3AKYA

Stability, activity and structure of adenylate kinase mutants
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
b'ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Stability, activity and structure of adenylate kinase mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Adenylate kinase
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akyA00
1CJUC 2RMKA 4L9WA 4B2LA 1G41A 1KSFX 1RJ9A 4LK2A 3QF4A 4OI2A 2Z4SA 2ZRCA 5JWHA 3SDZA 4CRWB 4BFYA 1VG0B 3FKSD 3EASA 1G3IA 3LNCA 1FNMA 3Q5EA 1NJFA 1JPNA 2X8AA 1N0WA 1K8RA 2WMOB 4LX0A 4OL0A 2MSEB 1XX6A 3I5YA 2KI5A 1US8B 4EIWA 2GBLC 3AF1A 2OCAA 4X8MA 4GFDA 1OYYA 4CT5A 3RSOA 4TL9A 1ZUIA 4TSFA 4EPTA 4QHSA 3BOSA 1KNXA 1OYWA 1V5WA 3EXAA 3EIQA 4TT3D 3NWJA 1Z6AA 2VYFA 2W0SA 2GZDA 2XXAA 5JCPA 2CNWA 4CW7A 4MITA 2VP9A 5FPTA 2JA1A 2AD1A 2ZREA 1OJLA 2I3BA 3O8CA 1GNQA 1WQ1R 4AIIA 1KHTA 2BBOA 2WSMA 4LBWA 1BMFD 4LHVA 2VP4A 1YZLA 3K0AA 3UATA 5TMPA 4HAXA 4JLVA 2XGJA 4JKIA 2CHQA 2QORA 4JJZA 2EVWX 4LCBA 3EC2A 2OCPA 1ZD9A 2X77A 1XU4A 3RS7A 1L7VC 4QM7A 5JWOA 4FMCB 1OXXK 1P75A 1UBEA 4CDGA 1UADA 5E95A 2A5DA 1V43A 4TYWA 1PVOA 2ZR9A 3LQRA 4B76A 3KJEA 4NYJQ 3FMOB 3UMRA 1UF9A 3EPHA 1TNDA 4TLBA 2Q21A 3T5GA 1CJMA 1LS1A 1X1SA 3CWQA 5TV2A 2UKDA 3KKNA 4Z54A 5KSZA 1R4AA 4JS0A 5C2JB 1IAQA 4N3NA 4Z1MD 2G83A 2YNMA 3N70A 4OQFA 1R6BX 4DDWA 4OK5A 1CRPA 2GJAA 5CIQA 2JJ1A 3GFPA 5D3MB 1T5LA 4LPKA 1E0AA 4DCTA 4PZLA 4CF7A 4HLUC 2V9PA 2W2TA 2RCNA 2G1JA 3CZQA 1I2MA 4HAWA 4IW3B 3QXCA 1TEVA 2AWNA 3CO5A 5DHFA 1E9EA 3OEHD 5CLQA 3RWOA 3TIFA 4B6FA 3EZ9A 4Z8YA 1J8YF 1ZU4A 5FBLB 2J5XA 4L16A 1A5TA 5L3QA 1Z2AA 3CBQA 4A2QA 2HT6A 2KB0A 2O8FA 3LLUA 2GXUA 4IEEA 3U7HB 3GFOA 5LD2C 5J5CA 2QI9C 3JVVA 3CH4B 2DPXA 5C1BA 4B33A 2O8BA 4TMTA 4D0NA 2W2XA 3GLGB 1AGPA 1OFHA 1PZNA 3LA6A 3GLFB 3PVSA 2ZJ5A 5DI3B 1X86B 4LJ5A 1XEFA 4PC2A 1PLLA 4A4DA 4QBFA 2ZU6A 1GITA 2A5YB 2AHOA 3O8RA 5AJXA 2ORIA 2QA5A 4A92A 4U02A 3FPAA 2CCGA 4DRZA 4DWJA 1SKYE 2H92A 1UKYA 3PEWA 1II0A 1TEXA 4LJYA 2XZLA 3THOA 5KO2A 2C78A 4US1R 4KFSA 4L8GA 4DLRA 2QTHA 2Y8EA 4QGHA 2QSZA 2GXAA 2AXNA 3SJZA 1E9DA 2ZANA 2GTPA 5KSPA 2CVHA 4US0R 4P3YA 1F2TA 1LV7A 3KKPA 4J0QA 2XSZD 4NCHA 4IOJA 1YZGA 3KKOA 4PPNA 1E1QD 2PLFA 1W46A 2IA5A 3WBJA 1JR3A 4YDHB 3RC3A 4HUTA 3UKDA 1D6JA 1AKEA 4KODA 2I1QA 1AZTA 2A7QA 3AP2A 4RD4A 4IVQA 2EFCB 2ZI5A 3RC8A 2FPMA 3ND9A 2WWWA 3CRW1 4JSTA 1J7KA 5FUXA 1G5TA 3IKJA 4XVRA 4D4KA 3KJIA 4KITB 2RGXA 4ILEA 1PLKA 2PLRA 5CJPA 1G291 4DSOA 2RHMA 2WKPA 1N25A 1F2UB 2BMDA 1ZMXA 5J4KA 3VFDA 1Z29A 1A1VA 2GWHA 2BV3A 2GESA 2WKQA 1CR2A 1OXTA 1FFHA 4AURA 3BFKA 4U5XA 2C04A 2VQSA 4MKHA 2VLIA 2RGNA 3C15C 5JZVA 4WZ6A 2E87A 1UBGA 2DY1A 1WP9A 1N6IA 4MQBA 4HATA 5UKDA 3QKSB 2OUKA 4TQ9A 1NVVR 1RFLA 3Q7PA 3DOEA 3VX3A 3C14C 1S3GA 4KXFB 1ZAKA 2G0NA 2OBLA 3AB3A 2IWRA 1E79D 1FL9A 2AFHE 1YRBA 2ZRKA 3QSYA 3KFVA 4JZKA 1E2QA 3WYGA 1E2EA 1KZ7B 1T9HA 1ZM7A 5B30A 5DE3A 1ZM4A 3AVTA 521PA 4MYTA 2HCJB 2FN4A 221PA 1CR1A 1TQDA 4ZPXA 1RRFA 3BAFA 3PUZA 1XPUA 1KDTA 2WOOA 4YMUA 1E0SA 2XOKA 2IUSA 1PUJA 5D3QA 3TH5A 2F3TA 4PTLA 3A58B 4Q7KA 1U0LA 1S9DA 4TLAA 2YJTD 1KO4A 2IYWA 4PO8A 2H5EA 4D6PA 3EPJA 4QL3A 3BK7A 5EUMA 2C8VA 1S4QA 2Z83A 4NYMQ 3QPVA 3TVDA 4JJKA 1JQLB 1N5LA 2AK3A 3OFNA 3MJHA 4L4UA 2QNRA 4IVRA 5FR2A 1TMKA 3NHAA 3RS4A 5G3YA 4QJ3A 4XH9B 4URYR 3RRMA 3GEHA 2WBLC 4HZIA 2JASA 1IQPA 1WE2A 4O25A 3QF7A 2VHUA 2O8DB 4C7OA 3M0EA 4IDPA 4FMDF 3TLXA 3HPQA 5C46F 4A6PA 2HF8A 4DLUA 2N42A 1NIPA 4LGMA 2B21A 3CB4A 4AKIA 4JMPA 5L3VA 2E1RA 4I1OA 2FFQA 1M1YE 3VKWA 2F9LA 4DLVA 4P33A 3C5HA 2YV5A 5KUTA 2QGZA 1JNYA 2XZPA 4V0KA 1NN0A 5TB5A 4EJSA 1CU1A 4B3XA 4YONB 5JMTA 3QBTA 3EZ6A 2JCSA 5HCIA 1OIXA 3A1WA 4DT1B 1N6PA 2H7VA 4Q48A 4IFEA 1P7CA 4IHQA 5KDDA 1GM5A 5DN6A 1QDEA 1GKIA 2VEDA 3WMEA 3MCAA 2PMKA 4HB4A 3K09C 3LO5A 5JSZA 2C5LA 3JZMA 3FOZA 4G5RA 3ZZUA 2PMDA 4JLNA 2IHYA 1J2JA 1ZNWA 5BQ5A 1D2NA 2G88A 2NIPA 2W2VA 4S2EA 4BFXA 4BZXA 2QG6A 4HLCA 4N1AA 4QBIA 4D0LB 2GK7A 3G82C 1KK0A 1TQ6A 2ERXA 3PITA 4KHZA 4TLCA 3ZIAA 3ZYCA 5DI9A 3IILA 4ARZA 2FGJA 5L3SB 4TLEA 3C8UA 1DELA 4K8OA 4NKRA 4C0LA 4ZO4A 1EX7A 1QHIA 2ZJYA 4GBMA 5CM8B 3UWKA 3PR1A 3ZVRA 3NC1C 1NMZA 2FJUA 1KI7A 5CITA 5HKKD 3LLMA 1X1RA 3QENA 4A0FA 1W47A 2D7CA 2LCFA 2V6JA 2QP9X 3VR3A 3DMDA 4JBYA 3NTUA 721PA 1XBTA 1G17A 4URUR 3CPEA 3ZIAD 4YXWA 2XEXA 1VKJA 3BC1A 2FF7A 2ZI4A 2ODBA 3QIAA 3MWKA 4LHWA 4Q1EA 4TQUS 1M74A 1OB2A 3U3KA 1YE8A 2R6DA 3NC0C 2ANCA 4M4SA 3ADKA 1P62B 4C0HA 3KXLA 4PAOA 1XEWX 421PA 5TXGA 1YZTA 1IY0A 2F43B 3CNLA 5LPNA 4DJTA 4DDTA 3A6PC 3GJ0A 3AKEA 1ZM3A 2IK8A 4TMKA 4XSHA 4NBSA 4OBEA 4IDOA 2FDCA 2FFHA 1GRNA 2IF2A 5DISB 1AQYA 5JCZA 1Q1ZA 1NLYA 4IOKA 2AN9A 4Y0VA 2ZR7A 5JWRA 4Q7MB 2QP4A 3U2QA 3Q9LA 3WNDA 3GLIB 1Q12A 1G8FA 2R9VA 4M0LA 2OESA 1ESMA 2BWJA 1Z0JA 3UANA 4MUBA 1K5DA 1QHGA 1SXJD 2KE5A 3I72A 2QBYA 2XNDD 3NXSA 3HDTA 5F9FA 1DAMA 4C0SA 3EIHA 3K70D 1OFIA 1OIVA 1Z22A 2WV9A 2QE7A 4LBYA 4MA4A 4NH0A 4GI7A 4IDQA 2G3YA 5JEEA 5IHPA 2VPPA 2J0UA 2PZEA 1Y3AA 5FFMA 4MYCA 4FD2A 2C2HA 4GOJA 3TKLA 2JLWA 1FQJA 2AFIE 2C95A 2AX4A 2AR7A 1SQ5A 3VMFA 2GZAA 3NH9A 1G8HA 1MO3A 2B92A 4G3XA 4BFVA 3QY0A 1S2MA 3LY5A 3WXMA 4DUGA 3AF3A 1M6NA 2ZSAA 1TU3A 2ZRLA 3FE2A 5B58C 2IYUA 2GJ9A 1Y63A 2BHRA 2IEZA 5KYKA 4B6EA 2P65A 3OF5A 4HDOB 4JVMA 1NN3A 5FI0B 2OILA 5B57C 3A4LA 2VL7A 4QRHA 1G9XA 5A4JA 1WBDA 2B7CA 1JQJC 1XF9A 3AGQA 2ZI6A 5G40A 3U44B 1SZPA 1ZNXA 2NPIA 3NDBB 1AS0A 2JLXA 5DIFA 1GILA 1G21E 1XZPA 1QF9A 3B9PA 1W4CA 4DUGD 5HZHA 1T91A 1G7CA 1L8QA 1M8PA 4LJ4A 2Q9AA 2XB4A 4A9AA 1RRPA 1N6LA 2L0XA 4JLDA 4TYQA 5CJ2A 5AWFC 2VF8A 4RJLA 3K0CA 4MRRA 3RRZA 3TAHA 3B7GA 3B6EA 3FHOA 1GDDA 4M9ZA 4LHXA 4AD8A 2I1VB 1KO1A 4OKSA 3L8ZA 3WY9A 3SZRA 1EXMA 3F8TA 4QJ4A 1Z6XA 3BIFA 1SVLA 3ZZTA 1JEEA 1S1MA 2QN6A 3NH6A 3WYAA 1Z08A 2OFXA 1QBKC 4WXRA 3OE7D 3U3JA 2BM0A 1R0YA 2FEMA 4EUNA 3ZGXA 2J0QA 2D7DA 3THYA 1N6NA 1LF0A 4UKDA 1NLZA 4KAXA 1ZUNB 2FMXA 3FKQA 3O8DA 5EXXA 1HEIA 1T6NA 2NO9A 2WMNB 4NP6A 3BB4A 2YWFA 4CEJA 4G5QA 3I5XA 5JJIA 4B34A 2Z43A 3THXA 4Q4AB 3GD7A 4ESHA 4WBSA 3DMNA 5M04A 1Z0IA 1NSFA 2YZ2A 3PFIA 2PX3A 3VNUA 4MGZR 1GFIA 4KYIB 4AC9A 2XX3A 3P1JA 2ZSDA 3IGFA 3QG5A 4D0GA 4TYNA 4M1OA 5IDVA 1G16A 1E1RA 1VG8A 1SVWA 3KUCA 1D9XA 1HQYE 4AYWA 2HLDD 2FE4A 2XJ4A 4LOAA 1RC8A 4LV6A 1GIAA 1Q3HA 3IIJA 2HV8A 3EPLA 2O52A 3I3SR 4B35A 4AYXA 3B1ZA 1E99A 1OIWA 1HUQA 2ZS9A 5FPYA 4QBHA 3PUYA 2Z5FA 2XTMA 2WPDD 4TZ6A 1HT2E 4EQ6B 1MO4A 3R7WB 3SC3A 3ZD7A 2ZSFA 1P73A 4XD7A 3CM0A 2NO7A 4RVCA 4ITRC 4QNMA 2VHTA 2QT1A 3THWB 4A36A 1NI3A 3TUJC 2JIZD 1VECA 4JSYA 4KFTA 4XTRA 3C7KA 3WP0A 3IHWA 3QQ5A 1ZJ6A 3I8SA 2VO1A 2P2LA 2CL7X 3V00A 1U94A 1ANKA 2DWOA 2QZ4A 4B48A 3CF6R 2ZUDA 3RWMB 1DADA 4PHFA 1XD2A 3T5DA 4E03A 1UDXA 4G5SA 1EFRA 2PZGA 3EWSA 1CR0A 1MT0A 3W5JA 2P6UA 4XD7D 1NN5A 1CP2A 4DC9A 4Q9HA 4LV8B 1G3MA 2D2EA 5DI3A 3CRMA 3WP1B 4CEHB 1ZRHA 5F3WB 4AI6A 3K8YA 4R2IA 1Q0UA 2ZRPA 1MRSA 2HYDA 1CR4A 1WB9A 2V6IA 1JB1A 2NO0A 2ZI7A 3C16C 3MUFA 1TF7A 2UVQA 4Q1DA 2IYRA 1NN1A 5FOUA 4XIGS 2IYYA 2A5GA 3IUYA 3ZJYA 3J81k 1X6VA 2YINC 4KLZA 2QRZA 1KI2A 2R44A 4TMVA 2QAGB 3A4NA 1EFUA 3IO5A 1S0UA 3RYTC 1NJGA 3NVAA 1J90A 3DO6A 3S1AB 5FBRB 4P0TA 1HY3A 1ODFA 2ZTSA 1AZSC 1GRQA 1G20E 3A37A 1UKVY 3FFAA 4OYHA 5B64A 4NYIR 3UG7A 4Q03A 3PEYA 4UNPA 2J9RA 1JAHA 2F6RA 4EJSC 3BERA 4QC2A 3SN6A 1ZM2A 2P6RA 2QROA 1C1YA 3P27A 1S1CA 4QBGB 2Q3HA 4DBLC 4DB2A 3T1TA 4UXJA 1KO8A 4DCSA 1Q20A 3MWLA 4UNNA 4DEYA 3K70B 3AVPA 3T12A 4EKDA 1XTQA 5FBWB 1C9KA 1Q3TA 3NBXX 1NVXQ 1KO5A 1F2UA 1KI6B 1U81A 3QXHA 3U3MA 2BCGY 3NHBA 1W2HA 4A6XA 2VSOA 3ADDA 4W9MC 1SVIA 3U6BA 3R20A 3VR6A 5K8UA 3CR8A 2OAQ1 4DLYA 2QSYA 1NMYA 3BFXA 5L3RA 4A1FA 3LWNA 3PEUA 3SYNA 4RKFA 3ZH9B 4JYCA 4WZAE 2ERYA 3K0FB 1GTVA 1FTSA 2F1HA 4CEIB 4LRWA 1SULA 1XEXA 3AF2A 4I81A 5KDLA 5KU1A 1IONA 3HU3A 4PZZA 2IS6A 1VYUA 5BYJA 4A2WA 1BIFA 3TR5A 3L0IB 1G18A 1E94E 4P31A 1WA5A 4A8JC 1S3SA 4UJ3A 2YWEA 1E0KA 4PSVA 5E7IA 5JS8A 3R8FA 3LBNA 2FX3A 1XMVA 3Q5DA 5BW8A 1ONBA 3BB1A 1VPLA 4MKFA 4WOPA 3EC1A 3CPJB 3BD9A 3EW9A 4DLZA 1LFDB 2NOAA 1G7TA 4QFMA 5DSZA 5ANRB 4MKGA 2WWIA 1COWD 4UNRA 1SXJC 2ZRFA 3MGCA 3UPUA 4ASUD 2ZRMA 4V02A 1OF1A 3K70C 3KTAA 2DHRA 4MDEA 2W0MA 2ANBA 1VYTA 4GL2A 2DR3A 4YMTA 2PCLA 2O0KA 4QKQA 2NQ2C 1CBUA 1SHZA 2O8EB 4B3GA 4PAQA 4LJ7A 4Q9JA 2OG2A 5EE3A 5F2EA 3ZS9A 1XB2A 4HAZA 3B13B 3GJ6A 5LD2B 3P20A 2AWOA 2V7QA 4US2R 4XJXA 1A82A 2MMCA 2QMEA 2J0VA 4M21A 4TSFD 3B60A 4BWYA 4TL8A 1GWNA 4Q4HA 1WF3A 2BJWA 3WNBA 4UJ5A 1X3SA 1TX4B 1XRJA 2B8TA 2WJIA 4QG7A 5GVSA 1WXQA 2J7PA 2ZIAA 2CNWD 3U7GA 1TF2A 3SNHA 2O0HA 3BBPA 4CIDA 5KPDA 1OT3A 3IPXA 3MSXA 5FTKA 1IXSB 5CIWA 3OZXA 1T4GA 3QVVA 1YZKA 4TQAA 2DFLA 4OJKA 2X1VA 4EDHA 2MSDB 3GJXC 3P4YA 1GL6A 2CK3A 1ZVQA 3DDCA 4OQNA 5CLLA 3KKMA 2G9NA 1KJYA 3VHXA 2N46A 2GZHA 3QXXA 1EGAA 1KDPA 1NVWQ 3JZAA 4KBFA 3D3QA 2CL0X 5DNYB 4JVSB 1GNRA 1KNQA 1XMIA 3V4RA 2ZR0A 3AVQA 2LWIA 2Z6VA 1HA3A 2QAJA 3D6TB 3FB4A 1XMSA 1SVSA 5E3HA 3HR8A 2GCOB 5AJYA 4PHGA 2CBZA 2OCYC 3CONA 3SHFA 4EPWA 3WMGA 2BC9A 4GRAA 1AKYA 4RFSA 1DARA 3R8CA 3U4QB 2KSQA 3RABA 3U7FB 4DDVA 1P9RA 2DFKB 1KMQA 2JJ1D 3WRYC 2FEOA 3EA0A 3K0CC 4CVNA 4QM6A 1MH1A 1Z6YA 1GP2A 2ZRHA 1DO2A 3H2YA 1E2PA 2NPFA 3LVRE 2NTYC 1YVDA 2BCJQ 1O87A 4GZMA 3QG1A 2CL6X 4QGAA 4BFWA 3SI7A 1E2MA 4R2HA 4BLTA 5TARA 4TYYA 2HDNB 2REOA 3BH7A 2OM2A 4HZUA 2WKRA 3RDPA 1MABA 3REGA 1UKEA 3TVTA 1RW4A 1F60A 4NYMR 4YDSA 1HTWA 1EESA 5E4FA 2O5VA 4UQOA 1UBCA 3G0HA 2JLYA 5DGXA 1YKSA 2F43A 3AVOA 1JBKA 1PLJA 5SZHB 5FTLA 3AKDA 3W9YA 1DPFA 3TUZC 5FTJA 2XZOA 1P61B 4ZI3A 3BB3A 1JAIA 3N5CA 1OB5A 4F38A 4D4JA 1F3OA 2GF9A 1RYHA 3CLVA 3NIBA 4V0LA 2ZE5A 4W5WA 1GVNB 3CWZA 2PEZA 2C03A 4FMCF 1M2OB 3W6PA 1Z8FA 4KBGA 3T1OA 5KTYA 2BMEA 1G6OA 2ZPTX 1R8SA 1FX0B 2P0EA 4ZKEA 4CZ2A 1DTSA 1T0JB 4JYBA 2WJGA 4B74A 4LJ9A 2IHBA 4OQXA 5AUPB 1NG1A 1R0ZA 2NGRA 3TK1A 4OQLA 2V55B 4C4PA 1E9RA 1SKQA 2Q9CA 1FNNA 4V0ME 3ADBA 3TNFA 3FVQA 1G4AE 2FNAA 2WJVA 1XDBA 1QZXA 2Q0HA 4PC1A 4XWKA 2A5FA 4P4TA 1M7HA 2B8WA 4BFZA 1XPRA 4MGIR 2JLSA 2V1XA 1GZSA 1VCMA 4BRWA 4KFUA 4C2UA 3AVUA 1YZQA 1TADA 3UG6A 1A2BA 1Z0DA 2QM8A 1H8HA 1X8JA 1ZIOA 5GVRA 3SEAA 1G1MA 1RYFA 2WICA 4E09A 1XPOA 1XJQA 3GLGE 2P6NA 2IL1A 3GLFE 3EZFA 1IXZA 4TMZA 1JR3D 4P4SA 3RS5A 1ZP6A 3KXIA 4OHVA 3RHFA 3DM5A 2FOLA 4FCVA 4CYMA 1Z63A 2A9KA 1F6BA 1JXMA 2EYQA 1YRAA 2K5UA 2ZUCA 3AQ4A 3TQFA 4FMDB 4DLXA 1Z0FA 5EP2A 2Z0MA 5FPHA 2FSFA 4O2LA 4JL6A 1ZNYA 2EYUA 2X2EA 3ECCA 3MAAC 4RD2A 3OIUA 1H8HD 4Q00A 5TY0A 5H70A 3FHCB 4DCNA 2FWRA 1RPZA 1QVRA 4S35A 4V0NA 1Z83A 2CJWA 4C0QC 5FL7A 2JGNA 3HYRA 1DG1G 1FQKA 2VSFA 4GP6A 4D2IA 5FI1B 2ZJZA 1WRBA 4RZUA 3WHKA 3GLHB 4II7A 2ZRNA 4LYHA 3N2IA 3F5FA 2OSBA 2ZSEA 4FWTA 4IKEA 4EFNA 4DCVA 1XJ0A 3TW8B 1RRGA 4NMMA 1E0JA 3KDSE 4DSTA 4M1KA 2WJHA 4HYYA 1OH6A 2WM9B 3SU8A 3BH0A 4PPQA 4DIDA 1KGDA 2EWVA 5KNCA 2ODNA 2W58A 3QKRA 1NIJA 5FUVA 1PJRA 2ZYWX 3KJHA 1CS4C 3KL4A 2CLSA 1Q57A 2AD5A 4ACBA 2F1RA 3MFYA 4MDFA 3H1TA 3TW4A 4C0JA 1LNZA 2WSSA 1N5JA 4Q19A 2ZJ8A 5E7JA 3GPLA 2VHJA 2XOKD 3M6AA 4HI0E 3CKLA 5AUNB 1ZCAA 5KSYA 4Q4AA 1E9CA 2BKUA 2OV2A 1AJEA 3QI2A 1QG2A 4B47A 4HSEA 2MMGA 5FL3A 3ONWA 4LV5B 1QHYA 4OHXA 1OSNA 1AA9A 2PT5A 4BASA 3HPRA 4ESVA 2ZVQX 2ODEA 3A1UA 1Z07A 2GKSA 4GMDA 3OFND 1J70A 2WZQA 1KOFA 1N6OA 2BKEA 1G3UA 3KX2A 2ZS7A 4Z51A 4LBVA 2XXAB 2CCKA 1XCGB 2HT1A 4BFUA 2IUTA 4G1UC 4YQFA 2C99A 4M1MA 3AM1A 1IM2A 1E2DA 1JJVA 1T5IA 4PHHA 5ELXA 2V1UA 4D26A 4OHYA 4M9SA 3B85A 3CF2A 3K0AB 1UPTA 1QHHA 2XITA 3WBKA 3HWSA 4IEIA 3SFZA 1XTKA 3L8YA 3D31A 3MD0A 2OXRA 3CF0A 4JIMA 3WMFA 5DH9A 3SBEA 1DAHA 1TTTA 3TJZA 1F5NA 3A1TA 4OI1A 3AF0A 3W8RA 3THWA 1T8UA 1R5OA 3AKYA 2AXPA 1I2DA 4BGDA 2UZ3A 5DN6D 2RHDA 2IXGA 1A7JA 2ONJA 4E07A 5J4YA 2ZRGA 1N6RA 1IN4A 4FMBB 4LC0A 2JJ8A 2C98A 4AWXA 4A15A 2F3RA 1TUIA 2NO6A 3CH5A 2WVJA 5CM9C 5CB6A 4IXMA 2CVFA 1HE1C 1I4LD 2IYQA 2QM7A 2TMKA 3AV0B 1KSJA 4PPFA 4PQRA 1I4DD 4AYTA 1AGRA 1FUUA 3MG9A 2ZRJA 4B73A 1EX6A 4ZDIA 4AKGA 4OHWA 3SJBA 3EARA 3O8BA 4Q7JB 3Q3JB 3DZ8A 4HUQA 4BUJA 2UZIR 5EP1A 1W7AA 3IDQA 1ZD8A 4BLQA 5L3QB 1DO0A 2GVZC 2QAGA 2IYVA 3UWOA 2O8FB 1S96A 1RVDA 5JLJA 1W48A 4B3FX 4DIEA 2QY9A 3Q72A 5BN3A 2N1BA 4MRPA 3I62A 3GJ8A 3E5HA 1E2IA 1YHNA 2EQBA 3U3OA 3V4FA 1TAGA 4YXWD 2ZROA 3BE4A 2BDTA 3T35A 2P3SA 1QG4A 3LW8A 2O8BB 2VP6A 3TBKA 3EG5A 2W6IA 5J4VA 1XNJA 1LB1B 4XWAA 5JS7A 4GPTA 1YJ5A 3U3RA 1HV8A 1D9ZA 1ZC3A 2H57A 2X19A 1W4AA 1KY2A 2QT0A 3WNCA 1R5NA 4JLBA 4MYUA 4KU4A 2XAUA 1X8KA 5A0FA 4EFMA 1GSIA 2KJQA 4W5JA 1E9AA 4Y0AA 1KI6A 4FI3C 3T1VA 1KIMA 3RVBA 5A5GA 3RS2A 4K46A 3TSZA 2GETA 2YC2C 2FPLA 4BLOA 1ZYUA 1W36D 1KY3A 2PCJA 2FSGA 4TLDA 5J47A 3FDIA 1XXHB 1NBMA 1A4RA 4CEIA 2GRJA 3EIEA 4LJ8A 2REBA 4K81B 4Q02A 4D81A 4WW0A 2RH5A 3Q85A 2OFWA 2QE7D 3OIVA 4BLSA 4ACAA 1CXZA 3ASYA 2QL6A 2WJYA 3RRYA 4CGZA 2HEIA 5AK0A 4FXPA 1Z06A 2ZYTX 1RE0A 4BFTA 3LBIA 1VCNA 2ZE6A 2GCPA 2BMJA 3A1VA 3BH6A 4Q9IA 1DS6A 2FFAA 5BXQC 2WWHA 4GZLA 3I61A 2IYTA 3GLIE 2VBCA 1Q1BA 4XVQA 3G5UA 1ZW6A 3KUDA 5EUQB 4OQMA 5EXPA 1NLFA 4L5BA 1CRQA 3HJNA 4RFVA 4E22A 1US8A 1EK0A 2HJGA 4KO8A 4HLUA 4GMXA 4U00A 3LRPA 4FWIB 4MGKR 3NG1A 3MLEA 2R65A 1W4RA 1W0KA 2ZITA 3K1JA 2VP2A 5FOXA 1KI4A 3SS8A 1ELOA 1KI1A 2IEYA 4DVGA 2D3WA 1LVGA 4C3ZA 1KK2A 5HCNA 3I1FA 1EFTA 4BQSA 3ZZ0A 4PO9A 3TR0A 2XTNA 2D2FA 1JPJA 4LPSA 2FA9A 2NG1A 2F55A 2ZRAA 3VAAA 4I99A 5HE9A 3ICQB 1E6CA 1WCV1 3MMPA 4Q1FA 1GL9B 2CE7A 2OE2A 5CK4A 1P5ZB 5GJWC 4AKHA 2FG5A 5CYOA 1SVKA 3LFUA 4X8HA 3CUEF 4F7WA 2OAP1 2IBMA 2R6GA 4N0EA 1P2SA 1HQCA 2ZQ5A 3UMFA 3B9QA 3M4YA 2R8RA 2KBFA 2IT1A 1GKUB 1ZUHA 1W0JA 1UFQA 2XNSA 3EA5A 2HYIC 2ECKA 3OESA 5IF9A 4GOKA 4D25A 4EPRA 1GOTA 1U0JA 1XCPA 4JLMA 1MKYA 1XD9A 5KNBA 1E32A 1HH4A 4C7OB 1U8AA 4ZV4A 2AKAB 1XTSA 5D3MA 5AR1A 4ZCLA 3UXMA 1E4VA 1D2EA 3DKPA 2RGNC 4PPGA 3X1WA 4Q9LA 1VG9B 1ZC4A 1FZQA 1OKKA 3W90A 4G5GA 3VQTA 2NO1A 2R6FA 5K8TA 4LWZA 5CK5A 1FUKA 1H8EA 3GCGA 5SZJA 4FCTA 3KQLA 2BBTA 4V0MA 4HAUA 4DEXA 5IRCD 1N2CE 2GEUA 1EFHA 3ZD6A 3WHLA 1DAGA 4NCNA 1E1RD 4EJSB 1D2MA 2LKDA 3QBVA 3X2SA 4BLRA 3MWYW 2IYLD 5AJWA 3W6OA 4MKIA 2RGCA 2VRWA 2QGNA 5GJVC 3Q7QA 1Z28A 2JDIA 5C18A 1DEKA 3VU9B 5F9HA 5E7MA 5FPSA 1JXOA 1Z47A 1OKKD 5AUQA 4KI0A 1VHLA 2SHKA 4C9BA 5FOWA 2QQ0A 4B75A 3DVLA 3QKUA 3H4MA 4URZR 3GLGA 1EWQA 4POAA 3U6KA 2ZEJA 3GLFA 3PXGA 4DSUA 2ZJ2A 2GEDA 1VMAA 3KQUA 3AEZA 1N6KA 4Q01A 4ARZB 2G77B 3A36A 3K9HA 1KSHA 1IN6A 1TL7C 1KSGA 3W5IA 2FFBA 1QHXA 3BXZA 1U0HC 5JRZA 5FUWA 4D4LA 5HZKA 5IK2A 4Q1BA 1G5RA 5EZ5A 1E2KA 2IYXA 3QEJA 2WWFA 2GAAA 4HB3A 1EFRD 3GJ5A 1XTIA 4QJ5A 1JJ7A 1FX0A 2FSHA 1E2NA 2XJ9A 1VCOA 3LX8A 4KV9A 5CYPA 4A8JB 1KKLA 2XTZA 1LY1A 2ORWA 1IJFA 2R6AA 1P3JA 3FMFA 3RNLA 1C4OA 5KDOA 1ZBDA 1AM4D 2C9OA 1W49A 5KHOC 1OFTA 1BKDR 4NYJR 1E3MA 4XTCS 5CB8A 5FBQB 2VP5A 2WJJA 2GEVA 1O3YA 2ZJBA 1HE8B 1R7RA 2J41A 3L2OB 2ZU0C 1SXJB 3AF4A 4HAVA 2Z4RA 2FGKA 1BYIA 2HF9A 3QEOA 3GFTA 4PXAA 1II8B 1EG7A 4QXAA 4R98A 2FSIA 4WA7A 4LSGA 4BEBA 3H86A 2CLDX 2F9MA 3OIWA 4FN5A 2G6BA 1E98A 2QTFA 4IOLA 2IC5A 5SZIA 1OHHA 1U8ZA 4NHOA 1J8MF 2ZE8A 2CHVA 1W36B 1OW3B 4TMXA 1WDTA 4ZDKA 2DFNA 4M1TA 4Q1CA 2P5SA 4AG5A 4M22A 1NNEA 4W7SA 1CTQA 2GXQA 2JLUA 3VR2A 3SR0A 3FFBA 3QKSA 1D8TA 1GNPA 1DBSA 3LX5A 3I73A 1F48A 1NMXA 5JEDA 3B8HA 3VKHA 1G64A 2EWWA 2HJVA 2I4IA 1MV5A 1OHHD 1KI9A 1RZ3A 2MSCB 3NKVA 3CRQA 3W8NA 3GLHA 4LHYA 6Q21A 3LAWA 3D8BA 1N0UA 1UKZA 1CLUA 2CXXA 3FKSA 4E5UA 3K09A 4WZBE 2EFEB 3WRXC 2CMKA 1KTVA 3I4LA 4NU0A 1G3RA 3SYLA 5JECA 1N6HA 3T61A 2OO7A 2DB3A 3QJYA 2V8OA 1ZCBA 1DAKA 1AIPA 1AN0A 3TMKA 1W2GA 3PQCA 1E4YA 1KO7A 1P4SA 3LW7A 1W44A 1B0UA 2F1IA 2DBYA 2WAYA 3L0SA 4TT3A 4D82A 5FTMA 3CRRA 1M7GA 1VDZA 1CJTC 2BMFA 1JR6A 1VIAA 4V0OA 4I1UA 1NSTA 3CNNA 1R5BA 5TVKA 3FMPB 4DXAA 2O8DA 3UK6A 4TN1A 1IY1A 2NZ8A 1W36C 4GDFA 3CIOA 2CHGA 1L4UA 1L2TA 1BMFA 3K9LA 2KBEA 1J99A 3IBYA 1NBME 4MUAA 1MOZA 4TWZA 3D7MA 4AK9A 3DKVA 3DM9B 1GAJA 1OXSC 3NBYC 3ADCA 2CEAA 1VG1A 1DOAA 5KSOA 1W5SA 4YLGA 4YMWA 4F4CA 8OHMA 1VTKA 5CDFE 3PJRA 1IN5A 4DT1A 2A2ZA 2IXEA 2Q3MA 3KJGA 4HLDA 4B44A 2H18A 3CX8A 2GILA 3AP1A 3AUYA 4ZIRB 3B5JA 3THYB 1E9FA 2V7QD 4MRVA 3K0SA 1KMHB 4Z1MA 1E2HA 2RGEA 1YQTA 2ZRIA 4URXR 4B3CA 821PA 3PUVA 1NVUQ 3SJAA 4C0KA 4JLAA 4CEJB 4ERNA 4R9UC 3RLFA 3THXB 4G0NA 2VHQA 3LVQE 4NYIQ 3T1QA 2ATVA 4LY6A 1YR8A 2DYKA 2J7PD 4Q47A 1KDRA 4ON9A 4PANA 3KQKA 1XJCA 3MWJA 2G1KA 1E2GA 1U90A 2ZYVX 3FTQA 3IIKA 3KKQA 4LDJA 5L3SA 4Q18A 1VYVA 1YZUA 3OEHA 3NDPA 1FMJA 3QOFA 3X1YA 1SKYB 2DWQA 1G8GA 2E9SA 1JI0A 1OV4A 3K0EA 4RCZA 2CK3D 3BS4A 5LB4A 4I4LA 3EWAA 2QP3A 2JAQA 1RKBA 1ZD1A 2CLCX 2WOJA 3OAAA 3H84A 1IBRA 1G19A 3E1SA 4PFSA 3VTKA 5EP3A 3SJCA 1E69A 3P32A 1P72A 4PZYA 5SZKB 3KB2A 2BM1A 4TTPA 1KAGA 3QPWA 4KJZA 1ETUA 3L82B 4OI4A 2J46A 1I4TD 4QGFA 4XVUA 4NE2A 3ZVNA 4RCYA 3B82A 4A82A 2FH5B 4IFBA 2W00A 1PV4A 3SOPA 1BH2A 1E2LA 3A8TA 4AG6A 3OAAD 2WWYA 3EPKA 3QPUA 4LI0A 2WWGA 1U8YA 2ZVPX 1UBFA 4HB0A 4R7ZA 4LJAA 3SYKA 1IHUA 2QEQA 4IVPA 1P6XA 4Q66C 4B3DA 4YMVA 1XD2B 1L4YA 2QPTA 4NZYA 2OFOA 2JJ2A 1HYQA 4MRNA 4B32A 4BE7B 1OH8A 2H17A 3GLIA 5FH9A 3CZPA 5G41A 1G6HA 3FWYA 1AS3A 5EZ6B 3GEEA 2QQEA 1SGWA 1Q21A 2QMOA 2XSZA 3VR5A 2O8CB 1CULC 3CNOA 1BO6A 3HU2A 1E1QA 4OK6A 5JI2E 3DEFA 2YOFA 4O3MA 4WIAA 3AVXA 3L0PA 3M1IA 1H65A 4UXIA 2WHXA 5FOTA 4Q4JB 5J4LA 3U60B 1P9NA 2JJ2D 2PBRA 1N0VC 2PX0A 2WWXA 3TSWA 4F91B 3GP8A 1XZQA 2EFHB 2C9YA 3BJIC 1U9IA 4U7DA 3A1SA 4A0RA 3BORA 3PG5A 4A2PA 5G53C 1XXHA 1GRRA 4JLPA 1NY5A 2EFDB 2F7SA 4FIDA 3RANA 1PUIA 2JLQA 2GA8A 2FZLA 4Q9KA 4DB4A 1XTJA 3GJ3A 2ZJAA 1LW7A 1DE0A 1AS2A 1Q22A 2GJSA 3GJ4A 2DWPA 2ZE7A 3LD9A 4X8OA 4KLNA 4OJQA 4DCUA 3F3YA 3U44A 3EAQA 3JVUA 4IDHA 1SVOA 1GKYA 3IBGA 1E79A 2YOHA 4P32A 5FTNA 2FZ4A 3QXJA 1T8TA 5DYGA 1G7RA 3QE0A 5EE0A 4GT1A 4Q4LA 4ZCMA 1R10A 5EJEA 5FUYA 1S8FA 4Z8XA 1IJEA 3L0OA 4IRUB 2Q6TA 2J59A 3EZ7A 3K9NA 4QOSA 4WAUA 5LB2A 4NONA 2D4HA 1K6MA 2DCUA 4I1VA 1XEXB 2ZETA 2OBMA 1TQ4A 3NBZC 3DL0A 2VHCA 5C4MA 4H1VA 2IWHA 1QHNA 2OEPA 1U99A 2GXSA 1KK3A 4JBWA 5FR1A 4TMWA 5FL7D 2HXYA 3BRWD 5HR5A 3PUWA 4RD1A 3FGNA 1HURA 1RJ9B 1N5KA 1UJ2A 4KYUA 3QF4B 2IYSA 2YHSA 1CIPA 4NPHA 4XSGA 3ICEA 3X1ZA 2J45A 1BYUA 1T0HB 2J7KA 1P2UA 3E70C 2IXFA 4H9GA 1K5GA 3K9GA 4UXHA 4DKXA 3F0TA 2AKYA 2GF0A 3U7EB 2ZI9A 3ZQJA 3SBDA 1SVMA 2OLJA 1AQUA 3AVWA 1NY6A 4BZPA 3L43A 2OZEA 1G7SA 3IEUA 3KFXA 3ASZA 5B2ZA 3KXKA 2GVDC 3RS3A 1YZNA 4IDNA 1TF5A 2VTKA 2YYZA 4QNRA 4B2PA 3LV8A 4TL6A 3KTAB 1KJWA 4JBXA 3OEEA 3W3AA 4H1UA 2C96A 4TYPA 2WSSD 4D80A 3PCRB 2W83A 3BGWA 5G3ZA 4Q7LA 1RRCA 3HR7A 3TSOA 4G5OA 3GLHE 2YOGA 4LYJA 1TUEA 2H16A 2BVNA 2VSXA 1LF5A 2D74A 2ONKA 4F93B 4FINA 2QMHA 3V9PA 3CPHA 4JLJA 4KSBA 4EAQA 5GADl 1IY2A 1QRAA 4EQ6A 2CE2X 4CT4B 3R7WA 3CW2A 4Q4HB 3U61B 2V4ZA 2NZJA 3OEED 2QU8A 3VR1A 5EE1A 1G5PA 4GOXA 4IJMA 5FBVB 4BLPA 3T34A 5JI3E 4OK3A 4O2RA 3AUXA 4IOMA 4XOIA 2EU8A 3ZVMA 3C41J 5DLQC 3B2EA 4URWR 1D5CA 1Z0KA 3MJRA 5H68A 4B3BA 4BPBA 4KFRA 3BFVA 5J4HA 2YWHA 3CX6A 3VU9A 3N2EA 2H8KA 1MR3F 4ABYA 3X1DA 3NEYA 5HKKA 4UNSA 1YR9A 2IYZA 2QTVB 2EW1A 4EPXA 2IS2A 1JALA 1NRJB 1AK2A 1DVRA 4PQFA 3ZS8A 1T3SA 3AGPA 3LQQA 4RZXA 4M1YA 2PJZA 4CEHA 5JJKA 2PT7A 2AK2A 4HLQB 1MRNA 2BEJA 1II9A 2ZUBA 4WVFA 1JEDA 5JBQA 4DLSA 2IX3A 1NF3A 2PZFA 4DZZA 1MO5A 4RSGA 5HPYB 121PA 1KI3A 1E2FA 3I32A 1QVAA 5LBIA 2C9CA 3SFVA 3W6NA 1YR7A 1E9BA 3DZDA 1TPZA 1NVVQ 4RFSB 3ZDQA 1IN8A 1KKMA 3KB1A 2J0SA 1KI8A 5GJCA 1T3HA 3S1AA 1B23P 1NKTA 5TDHA 4A8JA 4JKYA 5DO9A 1VHTA 2BBSA 3AH8A 3FHTA 1M34E 4YC7A 1EWRA 4TTRA 3KZ1E 1Z5ZA 4LZZA 2D06A 1W4BA 4HZUB 1XWIA 4BEJA 4FCWA 4AY2A 1MABB 1BOFA 1HT1E 3GMTA 3RAPR 4DHEA 2B6HA 4M53A 1G8YA 4MH0R 2FU5C 4B2IA 4YMSA 4DLWA 1CKEA 4DDUA 1OXUA 3E2IA 3LXRA 2P5TB 2GBLA 3AP3A 3Q8XB 3W3ZB 4L15A 1SXJA 1JECA 2XNDA 5JJLA 3RS0A 1BS1A 3IEVA 5K8LA 1UM8A 4RD6A 2QPOA 1Q1EA 3MRSA 2GHIA 1II8A 2JLZA 2RGDA 5HTKA 5BWMA 1M7BA 2C77A 2YWGA 3QXSA 3GJ7A 1LTQA 3PIRA 1OXVA 1DAEA 2OBNA 4KCGA 3U5ZB 3NBFA 1UAAA 5AJVB 3VX4A 2ZYUX 3PV0A 5EE5B 1NG9A 1U98A 2W6ID 2B7BA 3HP1A 3REFA 4PC6A 1ZIPA 1N3BA 1UEJA 1OPXA 1FPMA 1X8LA 4JL5A 2A30A 2H1LA 1F2TB 1T3LA 1W5TA 4M9QA 3K0FA 4MRSA 4X8LA 4NCKA 4HDQB 2BOVA 4QGGA 4BECA 1UEIA 2PJRA 2GCNA 1GL7A 4RY2A 2HCBA 3IO3A 1S9HA 4HEJA 4N0DA 4BZQA 2GJKA 1NP6A 1RIFA 4LUCA 1FMLA 3HYTA 5CDFA 3HU1A 1XEWY 2ODWA 3KQNA 3CR7A 2RKOA 2XB2A 4GSYA 2A5JA 1OH5A 4G01B 4PSAA 1NBMD 4V03A 1CEEA 2QRNA 1FTNA 1ZM9A 2ZSBA 3LXXA 2Q9BA 3UIEA 2YC4C 2PL3A 5IT5A 2J1LA 4BRUA 1OE0A 2OLKA 4P4SB 4XWOA 1G8PA 4I1SA 621PA 3LH5A 4M2LA 4QHTA 2PEYA 4ZDJA 1GUAA 3B78A 2PH1A 2ZXUA 2R2AA 2V3CC 1KDOA 2ORVA 5F98A 4PAMA 4WXPA 2RGBA 4KVAA 1KJZA 5EE9A 4PC3A 5JHHB 1P9WA 2VIIA 3SHWA 2OHFA 1YU9A 4TZ0A 3GQBA 2WTUA 2CJWB 1ZU5A 2O8EA 3OIYA 3OE7A 1SHKA 3EX7C 1ZNZA 3B1WA 3K53A 1QHSA 3TRFA 3EZ2A 4URVR 1DAFA 1XTRA 1XXHE 4BFSA 5JHGB 3UMSA 4F4IA 4TTQA 4LBZA 2WAXA 3BWDD 4RKEA 4TL7A 1JR3E 5J40A 2ZI3A 4PQYA 1W0KD 2V54A 1KZGB 4PHTA 1OFUX 2BIFA 3P26A 2IUUA 1FOEB 3ZVLA 4JT4A 4LYAA 3QKRB 5EXSA 3X1XA 1YR6A 2KWIA 5DYIA 2ATXA 3AVYA 4JLKA 1G3QA 1U9IC 3LDAA 3QKTA 1R8QA 2OCBA 1KYIA 4M8NE 1Z6TA 3VR4A 4ZCIA 3IQWA 4ZIRA 1KMHA 3AVVA 1XMJA 4EFLA 2HLDA 1VIYA 3PUXA 5HE8A 2ZAOA 1P60A 4GP7A 4C0AC 1UDWA 5FOVA 4Q21A 1CF4A 3B1VA 5EQTA 1G4UR 2BBWA 4L9SA 2OT3B 2WPDA 5BN4A 3PENA 1W0JD 5AUOB 3R9IA 2IF0A 4Q5IA 1EFCA 2GCOA 1R0WA 2HUPA 3OHMA 4C30A 2A78A 2JIZA 4MYHA 3RSLA 1IOZA 1P2TA 5EP4A 3TUIC 1U2RA 1WMSA 5KOYA 1GG2A 3U4QA 2VA8A 2IW3A 1W1WA 3C4JA 2ZRBA 2FV8A 4OHZA 3LBHA 1KK1A 3T15A 3IPYA 1Z2CA 4C2TA 3O47A 4W5HA 2EFGA 3IHLA 1QHHB 5P21A 4RD3A 5JSZB 1ESNA 1Z6GA 3QUSA 4R71A 1H8ED 3SQXA 4OI0A 2WIBA 3VNVA 5FOSA 4D4MA 2AL7A 5EXTA 4ZI2A 2FPKA 4HDCA 3DOFA 4A0GA 1XP8A 2GK6A 3FMIA 2X2FA 2VP0A 4EPVA 5L8VA 4FW9A 3B1YA 4LJ6A 2JLRA 4KVGA 1LS6A 4PO1A 4AKEA 2JDID 2P67A 4NTZA 3SE0A 4LYFA 4B43A 3VKGA 2R62A 3A4MA 1OH7A 2GDJA 1A2KC 4RZ2A 3I8XA 5H1YA 1P2VA 4JVLA 1FP6A 4JVNA 2GNOA 4C0BA 1Q1QA 3FYHA 3TE6A 2YKGA 2J3EA 2F1JA 3ND8A 4PR0A 5AJZA 2D62A 1WBBA 3ZLJA 4DLTA 2YVUA 2O8CA 2ASEA 2QMUA 2ZAMA 2IS4A 2DFTA 2CDNA 1KAOA 3DPUA 4HUQB 1NL3A 4O0MA 1XD8A 1XCMA 2GJ8A 3DHWC 4P4UA 1OLOA 5JRJA 4ZDWA 5IK2D 1IXRC 4M9XA 4RD0A 3CRVA 1DAIA 2LKCA 2RB4A 4Q4JA 4QHYA 4RZ3A 5FPKA 4HAYA 1TU4A 3TQCA 1Z0AA 3IIMA 1FP7A 4JL8A 4PX9A 3C5CA 3RRNA 3TGPA 4ZKDA 2RGGA 5LDDC 1XFAA 2REXB 5GJBA 2WIAA 4JT2A 3R9WA 2CCJA 1IN7A 1CJVC 2VH5R 2QENA 2JLVA 3NEJA 1NKSA 4M1SA 4NCJA 3W34A 5K8IA 5H8WA 1TQ2A 2RAPA 5C4GB 4GNKA 2J87A 2ZJOA 2QBYB 2GAOA 4LHZA 4UNQA 1DG3A 2W6JA 3CX7A 4JLOA 4KSCA 2R6CA 1N5IA 2QPAA 2G0TA 1E9SA 4HB2A 1R0XA 4NL4H 2Q3FA 3WYFA 4DSNA 4EPYA 2RGAA 3GEIA 4A0HA 1FW6A 2OXCA 4NCIA 4B71A 5BN5A 1ZINA 2O0JA 1VCIA 2J0UB 2JEOA 3ETLA 2IS1A 3IQXA 4M1WA 1Q44A 2QUZA 3T06B 2ZS8A 5DHAA 2NMVA 1E96A 4IXNA 3H0KA 4PC7A 3VHLB 3PEVA 2ZM5A 1Z3IX 3QVUA 2A3RA 4F92B 2JATA 5BYKA 3QNUA 4LC1A 3KQHA 1MO6A 2BJVA 4MGYR 4F4JA 1R2QA 3B1XA 5KNDA 2W6JD 3SQWA 4Q1AA 2VF7A 2ZRDA 3R9XA 2HXSA 1CJKC 5JFGA 3TAUA 4NDZA 2QAGC 1COWA 1SXJE 3AKCA 3ZQ6A 3P4XA 4PSKA 2BEKA 3I92A 5KPJA 4ASUA 1E2JA
chains in the Genus database with same CATH superfamily
1CJUC 2Z8ZA 3MN1A 4RKWA 1G41A 3R3YA 4IJQA 2HMYB 4LK2A 1CQIB 4I66A 1JH8A 2WWVD 3FLEA 5JWHA 4ZJPA 4D9KA 4WPGA 4BFYA 3FWHA 4S1PA 1RAAA 4DA4A 2MSWA 3LNCA 5IJ9B 3G0IA 2EDAA 3CBGA 3Q5EA 4BRSA 1NJFA 1JPNA 4C05A 4R7GA 1YBAA 4JS0A 3L8FA 1EUYA 3S2ZA 2X0IA 4OL0A 1S01A 5I7RA 5LP6C 1XX6A 4DJAA 3I5YA 1RYNA 2GBLC 2JVKA 3T0FA 3X0DA 2BFWA 5AKEA 5AKLA 4BFLA 3QWAA 4GFDA 3RU3A 1OYYA 4JB0A 2V7EA 4CT5A 2DWCA 2JIQA 2VCHA 3GT4A 3NC4A 3UWMA 4DTCA 1SC4A 3PJGA 4GWLA 4QHSA 3BK1A 3ZQ4A 1OYWA 1P1IA 1I3CA 2CZGA 3EXAA 3GAAA 3NWJA 4PX3A 4QFCA 1QMPA 2DR2A 1RJGA 5EUCA 3K5PA 2VYFA 3OCCA 3TZBA 2W0SA 2GZDA 2D1RA 2XXAA 2GD1O 4CW7A 2VP9A 4A8HA 2JA1A 1RI4A 2J6CA 2J6HA 1O4WA 3LFTA 2Y66A 2G28A 5D2CA 3K32A 3CS3A 4GVLA 3B52X 5HS4A 3VKVA 3K0AA 2WHPA 1EK5A 4MQ4A 2Q45A 2QORA 2XF8A 1HT0A 4L0CA 4LCBA 4RADA 3G68A 4AO8A 1WZNA 3RS7A 1DXHA 1XU4A 3ZHTA 5IWAB 1P0FA 2HIMA 2ZUSA 3PQ3A 4KG7A 3E0XA 5JWOA 4FMCB 1C7JA 1KYWA 3FRIA 3K1TA 4P35A 3TTSA 1P75A 1QUFA 4ALJA 4O4LF 3N2GA 4AJPA 2WAMA 4JBLA 4UBKA 1PVOA 1O97C 3CV3A 4RU1A 4WLVA 5AP9A 1K98A 1NW3A 2IYOA 1DKLA 3PDUA 4YRDA 5FFFA 1TNDA 4A2CA 4B0PA 2J9FB 1CUVA 2QZSA 5IBQA 4V1CA 3T5GA 1X1SA 3ENKA 3GH3A 1VKHA 4EF5A 2PBZA 4REQB 3F1KA 4Z54A 1QTIA 1R4AA 5KSZA 4N3NA 2O5CA 3IP8A 1NXVA 1VA5A 2YNMA 2H59A 1JDBB 3C6XA 3CMMA 1XRSB 4PICA 4WL0A 4BMSA 3RIXA 4K2HA 5BR1A 1Z8DA 4KLRA 2E49A 2X8JB 5D3MB 3SXUB 4I1IA 2MYUA 3T3DA 3QOYA 4DCTA 4NJMA 1IN1A 4QQFA 2OV6A 3OMLA 4W1RA 1B8UA 4TLLB 3REOA 1XWWA 1KEEB 3MSCA 4ETMA 5DHFA 3LLCA 2B8EA 2ETXA 3OEHD 2XDQA 5CLQA 3RWOA 5IUNC 4FFSA 4TRMA 4BB6A 5C7LO 5JSYA 1J8YF 1C0EA 4NJEA 4CTNA 2CMDA 2P3OA 4G1MB 4IFTA 4WKNA 2V45A 1L5ZA 3CUTA 2XYGA 1KFCB 1T24A 1U8XX 3F2VA 5L3QA 2YJ5A 4MHSA 2IDKA 1AG9A 2O8FA 4HX5A 3LLUA 5KOIA 2B37A 1IQRA 3N8DA 2D3TA 3QE4A 2UUCB 3LUGA 1W88A 3AI1A 3M9XA 3GJTA 1V48A 3URKA 4DCCA 1SUEA 4HUJA 2UU9B 1MJGM 1Y9ZA 4L8WB 5C1BA 3UT5A 4FFBB 5EJ8A 1QFJA 4CM8A 4E15A 5KQGA 2XLBA 4HR7A 1AGPA 3NALA 1PZNA 3EQZA 4PNHA 3KB6A 1DSSG 5A5VA 1X86B 3LBFA 1W85A 1PLLA 4G0QA 3DZGA 2XB9A 2ZU6A 3KRTA 4K9NA 4PC2A 4R3WA 5AJXA 3PHHA 5ALTA 5E8JA 3ODPA 3R41A 4LNUA 5B58T 2H8GA 5LZ9A 5KYVA 2CCGA 3OA0A 4QODA 1QUEA 2JFPA 3L4BA 3MPOA 4G8CA 1PT7A 4P93A 4XR4A 4XWTA 1N77A 5F2KA 2X9NA 1UBNA 4JHXA 4UCWA 3OO0A 2BLNA 1IU9A 2HSDA 2IELA 1AHPA 1FP1D 2C78A 2YV1A 4L8GA 1AF7A 2E82A 1YMUA 1ZIXA 1R15A 2O3QA 1FP4B 2QTHA 3HZHA 3QNMA 4ADSG 4LHEA 2QSZA 3JQ7B 5KC8A 3AEQB 3WA7A 3KSDO 3N0XA 3OCVA 1E9DA 2ZANA 4WERA 3HR4A 3WK5A 3MLBA 4UEJA 3EGDB 3WKEA 1IWBB 1RXUA 1ZN2A 3A4VA 3GRPA 1MJHA 4A6EA 2HGZA 1DKPA 3V97A 1F2TA 3LBAA 2GS9A 1T13A 2XSZD 3ENQA 4IG9A 4NCHA 4PV7A 1I7SB 1V8OA 4NCXA 3VR0A 2OQIA 4DA0A 3KKOA 1WZ2A 1T2DA 3V4SA 2V3VA 4FNOA 4AULA 4B7AA 4LXXA 2W6PA 4ZOLF 2DH5A 1YA4A 5LQKA 4YDHB 5CAEB 1Y8RB 1T8WA 1FRFS 3UKDA 3L84A 3T9AA 1UMKA 1RWBA 2GM9A 3TLZA 3NJ8A 1CY2A 3HEMA 1E3QA 4H27A 1IL0A 3GGJA 3ZIUA 4NOJA 4MW5A 2IUYA 2OBXA 3IVGA 3QLTA 2FPGB 4IVQA 4KPUA 1NXSA 1FMCA 1SG9A 1X14A 4G25A 3T5MA 4JSTA 4DR2B 4IIUA 1URPA 5BR4A 1J7KA 3QFCA 5JAOA 1G5TA 3IKJA 1E60A 5FP0A 4BCCA 2VCEA 2J5KA 2YRFA 3PPYA 4MWCA 5TC4A 4C22A 4RV9A 4MQMA 4EMUA 2SBTA 3G88A 3ILXA 3GU3A 2EX0A 3AEKA 3IVRA 1Z29A 5T4EA 3VDXA 2GESA 1NC1A 4WESB 5FULA 1CR2A 4CHTA 1FFHA 3HE3A 3HRKA 1L6IA 4LJLA 3BFKA 1ULBA 4JC0A 4EG4A 3S2GA 2RGNA 3H5OA 2P4SA 2E87A 4HXGA 5CNKA 3WS7A 1NW4A 5DEIA 1ABBA 2G5TA 3VA7A 1BMQA 4EY8A 3W2GA 1WP9A 4QTYA 2RBEA 3QITA 4HATA 5UKDA 4EA7A 1SK8A 1NVVR 2Y27A 1RFLA 1GGNA 4KXFB 1ZAKA 2XMRA 3AQIA 4D8VA 3AB3A 3EEIA 3IHTA 1FL9A 2AFHE 5CYFA 4JUDX 1YRBA 3ILSA 1B4DA 4IIEA 3F3KA 4ND8A 4B6OA 3QSYA 4W5NA 3KFVA 4JZKA 3V2UA 4Y9DA 1M6EX 1ULUA 5IVPA 3AVTA 2FZGA 1I30A 4L74A 4KWEA 3C39A 1UKCA 4BP8A 3DE7X 1TD1A 4Q82A 4MYTA 3W6ZA 3GLQA 4EYOA 2HCJB 3IA2A 2FN4A 3KZKA 5J1TB 221PA 2JD0A 3HKEB 2LR0A 4RAQA 2WOOA 3COVA 3EUWA 3N2NA 4P82A 1E0SA 1E66A 1MB4A 3VI4B 4YMUA 3QIVA 5D3QA 3GUUA 1RQRA 4Q7KA 4DLRA 1RT9A 1U0LA 3T7KA 4QXOA 4N18A 2IYWA 2JFUA 4D6PA 3AF5A 3C6YA 2V7PA 3ZWMA 4NBKA 3BK7A 3CR3C 3GRRA 1C9MA 1S4QA 3D8TA 5EUMA 1E4OA 3ROKA 1QP4A 3QPVA 1MJFA 3TVDA 3Q3HA 4ZARA 4DR6B 4IVRA 4O02B 5FR2A 3U9LA 3NHAA 4QJ3A 1QQ7A 1T1RA 2VDJA 1CVRA 3H9GA 3HB9A 3RRMA 9ABPA 2ATCA 1ZK3A 4LC9A 5I9NA 4I08A 2VHXA 4ZI7B 1PP4A 2R5NA 2VHUA 4MVCA 4WJZA 1VRVA 3OETA 1A72A 3M0EA 3LT1A 4IDPA 5C46F 3TLXA 3HPQA 4JUAA 2N42A 3FPCA 3NIGB 4C78A 1XNRB 4MV8A 5L3VA 4BAGA 1B76A 2E1RA 3PTAA 1XTBA 3ECAA 1M1YE 2SCUA 3VKWA 2F9LA 5TEVA 4DLVA 1YUMA 2ZB3A 3C5HA 5E7QA 1JNYA 4MQEA 3DEHA 3IP5A 3CEMA 3OQNA 3I6YA 2H2AA 4EJSA 2DTXA 2FFRA 4XAQA 3ZK9A 5K01A 3L7LA 2YZKA 5JMTA 1ADCA 2R8EA 1FRNA 2JCSA 3AJRA 2XE4A 4Y6QA 2ON6A 1YRLA 1QVWA 4L0DA 5ILQA 4C4XA 2J5RA 2H7VA 3ENVA 3PXBA 4IFEA 4OYLA 5KNCH 1AMNA 4ZWNA 1NFQA 3NPAA 3IEKA 1GKIA 3WMEA 3CUYA 1KXZA 5FQNA 1UMBB 4ZYYA 3W04A 1WV1A 2ZBEA 4RA9B 3M89A 3PEFA 3SY8A 1X92A 3V32A 4F2GA 3ZZUA 5LJIA 4LOLA 4C14A 2ZULA 3MWDB 3U3ZA 5LFAA 2DLNA 1ZNWA 2IHYA 5BQ5A 1FXSA 1SU8A 4BZXA 2NIPA 2W2VA 1MH9A 3NX4A 4QTXA 1T9BA 1GCGA 4QBIA 3AVVA 3L40A 4J6FA 2ERXA 5AK5A 3ZIAA 3ZYCA 1SZJG 2FPPA 5CX1A 4LMPA 3IILA 5EG5A 5FLEX 3SC2B 1PWEA 2FGJA 5D1HA 3PKJA 4IMRA 3VTFA 1L5LA 2QRHA 2ZIWB 3BTUA 4ESEA 4K8OA 5I9MA 1SM4A 2PT6A 3NQ41 1EX7A 1QONA 1E1NA 2GA9A 1KPHA 2PKYX 3JD4A 3UWKA 3ZVRA 4PN3A 2PZBA 3NC1C 2QW1A 2MYPA 3PUJA 5AXAA 3NBAA 1J56A 1Z26A 3RB8A 4BJ6A 5CITA 3R3UA 3FFWA 1J8VA 3WBFA 2VCYA 1Q7CA 1EUZA 4MMYB 3TVYA 3MCVA 3GA7A 4A0FA 2QP9X 4ARVA 5I4KA 3DMDA 4JBYA 1Z7EA 3ZX5A 1T5TA 4Y2GA 2M32A 4X6LA 5TQVA 2AFIB 1XKXA 1FTQA 1JWLA 1VKJA 2FF7A 2YRXA 1LPAB 4Y1FA 2I1WA 2X5KO 2ODBA 3RKRA 4AX4A 4EZBA 2CLHB 1U2QA 3WRXA 4PG6A 2R6DA 1ISIA 5TMBA 1JUDA 3G8BA 3L0YA 1JKJA 4RS3A 4M1EA 3CSUA 3KXLA 1V7CA 2ID7A 2YTZA 5TXGA 1YZTA 1Q0ZA 3AMVA 1VIMA 1Z36A 5F5XA 4C29A 2Q5OA 3RUFA 1V37A 5LMCA 2C31A 2LGJA 5LPNA 2CMHA 3PT5A 4KQGA 4DDTA 3A6PC 4TMKA 5JSHA 4ODIA 4PZDA 4O4IB 4NBSA 2RH4A 4EEXA 1D3AA 3S68A 2PZJA 3KOOA 1Q1ZA 2WG2A 4IOKA 5LLDA 1NJ5A 3DDWA 2Y68A 1YCFA 1OUMA 1MIOB 1W5BA 1XZCA 4ZT6A 3IT0A 3Q9LA 4EELA 2IUEA 3EVGA 2ZZNA 1G8FA 1USUA 2R9VA 1SCDA 4JDPA 4IQGA 2JG3A 3HXPA 1WCXA 3ZPXA 1LSJA 1OBOA 3IDZA 5I4BA 4MUBA 3MS2A 2KE5A 3F96A 2AJBA 4PSUA 3I72A 4N5LA 4UTXA 2XNDD 5ECWA 1QANA 1CC1S 2DHEA 2OBBA 1XDGA 3ONFA 4GPEA 3RTEA 4OH7A 3DYVA 1KFBB 3UGQA 4ZHSA 1VLLA 4DGQA 1OFIA 2FPRA 5HMLA 4ZCTA 1OI3A 4ZU3A 4D44A 3R7NA 1N8TA 1NE2A 3C6ZA 4IDQA 1NR7A 2E4AA 5I6DA 4G41A 2JBAA 3STHA 2J0UA 1L7NA 3T1NA 13PKA 2ZB7A 1LRKA 4WFQA 4W8GA 3OJXA 2C2HA 4GOJA 1G0OA 5HFAA 2D7JA 1B73A 1UBTS 1ODSA 1R0KA 2AX4A 2YN4A 4L4YA 4AVYA 2FN8A 1VSTA 3EEYA 1OLUA 4OUKX 4UBIA 3NH9A 3UV3A 2XBMA 1MO3A 4G3XA 3QY0A 3LY5A 1EPUA 2GHRA 2YS6A 3N5KA 4GOND 4OLFA 3RSFA 4BMNA 3DGEC 1ZGZA 2WYWA 2ZSAA 1TU3A 4O4JB 5CA0F 2IOYA 4RV4A 4DIUA 2IYUA 3AFGA 5B58C 4C7VA 5AW8A 4KR7A 2BHRA 2IEZA 2I71A 3DLIA 3OF5A 1FS5A 3NIFB 1NN3A 3OQOA 2OILA 1ODIA 1COZA 2PMEA 1U8CB 5EN4A 3RRJA 1G9XA 4PX2A 4YFVA 3QU4A 4WA8A 4AECA 1W2WB 2LXNA 5AOCA 3UMMA 2A4MA 1F0YA 4R2WA 5IT0A 1FFGA 1FFWA 1XYVA 3QHAA 3ZWCA 3U44B 2FSUA 2R66A 5HKBA 2NPIA 1CY1A 1AS0A 2R60A 3GP5A 4KQCA 4R1UA 5GONA 3M9LA 4ZCSA 3H2GA 4U7TB 3UKOA 2JLXA 3QX3A 1XZPA 2QR5A 2KYRA 4DUGD 1G5FA 2COEA 3KQVA 3M6XA 3WADA 1M8PA 3D7SA 2XB4A 2ZCJA 2O2SA 3ZUPA 4HGRA 3JWHA 5CJ2A 3R77A 4ZK6A 4NG5A 4NENA 1DCKA 1N2GA 5DTRA 1SC1A 3WLNA 2V7GA 3AG5A 5LQSA 4EB6B 1GDDA 4LHXA 1QGDA 4CEHB 2E18A 4V39A 2QUAA 3ZCPA 1WIWA 2XD9A 1PV1A 2FE1A 3AEYA 5EJFA 4OKSA 4ENSA 1EXMA 3F8TA 3AJDA 3JQBA 4QJ4A 4RWEA 1Z6XA 3RG2A 4X71A 1SVLA 1JEEA 1S1MA 4FUQA 4AL4A 3SCZA 5BPFA 4BO9A 4GG1A 5ESWA 3U3JA 4FLMA 4DRXA 2CXTA 4DW8A 2FEMA 1PHPA 1HQDA 4FXOA 3UT0A 1UBKS 3BF7A 2YWCA 2QG4A 3IULA 3EEBA 3KTFA 1H2RS 1LLDA 2D7DA 4KR6A 3OLQA 4UU0A 1BWRA 1X8XA 4QE3A 2PKXA 1N6NA 5FX2A 2QN8A 2V58A 4OP2A 1YAHA 1ZUNB 2JAHA 2FMXA 3HYNA 2XUKA 3VZPA 3FYCA 1HEIA 1T6NA 2VH2A 3F6BX 4WRRA 3ZHUA 5F33A 4YJHB 4K6KA 1O08A 5JJIA 4B34A 1PKXA 3L8HA 2Z43A 6GPBA 3THXA 3GD7A 4WBSA 4EA6A 5M04A 1Z0IA 2FSVC 4UQLA 1FRZA 1EI9A 2QGFA 2ETVA 2EXXA 1EDDA 2YZ2A 5ALIA 4DBVO 1BKYA 4MGZR 1L7OA 4HEA6 4YH1A 2IITA 2ZYRA 2PS9A 4L02A 1AUXA 1GFSA 3PS9A 4FS3A 2ZSDA 3ESAA 1N2SA 1QIIA 4YP1A 1RZUA 1R9JA 3ROQA 3RS9A 1E7RA 3TRJA 4TYNA 1E1RA 5D1NA 3OM1A 4JI0B 2G80A 2I7CA 1EFVB 4FYXA 3JRNA 4MWTA 1L8AA 3DPSA 4L3WA 2C1ZA 4O1HA 3OF2A 2FY8A 3IQFA 1WB4A 1WDLA 3AFNA 5B2EA 3EPLA 3PD0A 4B35A 4AYXA 2H4FA 2AEEA 1EX9A 4EMSA 4QBHA 8ADHA 5K6TA 4KK4A 3T8YA 5JD4A 2WPDD 3USES 4TZ6A 1YC2A 1MO4A 3LPNA 3R7WB 3AF6A 4I5EA 4ZEVA 4NMLA 2NUTB 1H1TA 2NO7A 3V1MA 4B6GA 3GLUA 2ZGVA 2C7PA 1SUBA 1UZNA 1M9NA 4RIFA 1J9EA 1VECA 4JSYA 4KFTA 3WP0A 4F11A 3H11B 4M99A 2B4YA 5IULC 3A9RA 4HX9A 1C8VB 3ICWA 5E38A 1J8FA 1U7XA 1RE1A 4MR9A 3AHJA 4WNAA 4ZYZA 1R6XA 1KR2A 1Y81A 2ADMA 3L5OA 1XD2A 2UUAB 3RAGA 3FZNA 4C08A 3UPUA 1UWLA 4CF3A 3EWSA 2W4QA 2LCQA 1CR0A 1MT0A 2J48A 2P6UA 5HBGA 1IIBA 2VTVA 5DI3A 3EOAI 2X14A 5BNFA 4AI6A 3WP1B 5M2QA 3D8SA 2ZYAA 4R2IA 2IBTA 5ED4A 4CM3A 1MRSA 2HYDA 1S2DA 3SYMA 1WB9A 2XTAA 2HQSA 2JK1A 1NI4B 1YQ9A 3GRFA 3JWPA 4Q3BA 1MGOA 5AM3A 3C16C 3MUFA 1TF7A 3RU2A 3WRWA 5JTUA 4Q1DA 3ZE6A 2QUIA 3OJFA 2VBGA 1NN1A 2HU2A 2PGIA 4TWIA 5FOUA 3JD0A 1LU9A 4XIGS 4XPIB 2NTJA 3IUYA 3LDGA 3V48A 3ZJYA 3J81k 2YINC 2VN8A 4MV3A 1KI2A 2R44A 3A6EA 2HA0A 4TMVA 3OPYA 1ZVVA 4LDZA 1S0UA 1NJGA 4ZVOA 1UPUA 2NU6B 3AKZA 1ONNA 3BEOA 4FS8A 5AKJA 3UHJA 2G9VA 1CF2O 3SBOA 1IHYA 3A37A 3QE2A 4CI0B 3FFAA 4K9QA 1USWA 4OYHA 5AMXA 4HVLA 5B64A 2IY8A 1FDUA 2WTAA 2UZ0A 2A7XA 5LDGA 4HKTA 3IP7A 2P78A 3JYLA 3K72B 5AM0A 2QW0X 3BERA 5GINE 3NT4A 4L6AA 1Y9AA 2QV7A 3FX2A 2QR3A 5A6SB 2C2MA 4X65B 1W35A 4QOHA 2YN2A 4QPZA 1S1CA 2BL4A 5FWNA 5KOHA 5ALLA 5TLSA 4CM7A 4QBGB 2EHJA 1N1MA 2OPBA 2ZJ7A 5KHAA 4DBLC 1JU4A 4L4XA 4BNKA 4TKUA 5H3CA 5KKAA 4HGPA 1KO8A 5IJ0B 1GU1A 3KOMA 4PG7A 3LQ4A 2J3JA 3U31A 4YUXA 5LXTA 1KO5A 4QDKA 1ZI8A 3PZRA 2BCGY 2QRJA 1LQ2A 1W2HA 3KXDA 4K03A 3REQA 4A6XA 3ER6A 1SVIA 1YU6A 1BCRB 1GGMA 3CR8A 3WDLA 5IXYA 1MDBA 1PV2A 1FJXA 1XDUA 4RX1A 1LNSA 2WNIA 5DHPA 5C34B 4BMCA 2B99A 4RKFA 4ENWA 1TVKA 2MIIA 2VYQA 2W8ZA 2YQ4A 3ABZA 4EO9A 2WJZB 2ERYA 4QGSA 1FMFA 2ZSKA 4QD3A 2F1HA 3UMGA 3UMCA 3PF9A 4I81A 4OATA 1EP2B 2ADOA 5HCUA 3MMNA 5F3DA 4D8UA 1ZPDA 5KTTA 3MINA 4FSDA 3JAKA 4LVOA 4WUTA 5B6IA 1L8LA 2HF2A 2YZNA 3RIHA 3TR6A 4EUHA 3IUNA 4MCAA 1DQPA 3QH4A 5AI4A 1OCEA 1USIA 4CXMA 4FCCA 3ML1A 3CA8A 3SZOA 5FV4A 2ZPAA 3WL6A 1Q16A 2YWEA 1HORA 4PSVA 4LTDA 1L5VA 4OBBA 2FX3A 5DGDA 1IDOA 3OT4A 3VM6A 5JRDS 1SD1A 1VPLA 1B8PA 5ALFA 4BJHB 3F5MA 4WOPA 2AMVA 3EC1A 1NYLA 2O2IA 3CPJB 2QTBA 2J5QA 2NX2A 3BD9A 1GZ4A 1LFDB 3EW9A 2NOAA 5B37A 4FN4A 2EQ5A 3N76A 4MKGA 2CL5A 3CO0S 2Z2KA 4B4WA 4C4YA 3R5FA 4JC5A 4OMFG 1DIRA 4K6HA 4UNRA 4QOFA 1DIBA 1EIZA 3I04M 5F2OA 1RADA 5ISMA 3T0IA 3DZBA 5A03A 2A58A 3MEQA 2CW5A 1YIOA 1FMTA 5FBHA 1JTFA 2ANBA 5DNCA 4GL2A 2O0KA 4MVJH 1I6LA 4QKQA 5C8VA 1SUFA 1CBUA 3KR1A 4N40A 3DV0A 4R84A 3WDMA 4E33A 1NXWA 4B3GA 4Z0TA 3EIWA 4PAQA 5JADA 4Q9JA 3WDSA 4MWOA 4PTYA 2QU7A 4ZP1A 3W1VA 2JANA 4HH4A 4UBLA 5FA8A 1XB2A 2FZEA 5IUJC 5EVJA 2GEKA 3GJ6A 5TR9A 3P20A 3QA9A 4GPD1 4MB2A 4G0VA 3R6TA 3CZ9A 3VSCA 5JVDF 2ZSJA 1K6EA 1DDOA 1JJIA 4AROA 4PLGA 5KYXA 4F1JA 2GQ0A 2JRCA 1SKBA 4EKIA 3M3DA 3ET4A 4OU5A 2P4QA 5B4TA 4N76A 3WNBA 4OAQA 1X3SA 1XRJA 5K3OA 5JISA 1TTQB 4P08A 5JCOC 4GZ3A 5AKXA 3FGZA 3PQDA 3BBPA 3OCZA 2ZJ0A 4BB0A 1PR3A 4EL0A 1IXSB 3RGWS 5LJLA 3OZXA 2FX2A 2XCQA 4ALIA 1PVDA 4OJKA 1TYDE 4JP5A 1YO6A 2DRIA 4QTUB 1GL6A 3G2HA 3N0WA 1ZVQA 4RGVA 5A2GA 2R25B 2Q3JA 3PQFA 5DNAA 3T41A 3WTBA 4AN1A 5B4VA 4DA6A 1RLJA 2H1SA 4MZDA 2IRWA 5BWLA 3GL9A 4G4JA 3RUPA 2R6R1 3Q7IA 2POCA 3ZBTA 1KNQA 2VPQA 4C4SA 5HKOA 3W9SA 1ZJ5A 3V4RA 3AVQA 1XQXA 5GGXA 3ZHZA 3B2QA 4DM7A 4DPMA 3BE6A 5CP8A 5BN4B 4DGSA 3FB4A 4NATA 3ZDBA 3A6FA 4MCIA 4BP3A 1CRWG 1X94A 3QVKA 5EUBA 1FYWA 2NYRA 4YQEA 3UAGA 5TSDA 2R4QA 3UOGA 4IY1A 1L7MA 5KINB 3QEAZ 3CONA 4DV5B 1V41E 3E4DA 3PFKA 2FEXA 1V1MB 1DRUA 1L3IA 1DARA 4PLPA 3JARB 1L5MA 5GZ6A 2KSQA 3R8CA 3DMHA 2R6JA 2ZIEA 4H4EA 4DDVA 2ASVA 5DP2A 1YZYA 2IEDA 3WRYC 3ESCA 3M6FA 5C5DA 4BNZA 3G17A 4CM9D 1MH1A 3KAKA 2CB9A 3EXIA 4L5AA 1XN4A 3M82A 4CHGA 2A35A 3K4QA 1MBZA 3FB1A 4QGAA 2O2XA 1U1CA 3SI7A 4ALNA 3PNSA 3P52A 3ZCUA 2HDNB 4I36A 1BN7A 1S5PA 4F5EA 2WKRA 3HB7A 2VF2A 3RDPA 2M1ZA 2C3YA 5JAZA 3UYKA 1RW4A 3RYCA 9ATCA 5EIBD 4YDSA 1TXGA 5FUBA 1C1XA 5EKSA 1I1OA 3TYXA 2C42A 2IHUA 3E27A 3RBXA 5YASA 3R7LA 5DHTA 1PR2A 5SZHB 3IAAA 1JBKA 1GTG1 3BRSA 3PQ5A 3AKDA 1DPFA 1O6FA 4J0JA 5FTJA 4ZI3A 3DVSX 2H5JA 4A8TA 3BGVA 4F38A 4KMOA 2DQZA 1GVNB 4U8HA 3FD8A 1FXWA 1L5NA 2PEZA 4Z4HA 4PYKA 1VQ1A 1M2OB 4OJMX 3F6EX 3O38A 3HJBA 3KCQA 3W6PA 4M6WA 1LX6A 2TMGA 3S2FA 4OHCA 3T1OA 2Z6QA 1HLDA 1G6OA 2ZPTX 1R8SA 2JAXA 3HCPA 3AZOA 1T0JB 3C97A 1MC1A 2Q3BA 2RARA 1XA4A 2OAEA 2WJGA 1RQGA 2IHBA 4JYBA 2VT7A 4LJ9A 1R0ZA 4K6OA 4BNNA 4HDRA 2JKVA 1AQLA 1FDVA 3TK1A 1VXRA 2CDCA 3OOHA 4YP7A 1RWQA 3PCTA 2EWMA 1KU0A 1L4MA 3M33A 5LZ7A 3AC0A 5HQJA 4RYLA 1ENZA 4P4TA 4ZVKA 3HG7A 3TFQA 3RIGA 2M6RA 3IH5A 4I9HA 2JLSA 1GZSA 4IEFB 1VCMA 1H3EA 2AUTA 1SHUX 4UASA 3BXHA 4C2UA 3ZTWA 1PNOA 5DM60 3HFSA 4OMCA 2PIDA 3H5TA 2BFAA 3KT8A 1TADA 1M2KA 3I09A 4LQCA 4MVWA 5E1BA 1PDOA 2XZTA 1Z0DA 4KJXA 1ZIOA 1U0OC 3DTVB 2AR0A 2BY4A 3A26A 3CX4A 3PHBE 4UE3S 2HMVA 4U2KA 2C2YA 3ENWA 2HWXA 2IJGX 5A3VA 1FB5A 2HPAA 2ZWOA 4JGIA 2P6NA 3BA1A 4TV8B 5FLXA 2EV9A 3GLGE 1E2UA 3SS7X 4KX3A 3EIUA 1JR3D 4RTMA 1YIDA 3RHFA 2FOLA 3NBKA 4R01A 4H7IA 1F6BA 1JXMA 1IJBA 2ZSHA 3TQFA 1DQZA 4Y6RA 3E1GA 3O5AA 1I1HA 4JWKA 1R4MA 1SU6A 1ZNYA 1RPZA 4GP9A 3HNPA 3GJYA 1T4BA 3VR5H 5LLTA 3IPAA 4S35A 5IAJA 2KW5A 1I7LA 1Z83A 4C0QC 3O0DA 2CC2A 1C3VA 1YR2A 1S02A 1UM9B 4GP6A 4HVAA 4D2IA 2EATA 1WRBA 2ZJZA 4LXHA 1RFGE 5IT9A 1AKRA 3K2QA 4ITVA 4LYHA 1XU9A 1OI4A 1ZJZA 2PZKA 1Z0ZA 3ZR4B 1DV2A 1K7EB 3V8RA 4EFNA 3TW8B 4W8HA 1NT2A 1RRGA 3EFHA 4IFIA 5ITVA 3AHCA 1R9MA 3KDSE 5F4ZA 4M1KA 1OH6A 1E62A 3KQYA 1YD7A 3BH0A 4XB6B 3H6HA 3MOGA 5BNZA 1N2CA 2G5GX 1HE2A 3O8QA 3DW3X 2W58A 4P3XA 3N2YA 5EWLA 1BFKA 3R0QA 4ZO6A 1PJRA 2EBUA 2H08A 2ZYWX 3KJHA 3EG9B 4BZZA 1CDDA 2O9JA 4OOFA 5K05A 1HLFA 1E5VA 2J08A 2CLSA 1KP2A 4ZGBA 1QYXA 3B1JA 4C4RA 1YRYE 1RWOA 5FNVA 5E7JA 1GT91 5K3CA 1ABEA 3GPLA 2XOKD 4HI0E 2XBUA 1WU8A 1ZCAA 3BMXA 1PNTA 3P0JA 4IUDS 1E9CA 2OV2A 3FYDA 4Q4AA 4XQEA 2WSIA 5AH0A 2OGWA 1X80A 3ZTTA 5DM2A 3EJWA 3QUBA 4C88A 1KPGA 1V8PA 1DX4A 4JD5A 4KNVA 1SR8A 5BSWA 3K8OE 4MPPA 1OSNA 1AA9A 4YTEA 4E6PA 5JC8A 2YWRA 3HPRA 1NXOA 4IG4A 5HIMA 2UYCA 3HL4A 2ZVQX 3LX6A 4II3A 4EYGA 4PTZA 1TA0A 4GMDA 4IO1A 4DE5A 3LY9A 1OA1A 1KOFA 1G3UA 2PRKA 4RZSA 4R6XA 4EI9A 4Z51A 4K88A 4LBVA 1Y3BE 3S8EA 2CCKA 2NW6A 4F97A 4DIFA 1JA0A 3O8OA 3JQRA 4HQ6A 1Z7GA 1NBAA 2C99A 3SX0A 3ZNQA 3F7OA 3C3KA 4R9RA 1QVZA 2CHFA 4D26A 1Z74A 2VSQA 4U7PB 1MAVA 4EM6A 1XJ5A 3AY6A 3C7DB 4FKMA 4F96A 1RZVA 4LRYA 2C5HA 4TRJA 4BV8A 1G20A 1IULA 3W5AA 4IEIA 3SFZA 1XTKA 4MWBA 2HRZA 1NPTO 2OXRA 2R1TA 2ZSUA 3CNBA 2CVQA 4S24A 1TZMA 4EFKA 1TTTA 3ESXA 2OCDA 1T8YA 2C4UA 2BR5A 2OZPA 3A1TA 3D4LA 3PC8A 3AF0A 2FW1A 4KXYA 5G1PA 1E1CA 2HKIA 2NN3C 3LI2A 3TM4A 1G42A 3PGLA 1J8QA 3VPFA 3BDVA 1FZTA 4YJ2A 2YCBA 3AKYA 3WKAA 2P9ZA 1I2DA 4MQFA 4B6RA 2AYZA 4LE0A 4X1YB 4OXYA 4QUEA 5EPOA 5LLSA 3CH5A 4FT2A 2NO6A 4X62B 3TLMA 5CM9C 1BW9B 4J94A 5CB4A 2VR1A 3VNSA 1HE1C 1OLSB 1WMFA 3BD6A 1T43A 1VMEA 3ZNOA 1I4LD 4DQ0A 5AVXA 1DQYA 5JC1A 1YZVA 1NQTA 3FYUB 4UUQA 4Y7DA 1ORIA 4OOEA 1QPBA 2AUNA 1HKUA 1AGRA 1FUUA 3MG9A 4HNUA 2P0AA 4GX5A 1FNDA 3JTMA 5K5EA 1C7QA 2X86A 2XMQA 3LPMA 4JUIA 3SJBA 1HNWB 2X40A 4BUJA 4Q7JB 1SWWA 2R1VA 4HUQA 3S55A 4ZMBA 5B1YA 1DOHA 2XGMA 3IDQA 4EL5A 5MDHA 2DBZA 2PANA 3U1VA 1SJ9A 2R97A 3LQKA 3ZU2A 1DO0A 2I91A 5BSFA 2HJSA 1JIKA 1UT6A 3TLAA 4TYMA 5D51S 1I36A 5JLJA 1W48A 3E22B 3P9CA 2Z2ZA 4B3FX 2B34A 3AM5A 4B81A 4LYEA 1OU4A 2AYYA 2X4IA 3V5NA 3E5HA 3U3OA 3OQVA 2ZROA 3BE4A 2BDTA 1JYEA 2NXJA 2P3SA 4ILKA 3LW8A 2B2NA 4RXUA 4ZQCB 5BO5A 2VP6A 3EG5A 2ZB4A 4DWWA 4XWAA 5I7EA 1JG4A 5E3JA 1UXOA 2AI1A 2OQRA 3R0XA 1F51E 1JMYA 4D57A 1L7XA 5DNYB 2HLPA 1OWNA 1HV8A 1ZC3A 1Z73A 2P7HA 2QT0A 3DCJA 2OECA 4BGVA 4OYYA 4TWJA 1ESCA 3I5UA 1H6CA 1I13A 4RSRA 4RPGA 3IYLW 4P84A 2KJQA 4QIHA 3FAZA 3T7JA 2OO3A 4MMXB 1T0BA 2FG6C 3KKEA 1PZEA 3G59A 3OE4A 1KI6A 4Y0AA 4B6JA 5BR7A 2ZAYA 1XRMA 2VAXA 3GN1A 1G98A 4J2TA 3RS2A 2JHGA 3TSZA 4GUAA 4P7JA 2IPXA 1NQ5A 3OY2A 2YC2C 3RTGA 5LN1A 4RULA 4B7XA 3J81A 2QJFA 2X9GA 1WHTA 1A8PA 1P6QA 4TLDA 4PLVA 5M29A 2Y1LA 2VHYA 4KE8A 1IPEA 1QXSA 1RM5A 1PNQA 2K7FA 4CEIA 3EIEA 5KYWA 2Q5LA 3EISA 1WXWA 4ND5A 3FCAA 5AICA 3SHTA 1WB5A 3ODGA 2RH5A 5E9JA 5EIBC 1ZA1A 4P7FA 4P81A 3ASYA 2WJYA 3V1NA 1ZMRA 3SIXA 3ITKA 5JPIA 3ELBA 3OWHA 5IM4A 1LSSA 1H4TA 3K3PA 4Y6GB 4GMFA 4AAYA 4BVBA 4RIIA 3DKIA 3LK7A 3DWFA 3OTIA 4YRJA 3LBIA 4XDHA 4Q9IA 3A70A 2EKLA 2FFAA 2WWHA 2QTNA 2JARA 4XJTA 1UP4A 5IJ9A 3I61A 2M9MA 1CUAA 1Q1BA 3BM5A 3N2KB 4LMAA 3K6JA 5HJ7A 5SYNA 3TJRA 4DXHA 2A0XA 2DUMA 3KUDA 2F00A 4OQMA 3UC5A 4E22A 2ZW9A 1TJ4A 1NV9A 2VXCA 2QDXA 4KO8A 1EFPB 4Q15A 1U2SA 3HK2A 4YCMA 5A3JA 1TJNA 3OFKA 4LFCB 2P77A 4MGKR 5FWAA 5KIAA 4F86A 1EM8B 1MAUA 3OZEA 1FXWF 4GR4A 4GW3A 1LXCA 3VGPA 3MLEA 4F1WA 4YJKA 5AVTA 2R65A 4J29A 4AJLA 1EDEA 1ZK0A 1Z37A 1Z6ZA 5FOXA 6NULA 2IEYA 1IZZA 3T4EA 1KC1A 4C3ZA 1D4ZA 4I4TA 3I1FA 1EFTA 4E1BA 1WULS 1GNSA 2E4ZA 4RH1A 3FNQA 4PO9A 1P1BA 2XTNA 3O82A 1A8QA 2ZJ3A 1JPJA 2MJLA 5D01A 4Y2XA 3RSSA 5ARBA 2F55A 1KPIA 3IOBA 4E30A 2J8ZA 3OLCX 1Z5GA 4GXNA 1KVUA 2YL2A 1R9GA 3TSAA 1XWFA 4N41A 1UXGA 1IBSA 1GL9B 4DM4A 5CK4A 3LUFA 5GJWC 3D54D 4R2KA 3WK7A 1SVKA 2HU7A 2OAP1 2JZCA 1KEVA 3DZHA 1P2SA 1L4HA 3GWZA 5ICCA 3QYJA 5DP1A 1EUDA 2GSWA 4EH1A 1LDMA 4ZT4A 3TQQA 2BHSA 3WJ7A 1CDOA 1XZBA 4CM6A 1W0JA 1N36B 4JI4B 2XNSA 1QG0A 4XXHA 3V1UA 3CU5A 3OESA 5IF9A 1ZQ9A 3AFIA 4REQA 1NR1A 4EPRA 3TZHA 3PNOA 3R4CA 4H0NA 3ZHCA 4PN7A 1HZJA 5EKTA 5DDIP 2R4TA 1B6GA 3A6DA 1E32A 5KNBA 2YFYA 2I3AA 3AIIA 1AHHA 3MJVA 1XTSA 2P2GA 2X8JA 5D3MA 4D45A 2CFCA 4R6WA 3VYWA 1E4VA 1M6VB 2DAPA 1T34A 2IEIA 4IHJF 1G0NA 3F3SA 1K3TA 1QIMA 2W7TA