1S1CA

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s1cA00
2F1RA 1JI0A 2A30A 3RSOA 4KHZA 2NZ8A 1LVGA 3TW4A 4HYYA 1KY3A 4LJ6A 1IAQA 3PCRB 3PEYA 3ADDA 5K8TA 3EIEA 2WICA 3NWJA 4UXJA 2B8TA 3RNLA 2GZDA 1KZGB 1TQ4A 3CX8A 4F4JA 2CCGA 4PFSA 2E1RA 1P9RA 1R10A 2CE7A 1JR3D 1P61B 3GJ4A 3N2EA 1E2HA 1UKZA 4Z8XA 3K53A 2BKUA 3QKRA 2AD5A 2W58A 4PQYA 1M1YE 4URVR 4US1R 2RGBA 3GFTA 4OK3A 1F2UB 4LHXA 4PHTA 2Q3MA 1R8SA 3U3MA 3BRWD 2C95A 1S96A 1EGAA 4AKHA 1L8QA 4IOKA 5JLJA 4CEHB 2J3EA 4PC7A 2HEIA 3GLGA 4V0ME 3I61A 2P6NA 2VP0A 2MSCB 3EPJA 1VYVA 1H8EA 1KTVA 3DPUA 2PX3A 4MYUA 2R8RA 1YR7A 4YMSA 2O8FB 3NDBB 1N6IA 2D2FA 3TGPA 3AVYA 1NSFA 3U44A 3IPXA 4HZUB 3MG9A 1DTSA 2QU8A 5DI3B 4GBMA 5AJZA 2FPLA 3TQFA 3MRSA 4R2IA 1X1RA 1E9DA 1ZD1A 4OK6A 4DEXA 4M8NE 2CL0X 1FX0B 3HPQA 2XJ4A 2PCLA 3KJIA 5FTMA 2JLZA 1G3UA 3LBIA 4KV9A 2VYFA 3DM5A 3IKJA 4ACBA 4QBFA 3IDQA 1CJKC 2GEDA 4F4IA 4BFZA 1OT3A 4UXIA 2CHVA 1Z28A 1CKEA 3GJ7A 2AD1A 1DAIA 4MRVA 2GZAA 5EUMA 4A1FA 4YXWD 4OI2A 2VHTA 5JMTA 1XTIA 5KSYA 4KAXA 4WVFA 2H18A 3GFOA 4IDOA 4K8OA 3G82C 4A2PA 1RYHA 3FTQA 1CULC 1G16A 5DLQC 1TPZA 5JSZA 4IVQA 2IYTA 1E1RD 1ZYUA 1D2EA 5FL3A 3LBNA 2O8CA 4DLTA 4G5RA 1D5CA 1BMFD 1KNXA 3KFXA 4QJ4A 4I99A 3I92A 4L15A 5JEDA 2C96A 2C04A 3RAPR 3BD9A 2F1JA 5P21A 3SQXA 5EXTA 3LLMA 3KXIA 4A4DA 1EESA 3JZMA 3C5CA 4Q9LA 1SVSA 5HZHA 2A5GA 4AYWA 2JCSA 3EIQA 3PG5A 1PV4A 1WF3A 3A8TA 4MDEA 1SULA 3VU9A 2R6GA 2RAPA 4YC7A 2FMXA 5IRCD 3I5YA 1CBUA 5C4MA 4KXFB 1N6KA 1TUIA 3BFXA 1GRQA 3O8BA 5HE9A 2RHDA 4KO8A 1OW3B 4QNMA 1W36D 3JVUA 2RGDA 3KKPA 4D80A 1NY5A 2XITA 2FFQA 4CYMA 3U7FB 1XPUA 2ZSAA 1IQPA 4EIWA 2BV3A 4M1SA 3PQCA 4Q7JB 2JAQA 4LYFA 3DO6A 3PUXA 5G3YA 1EFRA 3T5DA 2IEZA 4A36A 3WYAA 1GP2A 3QKSB 3RS3A 4QKQA 4PHHA 2VP4A 2LKDA 1JXOA 1J99A 3ADKA 3K1JA 2JLXA 4D4KA 2ZM5A 3AQ4A 2YINC 3QVUA 4BFSA 2PH1A 1O3YA 2WSSA 4NDZA 3R8FA 1E99A 1G3IA 2D7CA 1NIPA 1XX6A 1UEJA 3C14C 5CYOA 5H70A 2IT1A 3UG7A 1IY1A 2VHQA 3UWOA 2O5VA 4US2R 2XTZA 2CNWD 3OEED 3CPEA 2PEYA 1BYUA 1JQJC 2XZLA 3RHFA 1A7JA 1Z83A 1MR3F 5G41A 1XMIA 2GCPA 4TYPA 4R71A 3U5ZB 4R9UC 2NMVA 1CU1A 1Q1QA 1DAKA 4LOAA 4ZKDA 2ZS9A 3FMPB 4JL8A 3LH5A 4TQ9A 1OXSC 4TSFD 4LJ9A 2Q0HA 3IUYA 1JB1A 4ZCMA 1N6PA 2CLDX 3MWJA 4MKFA 2O8BB 1I2DA 3RS7A 5ANRB 3ADCA 1QVRA 5DIFA 3GPLA 1X8JA 1TQDA 4LJ4A 2QP4A 4RJLA 4AC9A 3B60A 4D0LB 4KFSA 2GXQA 2NOAA 1AJEA 3ZS9A 3HPRA 1MKYA 3GCGA 4FMCB 3K70B 2ZRDA 3IEUA 5JRJA 3AVQA 1Q21A 2C2HA 4BZXA 3CBQA 1MABA 2H92A 4B3XA 1NVUQ 2IWRA 3EPLA 2GCOB 2QA5A 4GP7A 1YZNA 1NJFA 4TMXA 4QM6A 2G0TA 5DH9A 2ZI3A 1KOFA 1XB2A 1ZUNB 1XD2B 2NG1A 2GESA 5SZIA 3W3AA 2OM2A 4GPTA 1G6HA 3BC1A 1MOZA 1OYYA 3W90A 3K0SA 4QOSA 1N25A 4O0MA 4J0QA 1E94E 2ZRMA 4QBHA 3WNCA 4B3GA 1G19A 2XTNA 5JEEA 4U7DA 2HT1A 2BCGY 5K8UA 3QVVA 4QXAA 4ZPXA 3U60B 2ONJA 1R4AA 3PFIA 1T4GA 3EA0A 4ZI2A 3WMGA 4QBIA 1LB1B 4PPQA 3FB4A 1TU4A 1C9KA 1UBGA 1L4UA 2B6HA 4ON9A 5EZ6B 4Z1MD 2OBLA 2MMGA 3LX5A 2H1LA 2F55A 3BS4A 2WWIA 2NPFA 4QJ3A 4O3MA 2EWVA 3U7EB 5JZVA 4YDHB 3P1JA 3D8BA 1JQLB 3Q72A 2R6CA 3SYLA 1ZW6A 3I8SA 3SBEA 1YR9A 2I1VB 4FMDB 4IFBA 2GJ8A 4MRPA 1FQJA 2A3RA 4AKEA 3OIYA 4BLSA 2BMDA 2RGAA 3V00A 4A0HA 5J4VA 1AA9A 1CRPA 1RYFA 2W0MA 1WXQA 3DMDA 4Q1EA 3DKPA 1SXJA 2EVWX 2FSHA 2ZUBA 3AVVA 2FN4A 4M2LA 1XD9A 4TQAA 5DN6A 3OE7D 2ZUDA 3HJNA 1XTQA 4W5HA 4NBSA 4AK9A 1WMSA 3A36A 1KMHB 4JBWA 1ZC4A 2O0KA 2EYQA 1AKYA 1E2NA 1Z6GA 4NMMA 2P0EA 1EWRA 3GMTA 4AKIA 1LTQA 3P26A 2JATA 2JIZD 2OAP1 1YQTA 2NO0A 3HU2A 4FIDA 1SVIA 3RRZA 1CTQA 2GEVA 1KIMA 3BH6A 3T61A 3EA5A 3BAFA 1Z22A 3CRW1 2IUTA 3CX6A 3EZ9A 3H4MA 4JLJA 1JR3A 4QM7A 1QHIA 3CRQA 5EP1A 1NLYA 1DAFA 1RFLA 1W0JD 2F43A 1G4UR 1E69A 4XJXA 4CEIA 1S8FA 4URZR 3L0SA 1U2RA 2EYUA 1N0WA 2ZYVX 3LD9A 1I4LD 3K9GA 4Y0VA 5DYIA 3UK6A 3K70D 3K9LA 4C3ZA 5ELXA 4M4SA 1D6JA 2ZPTX 1SXJC 1KI2A 3PEVA 2OXCA 4NYIQ 3UXMA 4D2IA 2BWJA 1KJWA 3AUXA 3O8DA 4G3XA 3FYHA 3SHFA 3X1XA 2C9CA 2R9VA 5FL7D 2HCBA 3U44B 4FXPA 1Z5ZA 1DBSA 1KY2A 2VF8A 4NTZA 3WBJA 2XXAB 1KO4A 3ZJYA 2VQSA 3LRPA 4TN1A 2F1HA 4NPHA 2ERYA 5EE9A 2ZRKA 4UJ5A 1BIFA 3GFPA 1T8UA 4Q1CA 3T5GA 4C0QC 4MQBA 3U4QA 2Q9AA 3QEJA 4DBLC 4Q1BA 1SKQA 1YRBA 3SJZA 2J46A 3F3YA 3PUYA 2UVQA 5FOWA 3MFYA 1A2KC 2GBLA 4JJKA 1BOFA 2V54A 3VNVA 1KO8A 5GJWC 1DADA 3VR2A 3NEYA 3WNBA 4QHSA 4JBYA 1XCPA 3ZQ6A 4DSUA 1CR0A 2BEJA 5EE0A 5CJPA 3U3JA 3E2IA 4KJZA 4G1UC 2ZR9A 3S1AB 3VAAA 5LDDC 4AURA 2B7CA 3U7GA 2ZU6A 1XMSA 3Q7PA 1IXZA 5JWHA 4I81A 1P7CA 4R7ZA 2O0JA 1VCOA 3Q9LA 4F38A 5F3WB 4M1WA 3SI7A 2AWNA 3U3OA 2JLVA 3CO5A 2ZRJA 2QMHA 3W3ZB 1VYTA 5GVSA 2RHMA 3L82B 1PUIA 2W00A 3DM9B 3LVQE 1NRJB 4KODA 2TMKA 5JWRA 3Q3JB 4KFTA 1AN0A 4C0BA 4H9GA 2QTVB 3PEUA 2B21A 3JZAA 3U7HB 4EPVA 4DKXA 3THWA 1E32A 1QZXA 1VYUA 4MA4A 2EFDB 5GJBA 1W4BA 2ZS7A 3B1WA 5L3QA 1E9CA 2HJVA 3AF0A 3LXRA 3TIFA 4DCSA 1BO6A 4BEBA 1ZM4A 2I1QA 4CVNA 4U5XA 1KI8A 2RMKA 2YNMA 4FCWA 4LX0A 1WBBA 1KDPA 3QSYA 1U99A 4POAA 5KUTA 3EARA 2OEPA 4A2WA 1COWD 1T8TA 1WE2A 3X1WA 3DZ8A 4BFUA 2OSBA 3IEVA 3LWNA 4LJ8A 4E22A 2J7KA 3OFND 5CM9C 1AS0A 3W6PA 1VHTA 2F3TA 3GEHA 4AYTA 1IN4A 2WWWA 1KI9A 4LK2A 5FFMA 3A1TA 4BFWA 2ZRIA 4N3NA 2OT3B 1Z3IX 4W5JA 2QP3A 5FR2A 4NYIR 1RRFA 2AXNA 2OV2A 3GEIA 2VHUA 4MITA 4BQSA 3DZDA 3W6OA 1Q3HA 1X86B 1WP9A 4ZIRB 3HR8A 1RRGA 4RKFA 3FDIA 4UNNA 3VR6A 1PLKA 2XSZD 3QG1A 1Z6TA 4DIEA 3LV8A 2QMOA 4RD1A 3MMPA 2HLDD 4NKRA 1ZJ6A 1HEIA 1E9FA 2RH5A 1S2MA 5CB6A 5EE1A 2BBWA 2FX3A 2OILA 3RC3A 1OYWA 5L3SA 3SJBA 4EPRA 1KKMA 4JL5A 1P72A 1W2GA 1Z2CA 4JYBA 4DT1B 1Q1BA 1P9WA 3UMFA 1IM2A 4M9ZA 1IJEA 1WCV1 4ZKEA 3VFDA 4RFSB 1NI3A 3K8YA 1Z63A 1TQ2A 5LD2B 1HY3A 4JLAA 4B76A 2W6JA 5JHGB 1DAMA 2FE4A 3FFBA 4PO9A 5K8LA 1W36C 4RD3A 4TSFA 1DARA 5HCIA 4GZLA 5JS7A 3I62A 3L8ZA 2WWXA 1DAEA 1EX6A 1YRAA 4Q21A 3TMKA 2WWYA 4MUBA 5C46F 2Y8EA 2V9PA 1KNQA 5BWMA 2DB3A 1UBCA 2CJWB 3GLHE 4DLUA 4Q48A 4IOJA 1XU4A 3TW8B 3ZIAA 4A6XA 1J7KA 4WOPA 1ANKA 2W6ID 3MJRA 1CJTC 1FQKA 1R0ZA 4QBGB 4DVGA 3UMSA 3EPKA 1T0JB 4NZYA 2XOKA 4RCYA 1OJLA 1XZQA 3B6EA 4CT5A 1MO4A 4DUGA 4F92B 4BZPA 2WWFA 3SR0A 1DOAA 3B82A 2BIFA 1G1MA 1RZ3A 1BKDR 4KSCA 2ORVA 3GJ6A 3ZYCA 3RS2A 1YVDA 3BORA 3TNFA 5EE5B 3THYB 3CWZA 3DVLA 1XPOA 3SJCA 3QXSA 1Q3TA 3FKSA 3C15C 1ESMA 1XMVA 3R9WA 1WDTA 4XSGA 2H17A 2YKGA 2XB4A 4EUNA 4PSKA 1KDRA 2Q6TA 4B3BA 1E6CA 2ZSFA 4MRRA 4DJTA 2ZITA 3CPHA 3IPYA 2FH5B 3KB1A 4HLUA 4PPFA 3QIAA 2J45A 3UIEA 1SVLA 1A82A 2IW3A 4M1YA 4NCKA 721PA 5AWFC 1ZUIA 4B71A 2HV8A 2XEXA 1KSJA 3T1VA 1T3SA 4DDWA 1N3BA 2V7QD 1NMZA 3I4LA 2QPTA 4PO1A 3RSLA 3LLUA 4F91B 1GL9B 4CEJB 1T9HA 4OI4A 5FOXA 1E0JA 3BB1A 4JLBA 2BDTA 2QAGA 5AUNB 4Q4HA 3TKLA 2GAAA 2QGZA 2KJQA 4IRUB 5FTLA 2OCBA 3TVTA 1FPMA 4LHZA 1FMJA 1XEWX 4GOJA 1P9NA 4ZDIA 2ZI4A 3V4RA 2WWGA 1EXMA 4DLWA 2ZRAA 2H57A 1GILA 3SOPA 2JIZA 3GLFE 1W4AA 2XAUA 3QF4B 4OQMA 2WMNB 2WJGA 4LWZA 3SFVA 1NLFA 2FGJA 3IHWA 2ZETA 2VSXA 2DY1A 1ZVQA 5C1BA 5BYJA 1NSTA 1EFTA 1T91A 2FZ4A 3B1XA 3THXA 1KI3A 2CK3D 4Q5IA 3NG1A 4BASA 2F9MA 4URUR 3HU3A 4HLUC 1JXMA 5JI3E 3AVUA 5FPKA 5KNCA 1I2MA 1VG0B 1B0UA 1YJ5A 5LBIA 1ZM7A 3QOFA 2WV9A 1DEKA 3EG5A 4OHZA 1E0KA 5FOUA 2OUKA 3BJIC 2GWHA 1MT0A 1FUKA 4UQOA 1G3MA 1GNPA 4V03A 2PCJA 1CJMA 5DHAA 2FWRA 4BRWA 3NHBA 1OH5A 2QAGC 1KGDA 1R7RA 1G7SA 1HTWA 2V55B 1N5IA 3VX4A 3GQBA 2YWGA 2ZJ8A 2X19A 3TH5A 1ZM9A 1FZQA 1JJ7A 4S2EA 2IK8A 3GLGE 4PTLA 4JLKA 3QXCA 2EFHB 3B2EA 4KFUA 4LRWA 5E4FA 1NVVQ 4C0LA 3Q8XB 5L3RA 1CJUC 5TV2A 1KHTA 3CIOA 4C30A 2VL7A 3AEZA 5DSZA 1OH6A 1XWIA 3AVOA 3QXXA 1VCIA 4Q4JA 3GJ8A 3K0FA 5E3HA 3LW7A 1VPLA 2VIIA 1GTVA 4IKEA 4Q66C 5KU1A 2ZREA 3FHCB 5AR1A 5A4JA 1IY0A 4HATA 5SZJA 3CRVA 3EXAA 1NBMD 1T6NA 3K70C 1KSGA 2QENA 2FJUA 2QPAA 1L2TA 2A7QA 4C2TA 1E2LA 1HQYE 1J70A 1NIJA 1P73A 2FFHA 5HCNA 2HJGA 5FBQB 2Q9CA 3C5HA 4B73A 4EPWA 3RC8A 1YR6A 2ATXA 1T0HB 3SJAA 1SVOA 3AKDA 5HR5A 1Q22A 1CRQA 1OIWA 3PUWA 4FMCF 1G5TA 4O25A 2Z43A 4OBEA 3ICQB 5FUVA 4EJSA 1LW7A 5AUOB 5L3QB 1NKSA 2FFAA 3QNUA 2VSFA 3OAAD 3CZQA 3O8RA 2FPKA 1WA5A 4TTPA 1TEVA 1M6NA 1OFIA 5IT5A 3F5FA 2XNDA 1VCMA 2I4IA 1COWA 3NBZC 5SZHB 1EFCA 2WJYA 4XD7A 1TF2A 1KAGA 1OF1A 3GJXC 5IK2A 1KSHA 4Q18A 4US0R 3TK1A 3QENA 4TLDA 4YMVA 4BFVA 3R20A 1FP6A 2IXEA 4LV6A 2JDID 4ESVA 2W2TA 2ZSDA 4KI0A 3SC3A 1E2GA 1RJ9A 5JFGA 2LCFA 4GT1A 3MLEA 1N6OA 1D8TA 4UNQA 4HUQA 4HB4A 3G5UA 1T3HA 1PLLA 2ZJAA 3RWMB 3PUVA 1W0KD 5J4KA 1K5DA 2ZJBA 1EG7A 4MKGA 3HYRA 3QQ5A 4B33A 4BLQA 4BLTA 2DBYA 4B34A 1SHKA 4AKGA 4EPXA 2PL3A 1KI4A 5DI9A 1XCMA 4UXHA 2N46A 1YZTA 1Z2AA 1NVVR 1N0UA 2OHFA 1D9ZA 4JVMA 4GOKA 1HA3A 3KJEA 4OYHA 4JBXA 4LI0A 4EJSC 4ARZA 1E2IA 1E9AA 3QKTA 2YOHA 3TR5A 2IBMA 2GKSA 4IOLA 5J5CA 3WY9A 1W4CA 4D4MA 1G6OA 5EP4A 5KOYA 2FA9A 3IO3A 2Q3HA 2JJ2D 2OLKA 2QQEA 2PX0A 3AKEA 3GEEA 3KTAA 5HE8A 2ZRCA 4F93B 2OCAA 1A1VA 1QHNA 5HKKD 1KYIA 2ZSBA 1KAOA 2HYIC 1NY6A 5FBVB 2A2ZA 2IYLD 1TADA 4URYR 2AX4A 5AJVB 2J9RA 521PA 3T15A 4IEIA 1E9RA 1GFIA 3PVSA 1II8B 4M22A 4Q4AB 1E79D 1U98A 2XNSA 4C9BA 2ZJOA 3NC0C 3IO5A 2NQ2C 1IHUA 2FOLA 2FSFA 4Q1FA 4TL7A 5BN4A 4MH0R 2PZFA 4RZUA 2G0NA 2PBRA 4IDHA 1XRJA 4OHXA 4A0FA 4DZZA 2F9LA 2VBCA 1V43A 1R8QA 2R65A 3ZZ0A 4Y0AA 1R2QA 2WZQA 2ZJYA 1FW6A 1AGRA 1M74A 5D3QA 1VTKA 1ZIOA 4HDCA 1U0LA 1UDXA 1E3MA 2C5LA 3R8CA 3KJHA 2J0UB 4PPNA 2AKYA 3CR8A 2QBYA 3UANA 4NCJA 4B74A 1G291 5FUYA 3RRMA 1M7HA 2AHOA 1Q20A 3IQWA 5FTKA 2GCNA 1SVWA 2O8EB 1E9BA 4ASUA 2WKQA 2VH5R 2ZRLA 1H8HD 1E1QD 4GRAA 2ODNA 2A5YB 1YZKA 1X8KA 1B23P 3NBXX 2C99A 3VX3A 1AIPA 3AH8A 2ZVPX 4KSBA 4C2UA 3MWYW 3PXGA 1ZD8A 3MD0A 1RKBA 2XTMA 3P4YA 4XWAA 5GJVC 3RRYA 3QJYA 1JAIA 2AKAB 1SVKA 2DFKB 4JIMA 4DCNA 3EAQA 4RSGA 4EFNA 4OJQA 3THOA 4L9WA 1KK1A 8OHMA 1XJQA 3QUSA 2X2FA 4B35A 4KFRA 3CNOA 4JSYA 1AZSC 5FPYA 1QHHA 3E70C 3A58B 1GUAA 1KK0A 1P3JA 1LFDB 1OFUX 2J87A 4GOXA 1E2QA 3GLHB 4P3YA 1AS2A 4KVGA 4MYHA 3F8TA 2E87A 1Z6YA 2KWIA 4DSTA 2FG5A 4HLQB 1U0HC 3E1SA 3K0AA 3NXSA 4XH9B 4XSHA 1OXVA 1A2BA 5KDOA 1XXHB 2BBSA 3LO5A 1SXJE 4DXAA 2IXGA 4A8JA 2ODWA 4R2HA 4TT3A 3WRYC 2FV8A 3AM1A 4Q00A 4D81A 3VR3A 4LBWA 3M1IA 1UKVY 2NO1A 3ADBA 3BERA 1Y3AA 2Q3FA 4EPTA 5BN5A 4D0NA 2XJ9A 3C41J 4KBGA 4URWR 1XNJA 2OFWA 1GZSA 5CK4A 1VIAA 1G20E 2RKOA 4DSOA 1KK2A 4ZCLA 3AVWA 5D3MA 4PHFA 3BXZA 4RCZA 4IDPA 5EQTA 2O8DA 1PJRA 1N6NA 5CM8B 2JJ1A 1SGWA 2P67A 3RVBA 1N5KA 2GK7A 4LJ5A 1E9SA 3IIJA 1JR3E 5KSZA 2XGJA 3FGNA 4C4PA 1G5RA 4LBZA 1G8PA 1G7TA 4C0AC 3B5JA 1HE8B 2AL7A 2IEYA 1XF9A 2V4ZA 4TMTA 4BRUA 4D4LA 1FNNA 3AUYA 3CLVA 2BKEA 1XTSA 2OCPA 2VHCA 1OHHA 2G3YA 3EIHA 5L8VA 5G40A 1E9EA 2IYRA 3RS4A 3UG6A 3W8NA 3WRXC 3IIKA 4EFLA 3JVVA 1NMXA 3LA6A 4G5SA 4V0OA 3EZFA 2HT6A 3TE6A 4E5UA 2X1VA 3CZPA 3LXXA 3FKQA 1OFTA 3TAUA 4Q9KA 2ZIAA 3V9PA 4A8JC 1E2DA 2GVZC 5C2JB 4XVRA 5CLLA 3L0IB 1BYIA 4NE2A 5LD2C 2XZPA 1F2TA 4KYUA 3QI2A 2R6AA 2DWQA 1KI6B 1ODFA 1Z06A 2P5SA 4Q4JB 4RFVA 1JEDA 1G5PA 1XEXA 4JLOA 1R0WA 2RGGA 3CKLA 2GXSA 3GLFB 1KJZA 2IYZA 2A9KA 3BFKA 2BEKA 1ZC3A 2IXFA 2VA8A 1J90A 3GJ0A 3I72A 3A4NA 1FMLA 4FW9A 3ASYA 4OL0A 4DDUA 3T1TA 3HDTA 2WAXA 3EZ6A 4URXR 4LZZA 1VCNA 3OEHD 1RW4A 3P4XA 4DLSA 1MO5A 1NJGA 3CRMA 2QORA 4GMDA 5TVKA 2PJRA 2BMFA 1Q0UA 2IUSA 4JT4A 2IYQA 2NGRA 4DLXA 2KBFA 1W44A 3H86A 3UKDA 2ZTSA 3H0KA 1GL7A 1II9A 2D62A 2FNAA 4TYYA 3KL4A 3UWKA 4IDNA 3ONWA 5JS8A 1IXRC 1Z0KA 2EU8A 4ZV4A 3ZLJA 3A4LA 3QKRB 4LHYA 4L9SA 4TLBA 5IDVA 3TRFA 1J2JA 3AKCA 3I8XA 4LJAA 1Z0AA 1LF5A 1OV4A 2CXXA 3EW9A 4HAXA 1AKEA 4P4TA 5EP2A 2QT0A 4Q7LA 4S35A 3GLGB 5EP3A 2JLUA 4IJMA 1TMKA 5KTYA 1QHSA 3D31A 3LVRE 5FTNA 2LKCA 4ITRC 4KITB 2A5DA 5K8IA 1S3SA 4MKHA 1Z8FA 3CH5A 3T1OA 2WKRA 2REOA 2ANBA 4AY2A 3A1SA 1JPNA 2OG2A 4PZYA 1E0AA 2JDIA 2CHQA 1OKKD 2RGNC 3RLFA 4CRWB 1RJ9B 5KNDA 1UAAA 3W8RA 3SZRA 1CS4C 4X8OA 1F6BA 2FDCA 3OZXA 3GLIE 4ZO4A 4KVAA 1G21E 4MGZR 4WXRA 5FPHA 3U3KA 4C7OA 2ZE5A 3P20A 1QHYA 4P4SA 2AK2A 2ATVA 3B8HA 1N5LA 4LJ7A 1PLJA 4JLMA 3N2IA 1MV5A 3R7WA 1CR4A 3FOZA 3CNLA 3ZVNA 2IF0A 1KZ7B 2AK3A 5CIWA 1IJFA 4YMUA 3M6AA 4YXWA 5JJIA 4XWKA 3PITA 1KO1A 3W9YA 1L7VC 3ASZA 2Z4RA 3UATA 4IEEA 4B6EA 3VHXA 3R9XA 2RGEA 2BC9A 5JSZB 3B1YA 1OB2A 3OF5A 3L8YA 2UZIR 4EQ6A 4OKSA 1E1RA 4YQFA 1E2FA 2VP5A 2O8CB 1BH2A 1BMFA 1EK0A 3BGWA 2WJVA 3N70A 2AR7A 3I1FA 3FHTA 1M2OB 2W2VA 2V1XA 4RVCA 4L16A 1N2CE 4TZ0A 1E0SA 2W83A 3VQTA 1TAGA 1QVAA 1ZNZA 2ZI7A 2BJVA 1E2KA 3SHWA 2DFTA 3EZ2A 1VIYA 1GVNB 5BXQC 4TLEA 1YZLA 2P6RA 3VU9B 2ZR0A 3PIRA 3EX7C 2F1IA 1DS6A 4TMWA 1G17A 2OXRA 4HDOB 1KSFX 1UM8A 2Z5FA 1ZINA 3BBPA 1F3OA 4QL3A 2WPDD 3GLIA 1UKEA 4LJYA 5GVRA 4HB3A 5F2EA 1W1WA 4TL8A 2PEZA 1C4OA 2G83A 4NCHA 3ZVLA 2JGNA 5DO9A 4NONA 4DCVA 1F2UA 2MMCA 4HAVA 3A4MA 4TMZA 5B58C 4GMXA 4Q02A 2JJ8A 1S4QA 1NN3A 2EQBA 2PT5A 5C4GB 1Z0IA 2PLFA 5BN3A 4WZAE 1G7RA 4OQLA 4CEHA 4XTRA 2HDNB 3N5CA 2VP2A 3PV0A 4PAOA 1I4DD 1ZM3A 1H8HA 5LPNA 1H8ED 2KI5A 2ODEA 1FL9A 4QNRA 3FHOA 4U00A 2RGXA 2GA8A 3B13B 2O8FA 3IBGA 4HZUA 3EC1A 4JLNA 2QY9A 1GKYA 1NMYA 2QE7D 5DI3A 1MRNA 1N0VC 3KXLA 2QZ4A 2ZJZA 1T3LA 1ZD9A 2CNWA 3BH0A 3WYGA 3OEEA 2QTHA 5CK5A 1TUEA 4V0NA 2H16A 1Y63A 1J8YF 2J59A 1NG1A 2J0VA 1UEIA 1ZU5A 3DOFA 5G53C 4TL6A 2V6IA 2ZEJA 4DC9A 5JJKA 1C1YA 1QHHB 3NKVA 4Q7KA 2H7VA 4A9AA 4IVPA 1PUJA 5FH9A 1Z0JA 2NPIA 1IN5A 4Z54A 3NTUA 3FPAA 4CF7A 1QRAA 2JEOA 2FPMA 4BFXA 4LV8B 4IXNA 1QG4A 3SBDA 2OAQ1 4PPGA 4FWTA 1GNQA 1YZQA 3OIWA 4W9MC 1GDDA 2CLSA 1OH8A 3Q7QA 3E5HA 5CLQA 3QF7A 1MRSA 4MYCA 4QRHA 1OFHA 1FP7A 3NHAA 4ZDJA 1X6VA 4IDQA 3W5JA 4ERNA 1MABB 5FBRB 4Q03A 3KQUA 4HI0E 2C9YA 4LHWA 4IXMA 4N0EA 1P5ZB 1SKYE 2DCUA 4YDSA 5HPYB 4NH0A 4M1MA 2J5XA 1ZUHA 3KXKA 1F60A 4QFMA 4LHVA 4UKDA 1DO2A 1EX7A 4I1UA 1D2MA 2EWWA 4ESHA 4PC2A 4CDGA 2WBLC 4B47A 3QKUA 3T12A 1CLUA 1EFHA 2UZ3A 4JL6A 4YONB 1D2NA 1UFQA 1G3QA 2YOFA 2VEDA 4RD6A 1AM4D 1WQ1R 2ASEA 2ZE6A 4JKYA 2QTFA 5DISB 5LB4A 3VTKA 2IL1A 4PR0A 2FEMA 4W7SA 2OBNA 2ZI6A 4BLOA 5JJLA 4OQFA 4QJ5A 1OB5A 1YZGA 3QEOA 5CB8A 3D7MA 3K9NA 4BLPA 2HCJB 4NCIA 4KCGA 4Z1MA 5IHPA 3R9IA 2BHRA 2QSZA 2GDJA 2FSIA 2ZYUX 121PA 4NHOA 3WHLA 3BB4A 2IHBA 5EXXA 5KHOC 1TQ6A 1M8PA 1E4VA 1EFRD 2CDNA 2IS2A 1UDWA 3KKOA 3AF4A 4UNPA 4DIDA 2YJTD 3P32A 3QKSA 1W2HA 2REXB 4HAWA 1QF9A 1HYQA 3RS0A 1HH4A 2AFHE 4LYJA 2ZRGA 4RD4A 4BFYA 1IY2A 3QPWA 1SXJB 1S1CA 4L5BA 2QGNA 2QMEA 1ESNA 2WSSD 2P2LA 4RY2A 1TNDA 3UPUA 1XD8A 3CNNA 3O47A 4H1VA 1SZPA 3OE7A 4D6PA 2WVJA 2ZI5A 3NH6A 1Z07A 1UBEA 3GJ3A 2J41A 3NBFA 1IN6A 4M9QA 2ORWA 3ECCA 3GD7A 3EWSA 4AYXA 2QM7A 1N6LA 4TMKA 2C77A 4HAYA 1Z0DA 5DYGA 2OFXA 2VTKA 3LQQA 4CIDA 4JVSB 3VKGA 2CLCX 4Q9HA 1W47A 4WW0A 3KJGA 1E4YA 4HLCA 3PJRA 4LUCA 3CH4B 2BBTA 2QT1A 5FOSA 2GRJA 1W0JA 1HUQA 2F43B 1UADA 1XEFA 3TSZA 4CEIB 5JHHB 1YZUA 2QP9X 1S1MA 1QHGA 3U2QA 4C0HA 2GF0A 2Z0MA 1K8RA 2V6JA 3CONA 4DWJA 1TTTA 3TSWA 3KKNA 4DDVA 3KX2A 1CJVC 421PA 2F7SA 3IGFA 4C0KA 4M21A 1UBFA 1XZPA 4DCTA 4PX9A 4JLDA 5EXPA 1FNMA 3DOEA 2JASA 2YWEA 3P27A 4L8GA 5BYKA 3GJ5A 3A37A 3B1ZA 4LGMA 4ZDWA 4OHYA 1P2SA 4JYCA 4JKIA 1RPZA 3RRNA 3VKWA 1Q44A 4B48A 2GCOA 1F48A 2J0QA 2PT7A 5FL7A 2ZI9A 4WAUA 1P2UA 2W0SA 1OKKA 1NKTA 4LBYA 2J0SA 1ZCBA 1UPTA 4M1KA 1E98A 3SFZA 2DFNA 3TUIC 3U4QB 3FWYA 1XTRA 3CX7A 3L43A 3MWKA 4A0GA 4Q19A 2FU5C 2D06A 3MJHA 2PMKA 4IVRA 1JJVA 4G0NA 4IOMA 3A1WA 5JI2E 4NL4H 2GAOA 2GJ9A 4LDJA 2QRZA 4N1AA 4FCVA 2GNOA 3IHLA 4B2LA 1G8FA 5HTKA 1FTNA 2SHKA 3X1DA 2OE2A 4B32A 4PHGA 2V1UA 2HUPA 2CCJA 2ZANA 2GJSA 3DEFA 3Q5EA 3FE2A 4PXAA 2V8OA 1R5BA 4MDFA 1AS3A 1CXZA 3L0OA 2X8AA 2LWIA 5JECA 3B7GA 4LYHA 1RIFA 4GNKA 5DNYB 3ICEA 5F98A 3NIBA 1SXJD 3H1TA 4P0TA 3THWB 1GRRA 1OXTA 2KE5A 4Z8YA 3KQLA 1Q12A 3F0TA 5KPDA 2ZXUA 3RYTC 3U6BA 4MGYR 5DN6D 5FOTA 3MAAC 1W7AA 4FI3C 1Z6AA 4FN5A 2YC2C 1KMHA 2ZUCA 4QGFA 1NN1A 4PZLA 5F9HA 1JBKA 3WYFA 1HQCA 4GFDA 2CHGA 2XB2A 4JMPA 4V0LA 2B8WA 2D4HA 1OIXA 4K46A 4NP6A 5FUXA 3BOSA 1VHLA 4DCUA 3GLIB 3OFNA 2WPDA 4B2IA 3KQKA 4D26A 4D0GA 4NYJQ 4O2LA 5CJ2A 1W36B 3ZS8A 4PO8A 5JCPA 2H5EA 5FOVA 1GSIA 2P65A 4WXPA 4A0RA 2ZYWX 2J7PD 1ELOA 1LNZA 4LBVA 4BLRA 4HDQB 1SVMA 2XSZA 1M7GA 2BOVA 2OLJA 2IC5A 2N1BA 3KB2A 4AWXA 3ZD7A 1R5OA 2HLDA 1KO5A 1W49A 1X3SA 1YKSA 4FMDF 5H1YA 4OQNA 3NEJA 1TEXA 2BBOA 1DPFA 3KUDA 3LQRA 2Q21A 5L3SB 4CGZA 2XXAA 1AK2A 3TQCA 2RCNA 4MUAA 4WA7A 4ZCIA 1TL7C 2QE7A 3CF0A 1WRBA 4RZXA 1GKIA 1NN0A 3QXJA 2W2XA 5LB2A 5DE3A 2PLRA 3KUCA 1US8A 3AF3A 3CF6R 5KPJA 2I3BA 1QBKC 4G5QA 4M9XA 1RC8A 3I5XA 2JLYA 3SYKA 4AD8A 4DRZA 2YYZA 3REFA 4K81B 1GWNA 4AIIA 3AV0B 4JSTA 3CR7A 2C98A 2YVUA 2N42A 2NZJA 2VO1A 3LNCA 1G8YA 1ZNXA 2YV5A 1JNYA 2IYSA 1CIPA 1G4AE 2V3CC 3SQWA 1CR2A 3TR0A 3B85A 1T5LA 5M04A 4G5OA 3S1AA 2ZRBA 2WJHA 5AJYA 4PZZA 4LPSA 3U3RA 1G64A 1TX4B 2HF9A 3T1QA 2BJWA 3TUZC 2B92A 3SE0A 4YMWA 4A92A 5AJXA 4M53A 5TY0A 4M1TA 4DB4A 2WSMA 4Q9JA 2Z6VA 3SDZA 2MSDB 1Q57A 4LY6A 3AGQA 2DFLA 4BUJA 3FMOB 2VLIA 4QG7A 1V5WA 4JVNA 4V02A 5A0FA 2W6IA 3IIMA 3KDSE 2DR3A 4BECA 2GEUA 5JCZA 4V0MA 2QL6A 3DL0A 1R5NA 1G41A 4E09A 3PENA 5AUPB 1S0UA 3DMNA 1VKJA 2XX3A 2OZEA 2IF2A 3LW8A 1KI1A 1NVXQ 3VHLB 2D7DA 1W46A 4PQRA 4NYJR 2BMJA 1PVOA 4F7WA 2H8KA 1ZNWA 1TU3A 1ZP6A 1YR8A 1JR6A 1K6MA 2VF7A 3NVAA 1T5IA 2C8VA 5H8WA 5J47A 4JZKA 2CEAA 1BS1A 3LBHA 4OHWA 4BPBA 2YHSA 1ZAKA 2HXYA 2J1LA 2REBA 3BWDD 4LCBA 5FI0B 1KKLA 4HLDA 1YU9A 2KBEA 3RDPA 4ZIRA 2ECKA 2PZGA 5B30A 3AVTA 2WMOB 1K5GA 1N5JA 2CVHA 2RB4A 3ZZUA 3CW2A 3T35A 5CYPA 2R44A 2V7QA 3I32A 4HB0A 2VHJA 4FMBB 1WB9A 2G6BA 2GZHA 1OIVA 1NLZA 5KSPA 1R0YA 4CW7A 3CWQA 3BK7A 3RWOA 2QAGB 3H84A 3TAHA 4Q4HB 4HUTA 2ZU0C 4NYMQ 4Q1AA 4LPKA 4DLVA 1DVRA 3D3QA 4DT1A 4JT2A 5G3ZA 1KMQA 2QM8A 1G7CA 1SKYB 4JLPA 2P5TB 2X77A 2EFEB 2ZYTX 2EW1A 4RD0A 2EFGA 3TVDA 2BM0A 4RFSA 4QC2A 1FOEB 3SEAA 1IN7A 3MWLA 5E7MA 1W5SA 4M0LA 3ZDQA 4DSNA 2W6JD 1RVDA 1M7BA 4Q1DA 3RANA 3TJZA 5KDDA 1IOZA 3IQXA 5J4LA 1TF7A 3T06B 1KO7A 3THXB 2GXUA 3X2SA 1NBME 2CK3A 1OXXK 5E7IA 5HZKA 1XP8A 2ERXA 4B44A 4TWZA 4QGHA 4OI0A 2IYXA 1CP2A 4EAQA 2Z4SA 4GP6A 4Z51A 2IYYA 2GHIA 1XDBA 3WBKA 2DWPA 1JPJA 4V0KA 1FTSA 1VG1A 2CJWA 1XTKA 2GXAA 1S9DA 1XCGB 2ZRNA 1Z0FA 4A6PA 4G5GA 2P6UA 3SNHA 4PAMA 1XJ0A 3ZIAD 1IONA 3ZD6A 1N6RA 2QG6A 2ONKA 4TTQA 4MKIA 4TMVA 4D25A 1HT1E 1VG8A 1G8HA 1AGPA 2G1KA 5EZ5A 2YWHA 3WNDA 1QDEA 2XOKD 5FPTA 4FINA 3MUFA 1ZM2A 4DUGD 2WWHA 4TYWA 2GJKA 3DDCA 1WBDA 2NO6A 3QBTA 3K9HA 1FUUA 3BIFA 4RD2A 4GZMA 3ZVMA 2AXPA 3TLXA 4OI1A 5BW8A 1GKUB 3SYNA 2DHRA 3THYA 1U94A 3U61B 3UMRA 3FKSD 3OIUA 4DLZA 2QPOA 3K0FB 3KQNA 3CUEF 3AP2A 1P62B 4GSYA 4NU0A 5BQ5A 1RRPA 2L0XA 1KDTA 4E03A 1R6BX 5CIQA 4A82A 2GJAA 3ND9A 4B3DA 2RGNA 3A1UA 5E7JA 1NBMA 3A1VA 3BH7A 4M1OA 3J81k 5E95A 2QQ0A 2WIBA 2RGCA 4NYMR 1SHZA 1VG9B 3VKHA 3K0CA 4X8HA 5FUWA 2JA1A 4CEJA 4XVUA 4TLCA 2G9NA 2FF7A 5J4YA 1YHNA 1E2EA 1Q1ZA 1U8AA 2F3RA 2OESA 1PZNA 4Q4LA 4DHEA 5IF9A 4EJSB 2IS1A 1II0A 5C18A 1VDZA 4BFTA 3MSXA 3OAAA 2WOOA 4PC1A 2WJIA 1XFAA 3FVQA 1YE8A 5B2ZA 4QHTA 3QF4A 5F9FA 2ZE7A 4FD2A 3EWAA 2QEQA 2AFIE 4H1UA 5KYKA 1G18A 1ONBA 4XTCS 3MGCA 2VPPA 5AUQA 1E2PA 4LSGA 2PMDA 6Q21A 4DDTA 1P60A 5EE3A 2YWFA 4B6FA 2VP9A 1EWQA 4TYQA 1OXUA 2J7PA 1P2TA 4HUQB 4B75A 4IW3B 4PSVA 1HV8A 5KDLA 3PR1A 4IFEA 1OPXA 2ZE8A 4MRSA 5L3VA 2ZRHA 1W0KA 2A78A 3QXHA 2C9OA 3K0CC 3WP1B 1XMJA 1KJYA 2VRWA 3M4YA 5EXSA 4RZ3A 1TF5A 4Q7MB 1ZCAA 4HEJA 3CM0A 1GRNA 3K09A 2QN6A 4HAZA 1P75A 1U81A 1G3RA 3RS5A 4A15A 3C7KA 1GL6A 1LY1A 3HP1A 1G8GA 3KZ1E 3SS8A 2CL7X 4ARZB 1CEEA 4I1SA 1HT2E 3AF1A 1OLOA 4EFMA 3I73A 2IA5A 2GVDC 4L4UA 3AP1A 1A4RA 4WZBE 3ETLA 3O8CA 2UKDA 1US8B 2P3SA 3KTAB 2JJ2A 4P31A 1E96A 5TB5A 1D9XA 1R0XA 5HKKA 1ZU4A 2QAJA 4OK5A 1S3GA 3WXMA 2BCJQ 4PC3A 1Z6XA 4KU4A 1AZTA 5TXGA 3FMIA 2MSEB 3FFAA 2CL6X 5KO2A 1OSNA 1X1SA 3SN6A 1NVWQ 4JJZA 1W4RA 2O0HA 2CCKA 2FSGA 2HF8A 3B1VA 1OE0A 4O2RA 5SZKB 2R62A 1E79A 1XJCA 1AQUA 5FBWB 2XZOA 3A6PC 1QG2A 3ND8A 3HWSA 1VECA 5JBQA 4E07A 2X2EA 3WMEA 2IS4A 2BVNA 3EPHA 2AWOA 3L0PA 2FZLA 3K09C 2IS6A 1NN5A 2QRNA 2ZROA 1N6HA 4EDHA 1AQYA 1UF9A 5EJEA 2ZQ5A 4I1VA 3W6NA 4LYAA 1MO3A 1W5TA 3KQHA 1VMAA 1LS6A 2WJJA 3QPUA 2QBYB 3KFVA 4OQXA 1GM5A 4XIGS 4R98A 2XNDD 1DG3A 4DB2A 2GBLC 1KK3A 2GTPA 3C8UA 3C16C 1HURA 2JLQA 2ZSEA 2HYDA 2ANCA 1EFUA 1A5TA 3CB4A 1JEEA 4AG5A 1X8LA 3B9PA 4ACAA 4B3FX 4ZI3A 3MCAA 1E1QA 4TL9A 621PA 1E2JA 3QY0A 1DAGA 4XD7D 2D2EA 4BEJA 1S9HA 3FMFA 4LV5B 2C03A 5H68A 5IK2D 4GI7A 2BM1A 3K0EA 1DG1G 2WAYA 4WBSA 4FWIB 2ZS8A 3RABA 2G1JA 2CBZA 2R6DA 3AP3A 5JRZA 1GNRA 1Z47A 2ORIA 3AKYA 2ZAMA 4RKEA 2KSQA 2R2AA 4II7A 1DE0A 3ZH9B 4I1OA 1P6XA 2A5FA 1MO6A 3TBKA 5TMPA 2A5JA 1MH1A 1FX0A 3V4FA 2GETA 3PEWA 4MYTA 4ZDKA 4BWYA 1LV7A 3LFUA 1P2VA 2BMEA 5AK0A 4P32A 1OH7A 1GG2A 2CMKA 5TDHA 2VSOA 5B57C 1U0JA 3LDAA 4TTRA 1NL3A 1W48A 3K0AB 2QNRA 4X8LA 4AG6A 2EFCB 2Z83A 2ZJ5A 1CF4A 2IHYA 5AJWA 3M0EA 2B7BA 3WP0A 3DHWC 4MRNA 2DWOA 2OCYC 4QHYA 4A8JB 4PC6A 4U02A 4Q9IA 2QROA 3IBYA 2YZ2A 2O52A 3EC2A 3L2OB 3W5IA 3C4JA 2D74A 2HXSA 4TLAA 3AVXA 3NDPA 1JECA 4BE7B 1U8YA 2JLSA 1II8A 3LAWA 1Q1EA 3CF2A 4RZ2A 4XOIA 3B78A 4Q4AA 3WHKA 5CDFE 3NH9A 4IHQA 5D3MB 4XWOA 2O8DB 3W34A 2QSYA 2IYWA 4KYIB 2ZRPA 2OO7A 4UNRA 4JLVA 4PQFA 5FPSA 5FBLB 4CZ2A 2IYVA 2ODBA 1XBTA 4EPYA 3QE0A 4PAQA 3BFVA 3D6TB 3B9QA 2IYUA 3AVPA 1XTJA 3REGA 2DPXA 2AN9A 3NC1C 3IILA 2GK6A 4QGGA 221PA 1SQ5A 1IBRA 1I4TD 1XXHE 2ZJ2A 2YC4C 4I4LA 3VR4A 1IXSB 1HE1C 2KB0A 3X1ZA 5FR1A 5JWOA 1ZRHA 1RE0A 2CE2X 1DO0A 2J0UA 3HR7A 3HYTA 4W5WA 1NG9A 2JLRA 3PUZA 2PZEA 4HZIA 4WIAA 3T34A 2QI9C 3Q5DA 4OHVA 4WZ6A 2CVFA 3OIVA 4C0JA 2IWHA 2NO7A 4KLZA 4MGIR 5J4HA 1F2TB 4TYNA 5FTJA 2FFBA 4ASUD 2O8EA 1H65A 4HSEA 5B64A 4HAUA 1CR1A 1LF0A 2G88A 2K5UA 3VR1A 4OJKA 2WTUA 4C0SA 4GDFA 3HU1A 3AGPA 4KLNA 2WKPA 1XEXB 3ZQJA 1KDOA 4N0DA 4DEYA 2WHXA 1Z29A 4JS0A 4YMTA 3OHMA 1IN8A 1DAHA 1JAHA 5UKDA 3QBVA 2NTYC 4Q01A 4A2QA 4BZQA 4TQUS 4BGDA 3OEHA 2YOGA 2FGKA 5DHFA 2WOJA 1GAJA 2PJZA 4YLGA 5CDFA 2ZR7A 3BE4A 5J40A 3BB3A 4B3CA 3I3SR 2D3WA 821PA 4KBFA 4DLRA 3ZVRA 4ILEA 3GLHA 4LC0A 4FCTA 3KKMA 4P33A 2Q9BA 1G9XA 1KI7A 5CITA 2O8BA 3QG5A 2GILA 1GIAA 3LY5A 4UJ3A 4X8MA 4UNSA 3U6KA 2E9SA 2QMUA 1U9IA 2WM9B 2OFOA 3OESA 1RRCA 1XXHA 1ZIPA 4TT3D 1Z08A 2NIPA 2IUUA 2R6FA 3CRRA 3LX8A 1O87A 3CPJB 3AF2A 3H2YA 3VR5A 4F4CA 2NO9A 1JALA 4JVLA 5GADl 1UJ2A 5KSOA 1XPRA 1M34E 1XD2A 4D82A 2G77B 3EASA 2JJ1D 4P4UA 1U90A 3G0HA 5FI1B 1E2MA 1P4SA 4PSAA 4QGAA 3EZ7A 3ZGXA 4AI6A 1DELA 4G01B 1NP6A 3GP8A 4D4JA 4C7OB 4NCNA 5KNBA 3VMFA 3Q85A 4B43A 1ZNYA 4P4SB 3SU8A 4B2PA 4MGKR 2FEOA 5EUQB 5A5GA 1OHHD 4LC1A 5DGXA 3R7WB 1ZBDA 2ZVQX 4M9SA 1GOTA 1ETUA 4HB2A 5GJCA 1FFHA 1L4YA 1XEWY 2ZAOA 4GL2A 3KKQA 1J8MF 4EKDA 3TUJC 1U9IC 2WIAA 5TARA 2JLWA 2F6RA 1QHXA 1F5NA 2GF9A 1NF3A 1GITA 3DKVA 4CT4B 4Q47A 2VP6A 3AB3A 1U8ZA 4DLYA 4XVQA 4EQ6B 2C78A 3QPVA 2DYKA 1KI6A 3VNUA 3X1YA 2QUZA 2ZRFA 4PANA 3TSOA 4TZ6A 2IX3A 3NBYC 3ZZTA 2OBMA 1LS1A 1UKYA 3WMFA 1ZMXA 1NNEA 4ABYA 3GLFA
chains in the Genus database with same CATH superfamily
1QCYA 2F1RA 4YT4A 5IBPA 1XGKA 4NS4A 1B6GA 2AFIB 1Y1PA 1TVKB 5LQNA 1G6KA 2NZ8A 3TI9A 2XH8A 3RG8A 3WLNA 3EEQA 4KGZA 4LJ6A 4U8GA 1X13A 1PK8A 4EJ0A 2XQJA 2FPXA 3EIEA 1IM8A 4ZMSA 3F5MA 1AQ6A 4UXJA 4IZIA 2BH9A 3F6SA 5LVAA 1KZGB 3QUCA 1H4QA 3ESZA 2GUGA 1ORWA 2O2XA 1TTHA 2CCGA 2GO7A 3DXFA 4P08A 3KC2A 1D1TA 1R10A 3T5AA 3GJ4A 4GC9A 1BNCA 5HMLA 1DBPA 3KZVA 1XCOA 4WFQA 5ALLA 2BKUA 4DQ0A 2AD5A 4ATNA 1M1YE 2ZKLA 2WJPA 4AZ0B 4URVR 2DHDA 4GKVA 4TVBA 1R4NB 3X2EA 1F2UB 5A5FA 4MIKA 1DIBA 5T6MA 1PGQA 2SKCA 2WYIA 1GT91 2AQKA 2FVXA 1R8SA 2Q3MA 3LT0A 3P9XA 4IH9A 4LN1A 3U3MA 3VNAA 2X0IA 1VMKA 1RR6A 2XGOA 4M8LA 5AM3A 5J2UF 3WYNA 5CFMA 2LPMA 4NV0A 4IOKA 1XRSB 2NZXA 4X6LA 1P0MA 4L4YA 4CLXA 3KK0A 2BEVA 5ED4A 3C3BA 2P79A 1KTVA 1C7ZA 4R8SA 4K03A 3RC7A 1YR7A 3O21A 4X54A 4BX0A 3IJ5A 3ROZA 5IAKA 3TGPA 5J59A 4DJFC 3LY9A 4B3SB 2EBWA 3KEFA 1DTSA 4DRXB 1O6FA 4KR9A 1ZRSA 5AJZA 5L45A 4YUZA 3CW9A 1QDUA 4R2IA 3LUPA 3ROFA 2H1CA 1IUKA 2V65A 2ZDQA 1EP3B 4OK6A 1J8QA 2VAMA 3HR4A 2PRYA 4HEHA 1XVTA 4DEXA 1SKMA 4MHOA 2AFRA 2CHFA 3KJIA 16PKA 5FTMA 4B5LA 5K05A 2JLZA 3EE6A 4FYXA 1A2OA 2R8XA 4ACBA 2H7CA 3B1KA 1LJUA 3IDQA 3KZKA 4PFQA 4V3BA 4UVEA 3ZWNA 2WZBA 4EJ2A 1LDEA 4UVHA 3GFBA 4G4SP 4UXIA 1VLMA 4C43A 1K7YA 1CFZA 1CKEA 1ZOIA 5DASA 1Y6JA 2GFIA 2X0DA 3I76A 2DJIA 2SNIE 2GZAA 4R4JA 3OFJA 4BMXA 3QNMA 2Q1YA 4ZHQF 5KSYA 1DKQA 4I0WB 4N3AA 1G9SA 1BCRB 3ASVA 3ITEA 3GO4A 2HGZA 4K8OA 5IT9A 5AKXA 1VRCA 1G16A 1WLYA 1OC4A 3USCS 3E9YA 4OATA 2PMEA 3M6VA 4JSRA 1FDOA 2DX7A 1IHPA 1ECFA 3NBUA 5FL3A 4G37A 2QTLA 2XV1A 5JARA 4L3OA 1PT8A 3KFXA 4HN4B 5DM1A 2VT3A 5A3JA 2XT9A 2B4TO 2C96A 5BOSB 5B12A 1J2RA 2C04A 3BD9A 3C7TA 4C4RA 4CV0A 4ETNA 1UWKA 1T4CB 3CU5A 5A5VA 4Z7NB 1SXQA 1VLLA 4TN5A 3E03A 2JNWA 2XUKA 3VPCA 4DZRA 3LLMA 3KXIA 3VUFA 4A4DA 1JDBC 2MSNA 2WFZA 3C5CA 2FPIB 4ZAZA 1SVSA 2YTZA 2A5GA 2GK3A 1HRKA 1A9XB 1V71A 1UKAA 3P9QA 1PV4A 1E6KA 4J07A 2YNMD 4XQ0A 3ER8A 5AP9A 1P3Y1 1SULA 1KDZA 3Q7EA 4HH0A 2VJLA 5AK6A 1FTWA 2ZP1A 3QITA 1HEUA 4J0DA 3I5YA 1Q0HA 3F3KA 4N9QA 5IAJA 1I2ZA 3WWCA 4RHEA 1NYLA 1I14A 4U2KA 5HE9A 3UV7A 2RHDA 3G1WA 3DBRA 4NMHA 3R3ZA 4QNMA 4G97A 3NKFA 3KKPA 3SOZA 5JYBA 4N40A 4BRZA 4ZEOA 4Z4HA 4MUHA 4PONA 4NRDA 3LF1A 2R7NA 4YUYA 4N0MA 4O5OA 2BV3A 3K1AB 1VHWA 4Q7JB 4C06A 5IS2A 3O5AA 1SQ6A 4LYFA 2VTEA 1PGJA 3I04A 3CTPA 5A9TA 1N0IA 3QLVC 4INPA 1RP1A 1QGUA 3G59A 5G3YA 1TZKA 5TF4A 5C5EA 4C21A 4FNMA 3UJ3X 1QYIA 3E18A 3LI2A 3OCUA 2OD7A 2NTJA 2YWCA 3D2AA 3ADKA 3K1JA 1V3UA 3PWZA 1HXHA 3UJPA 4D4KA 2R8YA 3HL0A 3QVUA 3ODGA 3WADA 4BFSA 5DX0A 5AW4A 5EA2A 3GLKA 1U0RA 1MV8A 4ZYYA 2PH1A 1O3YA 4JKOA 4LY9A 3ECAA 1G3IA 1NIPA 1XX6A 1ORDA 1UEJA 3PRYA 4WJZA 1JZTA 5CYOA 3KSMA 2IT1A 3ZQKA 1K4YA 3OMWA 5AQ1A 4P7JA 2TYSB 1QQ5A 4US2R 3D1VA 4FE3A 1UOPA 1C1XA 3UOAB 4RDCA 3OEED 1XNHA 2PEYA 1BYUA 1E5QA 4AX4A 1A7JA 5PGMA 2A9JA 4ND4A 4N7JA 3TOZA 4TYPA 4R71A 3U5ZB 1G1AA 4U2GA 2OD9A 3GUVA 4LOAA 2PSJA 1TJPB 3EC7A 1DEXA 4JLWA 2Q2WA 4LCJA 3ISVA 4FFLA 1E7YA 4HR7A 3JPYA 4TSFD 4C1BA 4JUIA 4DDKA 4D4GA 2JB9A 2P3OA 2Q0HA 3IUYA 3R0IA 2VT7A 1WTAA 4MICA 4F21A 5C81A 3G02A 1TW3A 2DLCX 3S29A 1YF3A 3ADCA 1QVRA 5A6SA 4OF4A 2XTJA 3D5QA 3SKXA 2BDEA 4B85A 1TC2A 1X8JA 3FA2A 2C2ZA 3TTVA 4GNRA 5KYYA 3OLWA 2XWPA 2EW8A 1DBWA 2GXQA 3NNSA 2PU5A 3KYDA 3RROA 4KIGA 2QX8A 2D54A 2ZIUB 4DJDC 2HWWA 3MJ4A 2ZRDA 5KYUA 3G7NA 2QUBA 1C4KA 1EWKA 2C2HA 1MABA 1NC1A 3ZVKA 4HCJA 1IMJA 4EHAA 1KE1A 4ARCA 1Z35A 1XROA 1XZLA 3KELA 1ICIA 2FZGA 2QA5A 3TPCA 3PXDA 4UFNA 1L7AA 2WT9A 4DG5A 4OH1A 4U8HA 2HSWA 5AMXA 1KOFA 5AOVA 5G0TA 1XD2B 3CG4A 5EZYA 4BWFB 5AVRA 1NT2A 1TK9A 1OTYA 4H17A 5H3LA 3ZDZB 3H04A 2WU8A 3EMBA 4A1OA 3W90A 3HMQA 3IDOA 1MQAA 3DT6A 4QOSA 4F6RA 4O0MA 1MX1A 3DLPX 3WNCA 3L9XA 4B3GA 2JGEA 1G19A 3QP9A 4D9MA 3N3AC 3EYWA 4LWOA 3UJ8A 2DM6A 3GBVA 4ZPXA 4E4RA 4XYMA 2V6BA 4ZJUA 3NVKI 2I1WA 3DMRA 1R4AA 3PFIA 3DSRA 1PR0A 2FPWA 1Z17A 2GEKA 3AEKA 4NNJA 3EWNA 1TU4A 2I03A 2GQ0A 1DOZA 2AE1A 2OC9A 2P4UA 3JWIA 3NHKA 1L4UA 5EZ6B 4JENA 5TRTA 3LDHA 4WNAA 3WJ1A 1ULAA 2VZ8A 2XXBA 3LX5A 3ZHUA 4FFWA 3LXMA 2JS7A 2NPFA 1R1DA 2HF7A 4UTRA 4UBOA 4NMWA 5JZVA 5F7OA 4YDHB 3P1JA 3D8BA 3W2IA 1JI3A 1KJIA 3Q72A 1ZW6A 4WBNA 5M2QA 1M6VB 4GQAA 3SBEA 1YR9A 4FHCA 2R79A 3C3AA 1Y89A 2GJ8A 3Q98A 4BLSA 1R0KA 2HK8A 2Y1EA 3KT6A 3R5JA 4ZQEA 4Y2SA 3KCNA 2XUIA 1PO7A 1AA9A 2BSAA 4X9XA 1I6WA 4F60A 1MAUA 3GUYA 3FFTA 4NI5A 2WT8A 3DTVA 3E2MA 4NJMB 2PGDA 5FQOA 2CXHA 5C5IA 5B5SA 3OE7D 4W5HA 1KAHA 3NAMA 4JOCA 3A36A 4JBWA 1ZC4A 5TNXA 1YQUA 2PRZA 1AKYA 5LJIA 3QPBA 1ZPDA 5K99A 1Z6GA 1BX0A 1EWRA 2AJ8A 2IOQA 1OI4A 2CT8A 2JATA 3HU2A 5CLIA 3RBZA 3TD9A 3OP1A 3TDKA 3ZY2A 4E11A 1G2OA 2RJ3A 3RRZA 3T61A 1KIMA 3BH6A 4EGCB 4PSUA 1YE3A 3OTIA 3OZBA 5I9TA 1X1DA 3JZIA 5LA6F 3R7FA 3TD2A 3VU8A 5A0TA 3LK6A 3CRQA 2BTQA 1DAFA 1W0JD 3T3DA 1PDOA 4J43A 3E7FA 4H1HA 1GNLA 4XJXA 4CEIA 3BSWA 4HTFB 5FKJA 4E21A 1S8FA 1UZLA 2FQQA 1LRLA 3JQFA 4W9RA 4EB3A 4F5DA 1APBA 1JSRA 2IP4A 3KP1A 4ZARA 2XCLA 2JAUA 5ALFA 2IUFA 1I6LA 1I4LD 1KP9A 1V1JA 3K2EA 3K9GA 4FZJA 4EGQA 3NQ41 1WEKA 4U2CA 5KIAA 4UU7A 3UK6A 2GLXA 3WLHA 2X9LA 3K9LA 4GLBA 1RKVA 1UFKA 4UHBA 4F2HA 3IMEA 4AW9A 3E9DA 4IIYA 5ELXA 3H8WA 3EJWA 2ZBVA 3KD2A 3S2EA 3ED5A 2OXCA 3PEVA 1RLJA 4G3XA 1DB3A 3AUXA 3JWJA 1XE3A 4YCAA 1G8AA 3X1XA 2R9VA 1KAMA 4WACA 3C0KA 5D86A 2FZVA 4BATA 1ADYA 4P5PA 4NTZA 1NE2A 4Y0NA 4TN1A 3V4LA 3Q8WA 2KPOA 2ERYA 1NQUA 1GHTA 4UJ5A 3GFPA 1E3WB 3EODA 1QRTA 4OHUA 1CEXA 2R6HA 2H07A 4MQBA 2B35A 2ZTUA 2YRXA 3QEJA 1GCGA 3AK4A 4FDUA 3RE1A 3TFQA 4YUXA 5BMVA 3RQIA 3SJZA 4ESOA 5HQ3B 2ZVDA 3DS8A 1FXWA 3PUYA 4N8SA 4OHMA 1A2KC 1PCXA 1BOFA 2V54A 3FOAA 3HBNA 2P1RA 3PEFA 4QUAA 2ZJ0A 2QVCA 3VNVA 1U3UA 1PX0A 2ATIA 2SECE 3EZXA 4JBYA 4DSUA 1ISSA 3C85A 3QU7A 2EEPA 2OXEA 5DGIA 5EE0A 3U3JA 3VJLA 5HVNA 4B83A 1KP3A 4LMRA 3E1GA 4G63A 3JQFC 4AWAA 3FDJA 4IQ8A 2B7CA 5JQGF 1Z4PX 4IP0A 4YV1A 2RG1A 3AEQB 1NJ2A 1AMUA 1R0BA 4CMCA 1ZD3A 2H1SA 3HADA 4ETWA 4C20A 1E3IA 2JIBA 4GZ3A 5JS2A 3U1BA 1GPH1 2Y1FA 2WTNA 3OZDA 2G8NA 4ZVSA 4PCUA 5JFGA 4PG7A 3ZV7A 2IZ7A 4QT0A 1XWWA 1NRJB 4ZI7F 1TM5E 5JWRA 3DR3A 2DG2A 1T8WA 1PJBA 5KI6A 4C0BA 1HEYA 4D9KA 3MJDA 1AKUA 2B21A 3U40A 5J43A 3EBPA 1QZXA 2FR1A 4U6SA 5ER6A 3VHRA 1RYNA 1L7DA 1WMEA 1YQEA 3TEMA 5BWOA 3AJAA 4MW1A 3PCTA 3RYCA 3AF0A 1R9GA 3PXUA 2CJPA 3MCWA 3LXRA 4K9SA 1ZGGA 4DCSA 3MYYA 2RHCA 3OT1A 1XA3A 1WNTA 1QO7A 4MV1A 5E2IA 2C7GA 3FWZA 5HK9A 4U5XA 2PQ0A 4LX0A 3JAKA 3NLLA 1U99A 3GX1A 2OEPA 1GPLA 1QKJA 5DGDA 5A4MS 2ENWA 3WL3A 3K6JA 3IUBA 3X1WA 1SIOA 1Q17A 3LWNA 1H2YA 4L1KA 4LJ8A 5ALUA 3BFJA 4GRIA 3ELWA 5AK5A 5DNVA 2X1HA 5JNTA 2F3TA 1GGKA 2Y77A 1EP9A 1NRXA 4WWHA 4HWPA 4JT9A 3L18A 2QX6A 1ISIA 2V9ZA 1IJBA 1Y6RA 1Z3IX 4RAOA 3VSEA 3K9CA 4W5JA 1U31A 4FKMA 3NIFB 5DNCA 3AY3A 4TKLA 5AKYA 3GEIA 1PZXA 2OV2A 2VHUA 4EA6A 3SDSA 1PG5A 2YFYA 1Q3HA 2WSLA 3C1TA 4ZIRB 5IWCA 2UVPA 4RKFA 2O2ZA 4HNRA 4MS4A 1PLKA 5CFPA 2OO5A 1PFUA 3DUFB 4FSXA 4DIEA 4RD1A 1K06A 1IL0A 5E6SB 5IUKC 2C9MA 3WSWA 1H6DA 2QYOA 4LYYA 3RPEA 3DEKA 3L1KA 2RH5A 2BBWA 1SD2A 2EL9A 2FX3A 2OILA 3BL5A 4FR0A 2HAEA 4HSGA 4HXFB 4BLUA 1OYWA 5I9NA 1ABBA 4M0DA 4XM2A 5TQ2A 3THRA 1HQDA 4IDGA 1GRCA 3Q5GA 1P1FA 5EJ2A 3JARB 2JLBA 4IEFB 2QTMA 4RENA 5DOVA 2IKSA 3ELYA 3ESCA 1KKMA 4M1QA 2YUIA 1ZIDA 1Q1BA 3HYCA 5I5EA 1U2GA 1A4UA 1ZN8A 4ZVPA 1LK7A 4M9ZA 3V8RA 3OF2A 3K8YA 1NTOA 2OGZA 3I30X 3ZU6A 2GCIA 1Z63A 4PZ9A 3JYNA 1C41A 4OXNA 4ENRA 3ADOA 4FILA 1FFDA 5JHGB 5K8LA 1JDVA 2XI4A 4JASB 4PGFA 4X85A 3CUWA 3UXHA 2FY8A 2UZ1A 5HCIA 2VYQA 3FSGD 1T1EA 3TX2A 1OZ0A 2WWXA 3CLUD 2O19A 5KTKA 2HHHB 1EK6A 4UM7A 3TF5A 2XKKA 2B36A 3MIIA 3QEMB 4WY2A 4Y6QA 2Y92A 4HDMA 5KQPA 2GM3A 4L5AA 1M2HA 1NQTA 4C7KA 5HSGA 3ERCA 2OO5C 5FFNA 2CJWB 5K9ZA 2XBUA 4CM7A 3HKEA 2QZPA 2K7ZA 4LRTB 5THQA 4X84A 1W5EA 2JFZA 4DLUA 2R87A 1SH7A 1YB7A 2E4WA 3EJ6A 1Y8ZA 1F12A 1DEAA 3OTGA 1A95A 3TTTA 1ANKA 2W6ID 3CV3A 1SC4A 2AT1A 3NPAA 3HCWA 4HNGA 4DVGA 1JAZA 3ZD8A 4XPIB 1F0KA 3E7WA 2YJ5A 3T4XA 4RCYA 3TINA 1OJLA 2DFVA 4BO8A 2UYOA 3SLGA 1XZQA 1ZCFA 5CVJA 1DC4A 1MO4A 1U2GC 4DUGA 4BZPA 2WWFA 4KBYA 2P2DA 2IPNA 2Y4OA 3B82A 4YY3B 3K8QA 1S2IA 1RZ3A 1P18A 5LP6A 3IEMA 3R3XA 3B12A 4JXJA 3EFOB 4WCVA 4BAUA 2W98A 1YVDA 1H1DA 5DGTA 4Y2PA 4IL5A 3W05A 5L51A 3EHDA 3A26A 5IFKA 4YAKA 3THYB 3JZDA 1VB3A 4QPCA 1F0YA 4Q3BA 5DX8A 3QXSA 2C1EA 1CIJA 3FKSA 3AEXA 3I8OA 4YJFB 4RS3A 4XSGA 4WGFA 4X94A 2FUEA 1CY6A 1JIVA 3P19A 3TQQA 1MTZA 1POXA 4Z0TA 1RZVA 4B3BA 3FOFC 2ZQYA 4F86A 3EH1A 2V7XA 1PL6A 4HLUA 4PPFA 3KB1A 2C88A 4G65A 4MUIA 1C0KA 1RBQA 3MTQA 3QIAA 4A26A 1L8XA 1SVLA 1CUFA 1A82A 5DK6A 4NCKA 4M1YA 4MZXA 3NRCA 5AWFC 5THXA 721PA 2XEXA 3VVLA 1Z8HA 2FXIA 4G25A 1TGVA 1MOPA 2B7LA 2FEKA 1RPJA 3Q0TA 4ZU1X 2Q9UA 5ES4B 1ZICA 1GZVA 1FB5A 1L5SA 3RSLA 2Z9CA 4DY6A 1T8PA 3PFNA 1C8BA 2HQBA 2XMSA 3L01A 4OI4A 3C6YA 5FOXA 2PWBA 1E0JA 4KQIA 4J0GA 1DDIA 1OYOA 4BQRA 2HPHA 1EVZA 3BMOB 2ATCA 3IBCA 4H08A 5AUNB 2VF4X 1AHIA 3E81A 3KM0A 4C29A 3D2BA 2UYHA 1PZFA 4UCXA 2BKLA 3BGDA 4IRUB 5FTLA 2I4OA 5LP6C 1FMJA 1N2SA 3G5LA 3WISA 4FYWA 1QYXA 3GA5A 2ZI4A 3RTBA 3TRKA 1EXMA 2HWUA 4Z3DA 4EY3A 5DM70 5E8JA 3IEPA 2JIZA 1W4AA 1V3QE 2XAUA 2C7BA 2XODA 1ACLA 1GU7A 1K8YB 1BKYA 2WJGA 4IDBA 3INRA 4OQMA 4EF6A 4EKNB 1WBJB 4ZMBA 4NJEB 4W7HA 2DY1A 1CV2A 4LE1A 2E6KA 4FT2A 5BYJA 3D2CA 1NSTA 1T91A 2FZ4A 2CK3D 3EGXA 4LZPA 4Q5IA 3ACBA 1XQXA 4N5DA 5U4QA 4URUR 1CG6A 4HDSA 1I0ZA 4HLUC 1JXMA 3PDWA 4B6JA 5IZCA 3GNTA 4AN1A 1I2MA 4KREA 1JIUA 2G7ZA 1PTKA 2V74B 2WV9A 3OOYA 4IV8A 2R85A 3R3YA 1R15A 5F7JA 4F11A 5KNLA 2I71A 4UEWA 3L46A 4LWQA 2WK1A 1NVAA 1TJYA 2ZIXA 4WT7A 4EVSA 1U7HA 5K0SA 3W5DA 5LSAA 3T9CA 4RTJA 3Q1LA 3RLIA 4CMEA 4DQKA 4YAEA 1MT0A 3RVQA 7ADHA 2YJ6A 3UMJA 3SPXA 4V03A 3QA3E 4JQZA 4RADA 4IZ6A 4Z4FA 1CJMA 5DHAA 1QB7A 4BRWA 4D8TA 2EBUA 1JHXA 3ITDA 5CRIA 1RJFA 1G7SA 1HTWA 2V55B 1ZCJA 3VX4A 2EHJA 3LTNC 2RSLA 2YWGA 5EVJA 4RVNA 3TH5A 4RTOA 2C0QA 4FYYA 3PSHA 1M0TA 4FFRA 4MAMA 4ZWNA 1UPXA 1FLDA 3PFCA 4WNIA 4PTLA 1BXGA 2FPSA 4JLKA 4F4DA 1ZKMA 2V8BA 1A98A 1UINA 2IPMA 3PC6A 1MTOA 3PR2B 5A2QA 1EYZA 4CTOA 5TV2A 3S8MA 3VPXA 3CIOA 2HKIA 3F1LA 2VL7A 4HX5A 5EIXA 3LCCA 3RB8A 1O2DA 1H2AS 3AFHA 4HOYA 2IPOA 2QLLA 1YS7A 4L0CA 3AVOA 3QXXA 4Q4JA 3TAXA 3ZY3A 1XVAA 3I34X 4B6SA 1XZNA 2LNDA 2W2KB 3LW7A 5IZCC 1VPLA 2AB0A 4ZQHA 5C52B 4Q66C 2CHUA 1XN4A 2IUYA 2P6OA 1N8SA 1L1QA 2REQA 4DYVA 1MZPA 4NICA 4W82A 5J2TA 2CNLA 4YJ2B 2G08A 2W8ZA 3FHCB 5AR1A 4DMFA 5K8CA 1ETHA 4HATA 2B1JA 3WSVA 4EGSA 1GNVA 5HXAA 3S2UA 1TJNA 1KU0A 4CMEC 4C2TA 4RHFA 3VOAA 1E2LA 2DTEA 1P73A 2O2HA 2HJGA 2JZOA 5FBQB 5ES3A 1KPIA 3C5HA 2BGJA 4W5OA 4OYYA 4EPWA 3IODA 5IW8A 4YT8A 1KXZA 2NUAA 4QOEA 3ZX5A 2GMWA 3AKDA 1OIWA 1YMUA 3WWOA 2OC4A 4OBEA 4PEVA 3ICQB 3CVOA 5FUVA 3DWGA 5AUOB 3FUXA 4RIGA 3PNBA 1M2VA 2P3LA 2VSFA 3CTMA 1TYEB 3P9NA 4D97A 4RDHA 1FYVA 3ETEA 3OA2A 5EJ4A 1X7XA 1Y9AA 1GYRA 1R6UA 2ID9A 5HKLA 1RHKA 1M6NA 1OFIA 4BN0A 1FYDA 2P0AA 5B6IA 2VQ6A 5C5CA 2D8AA 4A16A 1Q11A 1V48A 1MA0A 1R18A 3HXKA 3ESDA 4JJ7A 1WZ2A 1D2RA 5IDQA 5G02A 3A3YA 3AR7A 4QTZA 5I3ZA 1TAQA 2NX2A 4W63A 3LC2O 2LCIA 2IODA 2VDPB 3SC2A 1PQUA 3ORQA 2WJYA 2FX5A 2XCQA 3EVTA 4FSHA 2G0AA 2O07A 1KSHA 3ZNQA 4UUPA 4US0R 3V4ZA 4YMVA 4BFVA 1FP6A 2FWIA 1B6SA 1Z4MA 2BLNA 1BJTA 2CHEA 2W2TA 4ESVA 2R4QA 2ZSDA 2PZJA 3DBIA 4GOMD 4KI0A 1RJ9A 3P52A 3SC3A 1V1RA 4GT1A 5BUSA 2LVBA 1D8TA 3G8BA 2XMBA 5CMLA 3RU7A 2R3SA 4C3OB 1JNXX 2C3PA 2F67A 1Y5IA 1L5MA 1T3HA 2Q5FA 2ID4A 4RELA 3JX9A 3VKFA 3WGGA 2HSJA 4FFOA 3IP3A 4OQDA 3AR4A 5EFZA 4MKGA 4ZVOA 3HYRA 3QQ5A 2AC2A 4YJ3B 1SG0A 2QU7A 4BLTA 3AHCA 5MN6A 1CYEA 1S6YA 3ZE2B 2QQ5A 1E4EB 3CKMA 2PL3A 1VE1A 1RRKA 4UXHA 1YZTA 1Z2AA 3EK2A 4HDNB 1UC4B 5FIUA 4BPRA 2O5CA 1NVVR 2QUIA 4NS1A 1HA3A 4OYHA 1RVV1 1UCFA 3EW7A 3T3MB 2CKDA 4ARZA 4D3FA 2NSJA 3TR5A 2Y67A 4ZT7A 2R60A 5J5CA 4D4MA 5FV4A 4BV9A 4EAAA 3ZJTA 2N47A 5KOYA 1ZOLA 1AOXA 3S99A 1TA4A 1RM5A 1YAHA 1VP3A 2Q3HA 2R47A 2PX0A 2C4KA 1FFWA 3KTAA 4X00A 5HKBA 2OCAA 1A1VA 4CKXA 4BQIA 1EUCB 3CJTA 3USZA 4UQLA 5HKKD 3Q3GE 4J4TA 2RCYA 2ZSBA 1KAOA 4OCZA 1TCCA 5FBVB 3A2MA 3IVRA 1DT3A 1FP4A 2R68A 1T8SA 4URYR 4ECEA 4EKYA 2RJOA 3UOWA 4PYRA 5FA8A 3ZY6A 3HCEA 2AS0A 5IBCA 5JAHA 2FDXA 3DOCA 2LE0A 4FE4A 1UXGA 3OKFA 4GYJA 1E79D 2DP4E 4HVLA 3VOTA 1C9YA 1KIAA 2NUPB 1C0IA 4YYEA 4FMPA 2ZJOA 2SKDA 2NM0A 2NQ2C 1Y3FE 5JVDA 4B4KA 3UHJA 1N2XA 4FOTA 2PT6A 4Q1FA 1Q7TA 1VJRA 2NU6A 4DLBA 5BN4A 4DIKA 4MVWA 4RZUA 2G76A 4G8JA 2PBRA 3PHIA 3FLMA 3DC2A 1YRQA 4A0FA 3DVAA 1NBOA 4BNUA 2NU8A 4MGEA 1R8QA 1CQWA 4FGWA 4NBUA 4Y0AA 1FW6A 5I45A 4ZVMA 2V7VA 1Z6ZA 3H1FA 3KTOA 3NYWA 3BTOA 3GT7A 3P94A 2J0UB 1D7AA 1LV8A 1SKBA 3L79A 1G291 4R1MA 4WXMA 3OQMA 1M83A 1N1EA 2BI7A 1QOZA 3ZBUA 5AVVA 4OHKA 2AHOA 1Q20A 3IQGX 5FTKA 4FXOA 4EVQA 2WHQA 2RHBA 5IJZA 5F7XA 2ZRLA 1H8HD 1E1QD 4EG0A 4GRAA 2PFKA 3GFRA 1A9SA 4HNAA 1XT6A 2IZZA 2ZCUA 1DCKA 1X8KA 5EMLA 2J5BA 2C99A 5BSWA 2BFFB 2Q5CA 2ZVPX 4C2UA 2EJVA 4ZO6A 3O4RA 1YONA 4XWAA 1P4RA 1FYEA 3DDHA 4RMNA 1SUBA 2CF6A 3B3JA 3HXMA 3CZ4A 3HKBB 1XV5A 3EVAA 2IU0A 4NQRA 3HACA 2X6RA 5BVGB 4EW6A 3EAQA 3N07A 1ULBA 2C61A 2ECOA 3K96A 1C0EA 1KK1A 1XJQA 2R6R1 5F21A 2A84A 4JI3B 5B55A 2X2FA 2JAHA 4GI5A 3UA4A 4WMLA 4UTOA 5K0JA 4X6UA 1AKWA 1Q74A 1LFDB 3KBOA 1XCJA 3B70A 3GLHB 4P3YA 3U4MA 3F7NA 3GDWA 1Z6YA 2YQ4A 4DSTA 1DL5A 2FG5A 5KJFA 3AR9A 3K0AA 3NXSA 3DHYA 4EI9A 3U3XA 1OXVA 2L42A 1N9ZA 2X2PA 4XR9A 3BZUA 3UK2A 1MDBA 1JDTA 1L7EA 2QW0X 3GVXA 3H5NA 3IYLW 4HVTA 4CHTA 4DLNA 5NULA 1XXHB 2BBSA 2Q5QA 4Y6PA 3F7MA 4TT3A 2OWDA 2QTBA 3LHDA 1Y80A 3PWSA 4QOGA 1RE1A 4LBWA 3OZTA 5K45A 3LXUX 5CLHA 8ATCA 3ENKA 3T9EA 1E8DA 3WZLA 1GFSA 1PSZA 2Q7XA 2C8LA 2ZAIA 4IF6A 4J49A 1GZSA 3OT4A 3DT9A 4OHRA 2RKOA 1KYQA 1KK2A 3A9RA 2K7FA 3IP8A 3ZUPA 1NM5A 2O8DA 2YJNA 1N33B 1L7NA 1PZMA 1SGWA 3EUFA 1NZFA 1PJ3A 3ZJUA 4LXGA 3VZPA 3ZI0A 4OMCA 3W06A 4NZNA 4KZPA 5TEWA 1XVUA 3PA6A 3UB2A 1JS1X 3M70A 4C0AC 3JYPA 2NVWA 1DWOA 4PR3A 1NUTA 5LOVA 2AL7A 1UT6A 2IEYA 4TMTA 3RJZA 1XZJA 2JBAA 4BRUA 1FNNA 3AUYA 2ESRA 3Q3HA 3ZCVA 2BKEA 2X1LA 1XTSA 4N6NA 3ZPXA 4HWGA 3PGLA 1GXSA 4J0JA 1VHJA 2X3YA 3H6HA 4DCMA 2B3TA 3GEMA 1K97A 4L5IA 4ECAA 1KPGA 1TO2E 1Y7IA 3IUQA 2C3MA 2IYRA 4LJSA 2P3QA 3UG6A 4LMPA 4X1IB 2WP0A 4BY9E 4LF9B 1VE3A 4EFLA 4JBGA 4WINA 4V0OA 3AY6A 2HT6A 1K7EB 4H6VA 3LXXA 3CZPA 4H3KB 4M1EA 3JCZA 3TE6A 4E5UA 1ZUD1 4RY8A 4E2WA 3TAUA 4IG4A 4KOEC 5F2NA 3TRDA 1UAGA 4R0VA 2D0PB 1YBVA 2GVZC 5IKOA 5SY9A 3RT1A 4BFCA 5C2JB 4JA0A 3BTUA 1F2TA 2XMQA 2BW0A 2DWQA 2IIVA 3KHSA 1QHEA 4H15A 4BP3A 3V4VB 1T35A 4FFMA 1K3UB 2H65A 4B7XA 3MMNA 2LDBA 1QO9A 3SIRA 1TDJA 1JUDA 4IM7A 5BP7A 1JKJB 3RODA 1FC0A 1O0BA 3BFKA 3U26A 2A9KA 1NM5C 2KX7A 4L22A 2VA8A 1SURA 3KSDO 3A4NA 3CEMA 5JZ9A 3N1UA 3R40A 1PF7E 4G1VA 3NTOA 1HMYA 2FEXA 1SIUA 2PKEA 2WAXA 4HRAA 1WPGA 4HS9A 1MC1A 1JMYA 1LLQA 3ZQ4A 4JXZA 3MT9A 4QLOA 4HNQA 2XBLA 3IKMB 4BKOA 2W4MA 3E5RA 2PJRA 3DHNA 2BMFA 2IYQA 3B5EA 1TCVA 3M2TA 1XZIA 4H7PA 2ON6A 4GLFA 1QB8A 3H86A 1TYZA 5LDHA 5JSFA 5DP2A 5IBQA 2E4VA 4I08A 5AI9A 3H0KA 1GL7A 1II9A 2MYUA 1G8KA 1IBSA 4TYYA 3DZGA 3UWKA 1L8LA 1U02A 4FU0A 1R8JA 1JH8A 2YJZA 2VCEA 1Z0KA 5JS8A 4IJ5A 4MKRA 5JAOA 3I9KA 3ZLJA 1BROA 4LHYA 3RYHA 1QRRA 2VTBB 5IDVA 3B3AA 1J2JA 1ZK4A 3AKCA 3I8XA 4PCLA 3RFXA 3TYXA 4AJNA 4CQMD 1Z0AA 3E9MA 5D85A 3ZLUA 4RPCA 4EHIA 2O2SA 3BA6A 1YJXA 3TWOA 3OPYB 3BRWA 1NLMA 3QELA 4BMOB 3CPSA 2QT0A 2FZKA 2TMGA 4ZO8A 4Q7LA 1O0CA 3GLGB 5EP3A 1BA3A 4IJMA 1TMKA 1UEXC 2R8PA 3D31A 4F3TA 4FVTA 4KITB 4MKHA 4NABA 5CB4F 2UDPA 2WKRA 3TSCA 2XGMA 4D9EA 1XQ9A 4R6XA 1PE0A 4RTNA 2G9ZA 3FAZA 4GUDA 3I1JA 1Z38A 1E0AA 2JDIA 2CHQA 3LZCA 3U48A 2IHUA 4EMUA 1AX9A 3GU3A 2R7AA 2YN2A 5BQXA 3RFCA 2HUNA 1F6BA 4WKNA 5HKKA 4DY4A 4KVAA 4P7FA 5KNBD 2OECA 2VWPA 2ZE5A 1NNUA 3P20A 4Q6BA 4PX5A 1QHYA 4TV9F 4P93A 3I05A 2QTGA 2DFPA 2AK2A 2ZAGA 3DMYA 4EWLA 3LYHA 2FWAA 4KQMA 1N5LA 5CU7A 3MTDA 1SHTX 3IEKA 4KN5A 4CUZA 2CVOA 1OX4B 4F5ZA 4S1OA 4BNTA 2ID8A 4D3SA 4E5SA 1ZI9A 4DMCA 2Q1UA 1WDLA 4YMUA 3WIDA 2C42A 2AJDA 5F12A 4MVJI 5D7BA 4YXWA 3NONA 3OH8A 4XUCA 3MT8A 1L7VC 4BP9A 1H1LB 1B2LA 1YR2A 3EULA 1Y33E 4C89A 3DG9A 3R9XA 1LJLA 1AVTA 4EQ6A 1OB2A 1E1RA 5I5GA 4HGOA 1TFUA 3MGBA 1Z7WA 2WU0A 2YFQA 2DTDA 3DXXA 2EIHA 1BH2A 4BIIA 2M1XA 3RHSA 3BGWA 2WJVA 3IAFA 2AR7A 3I1FA 1WZIA 3HRIA 2CFTA 1N8TA 1UAYA 2DERA 5DZSA 2HRCA 2O5EA 2B1QA 2V1XA 2W2VA 3L8FA 4RVCA 1N2CE 1NV8A 1PTJA 3UUWA 2OBXA 5DXAA 4TTIA 2JGKA 3EXEB 4MTCA 4UD6A 3FTDA 1CZUA 1NI5A 3EXFB 2ZI7A 4AZWA 4KPEC 2CNOA 1E2KA 4R2XA 3SHWA 1GVNB 3GRYA 2YYSA 2AJCA 3AMVA 3VU9B 2DQZA 1VE5A 3IH5A 4ZGBA 2F1IA 4ER5A 1DS6A 1VL1A 2RBGA 3BRQA 2GHRA 3ICPA 4TMWA 3BQMB 4NLLA 3IOBA 4ZT2A 1X7HA 1L7RA 2WIFA 2WQ7A 2FW1A 2NAFA 1BDJA 1GKLA 1N3LA 4LYDA 4PWYA 1UKEA 2FSSA 1BCSA 2GPJA 1NUSA 4NBVA 1QGAA 1JE1A 1C4OA 4YRLA 4OX9Y 2TMDA 3O9MA 1PGOA 4IIDA 5DO9A 4Z3KA 2OKGA 2CNDA 4HAVA 3I9JA 5LWHA 1PZEA 2NTEA 3LVFO 1CE8A 4GMXA 4I9FA 3V4SA 2YXLA 3L1UA 5C4GB 2EQBA 4OKNA 2PLFA 5BN3A 3LQ4A 1NUPA 2F8SA 1J0EA 2HDNB 3CJQA 4ALLA 1B0AA 2I6TA 3W1VA 2HNKA 3JQRA 3HN7A 3PV0A 2OBBA 1ZM3A 1I4DD 4CKYA 1RHUA 3LHFA 4P0QB 1ZRNA 1QIIA 3PF9A 4OBXA 3UMGA 1PTJC 5F3DA 3SIWA 1TLTA 1Y7HA 3WJAA 4JYAB 4HZUA 4P3PA 1JJAA 1QQ7A 2GPBA 1NMYA 1NVBA 1B73A 1XKXA 3HY6A 2OK7A 3KXLA 3MEQA 2QZ4A 3KUXA 1EWYA 3M33A 3BH0A 3H1BA 4D8WA 2TS1A 1ZK3A 1E3SA 1U1DA 2H16A 5GTDA 1NG1A 2J0VA 1UMBA 1K4KA 2HADA 2YICA 3G9ZA 3MQFA 3MS4A 4Y9RA 5G53C 3ZBPA 3RH0A 5JS6A 5ALPA 1NAHA 2NLOA 3M82A 1C1YA 3ZWOA 3GD5A 3ZV4A 5ALDA 3GGSA 5DTIA 4A9AA 5JZSA 4D02A 1A27A 5FH9A 3OQOA 1NATA 3ILYA 4NXMB 1HKUA 3V1LA 3NTUA 1RHMA 3F5QA 4GPIB 1K9SA 2JEOA 3CN9A 2P2NA 3BL6A 3R6GA 3JZFA 3KXDA 3WDSA 3O7MA 4X1KB 3K9QO 2F48A 4R41A 4XDGA 4I46A 4W9MC 1L1RA 4GBGA 4X6XA 5K3FA 5K2MA 1WVMA 3S1SA 1MRSA 4JR2A 4KEAA 5KYXA 4QRHA 1OFHA 1FP7A 5IMBA 1X9GA 1X6VA 3Q9NA 3COPA 3DXYA 3H75A 4ZANA 3MM4A 3N87A 5I9SA 4J7UA 4AY5A 5FAKA 4CE6A 5HPYB 1P5ZB 1SKYE 4IHJF 1U3FA 3JAWB 4JCCA 4MP8A 4PN3A 3G7UA 1F60A 2CMFA 4HRXA 4QFMA 4QEKA 2NZUG 1DO2A 1ZL0A 4I1UA 2YXDA 4PF1A 1HNZB 4BO0A 1XAIA 4II2A 3WGLA 4ESHA 4PC2A 1EVEA