3AKYA

Stability, activity and structure of adenylate kinase mutants
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability, activity and structure of adenylate kinase mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Adenylate kinase
molecule keywords ADENYLATE KINASE
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akyA00
5L3VA 1QHNA 3GJ0A 5E4FA 4RD0A 1P5ZB 1II8A 3AP1A 1HV8A 4ZCMA 5AUNB 2JATA 2QA5A 4RD1A 4NPHA 4RKFA 4UJ5A 4C2UA 2QENA 2JIZA 1LVGA 4B2IA 2LKCA 1XEXA 2BBOA 4WA7A 4D26A 4BUJA 3DL0A 4XVQA 2JLZA 1Q1QA 3B7GA 1XJ0A 2FA9A 2Q9AA 4A15A 4A0HA 3FOZA 1Z47A 3QKTA 3LW7A 4DCNA 2RB4A 1E2FA 5SZIA 2KWIA 4BFTA 4OBEA 2CK3D 2IHYA 1AS3A 3NIBA 2FMXA 2KBFA 3I73A 4NKRA 1RFLA 5CJPA 2D7CA 1XU4A 3AKEA 2ZQ5A 3W6NA 2WSSD 1X1RA 4NH0A 1G8PA 1EX7A 1D9ZA 1EWRA 3QUSA 1BIFA 4PZYA 4WW0A 4TL7A 1WB9A 2ZRHA 1RYFA 3GJ4A 1XJQA 4YMWA 2V6JA 2WKQA 1OXVA 2FSIA 4BZQA 2A5YB 2PZGA 5HTKA 4YMVA 3Q3JB 4RD3A 1Z3IX 3EZ9A 2A78A 3KFXA 1M8PA 2ERYA 2IS4A 5L8VA 4EPTA 1NBMA 2J0UB 3RSLA 3ZVMA 3AVOA 2ZSEA 1CULC 1AKYA 4TMKA 2PZFA 1XZPA 2H7VA 4G01B 3FHOA 4C7OA 3IEUA 5G3YA 2G1JA 2F3TA 2O8FB 1NJFA 1YZTA 3ADCA 3BFVA 3I4LA 1D8TA 1DOAA 1FX0B 2CCJA 4BE7B 2O8CB 2Q6TA 2QSYA 3BAFA 4PC2A 2ZSDA 3HU1A 3AB3A 3PUWA 1Z0JA 4TMVA 2XNSA 4GBMA 3VU9A 4QM7A 4C4PA 1X1SA 2QM8A 3A36A 2FPLA 3AKCA 2E9SA 3NXSA 1NP6A 3QF7A 1F5NA 1A82A 4Q19A 1ETUA 3C16C 3B1YA 5DE3A 5TDHA 3TRFA 3LWNA 2H92A 4BLRA 4RFSA 4WOPA 1OH5A 3GLFA 2QROA 1TUIA 2MMCA 2QRNA 4Q7LA 2Z6VA 2ZSFA 5J47A 3GJXC 1OSNA 3L8YA 4G5OA 3ZQJA 3SQXA 2GDJA 4QFMA 3DDCA 1MO5A 2WWHA 4U02A 1YR6A 4IHQA 1FQKA 2H8KA 3ADKA 4AD8A 2ZVQX 2IWRA 5A5GA 2ZJZA 4Q7JB 2NMVA 5GJVC 3V00A 4PSAA 2VA8A 3UPUA 1DG1G 1YRAA 2OFOA 3LBHA 2DHRA 4DKXA 5HPYB 4JVLA 4MRSA 4NBSA 4EAQA 2Z4RA 4EPXA 3T34A 1J2JA 1RVDA 1SXJE 4QGFA 4BEJA 1XF9A 4DLTA 1XMSA 2NPIA 2DFLA 3C41J 3CKLA 1JB1A 2UVQA 3FHCB 4LJAA 4BLTA 3K0CC 3L43A 521PA 4Q1FA 2FSFA 2Q0HA 4GRAA 4IDNA 3WRXC 3VX4A 4PC6A 1AK2A 2E87A 3KKQA 4OQMA 2JLSA 5EE1A 1E6CA 5L3QA 2C99A 2AHOA 3C5CA 3NG1A 3AP3A 1T91A 3ZZ0A 2IYUA 4OQNA 4BZXA 2WJJA 2XITA 3RRNA 3AVTA 4B3GA 1E4YA 2IYSA 3EC1A 1MT0A 2C04A 3VHLB 1T3SA 1CR4A 3WP0A 1T5IA 2ZAMA 3VFDA 4AKGA 1GITA 1P4SA 4JLNA 1KI6A 4ACAA 2VPPA 1PUJA 2A5DA 1JNYA 4L5BA 4FMBB 3F8TA 3MMPA 1SVSA 4A82A 4BGDA 2NQ2C 2WM9B 3QOFA 2IEZA 4I81A 1R8SA 4ZI2A 3BD9A 1IAQA 2RMKA 3U61B 1HTWA 3REGA 2WAXA 1A1VA 2YYZA 4TYPA 2GJAA 4DDVA 5JS7A 1OV4A 3EX7C 2ZJ8A 4Q1BA 2G9NA 3HR8A 4US1R 1ZMXA 4DB2A 4JL6A 3GJ5A 1XMIA 2AKAB 1FQJA 2EW1A 3Q8XB 4YMSA 1WXQA 1W0JA 4O2LA 3X2SA 2GCNA 2YINC 3QXJA 3FMOB 4LX0A 1HE1C 4PPNA 3ND8A 4BEBA 1FNMA 3A8TA 3FTQA 3SN6A 2GAOA 3ZD6A 4HI0E 4DSTA 2JLWA 1N6HA 2IHBA 1UAAA 3P4YA 2CEAA 3AF3A 1UM8A 3HDTA 3R9XA 1JR3A 2VP5A 5JEEA 4HATA 4BWYA 2JLQA 3RNLA 3K0AB 4I4LA 1XEWX 2XAUA 4QOSA 3GLGA 5JS8A 3OEED 5E7MA 2N46A 2JDIA 3SR0A 1G21E 2HJGA 3OIUA 4KHZA 4LCBA 4PXAA 1ZU4A 4GOKA 1DG3A 3KL4A 4KLNA 221PA 1X8LA 4H9GA 4URYR 2CE2X 4IXMA 3WP1B 3WHKA 1GKIA 1K5GA 1QRAA 1E32A 3BBPA 4F4CA 2C95A 3LDAA 4MQBA 3MWYW 1CXZA 2ZJ5A 1Q1BA 1MO6A 1QG4A 2DFKB 2NPFA 1VG0B 1NVUQ 1XDBA 2PMKA 5KYKA 1X86B 4V0ME 1G7RA 2J59A 3KTAA 1SXJA 1I4DD 4HLDA 2IA5A 2OZEA 1W5TA 4H1UA 5BXQC 2UZ3A 3GPLA 1NMZA 4GZLA 1OW3B 4JJZA 1UKEA 3NH9A 1E0JA 3J81k 3FMFA 1T3LA 1YE8A 4PANA 5JLJA 2FU5C 1XD9A 2ZSAA 4QJ5A 2CHVA 2CHQA 4E22A 2Z83A 1U8ZA 2X8AA 4IW3B 3DKPA 3L0PA 2FE4A 2J41A 4E5UA 4POAA 5JJIA 4KJZA 5LPNA 4KSBA 4DXAA 4EFLA 1H8EA 3OFNA 1ZNYA 2I1QA 1L7VC 1TF7A 4JBXA 4IOMA 1E1RD 4PO9A 3LX8A 4DDUA 1TADA 1VCNA 1N0UA 2D2FA 4DIEA 1H8HA 5FUWA 3I5XA 2QTHA 2Z43A 2ZI4A 1G17A 1W0KD 5DH9A 2V7QD 1CS4C 3SDZA 1P73A 2J7PA 3W9YA 3IILA 2PJRA 3QXXA 4JLKA 3RHFA 4HYYA 1DAHA 3VQTA 2ZANA 1D2MA 5CB8A 4TLAA 4P4UA 2DFTA 4YXWD 5FL7D 1N5JA 1XXHB 1EGAA 1P72A 1KSFX 1DEKA 2BWJA 2XOKD 1FZQA 5DN6A 4BLPA 4TLBA 3PG5A 4RKEA 4LGMA 4MRRA 4KFRA 1SZPA 4MGZR 4TLCA 3FVQA 3SHFA 1NVXQ 2R6AA 1JAHA 2ZR7A 3IGFA 4DDTA 2ZVPX 4KXFB 2OXRA 4FCTA 3B85A 5EP4A 1MO4A 5LD2B 3O8BA 3D7MA 3N5CA 3FFAA 1M74A 2ODWA 2C03A 1Z28A 4E03A 4D2IA 3QI2A 4IXNA 1SVOA 2QI9C 1EXMA 3FKQA 4JLVA 1OT3A 2VTKA 4BFVA 1ZCBA 3LQRA 1RKBA 2WSSA 3RVBA 1XCMA 2R6GA 2VLIA 2DYKA 1X8JA 3H2YA 1OB5A 1VTKA 1XTIA 3SBEA 3TE6A 2ZS9A 2WJGA 1NSTA 3RS4A 4B32A 1BH2A 2B7BA 3NC0C 3FGNA 2H5EA 2F6RA 1QHYA 3SBDA 4BFSA 4JJKA 2CVHA 2YKGA 3IHWA 4MYHA 2IS2A 5BYKA 3S1AA 4R71A 1ZUNB 4XVUA 4LK2A 3PEWA 1TEXA 1F2TA 4IOLA 4UJ3A 4MGYR 4FWIB 2ZE6A 1G9XA 2HUPA 2WZQA 2IYXA 2AK3A 4HLUA 3THWB 1X3SA 1Z2AA 2OEPA 2XNDA 3I92A 2GNOA 5F9HA 3GJ3A 2QRZA 3GLFE 2CMKA 3BFXA 4PTLA 3BB4A 5KTYA 2XNDD 1MO3A 3LV8A 3P1JA 3ZQ6A 3BRWD 2JCSA 2DWPA 1IJEA 1KKLA 5FPHA 4D0GA 4HSEA 4MDFA 2ZJAA 1HA3A 1ZM2A 1OH6A 3EXAA 1NI3A 3ZYCA 2EWVA 3U7FB 5F9FA 2AWOA 4G5QA 3RABA 2O8BB 3MSXA 5LB4A 4TTRA 4PX9A 4EKDA 1G291 1G8HA 4U7DA 4OHYA 2PZEA 5EP1A 1U90A 2CVFA 2ZIAA 3PUXA 4A2PA 3OE7A 4G5GA 4LJYA 4ZCLA 3T1OA 5EQTA 4JIMA 3QENA 1Z29A 2O8DA 4URVR 3PUYA 3O8RA 1IN6A 4LV5B 1KI6B 3AVVA 2NO7A 4KI0A 4FCWA 3VKHA 1HYQA 4O0MA 4DT1B 1RC8A 2EWWA 1I4TD 1U99A 4KYIB 3SS8A 5FBVB 2PCLA 2BEKA 3HP1A 2ZJYA 3UANA 2ERXA 3ICQB 4NE2A 5TMPA 2C9OA 1US8B 4JVNA 1Z0IA 3MJRA 3P26A 3QXHA 1HE8B 1ONBA 2C9CA 1FTNA 2FN4A 1Z6AA 2QORA 1KJWA 4M1OA 1XEWY 2GBLC 3CUEF 2R6CA 2GEUA 1YJ5A 4GFDA 4TZ6A 1TEVA 1P9NA 2DY1A 2C8VA 3OZXA 3DO6A 4OHXA 3R9WA 3LVQE 4Q1DA 3RLFA 4TZ0A 3THWA 2ZI7A 1ZW6A 3UMSA 3BIFA 1XNJA 1E0KA 3KB2A 1Z08A 4D6PA 4HEJA 4URZR 5K8UA 1KKMA 3U4QB 4X8HA 1L2TA 3TBKA 4CEIB 1GAJA 3SZRA 1R2QA 5DYGA 1EG7A 2I4IA 4O3MA 2QP9X 4A8JC 2V7QA 1G7SA 4W5WA 1J8MF 5EJEA 4LWZA 2P6UA 2IBMA 2J3EA 2HYDA 2Z5FA 2ZRBA 3A1WA 3CNNA 4Q4LA 1TQ6A 3ASYA 3PITA 2FPKA 4ARZB 1C9KA 1Z06A 2DCUA 4F4IA 2OCYC 2CNWA 2W2XA 3R7WA 3MWJA 1P60A 2O8EB 3SNHA 4BFZA 1IN7A 4R7ZA 1C4OA 5ANRB 4CZ2A 1U8AA 4FMCF 3M6AA 3AF2A 1W49A 3ZVLA 5K8TA 4JLMA 3K0FA 3CZQA 4LJ5A 4QC2A 1OFUX 1RE0A 1A5TA 3CONA 2V54A 1KO7A 5JBQA 4HZUA 3HYTA 5FPYA 4LV8B 3VKWA 1P75A 1SXJB 2IEYA 3DM5A 4N0DA 5FUYA 2VHQA 3RRMA 3W8NA 1NG9A 1U0HC 4PHGA 1E1QD 1XTRA 3QBVA 5AJYA 2OBMA 2GCOB 3F5FA 3OEHD 4D0NA 1XD2A 2XJ9A 2QN6A 2WWGA 5DISB 5AR1A 2YOFA 5JHHB 3QY0A 2CCKA 4NYMR 4ZDKA 1P9WA 4PQFA 3RC8A 1P2UA 2QEQA 1G8YA 4BFYA 4JBYA 5A4JA 2YVUA 1NN1A 2WKRA 1H65A 1ZP6A 2QAGA 4P32A 4MITA 3CZPA 5CLLA 4A0GA 1JPJA 1GL7A 2VYFA 3GLHB 3CX6A 1NKTA 2FX3A 2J5XA 5SZKB 1ZBDA 1WQ1R 1R5OA 2GJSA 2AR7A 1J8YF 4PZZA 5CB6A 2ZI6A 3KQHA 1NY6A 2C96A 2FF7A 3LBNA 1L4YA 1P61B 1N0WA 1AZSC 2QQ0A 1NIJA 2VP0A 1BMFD 2OLJA 2WBLC 3X1XA 1AS0A 3RSOA 5DGXA 4B73A 4W9MC 2NO9A 1WBDA 1E4VA 4V0LA 2PCJA 1BMFA 1UKYA 2ZR9A 2W6ID 4L8GA 3TAHA 4EFMA 1KI8A 2XZLA 5JRJA 1Z0AA 1C1YA 1W0JD 4PC1A 3GCGA 1EFCA 2CJWB 3NVAA 3KQUA 5BYJA 1XEXB 3ZVRA 3TVDA 2QT0A 2AFIE 5DNYB 3F0TA 2VH5R 4JS0A 3AVYA 4DLUA 5EE0A 2OUKA 2F1HA 2W0MA 3RS3A 2IXGA 3I8SA 2W2TA 3VR5A 1G3MA 2DFNA 3KQLA 5P21A 2EFGA 1E98A 1R10A 4V0NA 5EUMA 721PA 3U3MA 4UXIA 1GDDA 5JJKA 3IO5A 2P2LA 1F2TB 3I62A 4KYUA 3TW8B 2YZ2A 4QGHA 3H4MA 4IOKA 3CNOA 4PPFA 4NP6A 3EIHA 2AKYA 5EZ6B 5KPJA 4OHWA 1EFTA 1IXSB 4G5SA 1NL3A 2VBCA 2ZE7A 2QMEA 4FINA 4ZO4A 3BH7A 4JKYA 1W5SA 4CYMA 4A8JA 3B9QA 1MOZA 1QVAA 4JT2A 4TSFA 2NZ8A 4UXHA 5L3SB 1QF9A 3JVVA 2PLFA 3SYKA 5AWFC 1ZYUA 2LCFA 1WE2A 4RD4A 1QG2A 4V02A 4HLQB 1RRGA 2NIPA 3CF2A 5FTMA 2CCGA 2RCNA 2O8BA 4C0SA 3THYB 5LBIA 2FSHA 4MDEA 2DPXA 1J70A 2J0UA 1Z83A 1IXZA 2FZLA 3D3QA 4IDOA 2XZOA 3OAAA 3QVVA 2A3RA 4R2HA 1SKYE 2ZU0C 2IX3A 1PLJA 2JA1A 3R8CA 3AUXA 3WYGA 2HF8A 4JLPA 2XGJA 1VG9B 4O25A 2PMDA 2ZAOA 1XCPA 3FMIA 1E9BA 4MKHA 4UNRA 5AK0A 3TVTA 3U7HB 3FMPB 2H17A 1RRFA 2A5JA 3I72A 3K70B 1ANKA 2W83A 5B57C 1M6NA 1NSFA 3TAUA 2MSEB 4JL5A 3B1ZA 4AURA 4M22A 3QKRB 5TB5A 4Q21A 3SJZA 2ZUCA 5DO9A 2YOGA 2RAPA 1QHSA 4WBSA 2EFHB 2Q9BA 2IYVA 3K0CA 3EWSA 4TYQA 5EXTA 1SVKA 2NO0A 5CYPA 4DUGA 2BOVA 1XCGB 3I8XA 2MMGA 2G1KA 3K9GA 3GEHA 3SJCA 1R0YA 1DAMA 2G77B 5AUQA 2W00A 2QL6A 1T6NA 2L0XA 1U9IA 4P31A 3RRYA 3ZZUA 4EIWA 3T1QA 2EFDB 4C0HA 3LFUA 1U2RA 1AIPA 2QTFA 1GRQA 4NCHA 5EXSA 3TR5A 5CITA 2GTPA 3LA6A 1KNQA 5CJ2A 4AKHA 1P7CA 2RGBA 1JQLB 1JQJC 1VG8A 4CEIA 5GJBA 2Q3MA 2QU8A 3EPJA 3U7EB 2FOLA 3TJZA 3EWAA 2F9LA 2Q21A 2ATVA 1FW6A 1VDZA 3W3ZB 4A0RA 1CIPA 5E3HA 1CTQA 4MYCA 4TYNA 4DUGD 2QPAA 2A7QA 2R8RA 4OK5A 3RWMB 3MD0A 4WZAE 3LH5A 1VIYA 3ZH9B 4TQUS 2B7CA 1CR0A 1OXUA 1Q1ZA 1TPZA 5L3QB 1E2JA 1W47A 4B2PA 1RJ9A 3CB4A 1Z0KA 3WBJA 2BMJA 5GVSA 4A6PA 3NWJA 1KGDA 3V4RA 3DOEA 1NBME 1I4LD 3H84A 4LY6A 3PJRA 1E2EA 2HYIC 1CRPA 1FUUA 3CRVA 2ZM5A 2UKDA 4EDHA 5TY0A 2HXYA 5K8IA 4QHSA 2HV8A 2W0SA 3HPQA 4HDCA 4BLSA 1LS6A 3MRSA 1E2IA 4AG5A 3NC1C 1OB2A 1Z0FA 1HURA 2GJ8A 2I1VB 2VSXA 4P4SB 3T06B 4XD7A 1TU3A 2G0TA 4GOJA 4D4JA 2CL6X 2QE7A 2FDCA 1B0UA 4ZDJA 3NH6A 5EE3A 1DAEA 2VSOA 1A7JA 3KZ1E 4I1SA 5FTNA 4DZZA 1OXXK 4EPVA 2J0VA 2ZRNA 4KVGA 3K9LA 2UZIR 4M21A 3K53A 3CRQA 3DHWC 2GF0A 2CK3A 3I5YA 4DSOA 1QHGA 3U5ZB 2R6DA 2D4HA 4XSGA 2HDNB 1OIVA 1XTSA 2OE2A 3KQNA 3IBGA 1AJEA 2XTNA 4KFTA 2GVZC 4OQLA 2ANBA 5L3RA 5JECA 4LPSA 5CM9C 3W5JA 4RCYA 1NN3A 1CLUA 4NYIR 2NZJA 4OQFA 4KAXA 1K6MA 2ZI5A 4DIDA 4TMZA 5DI3B 4GMDA 1N6OA 3JZAA 1DELA 4MRPA 2C78A 4EJSC 1QHXA 1VKJA 2AN9A 4RZ3A 1S4QA 3DEFA 1OFIA 2YHSA 5AJXA 3AEZA 3NBXX 5C2JB 2DWOA 1E2GA 3QPWA 3NBYC 2B6HA 4AYWA 4DLZA 1E9SA 4NCJA 4BZPA 1AM4D 2ZRGA 3AF0A 4UNPA 5KDLA 5SZJA 1OYWA 2VIIA 1OLOA 2BCGY 4DLVA 4M2LA 2G6BA 3W3AA 4B75A 4HLCA 1UEIA 3KKNA 2R65A 4MKFA 5FR2A 3T1VA 3AVWA 4US2R 5DN6D 2HF9A 5HE9A 3WMFA 3QQ5A 4B3DA 2O0HA 2QMUA 1WA5A 5FL3A 2REXB 5DI3A 2ZU6A 3LBIA 4QGAA 2GK6A 3HWSA 2JJ1D 3JZMA 3T15A 3FHTA 1U0JA 1M2OB 1FOEB 5IK2A 1MKYA 2V8OA 1S1CA 1XD8A 5C18A 1S2MA 1KO4A 2BHRA 4URWR 4TT3A 4M4SA 1Z6XA 2WWXA 1YZLA 3AF4A 2WPDD 5D3QA 5DLQC 3FWYA 2DB3A 4QGGA 1F2UB 1OIXA 4OHVA 2QGNA 1KSHA 2IYLD 2WWIA 3VR3A 2VF8A 2XTMA 2QSZA 4G3XA 5LD2C 4QL3A 4MRVA 2IT1A 2QT1A 4XTRA 1G4AE 1W4BA 4HB4A 4DLXA 1D5CA 1NIPA 2WV9A 3QXCA 2EFCB 3U6KA 4JL8A 2ZRLA 121PA 1PLLA 3LXXA 3TK1A 5FBWB 5HKKA 4P33A 1W44A 1CJTC 1SXJC 2GZDA 4DSUA 1E1QA 1KK0A 1CKEA 4JSTA 4DCUA 4UNNA 4F4JA 5B30A 1LV7A 2QBYA 2I3BA 4A6XA 1MRSA 3AGPA 3H0KA 1CR1A 2HCJB 3B5JA 1DADA 3A1SA 3VR4A 3AF1A 4ARZA 2YNMA 2AK2A 3PUVA 1NLFA 2F9MA 2R2AA 4K46A 3VAAA 1WMSA 4XVRA 3KKMA 4MRNA 2A9KA 4QNMA 4CEHA 3IKJA 2IS1A 3M0EA 1EESA 2BJWA 1SVMA 4G0NA 4BQSA 1II8B 4MKIA 1D9XA 4Q1CA 1YZGA 4W5HA 1S9DA 2FPMA 3CBQA 5IDVA 3MLEA 3WNBA 1ZIOA 1KMHB 2OBLA 4C30A 3UWOA 4KFSA 5H68A 4AY2A 3DM9B 3ADDA 2BCJQ 2ZRPA 4JYBA 1JR6A 5FPKA 2H57A 2OILA 3T1TA 3QF4A 5FFMA 4A0FA 1E69A 1PZNA 3AQ4A 4PO1A 5KDDA 1SKQA 5JZVA 3W90A 3G5UA 3TUIC 3B1XA 2NO6A 2F3RA 2CLDX 2GETA 5KNDA 3CH5A 4ITRC 5FBRB 4YXWA 2OXCA 3SU8A 2ASEA 4BPBA 3ONWA 4ABYA 5G53C 2OAP1 3QKSA 3ZIAA 2NG1A 3W6OA 3Q72A 4CT5A 4OL0A 1KTVA 1OHHD 4NCNA 5TVKA 5KSOA 1PUIA 1Q1EA 1KI4A 1IHUA 5CIQA 1COWA 1UDWA 4L16A 5FR1A 5JJLA 1G7CA 3GD7A 1YRBA 3GFOA 3BB3A 2JGNA 2ZRDA 4LYHA 3BB1A 1E9RA 3PV0A 4Q4HA 1GRRA 4C7OB 4RY2A 3EG5A 1G41A 1CJKC 1W2GA 3D8BA 1JR3E 2OCAA 3SYLA 4B43A 4GT1A 4D82A 4CEJB 1AQUA 4Q7MB 3NHAA 3KB1A 2YOHA 2YWHA 4PFSA 1MV5A 4X8LA 4H1VA 2GF9A 4Y0VA 5JCPA 4CGZA 3A6PC 1DAIA 3EA5A 4Q48A 2CJWA 2WJHA 3VU9B 1TL7C 5FOWA 4XOIA 4ESHA 3Q7QA 1KI9A 2B21A 1W36B 1FTSA 2RGNC 2WICA 4RZ2A 4IOJA 3HYRA 3V4FA 2XOKA 3FB4A 2ZREA 1GL6A 4RFSB 1N6RA 2Z4SA 4JT4A 3EPLA 1J90A 1E3MA 2IXFA 5HCNA 1OXTA 2ZS8A 4LPKA 1N5IA 2A30A 4YC7A 4C0LA 1DS6A 3UK6A 1E1RA 3BFKA 3KQKA 4OKSA 4WZBE 4UNSA 2J7PD 1GZSA 4P0TA 2ODEA 2CHGA 4CEJA 2EFEB 1W4AA 1GUAA 4FW9A 4ERNA 2VP4A 1N5KA 2QMOA 1W0KA 1CRQA 1OHHA 2ONKA 5KDOA 3TMKA 1Z6GA 3A1VA 3D6TB 4Z8YA 2BKUA 1P3JA 3GLHE 5CK4A 2VRWA 4A8JB 2PEYA 1DBSA 3PFIA 3RDPA 5F2EA 3Q7PA 3B13B 2J1LA 4NONA 4IEEA 1H8ED 4TLDA 4WIAA 4V03A 4D4MA 3T12A 4BRWA 3X1DA 1CR2A 3PEYA 1YZQA 3PENA 1ZCAA 4DWJA 3LW8A 3SC3A 2P6NA 4XSHA 4B35A 3VNUA 4B48A 4A2QA 5FI1B 2QTVB 4P4SA 2XXAB 2YWGA 1RYHA 5FTKA 4TWZA 3L0IB 4UNQA 1SULA 3NTUA 5FOUA 3VHXA 2X19A 4NU0A 2GWHA 5JI3E 3DKVA 3Q5DA 4L9SA 4Q1AA 4D25A 4HAZA 1JJ7A 1E96A 2R6FA 3IIMA 3RS5A 3A58B 2O8DB 3AH8A 1J99A 4HAWA 3IEVA 2KE5A 3P4XA 1CJVC 4FMDB 5BQ5A 2ZI9A 3O8DA 1G5RA 1W46A 4M9ZA 4NYMQ 5JHGB 1E0AA 4B74A 4LDJA 2YC2C 2G0NA 4IJMA 5TV2A 4DVGA 2ZRFA 4HAYA 4WXPA 2ZEJA 4KITB 3BWDD 3L0SA 1NLZA 3EZFA 3B8HA 5G41A 4TQ9A 1T0JB 5C4MA 3KXLA 3T5GA 4CT4B 1HQCA 2GAAA 3LD9A 1LB1B 3R9IA 4RVCA 2ORWA 5J4VA 1NMXA 2F55A 5AJWA 1NNEA 3PEUA 2FWRA 4Q9LA 3I1FA 2X77A 2FEMA 3RC3A 1SVIA 2BIFA 2ZTSA 1Q3TA 5AJVB 3RS2A 4D4KA 1E2HA 2WPDA 2PBRA 3IHLA 2P5SA 1W2HA 3Q9LA 3K0SA 3MFYA 2FGJA 1N2CE 1WBBA 1KZ7B 1A2KC 1ZUHA 3BOSA 4KCGA 4OK3A 1LY1A 1OJLA 2GCOA 4LC1A 4OK6A 1TTTA 2GHIA 5B64A 2WHXA 3K0AA 1FP6A 4K81B 1IXRC 3L0OA 2IUUA 3QG5A 4A92A 4O2RA 1T4GA 4OQXA 1DAKA 4DC9A 3X1ZA 3E1SA 5D3MB 3TQCA 2F1IA 3EARA 1E2KA 1BOFA 1Q3HA 4LJ6A 2LWIA 3Q5EA 4OJQA 1R6BX 1R0XA 1U9IC 4ZKEA 1KSJA 3OHMA 4AKIA 3T5DA 4XIGS 5KHOC 1LF5A 3SQWA 4UQOA 5GJWC 5AJZA 1JBKA 2V3CC 1VYUA 2Q9CA 4RJLA 1U98A 1NVVR 2QE7D 1UEJA 3ZS8A 1ZUIA 1NKSA 2FFHA 1DPFA 1SXJD 1W48A 3LXRA 1UDXA 3UWKA 4B3CA 5JRZA 3UG6A 4CVNA 3MGCA 3M4YA 5FUVA 2QBYB 1RPZA 2ODNA 2GEDA 3PIRA 5EE9A 4HB2A 1E79A 4S35A 3EPHA 4RCZA 1MABB 2ANCA 4CF7A 1IY0A 2OFWA 1DARA 1E94E 2JJ2D 2JLUA 2CL0X 2OV2A 2QP4A 1YHNA 2FFAA 1UKZA 1YU9A 2W6JA 2WOJA 4KLZA 5LB2A 1NVWQ 4GNKA 3UG7A 4FI3C 4PHHA 2YWFA 4OI1A 3KKPA 1Y3AA 5E7IA 2BEJA 1ZAKA 4KV9A 4LC0A 5G40A 1RW4A 4DBLC 2F7SA 4YQFA 2OG2A 2PL3A 4BLOA 2FJUA 1G18A 4GZMA 2GXQA 4TL8A 4IRUB 5BN3A 1ZM9A 2AXNA 3OIVA 3OESA 4LBZA 4RZUA 5EP2A 1ZC4A 1ZD9A 2QPOA 1YR8A 1KDTA 1E2DA 1L4UA 3A4NA 3LQQA 4KU4A 2V1XA 4TMTA 5DI9A 4QM6A 1L8QA 3BERA 3NEYA 2RGNA 5EP3A 4OI2A 2O8CA 1OF1A 2OBNA 1FPMA 2WIAA 3OF5A 3GP8A 3IO3A 4XWOA 3GJ6A 1P6XA 4Q9IA 2F1RA 3CPEA 1GILA 2OCPA 1BYIA 4I99A 4Q00A 4EQ6B 2ZPTX 2GJ9A 4JLJA 4N1AA 2BBTA 4TL9A 3W8RA 3U44A 5FH9A 2D62A 2E1RA 4PAMA 2PH1A 3BH0A 3IBYA 3UMRA 3X1WA 4B3BA 3WMEA 2J87A 2MSDB 3THYA 3P20A 2VP2A 1LW7A 2ODBA 3HU3A 1AS2A 3CO5A 3H1TA 5FOVA 3KKOA 3B1VA 4ZCIA 1R5NA 1IJFA 3VR2A 4E09A 1K5DA 4S2EA 5C46F 3CRMA 1HT1E 4B2LA 1XPRA 2JJ8A 4ZKDA 1SQ5A 5EE5B 3EA0A 4TYYA 4GDFA 4FXPA 1YVDA 4R2IA 1DO2A 1XMJA 4M0LA 1HY3A 2B92A 1H8HD 2YV5A 1SGWA 5HR5A 1XXHE 3WY9A 1AN0A 4ZDIA 1P9RA 1W4RA 4M1WA 3TLXA 4IDHA 1EFRA 3QBTA 4BLQA 3KJGA 1Q0UA 4BFUA 1S3GA 4BASA 3VMFA 3AVQA 2JLRA 4D81A 1VMAA 3QKRA 2FFQA 4PC3A 2XSZD 1W36D 3A1UA 1KNXA 2P6RA 5J4LA 2HT1A 1VIAA 4DLWA 3LVRE 4LRWA 5FTLA 4II7A 1ZD1A 2AD1A 1GM5A 3CR8A 3IQWA 3U2QA 2PT5A 4JZKA 5FBQB 1MH1A 2FFBA 5H70A 1CBUA 4B3XA 1T8UA 3RS0A 2IYRA 4JYCA 1DO0A 2V9PA 4R9UC 1OH7A 3CRRA 4DDWA 5CK5A 2CL7X 1JALA 1HQYE 2JLYA 1T5LA 4KO8A 4KFUA 5E7JA 1KI1A 2KI5A 4AWXA 1D2EA 2RKOA 3PVSA 5G3ZA 3EZ2A 4LHYA 3AV0B 4M1TA 3HU2A 2O0KA 1GNPA 2VF7A 3Q85A 5JFGA 5CYOA 4Q9JA 4EFNA 5HCIA 3RANA 3THXA 1ZNZA 3FE2A 1XD2B 3CF6R 2CLCX 3KXKA 2B8WA 3NEJA 5EXXA 5B2ZA 3U7GA 3C5HA 1BKDR 3DPUA 2V55B 1Y63A 1P2VA 3GMTA 1VPLA 1RJ9B 4PR0A 3LNCA 2J46A 2OT3B 4B71A 1CP2A 4OYHA 4TTQA 2ORVA 1MRNA 1LTQA 4M1KA 5IHPA 2ZJ2A 1GKYA 1GNQA 2VL7A 5IF9A 2VEDA 1N5LA 2W6IA 3QKSB 4XTCS 3DZ8A 1KJZA 3WMGA 2QAJA 2W2VA 4GL2A 2P65A 2SHKA 3N2EA 2KSQA 3QPVA 4HDQB 3HPRA 4C9BA 1OPXA 2IYQA 4MKGA 1FFHA 3OIYA 2XB2A 4Q5IA 1KK3A 1OFHA 1Z22A 1E99A 3SHWA 1GNRA 2CBZA 2ZUDA 4M1YA 4AYXA 4N3NA 3SOPA 5KSYA 1VECA 4JMPA 3VR6A 2GBLA 4YDSA 2ZRCA 4IVPA 1NJGA 2IYYA 1EWQA 4TT3D 3C7KA 3FFBA 3GLIA 1ESNA 4GP6A 2K5UA 1M7GA 1JEEA 1G4UR 3FDIA 2FNAA 2QAGB 4B34A 4F93B 3U4QA 3NKVA 2GKSA 4PZLA 2VHJA 3DZDA 3U3RA 4A1FA 4AKEA 2QY9A 3SI7A 1N6IA 5IRCD 2JLXA 1V43A 1CEEA 2HLDA 1KI2A 1AGPA 1TAGA 1II9A 1UBFA 3EIEA 4I1VA 4KSCA 3PCRB 4Q4JB 2G3YA 2QUZA 3EIQA 5JSZA 4LHVA 2ORIA 5FBLB 5TXGA 2OAQ1 5FUXA 1U94A 4C0BA 1KHTA 1OH8A 3KTAB 4DLSA 4QBFA 3QF4B 1W36C 1R8QA 1TF5A 4JVMA 1M1YE 1CJMA 2GVDC 3CH4B 4G1UC 4QG7A 1KOFA 3G0HA 4LYAA 4HAXA 2FGKA 1QVRA 4HZIA 2EQBA 2ZJOA 4UKDA 3L8ZA 4QBGB 4NMMA 2WWFA 1R4AA 1T0HB 1ZC3A 4XWAA 4DHEA 4ZV4A 5GJCA 5E95A 4C0JA 4L4UA 3A37A 3UATA 1W7AA 4MYUA 1FMLA 2IK8A 1YKSA 2CDNA 4G5RA 2WMNB 3REFA 1PVOA 3OAAD 4IFBA 3CX7A 2REBA 2ZITA 2X2FA 4MYTA 2FSGA 1TNDA 3IUYA 3TSWA 5JCZA 3K9HA 3WYFA 5EUQB 1TMKA 5KSPA 4QRHA 2GZHA 2GA8A 2NTYC 2JDID 3QVUA 8OHMA 5CIWA 1F2UA 1CJUC 4M8NE 1GKUB 1XMVA 2KJQA 2ZS7A 2GRJA 4DLRA 1AQYA 5FTJA 1E2MA 1ZRHA 1IN8A 3PXGA 3CM0A 1G5PA 3GFPA 4W7SA 1XXHA 4F38A 3E2IA 2QAGC 2QP3A 2NOAA 4A36A 5CDFA 2RGXA 2W58A 4GI7A 5JWRA 5TARA 1SVLA 2KBEA 1SKYB 2A5FA 2V6IA 4AC9A 4WVFA 3THOA 4MGKR 3SJBA 1E9EA 1XWIA 3DMDA 3K70D 2VSFA 1XTKA 2ZXUA 2WVJA 3GJ7A 1UF9A 2XZPA 1ZM7A 1G16A 1V5WA 1R0WA 4LBYA 2QPTA 1XEFA 3UXMA 1KO5A 3O8CA 5H8WA 4MA4A 2PT7A 1RRCA 2BDTA 4JLDA 1D6JA 1QHIA 2CE7A 5K8LA 1TU4A 5ELXA 1XX6A 1KSGA 4F91B 1KDOA 3QEOA 4D80A 1Q22A 3AUYA 1FMJA 5BN4A 2F1JA 3HR7A 1II0A 4KBFA 3X1YA 1XRJA 5AUOB 2EYQA 1QDEA 3BJIC 3IIKA 1KK2A 3VTKA 1LFDB 1NG1A 2JLVA 2ZI3A 3DOFA 4FMDF 3EASA 4ILEA 1IM2A 3U3KA 2WIBA 4C0KA 2VO1A 3UKDA 4CW7A 4TLEA 1PLKA 2BM0A 1D2NA 4ZPXA 3UIEA 1VHLA 3D31A 4DLYA 4NTZA 4NYIQ 1G6HA 2A5GA 4DJTA 2ZE5A 2CNWD 4Q02A 4OI0A 3QEJA 4L9WA 2IF0A 1EFUA 1DE0A 3ZLJA 4TMXA 2XB4A 1G3RA 2ATXA 4TL6A 3CNLA 4MUBA 4XJXA 2OSBA 5BWMA 4KBGA 1SHKA 3N2IA 4QBIA 1ZJ6A 2GK7A 4IVRA 2O8FA 4EPRA 4NCKA 2GJKA 1AZTA 3U3OA 1VCIA 1ZINA 3PQCA 4M53A 3HJNA 4LI0A 3B6EA 1J7KA 1QBKC 3EZ6A 3MG9A 3MUFA 4LJ7A 1KAOA 5FOXA 3RYTC 5J4HA 4V0MA 4DEXA 1IOZA 1Q57A 2D2EA 1TX4B 1WRBA 4YDHB 4DCSA 3V9PA 2Y8EA 4JLAA 1PV4A 1NN5A 4K8OA 4LHXA 1K8RA 3MJHA 4LJ8A 2RH5A 4Q4HB 5C4GB 1E9AA 4B6EA 1QZXA 5KNBA 2JEOA 5JWHA 1RRPA 1TQ4A 4DCTA 4MUAA 4RSGA 3NBFA 4ESVA 3AVUA 1Q44A 1E2NA 1VG1A 4FN5A 3C14C 2X1VA 3BE4A 4QXAA 4WAUA 4CRWB 1S0UA 5LDDC 1MABA 4BFXA 3W34A 1A4RA 2WKPA 4GOXA 3QSYA 3K0EA 5FOTA 1OXSC 3GLGE 2XX3A 1M34E 3MAAC 1AGRA 4KVAA 2ECKA 1O3YA 2BJVA 2D74A 3ADBA 3SEAA 5B58C 4URXR 2QGZA 1HEIA 2RGCA 1N3BA 4GP7A 4NHOA 4AG6A 3L82B 4JVSB 2JJ1A 4LJ9A 1ZM4A 3KJHA 4R98A 5M04A 2P0EA 4AIIA 1T9HA 1B23P 2OHFA 3GLIE 4Z1MA 2C2HA 3FYHA 3I32A 1JR3D 1S8FA 2RGAA 4LBWA 4ASUA 5IT5A 4YONB 5KUTA 3ICEA 3SE0A 2OCBA 1KJYA 3LRPA 1S3SA 2EVWX 2ZYVX 4FWTA 2ZE8A 4PQYA 4YLGA 3K8YA 3QG1A 1XJCA 1TQDA 4ASUD 4HUTA 3EPKA 2QNRA 2GZAA 1NY5A 4PHTA 2O52A 1G8FA 3U6BA 1I2MA 3KUDA 1PJRA 5J4KA 2GEVA 1UBGA 1UBCA 2D3WA 3WXMA 3CPJB 4GMXA 5JWOA 4C2TA 1Q21A 2YC4C 2LKDA 4LJ4A 3CLVA 1UBEA 2IXEA 3OFND 4Q4JA 5JSZB 4L15A 3W5IA 4HLUC 1EFHA 2J45A 4ZIRA 3QJYA 4B76A 4N0EA 1XTQA 4LSGA 621PA 3K9NA 3CR7A 1YZKA 1OFTA 3BK7A 4U00A 2QQEA 4Q9KA 4EJSA 3TIFA 1OE0A 2DR3A 4JSYA 2R62A 4JKIA 3O47A 4DRZA 4IEIA 3RS7A 1VHTA 2VHTA 4P3YA 3K70C 3RRZA 2N42A 1S96A 3I3SR 1JJVA 1G1MA 2BMFA 2WMOB 1XPUA 1ELOA 5UKDA 2IS6A 2ZYUX 2D06A 5KOYA 2JASA 3LLMA 4V0OA 2B8TA 2BMDA 2GILA 2CLSA 4LYFA 1Q20A 3VX3A 1Z6TA 3B1WA 3AVXA 3ECCA 4HZUB 4RFVA 2JAQA 3LO5A 2QM7A 4F92B 2J9RA 4B33A 4Q18A 2H18A 2WSMA 5F98A 4XD7D 1E9FA 1IBRA 5J40A 1VCOA 2DWQA 4X8OA 1X6VA 421PA 1G3IA 4DB4A 4B6FA 4Q01A 4FIDA 2XXAA 1UADA 3WRYC 3ZGXA 3ZD7A 2IYTA 3JVUA 2OLKA 1FUKA 4X8MA 3IPXA 2VHCA 4PSKA 1GRNA 3PUZA 3R20A 2X2EA 1NRJB 2R44A 3B9PA 3CIOA 1UJ2A 3H86A 4PSVA 4DSNA 2CXXA 2ZUBA 1ZIPA 1WF3A 4M9QA 1Z0DA 3M1IA 4HB3A 4LV6A 4ACBA 4ZI3A 1TQ2A 3FPAA 3C8UA 3U3JA 3ZVNA 1ZVQA 2HLDD 1ZNWA 1CF4A 1MR3F 2IC5A 1G6OA 1KDRA 4RD2A 3CW2A 1GP2A 2AXPA 2BV3A 4Z1MD 4ZIRB 2IW3A 4P4TA 5KSZA 1NMYA 1OIWA 1G3QA 4IDPA 1KAGA 5FOSA 2BM1A 1G19A 3QXSA 1COWD 1E2PA 1VCMA 4TMWA 1FL9A 1UFQA 5HKKD 3A4MA 2ZYTX 3EW9A 4EJSB 3KFVA 4Q7KA 1YR7A 4Q03A 4JLBA 2PLRA 2YJTD 2OFXA 4MH0R 4PAOA 4YMUA 3BC1A 3K1JA 5C1BA 3MWLA 4Q47A 2C5LA 3R8FA 4LYJA 2PX0A 1OYYA 5HZHA 1ODFA 2VP9A 1GFIA 2NO1A 1XPOA 1IN5A 4J0QA 5FPSA 1UPTA 3GJ8A 2G83A 2REOA 2Q3FA 4HUQA 1QHHB 4LUCA 3ZJYA 4A4DA 1M7HA 2GXSA 1N0VC 3P32A 5F3WB 1IN4A 2IUTA 3RAPR 1VYTA 4V0KA 3RWOA 2MSCB 3ND9A 2C98A 4QKQA 1Z63A 2HCBA 1IQPA 3WYAA 1KI3A 3DVLA 4NZYA 2IUSA 3LX5A 1UKVY 3FKSD 1F6BA 3VKGA 1KY3A 4MGIR 2XTZA 3OIWA 4QHTA 3SFZA 4I1UA 2ZRJA 1N25A 4PQRA 2BBWA 3WBKA 4C0AC 4IFEA 2OM2A 4DT1A 1JECA 3NDPA 4FD2A 1JXMA 1GTVA 2O0JA 2IYZA 1WP9A 1XB2A 3S1AB 3DMNA 1Z2CA 3THXB 1KIMA 1A2BA 1U8YA 1N6LA 5CM8B 3QPUA 2FG5A 4W5JA 5GADl 1CU1A 2EU8A 3C4JA 2HXSA 4E07A 5KPDA 3VR1A 1JAIA 2A2ZA 3GLGB 1W4CA 2ZROA 1R0ZA 3CF0A 4OI4A 4AK9A 4A2WA 4PAQA 4QBHA 3OE7D 1NN0A 3AKYA 3GEIA 3ASZA 2OO7A 4RD6A 5CDFE 3BXZA 2AD5A 2H16A 1ZD8A 2JIZD 2WJYA 4GSYA 4CEHB 4PO8A 4NL4H 1U0LA 2BBSA 1LF0A 2P3SA 2PX3A 2ZSBA 3K09A 4TTPA 3UMFA 5EXPA 1M7BA 5JEDA 4EQ6A 3SFVA 1ZM3A 5DHAA 4HDOB 4OJKA 4ZDWA 3AKDA 1W1WA 2XSZA 4NYJQ 5HE8A 3QKUA 1GSIA 3IIJA 3QIAA 4Z51A 1TF2A 4PHFA 3ZS9A 5DIFA 3I61A 1QHHA 5IK2D 1JXOA 2BKEA 1XFAA 4LHZA 3ZDQA 1DTSA 1R7RA 3GQBA 4WZ6A 2GXUA 5EZ5A 821PA 3E70C 3EAQA 4C0QC 2WOOA 1IONA 4CDGA 1Z6YA 1RZ3A 3AVPA 3NDBB 2P67A 1Q12A 2IWHA 1FP7A 3KXIA 3GLIB 5CLQA 3TQFA 3BORA 4DCVA 1XZQA 3T61A 2RGDA 3TGPA 1ESMA 3A1TA 1LNZA 3TR0A 1DVRA 2XEXA 3AGQA 5L3SA 4EPWA 4LBVA 1KMQA 4M9SA 4RZXA 1TUEA 1NBMD 3ZZTA 4C3ZA 3GFTA 4IVQA 3G82C 4B44A 3CPHA 4PPQA 1YZUA 1BYUA 3WNDA 3B2EA 3NBZC 5J5CA 3T35A 2BC9A 3GLFB 3U44B 1Z07A 1P2TA 2VQSA 1S1MA 5FL7A 2P5TB 1N6PA 4JBWA 4AI6A 2ZJBA 1BO6A 4UXJA 1E2LA 1NVVQ 2ZRKA 3TUZC 1GVNB 3QE0A 3AM1A 1GIAA 3B82A 4B47A 2IL1A 1JI0A 4Y0AA 1XP8A 1VYVA 2ZRAA 2ONJA 1KK1A 4IDQA 2J0QA 2XJ4A 4A9AA 2HT6A 3A4LA 4D0LB 1KY2A 1FNNA 1P2SA 5KU1A 4IKEA 5BW8A 3VNVA 3L2OB 2WWYA 4Q9HA 1R5BA 2VHUA 1P62B 2VP6A 3KJEA 2J0SA 4QHYA 2V1UA 1KDPA 2ZYWX 4PC7A 2AWNA 2W6JD 4I1OA 1HH4A 3TUJC 3W6PA 3IPYA 2WAYA 4EUNA 2ZRIA 4TQAA 3ZIAD 4URUR 3KX2A 3TKLA 1KYIA 1O87A 4U5XA 1GL9B 1G5TA 2F43A 1WDTA 3IDQA 3SJAA 3GEEA 1N6KA 3BS4A 1E79D 2RHMA 5DSZA 3AP2A 2EYUA 3R7WB 2O8EA 2GXAA 4QJ4A 2FZ4A 3C15C 1KO1A 3TNFA 4Q4AA 2PEZA 5D3MA 4HB0A 4Z8XA 4KODA 4M9XA 4EPYA 2GCPA 2Q3HA 1SVWA 2KB0A 3CX8A 2QZ4A 4XH9B 3K0FB 4BRUA 3MCAA 4PPGA 2IF2A 1N6NA 3P27A 2QMHA 2RGEA 1KO8A 2AFHE 5FI0B 4LZZA 5BN5A 1DAGA 2V4ZA 2DBYA 1JEDA 1SHZA 1ZNXA 4Q1EA 2O5VA 2WJIA 1JPNA 4BFWA 3KJIA 3TW4A 1YR9A 1T3HA 4TN1A 2HEIA 2NGRA 3CWZA 3B78A 2R9VA 4B3FX 2AX4A 3CRW1 1KI7A 1RIFA 5JI2E 3EZ7A 2WJVA 1DAFA 4US0R 1GWNA 3FKSA 4NYJR 2BMEA 4HAUA 2PJZA 4TYWA 1I2DA 2RHDA 2N1BA 4FMCB 2FEOA 3PEVA 3KDSE 3N70A 4Z54A 1IY2A 2FH5B 4LOAA 1NLYA 4TSFD 4NDZA 5A0FA 1F48A 2D7DA 1Z8FA 4AYTA 4HUQB 5FPTA 2WWWA 5DYIA 3K09C 4JLOA 4XWKA 1F3OA 3EC2A 3SYNA 5KNCA 1G20E 3LLUA 4QJ3A 5AUPB 1OKKD 2FV8A 1EK0A 4YMTA 2AL7A 4D4LA 2WTUA 1GOTA 3IQXA 1HUQA 1G3UA 3E5HA 1XBTA 1X8KA 2F43B 3B60A 2G88A 1AA9A 1AKEA 1Z5ZA 2ZETA 4M1SA 4WXRA 2QG6A 2J7KA 4NCIA 3TSZA 3WNCA 1F60A 2C77A 3U60B 3BGWA 1HT2E 3OEHA 3ETLA 3OEEA 2ZR0A 4Q4AB 1S9HA 4Q66C 2RGGA 5SZHB 5J4YA 2IYWA 5HZKA 3MWKA 2C9YA 4F7WA 4DEYA 1E2QA 1E9DA 3CWQA 3GLHA 3TSOA 1YZNA 1KMHA 1G64A 3QNUA 1EX6A 4LHWA 4GPTA 5KO2A 1NF3A 5H1YA 2H1LA 3TH5A 2HJVA 1GG2A 1YQTA 2ZRMA 2TMKA 2JJ2A 4FCVA 4HAVA 1XTJA 1IY1A 1E9CA 1US8A 3NHBA 2YWEA 4M1MA 4BECA 2BVNA 4ON9A 1G8GA 2GESA 1LS1A 2Z0MA 3PR1A 6Q21A 4QNRA 3WHLA 3F3YA 5JMTA 1U81A 1KZGB 1OKKA 4OHZA 3BH6A 2OESA 1BS1A 1E0SA 5DHFA 1T8TA 3LAWA 3LY5A 1ZU5A 5GVRA 1EFRD 1FX0A 1WCV1 1G7TA 3KUCA 4CIDA
chains in the Genus database with same CATH superfamily
1OCEA 1ENYA 4A26A 4RH0A 2X1HA 3UQYS 4RD0A 1TYCA 1QFSA 3ENWA 1M0TA 1P5ZB 2XCOA 1G2PA 2QA5A 4M8KA 4F2PA 3PT5A 2VRBA 2BCEA 1GDTA 4D26A 3DL0A 3MW8A 4N9QA 1BGWA 2QE6A 3B7GA 1LQ2A 1QP8A 4A15A 4FYPA 5LMCA 1T9GS 4O0LA 3PPYA 3WK9A 3QKTA 4WFJA 1V4VA 4XASA 4A16A 5BVHB 3DLAA 1YUMA 2QZSA 1E2FA 4IICA 5AD1A 2KWIA 1D5WA 3OZUA 4D57A 1DQRA 2OC9A 2IHYA 3ONDA 2BI7A 1YAHA 2FMXA 1RI4A 4ICIA 2KBFA 5HIIA 3EGXB 3ZHCA 4BUCA 3GT4A 2CYAA 1EKXA 2IXAA 1D4AA 5TMEA 2YZMA 3AJDA 2DQKA 3HO8A 2OGZA 2Y27A 4ZO7A 4NV1A 5K0FA 5IJXA 4YA6A 1XSEA 2IVZA 1EX7A 2XUZA 1JN0A 5JMPA 3I9KA 2HN9A 2GN2A 1WUKS 2O7RA 1CRWG 2BISA 4GG1A 1CQZA 2ZRHA 2FWJA 5FAKA 2RARA 4UVGA 4MCIA 5J5VA 1OXVA 2FSIA 1U2SA 4RADA 2R7KA 2PZGA 5HTKA 3QLUC 1Z4IA 4RHCA 2J31A 1HM5A 3G2IA 1P74A 3EZ9A 4W5QA 4HPXB 5L8VA 4EPTA 2ZYRA 1QB8A 3CZAA 3GIWA 1AKYA 1QQ6A 1VJ1A 3KR9A 4OKIA 4Q24A 4UU7A 1JQAA 3RTBA 3ZHZA 4YT4A 1T0UA 1AB6A 3RREA 5NLLA 4KWCA 5G3YA 1FLDA 4LVNA 3ZCRA 1FCJA 2F3TA 2UYQA 4YASA 2PWPA 3DUFB 1J33A 1BDIA 1FX0B 3WO0A 1XYGA 5LBUA 1N32B 3L6DA 4R2MA 3HB0A 1IEXA 1PG5A 3HU1A 3PUWA 5M5BA 3AXTA 4GBMA 3F49S 3MWDA 3A36A 3DNMA 1NVBA 3QF7A 1NGSA 4BP3A 2H8GA 3E3OA 3RH0A 1C3XA 2J6HA 3EEOA 5JD6A 5DE3A 3INNA 4BPRA 2H92A 3O8LA 1NZJA 4BC0A 4WOPA 1YCFA 1ZL0A 2IHJA 4EITA 4ZEMA 2Q3CA 2V4MA 1U7DA 4C7VA 2MMCA 4K0RA 3CN7A 4C3VA 4Q7LA 5JBNA 5DLDA 1L5SA 1KKUA 3S2SA 3GJXC 1OSNA 4G85A 1BU8A 1O5IA 2GDJA 3ZU4A 3LNTA 4OGKA 4EM6A 1IHXA 1OBCA 1YR6A 1EDEA 2H3HA 4IHQA 3DL2A 3ADKA 1KAHA 1IMJA 3NAGA 4Q37A 2I67A 4Q7JB 5GJVC 1YQWA 2Q1UA 1QKIA 2JGDA 4PSAA 3GJQA 4GYYA 3S1SA 1YRAA 2JIOA 2OFOA 4H3HB 2Y68A 3HZHA 5A4MS 1PL0A 4RE6A 2Q5IA 2Z4RA 1WPXA 2DE0X 3T34A 1SXJE 3HZOA 3T3OA 1I2BA 4BEJA 4PLVA 4UDOA 1CUSA 4EW6A 4UEJA 3CKLA 1NUAA 4QU5A 5L40A 1HNZB 2H08A 4GXNA 5C34B 1EJ2A 4C7BA 3FI0A 2IY7A 3FHCB 3HZRA 4LJAA 4Q4CA 3JAKB 3L7NA 4OP3A 3QUAA 4LS3A 3VPHA 4BLTA 2CUZA 1U0GA 521PA 4E12A 3JRXA 1K6JA 4M99A 1KAMA 2Q0HA 3IMGA 3P9PA 3ZQ4A 4GRAA 3ESQA 4RPGA 2NUAB 3TXXA 1AK2A 4BTLA 4OQMA 3ZKAA 2JLSA 3HJAA 2WHEA 1RLOA 1E6CA 1Z2PX 2QAIA 4F85A 4B7AA 3AR8A 4V1CI 2IIBA 2I4OA 3CUWA 2ZTLA 5CFQA 4OQNA 1G38A 1VC2A 2OXTA 4BVAA 5BRAA 1HE2A 2WJJA 2XITA 3RRNA 3UXEA 2IP2A 1GARA 1DU4A 4TZKA 3EULA 2NUTB 3EMDA 3ZOZA 2WSLA 4K28A 3H6KA 5BQOA 1GPMA 2CVZA 2ZAMA 1W88B 4XPZA 3KQMA 5IZCA 1TEZA 3W5CA 1KI6A 2WVGA 3HJUA 3JWIA 5K2MA 3T4EA 3G49A 1JNYA 3BRSA 1TQ8A 4NQRA 4BLWA 1QRSA 3X1MA 3F8TA 4YCLA 5FX2A 7REQB 3HXMA 3ESYA 4NCBA 1SVSA 5LU9A 2NQ2C 3IE1A 2HSGA 4N3GA 3UXHA 2PFSA 1NR5A 2FFJA 1GQRA 3BD9A 1UC8A 2RMKA 3F5QA 3LIIA 2I99A 4WK0B 3D3WA 3R7SA 1A4XA 5J58A 3DVRX 1OXMA 4G0YA 4OUKX 1WHSB 3LC2O 1WU8A 7MHTA 1ZMXA 3AZQA 4JL6A 5WRFA 2M2IA 4YAIA 3VSAA 1WXQA 5BNWA 3HHEA 2GCNA 4LX0A 4FBGA 3FMOB 3LDUA 3V5NA 4PPNA 1OROA 3CUSA 3VR5D 1FNMA 1OTXA 3DBRA 5JXGA 1RJEA 2GAOA 3F7NA 4FYMA 3EOZA 1R6TA 2IHBA 1KFJB 2CXSA 1SC1A 1PYGA 3R3SA 4RKWA 1MDBA 4QATA 3ZH2A 5FOQA 1UM8A 2XBMA 2DU8A 1AF7A 2IXBA 3DC2A 3QLUA 3Q8LA 2B1IA 1LBTA 4PGGA 1XYYA 1D7AA 4PZCA 1NXPA 3A9VA 3K2BA 4IUCS 1P1JA 1XHEA 3K0AB 1YDFA 3UA3A 2E4YA 4WN9B 3GVHA 1C7JA 3H16A 4BB6A 4U7PB 3SE7A 1NXVA 3QV2A 4OQYA 4PINA 2RGRA 1GG5A 3NIGB 3PFHA 3M70A 3SR0A 4LCBA 4PXAA 4R1TA 2OK8A 3CKYA 4Y9RA 3KL4A 1T5OA 4KLNA 3P0FA 4HQOA 4R7TA 3IBTA 3SAJA 5D2CA 3N6VA 2DSNA 1X1QA 5CCXA 4IXMA 4DNOA 3WHKA 3BBPA 4DBZA 4DMRA 1W6UA 4TVKA 1Z6ZA 2C95A 5CYGA 5DHTA 3MWYW 3RYFA 4ZTBA 2NPFA 4LJSA 1VG0B 1NVUQ 2LP4Y 4YYZA 4CTJA 2XE4A 3K9BA 1X86B 5T41A 1G7RA 2XCTB 2J59A 4U2EA 1RQNA 3GNTA 3M6LA 1SXJA 3BHJA 3R3JA 4D45A 5F35A 4DABA 3NPMA 1FYDA 4HLDA 2ZG6A 5GZ6A 2OZEA 1W5TA 2J6BA 1MGPA 2IEAA 3AHHA 2UZ3A 3E9MA 1NMZA 1MN6A 4GZLA 1OW3B 5AI5A 3CTMA 2LXNA 5HZMA 3NH9A 1PT7A 3NJ8A 3J81k 4KE9A 1POWA 1XD9A 2Y1FA 1GPUA 2X9VA 2ZSAA 4GLLA 2NP6A 4G8DA 1TVMA 2YZ7A 3HJBA 1MHTA 4PLPA 3TFWA 3BBLA 3D0KA 4IW3B 2XQFA 3GFRA 2FE4A 4A03A 4IF6A 1MQAA 2ORYA 1LBQA 1LPAB 1OAOC 3NTRA 4KSBA 3WE7A 1ZNYA 3AW8A 1FRFS 4ZT7A 3LUHA 1E1RD 1OTHA 2C2KA 2I65A 1UMCB 3PGJA 4L1KA 5CUQA 4ZAZA 3GLRA 2R1UA 1TQHA 1SELA 1NQAO 1XK7A 1PJLA 3KD2A 4DIEA 2IITA 2X3UA 1GZ3A 2FRVA 2Z43A 3UAXA 3W5UA 1I6MA 2V6GA 3EOBI 5F52A 3TLKA 3I5XA 4WPGA 1W0KD 1N9KA 1LPBB 1SG9A 1Y7HA 3L6EA 5LKAA 2QYHA 1GR1A 2HPHA 3AHFA 4JR1A 5LC1A 2QSUA 3IILA 2X0JA 5K0EA 4HYYA 5CNKA 4OQ4A 4YUXA 4V0SA 5ULLA 3A28A 4TKMA 4B09A 4BKRA 1XIVA 5E7QA 3AUSA 2BF7A 5CB8A 1JWLA 1V4NA 3P9RA 1EGAA 2VPTA 4BWVA 4C4TA 2FETA 3C5WP 3IULA 4ZEWA 2PVPA 2FQQA 2IKSA 2PZMA 3U4DA 4TLBA 2RHWA 4LGMA 3QVGA 1SBZA 1ECGA 3PL5A 3I2IA 3IC5A 4MHOA 4TLCA 3SHFA 2BTQA 2BH9A 3C8ZA 4MZDA 2HA5A 4DDTA 2K4MA 4GPZA 4IQ0A 4FCTA 3GW8A 5A3VA 2RI6A 1ZXLA 4OD0A 3VHRA 4CCAA 3FFAA 1M74A 1LX6A 1RMQA 2ODWA 2N0SA 1Z28A 3ECAA 2C42A 3GGDA 1U2QA 2PDAA 3F3SA 3MJCA 1XA0A 3QI2A 5IG2A 3WGUA 2GYWA 1HBJA 5K0BA 1SVOA 3LGAA 3MIZA 4M7PA 1V8BA 3FKQA 3GRVA 1K0FA 2Z8YM 2DQ4A 3RUCA 4G4GA 4NXNB 2Q8QA 3K0HA 4F06A 3LQRA 3BIJA 1AV6A 1BS9A 4MUFA 3RVBA 3FGOA 1VSUA 1JFFB 1VTKA 1ZR4A 3HS3A 3SBEA 2W2LA 1UFOA 2WJGA 2ZS9A 4B32A 4Z3KA 4JGGA 4GQAA 5DTRA 4BX3A 1ZDMA 1RRKA 1XDWA 1GA6A 3L0CA 4M6WB 1U1IA 3H5LA 4WLOA 2P6PA 5CYFA 1CNMA 3HRKA 3IQEA 5D5PA 4D8XA 3N74A 4ARCA 4JJKA 3ZDFA 2HMVA 5A3JA 3FTNA 4R71A 5LQKA 2ASVA 1W581 1U2ZA 3H1GA 4XVUA 4JUAA 4GWKA 4PRYA 2EP7A 2ST1A 1O1YA 1DXHA 3DVAB 4M3NA 1P91A 3JQCA 4KX5A 2FWNA 3WV4A 1KBOA 4D46A 1ADYA 2IVFA 5L4LA 2QNBA 2WZQA 4HLUA 3IXLA 3M6WA 1Q0TA 2P90A 2BM8A 5K3FB 2OEPA 2XNDA 4KGDA 2BGLA 4IIEA 1XMQB 4L3WA 1ZRSA 2Q7DA 3IJRA 1TVCA 2FZWA 1ABFA 1VLVA 2J9FB 3PC6A 1SUEA 4S1VA 3FBWA 1YJCA 1SQ6A 5JCOC 1FE8A 1QRTA 4J7CA 4F86A 4LRUA 1M72A 3C6QA 2JFGA 3SLGA 3TTSA 1HA3A 1ST2A 1UP6A 4JC5A 1L5VA 4GXQA 4JJ7A 1CHNA 3UF0A 2VUHB 5L53A 3ZYCA 1Z5WA 5COBA 1D1SA 2AWOA 4JB3A 3OTGA 1A9PA 3MSXA 3JQQA 4LN1A 5IXSA 4LAFA 1WNTA 5KYYB 4JT8A 1V8ZA 4U7DA 4OHYA 3O1IC 1X7ZA 2L69A 2PZEA 1TM1E 1HT3A 2WUWE 3K0BA 3ANXA 3DOOA 5JZSA 5AVXA 1T6YA 3PUXA 1B3BA 1QVVA 1A9TA 4LJYA 5AKHA 3DLCA 1IG3A 5F51A 1QV7A 2H5LA 5T4FA 1SD5A 2O8DA 4URVR 5DU2A 1FDRA 2L42A 5HS6A 4LV5B 1YBVA 3RK4A 4O3FA 4EY6A 3BN3A 4MS4B 4FYIA 3CVXA 2IPOA 2C9BA 5EJFA 1G66A 1IOWA 4FCWA 2R79A 1F9EA 3OD5A 5E4YA 1RC8A 3GRYA 2ZTHA 4D8YA 4FSDA 3HP1A 3OKPA 5HTOA 1IQUA 5KZMB 3KCQA 2C9OA 3K4HA 1RI1A 2GEFA 4CKWA 1US8B 4N01A 1Z0IA 3D54D 4MGEA 1FUYB 2JZOA 1HE8B 5EZSA 3RK1A 3RLIA 1M6YA 3VZSA 5ESRA 4NESA 4NBRA 3R3XA 1DJQA 1U3CA 3R3UA 2R6CA 3P8ZA 4AO7A 2W42A 3ON5A 4TZ6A 1Y0BA 2Q50A 3EF1A 5LWHA 2C8VA 1KFCB 4EHNA 4OHXA 1WHTB 2G6TA 1UXIA 2WTEA 3QA3E 3MPUA 3DKRA 3S68A 4TZ0A 1GGJA 2ZI7A 4OFWA 2FN9A 5ICSA 4RXMA 4H3VA 2NVUA 3B36A 3ROPA 4URZR 3SQLA 4P3XA 3ERCA 1KKMA 4EJ2A 3U4QB 1JEJA 1L2TA 4B83A 3VJRA 1V8OA 4L22A 1WKCA 3MMNA 5CG2A 1BXRB 2ESRA 1XDSA 2EGUA 4S04A 4ZRDA 1X38A 4W5WA 1J8MF 4ENSA 5AVTA 3DFUA 4G23A 3FDZB 1A95A 2NU9A 5AM4A 4QUKA 3C5EA 1MA3A 4CTOA 3HA2A 1K9VF 4ZWNA 5JUWA 3CNNA 5A1JA 3ZBTA 3S4YA 5A0TA 5EUBA 2X8JA 2QVYX 1FFYA 3KOWA 1Q0LA 1ZA2A 2NV6A 4ZCRA 2I6TA 4C5BA 1SU6A 2ZUEA 2ZP1A 1QM5A 2CXRA 2W2XA 2I1LA 2X7HA 2O7SA 1Z3CA 3BF8A 4OQPA 2QTTA 1I01A 2IHKA 1XPJA 5ANRB 1KRXA 2DUWA 1MW9X 2BRUA 5T4HA 3NIFB 5HJ2A 4JU8A 1W49A 2X9NA 1WETA 3V7UA 3N8NA 1Y1LA 3K0FA 4LJ5A 1ZEJA 1RE0A 3C8HA 3CONA 4IXTA 1KO7A 5JBQA 1RQLA 2CNLA 2FEPA 3H2IA 4DYHA 5FPYA 2BFCA 4PRZA 3C3MA 5KOJB 1ZICA 4OF4A 1FLVA 3QLVA 2I4MA 1CYEA 1PK9A 4OSPA 2WUGA 4KN5A 1O95C 4YI3A 3E7FA 3IXMA 1MOSA 1E1QD 1XTRA 3QBVA 5IWAB 3F5FA 1LTHR 4WJLA 1ND5A 2XJ9A 1L7MA 3ZNQA 5DISB 4CLRA 3QY0A 2CCKA 4ZDKA 1N36B 2P9GA 1LK7A 5BRJA 3IP9A 4NSNA 1I6LA 3WS7A 3QUCA 1JIKA 4QM7A 2ET6A 4WDRA 4ER7A 1DQZA 2YVUA 2WKRA 2A88A 1XZIA 2QAGA 5DBIA 4UFPA 3AV3A 5CLLA 4JP3A 2OV1A 1GL7A 2GERA 2I87A 1JDSA 3JVEA 3QFSA 6PFKA 1RZUA 4HH3C 1JAZA 2EDAA 1IB6A 2F64A 4I5EA 4PR3A 5KYWB 2AR7A 2CXHA 2ZUWA 2CYBA 2AZ4A 4WFKA 4N5NA 4XZ3A 4ZHQF 2GHQA 1HORA 5KNLA 4IINA 3LBNA 2E82A 1L4YA 1P61B 2L2QA 2QVGA 4WFIA 3ZHXA 3DVQX 3OU7A 1BMFD 4QIHA 3UOAB 4JMLA 4B73A 2JAXA 3A3OA 2B61A 4V0LA 4X97A 4R5MA 3IUEA 1T1SA 2PD4A 1SBIA 4ALNA 2XZLA 1MQ8B 5HDQA 1Z0AA 2O20A 2IPAB 2DLCX 1S3IA 1CRLA 3NVAA 1B74A 2CJWB 5H59A 5HILA 3DMYA 4RW0A 1L4BA 3AIKA 4HHEA 5BYJA 3TNLA 3U0VA 2QRUA 4YAJA 3NHUA 1XEXB 5BN4B 4A2CA 4W5OA 3AVYA 1T4CB 2VH5R 2AOXA 4PZUA 1KYZA 3LTNC 4IG9A 1PJ2A 1HO3A 2W0MA 4IYJA 5CD1A 1QWSA 3WMRA 1KBQA 3AM4A 4MUNA 3RS3A 3VR5A 4AUKA 1IZ9A 2OB2A 1GTJ1 1MVLA 2EFGA 5DM0A 1E98A 4N5HX 721PA 1GDDA 2VAVA 3TQIA 4PWYA 3TDKA 3V6LA 2VYND 1DRUA 3GK3A 2R6R1 5JXIA 5DLYA 3I62A 2VWGA 1SBHA 3DE2X 3PJEA 3CNOA 5EZ6B 4KPYA 2BEVA 2AKYA 2PH3A 4MZXA 4BNFA 1J21A 5DEIA 1QONA 5BN3A 2ZE7A 1SOWA 4HOYA 3AOEA 4LOJA 2HTEA 4ZO4A 5E6SB 4CLHA 5AVOA 2AUNA 1W5SA 4A8JA 3B9QA 1CS0B 1QVAA 1UOOA 2GUWA 5JG7A 3ZWPA 4RVNA 2RC6A 1KEEA 2PLFA 4K9OA 4MMYB 4TX1A 1RCUA 1P3Y1 1OVMA 1Q83A 2ZCVA 1WWKA 4JZYA 4RD4A 1E5VA 3KVNA 3LZCA 3R0XA 2GAIA 4RIFA 1EU1A 1GLGA 3L0ZA 4CQLB 1CQWA 1DUIA 4D9HA 2YMMA 3DE3X 2I3GA 5FTMA 1XI2A 3OZCA 3AFGA 1EEHA 3P2KA 4KE8A 1YBHA 1X7DA 4C0SA 2O8BA 1Y4DE 3L07A 4FE4A 1MEJA 3TQHA 1B2LA 2DPXA 4LHSA 1CZHA 3G2KA 1Z83A 3W5SA 4FT2A 2JFNA 4IDOA 4YHBA 4YQZA 1E3JA 5LXTB 2XZOA 2QD4A 1D4OA 3DQQA 4JP8A 3UPDA 2ZU0C 3KU4A 1PLJA 2B4KA 3R8CA 3PIIA 2XVXA 4L75A 2H4WA 3WYGA 1PBNA 2XGJA 2LDXA 4R0MA 1ZG3A 3IJPA 1QZ3A 1AHHA 4O25A 3TEJA 3WGOA 4ZU6X 1Z4QA 1MTOA 2ZAOA 1OX6A 1XCPA 3FMIA 1O97D 3A4VA 4RF4A 1E9BA 2G17A 1M8GA 3VZBA 3Q8KA 3U7HB 2C9DA 2C59A 4YK7A 3WYEA 4DIUA 2W83A 3O7WA 3QMPA 5KYUA 4QASA 3QZUA 2OMEA 2MSEB 4JL5A 2JH3A 5L95A 2I0FA 3B1ZA 4MV1A 3OVMA 5TB5A 3L8DA 1ZISA 1XCBA 9GPBA 5JSUA 3LL4A 3V4OA 4RTPA 4WBSA 2G71A 4YJGB 3UAGA 1RZVA 2DFVA 3V4VB 5EHNA 3U4HA 3JS5A 5FA5A 3K0CA 1K7FB 5EXTA 1I9CA 1XK6A 3BDAA 4G4IA 3NP9A 4D9FA 4DUGA 2LV8A 3I8XA 4MUXA 5IN5A 3N2KA 5KI6A 2OL4A 3EXIB 3FM9A 4MWOA 1R0YA 1UMBA 1YQ9A 3C3JA 2W00A 1VKNA 4KQKA 4OO3A 4RIHA 3RRYA 3UV7A 5FCDA 1OLXA 3OUZA 3OA0A 2EFDB 4PLZA 3V7FA 3LFUA 3GNLA 1NF2A 1MCZA 4NCHA 4CR7A 1DKLA 5CITA 1NATA 1AXGA 2GTPA 3KJQA 1EINA 1KNQA 3DE4X 3DDHA 1KJ8A 4AKHA 3WV5A 3ZWQA 1GA1A 3D64A 1JQLB 5D87A 1OXKB 2VHXA 5HRCA 1DGQA 4QPCA 2Q2VA 2OP0A 2C5AA 2QU8A 4DMMA 1G20B 2AMYA 2X41A 5AIBA 5CEFA 3FBTA 3SZMA 4BS9A 4RDXA 2QTZA 2WF6A 2Q21A 2ATVA 2BZGA 3W3ZB 1CIPA 2HPAA 1KVSA 2HQOA 4J9UE 3L7MA 1RQXA 4AF8A 3MJSA 1MOQA 2YMPA 2UUOA 1RP7A 4HYEA 4R0NA 3MD0A 4PU0A 4IX1A 3LH5A 1VIYA 3RWMB 5I9LA 3ESZA 3NANA 2XNCA 1CR0A 4H7PA 4NARA 3RWBA 2H7YA 2J0EA 1PSWA 3DHYA 3E9DA 2EX0A 3G9QA 1Z0KA 2VBFA 3VC1A 3WBJA 2BMJA 2N9UA 5GVSA 4MRMA 5HQJA 1FYFA 1NLMA 3OE4A 3NWJA 1E7YA 3ILVA 3MFQA 1KGDA 4OYLA 5DMXA 3KP1A 5JZMA 3SFTA 1SD2A 3ZCSA 3LE8A 4HEA6 1NBME 2ZULA 5T8KC 2P7HA 4QUHA 3M4JA 4F21A 1CRPA 1FUUA 4X5OA 2FPXA 1P4JA 2RH8A 3ZK9A 2BFPA 4A7PA 4JOSA 3UGJA 2ZM5A 4EDHA 1XZLA 3E5MA 1Y9EA 3HVUA 3HJGA 4TM8A 3AI1A 3PA8A 4RZQA 2X9GA 5ECYA 1UUFA 1E2IA 1Z5OA 2LGJA 2YY7A 4WLFA 5DHUA 4D9EA 2NVWA 2X9LA 2A9RA 5LIRA 3T06B 4XD7A 4Q3LA 2CL6X 4F5YA 1B0UA 3OQNA 5C5IA 2A9VA 3WRYA 5EE3A 3MCZA 2EZ4A 3D2LA 2O7NA 2B8EA 2VSOA 3N8HA 4CUKA 2VJCA 2P2ZA 3PXUA 1KJJA 1OXXK 3NORA 3RVKA 1UBNA 4EPVA 2WILA 4GM0A 3UCEA 3TD9A 4KVGA 4R84A 4E1AA 5JATA 5LMUB 2LW7A 4KMOA 2Q1YA 5FT9A 2GF0A 3C1UA 4DSOA 1QHGA 1TTHA 2R6DA 1I7NA 2HDHA 3A31A 4QVGA 1CHDA 3ZHSA 4WCVA 1CQIA 2BGRA 1HQKA 2HU8A 1OIVA 1XTSA 4D9JA 3DFKA 4Z5XA 3KE8A 1JDNA 4UMFA 3T3GA 3TRHA 2PL1A 5JECA 4LPSA 5CM9C 2D59A 4WESB 4RCYA 1PFYA 2NXCA 2P5YA 3I6BA 1AKVA 2C7BA 2KYRA 2NZJA 2YFHA 4QOHA 1Q7BA 2B0JA 2PZKA 3B6MA 3VC2A 4D9GA 1T1GA 2AFVA 3VR3D 4DIDA 1L8XA 3WL4A 2P8JA 2OENG 3IPCA 3KPUA 2J5RA 1NJ6A 3DZHA 4GMDA 1TM7E 3DR5A 1U3GA 2YY6A 3HBLA 4M37A 1IBMB 4Y6LA 1VKJA 4NE7A 1VMDA 3LBYA 6ABPA 2W6QA 4BHTA 4KX3A 2XKKA 1A0OA 1CR6A 2JH9A 2JZNA 3FZEA 3NBXX 2ZCJA 4LDRA 4QU0A 5F1KA 3GDFA 1R66A 4IL5A 4LNAA 2E7ZA 4ZEXA 1VSBA 3NV7A 4NCJA 3W0LB 4BNYA 1ADBA 3RAEC 1RZRD 2FRDC 3AF0A 3LYHA 3FJ1A 2YIJA 1DC3A 2OZLB 2XLBA 2QW8A 2ZWVA 5BOVA 2FR8A 4FZ5A 4DLVA 4M2LA 2Z6AA 3W3AA 5DOZA 4MKFA 1C3OB 5FR2A 5LQSA 3HVIA 2Q0QA 3B52X 3AVWA 2E49A 4L4SA 4HKTA 3GPBA 4NAUA 2LIVA 4V0RA 5AHKA 5EPOA 2RH4A 4L9AA 5CVDA 4Q34A 4OU5A 3IXQA 1HDRA 5ER6A 3RS9A 1S8AA 4D9MA 3HBMA 2FUCA 2HLNA 2PIAA 2YQZA 2H54A 5IC6A 4DPKA 4Y2VA 2JJ1D 3FHTA 2WY2D 2KLBA 1A4UA 2XUAA 4JNKA 3QEKA 4O4IA 1IL0A 3UKOA 1XD8A 1H2XA 3HWRA 2BHRA 1KO4A 3ZGVA 1UZUA 1RHUA 1PJTA 4LJRA 1Z6XA 3HDJA 4CN9A 3BL5A 2Q4TA 2QU7A 5JC8A 1NBIA 2JGKA 3UJ8A 4ZYLA 1F2UB 2Z6QA 2G08A 4OHVA 2A1TR 2QX9A 3OJOA 1PS0A 2WWIA 4EY8A 2Z9DA 2XTMA 3WOHA 4ARSA 5KYGA 1H6AA 3JQGA 4DA4A 4BNXA 2Y9MB 2QT1A 3D02A 4XTRA 1G4AE 1W4BA 4DLXA 4UC0A 2ZRLA 1RKQA 1LC3A 1U04A 121PA 1PLLA 5CRIA 1QAOA 4XWYA 5LA6F 2VDVE 2NYAA 2G5CA 4R5HA 4ER5A 3L1KA 1NW5A 5B2EA 4D43A 4RBNA 1D3AA 4OOEA 1E1QA 3INTA 1KK0A 4WD3A 2IHNA 3UWPA 4UNNA 5A4DA 1FSPA 4F9EA 1LV7A 4P9NA 2JK0A 2OVFA 2W8BB 2WT4A 4OYYA 1CUVA 1BJKA 3FX2A 3AGPA 4X3PA 1SPBS 3DEHA 3URMA 1CD5A 1Y8QB 2GBFA 1QRDA 3PUVA 4GP9A 1RWOA 2GDZA 3GPCA 3NHKA 3B7PA 4XVRA 4OXQA 3KKMA 4MRNA 1YRQA 2IS1A 1JHAA 4DWVA 3BMOB 4J16A 3UV3A 1ZD3A 4XFKA 1XZ8A 1RMYA 4HDMB 3UYLA 2J09A 4XUDA 3TOSA 2ZIEA 3W2EA 4Q1CA 2IEBA 4WASA 1SBYA 4MAFA 3EXFB 3TXYA 3ZY4A 2AVDA 3CBQA 1IB0A 4K40A 4QA9A 1RAGA 4RA9A 1KEUA 1PFWA 3AK4A 2BSXA 3HNOA 1KOLA 4C30A 3TFOA 3T0GA 1A8UA 1Z5GA 1RYNA 4UEKA 5H68A 1EVZA 3UFBA 3WSWA 4AY2A 3DM9B 4JYMA 3E7WA 2DULA 5HF6A 3TTTA 2I34A 3ST7A 3TCKA 4OAOA 2RSLA 3NS7A 1DV1A 3HB9A 1EIWA 2BPOA 2SKCA 3H9CA 3STVA 1P9LA 1XVIA 1TCCA 1D03A 1T1RA 3KKLA 4MVJD 3KJNA 4PG4A 1B8NA 5JZ9A 1Q11A 1YUBA 1ZOIA 4QU8A 2F3RA 2HQBA 1QU2A 4A6DA 5EJGA 4AJHA 3W77A 2RG7A 4R69A 1KQ3A 1B16A 5F2NA 3FSRA 4HRAA 2HRRA 3CH5A 4YXWA 3ESCA 4WFQA 4UU8A 3RSSA 3F3MA 3SU8A 3ONWA 4BPBA 2H2WA 4FW8A 1UP4A 2I3DA 5FNVF 4YMHA 1W85B 2OV8A 3OECA 5LL6P 2V58A 3UV6A 1HFJA 4REQB 3AR6A 4CT5A 4J6FA 4ND8A 3ZDYB 1EVQA 4BQRA 4N7RA 1NTRA 3V80A 2DGDA 3F5SA 2UUBB 1SM4A 1T5SA 3CSUA 1THMA 5JJLA 4H18A 3GH1A 4KC0A 4DNFA 3BB3A 3BXOA 5DYWA 2KHZA 4G5HA 1B41A 2HIHA 2K7ZA 4LXYA 2ODTX 1EVIA 1DBPA 3D1JA 3EG9A 2PL9A 1W2GA 4AP5A 1RWKA 4D82A 4CEJB 3EISA 5CEEA 2AEFA 1AQUA 5BWCA 4Q7MB 3WL6A 4UHDA 1I30A 1DWOA 2PHZA 1C7IA 1D07A 4DSZA 3UAOA 3CB2A 4I0WB 4CKBA 4Y0VA 3ZNPA 1M2HA 3G68A 4E70A 4Q48A 2CJWA 4JCCA 3VU9B 1IRIA 3NT4A 1Y5NA 2B4YA 1J8QA 2B5VA 1KI9A 2B21A 1W36B 4X3OA 1FTSA 4BNVA 2RGNC 2WICA 4RZ2A 1GQFA 3V4FA 1DCKA 4ZV7A 1GL6A 2L18A 2QXTA 3ZU2A 3O5AA 4F2WA 2IXFA 2PH5A 3HC7A 3GQBB 4DMCA 2Y05A 4YO7A 4CV2A 4EHJA 1KC3A 2G5GX 2W9XA 4DCPA 4EA8A 2D5BA 3JPWA 4WH0A 3RG2A 2O7VA 1F51E 3L5KA 4P0TA 2XIQA 1SHTX 3GRKA 5DPMA 6AT1A 2XQJA 4L6CA 4IXWA 4NRDA 4XW2A 1N5KA 2QMOA 1SCJA 3DULA 1CRQA 1NBOA 1OHHA 2QX8A 2X0KA 2WTMA 1E1DA 1GY8A 3DAYA 4U6NA 2BKAA 1Y1QA 3IMEA 2QHXA 3HH8A 2Z1NA 3RSQA 4EP1A 3I2FA 3NTVA 3U09A 3SHQA 3KWMA 4P83A 1VHDA 5IH3A 5F2EA 4BNLA 3B13B 1H8ED 2H4HA 4WIAA 1K1EA 2VCEA 5AK3A 2VZ0A 4KQ9A 2P2CA 1AX9A 5CFOA 3X1DA 2UUAB 2YMQA 1UBKS 3KT0A 1XRPA 3FJYA 4MWEA 4XA8A 3PEYA 4M9UA 1ZCAA 1ICIA 1MB3A 1REQA 5K0CA 1QRUA 3I9JA 2P6NA 4XSHA 4B35A 2FXIA 3JASB 2YWGA 4CWAA 3P9CA 2JFUA 3KPVA 1GYPA 3H7IA 2ZB4A 3CTPA 4EGSA 1PT8A 3BE8A 1XZFA 1IZ0A 3L0IB 1UC4B 1SULA 1GXSB 2PL5A 3NTUA 1QNFA 5FOUA 2GWHA 3D7KA 5CXXA 1ODSA 1YASA 5IDQA 3IUSA 5LQMA 3DKVA 4WNAB 4RJJA 4Q39A 1M34B 4Q1AA 2FMIA 3W06A 2NZYA 4JU9A 4L6AA 3R2JA 4OLJA 1UXHA 4MK4A 1O96A 3LXMA 3RYFB 5JRDS 5A3QA 4GC5A 5A7GA 1SUAA 5BNIA 3VNAA 1D0VA 3TG2A 1FP4A 1Q77A 1B15A 1J00A 1Y8RB 3U49A 1G5RA 3BXXA 3ROXA 2O2GA 2W2QA 2FP4B 3U3XA 4B74A 5HWSA 5JHGB 1G60A 3MTIA 4IJMA 1G63A 1E8DA 3AWDA 1SR8A 3N8DA 3HFSA 4KITB 3BWDD 3MJTA 2Y3IA 1NLZA 3EZFA 3BJEA 2AUMA 1QPBA 1STOA 1YMVA 2C8JA 3A0RB 4PSUA 5C4MA 3N2KB 1L5ZA 3T5GA 1HQCA 4ZOLB 2GAAA 3LD9A 4J0HA 4JHXA 3TBHA 1ZW1A 3L0DA 2VTBB 4RVSA 4Q9AA 1WEHA 2CDBA 1AQJA 1UMKA 5B4TA 3HKCB 2Q3EA 1NNEA 4C03A 5T57A 4KR6A 4FEYA 3RBAA 3SD7A 5KYTA 2ALJA 3K5IA 1NJ1A 1NM5C 3ZY5A 2C84A 1W6RA 4EYSA 5K7SA 4OB7A 3RFFA 3VZDA 2BIFA 4IM7A 4UM5A 1LVUA 2GT1A 4D4KA 4BRZA 3BZUA 2Y66A 4MYDA 3IHLA 4NZNA 1EDZA 1H5QA 3UN1A 4YRCA 3MB8A 5HIKA 1RLMA 3H75A 3DMGA 2AC2A 4OBXA 3CT4A 5EYPA 1DEOA 3O26A 2QRQA 4HDNB 4KPFC 3ZPXA 4CIXA 1KZ7B 1A2KC 1EK2A 3H5VA 5JR3A 5JVDA 3STTA 2W2KB 3NHYA 3CLRC 4QO8A 1TKRA 4MV8A 1CDZA 4OK6A 5IF3A 1TTTA 3NMUF 4J1QA 1WF6A 4ERXA 1FP6A 1YVRA 1IWBB 4N0QA 2NV0A 2J9ZB 2W48A 1YJ8A 3QG5A 3ELYA 2XMSA 3OJEA 4MR8A 3JTEA 3CZ4A 3KQQA 5KJCA 4GSKA 3KRTA 2X6TA 5D3MB 1N8TA 1IN1A 3BZBA 1LLQA 3EARA 1XTZA 2CSUA 1DUVG 4LJ6A 5ALZA 1QK4A 1R6BX 2X0RA 1A5ZA 3JQGB 4OXKA 1G2OA 1KSJA 4ZKEA 4DCJA 2E5FA 3T5DA 5CLHA 1XTUA 4O2AF 2LR0A 5ED4A 4IYRA 4AKIA 1JEQA 4B17A 1LF5A 3OM9A 1Y34E 4LTDA 1PI3A 2AOUA 3C3DA 3D0OA 4JP5A 4LXHA 3IA2A 4WCFC 3AR3A 5EYPB 3V48A 1UEJA 4JUBA 3JSAA 4KB5A 2FFHA 1JDUA 1SXJD 2QW1A 4GLBA 1ZH6A 4MR9B 4B3CA 1L3CA 3KR0A 5JRZA 1DZIA 4J0DA 2YCBA 1TYEB 3M4YA 4KE6A 2AJLI 1FSGA 4V2IA 4HRVA 5NULA 5T8KA 5I8ZA 2PR2A 1E79A 3TSCA 3TR6A 2H0RA 4RCZA 1MABB 2G40A 2ANCA 1Y3IA 4AWAA 3DP7A 1XDGA 4QICA 1IY0A 3VV3A 1C9NA 2PKEA 1G9TA 2F8LA 3EXG2 1V26A 1A72A 1DARA 1E94E 1V1MA 1JNXX 4RJ2A 4J3NA 2JLUA 1NI4A 2J3IA 3JAMA 3A9TA 2E4WA 4B1FA 2OV2A 2LD4A 1HK7A 2FFAA 2W6JA 4H77A 5LB2A 1GTMA 3GCWA 4JASB 2CNKA 4GNKA 3UG7A 2I2XB 3GDWA 2PRSA 5E7IA 3LYLA 4F8YA 5G40A 3R7NA 1RW4A 2Y92A 2ZYAA 1CIVA 4PXYA 4YQFA 3TOCA 5A3SA 2OG2A 3EXHA 3W1EA 4BLOA 9ABPA 3DBHB 2CV2A 4IILA 4GZMA 2GXQA 4MMZB 4YROA 3QE9Y 2AXNA 4ZJUA 3LVFO 5F2KA 2QPOA 4UAVA 4TMTA 3A4NA 1L4UA 5BW4A 3B53X 3VBCA 5FA6A 4YJFA 4WXMA 3BERA 4MPTA 4XDGA 2HHCA 3VMMA 3NEYA 1TCVA 1GZ6A 5J2UF 5EP3A 2QL9A 1JLLA 2AT1A 4FQ8A 3HN2A 2SKEA 1T0BA 4MWGA 2DF8A 4AY5A 1B1CA 3PFFA 2Q07A 4JQSA 3VYWA 2UXCB 1IAVA 4I4IA 5I7UA 2FZ5A 1GZUA 4DPLA 3TTUA 3W79A 5CH5A 1BYIA 1VL1A 1C3OA 1D2RA 2WSYB 1TGYA 4JLJA 3W8RA 3IEMA 3U44A 3GFVA 4LWOA 5FH9A 3E81A 2OPBA 4S0ZA 4GL2A 3T7RA 3UMRA 3WMEA 2YXLA 5FO0A 3PQ4A 1LW7A 3U9TA 3E9EA 4R1OA 4MDYA 4XDZA 3CO5A 3HL4A 2R7MA 5FOVA 3TTWA 1DIHA 2R6JA 2O0LA 5C46F 2BLLA 5JNUA 2B35A 4HWRA 2QTRA 1GU7A 3IOBA 1XPRA 1I51A 4RAQA 4CMHA 1SQ5A 4ZAWA 2WM2A 5FORA 1UXJA 2Q7XA 1YE5A 3PWZA 5EWJA 4C22A 4QLOA 1H2ZA 1XMJA 4P3KA 3HCCA