1S1CA

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
total genus 59
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s1cA00
2J0VA 5EP4A 1P2TA 4Q4HA 1KO8A 2UZ3A 4X8HA 2PX3A 2AFIE 3A4NA 2OM2A 4RFSB 3V00A 5L3SA 1Z0AA 2DFKB 4ZIRB 3WP1B 5FTMA 3FMIA 2CVFA 3GMTA 4O3MA 1OHHA 2IYYA 3IILA 4FXPA 4LV6A 2VF8A 2OCAA 4JBXA 2D7CA 1COWA 3H84A 2NPFA 3GEIA 3K1JA 3LWNA 2CNWA 3P32A 1OKKD 4M9QA 1XP8A 4HAXA 1KKMA 2CBZA 4DC9A 4D2IA 2O8FB 4XWOA 5FH9A 1N5LA 2A5YB 3CF0A 3EIQA 4LBYA 4FCVA 3HDTA 5FBWB 3D8BA 4XSGA 3EWSA 3M4YA 3KQUA 5KNCA 4GOKA 1SXJE 2CK3D 2IXFA 2ERYA 4RZ3A 4HLUC 4KSCA 1E2GA 3QPUA 2J7PA 4TSFA 3MJHA 2O52A 4QHTA 2HCBA 2RGNA 4ZV4A 2ZYWX 2ZRDA 2C78A 2EU8A 2EYUA 2QRNA 4G01B 3U44A 2PZFA 4AG6A 1EG7A 2E87A 3NDPA 3FPAA 4GDFA 1P62B 2IW3A 3ADCA 4WIAA 1MRNA 2IF2A 5FOTA 3RNLA 3UATA 2CLSA 3BIFA 3HPQA 5GVRA 1G7TA 2R62A 3B1ZA 5L3QA 2JCSA 3EPKA 2XITA 1NI3A 4QXAA 1S0UA 1R2QA 2BWJA 2I4IA 4DLZA 2OO7A 4R71A 1V5WA 3K0AB 1PUJA 1KO1A 4H1UA 4B6EA 2JLXA 2WJGA 3O8CA 1IN7A 3OIWA 2ASEA 1CJMA 4E03A 2WWXA 3ZVMA 3U3JA 3K09C 2JLVA 1ZVQA 2DWPA 4U02A 1XMIA 3DHWC 1ZNWA 4HB2A 4B71A 1CBUA 2ZRCA 4LZZA 4JLOA 4DZZA 5JLJA 4C0LA 3G0HA 3QXHA 2ZRBA 1Z0JA 1UPTA 3JZMA 3KXKA 3L0PA 4FI3C 4PHTA 4DDVA 3AKCA 4TSFD 4UXHA 4TWZA 2X19A 2GVZC 5G40A 4HI0E 3VMFA 2HJVA 3KTAB 2IL1A 2W0MA 2VQSA 4I4LA 3W3ZB 2CXXA 4RD1A 3VHXA 1E1QD 1ZIPA 6Q21A 1QVRA 4KU4A 5FL3A 4DSOA 3QF4B 4ZDWA 621PA 4GOXA 2VHQA 2ZPTX 2GF9A 3LAWA 2DFNA 2P5TB 3NHAA 1KSJA 1AA9A 5D3MA 3CRMA 5BYJA 4NYJQ 3GJ8A 3SNHA 5IHPA 1K8RA 2BV3A 2VH5R 4RCYA 4CRWB 1GKYA 1RE0A 2JLUA 2SHKA 5TXGA 2HCJB 3MD0A 4JVLA 3GFOA 2JEOA 3T06B 3KB1A 1J90A 5FOSA 4DIEA 3C4JA 2XZOA 1W5TA 2RAPA 2QENA 3MAAC 3RLFA 4BFSA 2MSDB 5GVSA 4PQFA 1KI8A 4MGKR 4OHVA 3BH7A 4OI2A 3VX3A 2QP4A 5GADl 4Z54A 4P33A 4V0ME 4MKFA 1V43A 5CJPA 1E2NA 3RRYA 4Q01A 3CONA 2J41A 1DAHA 5CB8A 1IOZA 1OW3B 4Q9KA 2GJAA 2ODEA 2W00A 3KKNA 4TLAA 2ZS8A 3ZLJA 1A82A 1OH6A 3R20A 2F1IA 4PFSA 2HEIA 3UXMA 4JYCA 4RZUA 1G19A 1KMHA 2Z43A 1LFDB 4NYMR 5KDOA 2JLWA 1P6XA 3RWMB 4GZLA 3NH6A 4LUCA 4EPYA 1FX0A 3TVTA 1RRFA 4DB4A 4NYIR 4NCIA 1XEWY 2ZYUX 3EXAA 4NHOA 5TV2A 4Q48A 4QKQA 2ZM5A 2JATA 2XZPA 2J0SA 1XTSA 2FH5B 2RKOA 2D2FA 1DG1G 3T15A 3I73A 2Q9BA 4G0NA 1TQ2A 4PPQA 5CIQA 5JEDA 4TLBA 5KPJA 2GAAA 4LJ4A 3KXLA 1DARA 4KYIB 4P4TA 1CR2A 2WIBA 1G6HA 4OHZA 3MSXA 2GRJA 2P0EA 1AQYA 2OE2A 3EZFA 4Q4JB 4AC9A 3E5HA 1F5NA 1U98A 1Q22A 4QGGA 4B3DA 3LA6A 1YR7A 3IIMA 1NY6A 5LPNA 3O8RA 1E99A 4X8LA 4Q21A 4M53A 1IN8A 1N6OA 4FCWA 2QBYA 1I2DA 3FKSA 2QMUA 3QEOA 3VNUA 1PVOA 2WICA 1D9XA 1W0JA 4HLCA 1XTJA 4MUBA 4WZ6A 1KKLA 4M1TA 3TRFA 3ZS8A 3K0CA 1NMYA 4JSTA 3KKOA 3CF2A 5JS7A 4NONA 2ZJ5A 4ACBA 3UK6A 1U81A 1E9DA 2AKAB 2BHRA 4BEBA 2QI9C 1LS1A 4M9ZA 1GIAA 1DADA 3TSZA 1NY5A 2WIAA 4K46A 3N2IA 1E1RA 3I32A 3CNLA 2HLDA 4JL5A 3TLXA 3PFIA 4IOLA 1WBBA 4C0BA 2GZAA 4Q1CA 4TTRA 2ANCA 2O8CA 2AKYA 3THXA 2ZJBA 1E32A 3GLIA 1YRAA 4UXJA 1XPOA 1HV8A 1S4QA 3QKSB 5SZKB 1ZCAA 1UFQA 5JRJA 2JLRA 1HYQA 1KJWA 3MCAA 3QXSA 3NBFA 1XWIA 4ZCIA 1KI6B 4OI4A 1GWNA 4V02A 5CDFA 1GL7A 1N5JA 3C5HA 2PJZA 4MKGA 1ZAKA 3RRMA 5F9FA 1D8TA 1OXSC 2VHCA 2H5EA 3A8TA 3FKSD 2FA9A 3IPYA 5FUWA 5EZ5A 3U2QA 2QA5A 2C2HA 3TSOA 3UMFA 2D4HA 4D26A 1G3MA 1MR3F 2XB2A 3FE2A 1GRQA 5F9HA 3K8YA 2J46A 2PMDA 5LB4A 2WWFA 3KFXA 5AK0A 5FR1A 3UANA 121PA 4HUTA 1W0KA 5HE8A 3AVXA 1T4GA 3AVTA 3CX8A 1WDTA 1N6HA 2RGBA 1J7KA 3WRYC 4DLYA 5EXTA 1SVWA 4IEEA 1VG9B 2V3CC 5SZHB 3DVLA 3MWYW 2GETA 2QQEA 2DCUA 4P4SA 4P4UA 1D5CA 4OL0A 1BOFA 4DXAA 1VDZA 4CEHB 3GLGB 2VHJA 1QF9A 3AVVA 4OQNA 5JSZB 1Z6AA 3GEEA 1TMKA 4XOIA 4F7WA 1Q57A 2B6HA 4MRSA 3AVUA 1DAIA 1KI7A 3NC1C 2RGNC 4XVQA 1SXJC 3LXRA 3K70B 1J99A 1G9XA 4OQXA 4KFUA 4URXR 5KSZA 2IS2A 2HUPA 2WSSD 2R44A 2FFBA 2JJ8A 3U7GA 2VTKA 3MG9A 4E09A 3PXGA 3DM5A 5EP2A 1ZCBA 1X8LA 2FSGA 1D2EA 2C9YA 1N25A 1Z6TA 4HYYA 2VP5A 1TADA 3OAAD 3FFBA 4Z51A 1KDRA 1N6KA 2HYDA 3ZZTA 1LB1B 4RD4A 4TLCA 1H8HD 4M1SA 3RYTC 1MOZA 3NIBA 3AH8A 1RRGA 2KBEA 3U5ZB 3LQQA 2DB3A 2GKSA 2W6JA 4QC2A 4O0MA 4PPGA 2IHYA 4LOAA 1Q3TA 4CW7A 3I8SA 3TUJC 1U94A 3X2SA 3FMPB 5F2EA 1Z83A 2GNOA 2NO7A 1A2BA 1DAGA 3WNCA 5AUOB 1JEEA 3I1FA 1NN5A 5CM9C 1Q0UA 4IKEA 5EUQB 2PT7A 3KXIA 4Q47A 4NPHA 4OK3A 2C9CA 1MO5A 2GTPA 2WWGA 1R5BA 4OHXA 1ZD9A 2WSMA 1T3SA 3BB1A 2FPLA 5P21A 3PUYA 2H18A 5FL7A 4KVGA 1A4RA 5KUTA 2JLQA 2B92A 1E79A 2DHRA 3AUYA 2O8FA 3X1XA 1AS3A 4HDCA 1G291 2ZU0C 2BBWA 2I1QA 3QI2A 4WZAE 4C7OB 2QZ4A 1R8SA 3NBXX 3FTQA 4AKEA 4CEIB 5B64A 5G41A 2FOLA 4GOJA 2UVQA 2W6JD 3REFA 1CLUA 3QKTA 3REGA 1E94E 2GCPA 2C77A 2ZJ8A 2AK3A 4WXPA 2ZVPX 4BLPA 2WWWA 4JVSB 1NKTA 2RMKA 4JSYA 3HP1A 3FGNA 2IYQA 3U7FB 2C99A 2J59A 4NYJR 3IEVA 1VIYA 1ODFA 2QAJA 4ZIRA 4FMCB 1ZM4A 4G5OA 2X77A 3WP0A 2F3RA 5KU1A 1E1RD 4ABYA 3H86A 3LH5A 1U2RA 1EX7A 1S2MA 2JJ2A 1DAKA 5JECA 3K9GA 5K8IA 4ASUA 2IF0A 5EE0A 4XH9B 3UWKA 3T34A 1KK1A 2AWOA 3A1VA 3SYNA 1JBKA 4CEJB 1ZRHA 1VYUA 3HU1A 2VLIA 5F98A 2P65A 2Q3HA 5L3QB 2ZI4A 2YVUA 4NBSA 5H8WA 4C3ZA 3TR0A 3TR5A 2Z0MA 5C2JB 1NIJA 4F91B 1DG3A 1YR9A 3QVVA 2PL3A 1CJTC 3KKPA 2OBMA 4WVFA 3B7GA 2RGDA 3WXMA 4RD0A 1AM4D 1VYVA 4AKIA 2ZS9A 2RB4A 1CJKC 1KGDA 3QUSA 5E7MA 4EFMA 4LYFA 1AS0A 2ZRFA 1GM5A 3B1YA 4LPKA 1N6NA 3GPLA 5LB2A 1MO3A 1P75A 4LHVA 2DY1A 2VRWA 2VPPA 1XJQA 4TMZA 1E9AA 3WHLA 2CJWB 2HV8A 4BGDA 2CK3A 4KCGA 4TQ9A 1DOAA 5DIFA 3QF4A 1P60A 5L8VA 2QMHA 4MITA 3IEUA 4NTZA 4FN5A 4D0NA 3CB4A 1U8YA 4PR0A 3UG6A 4MYHA 1E9FA 3QKRA 2KI5A 1WQ1R 2AD1A 3ZQ6A 2V6JA 2LWIA 3P1JA 4KLZA 1E3MA 2GHIA 3R9XA 4D6PA 4LV8B 4F4IA 2Q9AA 3VNVA 1QHSA 5TARA 1M8PA 4TMVA 4ZDIA 5AUPB 2J87A 1UBCA 1UDXA 2QMOA 4JLBA 2IWHA 4PQYA 4IVRA 4XTRA 2CCKA 3AUXA 5J4HA 2ODNA 1FL9A 5FI0B 4R2IA 1Z47A 3BFVA 2BMEA 3IQWA 2FF7A 4GP7A 4Q1AA 4DUGD 4BEJA 2WVJA 4TT3A 2DWQA 2A2ZA 4C9BA 1FZQA 3NC0C 4GRAA 5FTLA 3GLFE 2XNSA 1BYIA 4CT5A 1R10A 1NMXA 5IK2D 2IYUA 2V54A 1G3RA 2FV8A 5BQ5A 2FX3A 2WJYA 4Q4AB 1FTNA 4HB0A 4BUJA 2RGAA 3TBKA 2OCYC 1R8QA 5L3VA 1H8ED 1BYUA 1KZ7B 2DFTA 1B23P 4DHEA 2B7BA 5FPKA 3C16C 2F7SA 1KK3A 2C04A 2KE5A 3MWKA 5CJ2A 3WNBA 1P9WA 3CNOA 4US2R 3WMFA 2V9PA 5FTJA 2F9MA 4BASA 3LX8A 1T9HA 2PCLA 2QY9A 1MRSA 4MKHA 1CR0A 1VHTA 4TT3D 2ZIAA 4AWXA 4Q1EA 3QEJA 4LGMA 1BIFA 2YWGA 3PUZA 3LW8A 5DNYB 1CR4A 3AVQA 1VG8A 4JLNA 2QAGA 5G3YA 2V55B 1Z0FA 2RGCA 3CKLA 4YXWA 2CL7X 3K9LA 1Z8FA 4LBZA 2J0UB 4A36A 4FD2A 1KMHB 3RS0A 3DDCA 2HT1A 1YVDA 2FEMA 2IYRA 2YINC 4RZXA 3OF5A 1G3IA 3PQCA 3NBYC 1KI1A 4V03A 2OAQ1 2DBYA 1MH1A 1J70A 5FI1B 3SC3A 5IDVA 3A1UA 1WA5A 4AI6A 5FPHA 3L0OA 2XTNA 4DDUA 1M1YE 4GP6A 1I4DD 1NIPA 1S3GA 5DHFA 2MMGA 1E9RA 1XXHE 3FMOB 2LKCA 2CEAA 4PZZA 2CLDX 4QGFA 1KK0A 2ZUDA 3Q8XB 3KKMA 4O25A 5EXSA 5H70A 2GESA 5IRCD 2REXB 3QKSA 4DKXA 5A4JA 1E0AA 1XFAA 3SEAA 4QNMA 4PO9A 1EFTA 4GL2A 2FZLA 4PHFA 2LKDA 1KO5A 1KDPA 5A0FA 3DPUA 1R0YA 1CTQA 4IVQA 1YE8A 1M74A 4I81A 2WV9A 3MRSA 5FPTA 4GFDA 1AGRA 1B0UA 1N6PA 1QHYA 1WF3A 2O0KA 2ZU6A 3A1SA 4ITRC 4PC3A 5CIWA 2JGNA 4BLOA 4YXWD 1OT3A 4IDHA 4TQUS 1WB9A 4Q4AA 3CW2A 4N0DA 4WA7A 3GCGA 1Z08A 3PCRB 2VP6A 2NO6A 1W44A 1AKYA 3UWOA 2C98A 5AR1A 1CS4C 1QG4A 3RC8A 2FFQA 3PG5A 1W0JD 4EIWA 2YWHA 4DWJA 3BH6A 1OXVA 2EW1A 2VHUA 1TF7A 3LBIA 1F3OA 2AD5A 2BDTA 2IUUA 4KITB 5CK4A 1JECA 1LY1A 4M1KA 2GEUA 1KJYA 5H68A 2YC2C 1FUKA 4CZ2A 4M1OA 1GUAA 5EE5B 2R8RA 521PA 1G5RA 1Z28A 2YJTD 1Q1ZA 3V9PA 1G3QA 3SYKA 2ZI9A 1E2QA 4Q7KA 5EE1A 4P4SB 2CVHA 3BFXA 5HPYB 2RHMA 5C18A 5BW8A 2QAGB 4I1VA 3GLGA 3VAAA 1Z29A 1YRBA 4P31A 4LX0A 3RRNA 2J0QA 1M6NA 2ORVA 3BBPA 3KFVA 2WKPA 1E0JA 1FMJA 2J0UA 4M1YA 4IW3B 1JAHA 1L8QA 2VO1A 5JSZA 4D4JA 4QFMA 1U9IC 2RGGA 1AZSC 8OHMA 2O0HA 2PMKA 3K0CC 3WBKA 5HTKA 4DDTA 1N6RA 1KJZA 2ZI5A 1M7HA 3DZ8A 1GZSA 3SJAA 1T5LA 1FNNA 1II8B 1ZYUA 2ZSAA 3EZ9A 3BOSA 3H1TA 4KSBA 3ETLA 1YZKA 3HYTA 3LY5A 1OFHA 3ADDA 3QPVA 1AIPA 2EYQA 1AK2A 2FN4A 1UKZA 3RSOA 4PC1A 2WAYA 3QBTA 4U5XA 2F6RA 3CM0A 2QP3A 4C30A 4GMXA 4PZLA 3CZQA 1II9A 1E96A 2QTFA 4KXFB 1TUEA 4TTPA 1GILA 1KO7A 4L4UA 4DUGA 5FUVA 4XVUA 2GCNA 2ZYVX 3Q85A 3ZVNA 3M0EA 2WOOA 1U0JA 3PR1A 4BRUA 2WWYA 3EPJA 3ZD6A 1S96A 3RSLA 2ORWA 1OYYA 5FR2A 2EWWA 5GJBA 5J4YA 3Q72A 2QEQA 1PV4A 1E2MA 3L0IB 3O47A 2YYZA 3UKDA 3R9WA 1RFLA 3ZVLA 3U7HB 3CO5A 1D2MA 1DE0A 1F6BA 4ILEA 4PZYA 1XZPA 5TY0A 4V0KA 5FBRB 3I5XA 4XD7A 4Z1MD 3A4MA 4B2IA 2QPOA 2VP0A 3CRVA 3L8ZA 2FMXA 4LK2A 4IDQA 4A9AA 4C4PA 4HLQB 4DLXA 3PEUA 1JNYA 3ADKA 4I1UA 3CWQA 3BWDD 3VR4A 3K09A 3QXCA 2G88A 4YDSA 4FIDA 3T12A 4P0TA 5EP1A 1VPLA 1P2VA 4IOMA 4QBFA 2ZQ5A 2OLKA 1Y3AA 2Z6VA 1NN1A 1Q1EA 4II7A 4LHYA 1BS1A 4N0EA 1M2OB 1IXRC 4M1WA 4M8NE 2X8AA 1KI2A 4CEIA 1RRCA 5EJEA 1NVXQ 1ZIOA 1R5OA 2IXEA 2EFCB 4TYNA 3ICQB 4MGZR 1G20E 3R8CA 2BIFA 1HQYE 1T5IA 2JJ2D 3EARA 1W46A 2Q3FA 3J81k 4HAYA 3ZS9A 5E95A 4NCJA 2ZAMA 4PXAA 2IYLD 2XZLA 2C03A 1RIFA 4LJYA 1Q1BA 1XJ0A 3NEJA 4RZ2A 1UBGA 1UBEA 2ZRIA 3JVUA 4LJAA 3WY9A 1FTSA 1Z0IA 3CX7A 3GLHE 3HU3A 3IQXA 3KB2A 2NPIA 3BJIC 5EQTA 1HQCA 4B75A 1BH2A 1P2SA 5FOWA 4YMTA 3BD9A 2JLZA 4TN1A 1CEEA 4PHHA 3GD7A 2P6NA 3GJ3A 4JL8A 3NDBB 2VYFA 4GMDA 2QRZA 3AQ4A 4KAXA 1DO2A 4ZO4A 2B7CA 1CF4A 3I4LA 2RHDA 5CDFE 5EE9A 2A5DA 4JJZA 1HT2E 1XTIA 1MABB 2G1KA 2IYSA 3LQRA 3ZIAA 4AG5A 4YMVA 3SE0A 1ZNZA 4L15A 4UJ3A 1ZNXA 4Q02A 2AN9A 1P4SA 4EPWA 4W5HA 3LV8A 3QVUA 1FUUA 2GJKA 3IPXA 2ZUBA 5BWMA 4EJSB 1PLLA 4Q1BA 4DLSA 1P9RA 4XTCS 4FWIB 4LSGA 2WPDD 3F5FA 4MYTA 4AY2A 3TE6A 2D2EA 4LPSA 3OESA 1P72A 2IXGA 2XSZD 1W1WA 4Y0VA 5EP3A 5FFMA 4TQAA 1H65A 4JLVA 1VCOA 1Z22A 5AUNB 1KO4A 1JJ7A 2ZETA 3GJ4A 2VIIA 4OQLA 2Z5FA 4QHSA 1OKKA 3CUEF 1G41A 3PV0A 3QKRB 4MGIR 1RKBA 2K5UA 3ZIAD 5KHOC 3X1DA 1VG0B 2BC9A 1YKSA 1ZUIA 3SJZA 5M04A 5E7IA 5SZJA 1TTTA 1GRNA 2FGKA 2ZRLA 3GP8A 4N3NA 3V4FA 1WCV1 4QGHA 2PLRA 2RGEA 4QL3A 3VKGA 3U3OA 4RCZA 2G83A 1Y63A 4C2UA 1IQPA 1JXMA 4TL7A 4RD6A 2WBLC 4JYBA 1DS6A 2PEZA 3B60A 3SQWA 4M4SA 2CJWA 3LXXA 4OI1A 2CLCX 2R6DA 1SVLA 2UKDA 2P5SA 4BE7B 4U00A 4Q9HA 5DE3A 1NLYA 2GF0A 3QNUA 3ZD7A 2ZRNA 4B32A 4C0QC 3DKVA 4JZKA 3CF6R 3HWSA 2FU5C 2XSZA 2ZRMA 3RS5A 2QL6A 3ASYA 3D6TB 4B74A 1SHZA 4TMWA 1SKQA 2A3RA 4OBEA 4Q9LA 1ZMXA 3FWYA 3AP2A 5DI3B 1XTRA 2IEYA 2FDCA 1EFRD 3VFDA 1EFUA 1SVIA 5UKDA 2A78A 1YZUA 2ORIA 1XDBA 1E2FA 1ZJ6A 1MABA 1OV4A 1GRRA 5DN6D 1ZP6A 3W34A 4F93B 2PZGA 3PEWA 3CPEA 5C4GB 4M2LA 3ZVRA 1XD8A 3KQHA 1W4BA 4LJ8A 3B9PA 1R0ZA 1U90A 5FPYA 2B8WA 3QKUA 1SQ5A 2QUZA 2WM9B 2IS1A 2C8VA 5KNDA 3TH5A 1E9EA 3KX2A 2KB0A 4JLKA 1XEFA 4ZPXA 1QHHA 3DOFA 2ZE6A 3TAUA 3QQ5A 3A1TA 3N2EA 5IT5A 1XD2B 1S9DA 2GXUA 4I99A 3LRPA 3UMSA 3WYAA 2QSYA 2XX3A 3W8RA 2CL6X 2YC4C 4AKGA 3AKDA 4YMWA 2QP9X 1G64A 3GLFB 1KI4A 1IM2A 3EASA 3ECCA 2GZDA 1ESMA 3SJBA 5FUXA 1TPZA 2NGRA 3BB3A 1J8MF 4H9GA 1XCMA 1Q20A 4BWYA 5CYOA 3CRW1 2WJHA 1OIVA 1UM8A 4G5QA 1CXZA 2AK2A 3VHLB 2WWHA 1NMZA 4UNRA 4B2PA 1D6JA 1T91A 2FEOA 3VKWA 1KSGA 3A4LA 4C0JA 4CF7A 3L2OB 3SI7A 4NCHA 1W4AA 2P3SA 4HUQA 1NN0A 2ZSEA 2QQ0A 2D7DA 3U6KA 2XAUA 1IY1A 2NTYC 5ANRB 3GJ7A 5DISB 3K0SA 4AIIA 2RH5A 1HTWA 2GXQA 5D3MB 5LD2B 2ZJ2A 2Z4SA 1IAQA 3FOZA 3EC2A 1QHXA 2NO1A 3KDSE 5FPSA 2OSBA 3O8BA 2JAQA 2J45A 5E3HA 3B82A 1VECA 1GVNB 3AF0A 4IFBA 4FMCF 1G17A 2R6CA 2VP2A 4A2PA 3QIAA 4V0MA 4AYWA 4FWTA 1G6OA 4LJ9A 2YWFA 1KY3A 1OE0A 5JHGB 3HYRA 3KQNA 4XJXA 3A37A 2FPMA 1W48A 2EFGA 4NMMA 2OT3B 1HY3A 4KLNA 4X8OA 2ATXA 4FCTA 5FTKA 1N0UA 4NL4H 1KNXA 4WAUA 5LD2C 2R6FA 1O87A 3AGQA 1RPZA 2IWRA 1UAAA 2W2XA 1KNQA 2I1VB 3AVYA 4GI7A 1LF5A 4JLMA 2G0TA 3OIYA 1K5DA 3C15C 4L16A 5FTNA 4NZYA 1ANKA 2NO9A 3FDIA 3WRXC 4BFVA 1DAMA 2VA8A 2Z83A 1G21E 5C1BA 5CITA 4JT2A 5DSZA 4BZQA 2IEZA 2JLSA 1I2MA 1KZGB 4D0GA 1RC8A 3I62A 2V8OA 4DCTA 2H17A 2N1BA 3T1VA 1OH7A 2FFAA 4F38A 2ZRKA 4BZXA 5KDDA 1ONBA 2FPKA 3ASZA 2LCFA 3HR7A 1P61B 4DT1A 3RANA 1NVWQ 4KODA 4MYCA 1VCMA 3OEHD 1X8JA 1W47A 4NE2A 2Q21A 3TKLA 4U7DA 4EDHA 4OHYA 4TZ0A 1FP7A 4PAQA 3GLFA 1NBME 4A6PA 1QHIA 1NP6A 1E0KA 2EVWX 3E2IA 4IHQA 4R9UC 5JJKA 4XD7D 4Z1MA 5FL7D 3SBEA 4B73A 4NYIQ 5DYGA 3P4YA 2QE7D 3TNFA 5IF9A 2XNDA 1HURA 5JHHB 2WMOB 3BORA 2JDID 2VSOA 5ELXA 3P20A 1N3BA 4PO8A 5JRZA 2JASA 2ZEJA 3TGPA 4HUQB 4Q19A 1R5NA 3NHBA 1KIMA 2AWNA 4JMPA 4D4MA 3MWLA 3AF1A 4M9SA 3SS8A 2BCGY 2YV5A 3N70A 5SZIA 4LBWA 2IYVA 4LC1A 4HDOB 3AKEA 5DN6A 4DBLC 1TL7C 4C0KA 4CVNA 1XRJA 3OE7D 3SHFA 1FP6A 4DCNA 1KOFA 5G53C 3HR8A 4HATA 1MKYA 1N6IA 5JBQA 2QTVB 2I3BA 2FWRA 2V1XA 1DBSA 5CLQA 1VIAA 2OZEA 4LDJA 4A2QA 3THXB 1NSFA 2EFEB 2FFHA 1NNEA 1J8YF 1N0WA 5TVKA 2W2TA 2BEKA 3LD9A 5BN5A 1GDDA 2BBTA 1R0XA 1TEVA 2OXRA 5HKKA 3FHTA 1NN3A 4MRRA 4L5BA 1R7RA 2IYWA 4GT1A 3E1SA 1F2UA 1VG1A 4M21A 3T1OA 1TNDA 2VP4A 3VX4A 1E2EA 1G18A 3FMFA 1W0KD 4PHGA 5C4MA 2BJVA 2QE7A 1KI6A 2GILA 3PEVA 1TAGA 2H16A 2WKRA 1XB2A 1ZM2A 1GNPA 3TK1A 3T35A 4XIGS 2R9VA 3ZGXA 1OSNA 2XTMA 5HZKA 1W2HA 2GCOA 2IS6A 3PEYA 2NQ2C 4FMDB 2BM1A 2REOA 1KHTA 1AGPA 4OKSA 1JR3A 2FGJA 4QHYA 4GBMA 1QBKC 1U0LA 5JJIA 5B30A 4QBIA 4DRZA 3IO5A 1KYIA 2YZ2A 4L9SA 3IIJA 3L43A 3IDQA 2TMKA 1FW6A 1Q44A 3R7WB 5BYKA 2J5XA 1A7JA 1WRBA 3PUXA 5FOVA 1ELOA 3BGWA 3OEEA 3ZYCA 1LVGA 3B85A 221PA 4AYXA 1WBDA 4TMTA 4H1VA 4QGAA 2V7QD 4D80A 2AL7A 2L0XA 4A0HA 1G4UR 3SQXA 2ZROA 3RWOA 2QORA 5FOUA 4HLDA 1Z0KA 4D4KA 3QOFA 5GJCA 3VR2A 3TW4A 2B8TA 2CMKA 4UQOA 3VU9B 3QBVA 1NJFA 1F2TA 3IHWA 3ND8A 4GNKA 4W7SA 4UJ5A 4TLEA 2ZI3A 4DIDA 2FE4A 4R98A 2NG1A 1NVUQ 5DHAA 4URYR 1TX4B 2XJ4A 5BN4A 1X1RA 4JS0A 3QG1A 1E2PA 2PZEA 2RGXA 1E79D 2BVNA 2AHOA 4RKFA 3I5YA 3BS4A 2FSFA 3AF2A 3NXSA 2O8EA 5AWFC 1QDEA 1U0HC 1X1SA 2G6BA 2V7QA 2FSIA 4QJ5A 1Z63A 4MUAA 4JT4A 3W6PA 2D3WA 1KSHA 4PSKA 3LLMA 2HT6A 2QTHA 2XTZA 1U99A 1IBRA 4PTLA 4ZKDA 2GBLA 2YOHA 2DFLA 4N1AA 5AUQA 1EK0A 2QAGC 3SYLA 4W5JA 1Z2AA 1OH5A 3F0TA 721PA 1OXXK 4UNNA 4WBSA 2OILA 4WOPA 4EJSA 2FG5A 4DCUA 1JQJC 4CYMA 2D62A 3IO3A 1HT1E 2NIPA 2OV2A 2VF7A 4A0RA 4POAA 3EAQA 2ZJYA 2XJ9A 4UNPA 4QOSA 4ACAA 3KJEA 3NWJA 1OB5A 2GCOB 1MO6A 2CNWD 2PJRA 3KJHA 4HLUA 4Q03A 2PH1A 3TQFA 1KAOA 4Y0AA 2ZI7A 3CLVA 4YLGA 1NJGA 4DVGA 1SZPA 3PIRA 2ODWA 5J5CA 1G16A 1OJLA 3TJZA 2QM8A 1ZM9A 1OH8A 1ZC3A 2OESA 2EFHB 3VKHA 1CULC 3OFND 4AK9A 2NOAA 1ZM7A 5DI3A 3T5GA 3W6NA 5J4VA 4C7OA 3DZDA 4NCNA 3OZXA 5D3QA 1W36D 3RDPA 2GJSA 4JBWA 1DVRA 3Q9LA 4NYMQ 4S2EA 3ZDQA 3DL0A 4PSVA 1GKIA 1WP9A 1U8ZA 2G77B 4MRPA 2JJ1A 2O5VA 3DMDA 4Q9JA 2YOFA 4LJ7A 4EPTA 1E0SA 1XCGB 3VR1A 2ZR0A 3KTAA 4Q7MB 4RJLA 4PAMA 2IHBA 3NEYA 3OE7A 4IVPA 4QRHA 1OFIA 1YR8A 2W58A 4DLUA 1YHNA 4TYWA 3BB4A 3SR0A 4QM6A 3CNNA 1KSFX 2OFXA 4UNQA 3EIHA 4DSTA 4MH0R 4XWAA 2FNAA 3T1TA 1Z06A 2CCJA 5JI2E 1M7GA 2QPTA 1A2KC 2D06A 3K70D 3NG1A 4LYAA 1PUIA 1UJ2A 1F48A 2ODBA 5BN3A 2CE2X 1RW4A 3C5CA 3GJ5A 2WOJA 4BPBA 4B2LA 4IFEA 3Q7PA 2GJ9A 2Q9CA 3RVBA 2QNRA 1HE8B 4B3XA 2JLYA 1XMVA 2CHVA 3OFNA 3R9IA 1KDOA 4LI0A 2EQBA 3B2EA 1UF9A 1E2LA 3KZ1E 4PC6A 5CYPA 4M0LA 3SJCA 1Z07A 4BZPA 4A92A 4B33A 1JB1A 5EZ6B 5AJVB 4DB2A 2IX3A 1E9CA 4V0LA 3UG7A 1RYFA 3C14C 2H92A 3MLEA 4BLQA 1NBMD 3F3YA 2WMNB 3FKQA 5DO9A 2C9OA 2OCPA 4KFSA 3EA0A 1K6MA 4MGYR 4DEYA 4LRWA 1SVKA 4QJ4A 1EFRA 3QG5A 1YR6A 4OQMA 1XMSA 1E1QA 1MV5A 4F92B 4B6FA 1E98A 5HR5A 1DPFA 3P26A 4TL6A 4RKEA 3RRZA 5KOYA 4EFNA 1P7CA 3U4QA 3K9NA 2CHQA 1WE2A 4QG7A 1X8KA 1UEJA 2ONJA 2C96A 1S1CA 5IK2A 1ZD1A 4TYQA 4W5WA 1N5KA 1VHLA 1Z6GA 3HU2A 2JIZD 4BLSA 2A5JA 1KMQA 4MRVA 1G8PA 1E2KA 5EXXA 3U3RA 1IN5A 2IYXA 4OK6A 2N42A 1RJ9B 3U3MA 1IXZA 2F9LA 1NKSA 3U61B 4ERNA 2ZRPA 1H8EA 1W2GA 1Q21A 2VSXA 4L8GA 1G7CA 1RZ3A 3GLIE 4B43A 3LBNA 4QNRA 1NBMA 4DLVA 4I1SA 1CJVC 1YZLA 3VTKA 3L82B 1KDTA 2BBSA 3WBJA 2JA1A 2F1RA 1QHNA 1JPJA 2HDNB 2IC5A 3W9YA 4G3XA 2P67A 2WAXA 1WXQA 2KSQA 4DLWA 5HZHA 4OHWA 3ZH9B 1XPRA 1FPMA 4EQ6A 4BECA 2ECKA 4ARZA 2BCJQ 3KJIA 2J9RA 1AN0A 1FMLA 5E4FA 2Q3MA 2F3TA 2ZRGA 4OQFA 1M34E 2G1JA 4PPFA 5JMTA 1KK2A 2F43B 3RC3A 2BBOA 2GEVA 2W6ID 4F4JA 3GFTA 1S3SA 1R6BX 3QY0A 2ZREA 4B76A 3EX7C 1JALA 3THYB 3QPWA 4MDFA 3ZJYA 2XXAB 1C4OA 3TUIC 2O8CB 3TAHA 3TW8B 2ZE8A 3EWAA 2JIZA 3AF4A 1VKJA 2DR3A 2J7KA 1N5IA 1YU9A 2V4ZA 4K8OA 5E7JA 4A6XA 5K8TA 2R6GA 4JIMA 1OF1A 1GITA 4DCSA 2ZXUA 4LHXA 4B3CA 4D0LB 1VCIA 1OFUX 4KYUA 1O3YA 2BOVA 2F1HA 3SFVA 4X8MA 1NLFA 2VSFA 1G7RA 4IOKA 2OFWA 4Q5IA 2DPXA 5FBVB 3EIEA 2ZI6A 2ZVQX 1EFCA 3FHOA 4B48A 1YJ5A 4PC7A 2C95A 4EPVA 2O8DA 5JWOA 5CM8B 2Z4RA 4P3YA 2WTUA 3NTUA 2BJWA 1XZQA 3TIFA 1LS6A 4O2LA 3CH4B 4G5RA 4TL9A 5AJXA 4NKRA 2CHGA 3IHLA 3W6OA 5A5GA 4KVAA 4WXRA 4MA4A 3U4QB 3I8XA 2A5FA 1WMSA 3PUVA 4KO8A 1I4LD 3EPHA 5EXPA 1AKEA 4LYHA 5HCIA 1ZUHA 4K81B 4TMXA 4HSEA 1DTSA 5JCPA 2F1JA 1TQ6A 2ZR9A 2GVDC 2QT0A 1CIPA 3RHFA 1RJ9A 4BFWA 4A15A 5FUYA 3OIUA 4OJKA 1ZBDA 4D4LA 3IIKA 3UIEA 4B3GA 2MSEB 3BXZA 4EAQA 1T3HA 4DDWA 2GXAA 4A82A 1OXUA 1F60A 1CP2A 2OBNA 2QGZA 4RSGA 4UKDA 3ADBA 3NBZC 1BMFA 2GDJA 2NZJA 1NL3A 2KJQA 4GSYA 4KBGA 5DH9A 1DAFA 3LBHA 3GJ6A 5AJWA 5FOXA 1CRPA 3K0EA 2QSZA 3Q3JB 3CRQA 3SBDA 2J7PD 4YMSA 1R4AA 1AZTA 1GL6A 1NRJB 2CDNA 4KHZA 4EQ6B 4EJSC 4D81A 1FQKA 3GLHB 4JVMA 3IUYA 4YONB 1NG9A 1SULA 4R7ZA 3U60B 2J3EA 2HF8A 3PITA 4B47A 1TF2A 1XU4A 3EG5A 1W49A 3W3AA 4BFUA 4BLRA 1ESNA 1LW7A 1N2CE 1YZNA 2WJJA 4QBGB 5EE3A 1EWRA 3BH0A 1QG2A 3O8DA 5JCZA 1YZGA 2XXAA 2QT1A 1GL9B 4NCKA 1AS2A 2R65A 4IXMA 3BFKA 4PC2A 2OXCA 1U9IA 2D74A 2BMJA 4A8JC 1KI9A 4ZI3A 3AGPA 4G1UC 1GOTA 1ZINA 4GPTA 4HZUA 4LCBA 5DLQC 4CIDA 5J4KA 821PA 2PX0A 1N6LA 4Q7JB 1SVSA 2IYZA 2OEPA 4RVCA 1GFIA 2BM0A 1NG1A 4JLDA 5JJLA 3VU9A 1XF9A 1XX6A 1G5TA 3MFYA 1QZXA 1RYHA 2PCJA 4B3FX 4E07A 5JS8A 3QSYA 3D7MA 3A36A 3EA5A 5HKKD 3E70C 4PAOA 2C5LA 3EPLA 1T8TA 4HAVA 2O8DB 4JBYA 2GWHA 3MUFA 1XEWX 2E9SA 4LBVA 3LDAA 3CPJB 1W36B 1L7VC 1GNRA 2A30A 2A9KA 4B3BA 1W5SA 2ZS7A 2XOKD 3IBYA 1OXTA 4EKDA 1QRAA 2YHSA 1E2HA 2H7VA 3W5JA 4QJ3A 3U3KA 1FQJA 1XTKA 5CK5A 2O8EB 4BQSA 2ZAOA 4C0HA 5KDLA 4ON9A 2HJGA 5B57C 1LNZA 4DSUA 2GJ8A 4US1R 1TEXA 1TU3A 4URVR 1G8GA 1JR3D 4URUR 4Q7LA 3IGFA 3ZQJA 1Z0DA 3BE4A 5DGXA 3RAPR 1XTQA 1OLOA 3RS3A 1H8HA 3B6EA 4A8JB 4R2HA 4A0GA 4KBFA 1IY0A 4PO1A 1F2TB 2ZSBA 1XEXB 4IDOA 1L2TA 4US0R 3ICEA 3EZ7A 1TF5A 4KFTA 2QGNA 4UXIA 1X6VA 4AKHA 1LTQA 2OLJA 3RS7A 2AFHE 2BEJA 3Q7QA 3K0FB 3KUDA 3CH5A 2ZYTX 3B13B 3S1AA 2DWOA 1P2UA 4HDQB 3T1QA 4CEJA 3CRRA 2PT5A 3WMGA 1K5GA 1EGAA 4BFZA 4OI0A 3K53A 1IJFA 4KFRA 1SXJB 2CE7A 5F3WB 3KQLA 2WHXA 4W9MC 3I72A 1JJVA 4HAWA 2W0SA 2O8BA 2VEDA 4TYYA 2ZJZA 2AR7A 2HF9A 4ZKEA 3WNDA 3LLUA 3F8TA 3LW7A 5FBQB 3X1YA 1GTVA 1IY2A 4D82A 3MWJA 4M1MA 4CDGA 4C2TA 4ASUD 2GK6A 3AVPA 4JJKA 1KAGA 3AKYA 5KO2A 2GEDA 2UZIR 1QVAA 4HZUB 2FZ4A 1M7BA 3H4MA 2EFDB 2G0NA 1ZC4A 421PA 4HEJA 4AURA 1U8AA 4JVNA 2KBFA 3B5JA 3W8NA 2OG2A 3KKQA 5L3SB 4TMKA 3PENA 1PJRA 2OCBA 5AJZA 2ZTSA 2VHTA 4YMUA 4PX9A 5B58C 1LF0A 5K8LA 5L3RA 4JLJA 3VR5A 4NP6A 4Q18A 2NO0A 1OIWA 2QROA 5G3ZA 1SXJD 2IA5A 4LWZA 2X2FA 5KSOA 1DO0A 5TDHA 1IXSB 2N46A 3TVDA 1Z2CA 3MMPA 1SKYE 3FYHA 2IK8A 1Q1QA 5DYIA 4IOJA 3KQKA 1OPXA 5DI9A 4ZCMA 2F55A 4BLTA 1SHKA 4D25A 2GXSA 4LJ5A 1PLKA 1OB2A 4EPRA 1T0HB 4PQRA 3TQCA 3A6PC 2GBLC 1Z5ZA 2HLDD 2IYTA 2H1LA 5AJYA 1JR3E 2FSHA 3EC1A 5TMPA 4V0OA 3U6BA 4RFSA 1G4AE 2ZRHA 1XEXA 4L9WA 3NH9A 4G5SA 2Q0HA 3QE0A 3VR6A 3U44B 4IDPA 1EX6A 5JEEA 3HPRA 1MO4A 4HZIA 3BAFA 3IKJA 2JJ1D 4B35A 5KTYA 3GJ0A 1G5PA 3OAAA 2Y8EA 2YOGA 4LHZA 4I1OA 4B44A 4Q4LA 3ZZ0A 5KPDA 2FJUA 3CX6A 2ZR7A 3K0AA 2ZRAA 3AP1A 3TUZC 1SXJA 4Q66C 2WWIA 3WHKA 1OHHD 2ONKA 3QF7A 1L4UA 2CL0X 1W36C 1KTVA 2AXNA 3H2YA 1R0WA 2Q6TA 2ZE7A 3OHMA 1L4YA 1P9NA 3CR8A 1EWQA 3B8HA 3C41J 5J40A 1Z6XA 1JI0A 1JQLB 1US8B 3AB3A 1C9KA 3X1ZA 2PBRA 4DCVA 2H57A 3ND9A 4A0FA 2QG6A 1TQDA 3OEHA 3W5IA 2CCGA 1JR6A 1E2DA 2XOKA 2BKUA 1GP2A 3KUCA 2ANBA 2VP9A 2A7QA 4S35A 3CZPA 3EZ6A 4C0SA 4BFXA 1Z3IX 4A2WA 1HUQA 3LVRE 4B34A 3G82C 2E1RA 2W6IA 3JVVA 5GJWC 1JEDA 2PLFA 4LV5B 3B9QA 1I4TD 3QXJA 1E6CA 3RS4A 4MKIA 4ARZB 4TL8A 4PANA 1VCNA 1E9BA 1G3UA 4EFLA 4NH0A 5HE9A 2F43A 1CU1A 2GAOA 2HXYA 2NZ8A 2AXPA 3DEFA 1NVVR 3AM1A 1PZNA 2G9NA 4HB4A 3AEZA 1UADA 2B21A 1IJEA 3LNCA 2GK7A 1E9SA 3L8YA 1IONA 3SDZA 4ZDKA 4KV9A 4J0QA 1J2JA 1HEIA 1FOEB 1XXHA 3SOPA 1W4CA 1SVOA 4E5UA 3I61A 2QMEA 3FVQA 3DM9B 1OYWA 3AF3A 4LC0A 2WSSA 2HXSA 1OIXA 2NMVA 4MDEA 3FHCB 4M22A 4LHWA 3SN6A 2P6UA 1E4YA 3SFZA 5JI3E 2BMFA 1QHGA 4CT4B 1ZM3A 2ZUCA 3K9HA 3HJNA 2REBA 3I3SR 5JWRA 3LO5A 1QHHB 1UKVY 2WJIA 2IS4A 4FMBB 1FX0B 4Q00A 2WKQA 1ZD8A 1XD2A 3B78A 3LX5A 4AD8A 1D2NA 3DMNA 4RD3A 2XGJA 3B1VA 2G3YA 1G7SA 1G8FA 3AV0B 5LDDC 3THYA 1CJUC 1X86B 5JWHA 2AX4A 3BC1A 4KI0A 5GJVC 3ZZUA 1T3LA 4M9XA 4QBHA 3D3QA 1BMFD 2R2AA 3Q5EA 2XB4A 4DSNA 1W4RA 3CPHA 1US8A 2DYKA 4Q4JA 4DLRA 2QN6A 3WYFA 1PLJA 3GJXC 4EPXA 3AVWA 1ZNYA 3DOEA 4WW0A 2HYIC 1MT0A 3Q5DA 3BERA 2WZQA 2H8KA 3OEED 4DJTA 2A5GA 3AP3A 1KY2A 2OHFA 3SHWA 3L0SA 1TQ4A 2X1VA 5HCNA 3WMEA 1JAIA 2ZANA 4Q1DA 1A5TA 1JXOA 5J4LA 4URZR 2GA8A 1NVVQ 2BMDA 3EZ2A 3C8UA 3DKPA 4Q1FA 1XMJA 5EUMA 4URWR 2OBLA 4IXNA 4JLAA 1G8HA 1XNJA 4OK5A 1II8A 2YWEA 3M6AA 3WYGA 1ZUNB 4RD2A 1COWD 3U7EB 4G5GA 4HAUA 4JLPA 2QM7A 2XEXA 1Q12A 4JKYA 2QU8A 2IUTA 4ZCLA 4E22A 1DAEA 5JFGA 1XPUA 2X2EA 1GKUB 3A58B 4A4DA 2IUSA 2BKEA 2QPAA 1GSIA 3I92A 5H1YA 3PVSA 4Z8XA 5K8UA 1S1MA 2V1UA 1DEKA 1UKEA 1S9HA 2OFOA 1TUIA 4DLTA 1RRPA 4ESHA 4IEIA 1UEIA 4A1FA 1XXHB 2R6AA 3QENA 1UDWA 3THOA 2WPDA 4OJQA 2QBYB 4F4CA 4FINA 5FBLB 3FB4A 4Z8YA 3TSWA 3UPUA 4XSHA 2JDIA 3P27A 3PUWA 3TMKA 5J47A 4FW9A 3MGCA 5KSYA 1BO6A 1NSTA 4LY6A 3VQTA 1AJEA 1UBFA 5KYKA 1X3SA 1Z6YA 3G5UA 3LFUA 1A1VA 1AQUA 5TB5A 2ERXA 1DELA 5JZVA 1T6NA 2P6RA 1EFHA 3GLHA 3KL4A 4O2RA 2XNDD 3GQBA 4JKIA 4ESVA 1ZW6A 4NDZA 2WJVA 1Q3HA 3QXXA 4LYJA 4FMDF 4DT1B 1RVDA 2MMCA 3EW9A 1VYTA 3T5DA 1XBTA 4HAZA 3M1IA 3C7KA 4NU0A 3QJYA 4YC7A 3GLIB 4QM7A 1EESA 2W2VA 3AVOA 2KWIA 4C0AC 3VR3A 4YQFA 3THWA 3SU8A 5LBIA 2PEYA 2IBMA 5CLLA 4LJ6A 5KNBA 4TYPA 4ZI2A 4OYHA 2ZSDA 1KI3A 2J1LA 4Q4HB 1XCPA 3CWZA 3GEHA 4IDNA 2O0JA 2IT1A 4BFTA 4V0NA 2W83A 3A1WA 4EUNA 3CR7A 4XVRA 4Q9IA 1E4VA 1UKYA 1LV7A 1C1YA 3B1WA 4TZ6A 3W90A 3S1AB 1VMAA 1SGWA 1ZU4A 4ZDJA 4UNSA 5C46F 3K70C 3CIOA 1HA3A 3BRWD 3IBGA 1ZU5A 2V6IA 1HE1C 3X1WA 3FFAA 5KSPA 3GLGE 2ZJAA 2P2LA 2O8BB 1YZTA 5B2ZA 3RABA 2OUKA 4MQBA 1T0JB 1IN4A 4YDHB 4KJZA 3T61A 3N5CA 5BXQC 1FNMA 4IRUB 3OIVA 1EXMA 3CBQA 2ZITA 4RFVA 3LVQE 4CGZA 1VTKA 2YNMA 1P73A 4A8JA 1SVMA 1F2UB 3B1XA 1II0A 1S8FA 3V4RA 3R8FA 3JZAA 3MJRA 4JL6A 4DEXA 3BK7A 1N0VC 4HB3A 4P32A 4CEHA 4IJMA 3NKVA 1CR1A 4XWKA 3PJRA 1TU4A 3D31A 1P3JA 3K0FA 1GNQA 3KJGA 2YKGA 2VBCA 2MSCB 1E69A 3DO6A 4MRNA 3NVAA 1E2JA 1YQTA 4GZMA 1IN6A 2ZRJA 1XD9A 4AYTA 4BRWA 5CB6A 4BFYA 1T8UA 3GFPA 1JPNA 2RCNA 4TLDA 1CRQA 1GG2A 3P4XA 3ONWA 1ETUA 1XJCA 2ZE5A 2ZJOA 1CKEA 2ZSFA 4TTQA 2OAP1 1E2IA 1FFHA 1NLZA 3R7WA 3SZRA 4PPNA 2GZHA 3UMRA 1D9ZA 1SKYB 4PSAA 3H0KA 2VL7A 1IHUA 4WZBE 1G1MA 1OFTA 2ATVA 1P5ZB 1W7AA 3THWB 1G8YA 1BKDR 1GAJA 1HH4A 1NF3A 2EWVA 3RS2A 4MYUA 1YZQA 4RY2A
chains in the Genus database with same CATH superfamily
4E31A 2IRWA 2J0VA 3GOQA 3N53A 3IBFA 1P2TA 4S3MA 2VH1A 1RHKA 1SKAA 4TYMA 2H9AA 4X8HA 2AFIE 3A4NA 4EWLA 1HLGA 3IVAA 1Z0AA 3H97A 1L5LA 5AUNB 5FTMA 2XB6A 3EVGA 3M1LA 3GMTA 1DINA 3S1LA 1MAUA 2BGUA 3FWPA 1F7UA 3UAVA 2VF8A 4JSRA 4ENQA 2OCAA 4JBXA 2ZWMA 3ZWWA 4IQ4A 1PJQA 3CZ5A 4N5DA 2VS1A 4NY1A 2YZGA 2GN8A 4K6KA 3LVFO 2CNWA 4YFYA 3P32A 5BWNA 1OKKD 4M9QA 2PKRA 3L1UA 3WBFA 3KVVA 3OG9A 2PJUA 4RLQA 1KKMA 4I4TB 1MIHA 2HY7A 2CC2A 3QHAA 4C3OB 2O8FB 4EVSA 1W85B 4XWOA 4D8TA 2P91A 1N5LA 3CF0A 4LBYA 4MUIA 3B2NA 4WNCA 3LKDA 4GECA 1OVGA 1QCCA 1WZEA 4FCVA 5GONF 3GMDA 3U49A 2CDBA 1GDHA 3HDTA 2D1QA 2PANA 3D8BA 2X13A 2YH2A 3EWSA 2LUOA 1SBIA 3I37X 3M4YA 3HDJA 5IDYA 4UREA 4KWCA 4OAQA 4UEKA 3FA2A 1YD7A 1KAMA 2IXFA 4H27A 1FFSA 1NNSA 4RZ3A 3DTVB 2VSNA 3MJHA 2OR3A 4QHTA 2HCBA 1GZ7A 1EP1B 4D97A 2ZYWX 5KTSA 2JI8A 1DIRA 1SAYA 2E87A 4JWKA 4UC0A 4GDFA 4NFSA 1KYYA 1R5JA 2HHHB 3MILA 1JBEA 5DSTA 2O06A 4ETIA 1ZVMA 4FDMA 5GVRA 3AL0C 1G7TA 2PMEA 3IUBA 2QNBA 4YRMA 5JQWA 4O29A 4R71A 4DLZA 1R2QA 3FCYA 3NWBA 1UANA 3ASUA 2FQ1A 3DVAB 3GJZA 1PUJA 3JQRA 1JFRA 3HXPA 2Q8NA 4XARA 1FP2A 1IVSA 5BSUA 2ZB8A 3K9QO 2WJGA 4EF5A 1HR0B 1CJMA 3C8ZA 3HHEA 4E03A 5B3JC 2PQ6A 4L9RA 2JI7A 2EC5A 3JWPA 4WECA 3T3DA 3DHWC 2JRCA 2WTNA 2NUAA 4B71A 1PTJC 1B1AA 1STOA 2HGZA 1ISMA 4JITA 3B9RA 3O26A 4HYTA 1QGAA 2ZRBA 4RDIA 2WKSA 3FNFA 4RHXA 2RK4A 1VLJA 4TSFD 4UXHA 4BKUA 4PZDA 2X19A 2GVZC 2SBTA 4HI0E 5ICFA 2WLSA 3O75A 1OFVA 3LC1O 1IVNA 2IOQA 3WQRA 3UQZA 4I4LA 4ZI7A 1J2UA 3MAGA 2CXXA 3NI2A 1A72A 4OAPA 4RD1A 1RI4A 3RAJA 3VHXA 5EIAA 3MMZA 1QVRA 3QF4B 1U3TA 4GOXA 4MQEB 4LA4A 2VHQA 5T3YA 1N3YA 4QQNA 2ZPTX 2GF9A 2HWXA 4LDRA 4BWFB 2ON6A 5LJIA 1E9VA 2DFNA 1X0XA 2P5TB 1KSJA 3THSA 3VR6H 1OH8A 1NHGA 5D3MA 3CRMA 1JTVA 1DDIA 3GJ8A 4LZLA 4ZZ3A 1K8RA 4UASA 1FLNA 1BS2A 2ZJ4A 3ZCXA 1GKYA 3STTA 4WJZA 1ISJA 5SYNA 1CEXA 1PJTA 2HCJB 1ZX1A 3MD0A 4HDKB 4NZMA 1TM1E 1ONOA 3KHSA 3T06B 2B1IA 3JVDA 2C42A 2FZKA 5DLPA 2QENA 3PQ2A 3ZXYA 5A3SA 4CG2A 2XODA 5GVSA 2MSDB 3ICWA 3E5RA 3FCAA 3JTEA 1KI8A 5FULA 5JW6A 3LZ6A 1TVCA 4EHBA 2HSEA 1ZONA 4G41A 1XCLA 4X24A 2C54A 3U4HA 1XQYA 1J21A 3PLRA 4V0ME 3QX8A 1NBAA 2VTEA 3CONA 2J41A 1CEQA 1DAHA 1FS4A 5JFOA 3GMSA 8GPBA 1OH6A 5IWAB 2AXQA 2Q4TA 1LDEA 2Z43A 1LFDB 1WJGA 3BWMA 3K6KA 5KDOA 6PFKA 2FXIA 1BE0A 4JR2A 5D6OA 3WVNA 1YDEA 3L8FA 1YNOA 3MTEA 3AXTA 1COZA 4PQEA 4Q48A 5HNKA 5AVKA 5EEGA 2QYOA 2H59A 3GHYA 3BWXA 2D2FA 4JC5A 3T15A 2XVZA 1N9GA 3T3MB 4F2GA 2BFEA 4JJGA 3HJAA 2WFLA 4QDZA 1MF7A 5JEDA 5CIQA 3TLGA 3BA1A 5KPJA 5T6MA 2HOQA 1R4NB 2HRCA 4RL6A 3T7TA 1HDXA 1EVZA 2HO4A 3WDKA 2WKWA 1ITZA 1V8BA 5KYWB 2BUCA 2HMUA 4Q4JB 1DCFA 2GRJA 2P0EA 1UH5A 3EZFA 4R8KA 4HNAA 5JIBA 2PYIA 1WB5A 1JDPA 3DMRA 4OYLA 3ZYZA 4BIMA 4KBYA 1TJ5A 4X8LA 5B1EA 4JGBA 2WF5A 4KO4S 4M53A 1KERA 1FP4A 1ZK3A 1N6OA 1X77A 5C31A 5U4QA 4CMCA 1L5SA 1U11A 3WIDA 1DTWB 5J58A 3LSTA 1W5BA 4YRJA 4X1IB 3PDWA 1W0JA 3JSAA 2ODTX 4N5IX 3ZI0A 6REQB 1NXVA 3G79A 2ALJA 4AUEA 2Q4RA 2NV2B 3ODGA 3WYBA 4D5EA 1U1IA 3CF2A 5CBPB 3CYFA 3D8SA 5IUNC 1X7XA 2BGJA 1C3LA 4HBGA 1BXRA 1L8XA 1T4BA 2QW0X 3GQBB 1QG0A 2INGX 1USUA 3GGGA 4M9ZA 4UBJA 3EQ7A 1DC4A 3TSZA 4ZVRA 1VP3A 5JOQA 3IAXA 3IHTA 4RKYA 2IZ7A 4LTMA 4LRQA 4EM6A 1JHDA 3HO1A 5CT4A 4C0BA 1EINA 1M6YA 3NBKA 3S7ZA 4CMAA 3D64A 4KXVA 4OP3A 4D3XA 4HFNA 3UW1A 2AKYA 2O8CA 3DLTA 3K0BA 1YHZA 1LDGA 2KPOA 3HB7A 4ZQGA 1MP0A 3LI2A 3LOPA 3I2IA 1WF6A 3PHJA 4M86A 4BVEA 5SZKB 1XROA 2BLNA 2JLRA 3UC5A 3KJQA 2C31A 1YO6A 3NBFA 4NENB 4UBLA 4QYIB 1F4VA 4PU0A 2VNKA 4V02A 4DNPA 4IR7A 1MN6A 1YL6A 2PPLA 3E48A 2QX7A 3C5HA 5IYZB 2PJZA 1WBJB 2Q5OA 1Q5PA 1KP2A 1ZAKA 1POXA 2CDAA 2NZVG 3NHYA 5JAQA 2R60A 2VHCA 5BV2P 1I2ZA 4FJ0A 2E1PA 4P4LA 2EBUA 1MB3A 1MJGM 3QUBA 4OL9A 1XZ8A 4D26A 4AJ1A 3O73A 4TKVB 1X80A 3VH4A 5F9HA 2ZAYA 4XE5A 5DTEA 5H9VA 3WDMA 1VBFA 2J46A 2PMDA 5LB4A 3AIKA 1BHQ1 4EUSA 1DG9A 3B3JA 5G0WA 2JB9A 2BDEA 4IXDA 2CJPA 4HUTA 2P3QA 4DV4B 2JEYA 3WIBA 4OJNA 1LVHA 2OYSA 3TNYA 1VE9A 2HQOA 5CXUA 4D57A 3NETA 3E2PA 2IIQA 3WQHA 2P41A 1N6HA 5KQLA 1YBAA 1K97A 3HCWA 3R4VA 2VPWA 3D6JA 4M9UA 3JYNA 4FYKA 2B99A 4IEEA 3CMMA 1VG9B 1OU4A 4EUFA 4GNRA 1XRQA 4LJKA 4W6ZA 5DBEX 1AE1A 5BUQA 3TLCA 5FP0A 2I03A 5I7AA 1DMRA 3CSSA 5I8ZA 3T1HB 1D5CA 3JPYA 1LDMA 3SM9A 4BLWA 4ESEA 2PIDA 1VDZA 2WZDA 4WK6A 4Y7CA 2C2XA 5EUCA 4ZOQI 2VHJA 1LI4A 3ZIUA 2MSNA 4L4YA 3IAHA 1L8OA 3AVVA 4AAYA 2WIDA 3OZVA 3GEEA 3PFWO 1JHOA 3SEZA 3PR2B 4MQLA 4M89A 5CTAA 4CIVA 4Y2VA 1RQXA 3NDRA 4HVAA 3DBRB 4BQFA 1RM3A 3P2YA 4MS3B 3CZRA 3K70B 1QDUA 3C6KA 4ZAZA 1G9XA 3JYQA 2RE8A 4U3JA 2IS2A 2Q0SA 5E6RB 3AWIA 4H4CA 5DHTA 1G2PA 1CHNA 2FFBA 4A0SA 2PFKA 2W37A 3DTVD 2Z04A 3P5SA 4IWNA 3DPIA 3S70A 4E09A 1RVV1 1T4CB 2LCIA 3DM5A 5EP2A 5JH7B 3PFFA 2O1SA 3DEKA 1AGXA 4GVLA 2FSGA 2ZIXA 4EI2A 4Y67A 2VZLA 2W6CX 3OAAD 3TZBA 1MOSA 4RD4A 4YRKA 2NSHA 4TLCA 5FTWA 2Y0CA 2B94A 4IINA 3TEFA 3AH8A 4K3VA 1RRGA 4TMYA 4UPEA 3U5ZB 3E5NA 3DKRA 1VSQA 2W2KB 5HEKA 2GKSA 3M6LA 5CFMA 5JG7A 3ZNNA 4QOIA 2XDQA 4O4LF 1ZK2A 3I8SA 4KK3A 4QARA 5A7FA 2VCEA 2R85A 4L22A 5A3QA 4QZVA 1Z83A 3RJ5A 3OMXA 1E5XA 1O7JA 2NO7A 1A2BA 4FNGA 5GM1A 1XYVA 1ZIXA 2YASA 4ZOAA 4HVCA 7AT1A 1GGKA 1QNFA 5C8VA 1UWKA 4AS1A 4G85A 3PNOA 5BOSA 5F1KA 3KXIA 3F96A 2ZOSA 4OK3A 3HGQA 4IJQA 5HIMA 4P7JA 2O3TA 3SC2B 2Z8YA 3QVGB 1ZD9A 4ND7A 5AH0A 3AI2A 4U6NA 4H0FA 1Y1RA 4HFJA 4BUZA 4D8XA 1Z33A 2GERA 4R9NA 3BSYA 5KUTA 3DL2A 3BK2A 5FEMA 3SXJA 1H0KA 1ZQ1A 4DM4A 1E79A 1ZI9A 2QTLA 2VWPA 3UBTA 2ZU0C 4I4CA 3QI2A 5H7XA 1R8SA 3K2EA 3NBXX 3PGXA 4H16A 1SOVA 1Z3CA 3ZE1B 4LNUB 4AKSA 5B64A 3AZOA 3ICOA 5G41A 1NU6A 2V0CA 2WE8A 1NLUA 4U1RA 2ID8A 2JK1A 3QKTA 2ZUWA 2AK3A 1VGRA 4ARUA 3A7DA 2WTMA 1NKTA 2WNSA 2OHHA 4J9VA 3RWBA 4A3SA 1WVMA 2J59A 3Q88A 3EQZA 3IEVA 3FROA 3KEGA 2WTEA 4DRXA 2FMUA 2QAJA 4E4RA 4ZIRA 3HB1A 5AFSA 4FMCB 4G5OA 4NJEB 4NIMA 3WP0A 1NJ2A 3T7CA 1Y6JA 1FBNA 1RYBA 4XD2A 3QJGA 1DAKA 1LRKA 1WZCA 4ASUA 1JGTA 4MOWA 4DQVA 5EE0A 4XH9B 2NU9B 2DH6A 3MCUA 4FN4A 4FR0A 3UWKA 1KK1A 3SYRA 3V7WA 4X1KA 1JBKA 1HQKA 5JBIA 3TEMA 4CEJB 2ZUVA 1ZRHA 1VYUA 3IP1A 2VLIA 2X8JB 4QJBA 1NPYA 4QDJA 4RMIA 1XA3A 2PSEA 4QUKA 4F2WA 4P08A 2Q41A 4NU5A 2XIQA 2R66A 2WSYB 4EY5A 1VE7A 4K03A 4M36A 3TR5A 2Z0MA 1NIJA 1RC1A 1UMCB 2A1UB 1VMEA 5AOCA 2JHGA 1YASA 2EBWA 4RF2A 5LLDA 4FZVA 1WKBA 3GFQA 3M83A 4AKIA 2ZS9A 1CJKC 4U6QA 3SE7A 1CY1A 1D0SA 3QUSA 5E7MA 2G82A 2C8KA 3BMQA 3U7JA 1AS0A 1C2YA 1XA0A 2ZRFA 4KFCA 3R5HA 1GM5A 1MBZA 2YXBA 3B1YA 3P2IA 5HM6A 1N6NA 4MP3A 1KDYA 2WV7A 5LB2A 5LLTA 4LHVA 1GQFA 3I5UA 5F1PA 3QVWA 5KVAA 3N6VA 4D43A 1GAEO 16PKA 1E9AA 2QTAA 3M49A 3IJPA 3Q12A 3KLBA 1RAHA 2G17A 1P0MA 3G1TA 4IF4A 4N3GA 3WS7A 4EW6A 5LIRA 3ITNA 2I3AA 1S8AA 3W1VA 4OF4A 4MVWA 3E4DA 5L8VA 2ZJFA 1H93A 4I9HA 2AUMA 2QMHA 1LXCA 2QUKA 3IEUA 4MITA 2IDZA 4NTZA 4YJHA 3G8YA 4CIBA 1NA5A 4RY0A 3CB4A 2HPVA 1U8YA 3EFBA 4GLOA 4ZU6X 1UOQA 3RVJA 3OJ0A 2HMSA 5AKGA 4MB2A 1XFDA 1WQ1R 5B1IA 3ZQ6A 2V6JA 3KETA 4LDZA 1M1NA 2GHIA 3R9XA 2A67A 3BRCA 3T41A 5A7HA 2WFAA 4QBTA 4X7MA 5AUPB 2J87A 4JUBA 4KLCA 3MTIA 5CCEA 1L7BA 4IS2A 2C4TA 5HZGA 2FUCA 3FI0A 4X45A 4XTRA 3DOCA 4Z49A 5DM70 4PV7A 4F86A 3OWXA 3OT1A 1FL9A 3AM3A 1IOLA 4GZ5A 4AY4A 4GLBA 1Z47A 4OMDA 2BMEA 3F67A 1EI9A 2OY0A 1QV9A 2WVJA 3OQNA 3L4KA 4TT3A 2DWQA 3NC0C 1PT6A 2YJ4A 1QXSA 3NPMA 5CCXA 1BYIA 1SBCA 2FPGA 5DU2A 3ZTTA 4QDXA 2AZXA 4B5LA 4CT5A 2IEGA 3Q8LA 2D1YA 3LPCA 4LNAA 4U2DA 1I1NA 1PGQA 3MCWA 1G3RA 1MGOA 3AZPA 3QTLA 4YASA 2ONYA 3D7RA 3TLMA 3MPOA 3VR4D 1Z4MA 5LUAA 4HRXA 3O38A 4HNUA 4DM3A 3GA7A 5K01A 1H8ED 2W22A 4IMPA 4K6CA 1KZ7B 5MFPA 1THMA 4MP6A 1B23P 4FR5A 2B7BA 2IY8A 3C16C 3LRTA 1KK3A 1NQWA 2HI0A 2KE5A 3MWKA 4KQCA 1P9WA 4X0EA 1E5VA 1VLMA 2MR5A 3WNBA 1FJHA 3WMFA 1E20A 5FTJA 4F8YA 3ABSB 1DCTA 3LX8A 4RVSA 4ZOBA 2J5RA 5BUSA 2NU8A 4HN4B 3V1YA 3WOVA 1MRSA 4MKHA 4WV3A 1VHTA 4CQLB 2HBRA 4ZPJA 2FF5A 4MYRA 4RXTA 2QVBA 3NDIA 4Q1EA 2YVKA 4X7RA 4GYYA 1H1DA 2YWGA 3AYXB 3PUZA 5DM1A 3TZEA 1BXGA 4U2EA 2CXPA 4NEHB 2VVTA 3QTTA 5D1HA 3ZLVA 5HQ3B 3MXTA 1V41E 4ZA2A 1PYGA 1OYOA 2G76A 1Z0FA 5JMOA 1ILEA 3CKLA 1E1MA 2CL7X 3NYIA 4IRMA 3K9LA 3EVBA 5ALJA 2IYPA 3TXYA 3DEHA 4K6HA 2IHJA 1IZ8A 4FD2A 3VH1A 2VKTA 2AQIA 1KMHB 3IOEA 4N40A 3SEQA 5L6LB 2HT1A 2LDXA 5IDQA 2YINC 4Q05A 1CW2B 5ALTA 2AXEA 2RI6A 1KI1A 3P97A 1FRZA 4LSMA 4YAWA 1KRWA 3LHKA 5TPZA 1EJBA 4CN8A 2C4UA 5FWXA 3SC3A 1WA5A 1CUWA 5I7RA 2WJ3A 3HFGA 1QP0A 4AI6A 5A1JA 5K0FA 1QCDA 2NXJA 3KTOA 2J9GA 2VDWA 3G85A 3SLKA 4GH5A 3VYRB 5MGNA 4KNYA 4MS4B 1ZD3A 3ZHSA 4ZFNA 5DHFA 1E9RA 3FMOB 2V6BA 3R5FA 4IWYA 1DQSA 1Y80A 4QGFA 3RBVA 3VO1A 4C5CA 2UXDB 1JA0A 4BNMA 3NIGB 4O25A 5EXSA 5H70A 3T0FA 5IRCD 4CU5A 1OT5A 2WHPA 2HBZA 4UEQA 5AVQA 1P0IA 3G0BA 3U1TA 1PQYA 1XFAA 5A4KA 4QNMA 2F3QA 3I09A 5DK6A 5EXDA 1EFTA 5ALVA 1CUGA 1KFBB 2J4FA 2LKDA 4GL2A 3H9JA 1WP4A 3ZQKA 3DPUA 2QTBA 4ARIA 1VMIA 4OKIA 2GKGA 3FI9A 5EI5A 1JU9A 1GQQA 4BTLA 1Z15A 5TQ0A 2DT5A 5GZ1A 1HYHA 1XLVA 3KZCA 3DC7A 3MRSA 5FPTA 4GFDA 1QHYA 1B0UA 2O0KA 1WF3A 1JJBA 2PLWA 1R64A 3A1SA 3N0XA 3NHZA 3NTOA 4ITRC 1PZHA 3LKBA 4ALMA 4IDHA 1CUAA 3M34A 2NVUB 3CW2A 2VOJA 1HZZC 4WA7A 2UUCB 1P77A 2AFIB 3OLYA 1DJOA 3PCRB 4BV8A 1DC8A 2NO6A 4HAIA 1KAEA 3FYCA 1CZKA 3PNLA 3UWPA 4M76B 2C98A 4JA2A 5AR1A 1BXKA 2Q5CA 1RRVA 3PG5A 1USWA 4MUXA 2ZWPA 3H18A 1FLAA 3IEPA 2YWHA 4LXTA 4S12A 1ZHHA 2WWVD 3UTCA 4YUAA 2CV1A 4UATA 1OXVA 4R1MA 1SCKA 1TF7A 2P3LA 2VHUA 3DL7A 3KSRA 2AD5A 1XVLA 2I2BA 3LBIA 3PD1A 4OM7A 5EESA 4R3WA 4KITB 4KUEA 4GKVA 1SK9A 2WM8A 4HQOA 2O4UX 1SU7A 2YC2C 1CYDA 1N5OX 1H9CA 2HPHA 5EE5B 1YS9A 2R8RA 521PA 1NM5A 3PX2A 1Z28A 2X4LA 5GONA 3KELA 4D6XA 3I6QA 1UFRA 2O2XA 1G3QA 2XOEA 4MI6A 5K3BA 1E2QA 4Q7KA 5EE1A 3WB1A 1HSZA 4P4SB 1U8CB 1N2JA 5A6VA 1ACJA 4M60A 1F0KA 3EDRA 2X7JA 1ZG3A 2CNDA 3BL5A 1U0EA 2JFBA 3FNRA 1YFKA 2H11A 3Q3CA 4H4DA 5B2FA 5KCZA 1YRBA 3V46A 1J8FA 2QRLA 3BBPA 3KFVA 2DP4E 2XDAA 3H65A 4I4TF 5CLIA 2G36A 1XDGA 4FZ3A 5DBGA 3TZLA 3IE0A 3HO8A 5DGDA 1YK0A 2HM7A 3IEMA 3K1ZA 4IFTA 3N76A 4RXMA 3CF4A 3KE9A 1XV5A 3PE3A 3RK4A 2OCKA 4B4UA 1ZYUA 3EZ9A 3H1TA 3SWWA 3VZBA 1QAOA 1YZKA 3WK6A 3ADDA 1OFHA 4IJVA 3QPVA 4RTKA 2FMTA 2EYQA 1OBHA 4OLBA 4ZVNA 4DY4A 3FSEA 2C59A 2OCDA 3RSOA 4PC1A 5EZYB 2GSWA 3L77A 2F6RA 3CM0A 3OOSA 3Q4GA 2GBPA 3IRUA 1D4ZA 3PNPA 2IYFA 3PFCA 4KXFB 5EMKA 5E3JA 1E6EA 2X5OA 3TQQA 5AKLA 1GILA 4W5QA 3EVCA 1TVKA 2GCNA 3DWFA 3Q85A 1XIVA 3ZD6A 1U0OC 3RSLA 2ORWA 1OYYA 3F1KA 2EWWA 1A7KA 4FKZA 1EYZA 4E3ZA 1JWBB 3PDJA 2EJBA 1BRMA 4HO1X 4IO1A 4DFDA 2CSXA 4HGQA 3R9WA 1O9BA 1GPKA 3ZVLA 3CO5A 2JK0A 1EE1A 1TZCA 3BKXA 4Y9TA 4V0KA 5DX0A 1NURA 4XD7A 5AQEA 3A4MA 4RHEA 4BNFA 4F6RA 2F48A 2G5TA 4RM3A 4HV4A 5C8ZA 1QUFA 2FFRA 1LX7A 1PSZA 1OX4A 4E5VA 2K7ZA 1ECGA 1L4NA 2FMXA 3QBDA 2WE7A 4V24A 5B2EA 5CPBA 4OV6B 4DLXA 4RH3A 2FZ5A 1U2ZA 3LBYA 3QE3A 4Y2RA 3CWQA 1C41A 4FFMA 2KMLA 2CT8A 4L4SA 3VYTB 2BHTA 3ED5A 3LIIA 3VR4A 3KOOA 5EKSA 2G88A 5IEJA 3A9WA 5BYAA 3VC2A 1FJ2A 1JX6A 3DAFA 3R7AA 4J0CA 1VPLA 2AQKA 2PVPA 2OLKA 1F8FA 1NN1A 3OPYI 1PT5A 13PKA 1Z7GA 2YFKA 4N0EA 1M2OB 1KFKB 3BXXA 3UPTA 2PUDA 2EZ9A 3JQ7B 1K4YA 4PX3A 3RBZA 3ZW7A 4COOA 4OU5A 4TYNA 2Q9UA 4CMJA 2EFCB 5IX8A 1Y6FA 3ICQB 3JD2A 4ENUA 2JJ2D 1TK9A 2UDPA 4M0PA 2Q3FA 3EEBA 3O2QB 1Y3HA 3SMVA 1CUHA 4GOND 1SBYA 2FEAA 2OHOA 3ACBA 4L4RA 4EG7A 2ZAMA 3GRCA 3EGCA 5ERXA 2XZLA 4H2DA 3T95A 3G02A 4KXQA 2QRKA 2J9FB 1GKLA 1Z17A 4QUIA 1RLUA 1Q1BA 1ZCFA 4CV1A 3LP8A 4YDRA 3JVUA 1F7VA 1EE9A 3LA8A 1NYRA 1F2VA 1GPAA 2FFJA 3CKYA 3IQXA 1P0PA 3KSZO 2WR8A 4IHJA 3U9TA 3VI4B 2R6ZA 3ETCA 3BJIC 1P2SA 5TC4A 3ZU4A 3AHDA 2VDJA 3LPLA 1OI3A 3X44A 4MVYA 4CLOB 4DWOA 2LGJA 2VYFA 3BA6A 3TOZA 4HEA1 2QRZA 3AQ4A 4KAXA 4QICA 5JSYA 1DO2A 1E7QA 2B7CA 4ZO4A 2AOTA 1RAEA 3H1BA 5TRTA 3ZE6A 1BN7A 2FWAA 1FDIA 2V5UA 3KHKA 5L45A 1QFJA 3QFRA 2BFPA 1EEXB 3MRXA 3NZEA 4ED9A 2VXOA 2Y9PB 5LA6B 4Q12A 3T5TA 3RTAA 1EFDN 1GQ2A 2H2GA 2AC2A 2G1KA 2VPZA 2JIRA 2IYSA 2VYVA 5EKDA 3TW0A 3ZIAA 1WTCA 1ZNZA 2J6IA 1JTEA 4Q02A 2AN9A 1P4SA 1VGQA 3S7TA 3J81A 2EKDA 1SOUA 2J07A 4XGQA 3MF4A 1P91A 2OCLA 4Y6LA 2DE0X 5G4KA 4CF6A 1DC3A 1DNPA 4TTAA 3VUEA 3WLFA 5BWMA 4ICIA 2VUTA 4DLSA 4NNOA 1P9RA 4E5PA 2XCQA 1WABA 2OZLA 1JHYA 2FCRA 4FWIB 4LSGA 4OQPA 5LZ2A 2DFVA 2R1UA 2BUBA 1UL1X 5FAXA 2HRZA 2UYOA 4C7BA 3HKDB 4FBGA 1YI1A 4Y0VA 5FFMA 1NGSA 1V5EA 3FFWA 1VCOA 2BTQA 3OPYA 1KO4A 1RM0A 2RC5A 4XYEA 5CX1A 3H8SA 2PQ0A 3NVMB 4OQLA 2GTHA 5IUKC 2WQ7A 1G41A 3RGGA 3PRHA 5D5QA 4AY6A 5JTUA 2DUWA 5KHOC 1JG7A 1BHJA 1QV6A 1PX0A 3NGXA 3D8TA 3SJZA 5SZJA 1XNGA 1YBVA 2IE0A 1X92A 1TTTA 1DGQA 3ANYB 3CNQS 2X6TA 2PLRA 2C2YA 2RGEA 5HDQA 4GWGA 2D5CA 3B51X 4MHSA 1OJ7A 5KJ6A 4IV0A 1ADYA 5KYTA 3HCOA 3HYLA 4WY2A 2WBLC 3R9XB 1U7WA 3H3XA 3PXBA 2PEZA 3N0TA 2JH3A 4OI1A 2CJWA 4IUCS 1U7OA 2N47A 1Y1QA 4JWTA 1IEWA 2ILVA 1C0IA 1V11B 5DYNA 2P5SA 3RHSA 2CL5A 2FPUA 4U00A 2EZ4A 1Y6GA 4HS9A 1NLYA 5K09A 2GF0A 1GNLA 2Q5IA 2WD7A 3KTDA 5I9SA 5KQGA 1YT5A 3DKVA 4JZKA 4KW7A 3CF6R 5DZSA 4C7KA 1NNLA 3V55A 1WUTA 1RHRA 3D6TB 1M72A 4U7WA 4TMWA 2R48A 4Y8VA 4ZAGA 4B74A 1U2GC 2FY8A 3ANNA 2VNJA 1V1JA 2X9LA 1N1DA 4TTTS 4F46A 3ER9A 5GY7A 3UJNA 3SJ7A 4OBEA 3JAMA 4GXRA 1UPCA 3FB1A 3FKJA 3DTYA 4U0JA 1U8EA 3W5SA 1E6UA 2L19A 1XLUA 3SBOA 4ZVTA 4OIFA 2ACVA 2W5UA 4UUOA 1N0IA 1VSUA 1EFRD 1G8AA 2JIOA 1GG9A 3JWGA 4QLOA 3VFDA 4DG9A 3U56A 1WIWA 2A78A 3MS4A 1CUCA 2YYYA 1IZYA 1OV4A 3RTDA 4Q6WA 3B1JA 1GRRA 3MJ4A 3L04A 4G0QA 4MK4A 3VSAA 4C0XA 2FEWB 3R3YA 1I51A 2XMGA 5A4IS 2XF2A 5LQUA 4IDBA 2I34A 2XUAA 2PZGA 3NBUA 2PD4A 4JBNA 4RHYA 2XVYA 3PEWA 5C4GB 4Q93A 1QH1B 3TFWA 3ZVRA 1MENA 4LJ8A 3TLAA 4LFBB 1U90A 1FQOA 1KEUA 4WUTA 4DNFA 3TMYA 4UZEA 3QKUA 1DV2A 2WM9B 4JELA 3C3EA 2R84A 3ZE7A 3ZBUA 1U7HA 4OBWA 1ZHOA 3B12A 2XUDA 2QJFA 1NZJA 1QHHA 3DOFA 2ZE6A 3Q3VA 1BX3A 3QQ5A 4NFYA 3N2EA 3K8QA 2QD3A 3ESQA 1S9DA 2GXUA 4FNAA 1TFUA 3RADC 1EWYA 2QSYA 4X65B 1EFLA 2YC4C 2CUTA 3QPCA 3BXFA 3ROKA 2PR7A 2JGKA 3DKIA 3VOAA 3HDYA 3W9SA 1YKFA 4REMA 1GGFA 1KI4A 1MJGA 5IAJA 1T43A 1ATIA 3EASA 2I6QA 3ECCA 4XEUA 3S2EA 4AS3A 4AY3A 2GZDA 2GNAA 5HTOA 5KNBD 1PZGA 1TPZA 4MW5A 3NHPA 3H2GA 1I4EB 1M0SA 4B5KA 4L50A 3BB3A 3CVOA 1NZDA 3DZHA 4FP9A 4CIAA 3NYQA 3PYLA 1RLTA 3SF8B 1QTIA 4MR8B 4KWHA 2NWQA 5EY5B 1QYWA 3BD8A 1OIVA 1UM8A 2PQ2A 1JDBC 1SWWA 3JRNA 2X0IA 2OPBA 3UHOA 3VHLB 1AHNA 4EABA 2YFYA 1EPUA 1SD2A 4RGBA 4MW1A 4JP1A 3BRSA 1T91A 4IGFA 2FEOA 2RHCA 4JC0A 3K0HA 2YL2A 1TLLA 1KSGA 2X76A 3K71B 4C0JA 5E6SB 2VQDA 3SI7A 3UAYA 3GB9A 4IDDA 3OCVA 4OA5A 1Z5NA 1NFQA 2YWRA 3BREA 4FHZA 4YYZA 4FU0A 4N0MA 1Q83A 2V6FA 3E61A 4KIWA 2ZSEA 4UM9B 3JWEA 2QQ0A 5AI8A 2XAUA 3IC5A 4WKNA 4AZWA 3GJ7A 1EZZA 2R8ZA 4Z7QB 1MJHA 4IM7A 5L4LA 3IQFA 1R27A 2B5VA 2IDKA 1HLFA 3WLNA 3JQ9C 1PVVA 1R3UA 1S5PA 3CV3A 4PW0A 1F8YA 2Z4SA 1IAQA 4WKCA 3FOZA 2PJDA 3EC2A 2NO1A 4IHJF 1LI7A 3HKCB 4IBOA 2PSJA 3O8BA 1DAOA 2AYXA 3WLPA 1G2QA 3JATA 1VECA 1GVNB 1OILA 2HHAA 3WFJA 1SCBA 2R6CA 4A2PA 4QODA 2KQUA 4R3NA 4V0MA 5DX8A 5AIAA 1YUNA 4UU0A 1KY3A 5EKXA 1A71A 1OE0A 4AJ9A 1T2FA 4GGOA 2ABWA 2OXIA 3V8PA 5JHGB 3EPRA 3HM9A 5DGTA 3SZLA 4YJFB 1HY3A 4G1MB 2B20A 3H5LA 4KLNA 4X8OA 4FCTA 1N0UA 3LQYA 4CTOA 3PQEA 2BFCB 1Y8ZA 4BCDA 2R6FA 1HL3A 3H04A 2C2ZA 4HKTA 1XAHA 5AM3A 3ZY3A 2OFPA 1UAAA 4ZANA 2PIAA 3IXMA 1UMBA 2EGUA 2V7XA 1Q7RA 1U1DA 3EZLA 4JLMA 5FNZA 4KK4A 1TO2E 1YL5A 2PBLA 3RFXA 2XQJA 1SKMA 3WRXC 2X15A 3UHJA 5LZ9A 4KN5A 2CFRA 1YCGA 3KZOA 5CITA 1CUZA 5AW7A 4N4AA 1TCBA 4YHHB 2OTCA 3GEDA 3E2MA 1RPJA 3I62A 1RC8A 1XZJA 2HAEA 5AVWA 2AKEA 2H17A 3HB4X 3TAXA 5U1PA 2VWQA 1GT6A 4P3KA 4BZXA 1SELA 1KVTA 3EIUA 4H18A 2LCFA 2VBGA 1P61B 1BWPA 3HR7A 4P7GA 3RANA 4DT1A 3KO8A 4PYRA 1D4AA 5A9SB 2NTNA 1W47A 3HKEB 3EXIB 4AJLA 3PHBE 4K6OA 3TKLA 4YPOA 4TZ0A 1FP7A 3AU8A 1VDMA 3P9RA 5JXWA 1MAAA 1FVOA 3LT5A 4I50B 5DT9A 1IK4A 1NP6A 1E0KA 4TTJA 2Q4EA 3BZBA 5AXDA 1SXHA 4G0VA 3E2IA 4R9UC 5AVUA 1G8MA 4XD7D 1NPTO 2JGDB 3LCCA 4NYIQ 3BDVA 1KEKA 3WWPA 1UOOA 2R97A 3TNFA 2CWWA 5LQKA 1DB3A 3RUHA 2XNDA 1BS9A 1HURA 2IOFK 2NO4A 3PQ7A 3UCFA 1BG6A 2WMOB 3QK7A 3BORA 2VSOA 3ICPA 5JRZA 2JASA 1V45E 4Q19A 3WFZA 1DWOA 2VPTA 3NHBA 2Q2OA 5BV7A 4YAUA 2CWDA 3AF1A 3QW4B 1BAPA 4LEIA 2G1PA 2YV5A 3ZXXA 1JYSA 4LBWA 3GF4A 2IYVA 1HG1A 4CHTA 3G9ZA 1TL7C 4HDNB 3C4QA 3OIDA 3GVXA 4WY8A 1PG0A 5EJ2A 4GP9A 1WTAA 3DBHA 3AUAA 1OR8A 1GZ4A 2WG0A 4GDMA 4L2IA 4TROA 1L8AA 4DCNA 4DJEC 3PHGA 3U48A 1KOFA 4AMUA 5BMVA 4KQ6A 5AW5A 4ENRA 3HR8A 4HATA 5I9IA 3QIVA 2HK9A 1FXWF 1N6IA 3O93A 4LE0A 5F2NA 5EL0A 3ORHA 1OASA 3PNQA 5BY2A 4OOFA 3EH1A 2IQ5A 5EJ4A 3QLVA 4LDJA 1O1YA 1OZAA 3EDYA 3PPXA 1OQAA 3THXB 1NNEA 1FNCA 2RI1A 1EE2A 1J4AA 3KSUA 2JEZA 1WY5A 1XE3A 1R0XA 4W9NC 3R9KA 1W94A 1NN3A 1OX5A 3KM0A 3ND6A 1MH9A 1R7RA 4MRRA 4M21A 1VG1A 3T1OA 3S2SA 5K8VA 5LOVA 1GUYA 3VX4A 1E2EA 2Z2XA 1BN6A 1N2ZA 1QX4A 3MWEB 1VJGA 2QW1A 4PWZA 4BX3A 1M75A 3TK1A 2EFYA 4RF5A 1ZGHA 1JKIA 3ZGXA 2XTMA 1RWKA 1PWXA 5E9QA 4MAMA 1EM8B 2GCOA 3MOIA 3V8NA 1MDBA 4OU4A 5CCDA 3QP9A 1SXIA 3F6SA 3O4IA 3J7AC 3IR5A 1U0LA 5IARA 4NU8X 5CTJA 1I0LA 3URMA 1QMPA 4DRZA 3SG0A 1KYIA 2X6QA 3HUEA 1JKMA 4FS8A 1W35A 2G25A 1Q44A 3BJEA 5EWMA 5ECGC 1YS6A 4WI1A 1LVGA 3M6IA 3MOGA 4YP0A 4HWKA 1TC2A 1CDDA 3AHIA 4H1VA 2V7QD 4HC4A 3A1EA 3ZDYB 4C4YA 1G4UR 1C3VA 3TOVA 2ZROA 1LK0A 2QORA 4B2YA 4HLDA 3ISVA 4JC8A 3UGJA 1N36B 4TS1A 5DBHX 2FTKE 3VR2A 4HQFA 3PD7A 3JAKA 1NJFA 3QBVA 3OZRA 2Q7DA 4G56A 3DCJA 4GNKA 4M7PA 3QYPA 4WNAB 3KZXA 3VAZA 3VJKA 4DIDA 1TTHA 1VRVA 2DH5A 2VZ8A 4BKQA 2ZJ3A 2HDWA 3D4BA 3OUTA 7GPBA 2NG1A 1NVUQ 5DHAA 5LDHA 4YV1A 3KT3A 4ZYZA 1TX4B 1E1YA 4QECA 3DMPA 5JVDB 3QG1A 1OYVA 2PZEA 3BDAA 3UUFA 4EHIA 1TT5A 3IX7A 2AHOA 4NCAA 5EIBD 4RV5A 4PYJA 3BS4A 1SCAA 4MAAA 2QMQA 1TJ3A 3AF2A 1QV7A 1SQGA 1U0HC 2OGTA 5FO0A 2G6BA 3JQDA 3V4LA 3SSMA 2UAGA 3WNZA 3PCTA 5DMHA 5ALQA 1J1UA 1EGMB 4RU1A 4PSKA 1LRLA 1JW9B 3A3PA 3UXEA 4EY7A 1PFVA 1H66A 1SG0A 2X6RA 3A10A 1BEZA 1KAQA 2ZKIA 1RZVA 4HDMB 1ZVKA 1L5NA 3NIWA 3KLOA 3TI7A 1VGVA 2ZK7A 2EAUA 3E8SA 4OP1A 4XLTA 4HRVA 5I8WA 3E9DA 3HGTA 4ENVA 2PLNA 4XYBA 1Z2AA 4M7OA 1EX9A 2HF2A 3F0TA 1P3DA 5ITVA 2XNKA 2LZ0A 3EMVA 3HJFA 3I4CA