB 1Z28A 2PH1A 1GWNA 1R5NA 2A5FA 4ASUA 4MYCA 1X3SA 4JL6A 4XJXA 3V4RA 3ICEA 1QHYA 1R0ZA 2W0SA 4G5QA 1E4YA 3QKSB 4RFSB 4EQ6B 1EK0A 2GZAA 3UKDA 3KKMA 5IK2D 1CKEA 3V9PA 4LJ7A 2Q3FA 4DCTA 4PZZA 3V00A 4HZUA 4OKSA 1HEIA 5CM9C 1A1VA 2UZIR 1DVRA 4F4IA 2O8BB 1G3RA 1F2TB 5CK5A 5F9FA 3K0FA 2EWVA 2IA5A 4D4KA 4AURA 5HZHA 1QHGA 1UBCA 4OI4A 3AVQA 1BKDR 2FOLA 2ZJAA 3GLFB 4P4SA 4I99A 2GDJA 4KO8A 4KVGA 3S1AA 2D3WA 3WYFA 4E22A 1HE1C 1NVXQ 1CP2A 1UKYA 1GNQA 2J0SA 3GLHB 5FUVA 3QSYA 2DFTA 3JZMA 3SBDA 4RZXA 4UNRA 4F4CA 1QF9A 5BXQC 2CCKA 2QG6A 2VHTA 2BV3A 4QNRA 1ZC4A 1BMFA 2ODNA 1ZNZA 1UBFA 1NG9A 1GG2A 4RD4A 5KOYA 3LQQA 4CT4B 4KBFA 4GT1A 2J0QA 2FGKA 2GZHA 3BB4A 4LHZA 3U7GA 4MRSA 1TF2A 3SEAA 2N46A 3CX8A 4DLUA 1DAMA 4GP6A 4JKYA 4D0NA 4BFYA 1CR4A 4E09A 1VYTA 3QPUA 1XD8A 3GD7A 4E5UA 1W4BA 1TMKA 2Q3HA 2AKYA 3B1WA 1ESMA 4GOKA 5EQTA 2G9NA 1TTTA 1TU4A 3LXRA 4GL2A 3ZIAA 4BLTA 4FCVA 2X2FA 5GVSA 5JJIA 4R9UC 4KFTA 1GAJA 4QFMA 4Z1MD 3AM1A 1QHNA 2PMKA 1DO0A 1W7AA 4RJLA 2CLSA 4Q4HB 5JEEA 5JMTA 3EPHA 3TVDA 2B92A 4A2WA 1D2NA 3SI7A 4Q9HA 3AF4A 5K8IA 4HB2A 3ZJYA 1K6MA 1VCMA 4NYIR 5CLLA 3Q5DA 1XEWX 1QHHA 3C15C 3FKSA 5AJXA 4ERNA 3IILA 2HF9A 1B23P 2NQ2C 2EFEB 1KI3A 4DLYA 1XEXB 1JR3E 2R6GA 4KSCA 4WW0A 1G19A 2V9PA 3K70C 2JASA 2RMKA 2ZTSA 1BIFA 3T5DA 3WP0A 1W0KA 1S9HA 3MGCA 4Q66C 3IPXA 2F6RA 5DE3A 3TUIC 4Q9JA 4AG6A 2OT3B 3FWYA 1IXZA 1NI3A 3UIEA 3X1WA 5F3WB 4DBLC 3TGPA 1Q57A 5F98A 3HDTA 3B6EA 2WWIA 1TAGA 4PXAA 5DSZA 3VKHA 4KFSA 2RGDA 2QTFA 1FZQA 4B73A 4I1SA 4DCNA 2OE2A 4LYJA 1S3GA 5BYKA 1VPLA 4ABYA 3AUXA 5BW8A 3A4NA 2FSHA 2IYRA 2RGXA 2ZRKA 1XZQA 4H9GA 1E98A 3GEEA 4BQSA 1DELA 3MWKA 1P7CA 1H8HA 2W2XA 4NYMR 5FUWA 3OFNA 2BEKA 2ONKA 1QHIA 3UMRA 3I5XA 3CRW1 5DI9A 1X6VA 4WAUA 5CDFA 3QXCA 1YKSA 1OSNA 4PSKA 4M1WA 4QHTA 3SDZA 2XGJA 3BGWA 2RGGA 1OYWA 1KMHA 1FMLA 2BEJA 2X8AA 3I62A 3SBEA 5KO2A 1KDPA 1MRNA 1XD2A 1U81A 2PZGA 4JT2A 2GCPA 2W2VA 1R8QA 2FA9A 3Q85A 3TSZA 3F3YA 1OFTA 2QTVB 5DHAA 4KYUA 5KNBA 4CT5A 1U0JA 4KHZA 3A58B 3Q5EA 4A8JC 2C04A 2F1JA 1ZIPA 3IBGA 5FH9A 1N0UA 2IF0A 2ZJZA 3THOA 5AUQA 1YHNA 3QE0A 1GKUB 3KJEA 2R9VA 5LD2C 1XFAA 1W36C 2O8CA 1M74A 1NSFA 2BVNA 4ZIRA 4LBZA 4TL9A 1Z0AA 1OW3B 2RH5A 4WZBE 3BB3A 3U61B 2L0XA 4P32A 1JAHA 1CULC 2BJWA 2B8TA 2IL1A 3NWJA 4Q4AA 4LOAA 2OHFA 3CF2A 4NCNA 1Z2AA 4NU0A 3ICQB 3OEED 5CB8A 1SXJC 3KKQA 2ZRDA 3MAAC 3OE7A 4PQRA 5J4LA 1I4DD 5FPHA 4G5OA 5IRCD 4JS0A 3QIAA 3EWAA 3U6BA 1W0JA 1VG1A 4Q9IA 3X1XA 1IN5A 4ZKDA 1Q3TA 3MUFA 5LDDC 1KY3A 3DZDA 2GETA 4MRNA 4LJ9A 2ZPTX 2ANCA 3DHWC 1G5RA 5CK4A 3BRWD 3THXB 4EDHA 1G18A 5J4HA 3VX3A 1XDBA 4DT1A 1OLOA 1NJGA 1WCV1 1OH8A 1SVIA 1RKBA 3CWQA 2FEMA 3I61A 2PZFA 4RFVA 5FI0B 1HQCA 4EPYA 2F3RA 3HP1A 3GJXC 2BOVA 3GJ6A 2WJYA 4URVR 4UJ5A 4F7WA 4CEIA 1IJEA 3CH5A 4XH9B 5FR2A 3HPQA 3RC8A 2VYFA 3H4MA 1W48A 4CVNA 3CF6R 2FZ4A 1J2JA 2CNWD 4Q7KA 2A2ZA 5AUPB 2WMNB 2XSZA 3IEVA 4C0LA 1KJZA 3SFZA 4EPXA 2XOKD 4C3ZA 4BECA 2WIAA 4NPHA 4AKIA 4NH0A 3Q9LA 4A8JA 4IOJA 3WYGA 3TIFA 5KNCA 2ATVA 1HY3A 3CR7A 1YZLA 1ZP6A 2ODEA 4HLQB 1F2UA 4GMXA 5FTKA 1S9DA 2FDCA 2DB3A 5FTLA 4PFSA 2GK6A 2ZAMA 4IXMA 4Q1BA 1E3MA 2J0VA 4TMKA 2ZXUA 3RABA 2OSBA 5C18A 4D4JA 4RSGA 1RPZA 3ZD7A 3CRVA 5CIWA 3VFDA 4TLCA 4ARZB 3LNCA 2ZRCA 4BZQA 4N0EA 4Q4LA 3KQNA 2A30A 2J0UA 1CLUA 3FPAA 4V02A 3U4QB 3VU9A 5A5GA 2AFHE 1OFHA 1VG9B 1ZYUA 4L4UA 4MGKR 2LWIA 3GLGA 4D82A 3L0IB 5C4MA 1ZW6A 5F2EA 4Q7JB 1U98A 2OCYC 3DKVA 1XTIA 2G0TA 3W3AA 4MUBA 3QXHA 3RSOA 4O0MA 3C5CA 4YMUA 4A0RA 2UZ3A 3LWNA 2KI5A 1R5BA 4LBWA 1G21E 1H8EA 2MSEB 2WOJA 1UADA 2MSCB 1N0VC 4A92A 2WV9A 1C9KA 2HDNB 4NL4H 2XB2A 2GJ8A 3NHAA 1YZNA 3AQ4A 1Z07A 1EGAA 3DVLA 1E2JA 1NJFA 4PZYA 3TUJC 5IHPA 1N3BA 3A1UA 2V6IA 4V0ME 1P2VA 1NF3A 3HU3A 3PEWA 1A5TA 2F1HA 1LB1B 2ZRGA 3GLIA 4JLPA 4LCBA 2OAQ1 3QKUA 4DSUA 2F1IA 2OM2A 2ZJ5A 1TUEA 2ZRPA 2RHMA 2KBFA 1XWIA 4LYFA 4E03A 1SHKA 4I1UA 2H92A 1M1YE 2FF7A 4WXRA 3G5UA 2WJHA 2OCBA 1Q12A 2QAGB 4UXIA 3AH8A 3KKPA 3T1OA 2ZE8A 3NKVA 5FUXA 4NCHA 4V0OA 1FP6A 1ZD9A 5JWOA 1GDDA 1E4VA 2JLVA 1IAQA 1YR7A 3B82A 3IBYA 2G88A 1IY2A 3IO3A 4MDFA 1Z8FA 2ZRHA 2W83A 4OQNA 4OL0A 2ASEA 4DZZA 5DH9A 2MMGA 2IS4A 4HAYA 1KTVA 1T5IA 5M04A 3AP2A 1DARA 3SJZA 4BRWA 1UFQA 3FVQA 1MABB 3WNBA 4C2UA 1NG1A 4R98A 2GAAA 4Q47A 1KI9A 3PEUA 3ZVLA 1FUKA 4YMTA 1COWD 2JIZA 1W46A 1KK2A 1NVVQ 3RS3A 3TQFA 1OHHD 2AD5A 2O0HA 1KO5A 5JRJA 3JVUA 4FWIB 4R2IA 1JNYA 2C2HA 1EXMA 4TMZA 1YE8A 1UF9A 2CCJA 3KJGA 4OQLA 3EZ2A 4LYAA 1KKMA 4HDCA 5EXPA 2RGBA 2PCJA 3KKOA 4C0SA 2AHOA 2D7DA 3LAWA 1J7KA 5BYJA 2REOA 1Z0IA 2JLRA 2YKGA 1FFHA 3G0HA 4DB2A 1SKYE 4A6PA 2GEDA 3ZVMA 1Z6AA 2VSFA 1SHZA 2BJVA 1GL6A 4JLNA 2FG5A 2NOAA 3IHWA 4KLZA 2VBCA 4AKEA 1CJMA 3A1WA 1N0WA 4PQYA 1D6JA 4OK5A 3VR1A 3U7EB 1IOZA 4B71A 2I3BA 3QJYA 4BLRA 2GJAA 3TJZA 4ZDIA 2O8EA 1GSIA 1EFRA 1CEEA 2Q9CA 3SYLA 4PHHA 221PA 3Q7QA 4LWZA 1CJUC 5FPSA 2VP6A 2A5YB 2YINC 4YQFA 3LO5A 4HLCA 3L0OA 4TL6A 1A7JA 2ERXA 1OB2A 1YR8A 4QOSA 2V4ZA 3P1JA 3Q3JB 4E07A 2WWGA 2O0KA 2BBTA 4V0KA 2JLWA 4TN1A 3U6KA 3LX8A 1Z6YA 1AK2A 4MITA 4QJ3A 4DLVA 2QENA 4BGDA 4FMCB 4BLOA 3FMOB 2IYSA 1E9DA 4LRWA 1JBKA 3SYNA 3TAHA 1XPOA 2QUZA 4HZUB 3WMGA 2AKAB 5FPYA 4C0HA 4EPRA 3UATA 1E99A 3BOSA 3EZ6A 1Q20A 4B3XA 2MSDB 2QMUA 3C41J 3G82C 3PQCA 4Q1DA 2HT6A 3K0FB 1JR6A 4UXJA 4FW9A 3HR7A 4MGIR 1UAAA 3SOPA 1RJ9A 1MO6A 3ADBA 2ZANA 2OBNA 2VP5A 3B9PA 1VG0B 2WPDD 1HYQA 3W5IA 4DJTA 4EAQA 1DAGA 4P4SB 3PXGA 5GJBA 3AKEA 3S1AB 4BFXA 1DAHA 3AVPA 2BBOA 2CL6X 3PUZA 4LHYA 4CEHA 1N6OA 1ZJ6A 3TMKA 3TRFA 1G16A 1SKYB 2C77A 1Z0DA 4DLRA 2DCUA 2XZOA 3CLVA 2ZYWX 1JALA 3RC3A 5L3QA 1E9FA 1NN0A 4US0R 1G5PA 3CPEA 2QT0A 1NN1A 2A78A 2V54A 1DAFA 1NVUQ 2ZVPX 2I1QA 3LLUA 3QQ5A 4D25A 1Q21A 2OFOA 1DTSA 1XF9A 1NIJA 4IVPA 3AP3A 4OJKA 2J7PD 3M4YA 3REFA 4EQ6A 1L2TA 2QNRA 3DZ8A 4DEXA 3CR8A 3KUCA 4XVQA 4HB3A 1XTRA 2ZEJA 4NTZA 3SS8A 1LY1A 1U8ZA 2J3EA 4GSYA 5G41A 3A6PC 2G0NA 4LBVA 1D2MA 5FOUA 3UMFA 4A36A 1U90A 3D8BA 2ZM5A 4DWJA 3PV0A 2AL7A 3I73A 1N6LA 3E70C 2QN6A 3NEYA 1GTVA 5AUOB 2HYIC 3E2IA 2H5EA 4TL7A 3CB4A 4TT3D 4OBEA 3C7KA 2QBYA 4PX9A 1KIMA 3LVQE 2WWWA 4GPTA 3FDIA 4XOIA 2YWGA 1JJ7A 3PFIA 2AXNA 3GEIA 2ZRNA 4F92B 1VCNA 1HV8A 4H1UA 1EWQA 3QUSA 3U7FB 2X2EA 4TMXA 3LY5A 3OAAD 4EIWA 1M2OB 4QHSA 5FL7A 5IK2A 1QHHB 4I1OA 3GJ8A 4MRVA 4OJQA 5FOVA 3T35A 1GL9B 3RDPA 2HEIA 3AVWA 2OXCA 2SHKA 2BIFA 4B6FA 4B3FX 1FNMA 4PHTA 1KDRA 3NC1C 4G3XA 4M9XA 4QC2A 4B74A 5J4KA 2QRNA 2VTKA 2XX3A 1OF1A 1KNXA 4IXNA 4DLZA 3BE4A 3QI2A 2IYYA 4DDVA 2BMEA 1M7BA 3SHFA 4QGFA 4HDQB 1WA5A 4G1UC 4F38A 4EFNA 4QGAA 1DOAA 4PZLA 4RKFA 3VAAA 4WBSA 2BHRA 4Q48A 3I92A 3R7WA 2NO0A 1YZGA 2GF0A 1Z6XA 1Z06A 1UBEA 4B32A 4WOPA 1JQLB 1W2GA 4JKIA 6Q21A 3Q72A 5JFGA 4Q21A 1PZNA 1HURA 2V6JA 4M1YA 3BJIC 4XIGS 1W4CA 3VKGA 1YZUA 2G83A 3EARA 1W44A 5CLQA 5KHOC 3Q8XB 4BZPA 1FTNA 3W5JA 2WAXA 821PA 3KB2A 5BN5A 1RRPA 1G9XA 3L0PA 4MRRA 4Y0VA 3M1IA 3LA6A 3B60A 3FOZA 1YQTA 1QBKC 1KMHB 4ZDKA 2WJVA 4P33A 4POAA 5K8TA 4KFRA 3WXMA 1XD2B 5FBLB 1XXHE 1Q1BA 2AN9A 2B7BA 4A9AA 2ERYA 2ZAOA 2R44A 5FBQB 2CHVA 1FMJA 1P2SA 4Z1MA 1WE2A 4KVAA 4LC1A 2V1UA 4LC0A 1E2QA 2V7QD 1ODFA 2EWWA 2BBSA 4URWR 3MCAA 1IQPA 3TE6A 3IGFA 3KDSE 2O8CB 1KGDA 2JCSA 3QG5A 4ZIRB 1JXMA 1NBMD 1L7VC 3B5JA 1T6NA 1MKYA 3QENA 1U9IC 2PZEA 2ZJ8A 3CBQA 4Q4AB 3U3JA 4Z8XA 1KO7A 3OEHD 2AR7A 5B30A 4DSTA 1Z3IX 2GJSA 3LD9A 3NBZC 2IUTA 1X8KA 1KO8A 1ZUHA 1WBBA 1SXJE 1ZU5A 4IDOA 3NBYC 2QQEA 1N5LA 1MT0A 1QZXA 1WQ1R 2IXGA 2QZ4A 4A1FA 3EPLA 2FV8A 4NYJQ 3HU2A 1PV4A 4JJZA 3QKTA 1ZUNB 4B43A 1RC8A 4B2LA 5JLJA 3T34A 1UPTA 3ND9A 4HZIA 3ADKA 4G5GA 1E2KA 3BFKA 4FMDB 1SGWA 1F3OA 3AEZA 4LHXA 1VG8A 2HXSA 5EE1A 4C7OA 2ECKA 5HE8A 4PAMA 1HA3A 4BWYA 5JS7A 4CYMA 2P6UA 2EVWX 3GMTA 3TAUA 3C16C 2DFLA 2CHQA 1JB1A 2C5LA 3QF4A 4I1VA 1LVGA 2FJUA 4TZ6A 1Q44A 4LJ4A 2W6ID 4CEIB 1AIPA 5DI3B 3GLIE 1G4AE 5EXXA 2CLDX 4Q9LA 5AJZA 4PC7A 4HAXA 2FPKA 3AF3A 3BD9A 3MD0A 3NDPA 1ZD8A 2HUPA 2ZJOA 2D2EA 2OG2A 1EX6A 2LKDA 3HYTA 1LF0A 4X8LA 2BKUA 2C8VA 121PA 1F2UB 3V4FA 3W9YA 3AGPA 3DL0A 5CJ2A 4PANA 3T15A 5HZKA 4FCTA 2P2LA 5LD2B 4M1OA 2IXFA 1M6NA 1Z29A 2P65A 4GBMA 1W36B 4NE2A 3ASYA 5ELXA 4GRAA 2O52A 5JWHA 5CITA 3K0SA 2DY1A 1KSGA 2GTPA 1AQUA 1U9IA 1TU3A 4U02A 3A4LA 1AGRA 3L82B 4HAZA 1GRRA 3OIYA 2Q6TA 1GRNA 2VH5R 2AWOA 2ZSDA 2J0UB 1PLKA 3VU9B 3UPUA 5E95A 3BXZA 1G8PA 1TUIA 4NYIQ 4PR0A 4ZDJA 3GLGB 2NO7A 4Q1EA 4WA7A 2CVHA 3OEEA 3WNCA 1NVWQ 5KNDA 1YR6A 4NCJA 1PVOA 2FFBA 4N1AA 3PG5A 521PA 4A0FA 1NL3A 2WJJA 2CK3D 1Z0KA 2JJ2A 4OI1A 2VP9A 4JIMA 1E79D 3LBNA 2GESA 1KK0A 5FTJA 2JLQA 5HR5A 2BKEA 1II8A 2CE7A 4QRHA 4A0HA 4DDUA 4YMVA 3IIKA 2XJ4A 2DR3A 4U5XA 4NONA 4OQMA 1BOFA 2CMKA 4LI0A 5FBRB 2IEYA 5FOSA 1QHXA 3EG5A 5GJWC 4HAVA 1E94E 4S35A 2QU8A 4OHWA 4ZPXA 2LKCA 3O47A 1MR3F 1N5IA 4AIIA 1N6KA 1GVNB 1U94A 2YWFA 3GFPA 4URZR 5LB2A 1VIYA 3R9IA 2JLYA 2XOKA 3K8YA 4NYMQ 2RAPA 4PSVA 4TMTA 3OZXA 5C46F 4LV5B 3SE0A 1OFUX 1VTKA 2DPXA 3P26A 2KB0A 1Q22A 2ZETA 4HLUC 2GAOA 4C0QC 1T9HA 1MO4A 1IBRA 1OB5A 1T91A 2VO1A 2H57A 5CYPA 4QJ5A 1TEVA 2P0EA 4XD7D 3X1ZA 5C4GB 5TB5A 1E2NA 2YHSA 3PUYA 1R8SA 5EP3A 4RD2A 2Y8EA 2VF7A 1U8YA 4QL3A 4EPWA 2IYZA 1GKYA 4FMCF 1RYHA 3MJHA 2W6JD 2FFHA 4LYHA 4QHYA 2GCOA 3TW4A 1IM2A 1W4RA 2IX3A 1HE8B 2F9MA 2AK3A 2PT5A 4X8MA 1T3HA 5CJPA 3QVVA 2FFQA 3BB1A 1MH1A 4C0KA 4DLSA 3EASA 3ONWA 4M1TA 2OEPA 4LJ5A 3CNLA 5TARA 1OIVA 2F43A 2IS2A 1YRAA 4B47A 1KSJA 4ESHA 3ECCA 4GFDA 5A4JA 1A2BA 1M34E 2NG1A 1VHLA 1L4UA 5IT5A 2IUSA 4AWXA 3K09C 2J1LA 3OIWA 4AYTA 1XTSA 5JCPA 4DXAA 2QTHA 4U7DA 2ZIAA 4JBWA 5G3ZA 4L9WA 4BEJA 1YU9A 3B13B 3PCRB 2WICA 2A9KA 4FINA 1KHTA 2TMKA 2K5UA 3VR6A 4BASA 2GEVA 3SC3A 2BDTA 4TTQA 4JL5A 2QAJA 1NBME 1TX4B 2IEZA 3BERA 3REGA 5JECA 1AS3A 4OI2A 2KSQA 2ZI9A 3TNFA 3NG1A 2X1VA 5JI3E 3A1TA 4MUAA 3SNHA 4MGYR 5B2ZA 4D0LB 3R8FA 4DIEA 2O8EB 1UEIA 2YOFA 1S1MA 1JI0A 1G7SA 2ANBA 3LDAA 2ZI6A 5KUTA 3AB3A 4JVSB 4BFZA 2YOHA 5AWFC 1Z5ZA 3DKPA 4M9ZA 3VR4A 1E2GA 1US8A 3MSXA 1BMFD 1CRPA 2GVZC 4ILEA 2JA1A 4JLMA 1MOZA 1E1QD 3HWSA 1R2QA 2FN4A 1XX6A 4WIAA 2GCNA 2VIIA 2V1XA 5AR1A 1XNJA 2NMVA 1N6IA 1AA9A 1XEWY 2Q9AA 1T5LA 4DDWA 2IW3A 1S3SA 4QGHA 2G77B 2DYKA 4XSHA 1COWA 2E1RA 3CRQA 3GJ0A 4EFMA 5L8VA 3U44A 2ZITA 2FFAA 4F93B 1FX0A 1OHHA 4Q00A 2PJZA 2XXAA 3K09A 1XXHA 4B3GA 2GK7A 5JCZA 1RJ9B 3HU1A 4BFUA 3AVOA 4ZI2A 3B85A 5JJKA 2CE2X 2WZQA 4CEHB 1T0HB 1FQKA 1Z63A 4CEJA 1J8MF 4OYHA 3W8NA 3ZQJA 4RFSA 1AM4D 5L3QB 1EESA 1G6OA 1GILA 1GKIA 2JDID 3B1ZA 3B2EA 4IW3B 1M7HA 4OHVA 1G7RA 1E2IA 1Z47A 1YR9A 2F3TA 4JT4A 4A6XA 3SR0A 1NY6A 2CL7X 3LLMA 4Q1CA 5GJVC 4TYYA 1JEEA 4OHYA 2D4HA 1W4AA 1Z08A 1TADA 4QBFA 2VQSA 1XTKA 2D7CA 1XCMA 4KYIB 4TYPA 2H7VA 4PC6A 3K0CC 2J7KA 2YOGA 1NSTA 3E1SA 4TSFA 5FUYA 3RS2A 1WDTA 2VSOA 1W0KD 3U2QA 1SXJA 2ZU6A 2JATA 3GLFA 3ZQ6A 3R9XA 1JEDA 3MWJA 1KI6A 5TVKA 3QEOA 2OLJA 5DI3A 2CJWA 5KDOA 2DFNA 3K1JA 2BWJA 1KY2A 1P2UA 4TQAA 2QMEA 4RCZA 2WOOA 1KI1A 2A3RA 2DBYA 4KU4A 2EYUA 2QQ0A 4UJ3A 2FGJA 4LK2A 5TMPA 2QGZA 1E32A 3NXSA 4IRUB 3UWKA 4KITB 3CKLA 1ZBDA 4TZ0A 3AF2A 4C0BA 1OH5A 1JPNA 2IHYA 3GFOA 4P4TA 1E1RD 5DIFA 2XTNA 3RAPR 2D62A 4NDZA 4YXWD 4FN5A 5EE5B 4FIDA 4TYWA 4B75A 4PHFA 2ZI4A 5AJVB 2F55A 3DM9B 1JECA 3R8CA 3SYKA 2HCBA 1IN7A 1ZU4A 2N42A 3I72A 1XP8A 2A7QA 3CWZA 5DLQC 2ZE6A 4L9SA 3PIRA 3CNNA 4TTPA 1R0WA 2IXEA 2I4IA 4DEYA 3GPLA 2O8DA 1FUUA 4GMDA 4HLDA 5KSPA 2WPDA 4AI6A 3EC2A 4A4DA 4CDGA 4LUCA 2VEDA 4FMDF 4Q19A 2IWHA 621PA 1LW7A 4IOKA 2QMHA 2DHRA 1A2KC 1S0UA 5BQ5A 2VRWA 2UKDA 1U0HC 2KE5A 3TW8B 4B44A 4KSBA 4XVRA 5FOXA 3H86A 1GIAA 1AKEA 1GUAA 4MH0R 3RS5A 1C4OA 1IXRC 1Q0UA 4LPKA 4CZ2A 2ZI5A 3K0CA 2J7PA 4JMPA 2QPAA 5C2JB 1T8UA 3QKRA 1S1CA 3CPJB 3T1QA 3ZH9B 1D2EA 4JLDA 4PSAA 5CIQA 2QROA 1G20E 4MYHA 1J8YF 1XJ0A 4IHQA 4RZUA 3OE7D 4DC9A 3B9QA 1AS2A 4W5HA 1E2DA 3GJ4A 1NIPA 3QNUA 2OZEA 3ZZ0A 3KJHA 2PX0A 1GFIA 2ZQ5A 1ZIOA 2R6FA 2J5XA 2VHUA 1ZM9A 3LVRE 2CL0X 4DDTA 1T0JB 4TT3A 3P20A 1XD9A 4D80A 4PHGA 1JPJA 2VF8A 2GXSA 3J81k 4TTRA 2OBLA 4HI0E 4HB4A 2C99A 1Z22A 3K0EA 5EXTA 2XAUA 1N6RA 1YRBA 4S2EA 1E0SA 1VHTA 1HTWA 3OAAA 5FFMA 3MLEA 1KYIA 4EFLA 1SVWA 5E4FA 3K9LA 4IVRA 3RYTC 4AYXA 1KK3A 4PPNA 4M4SA 2R6DA 3T1TA 1ZNXA 1YJ5A 1DADA 2OXRA 4US1R 2HLDD 1NN5A 2EU8A 4OHXA 4X8HA 2AK2A 4RZ3A 3EPKA 2P5SA 3FFBA 3F5FA 3LBHA 1G7CA 4GZMA 4D2IA 2X77A 1I4TD 4LV6A 3N2EA 2W2TA 3OIVA 1YZKA 1UKZA 3NIBA 5EZ6B 2ATXA 4PPGA 2G1JA 1IY1A 2QA5A 4LGMA 2G6BA 2C03A 1MV5A 4HATA 4C30A 4AD8A 4DUGA 3K0AB 4G01B 3PJRA 2CLCX 2ZRBA 4TYNA 1WBDA 1DAKA 3T5GA 2ZSFA 5BWMA 3KQLA 1G4UR 2GNOA 2YVUA 5DGXA 3U5ZB 2RB4A 3CNOA 2DFKB 3DMDA 5JBQA 1QHSA 3IKJA 2DWOA 5A0FA 3QF4B 3PVSA 5DHFA 4KI0A 4I4LA 4M1MA 3UANA 2BCGY 1W2HA 1DG1G 1N25A 3W34A 4KAXA 2YJTD 2EQBA 4BZXA 4G5RA 2AWNA 4AY2A 2XTMA 3ZD6A 2KBEA 1G7TA 5P21A 4IVQA 4TWZA 2RHDA 1ZMXA 4M1KA 3DO6A 3NH6A 2H18A 3AVUA 3FB4A 1KZGB 2AX4A 4TQUS 1Q1QA 3KL4A 2VSXA 2REBA 2FSFA 3CRRA 1QRAA 1ZCBA 3DM5A 1NLFA 3P27A 1SKQA 1NKSA 1P3JA 2WSSA 2OUKA 1P6XA 2V7QA 4EJSC 2Z5FA 3L8ZA 2W0MA 2P6RA 3A1SA 4HUQA 5J5CA 2VHJA 2X19A 2OCAA 4PO8A 1OXSC 1XJCA 2EFGA 2ZYTX 2IBMA 2ZREA 2P67A 1NBMA 4B2PA 4TLEA 4C9BA 4I81A 2QORA 3IUYA 2QPTA 1IJFA 3Q7PA 3T1VA 5J4VA 3QXSA 1ETUA 2BC9A 3OEHA 3U3KA 2PCLA 3SQXA 4IEIA 3W8RA 2JJ1D 2YC4C 2PLRA 2ZSAA 4Q7LA 2WSMA 4MRPA 4ZDWA 1E9EA 2QAGC 4B76A 2D74A 1GL7A 2VHCA 4JJKA 2QM7A 4XVUA 1D9XA 2ODWA 4IDQA 3PUWA 2UVQA 3BH7A 1SVKA 3MFYA 3GJ3A 4Q1FA 1II8B 1W5SA 3ZS9A 1SVMA 4JVMA 4NP6A 4WXPA 1J99A 3QOFA 1ZCAA 2GA8A 2ZJYA 3U60B 2GRJA 2QY9A 4AKGA 1TPZA 1K8RA 3WMFA 1YZTA 3OIUA 2EFCB 4JLKA 4UNNA 4QM7A 1OXXK 1RVDA 3MRSA 3MWLA 4MKGA 5B64A 1S4QA 5L3SA 2GXAA 4TMVA 2W6IA 5FBWB 3UK6A 2FPMA 2JIZD 2NO1A 2EFDB 3QY0A 4B48A 2QE7D 2IYXA 4TMWA 4Q03A 4B34A 3IO5A 3D7MA 4XSGA 3CX6A 3DOFA 2XEXA 2P3SA 3DOEA 2FH5B 3CIOA 4EJSA 4QJ4A 4J0QA 1EFUA 3MG9A 3WBJA 2ZRFA 1G3IA 1ONBA 1R7RA 2IYVA 5H68A 2AFIE 1U0LA 2QP3A 4UNPA 5JJLA 4IDNA 3CM0A 2JLXA 4W5WA 2C9OA 2FNAA 3AKDA 1OIXA 2ZR7A 5TXGA 3RRZA 3O8RA 2WKQA 2OFXA 1OH7A 1NMYA 3PEVA 1E2HA 1MRSA 3DMNA 2GCOB 1JR3D 2YWEA 3QVUA 2AXPA 3LW7A 1WRBA 2JLSA 3WNDA 1JXOA 1OJLA 5H8WA 3BWDD 1CR1A 5TV2A 1OKKD 2ZJ2A 1AZTA 2DWPA 4MYTA 2ZUBA 1DBSA 2ZS9A 3SN6A 5JEDA 2R65A 1TF7A 5EP1A 1TQDA 3HR8A 4MKFA 3KFXA 3VTKA 1E2FA 4ITRC 1OXTA 2ZE5A 4DKXA 4GDFA 3UXMA 3UG6A 4AC9A 4Q4JA 2CVFA 2OFWA 4US2R 3CPHA 4MKIA 1VYVA 2RGAA 2ZROA 4JSYA 4Q5IA 1I2DA 3O8CA 1F48A 2F9LA 1HUQA 3AF1A 2PL3A 3EZFA 3KFVA 2Q0HA 4F91B 1IN8A 5FOTA 3RS7A 4DLWA 2ONJA 1PLJA 2XITA 3I1FA 2J9RA 2PT7A 2IYUA 4DRZA 5LB4A 3I5YA 1G8FA 3EIEA 3ZGXA 3N2IA 4Z51A 1JQJC 3VHXA 1SULA 721PA 1GP2A 2ZVQX 4ZO4A 2WAYA 4PO1A 1P72A 3KTAA 4RZ2A 2GBLC 3F8TA 3EXAA 2VP0A 3AUYA 4YMWA 5HTKA 4ZI3A 5DYGA 3C5HA 4D81A 3K70B 1XPRA 1XMSA 1XU4A 1ZNYA 1TNDA 2WMOB 4MDEA 1LV7A 5HCIA 3RRYA 1TEXA 5KSZA 3RRMA 4MYUA 2FSGA 4P31A 3T12A 4BUJA 3GLFE 3KUDA 1CRQA 5AK0A 3PEYA 4BLPA 1KKLA 2H17A 1KSFX 2OCPA 4M22A 3K9NA 1US8B 2H1LA 1Y63A 5KTYA 1IONA 4HAWA 4FMBB 4M21A 4DT1B 5TY0A 3ZVRA 4HEJA 2FMXA 2W6JA 2A5DA 2C78A 3NHBA 2WWFA 3N5CA 1HH4A 4UQOA 4W9MC 4IDHA 5EP2A 5K8UA 1EG7A 1ZAKA 2ZUDA 2JLUA 3U44B 1OXUA 4PC1A 2XXAB 1XXHB 1G1MA 4F4JA 1IXSB 1ZC3A 1S96A 3KZ1E 4A8JB 2Z4RA 1RIFA 1LS1A 4FCWA 1OIWA 3TLXA 3PR1A 1VDZA 3K53A 2YWHA 3B1XA 4EPTA 2KWIA 2ORWA 3GJ5A 4IDPA 4CEJB 3IQWA 2J87A 5K8LA 3UWOA 3FKQA 2QI9C 3WHLA 1ZNWA 1IY0A 3KB1A 4PAOA 5FL7D 2R6CA 4ACAA 5DN6D 1VMAA 3I3SR 4JLJA 1E6CA 2GBLA 2GJKA 4HSEA 1R6BX 1CU1A 4PQFA 1O3YA 4N3NA 4NYJR 4TLDA 1JAIA 4DCSA 4MQBA 4PPFA 4M9SA 5FPKA 3GP8A 1Q1ZA 3VNVA 4QNMA 1AQYA 1SXJB 3KKNA 3LXXA 4WZ6A 3B78A 5JSZA 5EE9A 1TQ2A 4LV8B 2NO9A 1KI6B 5EE3A 1FTSA 1ZM4A 2CJWB 3TBKA 3TR5A 1W47A 1XTJA 2ZU0C 3FHCB 4RCYA 4A2PA 4KV9A 2OLKA 3ADDA 2Z83A 3FHTA 3WYAA 1CR2A 1OFIA 1P9NA 3A1VA 2XNSA 1KO1A 1T3SA 3KXKA 3QEJA 4QG7A 4WZAE 5D3MA 1E1QA 2P6NA 2MMCA 1UEJA 1ZM2A 2C9CA 5EUMA 4O25A 1HQYE 3BH6A 1OYYA 4Q01A 2RGEA 2IWRA 4DB4A 1NY5A 3EPJA 4TLAA 1GRQA 5G40A 2QM8A 4D26A 1E0AA 2ZRLA 1PLLA 1DEKA 2XNDD 3CW2A 3GLIB 3B1VA 4JBXA 4URYR 4V03A 3QBVA 4BRUA 1G3UA 2R62A 1ZVQA 3EW9A 3IPYA 3WBKA 1UM8A 2JLZA 2CNWA 2O8DB 4QBHA 1CS4C 4D4LA 4NHOA 5E7MA 2BM1A 3SHWA 3U3MA 1RRCA 2OAP1 3P32A 5HKKD 5KYKA 4CIDA 3SJBA 2IYTA 4M8NE 3KXLA 4L5BA 2IF2A 3ZS8A 1DO2A 2QPOA 5KSOA 4FI3C 2JDIA 4GI7A 2C95A 5J47A 4YDSA 1WB9A 1G3MA 2B8WA 1EFCA 1AGPA 1S8FA 1AS0A 5IDVA 421PA 5AUNB 4W5JA 2HJVA 5DISB 5BN3A 5KU1A 3FTQA 1WF3A 3NH9A 3QKRB 4FD2A 4PC3A 2ZI7A 5IF9A 3CRMA 4RY2A 3FFAA 4NMMA 1G8HA 1IHUA 2GXQA 4Q02A 4OK6A 3THYA 4G5SA 3ZDQA 3W6OA 4KBGA 1D8TA 3GEHA 1YVDA 4O2LA 2ZYUX 2GVDC 4PTLA 1LS6A 3MJRA 1XBTA 3X1DA 1R10A 4XWOA 3BIFA 2ODBA 2O5VA 5KDDA 4FXPA 2NPFA 3ZYCA 2NZ8A 3DPUA 4AK9A 1FL9A 1T3LA 1X1SA 4BFWA 2ZR9A 3IEUA 3QBTA 2V8OA 4ASUD 2JJ8A 2YV5A 2G1KA 1Z83A 4BFVA 5FBVB 1VCIA 4WVFA 1E1RA 4H1VA 2F1RA 1E2LA 4B35A 3EA5A 3EZ9A 4YXWA 4IFEA 2NZJA 1N2CE 1Q3HA 2ZS7A 2OESA 5SZKB 1QVAA 1QG4A 2QT1A 5G3YA 1G41A 1KK1A 1RYFA 1L4YA 3THWA 1FOEB 5GADl 2WKPA 3U3OA 2OILA 4QXAA 2B21A 4PAQA 3NDBB 3FHOA 4BFSA 1NP6A 4D6PA 2QL6A 4CRWB 4BE7B 2WIBA 1R5OA 2BMFA 3TR0A 4B33A 4HLUA 1I2MA 3VHLB 1KOFA 3IHLA 2QEQA 1RW4A 1CBUA 3TVTA 1SVLA 3GFTA 1PUIA 2VA8A 1W1WA 4Y0AA 1ZINA 1E0KA 2IYQA 2XB4A 2OBMA 3NC0C 3CZQA 4GOXA 1NKTA 3H2YA 2ZJBA 2E9SA 2ZRJA 4MA4A 3L43A 4NCIA 4ON9A 2G3YA 2R2AA 4LJ6A 3X1YA 2Q3MA 2RKOA 5E7IA 2ZS8A 2J41A 5AJYA 4U00A 1G64A 4B2IA 1M7GA 1RE0A 3VX4A 1MO5A 4ESVA 2BMJA 4A82A 4C2TA 2CDNA 1ZUIA 3RVBA 3ZLJA 1UKVY 3ADCA 3D6TB 4JSTA 4M1SA 2FZLA 1E2EA 3CUEF 4B3DA 2LCFA 1KJWA 3FYHA 4Z8YA 2H8KA 2JJ2D 4XTCS 4AKHA 3BH0A 3KQKA 4XTRA 5KPDA 1II0A 2WBLC 3I8SA 3C8UA 5FL3A 2ORVA 3ZIAD 2B7CA 5CB6A 3EIHA 1CJKC 4PPQA 4AG5A 2FPLA 2PJRA 4V0LA 2YZ2A 2PEZA 1KJYA 2PMDA 4RD0A 1NMXA 4DCVA 2O8FA 1XRJA 2DWQA 1IN6A 4Q1AA 4HUQB 1BYIA 2WM9B 4LX0A 3QKSA 1WXQA 1ZD1A 2BMDA 3I32A 1XZPA 4M2LA 3ZZTA 3A36A 1XMIA 5E3HA 3CONA 5HCNA 1P73A 3FKSD 3U7HB 2ZI3A 1DAEA
chains in the Genus database with same CATH superfamily
1Z0FA 4P5PA 4X6YA 4YP7A 3PENA 3AKCA 3O82A 3A4YA 1QH9A 2HLDA 1EM6A 1KZ7B 3RHFA 4AQYB 2ZIEA 1SU4A 5H1YA 1JP7A 3TUZC 5IVKA 1EWVA 1F2TA 1NXSA 2IYAA 4P4UA 3CLKA 1JG7A 2XTZA 4PWZA 2DH5A 1ZW1A 2QRJA 5KOJA 3ONFA 1L7QA 3ESAA 1RBQA 4B4DA 1I6KA 3KOOA 1SU6A 4GM4A 4KJZA 2K2WA 1AJEA 1X15A 5TIIA 4KFUA 3TIGA 2FN9A 1GPJA 1YMQA 3DWEX 4D6XA 4N0DA 1EWRA 2RI0A 3LUDA 3PC7A 4EEXA 2XGOA 2E5FA 2J85A 4D3YA 3NOXA 1V4BA 3OCYA 5F2KA 1WIWA 2QBYB 3D1JA 3ESCA 3QBDA 2VJKA 3LKZA 3NU1A 4KUHA 2ZCJA 4MTCA 2FW9A 4QPNA 1JDSA 4CLOB 7MDHA 3EEFA 3E3OA 1DP4A 1JWBB 3QU5A 4OGLA 1ONOA 2FU5C 1N2IA 3ESRA 4C7XA 1HE4A 4F2PA 1H8HD 1W49A 4QGBA 4O2RA 1OLXB 3OFND 2YFKA 4UNQA 3TRIA 1VJRA 4B9AA 4YT8A 4QX6A 4LDJA 2JAHA 5H02A 3FRIA 3KQUA 1BTOA 1J0CA 1UWKA 5ERGB 3FLEA 5JHHB 2R8RA 1TZBA 1XVAA 1E20A 2UZAA 4L15A 2A5GA 4LC9A 4RD6A 2GN1A 1XMVA 5C1BA 1II9A 1T1RA 5CYOA 4M9QA 1Z7GA 1C1HA 2FE4A 2WLSA 4I50B 3X1MA 4KFCA 3K9HA 3SZOA 3S2GA 5FTNA 1T36B 2QW1A 1YB5A 2PBRA 2QSJA 1NNEA 1ADJA 1J20A 4I9HA 5C35A 4Q4HA 1SUEA 4IUBS 2GJ9A 4J7XA 3S8YA 3SICE 1CR6A 3CO5A 1G9SA 2BGKA 4WCDA 4M0KA 3TIIA 3I2YX 4N7MA 3H04A 1HLGA 1QS0B 2FW8A 1RJWA 5ALYA 3TTYA 4E13A 5BV8A 2H0AA 1OZ0A 5LQCA 3T52A 3L7IA 2E4VA 3AO0B 4NENB 5EAIA 3ZDEA 4JJGA 1XRMA 2IUFA 4D96A 1GM5A 4LDNA 3NHZA 1QFXA 1ESNA 4F7DA 5HQ3A 1J1UA 4WFKA 2ZUTA 3ASZA 3GROA 3TLYA 5BPHA 1P9RA 3NW9A 2CFRA 5AKXA 1P9WA 1QVRA 4GS5A 4FOSA 4FLEA 4LXIA 4BNDB 4UBMA 2V4UA 3HCDA 4G2TA 4FFOA 4RIEA 3BQMB 1CUJA 3ZJUA 1OC2A 3ETDA 5CXSA 3MBIA 3MTIA 3PCTA 5ALUA 3HY3A 4KDRA 4ZYTA 1RWXA 2GZ2A 3WWPA 2A0FA 1O6BA 3CH4B 2VFAA 3FVTA 3ZXIA 3AR8A 3EX7C 3DAOA 1Z33A 2BBWA 3W6PA 1YFLA 2CXXA 2ZSEA 1KEUA 4Y8VA 4DCMA 1O9GA 4ND7A 2G09A 1A97A 3LP6A 4JL8A 4FDMA 2ZRMA 1Q0TA 1XNRB 4BEBA 1GPUA 4Y2JA 2GFIA 2YJ5A 2HSJA 4QYIA 4FP9A 1ZXLA 3IEPA 5JAPA 1BNCA 1DQZA 1XEFA 3UGJA 4I2VA 4ZEWA 2G1PA 4C4ZA 2Z8YA 4TGLA 1SCKA 1Z6TA 2FW7A 3NHWA 4JR1A 3VHXB 1A88A 3GT4A 3OHMA 5ER6A 1JHUA 5K6RA 3RB8A 3BK7A 3KTAB 4IH1A 2XJ9A 5KCMA 3WWDA 1Z6ZA 3TLMA 1GNTA 2QE7A 2GPSA 1BJKA 1F9AA 1HXHA 4FE7A 3CV3A 2Y1DA 5TSDA 5JO0A 2DPMA 1FVOA 1SAYA 3OCZA 4IDCA 4RGYA 4C05A 2I3AA 4EB0A 1DKUA 4IO0A 4OCZA 3FTFA 1R12A 3NTUA 2FKNA 2G9RA 2MSLA 2OD7A 2QTVA 2XE7A 4CE6A 1WV1A 1YCDA 1NF2A 1E7RA 5JS2A 3WYBA 1KIFA 2VJMA 3JALB 4L74A 1LXCA 4YJFB 1K7EB 1ZJ4A 1WXHA 2RHTA 3SGLA 1CQJA 3H2GA 4Y1EA 5E9QA 2H85A 3DXXA 3TX2A 4BAZA 1Q11A 4XYLA 2A57A 1AQIA 3CLTD 4YJHB 3E81A 4Z7OB 3N2KB 4URUR 4DSZA 2HN9A 4KAFA 4N7BA 3D4OA 3A1FA 4QGGA 5EJ2A 4EVQA 3GA5A 3MZ0A 4G84A 4RAQA 2PZJA 4BVKA 3SZMA 4N82A 3A32A 1J2UA 5JHGB 1NVVR 1QR6A 2A4KA 1JR3A 1UPUA 2PYZA 4MS3B 1NJ8A 2AMLA 3TEJA 5LZ4A 3DL2A 4ZV4A 4IKEA 4X1IA 4TXLA 4FOLA 4B6EA 1SXJD 1E5DA 4YA6A 3OESA 5BT9A 3MT7A 1NTOA 3CBGA 4LSMA 3VR5A 3HBNA 3SOZA 5LWQA 6CHYA 4I2NA 1QG2A 2JIDA 4M0LA 3H1TA 5EP4A 4DLXA 3PLRA 3L79A 5JSUA 1ABBA 1EEXB 4HWPA 1BDJA 1XLTC 1A8QA 1PNOA 1O5OA 1HFKA 4QQRA 4FWTA 1OLSA 1PJSA 1RQPA 3K92A 3UJ9A 3QPWA 3DD1A 4G2NA 4DVGA 3UUEA 4JFAA 1I7SB 3HYNA 3ZGVA 1UBNA 5JBNA 5T6MA 3ZJ5A 4F6LA 2OV1A 2I7CA 3KVRA 5DBHX 4A03A 5AYVA 3NP9A 1V48A 1A4RA 4C0XA 2LIVA 4A2QA 1T9ZA 3BSFA 1JT2A 3WSTA 5H0IA 3ZE2B 4C1BA 4E12A 4EUHA 1AMNA 4Q37A 4K81B 1L7MA 3VPDA 5CDYA 1FP7A 4HXGA 2C4TA 4ER5A 2IOFA 4NE9A 1C1DA 5DGCA 4W7SA 2C2YA 2DPLA 1SXPA 4RVSA 3M6AA 4HGZA 4AY3A 3LPCA 2DP4E 3O74A 3T5AA 1WB6A 3EC7A 1YSCA 2RKWA 3L04A 3NAZA 4JBYA 1UKEA 1O95D 3D8HA 5C1DA 2FMHA 4C4AA 1FTYA 4LOIA 5C8ZA 4ZYUA 2IIQA 1UOOA 2Y0DA 1G5QA 3AIMA 3JQ9A 1VIAA 2FX3A 2H0QA 2TMDA 1F0YA 2IY8A 2Y67A 3OIGA 4AZ3A 4C01A 5KJFA 1FNNA 2GZDA 2YUTA 3HB4X 4KXFB 3NNDA 4B6OA 1LF5A 4C0JA 1QFSA 2FX5A 4KMMA 4TS1A 4AMBA 1WUTA 3G1WA 4S04A 1EP2B 3K0KA 1SWVA 2FWIA 3N8HA 4Q3NA 4LNUA 3QVMA 1V1RB 5FF9A 5FD8A 3VM6A 2QRQA 4TSKA 5DX8A 2VLIA 2A1UA 2PUBA 4JWKA 5SICE 5JH7B 3SD7A 4II7A 2ONZA 3JQAB 1Z4KA 3IXQA 2I6TA 3OC6A 4MNTA 4F45A 5JWRA 4KV7A 2RGNA 3FGNA 4UDOA 1Q77A 2WHPB 1C7QA 4QATA 3FMPB 4ENPA 4MB0A 4RNDB 2AF3C 2B1GA 5T57A 1T35A 2B30A 1NWHA 4PC2A 1BQ3A 1W88B 5L9AA 4ARZA 2P11A 2IS6A 2HT1A 3RRNA 4MB2A 1O8BA 1KU6A 3G3EA 2VPPA 3HHPA 4I19A 2EFHB 3UKJA 1VCOA 5DYIA 2GTIA 3MJTA 1V1MB 3E9ZA 3EF3A 3WMWA 3ABQB 4C14A 4KH1A 1VJTA 2VDMB 2JFXA 1KTIA 4HUTA 1J0BA 4YUYA 1PN3A 3GRVA 4JJAA 2FPPB 4DRXA 5J1SB 1YQUA 1PTJA 2JLCA 3CEAA 3RT9A 4YUZA 3RS0A 3W7BA 1UQUA 4XFJA 5GGXA 5IH7A 1DTWA 5EIBC 2CV1A 4MQMA 4GI5A 1B0ZA 1M67A 3D8RA 2MJLA 3I2GA 1YHYA 5BN4A 4PG8A 2B6HA 4QLOA 3A8TA 2CMFA 4PGMA 4CM4B 3M0EA 2IYNA 3E61A 2RK4A 3BG5A 3HLTA 3IMFA 2V58A 3DSRA 3P2MA 3SX4A 4DMKA 5LQMA 3IAUA 3L07A 4QDOA 3AGQA 2OV4A 1EJ0A 3T0FA 4FHEA 3QMVA 1PK7A 3JQPA 3QE3A 1QH1B 2H0RA 4NU8X 1M76A 2R1UA 5E4JA 2IX9A 5BVHA 3WLTA 2OO7A 3AL2A 4KL8S 3TN7A 1GA1A 2FUG6 2PKQO 2J59A 5EHXA 4ID3A 4IZHA 1HT1E 2XQIA 2O14A 3KYCA 1ZM3A 3E6AA 5FBZA 2DSNA 3BAFA 2HMSA 2UZ4A 5A5FA 2ZJ7A 1LLUA 2BEWA 1U2GA 2ZR0A 3H0CA 1YB1A 2R84A 3KQYA 4R7ZA 4UDNA 3S6JA 5LIPA 3V6LA 3SSOA 1ADCA 3B7PA 4TRMA 5JSYA 2FSIA 3OQ1A 3SPXA 1G8KA 4GPZA 3LRPA 1RCTE 2FB9A 3BGVA 3QBJA 5AM3A 1NVGA 1N6NA 2GM3A 2R6AA 4JMPA 3U0BA 3DQZA 4BFCA 1E79A 3LCCA 2VJBA 4BVGA 1P39A 3IQXA 4RVFA 3TD6A 3HACA 5HBGA 3Q8MA 3R5XA 2FCRA 3OICA 1F17A 2XVAA 3VZBA 4EBBA 3L8EA 1IJKA 4I4NA 1H4TA 5JAHA 3MBOA 4GWKA 1NXOA 4RGQA 3DW3X 4FKMA 1PU2A 3AP1A 4J0CA 5KNCH 5KS2A 3I4LA 5DFAA 4C0WA 1B6GA 1MABA 2HK8A 4GOMD 4WL0A 2BY4A 1RPNA 1Z6GA 3KC2A 3BM5A 5LNK1 2JI6A 5A7HA 3WG9A 3LP5A 4QGSA 5B6PA 1D6MA 1JZSA 2GTHA 3NBXX 4ZAVA 2HEGA 3LT1A 2JAUA 4W1QA 5EUQB 5LA6F 2NO5A 1SO8A 2OCGA 2R6ZA 4PHCA 2HJGA 3V9AA 4Z4HA 3UFXB 1JQBA 3AKZA 3KJFA 1BVYF 2ZYRA 3G49A 2PY6A 1WP9A 4M0FA 1PJ8A 1D7OA 1DJPA 1QGUB 1ACJA 1CRZA 4ND5A 2PFKA 1GEEA 1XDUA 1Z2PX 2QD1A 3CZ5A 2REXB 3EAQA 2B98A 3IESA 4L9AA 5BR7A 1RTKA 1XJQA 5KJCA 1E18A 1XN4A 2JCXA 3VO8A 3CHYA 3C14C 4GOND 1VYUA 4ND4A 4KRFA 1Q1EA 4LMPA 1IZ8A 1U0RA 4L3WA 1ENZA 2VL7A 3N70A 4R1UA 1P61B 1U5BB 4PG5A 1PGOA 5EINA 4EB3A 5J3JA 3IDAA 3IIJA 4E08A 3CF0A 3KR9A 4LVNA 4JLBA 2YW9A 4L27A 4LTMA 4RA6A 1RRGA 5HMLA 2W7TA 1Q14A 2IPNA 2IYLD 4WXHA 2C5GA 4WXYB 2Q2QA 5AKGA 4ENVA 1VLLA 1VMKA 4PCUA 4UEWA 2ZYVX 4TM7A 3AFMA 3BICA 4YDHB 4IHJF 3PU6A 5DWVA 3RC7A 4B46A 1M0EA 4NV1A 1I4LD 3L7DA 2JFHA 3VR2A 2KS6A 3D3QA 4PZDA 4N3BA 1O77A 1QZTA 2XMZA 4LJ8A 3PPIA 2HRCA 2LZ0A 3UJBA 5HUHA 3R9WA 2AMFA 1O89A 2UUOA 4EA7A 1TYZA 3KWJA 1A8PA 1W8IA 3WK4A 4QKQA 3AEKB 5CGZA 4W5QA 1AZSC 3NM5A 2D0PB 3K0AA 1NNSA 3MK31 4KDFA 2B8NA 2JEYA 3HZHA 4N7RA 2H5IA 3RU9A 3SBXA 3WMRA 1QX3A 8ABPA 3NVKI 2VR1A 3AYXB 2JARA 2QX6A 2BUBA 3PL1A 3AXTA 1K1EA 3TLGB 3UJ3X 1I24A 1M5TA 2PH1A 4FBGA 1R5NA 4CUZA 1X0VA 3JD0A 4JL6A 3M4NA 1WTAA 4X93A 4G5QA 2W0SA 3SQNA 1BCRA 1E4YA 3G85A 1EK0A 4G4IA 3U40A 5AM4A 2XT6A 2CJFA 3OLWA 1PG2A 4TWAA 1RWBA 4RNCA 3V9PA 4LJ7A 2Q3FA 4R8VA 1ZIDA 2H5JA 2QWXA 1IDOA 3N28A 1GG9A 3NIGB 1A1VA 4BO0A 3B8EA 2FG6C 4N8DA 1JU4A 4UBNA 3I2JA 2OXFA 4PFKA 5FLYA 1FDVA 4Y6PA 1V3QE 1F2TB 5F9FA 1GTRA 5CXXA 3K0FA 2EWVA 2WJPA 2J48A 1SQGA 4LRUA 4Y6GB 4D4KA 2HTFA 1UBCA 4XWTA 3WO0A 3AVQA 5KOJB 4KVFA 1KS9A 3Q6MA 3FGPA 3R9XB 5SYMA 3FVWA 3UEOA 2C4WA 2FPGA 2GPYA 2CFCA 3CVUA 3PQ7A 2WRZA 2XNHA 1SQ6A 2BF7A 5DTMA 3UA4A 1K97A 4RTLA 4B7XA 3P9CA 1Q3KA 4OKNA 4RZXA 4F4CA 3KAPA 3I12A 2PGDA 3W8EA 2ZZNA 4BTEA 2CCKA 2QTBA 1QO0D 2N47A 4Y2QA 5AW8A 3GLVA 4GO1A 4ZXPA 1ZNZA 1NG9A 1GG2A 2B4YA 4EF6A 1SIOA 1WSBA 3C3DA 3LQQA 1VBNA 1K89A 1L5MA 1VPTA 2PH3A 3KZMA 3RCBA 3GU3A 5I4CA 1CQXA 4BJ3A 2RI6A 2W2NA 3T1NA 1T8YA 5IT9A 2FGKA 4OHBA 3R6TA 3BB4A 4QDXA 1W6RA 4U4AA 3G2LA 4ZT3A 3U7GA 1CZRA 1VSQA 2NUAA 3E53A 1USUA 3W2FA 4ZAZA 1E1DA 2WLTA 3F6PA 1Q7TA 2QY6A 3R0IA 3TI7A 3NDIA 3NHRA 2PGJA 3K1ZA 4INOA 1U8FO 3UT5A 4XDHA 3GD7A 4DADA 5CA1F 1RWOA 1BXGA 2GRAA 1W4BA 4WNAA 1TMKA 2YXLA 5TMEA 3ZV5A 1ESMA 2PS3A 4WJZA 1TCAA 3IR6A 1TTTA 1YC5A 2R8EA 5EZQA 4GL2A 1U3TA 1XSEA 2DUWA 3AHDA 5KJEA 4BX2A 4YJGA 1RXIA 4FCVA 4ZAXA 2GH1A 4Z1MD 1GAJA 3IOBA 3RVSA 1UDRA 1QHNA 2OQ2A 2PMKA 1U3FA 3HXQA 1LKZA 1W7AA 4Q4HB 2ALJA 3IAS1 3MLBA 3P5BA 4A2WA 4FHFA 4HXYA 3SI7A 3RKSA 1PT5A 3CZCA 3TGWA 4QLAA 5K8IA 3QUTA 3ZJYA 2BTEA 1ZEJA 3C24A 1VM6A 3Q5DA 4LZWA 4X62B 3STHA 1QHHA 5BN3B 3IE1A 2WQZA 1JEAA 4V2IA 3WV4A 1JDNA 2YBDA 3II6X 1Y7HA 1UM9A 1LPMA 1L8OA 2M1XA 3KEFA 3NHLA 4JLSA 4KYTA 1MFPA 1UDCA 1GD1O 1GGVA 2O3SA 3KBBA 4Q3AA 4UUQA 3BK1A 3M6XA 4LYEA 1ZJWA 4PGFA 4KSCA 2HSDA 2VT3A 2V9PA 3GGCA 4R9RA 4WW0A 3RC2A 2PUGA 2V7UA 3JRWA 5SYNA 3V2HA 1BIFA 4CEIB 5EMHA 4ZVPA 3FA2A 3VA7A 4Q66C 2F6RA 2VXYA 4JJIA 3IQEA 3F6RA 2GVNA 4MV4A 4AG6A 4M1EA 3JD3A 4YFVA 3IAXA 3TQIA 1UZLA 4AG3A 1M73E 2X0IA 1MQ8B 4GWLA 1HORA 1UFKA 2VOEA 3B6EA 4IJQA 1DXOA 2OQIA 3VBEA 1XL0A 4KXWA 2ICAA 4PXAA 3V3KA 1XZGA 2AN5A 5AKZA 1XZJA 4J16C 4KFSA 4BWFB 2QTFA 4C7JA 4IO1A 4B73A 4BUZA 4C4TA 1CQIA 1VPLA 1SCNE 3WZMA 3GBSA 3IKLA 3A4NA 1V5IA 3Q3GE 1GQ2A 1BMQA 1PGQA 3BMCB 3F1LA 3UAWA 4AW9A 1XZQA 1QFZA 1E98A 2R6R1 1JAXA 3H5WA 1F7UA 3UAVA 2ZUEA 2RHOA 3NETA 5EJMA 3UMRA 3I5XA 3I37X 1YZ3A 3CRW1 3TRDA 1U65A 1X6VA 4R68A 3NATA 1AF4A 3DVRX 2GN8A 3QXCA 1L3IA 4M1WA 4NG4A 5ADWA 2DR0A 4HBGA 3OY7A 1WF6A 3R5HA 5K0JA 1R16A 2X8AA 3Q7IA 3UJ6A 5T4FA 2PZGA 1SU8A 1U81A 4P4GA 5J4YA 2W2VA 4MVJI 5AK3A 3ZKAA 3F3YA 1OFTA 2QTVB 5AVKA 2BELA 3LF2A 2FWJA 4BAUA 2FPXA 4KHZA 1LSOA 4RBNA 3OHSX 2G67A 2I29A 2VJMB 5HSGA 3URMA 2F1JA 1VL6A 4MEAA 3AZPA 1CQJB 1FUYB 1JG3A 2OC9A 4ODIA 4OYYA 5FH9A 4HNSA 4P83A 1B8PA 2ZJZA 3PJDA 4E32A 3AX6A 4GI2A 3T54A 3C4VA 3LQ4A 3FOFC 2C2GA 1TQ8A 5G4LA 4RXTA 2O8CA 1XDSA 3O83A 4ARVA 1NSFA 2JIBA 1OAOA 3E9QA 3DWGA 3LI2A 3N0TA 4TL9A 5ALPA 1X14A 2L69A 3BB3A 2Z2YA 2F4NA 5GIOE 5K03A 1Q17A 2EDCA 4BU0A 2OBYA 4X1IB 3OFJA 4X9XA 2BJWA 2R8YA 4OSPA 4U3JA 3NWJA 4Y18A 3EE6A 4C1NA 4MS4A 4EJ2A 3GZJA 4LOAA 4EJMA 1AQLA 3PHLA 3VVLA 2X76A 1FYFA 1E3LA 3WL8A 1Z2AA 3GN2A 5CFZA 5CB8A 5JNWA 2GHQA 4YJ2A 2EW8A 1I4DD 3QU9A 1D04A 3IPLA 4Y2UA 4CKXA 4OHMA 1VG1A 4Q9IA 2TYSB 3HXMA 5B7QA 4K6CA 4XEUA 5LDDC 4MRNA 1IVYA 2GETA 1T5BA 1OLSB 2ZIXA 4CM6A 5IHXA 5KTNA 3GEMA 3ABSB 3GNLA 4YV0A 4FQ8A 2QN8A 2DF8A 2L42A 2B34A 1FSZA 1GUBA 5E38A 3VX3A 1GZ6A 4DT1A 1WCV1 5J4HA 3VPXA 2VNAA 2VT6A 3O1IC 2FEMA 1BU5A 3MCUA 3F9RA 3RFXA 4DABA 1HKHA 3STYA 4EA6A 4ENRA 4EPYA 1JHAA 1JSXA 2F3RA 1EBUA 1C1DB 2VKQA 2WJYA 2GD1O 3KLOA 1I33A 1P1RA 4TLMB 3M89A 2WVGA 2VCHA 1E8NA 5EY5B 4QEDA 3T0GA 4F7WA 3PLNA 4XH9B 4URVR 6GPBA 1SXQA 1MW8X 3BWVA 4I6JA 3WLMA 1A7UA 3EXFA 2D5IA 3PXXA 5HF9A 4FEGA 4Q7KA 1NYQA 2EOAA 2WMNB 1YVEI 2VT2A 2XSZA 2YQ4A 3MTDA 3ZY2A 4AZ3B 4C3ZA 3IR5A 4DMLA 1V6SA 1ZQ9A 4BECA 2WIAA 5PNTA 5I9BA 4F84A 4GW3A 4A8JA 3Q9LA 4AKIA 2HV9A 2Q27A 3G2IA 1U2TA 4IICA 4Z9XA 4XJVA 1WSDA 1HY3A 3EEQA 3PPYA 1HE5A 4LNUB 3QJGA 3PNOA 5FTKA 5AMXA 4BBAA 2DB3A 5JZ9A 3GVIA 3WGQA 1DRKA 2A1UB 2A0XA 3AFOA 3L4BA 1AX9A 3HSSA 1I6MA 4IXMA 3WB9A 4Q1BA 4EUSA 3R6WA 4YQYA 2MINA 4X6XA 5E2AA 5A2QA 3DE1X 1DEXA 3KB6A 5TT0A 3V55A 1YRHA 2PYIA 4GVXA 3ZD7A 1Y3FE 4XQEA 2WYVA 3GCWA 4ARZB 3MT9A 1CVIA 1XZDA 2ZRCA 4OSOA 4CNBA 3Q2KA 2QN9A 1C7JA 2WU1A 3TZKA 1VLVA 1P2BA 3W77A 2E7ZA 2BFDA 1T26A 3FPAA 4V02A 3V8BA 1WJGA 2XWPA 4ZOQI 2DH6A 3A1NA 1E63A 2BKAA 5I7HA 3ND7A 3H2SA 1GFWA 2I2DA 2LWIA 2V5AA 1KOGA 1CETA 1B93A 2Y1GA 1ZW6A 1RJEA 2EC5A 4HDAA 4Q7JB 1U98A 2OCYC 3DKVA 1Y8QA 4DRXB 2G0TA 3QNMA 2G40A 2QD2A 3EW7A 3HCEA 1DTWB 5F5XA 1KFCB 3Q6IA 4FI3F 4A0RA 4IG9A 4NARA 5GOTA 4F5EA 1G21E 2WOJA 4A92A 3OOSA 3SP1A 2Y2UA 3M9LA 1C9KA 3QV1A 2HDNB 5BN4B 3UHFA 1UZMA 3B1FA 2GJ8A 1EWKA 2BEUA 2P3OA 1Z07A 1EGAA 3DVLA 3HP7A 1BDMA 4RPJA 5DM70 4XX0A 2VSQA 3VR6D 4B83A 3A1UA 4KO3S 3ZW9A 3SVTA 3CU5A 4ZVMA 1B0PA 1NF3A 3PEWA 5DRTA 2IXBA 1J7JA 2Z3WA 2YZ7A 2B61A 2ZRGA 5SY9A 1P0PA 2OAQ1 3WHPA 2VPIA 1K5HA 2WU4A 5AP9A 4ZMRA 5BVHB 3RG2A 2F1IA 5C4IA 2ZRPA 3W2HA 4L07A 4LYFA 3KYCB 4M86A 2AQKA 4DLPA 1KDVA 1PIWA 3UJPA 2BEWB 1SHKA 4CKEA 2H92A 5IP5A 2WJHA 5FB3A 1Q12A 1WR8A 4J0GA 4UXIA 2ZE8A 1FK8A 2NU9B 5BNWA 3GXBA 4YRRA 5FUXA 3EPRA 4NCHA 2XCQA 3A9WA 2QTNA 3OIDA 4C20A 2EX0A 4KDEA 4PZUA 1GDDA 1H2FA 4PGGA 1HFJA 1RS0A 2O8NA 1L5OA 3RLIA 1J0DA 4RTOA 3P45A 3S99A 2AR0A 2EARA 2C4NA 3IBYA 2VDJA 4G1VA 4AJ1A 3IP5A 1HLPA 3VR4D 2A0UA 4A8TA 2P75A 2BFAA 1MV8A 3O4IA 1AQ6A 1Z5UA 3I9V6 4OL0A 5CDGA 5DH9A 3JAWA 4NS4A 2MMGA 4BMSA 3VVCA 1GPNA 2HO5A 2QVBA 2SCUA 4Y2YA 4BO9A 4Z3OA 2PSHA 1QPGA 1QWOA 3SJZA 2OP0A 1BA3A 1SBCA 1MABB 5AJUA 4C2UA 1JT9A 4WCFA 2GAAA 3BFPA 1KI9A 3PEUA 4YCLA 3ZVLA 1FUKA 3FIJA 5F35A 4YMTA 2JIQA 2FPUA 4EHFA 2JIZA 4Z7NB 3L6OO 3JQEA 4W8HA 3GRUA 3RS3A 1JHPA 4GC9A 4PYRA 4LJRA 5GV8A 3C6XA 2EP5A 3A28A 1AMUA 4U8HA 1OGJA 3OPYB 1LLQA 3LLSA 3BWMA 1QONA 1YE8A 3KJGA 4OQLA 3GFQA 2FUNB 4UE6A 1Z6QA 3G2OA 1JKIA 1L6IA 3DCNA 3QTTA 5AHXA 1FTQA 3N6XA 1KYZA 2FRDC 4HDCA 2PCJA 5EXPA 4YRIA 4QDKA 4LDQA 2PMEA 4C0SA 3HCRA 1XR3A 2FETA 4GHWA 3LAWA 1BN7A 1J7KA 4ZQGA 1CCWA 3HRIA 1JSRA 4XSVA 3TNJA 4RKQA 4O3FA 1A9RA 4MS1A 4AMYA 3G0HA 2GEDA 1SCAA 1AKUA 2GA9A 3O73A 1OR8A 4XPIA 4MWCA 2BJVA 5DNWA 5EKUA 2Z09A 2PHZA 2AFVA 2CYBA 1EGMB 1KJQA 3IHWA 4OJTA 3ZYZA 1JG1A 3TECE 2ETXA 2FMKA 2VBCA 1ZX1A 1CJMA 4X65B 3F6BX 3MSCA 4LKRA 4NF2A 3HYLA 3O5AA 4OK5A 2IZZA 4YRZA 4E2XA 3K73O 3EN0A 4MRAA 2XMCA 3ES9A 2VTDA 1L7BA 4YHHB 4ZDIA 4XLZA 1V7QA 4MI3A 2Q9CA 4NZMA 1D0VA 1FLNA 2WB4A 2ZIFA 2C58A 3H8JA 3IJ5A 3LC0A 5HIIA 4EKGA 4LWZA 1CJUC 4YQFA 2W6CX 2ZAIA 4J03A 5FQNA 5PGMA 3OZUA 2AUNA 3EFHA 4HLCA 4U2CA 3UZUA 4ZHSA 1CE8A 2EWMA 3C7CB 5A4AA 1G5HA 1P1FA 1DC4A 4OHCA 2J6CA 3KTDA 2H63A 4PSVA 4DQXA 2IHNA 4IRXA 4TN1A 3U6KA 3DAYA 3LX8A 1Z6YA 1AK2A 3OD5A 4MITA 3OMXA 4M9UA 4QJ3A 2AI1A 1U4OA 1BCRB 1PG5A 1FNDA 3HUTA 4OPMA 1Z74A 1QCCA 3PFFA 3ZOKA 4B5LA 2RI1A 4BTLA 2QGFA 1HNNA 5CD9A 4HDSA 5K9ZA 1J24A 2BLNA 1VE9A 1JBKA 2JJQA 1BWPA 1K06A 2OFPA 2P9HA 1VRWA 1UZAA 3HEAA 4JT8A 2AKAB 4LE0A 1GTMA 4QUIA 1CDOA 3UATA 2O05A 4EPRA 2VQEB 5KKNB 1QRUA 3LUJA 1VIVA 4Z3DA 1WZNA 3BOSA 4LRQA 4NC9A 2J9XB 4ZT2A 3G82C 2EX4A 3H5OA 2HT6A 3AM3A 3PC2A 3K0FB 1JR6A 3D4NA 4UXJA 1B16A 4K28A 4MGIR 5LZ5A 5C1OA 1YBVA 1LLDA 1JKMA 2ZANA 4INAA 2VP5A 3B9PA 2WPDD 5JG7A 4DJTA 4DREA 3K1AA 1U7TA 1D5WA 2FSVA 1PR1A 3PUZA 3Q2OA 1U1DA 2BBOA 2FPGB 4LHYA 4ZQEA 4MB6A 1QP7A 2OZPA 1E6UA 1G16A 1NPYA 2C77A 3RIHA 2PSSA 2V5VA 2XZOA 3CLVA 2ZYWX 1JALA 2X7JA 2FMTA 3M5DA 1G5PA 3I9NA 4IIVA 2DECA 2DHEA 3ZDZB 3T41A 1U7OA 5BMOA 1GA6A 2I1QA 3C6KA 4D25A 1PK9A 4UE2A 4Q24A 4M88A 4MO2A 4N6OA 3AP3A 2GPWA 5LMZA 3KQLA 2R8OA 3BMOA 3M4YA 3KXDA 4EQ6A 2K7FA 3Q4GA 1RLJA 4FLFA 2EKBA 2OV6A 1TRKA 1IBSA 3VSCA 3PQEA 1SCIA 3KEMA 2NUAB 1QQ5A 2EERA 3G0DA 4OATA 4P2BA 1U8ZA 1WCYA 3N7UA 3UT5B 4LBVA 5FOUA 3UMFA 1BXGB 4WNAB 1U90A 4Q93A 2X6RA 3PV0A 2QN2A 1TW3A 2D1YA 3E70C 3OU7A 4PS0A 3A2LA 3R3UA 5AUOB 4YJGB 3O21A 1PCXA 4LXYA 1WBJB 3I01M 4NK5A 3WK6A 3FHLA 3LOQA 3QZUA 4JKOA 4MVJE 3C7KA 5AVJA 3AVWA 2LTAA 4ZA2A 1NOJA 2HREA 1KIMA 2FPRA 2ZBFA 2Z1NA 2JL1A 1GSHA 3GEIA 2ZRNA 1A5AB 2IDZA 3N1UA 1VHDA 3A27A 4H1UA 2YFYA 3QUSA 2VQ6A 3GJYA 4X61A 2X2EA 2BJHA 3LY5A 3NR2A 3OAAD 5KU7A 2DVMA 1MJHA 2I6XA 4QHSA 3CLSD 1I14A 1QHHB 4FGLA 3GJ8A 2XF2A 4QUHA 4UQPA 4DGSA 2C7VA 1EUQA 3IUQA 4OB8A 1UM9B 3SF0A 3K5PA 2BIFA 1N1GA 2ZSHA 5D5HA 1GPYA 5KKAA 2HU7A 5KTOA 4JI4B 2Q2VA 1UC5B 4OHKA 4LXUA 3ULKA 1O6CA 3CNQS 1J42A 1OF1A 4IXNA 3RVNA 4DA4A 4DMGA 1MRZA 3IVMA 2IYYA 3O8LA 2IHUA 3QGMA 4MWEA 1SKMA 3HB9A 4A8PA 3SHFA 4QGFA 4IAOA 3ZBUA 2AN3A 1ZMRA 5ES3A 4F38A 4C6TA 1L4MA 3CVXA 1PNVA 1V5EA 3DR5A 4O2AA 3KSMA 4RKFA 2WTBA 1YI1A 4Q48A 5IJAA 3VH2A 4AJNA 2NO0A 1Y8ZA 4FTWA 3ZD9A 2GF0A 4XXHA 2BR3A 1B4DA 2ZB3A 6Q21A 4JKIA 1AK1A 3TW8A 4DV3B 1Q84A 4GLOA 4HH1A 3NFYA 2V6JA 3FTPA 5EFZA 3VKGA 1QKIA 5CLQA 1W44A 5KHOC 1PSWA 4GVPA 4BZPA 1BGXT 1IBMB 1ZCZA 3DFIA 4EM6A 1HTBA 1KPHA 1XAHA 3EVBA 3A9UA 4XIFA 4G25A 2PRIA 3OY2A 3ZGLA 4UM7A 4Y2XA 2FP3A 3U37A 2JHPA 1ZZEA 3RIYA 2II6A 3EGDA 2XQGA 4HSGA 4MQ4A 3SS9X 1SHUX 5K20A 1YQTA 1QBKC 2QTWB 1Y1SA 3IPAA 3JYPA 1TO1E 2WJVA 4P33A 4POAA 1RXEA 2IY9A 3B38A 4E1VA 5EJ7A 4TS4A 1XXHE 3L7KA 5I7VA 4LSZA 1P6QA 1Q1BA 4HN2A 3B36A 4GVLA 5CTJA 2C0QA 2XA2A 3ME5A 4XR4A 5EQDA 4YB8A 4EELA 4FT2A 4K3UA 3HMKA 4YLEA 5HIAA 1Z68A 3L49A 3U4IA 4LC1A 3RTEA 3I9OA 1PX2A 4F9TA 1ZG3A 1ODFA 2BBSA 4RFLA 5BW6B 1UWVA 3CNEA 4FDVA 4P35A 4B85A 4AZVA 3CMCO 3IGFA 2O8CB 2I7DA 1KGDA 2QUBA 3GJSA 4C7KA 1BS2A 1ZOOA 2CUKA 3QG5A 1FA9A 3EG9A 5THQA 2I6FA 1NBMD 1DDGA 2B1QA 1T6NA 4RIGA 3RADC 2QX9A 3QENA 3WQHA 1U9IC 1T6YA 2I22A 3AHCA 3PWZA 2PZEA 2ZJ8A 3L7BA 4FHDA 4QYTA 4U3JB 3B3FA 3JWJA 3DC7A 1KO7A 3KCNA 3DTVA 4KGXA 3T5CA 2GJSA 3LD9A 2J4FA 5GP1A 2NU8A 1X8KA 1KO8A 1BEEA 4P7BA 3UQZA 4KE8A 2ACKA 3NBYC 1WX1A 2IU3A 4JDUA 4RQUA 4DM7A 4HVAA 4RMHA 1XPJA 1SUCA 1PSDA 1QZXA 1WQ1R 2IXGA 2PKXA 3B1KA 2I6SA 1JRLA 3HCPA 3HU2A 4NNOA 1Y3CE 1HT0A 4NYJQ 1TIBA 2ZIXB 1PL6A 3QX3A 4HWOA 1A5ZA 4C5BA 5JLJA 3T34A 1C5KA 1OPRA 1UPTA 2VUTA 3GNQA 1N7HA 3LFTA 3Q5GA 4G5GA 4RANA 2QNBA 3D3WA 4FMDB 1PGNA 1S2IA 1SGWA 3HGMA 5EJ9A 3IKTA 2YN2A 2ZWVA 5AKIA 5EE1A 2ECKA 2MYUA 3GPCA 5JS7A 3W5AA 3LG2A 5DCWA 5THKA 4BFLA 2IIBA 2XB8A 2IP4A 3GMTA 2VDWA 4R54A 1QVZA 5BNTA 5BNFA 2CHQA 2XH8A 2C5LA 2YY6A 4EW1A 1YFJA 5K09A 3LSTA 2NXNA 1Q50A 3OJLA 4BDSA 2WF9A 1KMNA 6REQA 3UCEA 3V34A 1HX7A 5DI3B 3AUAA 4IXDA 2ZBGA 4FLMA 2HHJA 1G4AE 3EXFB 5EXXA 4ZMBA 5I3CA 4PCLA 4EP1A 1K3TA 4ALIA 4PC7A 2C9DA 3BQNB 3LZCA 3EVFA 2UYGA 1K7CA 5CJJA 4O2AF 2Q28A 5HKOA 3AFNA 1KZ4A 1ZD8A 2ZJOA 4EHJA 4DB4A 1I2BA 1JQAA 2GUGA 2LKDA 1NKVA 1VL2A 2OG2A 3EXEB 3JQ8A 3KBOA 2BKUA 3PCXA 4DCJA 1K7FB 4O4HA 4ZJPA 1WUHS 2NZVG 4ER6A 1TZ2A 5CJ2A 4BC0A 3JQBC 1O94A 4PANA 4U9UA 4YRMA 4FCTA 2P2LA 5HZKA 1GTSA 1Z29A 4X64B 3Q7RA 4C7VA 5ELXA 4LISA 1P8AA 1YD7A 2MINB 2OZVA 3O92A 5CFNA 2O52A 2PLWA 4KQCA 5FJIA 3Q3VA 3W79A 4HADA 3K0SA 2VXOA 1TGVA 5IPFA 2Q9UA 4E5SA 1AQUA 1TU3A 2J67A 5EUBA 4I8IA 1S8NA 2OWEA 2M6LA 2GPNA 3W5VA 1IIBA 4LZOA 5J5AA 4MWBA 3OIYA 1Y5MA 2BFDB 2AWOA 4KO1S 3FR7A 4UE3S 1KRWA 1DC8A 5E3IA 3UPUA 5EFOA 1DKNA 3LYUA 3BXZA 1UEXC 4FX5A 1TUIA 1B3BA 5E95A 4IY1A 1D1SA 3LL4A 1UBSB 3VUEA 5FWYA 4BXOB 4Q1EA 4WT7A 1XCOA 2BF4A 3OQVA 4R7TA 1NVWQ 4NCJA 1PVOA 5CLHA 1Y8QB 3PG5A 4FC6A 1FQWA 4MGYR 3T95A 3WIEA 2ZYAA 4UBIA 2WFMA 4WCVA 3C43A 5KYUA