1S1CA

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s1cA00
1E1RD 3C15C 2RGAA 2YV5A 2H16A 1L4YA 1XEXA 4BECA 2G3YA 2GVDC 3BB4A 1F2TB 4E07A 2IS1A 2D7DA 2PX0A 4EUNA 4HLUC 2QG6A 1TTTA 1QBKC 1RJ9A 3IBYA 2XOKD 3QIAA 1SULA 3KL4A 3CUEF 1YZGA 1N6KA 2PZFA 3UWKA 2REXB 4L9WA 4BLTA 1E2QA 2PJZA 2JJ2A 4JVLA 1NLFA 1BKDR 2OFWA 3ZVLA 4XWOA 4FMDB 1HE8B 4LJ9A 1ZCAA 3LFUA 4GOKA 4N1AA 2GESA 4E22A 1G8FA 1OHHD 2C8VA 2CCKA 2CL6X 2G1KA 4C2UA 1ZBDA 2Z83A 1FP7A 1US8B 3AF2A 2XJ9A 5BXQC 3A1SA 4FWIB 4Q1DA 4CYMA 1G9XA 3FKQA 1E69A 2YOHA 1W0KD 4JLKA 4NKRA 4ASUA 4NP6A 3M6AA 2YC2C 1Z06A 3N2IA 4YMWA 1KI6B 4V0OA 4PC1A 4WVFA 2C77A 1G7SA 5CYOA 1J2JA 4TYNA 1M2OB 2WJGA 3ZDQA 2JJ2D 2PH1A 2DFLA 4OI1A 1XEXB 3H86A 1SKQA 3BD9A 5IF9A 1W5TA 1QHGA 2WICA 2RAPA 2J46A 5FPHA 1E79D 1MO3A 3MCAA 2FX3A 1FMJA 3OAAA 3GD7A 2CBZA 5EE1A 2QMHA 1YRBA 5DH9A 1RJ9B 4QJ5A 2ZYTX 1R2QA 1U9IC 3THOA 5BN5A 1E4VA 2HV8A 1JNYA 2WJHA 1PZNA 4Z1MA 4ASUD 2VA8A 1JR6A 3KXKA 2AL7A 4IJMA 4TMVA 4D4JA 1G3UA 4Q00A 5KSOA 2XGJA 2OAP1 1E2HA 1XPRA 1ZINA 2ERXA 4M1KA 3TR5A 3EPJA 5TV2A 1XMJA 4TYYA 1VMAA 3EC1A 1G21E 1E0SA 3P26A 5FL7A 5GVRA 2HJVA 2GWHA 2BHRA 1NF3A 1NRJB 3BE4A 3B82A 4TL7A 1VCIA 1XD2B 3GLHE 4Q7JB 3I5XA 2V54A 3BH0A 2UKDA 4B2IA 1OV4A 2BM1A 4B76A 1FFHA 5GADl 1W36D 3IHLA 3N70A 3LLMA 4Z1MD 4BPBA 2J0SA 4YMUA 4QOSA 3CZQA 3BOSA 4A0GA 2OSBA 3RRNA 4MRPA 5JLJA 4OK6A 2ODWA 4A2WA 5JZVA 3FGNA 3E2IA 1E9CA 3DMDA 4JYCA 4JJZA 3K0SA 3MFYA 3T5DA 3U6BA 3M4YA 5AUOB 3LDAA 5KHOC 1YR6A 2A5FA 1G1MA 1CIPA 2R9VA 2QUZA 3A58B 2QBYA 2XZOA 1W36B 1X3SA 5BQ5A 1CKEA 4M1TA 4BASA 3RS5A 4WZAE 3O47A 3B1WA 4TL6A 4TN1A 2I1QA 1E2FA 1UBFA 4POAA 1QZXA 2AK3A 4C0LA 1I4TD 4JL8A 3VNUA 1AJEA 4RZ3A 2JASA 2OXRA 3TKLA 4C7OA 1PUJA 3J81k 1Z6TA 2VRWA 3TJZA 3IKJA 3CO5A 1UM8A 2A5GA 2C9CA 1G3MA 1VTKA 2Q21A 2W00A 4LHWA 5EZ6B 1P2VA 1N0WA 2YC4C 4LYHA 2NZJA 4PX9A 1HUQA 1GVNB 3I8XA 2OZEA 1N5JA 3GJ3A 2OV2A 3SYNA 4TZ0A 2BJVA 3GQBA 2GCNA 2HXYA 1CF4A 3BFXA 2C2HA 4FMBB 4HAZA 4ZCMA 3KQKA 4O2RA 2V4ZA 3PENA 5DI9A 3IO3A 4NPHA 4I1UA 2GJSA 4Q5IA 3BRWD 3KJEA 1RYHA 4J0QA 4NMMA 2ODBA 3CX7A 5KNBA 2QBYB 4Q9LA 4LHZA 1R7RA 4B32A 4PXAA 1WB9A 4RD0A 4YONB 1S96A 3CNNA 2QL6A 3PJRA 4PHFA 3AVUA 4KV9A 2XB4A 3NWJA 3QSYA 2GAOA 1OB5A 1OLOA 3FKSD 4V0KA 2EVWX 1FZQA 3KJHA 2WAXA 1T8TA 3U61B 1TF2A 3HR8A 4PR0A 4KSBA 3D6TB 5TB5A 4GOJA 2KJQA 3QXXA 3SYKA 2YHSA 1DAEA 3DM5A 3L0PA 5BYKA 5J4HA 4C7OB 1G5TA 1XJCA 1KO7A 4PTLA 2AR7A 3TR0A 3KZ1E 3ZS9A 4MGYR 5TDHA 4TLCA 5KNCA 3AVPA 1ZRHA 4XH9B 2FZ4A 2QTVB 4DSNA 1XWIA 5KSPA 2ZVQX 1Q1BA 1XF9A 1KGDA 1N6IA 3I8SA 5AJWA 4OQLA 2BM0A 1MABA 2H18A 1N6NA 2NGRA 5K8IA 3T1TA 2ZM5A 3A6PC 1GKUB 4LBZA 2BDTA 5E95A 2J0UA 5FBQB 5EXTA 1E99A 1XRJA 3MRSA 4DDTA 5EE3A 4P32A 2ZRNA 4M9XA 4WXPA 1XXHA 3MWKA 1A2KC 4W5WA 3PQCA 1X8KA 4LJ7A 2O52A 4JVMA 2EFCB 3L0OA 1L7VC 3IUYA 2XEXA 3VX4A 1XTKA 2OAQ1 3VR1A 4AKIA 4ARZA 1OXVA 4BFSA 3AVWA 1MT0A 4URZR 5CM9C 1C9KA 1O87A 5J40A 2WJVA 3H4MA 5D3QA 4M2LA 2J7KA 3ZZTA 3K9NA 2Q6TA 4Q4HA 3U7HB 2BVNA 1NY6A 4LOAA 3ZJYA 3TH5A 5FTLA 4GSYA 421PA 3VR4A 1G7CA 2YVUA 3OIUA 2AXNA 5KOYA 5TMPA 3V4RA 1W0JD 1E1QD 4WZBE 4A4DA 3TQFA 5SZKB 3CWZA 5E4FA 1RE0A 3ZIAA 4OI0A 4MGKR 1U81A 4EPRA 2SHKA 4MKFA 2EFEB 2VP6A 1IJFA 2YWFA 3KXIA 4US2R 3KQHA 4ITRC 1MABB 1TADA 2HLDA 1P2TA 3UXMA 2JLWA 2JEOA 3JVUA 1TQDA 4NYIR 2F3TA 1TEVA 2WWGA 2J0UB 1F3OA 2H7VA 5FOWA 2OO7A 2ZITA 3LLUA 1CR0A 1D8TA 1ZC4A 2QSZA 2WV9A 2XZPA 4P33A 4JL6A 2GBLA 4PPNA 3QF4B 1XXHB 4OHWA 1ZM7A 1XX6A 4HZUB 5FOSA 1Z28A 3KFVA 3EZ2A 1YVDA 1OXUA 4PO8A 4EPVA 4AY2A 1OJLA 1U8YA 1CR1A 3SN6A 2W6JD 2OM2A 3P27A 3I3SR 4A8JC 5HR5A 1S1MA 3ASYA 1YE8A 2G77B 4KHZA 2JLVA 3DKVA 3IIKA 2RMKA 1XFAA 1LF0A 5IRCD 2CLSA 2ZAOA 4Q4JB 1YR9A 3KKNA 4UNPA 2WJIA 1G64A 2X77A 3EX7C 5A4JA 4QFMA 3R7WA 2ZS7A 2VP9A 2OBLA 1XCGB 1GUAA 4HB4A 1R0WA 3B78A 4OHZA 1G19A 1EXMA 1E96A 4B71A 2O8EA 1CBUA 3CF6R 3X2SA 1YQTA 4BWYA 4US1R 4DT1B 1OE0A 2FV8A 3CW2A 3PIRA 5GJBA 2F9MA 2YNMA 3Q3JB 2IUTA 3EZFA 5E7JA 4MA4A 5EXSA 4M53A 5JHGB 3PUVA 4DZZA 3FMPB 3DZ8A 1G6HA 1NBME 4R71A 3DHWC 1VHTA 4B48A 2ZJBA 3VKHA 5B58C 2RGGA 4Q1BA 3MSXA 1Y3AA 2OFXA 5KO2A 1HQYE 4M0LA 1DPFA 1T91A 2OUKA 1QRAA 2IYLD 2QA5A 3CBQA 5DNYB 4IFEA 1GRNA 3OIVA 5EP2A 2QQEA 3AV0B 2W83A 4P31A 1OH8A 2REBA 2RGEA 4P4UA 1IBRA 1I2DA 1E3MA 2GTPA 1G4AE 4A6XA 2GZAA 1DE0A 2GZDA 3NC1C 2JJ8A 4AG5A 3TIFA 2ZJ2A 2WOOA 4G0NA 3O8CA 2AN9A 4CRWB 2ZI7A 2XX3A 3G5UA 3MWYW 3KTAA 4QBIA 3R7WB 2AD1A 4PHHA 4WBSA 4JVSB 3IEVA 4BFZA 1AM4D 1MH1A 2VLIA 2GF0A 4LV8B 4RFSA 4TMXA 3PUWA 5FOXA 2O8EB 4KYIB 3BJIC 4BFTA 3QPWA 5AK0A 2ZI3A 3K0EA 5CK4A 1X8JA 3DO6A 2YKGA 3F5FA 2ODEA 4V0NA 2FFQA 3T1OA 5L3SA 1ZM9A 1FNNA 4HLUA 1FP6A 521PA 3QEOA 4PQYA 3RS7A 4TWZA 5HCIA 3B1ZA 3HJNA 5L8VA 3QF7A 2CL0X 1OXTA 3F8TA 2B6HA 1WF3A 5FOUA 3OEEA 4HDOB 5FOVA 1IQPA 2JJ1A 3NVAA 2CDNA 4IKEA 2I4IA 1OFHA 1MO5A 1P61B 3FHCB 2FGJA 5TXGA 1UDXA 4R2IA 5EE9A 4WW0A 1KNQA 1R5BA 3QQ5A 4W5JA 4PSKA 5JI2E 5JWOA 1X8LA 5BW8A 4LHXA 3PFIA 4B44A 5F9FA 3REFA 4QHYA 1CJKC 3EIHA 4MYHA 3OEHD 1WRBA 3QXSA 4JLVA 4C0BA 4FMCF 2UZIR 4FIDA 3NHAA 4ZDKA 1QHXA 2V9PA 1BH2A 3KB2A 4N0DA 3KTAB 4JBWA 4EFLA 1WBBA 1CJUC 2I1VB 2Z0MA 1J90A 1N25A 4RFSB 4II7A 3SEAA 2RB4A 1YZUA 1OH7A 2AKYA 1ANKA 1W4BA 2RGBA 3RAPR 4ZV4A 3CPEA 4TTRA 4GT1A 2GEDA 2HF8A 4FMCB 4WAUA 4BUJA 3R8FA 4C0QC 1E9SA 3W34A 5L3SB 1U90A 5BN4A 5LDDC 1SXJC 4DCNA 1A82A 2A5DA 4PQRA 1E2LA 1U9IA 4IFBA 1KK0A 3KQNA 4PC3A 3FB4A 5KU1A 3S1AA 5KPDA 4LPSA 4IVRA 3EIQA 4XVUA 1NSTA 5EP4A 3GFTA 3RSOA 2QAJA 1GITA 1VG1A 2OEPA 4KBFA 4OK5A 4A2QA 2LKDA 1AGPA 5DN6D 2ASEA 4LPKA 2DFNA 4PZZA 1SKYE 2J5XA 3DVLA 1L2TA 2FNAA 4HAXA 1PUIA 3EA0A 1ZD8A 4KAXA 3KUDA 2LCFA 1GIAA 2X19A 5CB8A 1MO4A 4JBXA 1RVDA 1R8QA 2BMFA 4B2PA 2IYRA 2FE4A 4HDQB 1P72A 5CLLA 3AKCA 3E70C 3T12A 3AP2A 1KK3A 5B64A 5LPNA 2VSXA 1O3YA 1XJ0A 3A4LA 3ZVMA 2ZQ5A 4PSAA 3HPRA 1KOFA 4RFVA 2QRZA 3DPUA 4DCSA 1B0UA 1QHHA 3VR2A 3AF3A 2N42A 1B23P 2XSZD 2VP0A 1JR3A 2VEDA 2LWIA 3QOFA 1YZKA 2F9LA 5CITA 3S1AB 1Z29A 2A9KA 3CRQA 4PZLA 1Q22A 2EFHB 4TLBA 4QJ3A 1SZPA 1GILA 3UMFA 3B8HA 1A7JA 2OCPA 4Q66C 3V4FA 5DLQC 3MAAC 2ATVA 2ZJ5A 1UKYA 3KKMA 2CVHA 3OF5A 4HYYA 5HKKA 4LBWA 3A8TA 4OI4A 4EKDA 4QM6A 5CK5A 1H8EA 3RRYA 1Q57A 4JYBA 4RD1A 3OE7A 3QKTA 3ZH9B 4AKGA 2CLCX 2FFAA 3D8BA 3TK1A 3A4MA 2IBMA 3GMTA 1Z2CA 4DLUA 3SDZA 3W6OA 4GMXA 4L5BA 2B21A 3L0SA 5LBIA 1KK1A 1GTVA 3MGCA 3WYAA 3GLIA 4X8HA 4PFSA 3BH6A 3QG1A 5B57C 4DJTA 1J8MF 4I99A 1KI3A 1NG9A 3IIJA 5HKKD 1G7RA 1QHHB 5M04A 2FA9A 4ZKDA 1QG2A 4QNRA 4CEIA 4CEHA 4DCTA 2FPKA 2CJWA 1H8ED 4EPYA 2WWHA 1DAMA 1GL6A 2WOJA 4AKEA 3PEUA 4Z8XA 4URVR 2QP3A 2R62A 4JT2A 4DLVA 3MD0A 5G41A 2D62A 2W2TA 1YHNA 4MGZR 3GLFE 1U99A 4FINA 4QGGA 4XJXA 3CRMA 2ZE8A 2OILA 3EAQA 1G291 4IXMA 3HU1A 5FPSA 1G17A 2GDJA 1N5LA 3BH7A 2P5SA 1Q21A 2Q3FA 1VCMA 3W3AA 1HV8A 1GP2A 5BWMA 2RGNC 1KO5A 5IHPA 1AS2A 4NBSA 4EFMA 4NCHA 3NHBA 2CCJA 1N6LA 1P73A 1TPZA 2WKQA 1PVOA 2AWNA 3QY0A 3X1DA 2OCYC 5E3HA 1CEEA 1P3JA 2ORWA 3P1JA 3WBKA 3BORA 4IDNA 2ZJ8A 4GP7A 2IUUA 4A2PA 4Q03A 4DIEA 3C16C 3AF4A 1VYTA 5J5CA 5EE5B 2QU8A 4YMTA 1E1RA 1Z83A 2XZLA 1LTQA 2IYTA 3LD9A 3QI2A 2ZUDA 4GZLA 4IEIA 4IXNA 1JI0A 4CEIB 4A6PA 1W49A 3TGPA 4NE2A 4CEHB 2WWYA 4RKEA 1TUEA 2D7CA 2PT7A 3QJYA 3RRZA 4UXIA 3WMFA 2R2AA 2W0MA 5AJZA 3VNVA 1E9EA 1DAHA 4RD6A 1WBDA 1W2HA 4PPFA 2FEMA 1AS0A 4CT4B 1KO4A 2ATXA 2VL7A 2ZJOA 5B2ZA 4AURA 1MO6A 2R6GA 1VPLA 4BEBA 2XOKA 3T34A 5FBRB 5AUPB 1D6JA 2GJ8A 2ZREA 4LK2A 1JQJC 5KSYA 2JLUA 4Q9KA 1OIXA 4CZ2A 3AKDA 3RC3A 2GZHA 4O25A 1QHYA 1TQ2A 3LAWA 5KDOA 2JDID 4MKGA 2QT0A 3SBEA 4DKXA 2X2EA 2D4HA 2ECKA 2MSEB 1GWNA 1OHHA 1Q20A 3FTQA 4Q1CA 4PC7A 5FUWA 3MWJA 4BRUA 3QUSA 5H8WA 3IGFA 4P4TA 4NYMQ 1SVMA 1U94A 4KLNA 4JMPA 4Y0AA 3GFOA 1NKSA 1W4CA 3UATA 3ICEA 1W0KA 4E5UA 2O8CB 2QQ0A 1E32A 4Q1EA 4ABYA 1ZD9A 2YOFA 4URYR 5EJEA 3GCGA 1KDOA 3EXAA 2E9SA 1EFTA 4M1OA 4TLAA 2D2EA 4DC9A 3DOFA 4S35A 2F1HA 1KK2A 3NBZC 4ZI3A 2ZEJA 3MJHA 4KODA 4R98A 2GRJA 1Z07A 3WMEA 4D26A 3WNCA 4OL0A 1G3QA 2J3EA 5HTKA 4M1YA 3DM9B 1KO8A 4P4SA 2NQ2C 1E79A 3LRPA 5SZJA 1NJGA 1G41A 3CR7A 1T4GA 1S0UA 1NIPA 1M7GA 2QAGC 3NDBB 5JI3E 4KITB 2NIPA 1NVXQ 4LYFA 5JSZA 4M9SA 4XTCS 1AGRA 1XTIA 3EZ7A 1GAJA 4HAVA 1VHLA 1Q3TA 5CIWA 5EXPA 3ADBA 4A8JA 1QHSA 5K8TA 2P6UA 1X86B 1WP9A 4M9ZA 1DG1G 1NN3A 1NVUQ 4JT4A 4MYTA 1Z0JA 1MKYA 2NO6A 3MLEA 4CVNA 2H57A 4B33A 4JKYA 2G1JA 2VHCA 2WVJA 2XAUA 3RC8A 2R6DA 2G88A 1E0JA 1N5IA 1NP6A 3U3MA 2IK8A 2LKCA 2ZRIA 2QNRA 1R0YA 2ZU0C 2CL7X 3ASZA 5HCNA 2XTNA 2ONKA 1CXZA 1XTQA 2GK7A 1XMSA 1T3LA 3LH5A 1P9RA 3UK6A 2VQSA 2FMXA 1JPJA 2P2LA 3RS3A 4F92B 4LWZA 3HYTA 1N3BA 3TSWA 1NJFA 5TY0A 3THWA 3T61A 1RW4A 4QNMA 1KI2A 2QGNA 3B5JA 5KUTA 4ILEA 5FTNA 1ZNZA 1GOTA 3ECCA 4P4SB 4B6FA 4EJSC 2F43A 1WA5A 2EW1A 3K0FA 3PUZA 3Q72A 5JRZA 3GJ8A 1TNDA 4B6EA 3H1TA 3AVYA 1NKTA 5JSZB 4U00A 4OJQA 3SC3A 1W1WA 2CNWD 4LC0A 2BBWA 4Q47A 2OG2A 5G3YA 3NG1A 4A8JB 2DBYA 2IL1A 4EDHA 4A82A 1UBGA 5CJPA 5HZKA 4KXFB 3KQLA 4TTQA 2XXAA 4X8MA 3L82B 2P65A 4QGFA 5LB4A 2FWRA 3SQXA 4WZ6A 1LW7A 3A1VA 2OT3B 1KI8A 1XEFA 1OF1A 3C8UA 4WIAA 1UEJA 4D82A 2NPFA 2I3BA 1NVVQ 2KB0A 5FI0B 4D25A 1E2EA 3WNBA 2IHYA 1W7AA 3AUYA 2PLRA 4L15A 1KJZA 3U7EB 1H8HD 1RRFA 3BS4A 3KJGA 4JLDA 1XD8A 4QGHA 5JJIA 1KI1A 2HT6A 2QPTA 1BIFA 2BBOA 1LB1B 1AS3A 1F5NA 1OYYA 2CHGA 1XJQA 3NC0C 3TVDA 3THWB 5DIFA 5G3ZA 2G0TA 1IY0A 3KKQA 2BMEA 3T15A 4C30A 1G7TA 1XBTA 4DBLC 1EGAA 1DTSA 2F43B 1TL7C 3K0FB 3SFVA 1XZQA 4MKHA 1Q1ZA 3WRXC 3MJRA 1R8SA 2DY1A 5TARA 3SQWA 1HH4A 2FOLA 4V02A 4DSTA 1IXSB 2J7PA 2QP9X 4MDFA 1Q12A 4PSVA 4D6PA 1E98A 3EARA 3X1XA 2FU5C 1YZLA 2ZI9A 2IYUA 3FKSA 1HT2E 4Q19A 3DDCA 2XXAB 4M4SA 5HE8A 4B34A 4NZYA 4FD2A 2JLXA 3VAAA 3FHOA 4URXR 1TAGA 2ANCA 2ZI5A 2XITA 8OHMA 1E2NA 5JFGA 2PMKA 3TRFA 3TSOA 2A30A 4ZDJA 6Q21A 1DAIA 4OHYA 2B92A 3GJ7A 2HCBA 3HPQA 721PA 1IN8A 2QE7A 4TMKA 3GJ5A 1UKEA 3DEFA 1E0KA 1M6NA 2J7PD 5DO9A 1A1VA 1IY2A 1UKVY 3M1IA 1X6VA 2WJJA 4RD4A 3IILA 4Q4AA 3SJCA 1SXJA 4G5GA 5G53C 3D31A 1X1RA 1CJTC 3KJIA 2KWIA 3H0KA 4LZZA 3K09C 5EUQB 1XPUA 1Z6XA 2GXAA 1ONBA 3DMNA 3P20A 1KY3A 1AKEA 1WXQA 5J4YA 1GM5A 3CF0A 4AC9A 3WMGA 1QVAA 2ZRLA 2JIZD 5H1YA 2NO0A 1G6OA 3PUYA 4QL3A 4R2HA 1JJ7A 4IW3B 3FMOB 4MGIR 4OQFA 2QE7D 1FTNA 2VF8A 3IIMA 3THYA 3SE0A 5J47A 2Z43A 2AX4A 4LBYA 1ZUIA 1KKMA 3GEIA 4DEXA 3BB3A 2BWJA 2J87A 4TYWA 1SXJD 2P5TB 2ZSEA 3P4XA 4NDZA 3QKUA 4MUAA 5JEEA 1FQJA 1GKYA 1FMLA 3B2EA 4Q9HA 2FSIA 1A5TA 2A5JA 2QORA 3CONA 1W0JA 2QTHA 1E1QA 2REOA 2PMDA 1G8HA 4Q4LA 1HEIA 4QJ4A 1J70A 2JAQA 2RGCA 3GEHA 4M1WA 3TLXA 1VKJA 3RWMB 2BMDA 1GL9B 3X1YA 2KSQA 1Z5ZA 1Q0UA 2J9RA 4DUGD 3KKOA 2R8RA 2IYZA 2KBEA 3T35A 4Q4AB 3VX3A 3FPAA 3NBYC 1SXJB 2ZRDA 3FMFA 4JVNA 1JQLB 2QMEA 4C0JA 4UXHA 5CYPA 3TVTA 2UZ3A 3AQ4A 1NMYA 1S3SA 3BWDD 3LBIA 5JCZA 2IXFA 5DI3A 1BYUA 1EFRA 2VP2A 1HYQA 3OESA 3KUCA 3CH4B 1IONA 1EK0A 1ZCBA 3Q5DA 4IDPA 3SJBA 3ZVNA 2P3SA 3EPHA 3QBTA 3GJ4A 4YC7A 4HLQB 1K5DA 1SGWA 1UDWA 3C5CA 2WMOB 4RCYA 2WWWA 3RSLA 5L3QA 4JLNA 2F3RA 4PQFA 4UNSA 4KVAA 1E2MA 5IT5A 4H1UA 2W6JA 3LO5A 1CU1A 4LSGA 2QM8A 3TW8B 3L8ZA 1Z2AA 4A92A 3TUZC 2FSGA 4I81A 3W6PA 3I72A 2WAYA 3K9GA 5L3RA 3VR5A 1Q44A 3GLGA 2JLYA 5SZHB 1E4YA 3A37A 1RC8A 1SVIA 4B3FX 4LRWA 2VHQA 1EFRD 1KJYA 3B7GA 4PAOA 2DFTA 3ONWA 4LCBA 4B2LA 3GFPA 5CB6A 1VIYA 2NTYC 3NXSA 5CDFA 4ACAA 2C98A 1XXHE 2GKSA 3WHKA 1SHZA 4ARZB 4NONA 1IY1A 3I32A 1T5IA 1EFCA 4OHVA 4O2LA 3LV8A 4G5SA 4Q4HB 4TTPA 5DI3B 1CJMA 3LQQA 2JCSA 1YZQA 1FUKA 4DLTA 1Z22A 4HB0A 1BS1A 3BERA 1KNXA 3THYB 4GL2A 4P3YA 2W58A 4DLRA 2VSFA 1QDEA 3JVVA 2PLFA 1Q1QA 3DL0A 2IYYA 1GNRA 4E03A 2O0HA 5L3QB 4DDWA 2P6NA 1NY5A 1PLLA 2GHIA 3SNHA 3UKDA 1E9RA 4L16A 2RGNA 4DLXA 2GCPA 3QEJA 1NBMD 4EIWA 2QTFA 4DB4A 2QENA 1N6RA 4EFNA 1ZU5A 3B9PA 2F1RA 4BE7B 2W2XA 3UANA 1DEKA 1VG0B 2VHTA 4JBYA 4XVQA 3GLGB 2IHBA 4Z8YA 3WY9A 1G8PA 3QPVA 2DWPA 2DB3A 2OXCA 2VH5R 4B3DA 3GP8A 4C3ZA 5KDDA 3QXCA 3ADDA 1QHNA 1PLJA 1U0HC 2WM9B 4L4UA 1PLKA 4A0HA 4G5QA 3IO5A 3GLGE 3U3JA 3EWSA 1CRQA 1KIMA 1VIAA 2Q0HA 4YMSA 3R9WA 3EA5A 3W5JA 5J4KA 2J0QA 3KKPA 1BOFA 3Q7QA 4KFSA 1XCPA 2QEQA 2ODNA 2ZSFA 4QBFA 4X8OA 3RRMA 1S9DA 3O8DA 4D2IA 4NYMR 1XEWY 4AG6A 1ESMA 2HYDA 4XSHA 1IN6A 2ZR9A 2XNDA 4LUCA 3ZQJA 2AFHE 3LXRA 5DSZA 4TSFA 5IK2A 1VCNA 4PO9A 1KY2A 4TQ9A 1S4QA 1XB2A 4KLZA 4Z51A 3RYTC 3A1TA 4ESVA 4XSGA 4I1SA 1ESNA 3R9IA 2A5YB 2ZR0A 5F3WB 3K53A 2RH5A 3BGWA 1P7CA 5GJVC 4DLYA 3CNLA 1UBCA 3CB4A 3AKEA 4JJKA 3RANA 2GK6A 2IS4A 4QHSA 3ZVRA 3OEHA 1ZC3A 5EP1A 2YOGA 4JLOA 4BLRA 2R6AA 4MYUA 1UAAA 3T1QA 1NNEA 2ZRKA 2WPDD 4RKFA 1R5OA 2VO1A 1IOZA 2XNDD 4TSFD 5IK2D 1E2JA 2IYXA 2VSOA 2XJ4A 1XU4A 2ZETA 5H70A 2WSSD 4DB2A 5AJVB 2QRNA 1ZU4A 5EE0A 1YR7A 2MSDB 2EWVA 1JAHA 1U8AA 2IA5A 2RCNA 4KSCA 3TW4A 3WP0A 2QAGA 1NN5A 5FBVB 4UQOA 3U3KA 4DDVA 2C04A 4GPTA 1NN0A 4HSEA 1BMFD 1OFTA 1LY1A 2Q9CA 4K81B 2BEJA 1AQYA 3U6KA 1MV5A 2W2VA 3AVXA 4GNKA 2FN4A 2V55B 4U7DA 4AYWA 5DN6A 5A5GA 1M74A 5H68A 2V1XA 3RS4A 3MUFA 3ZZUA 4GBMA 5FH9A 2ZRPA 1YZTA 1MR3F 1U2RA 4Z54A 3H84A 3W8NA 1RYFA 5JHHB 2VP5A 4NCIA 3EW9A 1E0AA 2WWXA 1XTRA 2AWOA 4G1UC 3PEYA 3IHWA 1TQ6A 1FQKA 4EPWA 4RJLA 1G3RA 1OSNA 2OESA 1T6NA 1Z6YA 1KI4A 3CRVA 2WZQA 4EJSA 1H65A 3K0CC 4M1MA 2XSZA 1N0UA 1KSFX 2V8OA 3IQWA 4OJKA 2QAGB 1ZNYA 3QKSA 4TT3D 5DHAA 4B75A 4LJ5A 4TLDA 3K70C 3EPLA 2FSHA 4AK9A 4BFXA 3AB3A 1W5SA 1WMSA 1P4SA 1NVVR 3B60A 1Z63A 2N1BA 4OQNA 4B35A 1LS6A 2IYQA 2OE2A 5JWHA 2O0JA 4TMZA 1EESA 2QPAA 4W5HA 1FTSA 3PITA 3HU2A 5DGXA 1E6CA 3K0AA 3I5YA 2ERYA 3FHTA 2CLDX 4LI0A 4CDGA 4BQSA 4A15A 4LDJA 4NYJQ 1UPTA 2EQBA 3CR8A 3PVSA 3TAHA 4QGAA 2O5VA 4DIDA 2H1LA 2F1JA 3CPHA 4YDHB 4AIIA 2X8AA 821PA 1OB2A 4B43A 5TVKA 1ZW6A 2ZRBA 2A2ZA 4LV6A 1SVLA 3TUJC 1GNPA 2EYUA 3AVOA 4RY2A 4YXWA 3VTKA 4FCTA 4CGZA 3RABA 1P9WA 1COWA 2WMNB 3TUIC 4F93B 5K8UA 2BKUA 3U44A 4EJSB 3LBHA 1VG9B 4TYPA 3RS0A 2XTMA 5FUYA 4UNRA 1XEWX 2GCOA 1JAIA 3SJAA 2C9YA 3QKSB 5DE3A 5FBWB 4IDOA 2QN6A 4D4LA 1QHIA 5J4LA 2Q9AA 3U3RA 3HWSA 2GILA 2C9OA 2ORIA 3BB1A 4KFRA 3BBPA 2O8DA 1AZTA 4IOLA 3WXMA 4Q02A 1JPNA 1G16A 2ZR7A 4TLEA 2IYVA 3KQUA 4ZCIA 1ZP6A 1JJVA 4PHTA 5GVSA 1RFLA 3PV0A 1DVRA 3W9YA 1ZM4A 2X2FA 4AYTA 4YXWD 621PA 3K0AB 1COWD 2FSFA 3EPKA 2UVQA 3EASA 4JLMA 1AKYA 5EP3A 4DSUA 1Z0IA 3PEVA 2NMVA 2IT1A 2PJRA 1ZUHA 2ZI4A 4MUBA 4Q48A 1Z8FA 3PXGA 1LS1A 2Z5FA 1R0ZA 1WQ1R 5BYJA 1XTSA 4NH0A 3JZMA 4BFUA 4ZDIA 1X1SA 3LVRE 3NH9A 4BFWA 5EUMA 1KSGA 1AZSC 1JR3E 2OFOA 1P2SA 5C1BA 2ORVA 2W6IA 4DLSA 4V0LA 4QBGB 4US0R 4TQAA 2MMGA 3K09A 4ZO4A 1ZMXA 2BCJQ 2GCOB 1UBEA 3VKWA 1TU3A 2ZI6A 2DYKA 1FOEB 1R0XA 3U3OA 1YU9A 3OFNA 1NG1A 1R10A 2ZJZA 1E9AA 2GXSA 4NYIQ 1E2GA 4BFVA 2CK3D 1LFDB 1Q3HA 4QM7A 1XP8A 2O8DB 4C0AC 1S1CA 3LX5A 3WBJA 4QG7A 3GLIB 2VTKA 2ANBA 5FUVA 2JDIA 2IEZA 2QY9A 2G6BA 4B3GA 4TMWA 2NO1A 2W6ID 3NH6A 4UKDA 4MYCA 4PPQA 3GLIE 1KDRA 2BJWA 3SFZA 4D4KA 1DBSA 3QPUA 3OIYA 2CJWB 1OXXK 4DRZA 3Q85A 1G3IA 3RDPA 3OFND 2GJKA 2XNSA 4FN5A 4HAYA 4BLOA 2WKRA 3RS2A 5E7MA 2ZSAA 1W2GA 3LQRA 3Q7PA 1QF9A 4JSYA 2K5UA 4BEJA 1G20E 5JBQA 2BC9A 3VHLB 3E1SA 2ZRAA 1VDZA 5FTKA 5JRJA 2AD5A 4EPTA 1E2DA 4NCKA 2RGDA 2VHJA 4L9SA 3EWAA 1JECA 5FI1B 1ZM2A 3F0TA 1EG7A 2HT1A 2G83A 3IEUA 4LX0A 2GXQA 2P6RA 4URWR 4M1SA 1W4RA 1L4UA 2PX3A 1KMQA 3FFAA 4Q1AA 1OFIA 2R6CA 3CM0A 2V6IA 3KXLA 4HZIA 1NSFA 3CLVA 3TNFA 1IM2A 3IQXA 5G40A 4QHTA 4ERNA 4PAMA 1E2KA 1Q1EA 4O3MA 2B8TA 1ODFA 5AUNB 2IS6A 1NN1A 5FL3A 2V6JA 4K8OA 5AJYA 1VYVA 3MMPA 1DADA 2EWWA 1T5LA 2J41A 4FMDF 4D81A 4KFUA 2ZRJA 2ZSBA 3NDPA 3HYRA 4HUTA 2F6RA 2ZRFA 1CP2A 4TYQA 4HLDA 4M9QA 3CIOA 3CNOA 2E1RA 2OLJA 5KPJA 1HE1C 2HUPA 4F91B 5LD2C 3F3YA 1V43A 3SHWA 4C0KA 1KKLA 3EZ9A 3GLHA 4M8NE 4HDCA 2ZPTX 2KE5A 4RVCA 1TU4A 1K6MA 2FZLA 2EYQA 1A2BA 2IXEA 1AIPA 3SU8A 2D2FA 3P32A 2A78A 3AGPA 4YLGA 1IXRC 1JBKA 2CNWA 1IAQA 1XD2A 1NIJA 4L8GA 2J59A 2XTZA 1CS4C 1ZNWA 5JECA 1CULC 3AGQA 1Z6AA 1UKZA 3TSZA 3PR1A 3AKYA 2ZS8A 4XD7A 2GJAA 4YMVA 2C99A 1TF5A 2PCLA 4W7SA 1S9HA 4DXAA 1EWRA 2EFDB 2Y8EA 4Q7MB 3IBGA 2ZRHA 1Z0AA 2C78A 3R20A 3WYGA 2QMUA 1QG4A 3ADKA 4JLPA 1DO0A 2ZYWX 4G5RA 1Z3IX 3LA6A 2YWHA 1KO1A 5C18A 1RRGA 1H8HA 1TX4B 2C95A 2QP4A 3BAFA 3BFKA 1W4AA 3C41J 4I1VA 5JWRA 3FOZA 5DYGA 3SJZA 3Q9LA 1T8UA 3SR0A 3JZAA 4NHOA 4C0SA 5HE9A 2C96A 4ZDWA 4XD7D 4OK3A 2JATA 4LJ4A 4EQ6A 5JCPA 1CJVC 5C2JB 2WWIA 3T1VA 3GLHB 2ZANA 4CF7A 1P2UA 4BLPA 4XTRA 3W90A 4JLJA 4DWJA 1IJEA 2QROA 1KTVA 4RZUA 3SBDA 2BIFA 4NTZA 3CRW1 1SVOA 2RHDA 3OAAD 4F4JA 4HLCA 4D80A 1U8ZA 3VMFA 1HY3A 4A36A 2BV3A 4I4LA 2OCAA 4KFTA 4BGDA 1NMZA 2J1LA 3T5GA 1Z08A 5JEDA 2F55A 3P4YA 5EQTA 3IPXA 2ZXUA 4Q18A 1KAOA 1DO2A 1I4LD 2N46A 2QPOA 4PC6A 5FR2A 4AWXA 3GPLA 2V1UA 3I61A 1Z0KA 3ND8A 1PV4A 1W44A 3GJ6A 5AJXA 4MKIA 4G3XA 1OIVA 2VYFA 4Q1FA 2VBCA 1T9HA 3ICQB 3OIWA 2PEZA 5FL7D 5FFMA 1AK2A 2R65A 1EX6A 4Q01A 1VYUA 3K9HA 4R7ZA 3NKVA 2CE7A 2YZ2A 1P60A 1FL9A 1LF5A 1P75A 1Y63A 3K9LA 2ZE7A 4O0MA 5KYKA 2B7BA 2IXGA 3CWQA 2JLSA 1U98A 1RZ3A 2GVZC 1BYIA 5FPTA 1IN5A 3UG6A 4EQ6B 2O8FA 1EWQA 1E9DA 1F6BA 3ZD6A 1SVWA 3TBKA 2GETA 2OBNA 1DAKA 1A4RA 2ZSDA 3KX2A 3QG5A 2BEKA 4F4CA 1RIFA 1CR4A 3B85A 1CLUA 2JIZA 2DFKB 5ANRB 5F98A 2Q9BA 3RHFA 2HYIC 4GFDA 4BZQA 3CPJB 2NOAA 4TQUS 2GAAA 3O8RA 4UNNA 3CF2A 5D3MA 4FI3C 3PEWA 3TMKA 2DHRA 2GNOA 1YJ5A 4ZPXA 1T3HA 3LW7A 3QKRA 4NCNA 4DCVA 2J0VA 4IRUB 4PZYA 1YRAA 2JA1A 2CCGA 2Q3MA 3C5HA 2C5LA 4U02A 1IXZA 3TQCA 2IS2A 2ZU6A 4RZXA 4DHEA 3BK7A 1E2IA 4EAQA 2AK2A 2FFHA 1I2MA 1P9NA 1XZPA 1AQUA 3W8RA 2JLRA 2HJGA 3BC1A 4KI0A 3V9PA 2WJYA 5CJ2A 4DUGA 1ETUA 3K0CA 3N2EA 3D7MA 3LW8A 3U7GA 2OLKA 2D06A 1I4DD 4RD3A 2WKPA 3AEZA 1MRNA 3ZZ0A 4G5OA 2H92A 4NYJR 4WXRA 2O8FB 5AWFC 2YJTD 1T0JB 2EU8A 2IF2A 2NPIA 2FFBA 1II8A 2Z6VA 1P6XA 2NZ8A 1AA9A 2V7QA 3BFVA 3FE2A 4XIGS 2E87A 1G5PA 2R6FA 3ZGXA 2GJ9A 5CIQA 1XNJA 4TL9A 2HEIA 1KI7A 3CZPA 4N0EA 5IDVA 3WYFA 3I4LA 2BOVA 4MRVA 1XDBA 1KDPA 1YZNA 4TL8A 1R6BX 4F38A 3DOEA 1DS6A 5J4VA 4Q9IA 1JALA 5D3MB 1XPOA 2IYWA 3QKRB 3VKGA 4X8LA 1VECA 3LVQE 5EZ5A 3CX6A 3QE0A 4B3XA 3ADCA 1OKKA 1DOAA 2R44A 1KSHA 3R9XA 3K70D 2H8KA 1ZVQA 3SZRA 121PA 2QI9C 1SXJE 3QBVA 1CR2A 3L0IB 2V7QD 1GSIA 3QF4A 4BLSA 2VP4A 3VR3A 4S2EA 4HZUA 4LYAA 2CVFA 1VG8A 2F1IA 1G4UR 1HQCA 3LBNA 3SI7A 4JL5A 3FMIA 4AI6A 3B6EA 3H2YA 3L8YA 3AM1A 1KSJA 4EPXA 3A1UA 1UFQA 4DLZA 3K70B 2ZRGA 1Z0FA 5FUXA 4QRHA 3NIBA 3Q8XB 4CIDA 4QC2A 1II8B 1FPMA 1OKKD 1N5KA 2ZTSA 4JSTA 1S8FA 4PANA 5KDLA 5F2EA 2RGXA 1P62B 3AP1A 4Q4JA 1MOZA 4LV5B 4UJ5A 4BZPA 4IOJA 2PZGA 3W5IA 1ZD1A 2DCUA 1D2MA 4LJ6A 5LB2A 2IEYA 4LYJA 2FPMA 1II0A 1ZAKA 2WBLC 4OYHA 3UPUA 1T0HB 4DT1A 1II9A 5FTMA 1J8YF 4C4PA 1NBMA 2WIBA 5HZHA 5FTJA 1TMKA 2G0NA 4MRRA 2CE2X 4QBHA 4TMTA 4BRWA 1GNQA 2AXPA 2GA8A 3A4NA 3L43A 1KDTA 2VPPA 3EZ6A 1G8YA 1K5GA 3QXJA 3LXXA 2FPLA 4C2TA 1G5RA 3GEEA 4UJ3A 1UEIA 4DLWA 2VIIA 4WOPA 1CTQA 1D2NA 3ETLA 3U5ZB 2IYSA 4HI0E 2QZ4A 5BN3A 4FWTA 4KCGA 2Z4RA 5C4GB 3ZIAD 2ZUCA 2FEOA 3UMSA 1GKIA 1M1YE 3ZLJA 2IWHA 4H1VA 4YDSA 1NI3A 3C7KA 3X1WA 1RKBA 2HLDD 3HR7A 3B13B 2KBFA 3UMRA 3WP1B 2Q3HA 2J45A 2D74A 1C1YA 1J7KA 2ZS9A 5JMTA 2QMOA 1OXSC 4ZKEA 3T06B 3PG5A 3X1ZA 2AKAB 3UG7A 2PZEA 1Z47A 2HF9A 3VFDA 4Q7KA 1KHTA 4NL4H 1OFUX 2P0EA 2QT1A 4AKHA 1M34E 1FNMA 1ZIOA 3PCRB 3NEJA 4OBEA 1GRRA 4C0HA 2O8BA 5C4MA 4AD8A 3ZQ6A 2MMCA 1DG3A 1W36C 4Q9JA 4GDFA 4GRAA 1D9XA 1V5WA 3G0HA 2WSMA 2ZUBA 3LNCA 4MITA 3AVTA 2DR3A 5CDFE 4LY6A 3ZD7A 1YKSA 3B9QA 2WPDA 2FH5B 4B73A 2MSCB 3HU3A 2RKOA 3CRRA 1RRPA 2OCBA 5KTYA 1N6OA 3AF0A 4IVQA 1NVWQ 1WDTA 4A0FA 4LHVA 4M22A 1W48A 4LJ8A 2WSSA 4IDQA 2PEYA 1Z6GA 2JGNA 4UNQA 3SYLA 4W9MC 2DPXA 1P5ZB 1BO6A 1NLYA 1E2PA 2AHOA 3QVVA 2PL3A 5HPYB 2WTUA 1HURA 1DAFA 3M0EA 3RWOA 4DCUA 4F4IA 1OH6A 1LV7A 3SS8A 3Q5EA 5JS7A 1BMFA 2DWQA 2VHUA 3ZYCA 4HUQA 2NO7A 3AUXA 1JXOA 1WE2A 4OHXA 3EG5A 3HDTA 5ELXA 4URUR 2FDCA 3I62A 2X1VA 1TQ4A 2VF7A 4D0LB 2WHXA 3ND9A 3WHLA 4F7WA 4FW9A 3A36A 1D5CA 3EIEA 2A7QA 3AF1A 4OQMA 3QXHA 2O8BB 2EFGA 3U2QA 4BLQA 4A0RA 1GRQA 4TZ6A 3KDSE 3AP3A 2ZRCA 2PT5A 4ZIRA 2OHFA 4HATA 3NEYA 3W6NA 1HA3A 4MQBA 2AFIE 2HDNB 3V00A 5C46F 4IOMA 1TF7A 4LGMA 1IN4A 2W0SA 2ZE5A 1ZYUA 5CLQA 5P21A 4OKSA 2D3WA 3BIFA 1JXMA 4HB2A 3TAUA 3MG9A 4IOKA 2FJUA 2IX3A 2H5EA 4GZMA 2IWRA 5FPYA 5JJKA 2ZRMA 3IDQA 1DARA 4PPGA 4ACBA 4G01B 5EXXA 4LJAA 2HCJB 1UF9A 3VR6A 2A3RA 3W3ZB 1ELOA 1F60A 2YWGA 5FPKA 4TT3A 2ZYUX 4DVGA 3TE6A 2GF9A 4DEYA 4PHGA 5K8LA 1KAGA 2IF0A 3VQTA 1M7BA 5AUQA 5GJWC 4HUQB 5L3VA 1ZNXA 4IDHA 4DDUA 2TMKA 2ZJAA 1DAGA 1XCMA 2PCJA 2ZROA 2ZVPX 3OEED 2RHMA 5JJLA 4R9UC 2JJ1D 4CEJA 2GXUA 1U0JA 2GEUA 4M21A 4WA7A 3SHFA 3CKLA 4MRSA 4BZXA 2ZJYA 4QXAA 4AYXA 1KI9A 4ZIRB 1HT1E 1IN7A 1R4AA 4LJYA 4E09A 1TEXA 1KJWA 2FF7A 3ZS8A 5E7IA 4GMDA 1SHKA 3NBFA 2ONJA 1E9FA 1LNZA 5LD2B 1F48A 1VCOA 4CW7A 3WNDA 1SKYB 4NU0A 1FW6A 2CHVA 3RLFA 3LX8A 1KZGB 1OH5A 2HXSA 3E5HA 1LVGA 1JB1A 5AR1A 1PJRA 2B7CA 4KO8A 4JIMA 2H17A 4BFYA 2L0XA 1C4OA 1ZJ6A 4QKQA 4V0MA 3N5CA 1KMHA 1S3GA 3HP1A 3VU9A 1GZSA 1SQ5A 3QENA 4GI7A 2YINC 1JEEA 2BCGY 4HAUA 4NCJA 4OI2A 4D0GA 1F2UA 4XWKA 5CM8B 4IVPA 3A1WA 4KJZA 3OZXA 4RCZA 3WRYC 3RNLA 4KVGA 3LY5A 1GL7A 4GP6A 3C14C 4JLAA 4LC1A 4RZ2A 5UKDA 5JS8A 4CEJB 2O0KA 3B1YA 3FWYA 1N0VC 3KFXA 4PO1A 1XD9A 2BBTA 2OBMA 3CH5A 1ZM3A 4JS0A 4LHYA 4OQXA 3GLFA 4LBVA 4Y0VA 3AH8A 3FYHA 5KNDA 4HAWA 4C9BA 1M7HA 3K8YA 4UXJA 2BMJA 3CX8A 1G8GA 1QVRA 1EX7A 2CMKA 1N6HA 3I73A 4N3NA 4U5XA 3EC2A 1E9BA 2YWEA 4GOXA 3U4QA 3R8CA 2JLZA 4IEEA 3FVQA 4D4MA 4ZI2A 3MWLA 1KMHB 3VU9B 2CK3A 4ESHA 1JEDA 5B30A 1JR3D 1F2UB 1NMXA 2G9NA 1FX0A 4RD2A 4V0ME 1OYWA 3U60B 1FUUA 2QGZA 5FR1A 5F9HA 2NO9A 2ZAMA 1ZUNB 4CT5A 1DELA 1L8QA 4FCWA 4JKIA 2KI5A 2GBLC 2IW3A 3GJ0A 2B8WA 4K46A 4D0NA 2F7SA 2P67A 1K8RA 1W47A 3U44B 3NTUA 221PA 5SZIA 3GJXC 2WWFA 4B74A 1SVSA 3KB1A 1GFIA 2C03A 2WIAA 1E94E 1NLZA 3LWNA 2PBRA 4V03A 4Q7LA 3D3QA 3K1JA 4JZKA 4ZCLA 4DSOA 3GLFB 1CRPA 1N2CE 3U7FB 2V3CC 4PC2A 3OE7D 2Z4SA 2FGKA 1G18A 1OIWA 2CEAA 2NG1A 1MRSA 1M8PA 3PUXA 3BXZA 3I92A 1OW3B 4KBGA 3B1XA 4MRNA 1J99A 3NBXX 1EFUA 3OHMA 4A9AA 2IUSA 2IC5A 1KZ7B 4FXPA 1GDDA 3QVUA 4I1OA 4P0TA 3THXA 2CXXA 3UWOA 3U4QB 2ZE6A 3B1VA 2ZIAA 1HTWA 2XB2A 1SVKA 4KYUA 3I1FA 1D2EA 5DHFA 1EFHA 4XVRA 3SOPA 2FG5A 1XMIA 5DYIA 1ZIPA 4JLBA 4B47A 1N6PA 4B3BA 2DWOA 1S2MA 3UIEA 4H9GA 1F2TA 2O8CA 1U0LA 1FX0B 1YR8A 2JLQA 3DZDA 1AN0A 4IHQA 3VHXA 3G82C 5GJCA 1OPXA 3IPYA 3RVBA 3FDIA 4MDEA 4RSGA 3REGA 2GEVA 4ON9A 1UJ2A 1KYIA 3O8BA 3QNUA 4KU4A 4XOIA 3DKPA 4FCVA 1UADA 1Z0DA 2BBSA 2QSYA 1D9ZA 5FOTA 4B3CA 4YQFA 1R5NA 1XMVA 1TUIA 3AVVA 4Q21A 1US8A 4XWAA 4MH0R 2ZYVX 5KSZA 1RPZA 1GG2A 1IHUA 5DISB 2BKEA 1OT3A 1W46A 5A0FA 1XTJA 3C4JA 1RRCA 1T3SA 3L2OB 2CHQA 2QM7A 4A1FA 1KI6A 2YYZA 3FFBA 4HB3A 4PAQA 1NL3A 3AVQA 1WCV1 5FBLB 4HEJA 3THXB
chains in the Genus database with same CATH superfamily
1MVLA 1ZISA 4ZJZA 1VKRA 3P0JA 2D13A 3AR9A 5TQ0A 3FGPA 4LF7B 1O8CA 4KR9A 2R6R1 3FDZA 1LDBA 4IVNA 1U2GC 3DYIA 5EJ8A 1AUOA 2H16A 5JCXA 5J59A 5JV5A 5KJFA 1I3CA 1ORWA 4CCSA 1LPOA 3D6AA 1UKBA 2JFHA 4JJ4A 4ALLA 4EHAA 2Q8QA 2PX0A 4AN0A 4EUNA 1GJRA 3W4IA 1AKVA 4V1CA 4NHEA 2QG6A 1M10A 4IXTA 1GLVA 4QOEA 3QIAA 1XQ1A 3L41A 1QIMA 1U0EA 2EZTA 1N6KA 2PZFA 4HYTA 5LZ9A 2X0IA 4ZZ3A 4L9WA 3ANLA 3FHTA 3OJXA 1KERA 1U2DC 1DTWB 4RIFA 4B4WA 3ZVLA 3VTZA 2VHXA 1HE8B 4FMDB 1ZCAA 3L0DA 4LJ9A 4GGMX 4CUKA 2CCKA 2R7MA 4E31A 1GZ4A 3BJEA 3KKEA 4G4GA 4HG2A 1F1JA 3JSAA 4UTZA 3TFWA 3AF2A 1ORVA 9ATCA 4IP0A 2PXCA 2X0DA 3RK4A 3RR2A 3JYQA 1G9XA 4JLKA 1E69A 2YOHA 2DU8A 4OU5A 3NBMA 4XUEA 5TSDA 3ORHA 4NKRA 4GI5A 4YI5A 3V3TA 5C7IO 1LKZA 1Z06A 5IAEA 3ZU3A 1MN6A 4V0OA 1RKUA 1F1BA 1PNVA 1C9DB 3KDPA 4MQFA 2DJ5A 1YIDA 3C7TA 4UULA 1LNQA 1A1SA 5EFZA 2C77A 4S1OA 4Z3DA 3F7TA 4UREA 1HZJA 1G7SA 4L0CA 2Y1XA 4LJLA 2C4NA 5CYOA 2BCEA 5I8ZA 3RC7A 5LMZA 2ZBFA 2PJDA 2DFLA 3MCTA 1XEXB 2RHWA 5F1OA 1SKQA 1MENA 3BD9A 1W5TA 2D1YA 3M9LA 2BEVB 3E9QA 1QHGA 4J1TC 1ZGHA 5IF9A 1JYSA 4RE6A 4EG7A 1BA3A 5LJLA 3C45A 4R3WA 4ZT6A 1YGYA 4R6XA 3V80A 4YRNA 3OAAA 4XGRA 2AZ4A 4QLBA 3OQOA 4TV9A 1VIVA 2QMHA 1I2AA 1RJ9B 5DH9A 1Q0ZA 1XRSB 5IYZF 2QLFA 4S0XA 2R8ZA 5E3JA 5JZBA 5KKNB 4DG9A 2B4RO 3BMCA 3L1JA 3KXKA 2QVCA 1QO9A 2R8OA 1BHO1 1RFGE 2ERXA 4IICA 3EPJA 3B6KA 2UVPB 4TYYA 1VMAA 1G21E 1JE0A 3NATA 1ZOLA 5HJEA 3G9UA 1WM1A 1C1DB 1JDUA 3R6TA 5LM3A 5FL7A 5GVRA 4Z5XA 3HXOA 2BHRA 3O84A 1CFJA 2VUTA 3K71B 3MOGA 1NRJB 2I29A 3LUKA 3JY6A 5C53B 1VCIA 4XUGB 1ISGA 5KOIA 4Q3AA 1WULS 5CLJA 5COQA 1EA7A 1XD2B 3EGDA 3AUAA 3FPEA 4Q7JB 4G9BA 3RIXA 4MUJA 2V54A 2UUCB 3INTA 3DYBA 1O96B 3FTPA 3UGQA 3BQMB 5GADl 3NTVA 3GLTA 1SVNA 3LUAA 3Q11A 4E7PA 4QOSA 5ITVA 3UMMA 2JH8A 3CZQA 5JFTA 4OBWA 1XZJA 2M98A 2R0QC 3BOSA 4WOKA 3RVNA 2B4QA 1ISMA 3GFVA 5IXSA 4QUAA 4C89A 1LBEA 1ZESA 2ODWA 3TLEA 3ZGNA 1J2RA 4IO0A 4DGQA 3PNBA 4IDDA 3GUHA 3T5DA 2O57A 2PHZA 3LDAA 3UV7A 3D3KA 1YR6A 1A9TA 1IZ9A 2A5FA 1G1MA 2BN4A 1CIPA 1CZLA 2GD0A 1FTWA 3A58B 1VPWA 4J94A 1XDWA 3GLVA 5BN5B 1D6NA 1JR2A 3G7NA 5CHYA 4BCBA 2FEPA 3BTUA 4TL6A 3IP9A 2IBTA 5T3UA 2OO3A 4POAA 5EQFA 1QZXA 3EH1A 5HQ3B 2AK3A 5MFPA 3QVGA 3LVBA 1I4TD 1XE3A 4JL8A 3VNUA 1V6AA 2X3YA 1UXKA 5FHQA 2JASA 4YT4A 2E4WA 1PUJA 2OVBA 2K87A 2ECFA 2PD6A 4KXNA 3VR4H 5CDUA 5IDYA 2PL5A 1AOXA 4P2GA 3AIIA 5K0JA 1D6SA 5EIFA 4F5DA 1GVHA 3PFHA 3HSYA 1Z4QA 2PIDA 1PI3A 1KQFA 2X9VA 2YC4C 3B2QA 4KPGA 2O20A 4PX9A 1HUQA 3Q1LA 3RYFA 1TMOA 1ISPA 2FP4A 4I6JA 1PV1A 2OZEA 3DTVA 3GJ3A 4TZ0A 2AJCA 3UGTA 2OXTA 5JD6A 1RYMA 1Z0UA 3C4QA 4KIWA 3FVVA 3ILVA 3JAKA 3CNHA 2NTJA 3BFXA 4FMBB 4N03A 4P7FA 4RKWA 4DABA 4ZCMA 5KYWA 2H3EA 3KQKA 1S2GA 8ATCA 1U28A 1PS9A 5FQNA 1XMXA 3H42B 3K32A 4NPHA 4ERXA 1FRZA 3ZBUA 4G0MA 1RYHA 1MAVA 2BR3A 1Z12A 2YXBA 4D8UA 1X9HA 4LHZA 1R7RA 2B2NA 2F2TA 3G6WA 2Z04A 4MDHA 5DHUA 3UFXA 3AZPA 4RD0A 4P7JA 4EAAA 2Q2VA 2QZ9A 1S96A 2IPXA 3FI0A 3SQMA 3EXG2 1EFDN 2ZVDA 1OLOA 3FKSD 3L6DA 2EVWX 5E1MA 3VKFA 4CM9A 1TF2A 5J23A 2I6UA 3DTVD 4KSBA 4PGHA 3CVUA 1Z6ZA 3ZWQA 1QQ6A 2Z3WA 4GOJA 4QFDA 4RW0A 3ZI7A 3F2VA 2YHSA 4BJ6A 3HK2A 2FW1A 3OLCX 4C7OB 4MVJD 4R1OA 1G5TA 1P33A 1Z17A 5T8KA 5WRFA 4EG1A 1TZCA 3KPYA 4KREA 4X60A 3AB8A 1ISSA 2O7QA 4MGYR 5TDHA 1GCIA 5DIZA 4YPOA 1V8BA 2YQZA 1D4FA 1NQTA 3BHNA 3WHPA 1J06A 5DEIA 4LF9B 3JTEA 3RVKA 3K96A 4UNIA 1WJGA 2WE8A 4DSNA 1XF9A 1F20A 1N57A 3M6UA 3WL6A 1IMJA 3E3MA 4WNAA 4BL5A 1KGDA 1N6IA 3TL2A 1MB9A 3U1VA 6ADHA 4Q3OA 2CV2A 1IZYA 1CDEA 1C7ZA 3UAZA 5ICMA 3A6PC 4LZPA 3BG5A 4OAQA 1T0PA 1L5HA 5IKOA 2J0UA 1WAMA 2O2ZA 4LN1A 3ZEAA 2J3HA 4G1EB 1E99A 4OU4A 1YVEI 4P3PA 3W2EA 3THXB 3P0IA 1KVQA 2FR8C 2VUHB 3OG9A 1PFUA 1XK6A 3A7DA 3CUSA 2PANA 1MLDA 4PN3A 1MB0A 4LJ7A 4FKZA 4EHNA 5INTA 1RKVA 3LUBA 1C9MA 3VZSA 4FLFA 4F3NA 2WU1A 4MQUA 2XOEA 3EF0A 1F2DA 3CZ9A 2HO5A 5IUKC 3VR1A 2X14A 2Y76A 2ATIA 6YASA 3WI7A 2GCEA 2A0WA 1B8PA 3NVKI 1HEYA 2VJOA 4BAZA 3AVWA 1ADCA 1O87A 4OB7A 1EIZA 4M2LA 2J7KA 4WZBB 1XZBA 4DMRA 3EXEB 5FTLA 1F38A 4GSYA 3UMCA 5JE8A 2GBFA 2YZMA 2I2BA 1E7WA 4MO9A 3UHAA 1UBLS 1W0JD 4FFMA 1CZNA 4FFDA 3CCFA 5EJAA 5KAMA 4GD3Q 1PRYA 4MV1A 5SZKB 1D4AA 3CWZA 2Y1OA 3OJOA 5E4FA 2QN1A 1JWAB 3G8CA 3W04A 2RBKA 4M9CA 2PD4A 3RVJA 4C0WA 2JFBA 1E9VA 2VP6A 3S2GA 4JH0A 1E6KA 2HA4A 3EFHA 3CJQA 4Y98A 3KQHA 1LJLA 2G82A 2WVHA 3ZWNA 5B3LA 5K3FA 2HLDA 3PXAA 3UXMA 3MQFA 5BQFA 1UOOA 2R7AA 3FZNA 1JG6A 3H1PA 1TCVA 4EJSC 2V9CA 3LMKA 3T7EA 1QGZA 5AQEA 2OO7A 1D8TA 2WV9A 4P33A 4PPNA 3BIXA 2AOWA 2GOYA 2GBLA 4JL6A 4RZHA 1E7SA 1PZHA 2VSYA 2ZXFA 2R79A 3PT9A 4D56A 5IH7A 1ZM7A 4EQZA 2MU1A 4HZUB 3PZBA 4JI4B 1AUXA 2OMEA 3MXTA 3T3GA 3E53A 2E48A 4BMZA 2VQEB 1FEZA 3C8HA 2GTIA 4MVWA 1J6UA 4PO8A 4YQEA 1QF7A 1U63A 4A8TA 4I46A 3LLVA 3CLKA 4LE1A 1UP7A 2IYEA 4D99A 1DV2A 3HABA 4A8HA 2BYTA 3U7QA 1UBJS 1P1JA 2QPLA 1EUQA 2PRJA 5JY6A 2LD4A 3PE4A 1BVYF 3UUWA 1RPAA 2B4YA 2OM2A 3BIOA 3I3SR 3P27A 4Z7QB 3DKVA 3HNRA 3IIKA 3QE2A 3KBOA 3T9DA 4PVDA 2PGJA 2IZ5A 1C8BA 2CLSA 2ZAOA 4WDRA 5CT6A 4Q4JB 1Z2DA 1I10A 4OA5A 4UNPA 3KQQA 5DNDA 3EX7C 1CUAA 3ETEA 4QFMA 4RQUA 2VP9A 2OBLA 1XCGB 4R2LA 4YPFA 2Z98A 4D3SA 3DCYA 1T4CB 3W0LB 3LL7A 2GFIA 5LYJA 3R7AA 4BNTA 5C7YA 4ZFNA 1JHMA 3SCZA 3AR4A 3CF6R 3X2SA 1QDLB 4NCAA 4EJ0A 5HSGA 4NZMA 2OAEA 3CVOA 4IWNA 3HXPA 5GJBA 4H6XA 2YNMA 3Q3JB 5E7JA 2ZGVA 2BFFB 4MA4A 5JAOA 7REQA 5A06A 3UCEA 1XRQA 4ZOAA 1KE2A 5HDBB 2ZIXA 3DZ8A 4X20B 1NBME 4JB0A 2BHTA 3DHWC 3JXEA 4WZZA 5EUBA 1JHXA 5AW5A 5B6PA 3BMNA 4B48A 4JUBA 3OLVA 1MJ5A 4EKGA 3U9SA 3TZ6A 5B58C 2V7EA 4GLJA 3MSXA 5C81A 1Y3AA 3NC4A 4IGFA 4X6LA 1UDCA 4M0LA 3G1TA 4YJ3F 4MVYA 5FF9A 3WGKA 2E18A 4OTZA 5BN3B 1VJDA 4IFEA 3BK1A 2QQEA 5EP2A 1GPKA 2JZNA 3FUCA 1DIAA 1OH8A 2REBA 2C2OA 5IJ9A 1NR1A 3H9GA 3MHPA 2Z08A 1H3EA 3W78A 4FR5A 1DE0A 4PLHA 5LN1A 1V7ZA 3AIOA 1R64A 3CMCO 5JVDF 3DAHA 3EEIA 4PAGA 4G0NA 3WWYA 2I6XA 4FJ1A 3ONDA 1EGHA 4QBIA 4H17A 1O77A 1WDWB 3DDNA 3CF4A 5BR4A 3IEVA 1CZKA 4BFZA 4ZI7F 1SIOA 1WZCA 3U7RA 1JHVA 4RL4A 3G8BA 4LV8B 4TMXA 1JEYB 1U2GA 1PYGA 3DBOB 4KYIB 5DKFA 2HU2A 4PTYA 3A7EA 3HCRA 3AJRA 4BIIA 2OCDA 1U1DA 3T9EA 1M2VA 1BFUA 2WB4A 1L3CA 4HDMB 1AG9A 3DO6A 4WLVA 5A3JA 2YKGA 3F5FA 1SIBE 5L3SA 3FSRA 1XIVA 1O58A 2XLBA 1FNNA 3TIVA 3VDMA 1FVOA 4KIFA 5AI6A 4D9NA 5BR1A 3C5VA 4ECEA 4TKUB 3AILA 5EKSA 1N3IA 5FFFA 3MCUA 2VZ8A 3QF7A 4JGBA 2NVUB 4HT3B 1U7OA 3LVFO 4TKLA 1V3QE 4NWIA 2D7JA 1OXTA 1PZFA 1U2DA 3WIOA 4D4IA 1WF3A 4HDOB 4RPCA 3NT4A 1FFSA 3T7RA 2JJ1A 1C7QA 3ODGA 4Z86A 1WMAA 2I99A 2OB1A 4RTOA 4W5OA 4R1TA 1UXHA 1OFHA 1P61B 3CSDA 2RFLA 1TD9A 2FGJA 4QSMA 5REQB 3AT1A 4GVPA 4R2IA 3MGAA 1SKAA 5ALNA 3QQ5A 4W5JA 1SKUA 3E3AA 3PRKE 1UUFA 1X8LA 4QNNA 4B4VA 5BW8A 2VXOA 3PFIA 5AK3A 3HA3A 3REFA 4QHYA 2XNKA 3GN1A 3VZCA 3EIHA 1U3VA 2EDCA 3OEHD 5A4KA 4HRAA 4FMCF 2HTFA 2UZIR 3TLKA 4D3ZA 4ZDKA 3KRTA 4GW3A 3GLQA 1F8GA 3KB2A 3KTAB 1K3FA 2YQ4A 4I1YA 4RL6A 5IMBA 2OA0A 3HEAA 3WLAA 4EFLA 1NOIA 2OFFA 3WL4A 2I3ZA 5DWQA 2I1LA 1WR8A 1VI5A 1PQ4A 1WLSA 2JFNA 2X2PA 3KR0A 3UPTA 2QK4A 4RFSB 2RAFA 2DR2A 4J1TA 1W4BA 4MV7A 3RAPR 3K5HA 4B82A 4QBKA 4Q3NA 3VZBA 2QN7A 2NUAA 3M6IA 3QYFA 1LI4A 1QH1B 3GJSA 1HE5A 4BCCA 1H2ZA 4R5MA 5BN4A 5LDDC 2VJMA 4EG3A 1A82A 1ZIDA 4PQRA 3ROPA 5LUAA 2I76A 3CGWA 4UDXX 4ARIA 5IBQA 5KPDA 3R5KA 8ADHA 3U4GA 3WB1A 1Y8QB 3CVYA 2Y6VA 3TO5A 1W35A 3BSWA 3M1AA 5FOQA 1SH7A 5AXBA 3JR7A 1ABFA 3W2IA 2O2SA 4FEYA 1MPXA 3GFTA 3BXOA 1CJBA 4KBFA 1Z7EA 2DHCA 1FFEA 1NXQA 3CW9A 4N6NA 4BTLA 2DFNA 2PM8A 2OHJA 3RV4A 1KQNA 1PZGA 3QP9A 4CKWA 1X9GA 3Q1KA 3SYMA 3W3AH 1O97C 2QLMA 2YJ3A 1ZD8A 2CDCA 4HAIA 2BF4A 2OXIA 5JH7B 2P35A 1RJGA 2GSDA 1N7HA 3BHIA 3E05A 2Q28A 3NAGA 2PWAA 2Q27A 4FDAA 4JBXA 1RVDA 4O08A 4WXEA 4B2PA 2IYRA 3N05A 4HDQB 3S99A 4F84A 3GGSA 2X4GA 5ERGB 3BCRA 1JH9A 3Q3VA 1UJCA 5CW2A 1S2LA 2ZUEA 3MILA 1YTLA 2R1VB 2ZQ5A 1TLLA 1V7CA 3EFOA 3HMQA 1AK1A 3BULA 4PSAA 3HPRA 4BQOA 4LQDA 1P3Y1 2HA0A 4MV5A 5DJ5A 5HM6A 2VRCA 1YQEA 2ALJA 1J2TA 2J3IA 1YL6A 2Q41A 2XSZD 1U0GA 1KORA 3TQQA 3ZQKA 3N75A 2CFOA 1OLXA 1XQ6A 4M0CA 2FQWA 3EVDA 4TM8A 2IEAA 1ATIA 1ZZEA 4N7MA 1Q95A 3TLMA 4QO7A 2FVXA 3CRQA 4IIFA 3FM9A 4WLNA 2L42A 3T9FA 4EVIA 1K0FA 3LY9A 3V42A 4ZEMA 4GBGA 4C29A 2G8LA 1CUHA 1GILA 1SZPA 2HWKA 2OCPA 1XFDA 3RYIB 1ULAA 3S8EA 1L4LA 2R60A 1UKYA 3GHHA 3DW3X 3P0HA 4E1VA 5A0TA 4FGKA 4N65A 4M46A 3VVLA 2NT3A 5BSRA 1TKRA 2WPNA 4PS1A 3A8TA 3WLPA 5A5FA 4EG8A 4IZOA 5LQDA 1O57A 1GZ3A 1Q57A 1V5GA 2HLPA 3FYUB 4JYBA 4D9KA 1DBIA 4NBRA 1SCDA 4F5YA 3OE7A 2RAVA 3T5AA 2C83A 4S12A 3KHTA 2HK6A 1PR6A 2X9GA 3D8BA 2C5GA 3HDJA 3GMTA 5F73A 5JD3A 3TK1A 3SDZA 2E4AA 3BICA 3G2HA 4JQSA 5BV8A 4GMXA 4L5BA 3L0SA 2FPRA 3UJNA 3GLIA 1GTVA 3MGCA 3EEBA 2BGIA 2JB9A 4E46A 4WY5A 2ZSUA 4RXTA 3O1HB 2AW5A 1DZIA 5TQVA 3FTFA 2GJ4A 1J8MF 5B53A 5LMUB 2JJYA 3CZAA 3IIJA 4BGIA 2XGMA 2FA9A 3IBTA 5FO1A 3K0BA 4IDBA 3I1IA 4C2BA 4CEIA 1T35A 4CEHA 2GYWA 4Z4EA 1UT8A 3KQSA 4JI7B 3C5WP 4FJ0A 1NW9B 3ZV7A 3I45A 5DTJA 4AKEA 2GZRA 3VH1A 4E5KA 1RAEA 1G20A 1VE1A 4Z8XA 4LFBB 2GPSA 3MTBA 4JT2A 5DPMA 4UFOA 3WKEA 3QSGA 4OXQA 4CMCA 1AF4A 3NHWA 2RJNA 5KQPA 5LR6A 3O5AA 2GZ2A 3EBLA 3FYSA 1U99A 2IP2A 4FINA 3WSTA 5A4IS 4AT1A 4QGGA 3BWCA 1TYAE 3RSSA 4OBXA 1GGEA 1G17A 3KNZA 1N5LA 3L7KA 4AZVA 3MVEA 2Q8PA 1L0BA 2FSVC 2E5WA 4ZVNA 3KVVA 1M2HA 1IE3A 5JXIA 2IEDA 4H7EA 4CMKA 4HTFB 1RXYA 2V0GA 2PT6A 4L3VA 1KO5A 3EPRA 3ZE2B 1DBPA 2XEDA 1AS2A 2WTAA 3K9WA 4EFMA 4TXHA 3NHBA 4NK4A 4C6TA 3U31A 1YHZA 2BELA 2JI9A 4YMHA 1L3IA 3DP9A 3NW9A 2APJA 4B8WA 3VVBA 2PUCA 4IDNA 4WVLA 4GP7A 3X0DA 5EIEA 1LDMA 1XMQB 4Y3UA 4DILA 1JN0A 2QU8A 3AZOA 3GGCA 1E1RA 2OHVA 1Z83A 3I83A 3KP1A 4R83A 4YXFA 2O2IA 2XZLA 4PRLA 2QAIA 2R751 3D2BA 1Z4OA 2WIFA 4A6PA 3TGPA 2FR8A 3AU8A 1FDWA 4N12A 4RKEA 2D7CA 2EJCA 3QJYA 2JRLA 4XQ0A 1X7XA 4UXIA 2R2AA 2RK3A 1X15A 5DP2A 4O4LA 1WBDA 5I7RA 2QJRA 3FTEA 2ATXA 1EBFA 2VL7A 2ZJOA 1QH0A 2R6GA 2GN2A 4L51A 5DSTA 4K40A 3T34A 4BEBA 1E3JA 2ZZMA 1JQJC 1LTHR 4BKRA 3NIWA 4TUYF 4Q9KA 3UW1A 3BAZA 1SK9A 3RC3A 4EFDA 4JQOA 4NZPA 4IFIA 2QT0A 3C98A 2WILA 4BWFB 3LY7A 4DRYA 5HBGA 1T5HX 3JZFA 1EVKA 4C3UA 1Q20A 3FTQA 4HMOA 3C3BA 5FUWA 4BRUA 5FNVF 4NJEB 1E8DA 4R1SA 5IJAA 5H8WA 3L77A 4RA9B 4DMFA 5JALA 4JMPA 3PNPA 1W4CA 2AUTA 1SBZA 3MS4A 4RY9A 1I8TA 3PCTA 2YFKA 2O8CB 4ABYA 1ZD9A 4QYMA 3VHXB 2YFHA 5EJEA 2Y0DA 3EXAA 3WA7A 5ALYA 2XMBA 4G0ZA 2EQAA 2HJWA 2IP4A 3M4JA 2YWJA 4OMFG 1T9GR 3HI6A 3NBZC 4HNQA 1DU4A 5SY9A 2O5RA 2GRJA 2Y92A 4GQAA 4PZDA 4YLYA 3BE6A 3UZUA 4RDIA 2I7VA 3OPMA 1JJAA 1PFWA 3L5KA 1G3QA 3WNCA 4EI2A 3T3OA 2J3EA 3IAXA 3IQZA 3QU2A 5K8CA 3MT0A 1NJGA 4M1EA 4BO2A 4ZVSA 1M7GA 3G3EA 2QAGC 1B74A 3NYRA 4RV5A 1KOLA 3GMSA 4HN9A 4BV9A 5HIAA 1RQLA 2OOSA 4YR7A 1NVXQ 1LZLA 3ON5A 4LYFA 3ULKA 2IOFK 4XTCS 2NU9B 4TX1A 3BDAA 3EZ7A 3TJMA 1KDVA 5AHXA 2ZAYA 5CIWA 4RHUA 5AI0A 1J42A 2XBMA 4GNRA 2P11A 1X9IA 1SCBA 2P6UA 3DV2A 4KMMA 4FM9A 3HB4X 3KYDA 1U9YA 3EQZA 4RSMA 3MLEA 4B33A 2J9FB 2VHCA 2XAUA 4UOZA 3NPMA 2R6DA 2G88A 3F6YA 1NP6A 4BFLA 3HADA 4DXHA 2CB0A 4QATA 3E8XA 2J33A 1R0YA 2HK7A 1QIIA 2CVZA 4F7DA 3EGWA 3PFKA 4MV8A 2W2KB 1PT9A 3P2KA 3AHDA 3FYTA 5LA6F 4BO1A 5EIXA 2ONKA 1CXZA 1XTQA 2IV2X 2NYRA 2W4IA 1QP7A 3RS9A 2YBDA 1P0IA 1T4DA 3O9ZA 4TMYA 5CXSA 5EZSA 2VT3A 1QE3A 4DR3B 1LRLA 3PDHA 5C31A 3HYTA 2I0FA 2NZWA 3PQ5A 3C6BA 3CUTA 2A0KA 3THWA 1RW4A 4NY1A 5YASA 4OP3A 1I7PA 2VYCA 5KUTA 2AMVA 4FFBA 5EJ9A 5AK6A 3TB4A 1PN3A 3VVCA 2QT9A 3ZV5A 3KOZA 2FPIB 3FSGD 1K06A 1H2RS 1LBIA 1N1EA 1OI4A 2R87A 2XQVA 5KCMA 1RMYA 2PVCA 1WA5A 3LFHA 4E6PA 5L7WA 2QQ5A 3TVYA 1Y33E 1EP3B 1RVV1 2XUAA 1UFRA 5BWNA 2BR5A 5JRZA 2G5GX 1GV0A 2AOTB 4J0HA 3SY8A 4U00A 2YRXA 1W1WA 3JAWA 4JWTA 1RXCA 1XCJA 5JD5A 3A2MA 3DBLA 4MQFB 2ILTA 3ENNA 1JYEA 2FUG1 2Y4NA 4MINA 2HTEA 5DHRA 2DBYA 2IL1A 2P3OA 4B6JA 1N2EA 1RPTA 1WO8A 1VMKA 2CC2A 4XWTA 3W9SA 3UJ6A 1UBGA 2NZYA 3UK0A 2FOXA 1LNSA 1Y8ZA 1L5NA 2UYYA 1E5QA 3KEGA 3SR4A 2G67A 4QGFA 2MINB 2W70A 2FWRA 1UPFA 3SQXA 3FRIA 2VRBA 3IODA 3A1VA 4J75A 1Q3KA 1BJKA 4RHFA 1IM8A 2EJVA 2PKQO 4CIYA 3CY6A 5JYEA 1OF1A 2GEKA 2WFLA 2NU7B 2AI1A 3FRHA 2WB2A 1JB9A 1UM9A 1X92A 3GGGA 5FI0B 3I3OA 3P9KA 1ZXXA 2IHYA 3ANMA 3LHFA 4L15A 4Y6SA 3JS5A 4PNEA 5G4LA 3BF8A 2OXEA 1RRFA 4JLDA 3TTTA 4YRLA 1TVMA 1BIFA 2QPTA 1O6CA 2CHGA 1X80A 2BEWB 1A9RA 1NJSA 2CXSA 3TVDA 3FNFA 1EX1A 3D6UA 1EGMB 2SICE 3BMXA 3DNFA 4MQEA 3Q8LA 2C7RA 3UT0A 5ARDA 1UR5A 2RC5A 3T15A 5LNK6 4FHCA 3PFWO 5MDHA 1UOQA 1Q6YA 4UE3S 1TL7C 1MAAA 1QORA 4P7GA 3SFVA 3DEIA 5H4HA 2BM8A 1QV7A 2G4LA 2W2PA 4KQJA 5KU7A 4QO8A 3MJRA 1R8SA 3DEAA 1PYOA 1ZONA 3MSCA 4Q0MA 4ZQEA 4AJLA 4PG8A 4WECA 4WGGA 2QP9X 1DFIA 1RQ7A 1FFDA 4M54A 3RUCA 2WVGA 5IDWA 1QC5A 3BXEA 5CA0A 3P9IA 2D2VA 2ZI9A 1J2YA 3TL3A 3C4VA 1HT2E 2O3RA 3QJGA 4Q19A 3DDCA 4E14A 3DH0A 3VO8A 4M4SA 2ENWA 2XUGA 1DWPA 2Y6UA 5JC8A 4FD2A 2X7XA 1T8RA 2P40A 2EIXA 5D2CA 1Q74A 2ZI5A 5ALOA 3FPBA 1E2NA 2FQQA 1WSAA 3ADOA 1SHUX 3MJTA 1X7WA 3FGOA 1L5RA 4RJJA 4YBRA 4UM8B 4ZOCA 5K99A 1SXPA 4BO4A 6Q21A 1O95C 1IK4A 1XA0A 1I1QB 4EFKA 4DQUA 2HCBA 4Z2AA 2QE7A 1UJ6A 4TMKA 3RIEA 3GJ5A 1QYXA 1ABBA 1UKEA 4F9TA 1UKVY 3M1IA 1XKLA 1TK9A 2W98A 4R8RA 3CNBA 5CCXA 3IILA 3HHPA 4Q4AA 3WO0A 4FGZA 4I66A 5G53C 3QRWA 1X1RA 4DC1A 1QIKA 1G4HA 1Y5RA 3UWMA 4LZZA 4V24A 4B2YA 3DVRX 4MEAA 5H80A 3UM9A 2BKXA 3K09C 1Z6XA 3H7IA 4TTSA 4O4IB 4CMJA 5CEFA 1ONBA 2YY5A 2OZVA 1OT5A 1U7DA 4MUYA 3ZE6A 4EB8A 4XOUA 4AC9A 1GM5A 1Y4AE 3LQ1A 3Q87B 2ZRLA 1WPRA 3ZNOA 3PUYA 4X3CA 3DUFB 4RWZA 4NCBA 4AMUA 4BQFA 4FZ5A 4HVAA 1ESDA 1WHTA 1OR8A 2QE7D 1MV8A 1DO8A 1PGQA 2Y1LA 1RPJA 4MI6A 2I55A 3O8LA 3SE0A 4F8EA 3BUSA 1GD1O 2DAPA 3CEPB 1QCDA 2AX4A 4L8WB 1N2IA 1KKMA 1I6WA 2H48A 3A6KA 2DGDA 3BB3A 3HNOA 2Q7OE 2J87A 4TYWA 1HMYA 3B1KA 2P6OA 3JYNA 3P4XA 2XT9A 3TW8A 2O07A 3LT4A 3O0DA 5AM3A 3B2EA 4YAGA 1ES9A 3EF1A 4B5LA 2QTHA 1JKJA 1E1QA 1SA0B 2PMDA 4Q4LA 1DIGA 3FAKA 4QJ4A 3TDKA 3GEHA 4QPPA 3ZY6A 4ROTA 2NZUG 4MKRA 3RWMB 2BMDA 3FROA 1C30A 4YMLA 1KARA 2KSQA 4MW7A 5B2FA 1SWWA 4ZTUB 3ITDA 1C3EA 3RREA 4DUGD 2IYZA 2ASVA 2Y66A 3L8DA 4UEJA 4KPFC 2Q1XA 2TRSB 3T35A 7MHTA 4GKVA 3VX3A 4PYKA 3FPAA 3PA8A 4JVNA 1KIFA 1S2IA 4XGKA 4ZGWA 4C4ZA 1P5JA 1ND6A 4C08A 1GLNA 1O97D 3AQ4A 1NMYA 4F4DA 4RTRA 3LBIA 5DWDA 3SE7A 1BYUA 3R3SA 1DBVO 1H4SA 4M0KA 4B31A 5A7GA 2VP2A 3CW8X 1HYQA 2CEKA 1J0DA 2HBYA 4YJFB 3FTCA 4YFYA 3K72B 4H4CA 2FDRA 3QX7A 3GNLA 2VNKA 3GFFA 2P3SA 1U5BA 3HBNA 4IUCS 5E7MA 1UMCB 4RSRA 4HLQB 4BMPB 4F6LA 2VUIB 3IAAA 3NTRA 4PQFA 3CZ5A 4KVAA 1E2MA 4IIBA 4TRJA 2BI7A 4JP8A 3UJ9A 5IBRA 1SUCA 1IIRA 3LO5A 3DJFA 3SC2B 3FPHA 3UJPA 1A72A 3TUZC 2XCOA 5CPFA 1OXBB 1RZRA 3AV3A 3I72A 3W6PA 2AMJA 3K9GA 5L3RA 2O7VA 4IG4A 2ERCA 2C94A 5SZHB 5TMDA 5BW5A 2WM8A 3BZUA 3KAJA 2EJUA 1LDYA 2XF8A 3MQ4A 4AQYB 3ERCA 4ITUA 3IUNA 3VR3D 1OX5A 4BX9A 1W2WB 3W5HA 2DFTA 4PYMA 3ONWA 4S3MA 4HVTA 1K6IA 1G5HA 3A2LA 3JD4A 2VCEA 3P0RA 2YYYA 1VSBA 4FNAA 5E2BA 3WGQA 4B2LA 4LVCA 1XXHE 4DGSA 4JR1A 2GKSA 3O4IA 3JAMA 1SHZA 1ZA2A 3OQBA 4NZZA 2AOUB 4NONA 1IY1A 1DAPA 4P86A 4P08A 1T1SA 2PGLA 3BA1A 3K1AB 4L2IA 1DKRA 2EAUA 5DI3B 3E5MA 4EUHA 2AUMA 1RZRD 2LZ0A 5IFKA 1CQPA 1YQQA 2Q9UA 1XVVA 4K6MA 1BS1A 3ZVRA 2X4LA 3PXCX 1NC1A 1MJGA 4CLXA 4P0PB 4NU6A 4YYZA 2O59A 3R74A 4DLRA 4NU8X 1LJ8A 4ZAGA 5BY2A 2PLFA 1X7ZB 2FSVA 3G0IA 4DDWA 1QQ5A 3I9NA 2H1FA 3L0BA 3UUFA 1TQHA 1OV6A 1B15A 2Q4EA 4M38A 1AKNA 3UKDA 1KQGA 4DB4A 1NBMD 1WMDA 2QTFA 3JWJA 1N6RA 5AKEA 3TLGB 4UHKA 1EUCA 1GT6A 2W2XA 4OQEA 1TEZA 1T0IA 4YAWA 5JJCA 1K3UB 4U2GA 2OY0A 1VG0B 5JJBA 3R5JA 1S2OA 4HWKA 4XVQA 5LC1A 3I6MA 3HGTA 3PGMA 3ZIDA 5DTEA 4NE9A 1QDUA 1JDPA 3IP6A 2DB3A 4QD3A 2OXCA 3BJZA 3TQRA 3ZGYA 4INZA 2W8BA 2A94A 3ADDA 4CN9A 2PZMA 2A9FA 2JVJA 2WM9B 2X41A 1PR0A 4B79A 3AUUA 4A0HA 1WMEA 2CXNA 3GZNB 3IO5A 3K8ZA 3GLGE 2VNJA 5JNRA 2AFIA 1CRQA 2Q0HA 1DQZA 2OHHA 2WSIA 3EGCA 4MZDA 4YMSA 3RHTA 4DCJA 3R9WA 1UBSB 1W96A 3ZBTA 3WQHA 3DAFA 4YAIA 1KOGA 2DR0A 1LLUA 2CYBA 3F4BA 4QBFA 4Z9FA 2PD3A 4X8OA 3FYDA 3OX3A 1JA1A 4NYMR 4KQIA 4RS3A 1R8JA 4BAUA 1U0BB 2V0CA 4L6CA 2ADMA 5JSQA 4XSHA 2YWCA 1AMNA 2XNDA 4A8PA 1C4XA 4O29A 1M54A 4LMAA 4TSFA 2X0EA 4BVBA 1PR3A 1OX4B 4PYNA 3ZXYA 4CQLA 2ZCUA 3RYTC 2GNAA 3AW9A 5K6AC 1JE1A 3A9WA 1EP1B 3OC0A 2AKEA 4EUFA 1HMPA 2AG1A 2FP3A 2PZLA 4I1SA 1Y6QA 4AROA 2A5YB 4KQ9A 3K53A 3BGWA 3V7YA 1AUVA 1RKXA 4INAA 2O0MA 4IIJB 4XPIA 1L5SA 3CNLA 4F96A 1OWLA 1UBCA 1A4XA 1UK8A 3OU7A 1QQAA 1YK1A 4LZOA 1D1PA 2CDBA 1EE2A 4RK0A 1C0KA 1KAEA 1RXSA 3V4LA 7REQB 3VUEA 1CRPA 4YP7A 1U6KA 3KV3O 4DZRA 4P35A 1O4WA 4QOIA 2R6AA 3HJUA 3OM0A 1FQWA 2QRGA 3TOSA 1UAAA 2ZTMA 3R3XA 3V7FA 1VQ1A 4RMNA 2ZRKA 4H16A 4YI3A 4K88A 1VE7A 1R5OA 4N4AA 2XNDD 5LDHA 4TSFD 3NUGA 3E3LA 1O5OA 3VU0A 4I4TB 3ZPXA 1MXHA 5FI5A 3WKBA 1E2JA 5BR8B 3R3ZA 1MB4A 3EMKA 3VOAA 1HNZB 2FJ0A 2WSSD 1V26A 1UXGA 2F64A 3OTWA 1PVDA 3RYHB 1YR7A 2H1HA 2MWMA 2FK7A 3LUHA 3KWMA 4IIVA 1JAHA 4J0EA 2RCNA 3T5TA 4C05A 5LLTA 3ZDBA 2IEGA 2QAGA 2I03A 1TCAA 5IJZA 3EVAA 4E33A 4UQOA 1X0XA 5JO0A 5HP4A 4BNDA 2VBGA 3OFSA 3ML1A 4GWGA 2P9ZA 5KQSA 2ZKLA 1GXSB 3RG2A 4ZOLA 1WZUA 5JG7A 2CMFA 2F3UA 3ZCXA 4TTIA 1PTKA 3SFTA 3WJAA 2Q9CA 2EF1A 2RARA 2NZXA 3KSMA 1O03A 4AQDA 5KQGA 1NDUA 5I9IA 3R0JA 4X1YB 4XXHA 1QRDA 3AIMA 4GL4A 4FFLA 2V55B 1O4VA 2CLFB 4JUAA 3WS7A 5DN6A 2BUBA 1WZIA 5A5GA 3C8DA 1GN9A 3L4JA 3HM2A 2V1XA 3C0KA 1XZDA 5DNEA 3MUFA 4KOAA 1SC9A 4L0MA 3VJLA 2MSNA 3ZZUA 1DQNA 1ZNQO 2ZRPA 3BCUA 4CF3A 4DPLA 5A6SA 3ASUA 2JC3A 3ZWPA 5AW1A 4R54A 1DJQA 2ZB8A 2ZTLA 4HQLA 1AN9A 5DEOA 1MC1A 4G0XA 3DR3A 1QWOA 2I6GA 3Q3HA 1VB3A 4LYDA 4WOJA 1S3FA 1ZEJA 3MWFA 4ENPA 1XAGA 2WWXA 2IZ1A 4DIUA 2IHZA 1N2JA 1E7QA 3CVJA 5LP1A 4S24A 3EZLA 3GG2A 4G1UC 2JRCA 5ENZA 1YFJA 1DC8A 1TVKA 3ZZ1A 4ZU3A 2W8ZA 1QJ4A 5D87A 1YUNA 1H1DA 1SC3A 3VR6D 5IBCA 4N76A 1ST3A 1BJRE 4D57A 1Z25A 1BMDA 1GPDG 1Y6ZA 4EJSA 1PK9A 4M1MA 1E1LA 3GARA 3KPUA 1DKMA 2HZBA 3KQTA 3TZEA 3SK0A 3ZDAA 3K5PA 3QKSA 4DV7B 3QPBA 1X70A 1PDWA 3WMWA 3EQ6A 5K9ZA 3L9WA 1HYBA 3MMXA 1EM6A 5AP9A 1J25A 2Q5LA 3COWA 4C78A 3UK1A 3HI4A 3TG2A 1Z63A 3L1UA 1VZ3A 3NYIA 3NV9A 2IYQA 3N2GB 3JWHA 3VV2A