3AKYA

Stability, activity and structure of adenylate kinase mutants
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Stability, activity and structure of adenylate kinase mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Adenylate kinase
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akyA00
2WJYA 2HCBA 1NVVR 2IT1A 3IPXA 3OE7A 1E4YA 2GCOB 3ETLA 3TQFA 2CEAA 2IUTA 3LV8A 1D9XA 2DFKB 2GWHA 2QM8A 4PAQA 4G3XA 1RJ9B 3ADKA 1Z2CA 3L0OA 3BFVA 4YMTA 2EWWA 5FOXA 3B8HA 3EASA 4B3XA 3AVXA 4XVRA 3LBNA 1N6RA 1L8QA 1AZTA 5FPTA 4AKHA 4TTRA 1ZIOA 4C7OA 1D2NA 2A2ZA 4DLYA 3CH4B 5KNCA 5EUQB 2XXAA 3SDZA 3TSWA 4B2IA 2ZJYA 1TQ2A 1DAEA 4OHYA 3TMKA 1UJ2A 3HPQA 2RGNA 4EJSB 1W5SA 3DL0A 2WSSD 2Q3MA 2ZJ5A 2XJ9A 2J0UA 2R44A 4TT3D 5JECA 1LW7A 5JEDA 2ZYTX 1XEWY 1VYTA 5AR1A 4TYNA 2ZUBA 1YJ5A 3EC2A 3CX8A 4M1TA 3V4FA 2QT0A 2VIIA 5EE0A 4Q7LA 4RFSA 2GJAA 1VKJA 4D80A 1SHZA 3CPJB 3HYTA 1E0KA 1ZINA 4NKRA 3TR5A 3SHWA 4FCTA 2FPMA 2JDIA 2W2VA 4FN5A 4BUJA 5EE1A 2RHDA 3FVQA 2CE2X 2EVWX 3CH5A 3MJHA 1AS3A 1ZD9A 3UATA 3THXB 3OEEA 1KO4A 2FSFA 3BB1A 1LS6A 4HLCA 4PPQA 3K70C 4PQFA 1DG3A 2ZYVX 3O47A 3X2SA 2RAPA 2ZRJA 5DGXA 2J0SA 1P3JA 5GJWC 1E9AA 5FTMA 3RS4A 1OH7A 1XD2B 4V0KA 3RC3A 3RS7A 5B58C 4AKGA 1Q21A 2KI5A 2QMUA 2CJWB 4V02A 4O0MA 2Q9CA 2QEQA 3AKDA 4JYCA 1P4SA 4NE2A 5BWMA 3NVAA 3PG5A 5J40A 1E99A 4QKQA 3JVUA 3L8YA 3SFZA 1U2RA 2BKEA 4KBFA 4JLKA 1GRQA 1HA3A 1T4GA 3RWOA 4B32A 3THYB 1S9DA 2J3EA 1DS6A 1BIFA 1CULC 5HKKA 4QM6A 4JKIA 1U90A 4OBEA 1A5TA 3CZQA 4LV6A 3CWZA 1CS4C 3UMFA 3ZQ6A 3QNUA 4PTLA 4RD1A 5EZ5A 3UIEA 5AUPB 1DG1G 4BEBA 5KO2A 1A1VA 3EWAA 2Z6VA 3GCGA 5CB8A 1MKYA 1E9SA 1CRQA 1TX4B 4Q4HA 1BMFD 5AJWA 1E2EA 3WBKA 4BLOA 4KCGA 3RS2A 3WXMA 1QG4A 4BFUA 3HU2A 4CRWB 2GBLC 2VBCA 3NC1C 3SC3A 3FKSD 3QXCA 1T3LA 4PHGA 4D6PA 2B7CA 2OFXA 2ZRLA 4B76A 2PJRA 3AUXA 4DDWA 4TMKA 1S4QA 3NEJA 1SKQA 3P26A 4FMBB 4OYHA 4AURA 3SYNA 3QKRA 3W8NA 3JZAA 2BC9A 4N0EA 4KYUA 1E32A 1SKYE 4PQRA 4IJMA 1NLFA 3TSOA 3DOFA 1XZQA 2R6FA 2LWIA 3ICQB 5AUOB 3EZ2A 3C15C 3X1DA 4BQSA 1AS0A 1CJTC 2FOLA 3OIVA 1FL9A 2GILA 2OXRA 3KJGA 1M7GA 3AH8A 4PC1A 4LWZA 2XSZA 3VR4A 2O8EB 2QU8A 2QQEA 1OKKD 1SXJC 2EQBA 2ZM5A 2AXPA 4IW3B 4LHVA 2BJVA 3A6PC 1E6CA 5D3QA 1VHLA 1XEWX 1U99A 4Z51A 2VSXA 2VSOA 1JAIA 3IBGA 4XJXA 3BAFA 2IXGA 3NBFA 2OG2A 4AG6A 1G8FA 2VHUA 3TW8B 4D4KA 2P5TB 2A7QA 1W48A 3PVSA 1MH1A 2A30A 1SVWA 1GKYA 1Z0DA 4MGZR 2OAQ1 2DWPA 1QDEA 5JHGB 2C98A 4RY2A 3T1VA 4D26A 3ZVLA 2VHCA 1OB5A 5TARA 2EFGA 2MMCA 4FINA 2R9VA 1XNJA 4M9XA 3U3JA 2ASEA 4CDGA 4D0LB 1R8SA 3PR1A 4KITB 4CYMA 4ZI2A 2FFQA 4A92A 2O0JA 621PA 3W6NA 2ZI6A 1N6PA 4Q47A 5HR5A 4CEIB 1KDTA 2IUUA 1P2SA 2R65A 4OI0A 2C9OA 4NDZA 3O8RA 1GDDA 1IN8A 1W1WA 1EFRD 2N46A 2ZPTX 1K5GA 3GJXC 3QXJA 4CVNA 5KPDA 2QBYA 2V55B 3LXXA 3A8TA 4HLUA 1LF0A 3D7MA 1NG1A 2OT3B 4CEJA 3HU1A 3U3OA 4AYTA 3MGCA 3EPJA 4IOMA 3FE2A 3U2QA 2C78A 1Q44A 3I8SA 4FI3C 4G5OA 4D4MA 4DBLC 3MLEA 1G3RA 1T6NA 4ERNA 1YZTA 3GLIA 1HV8A 5FOSA 2EFEB 5K8IA 5GJBA 1LS1A 2O8BB 3RSOA 2YOHA 2V8OA 3H84A 2NGRA 2IW3A 3OEHA 2EU8A 4H9GA 3GEIA 3QKUA 1NBMD 3EG5A 2BBTA 1ZUNB 2BMFA 4PAMA 4M8NE 4RZ3A 3MRSA 4ARZB 3VMFA 4DSNA 2ZU0C 3SN6A 3PENA 2CVHA 3GJ4A 2W6ID 1NSTA 2O8FB 3P32A 3ZIAA 1R0ZA 1RPZA 1L4UA 1ZIPA 3QPWA 4DLSA 1ZM2A 4EPWA 2F3TA 2ODWA 3O8BA 1JQJC 5JSZB 4Z1MD 4NYJQ 1N6NA 1GSIA 1TEXA 4DVGA 3TSZA 1JJVA 1Z07A 1KJWA 1H8EA 5M04A 5E7IA 4C2TA 2NO0A 3P4YA 4EPXA 5E7MA 1GNQA 2DFNA 4YMWA 1U94A 3KTAA 3T35A 1IAQA 5EUMA 1TF2A 1FX0A 4OQNA 2OCPA 3KX2A 4P4SA 4QGGA 2RGXA 5IT5A 5IK2D 2ZITA 2JLQA 3TUZC 3FMOB 2QI9C 2NPFA 3D6TB 4GL2A 1GTVA 5CJ2A 4ON9A 4LJAA 1GNRA 4O2RA 521PA 5C1BA 1P2TA 1KY3A 2HF9A 2IS1A 1IN5A 2GJ9A 3HR7A 4NYJR 4PC2A 3QEJA 1JAHA 2AFHE 3CX7A 5CB6A 3U44A 2JLRA 2WZQA 1SZPA 1IXZA 1T91A 4KODA 1KIMA 3QKSB 1SKYB 1QZXA 2BWJA 4EUNA 5KTYA 4CEHA 3I73A 1NN3A 3DZDA 3KFXA 2ORVA 2BHRA 3FFAA 4DCTA 5G40A 2H57A 3ZD7A 3C16C 5AWFC 1IY1A 2VF8A 1BOFA 4EFLA 1OPXA 2BOVA 2WWIA 3P27A 4LHZA 5FR2A 3NDBB 1TPZA 3GFOA 4G5RA 3NKVA 2WM9B 4JLDA 3PEYA 3H2YA 4C0JA 1ZNZA 4JZKA 5DN6A 1Y63A 2YNMA 4UXHA 3FB4A 3AVOA 4DIDA 2H16A 3K0CA 2AK2A 3D8BA 2WKPA 1E4VA 4DDUA 1EG7A 1AIPA 3QVUA 1COWD 1P75A 4FW9A 1IOZA 4PO8A 3KKOA 2WJGA 4GOKA 4P0TA 5BN5A 3OE7D 5CJPA 3CF0A 1MOZA 1OIVA 2R6GA 3AVTA 3I32A 4FMDB 1XPRA 1D6JA 4X8LA 5C18A 1XPUA 1B23P 2PEZA 3X1YA 1RZ3A 2ZSEA 2JEOA 5J5CA 2IYTA 3LVRE 3IIJA 3H4MA 1S1MA 4LYAA 2JLYA 2G88A 4KXFB 1CJUC 2A78A 2ZRHA 4BPBA 2IHYA 4JVNA 1G291 4XOIA 5JFGA 2RGDA 3T06B 4WZ6A 1XJ0A 3H86A 4MH0R 5FOTA 5A4JA 3QQ5A 5KUTA 3J81k 1NMYA 2BVNA 5HE8A 3TGPA 2P67A 1SVIA 4Q03A 4RFVA 1PLLA 2CMKA 2ERYA 2QUZA 1ZW6A 1Z28A 4F4JA 3WHKA 1W2GA 1W5TA 2G3YA 2ZETA 2AK3A 2VP9A 2C99A 1E0AA 1R10A 4YXWA 3SE0A 5C4MA 1DPFA 2JLZA 1QHNA 4BFXA 3SJZA 1W0JA 1KMHB 2BDTA 2P6RA 3BE4A 1F6BA 3EA5A 4Q4AA 3WY9A 3B1VA 3TUJC 1X6VA 1JBKA 4HAUA 4PSKA 5D3MA 3U3RA 2QBYB 2HXSA 2JDID 4MGYR 2VA8A 4BLTA 3QE0A 4CEJB 3GFTA 3TK1A 3U61B 3QPVA 1JQLB 2C95A 5K8UA 1YZUA 3OEED 1HTWA 1W49A 4ACBA 2NZJA 2IS2A 2BBOA 8OHMA 3Q5DA 2AX4A 4QNMA 5TY0A 4DSOA 1Q3HA 4XTCS 1HT2E 4XTRA 4LGMA 4LV5B 4XH9B 1KGDA 2GJKA 3QJYA 4EJSC 1MO6A 1S3SA 1G8HA 3OFNA 2JIZD 4HAWA 1SVOA 5KNDA 1PUIA 2RMKA 2GF9A 4CT4B 2RGCA 4C9BA 1KI7A 4K81B 1EX6A 3X1XA 5DHFA 3SYKA 4QGFA 2HYDA 2CHQA 2F7SA 5EE3A 3DKPA 1H8HD 4W5JA 1ZMXA 2NQ2C 4OI2A 4FCVA 4GDFA 3KL4A 4JT2A 5BXQC 1XCGB 2FPKA 1K8RA 4TQ9A 5FOUA 3CUEF 5HKKD 4B2LA 2L0XA 2NO6A 2ZS7A 2WOOA 1P60A 3WMEA 2IUSA 3IQXA 4V0MA 5FBLB 3ZVRA 1YR9A 1XCPA 1IBRA 2OM2A 3M6AA 4GP6A 2XJ4A 2OCBA 2ZJZA 1XDBA 2OESA 3KTAB 1ANKA 2NMVA 4PFSA 2QAGC 3SNHA 3K0SA 3SFVA 1FX0B 4P4SB 1WRBA 4PPFA 1G1MA 3S1AB 1GKUB 4POAA 3KQNA 4JL6A 2C8VA 4LK2A 3VTKA 1CEEA 5G53C 2JLUA 1E79A 4XD7A 3CM0A 2QY9A 4O3MA 5BYJA 4M4SA 1XTIA 5H68A 4V03A 1TTTA 1JNYA 4DLRA 3GLHA 2DPXA 4TL8A 1C9KA 3WMFA 1DVRA 1G5PA 2J59A 1GRNA 2WWHA 5HCIA 4FMDF 3ADBA 1YZQA 2XTZA 2RCNA 2UZ3A 1GZSA 3IIKA 1S0UA 1ONBA 3WYGA 1JR3A 1Y3AA 2Z4SA 2CL7X 2KE5A 3DPUA 3QG1A 4AYXA 1OT3A 2XSZD 3EPHA 1GITA 3BRWD 3PUZA 5KSPA 3I5YA 3CX6A 5KU1A 1ELOA 3A4LA 4XSHA 1Z6TA 2DBYA 4PX9A 4F91B 2GVZC 1GG2A 3KKMA 1DO2A 1GAJA 2ZRCA 3QBVA 2PMKA 4JLNA 2XB4A 1G21E 1OH5A 1E2DA 3MMPA 4HAZA 4B3GA 4HUQA 1G4AE 2QMEA 5FOWA 4D0NA 2FMXA 1E1RA 1Z5ZA 2VO1A 4GZMA 3GPLA 5L3QB 2BMDA 3W6PA 4A0RA 1MO4A 4QBHA 1P5ZB 2OO7A 2YC2C 1N25A 3OHMA 3QG5A 5SZJA 3L2OB 3WNDA 3RSLA 3SQXA 2JLXA 4P32A 3LD9A 2F55A 3PQCA 2VHTA 2QAJA 1XXHA 3VR1A 2V54A 1EFUA 1HQYE 1MO5A 1YR7A 2REXB 4EDHA 2FGJA 3KB2A 1OB2A 1P7CA 4U02A 3SQWA 2ZRKA 3IO5A 4WOPA 1L2TA 2H18A 2YHSA 1NG9A 1UDXA 2LKDA 5EE5B 2XTNA 1DEKA 3U4QA 3BFXA 1D5CA 4URXR 4A15A 2JLWA 1OYWA 1YU9A 3NG1A 2FZ4A 3EIEA 2XB2A 3IHLA 1VG9B 4F4IA 4B47A 4D25A 2YWFA 3K1JA 1G3QA 2VSFA 5C4GB 3RS5A 2JJ2A 4IOKA 5C46F 4KLZA 2OBMA 1ZRHA 1M34E 2P2LA 1W46A 1QBKC 2G77B 4JSYA 6Q21A 1NVUQ 2UKDA 2G83A 1FPMA 2V9PA 4OHXA 4NCHA 4M1WA 2P65A 2GXUA 2Z83A 1FTSA 3OEHD 1CLUA 3R9WA 4MDFA 2P0EA 1N0UA 2V4ZA 4K8OA 3SEAA 4Q4AB 5EXSA 1HT1E 3KB1A 4L9WA 1EFCA 5CDFA 1I4TD 2J41A 4GZLA 2RGGA 3VQTA 3U3KA 1FNNA 2VL7A 5CM8B 2FFBA 2MSCB 4MRRA 4B6EA 3ZIAD 4HDOB 2XNDA 1OV4A 2GEDA 1B0UA 3NBYC 3NH6A 4M1MA 2OBNA 1MABB 2QTVB 1E2KA 3LA6A 1Z0FA 2ERXA 2ZRAA 3AKYA 5EJEA 1HUQA 2R8RA 4QOSA 1H8ED 4DCVA 2FPLA 1YE8A 4DXAA 4OI1A 3RABA 1G4UR 1SGWA 4E5UA 2J9RA 4I1SA 2GAAA 2FWRA 2QGNA 5IDVA 1NVVQ 2R62A 1RC8A 1KI6A 1TUEA 3GJ8A 1CKEA 1II9A 1G19A 1R8QA 2CK3A 3ZJYA 2A5YB 5SZKB 2V1XA 4E09A 4EPVA 3IO3A 1UKZA 3PIRA 1P2UA 4QHTA 2PLRA 4WXRA 4BFYA 4D82A 3VHXA 1IXRC 1XFAA 4RKFA 1NL3A 1SVSA 4KBGA 2QP9X 1HH4A 4CIDA 4MRSA 2JJ1A 1Z8FA 3RLFA 4URWR 2QA5A 4BLRA 4IDQA 2WJJA 1GL9B 1AQUA 3C5HA 2W0MA 1TQ6A 4HLDA 2IYZA 1W36D 4CT5A 1OFIA 1TL7C 3RC8A 1NF3A 2O0KA 2D7CA 3OIYA 3LQQA 3B1XA 5K8LA 3VKGA 5LB4A 2PX0A 3AKEA 3CR8A 5B64A 4GOJA 4Q19A 4IFEA 3UMSA 3GLFA 5AJVB 3TVDA 2HXYA 2DFLA 4AK9A 4Q9LA 2JASA 4TMTA 3U7EB 2H5EA 5EQTA 4OJQA 1KO8A 1P6XA 4Q66C 1ZUIA 3BB4A 4JLBA 3TLXA 4JL8A 3K0FB 4IOJA 4B74A 3PFIA 1T5LA 3RANA 1KI1A 221PA 1IJFA 3EA0A 4IDNA 2BEJA 2J7PA 4LBVA 1KSHA 3D3QA 4FMCB 2ODEA 4HEJA 1FP6A 4QBGB 5FPYA 3SBEA 2D7DA 3REGA 2JLSA 3ZS8A 4GSYA 3ND8A 1XX6A 4HB3A 4PO9A 3KQKA 3N2EA 1E96A 5CM9C 4G1UC 1QRAA 1CP2A 3WNCA 4IDPA 2VP0A 4BFVA 1ZM9A 4MKHA 4TN1A 3A1UA 1NNEA 4B43A 4US1R 1SQ5A 1IY2A 4PC7A 1Q0UA 3HWSA 4RD6A 4TLEA 1ZD8A 3LNCA 2IXFA 2W00A 4JT4A 4Q4JA 4BZPA 3U60B 4ASUA 4CZ2A 1QVAA 2Z4RA 1AKEA 2IHBA 2J7KA 4L4UA 2G6BA 3KUCA 1KI3A 4RD2A 2J0VA 3CRW1 4D2IA 3GQBA 3EIQA 3BS4A 3WP0A 3B1WA 4MQBA 5J4HA 3MUFA 1Z6AA 2QAGB 4MGIR 1CRPA 4JYBA 1FMLA 1BYIA 3KJIA 1KI8A 1G3IA 1F2UA 1G20E 3AVPA 1KJYA 1M8PA 2BEKA 3GD7A 3LDAA 1GM5A 4QM7A 4TLAA 2O52A 1OE0A 3QF7A 3N2IA 4RD4A 4YXWD 2OCAA 1KSGA 3GMTA 4D4LA 4H1UA 5E4FA 5DLQC 5JI2E 4B6FA 1W0JD 1Q1EA 4A8JA 1S1CA 2D3WA 4TL9A 1E9CA 1UKEA 2OAP1 4R71A 1JR6A 5L3VA 2IWHA 4C0HA 1LY1A 3NDPA 1LVGA 1L4YA 2KB0A 2FSGA 1J70A 2RKOA 3KFVA 2Q3FA 1KO1A 5JHHB 3U4QB 1CXZA 4A2QA 4W9MC 3FFBA 1L7VC 5TMPA 4EAQA 1VPLA 3IBYA 4R2HA 3I5XA 4D0GA 5IRCD 1EGAA 3RRNA 3OF5A 3R7WA 4JLVA 4Q1EA 4UNPA 4A4DA 3QF4B 4PHTA 4C0SA 3QVVA 3D31A 1VG8A 2R6CA 3P1JA 4L9SA 5B57C 5CLLA 2FJUA 4E03A 2F1HA 2NO7A 1UBGA 3I62A 4PHHA 3OFND 4F92B 3TVTA 2ZIAA 4A1FA 3LX5A 2BMJA 1E2GA 2PL3A 1FQKA 3WRYC 3IKJA 4MYUA 2Q21A 4Q1FA 5L3SB 1HEIA 2KJQA 1KOFA 1QHYA 2WBLC 3PJRA 1D2EA 1NMXA 2F43A 2MSDB 1Q1ZA 3BK7A 4PO1A 3E1SA 1QHHB 4LYFA 1TF5A 2W58A 3W3ZB 1F2TB 2GK7A 2RB4A 4O25A 1S2MA 1XEXA 3B85A 4QJ5A 5TXGA 1KI2A 2IWRA 3PXGA 5KDDA 3K8YA 3C5CA 3BD9A 4LSGA 2OFWA 3LW7A 1TQ4A 1U8ZA 2G0TA 3SZRA 2AWOA 2ORIA 4TWZA 5JLJA 4C30A 2FG5A 3LO5A 2ZXUA 4NHOA 4FMCF 2HEIA 4A0HA 5J4YA 4XD7D 4B2PA 4KVGA 3E5HA 4NCKA 1F3OA 1CR1A 2QSZA 4EQ6A 1N5IA 4LHYA 4G5GA 4ITRC 4UJ3A 2O8CA 1IJEA 4M21A 5EP3A 4PZLA 5DHAA 1G18A 1I4DD 1XTSA 1FNMA 4HZUA 5FL7A 4KYIB 2EFDB 4DDVA 2I1VB 1LTQA 2ZE6A 3CF2A 3L82B 2IF0A 3HJNA 1CJMA 2AN9A 2ZSFA 3JZMA 2BJWA 3OESA 1AM4D 2VEDA 5LPNA 1JR3D 2GJ8A 3W34A 2FH5B 4Q7JB 4X8OA 3A37A 1J99A 3L0SA 2XEXA 1UPTA 3KQUA 2ATXA 4Q01A 1NVXQ 4B33A 3NBXX 3Q72A 4IOLA 1TU4A 3IHWA 2GK6A 2AR7A 1N6HA 1W4CA 3AUYA 3IPYA 3LY5A 2FEOA 4IXNA 1G5RA 3LRPA 5KOYA 1W0KA 4MGKR 3VKHA 4JSTA 2VP2A 3CZPA 1O3YA 1G8YA 3KDSE 2NPIA 4HZIA 3C7KA 3ASYA 2CXXA 2FSHA 1KNQA 1YZGA 4OK6A 1OH8A 4PC6A 4C7OB 1G64A 2XXAB 2FZLA 1NVWQ 4HDQB 5H1YA 2J0QA 1E1RD 2GBLA 1U8YA 3VR6A 4M1SA 4HB4A 3U6KA 2OBLA 3HR8A 4DLVA 3MWLA 4B75A 4MUAA 2XZOA 4YC7A 3TJZA 4P33A 1P9RA 2D2EA 4B71A 4C3ZA 2P6NA 2LCFA 3LAWA 1US8A 1E2LA 2J0UB 4IKEA 1XU4A 1CR0A 4Q00A 4FCWA 2YJTD 1Z6GA 3KZ1E 1AGRA 3EAQA 5CYOA 1CF4A 4CW7A 1OYYA 1R7RA 1SVMA 5FPHA 3FHTA 1I4LD 1NKTA 2UZIR 4RFSB 4Q4JB 4M0LA 1IQPA 1NMZA 3GLGA 1QG2A 4LBZA 4S35A 4RJLA 4TYYA 3U7HB 1W44A 4HB2A 2P6UA 2QRNA 1ZCAA 1SXJA 4DZZA 1AK2A 5G3YA 3K0CC 3VKWA 5FL3A 1VCIA 2XZLA 2JJ2D 3CNNA 3GLIE 3TAHA 3ZGXA 4JMPA 4QL3A 3CW2A 1Z0IA 2FU5C 4YMSA 2QL6A 1KKMA 1E98A 4TYPA 4TMVA 1F2UB 3I61A 2VTKA 5C2JB 3ND9A 4KFSA 1KK3A 4B73A 1UKYA 2G1KA 3LLMA 2A5JA 3BXZA 2GZDA 3CPEA 2G9NA 2WVJA 4A8JB 1KDRA 2WAXA 3GLGE 3OZXA 5AJXA 1TQDA 1ZAKA 4LUCA 3EZ7A 2H8KA 4HDCA 1N6OA 3SOPA 1XCMA 4B3FX 3Q7QA 2Q3HA 3ZH9B 3KQHA 1MRNA 5TV2A 3VU9A 2XNDD 2J45A 2K5UA 2QP3A 4M2LA 4DEYA 4EPTA 1UFQA 2XAUA 4C0BA 3TAUA 1XMJA 1XMIA 1N0VC 2IBMA 4W5WA 2QPTA 3SR0A 3RDPA 4LZZA 1Z06A 2VYFA 3R9IA 4Q4HB 2ZR0A 4P31A 5A0FA 1P9WA 1E2IA 3NC0C 2YOGA 1R0XA 3CWQA 3MWJA 3DZ8A 4N3NA 2GAOA 4KVAA 4DUGA 1XPOA 2HJVA 1Q12A 2CK3D 3MJRA 3EIHA 2OHFA 1M2OB 2ZYWX 1YR6A 3GP8A 2R6DA 4LJ7A 1KY2A 2JA1A 2VQSA 1G8PA 3F5FA 3I8XA 3QKRB 2WIAA 3Q7PA 4QNRA 4TYWA 1II0A 1WCV1 1NIPA 3C14C 2D62A 1Q1QA 2ZREA 2RH5A 1VMAA 3CLVA 3L43A 3K9GA 2AKAB 1G7TA 4DLWA 1KAGA 4FWIB 4NH0A 2C9YA 2WMNB 3PUVA 3LXRA 3THOA 1YVDA 4QGHA 1G7CA 1FZQA 2FV8A 3UWKA 1AQYA 4NCIA 2F9LA 4YMUA 2HLDA 1S96A 1M7HA 2KBEA 1N6IA 1U98A 4QRHA 5FBRB 4M22A 1DAFA 1E2PA 2P3SA 4AY2A 1HYQA 3UK6A 2ZRPA 3ZS9A 1V5WA 2WSSA 5E7JA 1XEFA 1ZM3A 2A3RA 2ZI4A 4DJTA 3DOEA 3T15A 4NONA 2NO9A 2FFHA 1BYUA 4X8MA 1DAKA 1MO3A 1N3BA 3I1FA 2RGEA 5DI3A 1OH6A 4FD2A 1ZU5A 2PCLA 2W83A 3LWNA 4Q48A 2ZRFA 1U9IC 1QHSA 4GMXA 3THWA 4Y0AA 3C8UA 2MMGA 3CNOA 3R9XA 3QEOA 1G7SA 2YKGA 4LV8B 1A82A 2IF2A 1A4RA 4BLSA 5JCPA 4ZO4A 2ODNA 1CR2A 1R5BA 1HE1C 3LBHA 3T1QA 3B1ZA 1YKSA 1ZUHA 2B21A 2OSBA 2QSYA 5FOVA 4A0GA 4HLQB 5DSZA 3KXIA 4FWTA 1UEIA 2UVQA 2QPOA 2CL0X 1E9RA 4ACAA 1XF9A 3QOFA 4ASUD 1GWNA 1O87A 1IHUA 5J4KA 2QPAA 3GJ5A 1G5TA 1E2MA 1OIXA 4EIWA 5F3WB 4G5SA 2IYSA 1NN1A 4M9SA 5DH9A 1EWRA 3K53A 2X8AA 2V3CC 4LBWA 2ZVQX 3M4YA 1EX7A 1VG0B 2IYVA 1R0YA 2ZS9A 3GLIB 3BC1A 2GZHA 3AF0A 1US8B 4PZYA 2CLSA 821PA 4ZKDA 3WYFA 3NWJA 1MR3F 4LDJA 4Q21A 1KTVA 2QP4A 3KXKA 4WIAA 5FUVA 5EE9A 3W3AA 2QTFA 1XMVA 2ZU6A 1KO7A 1TF7A 4YDSA 3MSXA 1ZNXA 3R8FA 2A5GA 1FP7A 1D9ZA 2ZE8A 3GLGB 2EFHB 2ZI3A 1T3SA 2CHGA 3LLUA 4XSGA 4EFMA 3Q9LA 1BH2A 2VRWA 4R7ZA 3DHWC 5ANRB 3G0HA 2HV8A 2OCYC 1A7JA 4AG5A 2O8DA 4OKSA 4DHEA 4U7DA 5L3RA 1OSNA 4B3DA 2QQ0A 3ZQJA 421PA 2HJGA 2CDNA 4GBMA 4JBWA 1XB2A 4QGAA 1CBUA 3U6BA 1UEJA 4LJ5A 4W7SA 4UJ5A 3A1SA 3ECCA 5HCNA 2ZTSA 1T0HB 4YMVA 1P9NA 1NKSA 3B60A 1OXUA 121PA 3PUYA 2WTUA 3BBPA 2J46A 5LD2B 1FOEB 5LDDC 2D4HA 2CLDX 2WKQA 4A36A 4A6PA 4DDTA 5CITA 1G3UA 4DSUA 1CTQA 4PQYA 1LB1B 4I99A 2YWGA 3U44B 1JEEA 4HAXA 4US0R 1KHTA 2GCOA 5BN4A 4V0ME 5KDLA 2IYXA 3WNBA 1M6NA 1P2VA 1XD8A 4LI0A 2R2AA 4F4CA 3M0EA 1OXSC 1W36B 1EWQA 2OE2A 1RJ9A 4WBSA 1BO6A 4CEHB 1U0HC 2GHIA 4GT1A 5JS8A 4A6XA 5EP2A 4Z54A 1VHTA 2V7QA 1Z22A 2ODBA 4LYHA 1E2HA 5HZHA 5JEEA 4G01B 4M1OA 4IHQA 3UPUA 1RRCA 4B3BA 2WWXA 4UXJA 1JI0A 1N5LA 4ZIRA 3K70D 4TMZA 2ZRBA 2B7BA 2WKRA 3BH0A 3EC1A 5EZ6B 3SJAA 4UNRA 1GP2A 3A4NA 1T8UA 3B1YA 2GNOA 3IUYA 3GLHE 4RZUA 2D06A 4EJSA 2B6HA 2WICA 4Q18A 2AL7A 3BFKA 4Q1BA 3DMNA 3E70C 1CR4A 2X2FA 3QY0A 5SZIA 4LJ4A 4LHXA 3IIMA 4F7WA 5JRJA 4Z8XA 1NIJA 4N0DA 1JR3E 4TL6A 5LB2A 4M53A 4JBYA 4AI6A 5KSZA 3ZVMA 5B30A 2IYYA 1KO5A 2HDNB 3P4XA 4R98A 1NY5A 4DB4A 1IN7A 2W6JA 2WJVA 4V0LA 1FTNA 2F1IA 2CNWA 3EWSA 3BH7A 4MYCA 4NP6A 1VECA 4LJ9A 4WXPA 2P5SA 5DI9A 2OLJA 3SBDA 4BRWA 1P73A 2LKCA 3W6OA 1NLZA 4EFNA 5KNBA 1UF9A 4JLOA 4HATA 4KFTA 3THXA 4NU0A 4OI4A 5IHPA 1QHXA 3QXXA 2IXEA 3B9PA 1WBBA 1ZNYA 4F38A 2XTMA 3GEHA 1ZYUA 3ADCA 3FKQA 1E2JA 1LF5A 4Q4LA 4JLJA 3IEVA 3TBKA 4CF7A 4RVCA 4NYIR 1XD2A 3MG9A 1TMKA 3DDCA 3KJEA 3I92A 2CJWA 3THWB 3WYAA 4CGZA 2WWGA 1DAMA 2BCGY 2EYQA 4DLXA 2YOFA 4J0QA 1XXHE 5KDOA 3DO6A 2B8WA 4JS0A 1ZP6A 3FGNA 3TQCA 3THYA 3KXLA 3VR3A 4WW0A 2IYQA 2O5VA 1RE0A 1QHGA 4DIEA 2HUPA 5HZKA 1ZBDA 2D2FA 3DEFA 4WAUA 5K8TA 2ZRDA 1U8AA 1GL7A 2F3RA 2F6RA 1Z08A 5D3MB 5FBVB 1XTJA 1G17A 1DE0A 4JVMA 3W8RA 4DLTA 5KSOA 3AP1A 1ODFA 4JJKA 2KWIA 1AA9A 3SJBA 1J8MF 4JL5A 4L5BA 4BASA 3BWDD 1RYFA 2QMOA 2PMDA 5DYIA 3LVQE 1QF9A 2FEMA 4NL4H 1M1YE 1UBEA 1W4RA 4P4UA 3ZVNA 1HURA 2GF0A 5JRZA 5F9HA 5EXTA 5JI3E 4BFZA 1IN6A 3PUXA 5IK2A 1Z47A 2REBA 3FDIA 3Q3JB 2DY1A 1GFIA 4QG7A 2RGNC 2XNSA 1A2BA 2BBWA 1E9BA 1U0LA 2AD1A 4JIMA 4LC0A 4TSFA 1X8JA 2PT5A 2IYWA 3MCAA 1RKBA 4LJ8A 1XMSA 4RZXA 3TIFA 2YZ2A 4S2EA 1EXMA 5CDFE 1YRBA 1IONA 2ZI5A 2GXAA 3AEZA 2GETA 3X1ZA 4Y0VA 3K9HA 2I4IA 3B13B 4G5QA 2OUKA 1X3SA 4UNSA 5CIQA 1ETUA 2QROA 4UKDA 1RRFA 4IFBA 2O8DB 1KNXA 5FBQB 4AIIA 1X1RA 2ZSAA 3EARA 2GCPA 1QVRA 3LBIA 2WWWA 1R5NA 3EW9A 2YWHA 2O8EA 4JLAA 4L15A 1KYIA 1T0JB 1XJQA 2ZRNA 3KUDA 5B2ZA 1SVKA 1E2QA 1DAHA 1AS2A 3BJIC 3CR7A 3CIOA 3H1TA 4NPHA 3MD0A 4UXIA 3TNFA 4B44A 3DVLA 4B34A 5GADl 3DM9B 4ZKEA 3R20A 1OIWA 1G6OA 721PA 4PZZA 4IEEA 2OILA 2VPPA 4DUGD 1KZGB 3C41J 4YQFA 3F3YA 4ESVA 1FW6A 5DN6D 1MT0A 1KDPA 4LPKA 1NLYA 2J1LA 1Q22A 2KBFA 1YR8A 4BGDA 4A8JC 3V4RA 3GLHB 4ZDWA 4C0QC 2J87A 1R6BX 1E3MA 1CJKC 2IC5A 2RGAA 3T34A 4KI0A 3FHOA 1WQ1R 2WHXA 5AJYA 1SHKA 4RCZA 2AHOA 1CIPA 1NRJB 4AKIA 2BIFA 1W2HA 2GXSA 2NG1A 5DIFA 3VX4A 2DCUA 3AKCA 1Q20A 3FMPB 3A1VA 1DAIA 3GLFE 4CEIA 2JGNA 2AFIE 1P62B 2WWFA 2HLDD 2WPDA 4ZIRB 1E0SA 4NYMR 3N70A 2QG6A 1JEDA 4L16A 5CIWA 1Z83A 3RHFA 3DKVA 3NHBA 1KDOA 1E2NA 3B9QA 3K9LA 4TZ0A 2AD5A 2JATA 4A82A 3QENA 2QORA 3BGWA 4Q02A 4RKEA 4YDHB 3B5JA 4HUQB 3ZZTA 4DT1A 3AV0B 1OFHA 1QHIA 3K09A 2WMOB 1UKVY 3ICEA 2O8BA 1WE2A 2QENA 2ZE7A 4PPNA 2PCJA 3NTUA 2IEYA 3M1IA 4OK5A 4QHSA 2XOKA 2R6AA 4A0FA 3KQLA 4ARZA 2SHKA 2GEVA 3U7GA 4BECA 4Q7MB 1JXOA 5LBIA 3UG7A 1XXHB 3CRQA 5HTKA 3SI7A 3FYHA 1N6LA 2O8FA 2ECKA 3MWYW 1NN0A 1E94E 2PBRA 2XGJA 2B92A 2AXNA 2C03A 2VP5A 3RWMB 4DEXA 4Q9IA 5JSZA 3PCRB 3AVQA 5JS7A 1WDTA 4GNKA 4XVUA 3A1WA 1UBCA 2ZYUX 2GJSA 2YVUA 4IRUB 1TUIA 4MKGA 1FMJA 1G6HA 1GILA 1XD9A 2WV9A 5FBWB 4WZBE 3VAAA 1MRSA 4A2PA 4PHFA 1Q1BA 2VF7A 1II8A 1Z0JA 1VCNA 1OF1A 3A1TA 2IYUA 5E3HA 2JIZA 5JJIA 1VDZA 4DLUA 2ZJ8A 3FTQA 4BRUA 3QSYA 5EXXA 1JALA 3MAAC 1E69A 2Q9AA 2ZI7A 4OQFA 5G3ZA 5FI0B 2VHQA 1H8HA 1S3GA 1ZC3A 2ZRMA 3FWYA 3R8CA 3WBJA 1RW4A 4XIGS 3QXSA 3L0PA 2GZAA 4GMDA 1DTSA 4DRZA 3ZDQA 3NBZC 5CYPA 1ZVQA 3T12A 3QKSA 1K6MA 2A9KA 3FMFA 1JECA 1J90A 2CCJA 2Q0HA 1I2DA 4ABYA 2C96A 1E9EA 1UADA 2ANBA 1IM2A 2JAQA 4A2WA 1BKDR 3IILA 3EPKA 3EPLA 5FUXA 1AN0A 2JCSA 4HLUC 1WBDA 1YRAA 3BIFA 4FIDA 5TDHA 1OXXK 1WF3A 2FFAA 2IA5A 4Q5IA 2ZSDA 5FI1B 3CRVA 4OHVA 4WA7A 3VNVA 2X19A 1JPNA 1W47A 4OL0A 4BFTA 4G0NA 3K0EA 1KI6B 5EP1A 4KSBA 3RVBA 3MWKA 1E79D 1OHHA 1N6KA 2FSIA 2I1QA 1WB9A 2CL6X 3CRRA 2G1JA 3WP1B 3B2EA 3BORA 3N5CA 3W9YA 1PV4A 1P72A 2C5LA 4KAXA 4PAOA 1Z6XA 1N2CE 3QUSA 5JWRA 1GVNB 2J5XA 3E2IA 2QE7A 1F48A 2VLIA 4C0AC 2GEUA 5J4LA 2C04A 2HF8A 4GRAA 1XP8A 1ZM4A 5SZHB 2PH1A 2V7QD 4C0KA 1Z2AA 3OAAA 2ZR7A 2C77A 3GLFB 5F98A 5FR1A 2F9MA 5DISB 2E87A 1GNPA 4TLDA 3K9NA 2JJ8A 2QGZA 4B48A 4JLPA 1IY0A 3EX7C 2ORWA 4PPGA 5GVSA 1D8TA 2CCKA 2ZJAA 5JWHA 3U7FB 2IS6A 2ZUDA 1E1QA 3H0KA 3NH9A 4TQUS 2OEPA 1OLOA 1PLKA 3OIUA 2WJHA 4PR0A 4QC2A 4WZAE 2DYKA 4NCJA 5LD2C 4TZ6A 4LX0A 4DB2A 2YYZA 1P61B 4H1VA 3FHCB 3SHFA 4LJYA 3RS0A 2Z0MA 1YZLA 1KMHA 1RVDA 1KAOA 4HSEA 4MRNA 4OK3A 5GJVC 2YC4C 4QXAA 3JVVA 2W6JD 3F8TA 3L8ZA 1HY3A 1UM8A 5G41A 4XWAA 2CNWD 2ZJ2A 1W36C 3TH5A 3W90A 4O2LA 3QPUA 2ZEJA 5CLQA 2O0HA 5P21A 1LV7A 3AF4A 4GFDA 4RCYA 1KSFX 1VYVA 2B8TA 5BW8A 2W2XA 1KK0A 1GKIA 2ZSBA 3HPRA 2OXCA 1TU3A 3RYTC 2VHJA 4D81A 4HB0A 2OFOA 4MITA 5AUNB 2VP6A 3I3SR 5UKDA 3W5IA 4DT1B 2DR3A 4NCNA 3ZZ0A 5A5GA 3TRFA 3I72A 1WXQA 3HDTA 1Z0AA 3Q5EA 5FTLA 1ZJ6A 4M1KA 4MRVA 3O8DA 3PITA 4AD8A 4KFRA 1YZNA 2NIPA 3LH5A 1TADA 2H17A 2RGBA 2A5FA 4ZPXA 1ZU4A 5KHOC 4R9UC 4TL7A 5ELXA 2FE4A 2GTPA 3EXAA 3LX8A 3Q8XB 2ZE5A 4JJZA 2Q6TA 5FTJA 3ADDA 1AKYA 1T3HA 3TW4A 5KYKA 1AGPA 2OZEA 1GUAA 1CJVC 1IXSB 1EESA 4DC9A 2G0NA 4YLGA 4D4JA 4NTZA 1SXJE 3U3MA 1DELA 5DE3A 3AF2A 2DB3A 3VR2A 3VHLB 1II8B 3FPAA 1FUUA 2WSMA 2PT7A 4QJ4A 4E07A 3C4JA 3R7WB 3UWOA 4IXMA 4Q9HA 3IEUA 3K0AA 3O8CA 3S1AA 2GXQA 1RRGA 1DOAA 2HYIC 2A5DA 2NOAA 1Z63A 3WMGA 3CO5A 5L8VA 1U0JA 3UANA 4JVLA 4UQOA 3UG6A 4YONB 4PSVA 5BQ5A 2EFCB 2V1UA 4OHZA 4TSFD 3SS8A 5EP4A 3ZLJA 2F1JA 1NJGA 2DFTA 4U5XA 4ZCLA 1KK2A 2CBZA 4MRPA 4ZDJA 3UKDA 2ATVA 3AF3A 4LCBA 4I1VA 3RRZA 3B6EA 4TLCA 3PEWA 4PC3A 4US2R 2PLFA 2QN6A 3FMIA 2WWYA 2F43B 2FF7A 4WVFA 4HAVA 4ZCIA 2JJ1D 3B82A 5FTNA 1ZC4A 4BE7B 3BERA 3MFYA 2C2HA 1XJCA 5TVKA 4ZI3A 3FOZA 3CPHA 1IN4A 4PANA 1KMQA 1XEXB 4I1UA 1H65A 1X8KA 2QTHA 4BZQA 1HQCA 1MV5A 1PJRA 4BWYA 4ZDIA 1ESNA 3NEYA 4IVRA 3UMRA 1DAGA 1ZCBA 3REFA 4B35A 3T5GA 1TAGA 4OHWA 1J8YF 3HYRA 2RHMA 4Q9KA 1LFDB 2PJZA 5FPKA 4QFMA 3K70B 3L0IB 2GA8A 4A9AA 3EZFA 5HPYB 1A2KC 1GOTA 3QI2A 2PEYA 5L3QA 4KLNA 1D2MA 4EQ6B 2IK8A 2O8CB 2QT1A 5IF9A 4BEJA 2HCJB 1OFUX 2X77A 2J7PD 4HZUB 3ONWA 4QBIA 1ESMA 1Q57A 3CRMA 5J4VA 2AKYA 4TT3A 2QNRA 3AGQA 4AC9A 1AJEA 1JJ7A 4JKYA 4TQAA 1R5OA 3AGPA 4HYYA 5AK0A 5FUYA 5HE9A 4EPRA 4LYJA 2REOA 5H70A 3IDQA 1AZSC 3VR5A 2GDJA 4NMMA 2Z43A 4GPTA 4AKEA 4I4LA 1G41A 1XZPA 4QJ3A 2NTYC 1T9HA 3VX3A 3WRXC 2FA9A 1NJFA 2E1RA 1VG1A 1VTKA 2WPDD 4L8GA 2ZR9A 1R4AA 2YWEA 5E95A 1YQTA 2VH5R 2ZJOA 2ZRIA 3G5UA 3NIBA 2ZJBA 1VIAA 2WOJA 4C4PA 3RAPR 2H7VA 3UXMA 2QMHA 3LQRA 5DO9A 2N42A 4ZDKA 1S8FA 2WJIA 1M74A 4GOXA 4MYTA 4DCUA 1Z29A 4JBXA 4BZXA 1EFTA 2NZ8A 5BYKA 3QXHA 4KV9A 4M9QA 5DYGA 3CONA 2QRZA 3BB3A 2DWOA 3ZYCA 4DSTA 2XOKD 3A36A 4Q9JA 2BCJQ 3VNUA 2QM7A 4TYQA 5BN3A 2YV5A 4DLZA 2FX3A 2VP4A 1NSFA 3ZZUA 3PV0A 1DBSA 2JLVA 3B78A 4P3YA 1E9FA 1N5JA 1OW3B 3AF1A 4LRWA 1MABA 4V0NA 2GESA 3AVYA 4Q1CA 2HT1A 3AM1A 1T8TA 4JVSB 1Z0KA 4KO8A 1ZD1A 4LJ6A 5JJLA 2IS4A 1LNZA 1SXJB 4U00A 1G16A 1NY6A 2IX3A 2GCNA 4KU4A 5J47A 4HUTA 5TB5A 1XRJA 1BMFA 3LW8A 5GJCA 5FH9A 1TNDA 2E9SA 2FN4A 3NHAA 4P4TA 2Y8EA 3TKLA 3VFDA 2H1LA 1DO0A 1G3MA 3FKSA 4MKFA 4TMWA 3WHLA 2ZAOA 3G82C 1XTQA 1U81A 1E2FA 3RNLA 4OQLA 2IYLD 2FDCA 3PEUA 2H92A 1J2JA 4NBSA 4RD0A 1ZNWA 3AVVA 1U9IA 1OXVA 2EW1A 2Q9BA 4IVQA 2ZQ5A 4KJZA 4QHYA 4II7A 3TR0A 1J7KA 1EFHA 2FNAA 1UDWA 1XTRA 2BM0A 3T5DA 3CF6R 3HP1A 3TE6A 3VU9B 3GJ7A 1VCOA 5FPSA 1JPJA 1R0WA 1JB1A 1YZKA 2CE7A 4OJKA 2TMKA 1UBFA 4QBFA 1Z3IX 4AYWA 4B3CA 3I4LA 2BBSA 5JWOA 3K0AB 4X8HA 4LC1A 2CCGA 4HAYA 1OKKA 3A58B 5AJZA 5FFMA 4FXPA 4MKIA 4IEIA 5CK4A 1FQJA 1R2QA 1W4AA 2DHRA 3GJ3A 1VYUA 1DARA 1X1SA 2YINC 4F93B 2CLCX 2X1VA 3K0FA 2GVDC 4RZ2A 2BKUA 4GI7A 3RRMA 4Z8YA 4AWXA 1OJLA 5DNYB 2ZVPX 1OHHD 2BM1A 3AP2A 5JBQA 3KKPA 4Q1DA 1F5NA 2ZS8A 4PSAA 1PLJA 3CKLA 1M7BA 5FL7D 3GJ0A 4ZCMA 4URUR 1JXMA 3QIAA 4MUBA 2N1BA 2V6JA 1W4BA 2QE7D 2PZEA 4LBYA 3SJCA 5F9FA 2EWVA 1C4OA 1VIYA 1KKLA 4ESHA 1OFTA 4R2IA 4ZV4A 3QBTA 3RRYA 4MYHA 3GEEA 5GVRA 3ZD6A 4NYIQ 5EXPA 2F1RA 4PXAA 3OAAD 1VCMA 5JCZA 3PUWA 1RIFA 3IGFA 3AP3A 2WAYA 1HE8B 3B7GA 4Q1AA 1EFRA 2IEZA 4E22A 4M1YA 4N1AA 4DKXA 2PX3A 1W0KD 4M9ZA 2HT6A 1UAAA 1KI4A 2GKSA 2ONJA 2XX3A 5KPJA 4TTQA 1BS1A 1I2MA 4URZR 5JZVA 2I3BA 2BV3A 2IYRA 2ZRGA 4LPSA 1EK0A 2QAGA 1NP6A 1E1QD 1SULA 1KZ7B 1G9XA 1FFHA 4BLQA 2CHVA 5DI3B 4LY6A 5AUQA 2AWNA 1XBTA 3EZ6A 4IDHA 2CVFA 3OIWA 3F0TA 1V43A 3PEVA 4TTPA 1Q3TA 1NBMA 4V0OA 2ZROA 3BOSA 1CU1A 2V6IA 2KSQA 4IDOA 1NI3A 4KSCA 3LFUA 1W7AA 1WA5A 2EYUA 2XZPA 4DWJA 1KI9A 5FTKA 3T1TA 2NO1A 2W6IA 4ILEA 5CK5A 1G7RA 4OQXA 4LHWA 1FUKA 3AB3A 2QZ4A 2W2TA 1GL6A 2OV2A 1KJZA 1GIAA 4Z1MA 3RS3A 1RRPA 1E9DA 1N0WA 1C1YA 1NN5A 4W5HA 3KKNA 1PVOA 3QF4A 3V9PA 4GP7A 3BH6A 3AVWA 1SXJD 4EPYA 5FUWA 2Z5FA 2PZFA 3T1OA 2ANCA 3GFPA 1YHNA 2OLKA 2PZGA 4TLBA 3V00A 1N5KA 1X86B 1NBME 4I1OA 4JLMA 1RFLA 3IQWA 1WP9A 4URVR 3AQ4A 1T5IA 2IL1A 4K46A 3X1WA 4RD3A 1GRRA 1ZM7A 2DWQA 1XTKA 3QKTA 5L3SA 4URYR 3DM5A 3W5JA 2C9CA 2ZUCA 3EZ9A 5JJKA 3DMDA 2ONKA 2X2EA 4XVQA 4I81A 3NXSA 5F2EA 3CBQA 4IVPA 1DADA 1QHHA 4MA4A 1WMSA 4OQMA 2ZANA 1F2TA 3SU8A 2ZAMA 4KHZA 1RYHA 4EKDA 5KSYA 4DCSA 3P20A 1E0JA 2MSEB 2XITA 1KK1A 3AVUA 3T61A 3KJHA 2GRJA 3CNLA 4C0LA 1SVLA 3SYLA 4BFSA 1PUJA 3U5ZB 1PZNA 4BLPA 2FGKA 2BMEA 1KSJA 3HU3A 4Q7KA 4C2UA 3TUIC 1G8GA 3K09C 1XWIA 4DCNA 1K5DA 4NZYA 4TMXA 4KFUA 1X8LA 4LOAA 4UNNA 3GJ6A 3Q85A 4MDEA 2ZI9A 3ASZA 1F60A 1COWA 4XWOA 3CB4A 2W0SA 1Z6YA 1OXTA 4XWKA 4RSGA 4UNQA 5JMTA 5H8WA 4HI0E 4NYMQ 1TEVA 3A4MA 2D74A 4BFWA 1S9HA 3KKQA 2WIBA
chains in the Genus database with same CATH superfamily
2FN7A 2I2BA 5F64A 2IT1A 4FFLA 5DHSA 4AMZA 1J5XA 5CFQA 1E4YA 1OWLA 4HNAA 4UU0A 4EYSA 3TQFA 2CEAA 2GPNA 3ILSA 1T4CB 5HILA 3LV8A 4MR9A 2DFKB 2JBHA 3A28A 1E58A 1OCEA 2QM8A 1E92A 4G3XA 1RJ9B 2GBPA 1ZJYA 4YMTA 5T8KC 1UPUA 1LI7A 1JG7A 3Q3CA 4XVRA 3DBLA 5I3CA 4YNBA 4NEGA 5CLIA 2RONA 1L8QA 3R3XA 4MUJA 4IMIB 3BXFA 2C9DA 2H0AA 4DG8A 3EUFA 1B3BA 3LF2A 3O4VA 1D2NA 3O1HB 2O54A 3LYHA 2V59A 2ZSIA 3EXFA 3IJEB 3OCWA 1M5UA 1VBMA 4MVJH 5DGHA 2Y1OA 3QVGA 1KKUA 1DAEA 1O9GA 1I1QB 1UBJS 4RVNA 3VOAA 3DBIA 4UEKA 1SMKA 4UHKA 4NXMB 3WDMA 3K6RA 4LQCA 1UH5A 1P0CA 2R44A 4TT3D 4WT7A 3D4OA 3W05A 5KCZA 3GZJA 1FS5A 3R24A 4JQZA 4XDHA 1VYTA 1E7MA 7REQA 5HGXA 4TYNA 4G84A 2ZUBA 4HWOA 4N5DA 3SP1A 2ES4A 2QT0A 2VIIA 2OBBA 3AFGA 2AE2A 1JIKA 3HTXA 2Y0EA 3C6YA 4MICA 1JEJA 1NXOA 4R1MA 4V0SA 1FFYA 4JYMA 1T1GA 1UZUA 3KT6A 2GJAA 4KAAA 2O7RA 1AY0A 3CPJB 4KFCA 2NUBA 1E0KA 4PYMA 4NKRA 1IVNA 5DLDA 2GN2A 3BGVA 1HZZA 3MGBA 2JFBA 3CZ9A 4D9HA 2Q2VA 3ANYB 2QNIA 1BWRA 3IUNA 3PRYA 1H2YA 2EVWX 3NTLA 2QTWB 1ORHA 4YRFA 3QE9Y 3COWA 3UW1A 2FSFA 1LS6A 2JH3A 2O2ZA 3D3WA 1YZYA 3PPVA 3QMMA 1DG3A 1I4WA 2Q2QA 2ZBRA 2Z5LA 3H5IA 1TKAA 3O47A 4XGQA 3VNQA 2WT9A 1NVFA 2EEPA 4UZSA 4DN6A 2NSJA 1L8AA 1I80A 4Y1RA 1Z7YA 2HSEA 3G85A 5FTMA 2EP8A 4YBRA 2BEVA 3C98A 5EEGA 3SX4A 4AKGA 3WTBA 5SICE 2KI5A 5M5BA 3HB4X 2QS9A 2J8ZA 3TEJA 2JAHA 2NXCA 5MN5A 1DFHA 2VDMB 4NE2A 5BWMA 3SPXA 1CVIA 5J40A 3ZGOA 4QKQA 4ZJZA 2BTEA 1LLDA 4WI1A 4FSXA 3W4JA 1K4MA 2F48A 1U2RA 5K1ZA 4MVYA 1GTJ1 2CV0A 1HA3A 2BCEA 3ILHA 1U9CA 3JQAD 1XQYA 3GJRA 4LY0A 1ZZEA 4ZGBA 3HEAA 1MTZA 4AMYA 3BE5A 1Y8RB 4H4CA 3R5KA 4WKCA 1FNCA 2XUQA 1QORA 3K32A 4W8OA 3T95A 3HCAA 1L5MA 3ILYA 2Z5VA 3NCHA 3P94A 3U4IA 3UJ9A 3W1EA 3H6GA 1NUQA 3QNUA 5EZ5A 5AVJA 1A1VA 1DG1G 1VZ2A 4IUDS 1YDHA 4IS3A 2GHRA 2AI3A 4P7BA 4R0NA 4X65B 3UICA 5CB8A 1G2PA 2W2LD 3EVFA 3D43A 1CRQA 1TX4B 3FCXA 3NHLA 4H08A 1GA4A 4Q4HA 5EN4A 3P2YA 3U3XA 3WGHA 5KKNB 2O2EA 4FU0A 2O48X 3KALA 3ESYA 4GH5A 5B2EA 3WZ2A 3T1NA 2R2GA 4EG5A 3TFQA 4F3YA 3AJEA 3FKSD 1E9VA 5K3FB 4PHGA 2B7CA 2ZRLA 4F2DA 4B76A 2PJRA 1M2OA 3KSDO 1IIBA 1S4QA 1G60A 1XHFA 1ZOPA 2DM6A 3D8RA 3NEJA 4TM8A 5AKYA 3H75A 2W8BB 3DE6X 5LP6B 2FY8A 5KBYA 4LDNA 4P6VF 2VYCA 1A27A 3DDSA 3JQGB 3UJ8A 3QX9A 3BZWA 4PQRA 4I6EA 4F4UA 1LPAB 1USGA 3FVVA 2E0IA 4EYKA 3B7WA 3GR6A 1LDMA 3S68A 3CSSA 2QM3A 1SK8A 4IS2A 4NICA 4ZALA 3JAKB 3P0EA 1AS0A 1CJTC 2IHZA 3B53X 3OIVA 4G6ZA 4IG9A 4CFYA 2IY9A 2GILA 2OXRA 3AH8A 4RYDA 4LWZA 2XSZA 3W06A 2O8EB 5T3YA 2HGZA 3LWDA 4TKLA 2QQEA 5FKJA 2IDKA 1SXJC 3R7FA 4AO7A 3S0JA 5L4SA 2CC2A 5JYBA 4RTSA 3I23A 3QLJA 2BJVA 1WJGA 1JQEA 3CVOA 3EGOA 2JIRA 3ZGNA 4C4ZA 3DDNA 2PX5A 2XGMA 2KS6A 5ALXA 3W0LB 3GCZA 1T9ZA 2VSYA 4OFWA 1U99A 2IYEA 5CNIA 3ROKA 2HQOA 4S1WA 5FWXB 2P78A 1KF0A 1ZO8A 2R8BA 4NU6A 3RTAA 4L6CA 2CJFA 3O8QB 4TXJA 3TBFA 5ECGC 3KB8A 3C2QA 1KMMA 4PZ0A 3KP1A 1D2CA 2EKPA 1XKLA 1LRLA 2R96A 2Z2ZA 1BE0A 1Z0DA 4EF4A 1AUQA 1CZRA 2CXHA 1Y7PA 1QDEA 3NJRA 4EABA 1E4EB 1YBFA 2VH1A 3LNTA 4Q24A 5TLSA 3AUKA 4XJSA 3ZVLA 2VHCA 1JJAA 5FYDA 3EVCA 4FINA 1WUKS 3I04A 2NQ8A 5BSRA 1T8PA 3WRYA 3OSUA 4M9XA 2FQ1A 1X1QA 3TOZA 1R8SA 2EBWA 4Z3KA 4ZI2A 4UDOA 2O0JA 3F5QA 3H1EA 1KRWA 4GOLD 1EG2A 1F8XA 1KDTA 1FYFA 1P2SA 1E1KA 2QXYA 4HP8A 4YLYA 1ZI9A 5KOJA 1JW9B 1NOJA 3CW8X 4NDZA 3O8RA 1IN8A 1EFRD 2ZPTX 1V39A 2QBYA 4CMHA 3PQEA 3KOWA 1FDVA 3V4VB 3I76A 5LSAA 4HLUA 1LF0A 1NG1A 1YQUA 4ZHSA 4YP1A 4LXIA 3UFXB 4E4RA 3RYFB 2N75A 3UJNA 1LCIA 4IOMA 1SUPA 2FRVA 3W79A 4F04A 1JHUA 1ZN8A 1I7PA 3OQIA 5CT6A 1EUDA 1KEWA 2VNJA 5E1DA 1C5KA 2NU7A 3BMXA 3VXKA 4B0OA 3OP4A 4OOFA 4FFMA 4QULA 5DBHX 5IZ4A 1E8MA 1WM1A 2FFRA 2OB2A 3MILA 1P0MA 1IQ0A 2F1OA 2G08A 2NNWB 2O8BB 5LOVF 2YOHA 1Y1LA 1AUVA 4RK5A 2V8OA 2ZSHA 2C4UA 1EP9A 4E7PA 1TKRA 4XX0A 4CQNA 1WY7A 4CIWA 2XWSA 3OJOA 2R48A 1CIJA 3HDGA 3EG5A 1L7MA 2BBTA 2IZZA 1M2JA 3CXRA 1LK0A 4X93A 3PENA 3NVMB 3MTAA 3OO1A 3QMWA 1HC7A 4IWYA 3RKRA 8ADHA 3CEPB 5DVZA 3RWBA 4F0JA 1RPZA 3R3ZA 1XQWA 1ZIPA 4QTYA 4U2DA 3AR3A 3PFBA 1KOLA 2BM8A 1VSBA 3AUSA 1N75A 1XTUA 1GSIA 4KPGA 1TEXA 4DIKA 1GLNA 2HJSA 2JGLA 2O7NA 4MEJA 3TSZA 3Q9SA 5I4KA 1H8EA 1OX5A 3QE4A 2XR1A 3P4YA 4BX3A 2P6PA 1T6YA 3G2IA 5C9ZA 1JYSA 2B5OA 2XT9A 2BRUA 1EJBA 2CB9A 3OTWA 5LZ9A 1FX0A 3QU5A 3A9UA 3GA0A 4HFJA 4J76A 4KNWA 4CIXA 1U7HA 2E4AA 5IT5A 2COEA 4WDQA 3WQRA 4YROA 3TOVA 3WYCA 5IK2D 1SXPA 3WGTA 1H1DA 1IRIA 3BKWA 1T3GA 2QI9C 5EFOA 2JPDA 5LDGA 2NPFA 4CUZA 5CJ2A 2YVLA 3O7WA 4GL2A 2EKBA 3ID6C 1UOPA 4GE3A 4DR3B 1QSGA 4G36A 4KWIA 2D1YA 1P2TA 2HF9A 1A7AA 3F6BX 2ZR8A 3UH0A 3VOBA 3SEQA 2IS1A 5E6UB 3N39C 2ECOA 2YHIB 4AT1A 4DIMA 2AFHE 3F49S 3U44A 3MJCA 1O1YA 4Z1OA 4FGSA 2WZQA 1SZPA 1XZEA 2Q3DA 4G26A 2QJOA 5BN1A 5JCJD 1FVXA 3JSAA 5BWBA 3QKSB 1PJCA 2XKBA 2EERA 4GRDA 4PBSA 5FORA 4LXGA 1NN3A 1N34B 4MCHA 1JIQA 2P9CA 2CUNA 3HDVA 4MRMA 2ORVA 3FFAA 3NWPA 1QU2A 5ES4B 3QZUA 3SC4A 1IZ8A 3QBJA 3FNFA 1OPXA 1AB6A 5KNBH 3MCWA 1TM1E 2MINB 3AR8A 3S8MA 4M8LA 1VPDA 4JLDA 6CHYA 2E55A 1QFMA 2Q99A 3P97A 4HV4A 3TRJA 3AUUA 4JCCA 3FB4A 3PJGA 1M0WA 3HBNA 3IP5A 2Q3EA 2GZ3A 3M70A 3SZOA 1E4VA 1E62A 3O83A 3FY4A 3TE7A 3F2VA 3L0CA 4KGXA 1AIPA 3QVUA 4LOHA 2JRLA 1ZONA 4YB8A 4L4ZA 4ZEXA 4UTPA 1JPVA 3DLHA 3TX2A 4OGGA 4K88A 4IAOA 2JG3A 2Y1FA 3N8DA 5CLHA 1IOZA 1GGFA 1JDSA 3HUDA 4EYOA 4UM8B 4JI7B 3B12A 4MWEA 3HR4A 3N0RA 1Q2UA 4XGRA 4TS9A 5CJPA 5E6SA 3CF0A 3TIIA 3Q7IA 3VM6A 3AFNA 1ABEA 1CUJA 4J8PA 3C8MA 2ZZNA 3OSZA 3G9QA 5KYWB 2PEZA 4U9HS 4OXKA 5B58T 3E48A 2HBYA 2JEOA 4UTRA 2HLNA 2EQAA 2C5HA 3LVRE 3GHHA 4URFA 3TLZA 3U16A 3INNA 1CJUC 1RLOA 4P1ZA 4GXRA 1VLJA 4XOUA 4BPBA 1CERA 2IHYA 4D43A 3ROZA 4XOIA 1WPGA 4IZOA 4BE9A 2RGDA 4CF5A 2AJ8A 1XJ0A 3OCVA 3ZBPA 4N5LA 2FPWA 1KZ4A 2B4QA 2E48A 5HE8A 1RAEA 3A9RA 5HOEA 3U7RA 3OLCX 4MGHA 2ERYA 5K9ZA 1U9YA 1T5BA 2O0MA 4YHBA 3TNYA 4F4JA 4KR3A 5ENZA 3BCRA 1W5TA 4N9QA 2AC4A 2AK3A 3FVRA 3O0DA 4IYJA 3M1YA 3GFQA 3FD8A 3NETA 3BD8A 3K1ZA 3LGXA 3NM6B 3UT6A 1RCTE 2J4DA 4NY1A 4YALA 1QHNA 1JG1A 5A9RA 1Y8ZA 3L8DA 5G4KA 2P6RA 1PW7A 3WY9A 4NZPA 4K9MA 1H2HA 3NATA 1N2OA 5A2QA 3TUJC 1WPXA 3DLPX 4AKTA 4DUPA 1MGPA 2FN3A 1TCAA 3HUTA 5D3MA 1X8XA 1Z38A 4F06A 4A26A 5HFNA 2QBYB 4EGSA 2JDID 3JQFC 4OAQA 2VA8A 4XQGA 2VHVA 2OY0A 3EXG1 4NS4A 5DLEA 3TK1A 3QLUA 3KLBA 3EE6A 4RTQA 1YZUA 4AF7A 4NG5A 2QLFA 4EQZA 1UCFA 1W49A 3OQIB 3WWCA 1EUDB 2GI4A 3INGA 4QUHA 8OHMA 2AX4A 2D3TA 1QXSA 5TY0A 4DSOA 4E5MA 1Q3HA 2NUTB 2VP3A 5A05A 2W5UA 3HBAA 5H0IA 5M34A 2VQFB 3V8QA 1KGDA 3QJYA 1ZEJA 4GLBA 4EJSC 1MO6A 2POCA 1PQYA 1DTWA 1UC9A 3ORRA 3KD3A 5KNDA 2J0EA 1TIKA 3EFOA 4FE4A 4ZRMA 2WZCA 4X44A 5AXCA 1DWOA 1KI7A 2JFXA 1EX6A 1OWOA 2O0LA 3NP9A 4J9VA 4MUEA 2R00C 3CPSA 5JIBA 4KPYA 3SYKA 2HYDA 4RMHA 5G1PA 1NYQA 4AULA 5MDHA 2WYVA 1PP4A 4CTNA 4EF5A 1H8HD 1H3NA 1QQBA 4QLAA 3ZDZB 3MBIA 3KVVA 4GDFA 3KL4A 5FB3A 3ORQA 4TQ9A 5DHPA 2QRUA 6ADHA 5FOUA 4I55A 4TN5A 1IK6A 2VZLA 3D1VA 1ZJ4A 3WMEA 4YMHA 1SUEA 1ITZA 1VPTA 3IQXA 1GTZA 5FBLB 3Q8KA 1YR9A 3IOEA 2P11A 1IBRA 2OM2A 3N86A 3EG9B 4Q39A 2C2XA 3KPVA 3M6AA 4GP6A 2XJ4A 5KOHB 3EIFA 1W88B 1XDBA 1V8BA 1YAJA 3MWEA 1ANKA 3QXGA 1D1QA 4ZANA 5K51A 4E6EA 4PFSA 2QAGC 1RWNA 2OSVA 3FG9A 3K0SA 4QU0A 4CMJA 1FX0B 2BR3A 4DA7A 1TK3A 3ZU2A 2AOUB 1J0XO 2EIHA 2ZAYA 1C0EA 2WU3A 2X9VA 3G1UA 4POAA 5F51A 2HSDA 5ALJA 3ZQKA 3Q2OA 3ZY2A 1DLIA 1G1AA 5G53C 4RK0A 5JTUA 1RKXA 3CM0A 1Z56C 1IEXA 4O3MA 3NI2A 3ROEA 2PV7A 4V03A 1JGTA 3LX4A 1ZDMA 2ST1A 2NSDA 4JP2A 3W6UA 1JHDA 2XTJA 3WLSA 1GTRA 1W9MA 1DVRA 3P96A 1G5PA 2J59A 4KK3A 4YCJA 1G2QA 3M5CA 1W5FA 5DTQA 5HCIA 3QEBZ 5B12A 5M3BA 4J3NA 2X8JA 3NALA 2LUOA 2RCNA 1DRVA 2XTZA 4R2JA 4OLBA 1ONBA 4E4TA 1Y4DE 2Y1GA 4MUGA 5FI3A 1OC2A 1B8VA 1ZI8A 3WYGA 1JR3A 2FSPA 3K3PA 1PV1A 1O54A 1I8TA 4MRMB 3L06A 3D2LA 1RYBA 2CL7X 2KE5A 1BXZA 4HWTA 5LA6B 3U39A 3PUZA 3G8BA 1GFWA 2YX1A 3G8AA 5KSPA 4Z7OB 1H5QA 2XRZA 4O4JA 4FFOA 1Z6TA 2I99A 1AMUA 1N7GA 1PYDA 4I6GA 2CJPA 1R6VA 1T4MA 2ZBQA 2JHCA 4YAUA 3H2KA 1GAJA 2ZOSA 1OXBB 1ZL0A 1VL5A 2XB4A 3GZNA 4JLNA 1G21E 4DJEC 1E2DA 3F8WA 2CV2A 4GS5A 5DP1A 1EFKA 3T0GA 1TYDE 3DVAA 3TBHA 5BXYA 5HUQA 1R37A 3LHKA 3OZUA 3PDUA 4Y2RA 3F5DA 2JGJA 4OMUA 1I14A 3GZ4A 5L3QB 1L1QA 2BMDA 3BVPA 4LRTB 3I2FA 1MQ9A 1MX9A 1WF6A 4I8XA 4QDTA 4YJDA 4RGQA 4ZAWA 2GS9A 2PGLA 3AT1A 4ZA2A 5SZJA 1QIGA 2P8SA 3IDZA 3L2OB 3L40A 1UMBB 1YSCA 1M34A 2QVLA 4RA9A 3SQXA 3O4JA 4P32A 1EFVA 3EF3A 3WLRA 2VUSA 3FWPA 3LD9A 3IRVA 4UE2A 3WRWA 2Z6AA 2QAJA 4AS1A 3T7IA 1MO5A 2FGJA 4FZRA 4FB4A 2G09A 2WU4A 3PUHA 3IO5A 1AO3A 1UOOA 1QVVA 1NG9A 1U2DA 3A32A 5EE5B 4E1AA 2VPQA 3UM9A 4MPDA 5DBGA 3V1NA 1QGDA 5LQKA 3C3MA 2HLPA 2W6MA 3AF5A 5JXGA 4QODA 4A15A 2JLWA 1RAAA 1RLUA 4RF5A 3MBOA 1G42A 1PD0A 2FZ4A 4UEOA 3BGSA 4WNYA 4B47A 1H66A 2HMVA 3GAFA 2A33A 2VSFA 3NGLA 2ACKA 3Q8MA 1N92A 2OMEA 1DNPA 5C46F 2AR9A 4P4GA 1T29A 4BBPA 1ZHFA 2CNKA 1HDYA 2P2LA 3FRJA 1UWVA 1QBKC 2G77B 2YS7A 3DC7A 3E3OA 1NVUQ 1WLYA 4MS4B 4P7KA 4D3ZA 4E1VA 3GA7A 6Q21A 2V9PA 4OHXA 2ZUEA 2OCLA 1FTSA 3DTVA 4UHCA 2QT9A 5J5VA 5G4KB 1PRYA 2PA0A 3F7OA 5B37A 1LU9A 4B3SB 2O2CA 2C7PA 2ISSD 4K8OA 3SEAA 4X7MA 1LTKA 5EHIA 1HT1E 1EFCA 1I4TD 2J41A 4N6GA 2P1RA 3SAJA 3TLJA 1I7QB 3GRKA 1JKIA 2VL7A 2BDEA 3U3KA 1HGXA 2WA1A 4MRRA 3U4MA 3N28A 2GEDA 3AHFA 3NH6A 1JFFB 2PIDA 3IQZA 3Q0IA 3MJEA 1EMDA 1MP0A 3ANTA 3HJGA 3W7AA 4EG6A 1E2KA 2BZGA 5JVDF 1V3TA 2M98A 3I04M 3CVUA 4QOSA 4F4HA 4YRCA 1GJRA 1PD1A 1WU7A 1YE8A 4DXAA 3O74A 2WW8A 4KQ2A 5JXIA 1SGWA 5A03A 4BEVA 4N5IX 5IC4A 2EBUA 1X7DA 2C8LA 4YIHA 2VNKA 1DTWB 3GDOA 3R0IA 5BYAA 4RYLA 1JS1X 4WK2B 4UUQA 4AZVA 5J2TA 5JMOA 1R74A 1WMEA 3GJ8A 3GRYA 3JAMA 4F45A 4E09A 3JAWB 3BWEA 3CCCA 1GGHA 4HOYA 1QRUA 4BLUA 4YP7A 3W9UA 4D4IA 5BVHA 1UM9B 3RU9A 1FDWA 4PRYA 4RKFA 2HRBA 1SVSA 4KBGA 5EKXA 4AIRA 1HH4A 3WKBA 4OYLA 5DNWA 3EMKA 4URWR 5CBKA 4IDQA 2BZ0A 1GL9B 2RSLA 1G5IA 1SBIA 1BXGB 2OVBA 2P9QA 1XDGA 2ZJ3A 3ENNA 4HLDA 2PU7A 1SD2A 4K40A 3P52A 1OFIA 4JUCA 4G0UA 3RC8A 2CY0A 4FHCA 3OIYA 2ZTVA 5K8LA 2MU1A 1ND6A 1M2FA 2G36A 2PX0A 3AKEA 3QE2A 3IL2A 5B64A 3G0OA 3MT9A 2AN3A 5JSFA 4PFJA 3A2KA 1VMEA 3IUQA 1A76A 1PEKE 2DFLA 2HXYA 4IEFB 4XLLA 2JASA 1VJTA 4MR7B 4S1NA 5ALGA 4LXUA 1AGYA 5EIWA 3RAJA 5JD4A 4BAZA 4QWMA 3GUUA 3U7EB 3T1YB 2H5EA 3OT1A 4OJQA 3H87A 1RAGA 3CU5A 4Q66C 5H3LA 4IV0A 2LDXA 3V1TC 3WYNA 2YNMD 4EGJA 4RH1A 3WS7A 3Q3HA 4RVOA 5EAIA 2LCIA 3FHJA 3HEMA 3RYHB 3OPNA 1H5NA 1YI0A 3W4IA 3RANA 4CJXA 4RXTA 221PA 1Q0TA 2BEJA 2J7PA 3WRVA 3WSWA 4EY4A 1IL0A 5K4AA 3VU1A 1SUAA 4IWNA 4FMCB 4FYWA 5B3JC 4L0DA 1A71A 4PLCA 3R3SA 4KE9A 3I5AA 4PNPA 3GVCA 3KR1A 5E3JA 3V6LA 3BICA 4OB8A 4KXWA 4QWWA 4F60A 2Q62A 4O2AF 3WNCA 4B3JA 4OO3A 4QUAA 4IDPA 3VO2A 2K2QB 3CVJA 1Z5VA 3FA2A 1AOXA 3KQYA 3IURA 4W63A 5ILOA 1ZM9A 2HTFA 2VI5A 3A1UA 1ID1A 4O4JB 4B43A 2AI2A 4ISCA 4QARA 4N3BA 1IY2A 1Q0UA 3IOYA 3DLAA 3RAGA 3HO1A 5CCXA 4U9UA 3MGAA 4NESA 1J2YA 1P4JA 3GI1A 4JBIA 3Q4GA 1CUFA 4MR8A 4WFJA 1QVAA 4Y6SA 2Z4RA 1AKEA 3A11A 4ASUA 4CZ2A 5CFPA 4YN3A 4UC0A 4L4UA 4D8TA 2ODQA 5BVGB 4DMHA 3T52A 1MAHA 3WSTA 2Q2WA 2CD9A 4P83A 1I5OA 2RKWA 3DVSX 4E6PA 4HMQA 2FF5A 3QU4A 2A67A 2AZ4A 1Z6AA 1Y5NA 4Q6BA 3JR7A 1HSOA 4WXMA 4X1KA 3KJIA 3ZXUB 2XNJA 3B1FA 3L7NA 3HJCA 1RIIA 1G3IA 1GM5A 2GEFA 1M34B 1D1PA 2JAWA 3BTOA 3NAQA 4GX1A 3ASUA 4P4LA 4RM3A 4TLAA 2BFDB 2QRPA 1Y3CE 2ZDQA 5J1TB 1KSGA 3TM5A 4YXWD 4YRJA 4EW3A 1TM3E 4F6LA 4B6FA 3QFSA 3OFSA 1A8SA 4X5OA 3FNBA 4Y8VA 4DMCA 2FX5A 4RUKA 1V71A 5ALEA 4Z4QA 2D3WA 3JZFA 1W85A 1V5EA 1UKEA 1ZGJA 1YE3A 2OAP1 3KR9A 4JQCA 1QFJA 4L57A 3V4SA 5LKAA 4IRXA 4OJTA 5FQNA 5A5DA 2V5AA 3LBAA 3QITA 5JHHB 5ESXA 1E3QA 3SDSA 1CXZA 5B1YA 3FFBA 5TMPA 3EXEA 1J49A 2VUIB 2HJHA 2RK4A 3OU2A 1IBMB 1D2RA 4E0BA 1KU6A 4EJ2A 1ENPA 5TPWA 1ACMA 2O3RA 4YJ3A 5AHKA 4MVJG 1EGAA 1TJ5A 2Y1DA 3R7WA 4Q1EA 5C7LO 1NUPA 2R7KA 4OXQA 3Q7RA 3QF4B 3OQJA 1B74A 3G6KA 4PHTA 3ZBUA 3T3HA 4C0SA 4OP1A 5B57C 1DO8A 5CLLA 4O2BA 3V1YA 4GLOA 2VBGA 1RWVA 5IXJA 5AM1A 5ERYA 3OFND 5H02A 5DX0A 4C7JA 1FFXB 4RENA 2EKDA 2FG7C 2ZIAA 5BMVF 3IB3A 4A1FA 1Y3BE 4KGDA 1E2GA 1GG5A 2VR1A 5EL0A 1P7YA 3WGUA 1DFIA 1BGWA 4X94A 2Z8ZA 3PZRA 1QHYA 1N5MA 2WTBA 3FLAA 4RHXA 1D2EA 1NMXA 2B34A 2F43A 4RF3A 5LU8A 3PJRA 1R6TA 2JCVA 3L7YA 5C51B 1XTTA 2FWAA 2W58A 1EUCA 2GK7A 3U4DA 1RI2A 4MWDA 1TA9A 1XEXA 2COKA 2H07A 3L4KA 1X3LA 2ONZA 2XHEA 4I36A 3JPYA 2IITA 3LK7A 1DKNA 3O4HA 3QLVC 3FKJA 1SCKA 4YAWA 3ZCXA 4DM3A 4BN0A 2OFWA 4ZI7B 3SZRA 1XCLA 2G04A 3G02A 4CMKA 1R0CA 2AWOA 1OVMA 2GYYA 2GJ4A 3IEIA 4IHKA 1ENYA 1WOMA 1B93A 4L7VA 1BVYF 2XCIA 1J0DA 3K0KA 1H1LB 3Q2KA 4KMSA 4Q4CA 4A0HA 1L4EA 3D7SA 4XD7D 4KVGA 1VJRA 1UMKA 3G2PA 4ZMBA 3P9YA 1IBKB 1VLQA 4DSAA 1U8FO 4NJOA 4TRJA 4MB0A 4BO0A 4UJ3A 5BSGA 1IJEA 2ILTA 5CW2A 4M21A 3VTZA 3WTCA 4PZLA 3LRXA 1DX6A 1XLTA 5FL7A 2Q1UA 5HBRA 5KTOA 3WLPA 2I1VB 3MCVA 5I7VA 1EGQA 3E03A 4WZAA 4ZAVA 5HIJA 1CJMA 4DUYB 1UP6A 1ZSNA 3MFQA 1IHYA 2BJWA 3AQIA 5ICFA 4JI3B 4E32A 4REMA 1MUUA 3UPTA 2RG1A 4KP7A 3O90A 3VKUA 3W34A 3HI6A 4KRXA 1EGMB 2FH5B 3B1JA 2AGVA 1GG8A 1FFWA 2ATXA 2Y9PB 2YH2A 3GP3A 4H59A 2XWQA 2X42A 4IR7A 4EVQA 4G8DA 5T3UA 4IOLA 3NM4A 5D01A 1TVCA 1T5SA 3USZA 4J0EA 3LUDA 3GVPA 1SCBA 1QO7A 1O94D 1PQ4A 2VBFA 3LRPA 3O03A 4HQKA 3WGOA 2IXDA 1NHGA 1SUBA 1CDEA 4MS1A 3VKHA 3EN0A 3K94A 1X92A 2BKAA 2P41A 4MQFA 4HZIA 1H69A 3P0IA 1IG0A 2R47A 4C2BA 4DQDA 3BEOA 3QUAA 2WTAA 4O4HA 3WK5A 3KWLA 3QUBA 1Q5PA 4PC6A 1AMOA 4BGVA 2AQ8A 5H1YA 2AB0A 1E1RD 3I1YA 3NS7A 5CA0F 2I66A 1LWNA 5BT9A 3DTNA 1EA5A 3O8OB 2R6R1 5KTSA 1CDOA 3MWLA 1A8QA 2F3SA 1P1KA 3A3PA 2F2TA 3PWSA 2I6QA 4QEZA 5I9MA 5IJ9B 5HA5A 4GMHA 2P6NA 3LAWA 2BR4A 1E2LA 5LJIA 3BAZA 3KJNA 2IRWA 2ZULA 4AXXA 1XU4A 1DRWA 3K1AB 3N3AC 4FCWA 4S24A 1QE5A 4M6WA 3O2QB 1UXHA 1Z7WA 4NAUA 4BMPB 4J2TA 3UK1A 4CG1A 1AKTA 1I4LD 2IOFK 3DR5A 3E84A 4Q05A 2Q45A 5IJZA 4QPPA 4IV5A 2FSUA 4KR2A 3GLGA 3GGJA 1QG2A 4LBZA 1XG5A 4S35A 4WRRA 5U1PA 2Z1DA 3U7HB 4HTAA 2EP7A 2H4JA 1WZCA 4QECA 3I9OA 1MAWA 3KHUA 3PGJA 4WKOA 4X63A 2WT4A 3TTTA 4BTLA 1EH5A 5IZCC 2NU8A 4DZZA 2ZWMA 1AK2A 1BWQA 1DC5A 4FFRA 5IC6A 3VKWA 3OZCA 3LLVA 1VCIA 2XZLA 3KQWA 5H80A 2JJ2D 1NTRA 3CNNA 4X3OA 3TAHA 2HSWA 2RIPA 4YMSA 4BNGA 4TQGA 3ABZA 3I2IA 1I32A 1E61A 1IHDA 3EEIA 4HJXA 1XHLA 5C2JB 3ND9A 1YVRA 2E4WA 5DM0A 3TQTA 1JTFA 1EP1B 2V0CA 2G70A 3X2FA 4KFSA 2ZWIA 1KK3A 1HFJA 4I9UA 3UJDA 6ABPA 3RAEC 2ONYA 3BRCA 1NJ1A 2G9NA 2R7MA 3MWDA 1PJ4A 2WVJA 2WAXA 1ZKMA 3L05A 5KB3A 4ZVPA 2CEKA 5K0GA 1ZAKA 1XZGA 5LQAA 1N6OA 5HIIA 2ZSUA 3OX3A 4W7HA 3RW9A 1MRNA 4AWBA 4H16A 5TV2A 1B1AA 1E6EA 2XNDD 5AK6A 5LMZA 2QD2A 1UAGA 1K06A 5BV2P 3PTLA 1UFQA 1RTTA 1EP3B 4NG4A 4ITVA 4Q3LA 5TPWB 2YJ5A 3FZQA 5K2OA 3W4KA 3RVKA 2ID8A 5A62A 3BXGA 4FC6A 3C3AA 4D97A 1W19A 2AYXA 2BP7A 2J9GA 2VQDA 3F9CA 3QIVA 4UM5A 1GZ4A 4W5WA 4ZVSA 2Q7OE 3FNHA 1GGJA 1RMQA 4GEGA 3SR0A 2VYFA 1P81A 2W6QA 3ZWNA 2F90A 3R9IA 4BDTA 5A0FA 5DM60 2RHCA 1LJLA 3OE4A 4YCLA 2YOGA 4W7IA 5GONB 4WE3A 4R1UA 4KVAA 3WQBA 1JIXA 4G0ZA 1NURA 2EJTA 1Q12A 3MJRA 1AHPA 5LP1A 1PL8A 1VE6A 1KPHA 4FGJA 1SU8A 4XEUA 3GP8A 2DTEA 2QXTA 2NU6B 3G8YA 5CYFA 5EWJA 4RDXA 2GBGA 3FPEA 3BHNA 5GP1A 4BCCA 2WIAA 3DH0A 1F0YA 4QNRA 4WLEA 3ORFA 5HUHA 5A0TA 1V8ZA 3DL2A 4CR8A 1SU6A 1WMBA 4CLXA 8AT1A 1Z12A 4FKMA 3ORHA 1CG6A 1GTG1 4FLMA 1G7TA 1TTPB 1KAGA 3AFIA 3K9WA 1M0TA 5CFOA 3ZZ1A 2Y4NA 2HF7A 4LJRA 3A9TA 4XRRA 1WDWB 4QGHA 3WL5A 2GPWA 4ZTUB 2JGDB 1T4DA 3QW2A 3EUEA 3FAZA 2F9LA 3NOXA 3HWRA 4D98A 2YBDA 2H65A 1JDPA 1U98A 5B3AA 4M22A 4ZT5A 4C29A 1PNTA 3HXOA 2SKDA 3QOXA 1P4AA 1PJSA 1T9KA 2NSHA 2A3RA 1GV1A 1CUXA 2V9ZA 3DOEA 3FYUA 3KXDA 3I2HA 4LDRA 4UTXA 1FB5A 1QF7A 2NO9A 3D5EA 4RWZA 5AKLA 1T25A 1DAKA 1N3BA 2OD9A 5IM4F 2DMRA 5DI3A 3GAMA 2HEGA 4B4WA 4YV0A 3H5WA 3PNPA 2W83A 2C5FA 3LWNA 2F00A 4H6PA 4QNNA 1QHSA 3E5RA 3S70A 4B8ZA 5K0TA 1E3IA 2MMGA 3VSAA 4HTFA 3Q3GE 1Z68A 4P81A 2H7XA 1G7SA 3QI7A 1JFRA 1RE1A 3QU7A 2IF2A 3FUXA 3RHZA 3KLOA 4TTAA 3BMOB 1Y3IA 1JMVA 1FU7A 1RI1A 1ULBA 5LQDA 1E3LA 3SZ3A 2OSBA 1MXFA 2QSYA 4FBGA 4FWTA 3C87A 4HLQB 2B1QA 2GHQA 2QVBA 4MS1B 4D9KA 3DHEA 3G59A 1ZBQA 2UVQA 3NVKI 1U0EA 2VPZA 4MQFB 3F73A 1K7XB 1A95A 2VPXA 2JHFA 2WYOA 4FJ1A 2V4UA 1YIOA 2FLVA 1L8OA 1RXVA 3KT3A 3U31A 3UXHA 5IAOA 3DP9A 2DT5A 4EIWA 1WUJS 1AXEA 2JF0A 2Y0BA 5EERA 5F3WB 4M9SA 5DH9A 2X8AA 2V3CC 1NJ6A 2GT1A 2ZXEA 3QMPA 1Z6ZA 3R0XA 1KEUA 4MUYA 1YJAA 2M6RA 2IYVA 2I7XA 4LHSA 5CBPA 3OKPA 4HDKA 3N2ZB 2YUIA 4UU8A 3WGNA 1SB8A 4ZKDA 2H1CA 3C3CA 4Y7DA 2RHGB 3VDRA 2GVNA 4QU8A 4ER3A 5EJ5A 4UPDA 2WFAA 4Q21A 2HW8A 4J2OA 3KXKA 2UXBB 1XPJA 3W3AA 4PGFA 1QHEA 1WU8A 2PS1A 1GQ2A 2PTHA 3AHEA 2ZU6A 4UHJA 2FWNA 2GD1O 1SRRA 2R1TA 4ZZ3A 2UZAA 2FPSA 4DA8A 3OOJA 2O8NA 2ZT5A 4H27A 3MSXA 3DBHA 1D9ZA 5DYNA 3GLGB 1TIBA 2H52A 3G7NA 3ZE9A 5IWCA 2CHGA 5JSHA 4R7ZA 1BH2A 1C7IA 1X7HA 4U7GA 1A9XB 4PLTA 4AG5A 1WUYA 2FPIA 1CZUA 3CLRC 4OKSA 3SYRA 5FIUA 4M9CA 5CXSA 4U7DA 2WD7B 3I1JA 2QN8A 1SC4A 1T9GS 5DLPA 3S2ZA 4F96A 4CG2A 1TO2E 3M4ZA 5IH3A 1MQAA 3ZKWA 2PUTA 2MDTA 3WRXA 1R0LA 4QGAA 3LPCA 2NU9B 2BGGA 1GYQA 1JQ5A 4IUCS 2VWGA 3TVYA 2DBQA 5KJFA 5KNCH 4B09A 1LH0A 4UJ5A 3A1SA 3UO8B 3FPBA 3HJUA 3IP9A 2W6PA 1ULTA 1B0PA 3WJ7A 4AZSA 5I8WA 1AV6A 1DQRA 1T8RA 1P9NA 2YYYA 3H5NA 2J3MA 1OXUA 2GSDA 2YN0A 121PA 3UGTA 4Z9BA 5LD2B 2J46A 4ZMRA 1EK5A 2CLDX 2WKQA 4HNVA 2CF5A 4A6PA 1ODLA 2HDHA 1CZHA 4DDTA 3HDJA 5AVZA 5TR9A 1Z4LA 3CE9A 1DDGA 4WL0A 4I99A 3IAS1 4C7BA 1EVYA 4C3VA 4JNKA 3MTIA 1RBQA 1VIVA 1OZFA 2IYXA 1M6NA 4FEGA 1CJBA 2R2AA 3EZLA 4H2DA 1LQ2A 1OXSC 2RG7A 3I6MA 4LI0A 1GZUA 1U6KA 1YI1A 4WBSA 5DGTA 4JJEA 3U7GA 1THZA 5EP2A 4A6XA 3L7BA 4LXYA 1P8AA 4MUXA 4QDOA 1Z22A 1E7RA 1LJ8A 5E8JA 2ODBA 3AKZA 3VR4D 1E2HA 1Z5WA 3C45A 2VQ3A 4YT8A 5JEEA 3ZGVA 1GZ7A 1IUKA 1OU4A 2WWXA 3PFNA 3TB4A 1JI0A 4B3BA 1PWZA 3K70D 2ZIUB 4U2CA 1ICIA 2C4WA 1SD1A 2B7BA 3BWCA 3D2BA 1SKUA 3EC1A 3I30X 1DAPA 3I6YA 3D4BA 5JDIA 2JD1A 2O14A 2P40A 3T9BA 8MHTA 4C6SA 2O3UA 1OQAA 3IUYA 5I4BA 4RZUA 2HMUA 5CJJA 5C34B 2EDCA 1Y8QB 2IP4A 2WICA 4IX1A 5ALUA 4Q1BA 4NBLA 4GMGA 4DLLA 1SHJA 1CR4A 3MCUA 2QIOA 2X0RA 3C8DA 4LJ4A 3IIMA 1RLMA 2HPVA 5LYJA 1EBBA 1O9HA 1S3FA 1YB6A 3SHTA