3AKYA

Stability, activity and structure of adenylate kinase mutants
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Adenylate kinase
molecule keywords ADENYLATE KINASE
publication title Stability, activity and structure of adenylate kinase mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akyA00
1ZIOA 5EZ6B 1XPOA 2VHUA 2VSOA 4NYMR 4C7OA 3IBYA 3DKVA 1SKYE 2BVNA 2D4HA 1ZM9A 2OSBA 1SXJB 1KSGA 3FKSA 3Q72A 5AJVB 2V9PA 4R2IA 1N6RA 1F3OA 5B58C 2IYTA 5L3QB 1PJRA 2YHSA 1UAAA 4HB4A 4YXWD 5E7JA 2XXAB 2HYDA 1WE2A 4ZI2A 3KXIA 3OF5A 4DLUA 1W4CA 4WBSA 2CL7X 5IF9A 5CDFE 3M1IA 3ASZA 1ZCAA 4LUCA 4BFZA 4CEIA 1KI4A 3E2IA 2WAYA 4P31A 2Z4SA 2H57A 2CCGA 4M1TA 2JDIA 4BASA 3GFTA 2D62A 2OESA 2P6NA 2IS1A 2ZJ2A 2IYXA 4TMKA 1TNDA 3SN6A 2WJGA 1IN8A 1W36D 3C7KA 1E1RA 1NJGA 4OKSA 1IN4A 1JB1A 3IIMA 3IIJA 4IEEA 2XJ9A 4Q9KA 5HCNA 3WBKA 2WOJA 2QPOA 5BYJA 3UANA 3BERA 3U3OA 1KOFA 3QKUA 1NY5A 2XAUA 1RJ9A 3LDAA 4TLDA 3K70C 3NC0C 1Z8FA 4O25A 4QGAA 4CDGA 2ZSBA 4E09A 5B30A 2IC5A 1ODFA 4M1MA 1P73A 3W5JA 4EPXA 1XPRA 3OFND 1Y63A 3TIFA 3QKRA 2EWWA 4A6PA 4RZ3A 4CZ2A 1DADA 2A7QA 3BBPA 4X8HA 4D25A 3QE0A 4AI6A 2I1VB 3G82C 1MO5A 3W34A 5SZHB 3TSWA 1XBTA 4ERNA 2RGGA 5AJWA 3KKNA 2ZYWX 4IDQA 4LPSA 4LX0A 2W83A 4ESHA 3HPRA 4L9SA 2HXYA 2J1LA 3TNFA 5J47A 1LB1B 3LLUA 2BHRA 3OAAA 3FKQA 5CITA 3L43A 1NJFA 5KPDA 1G20E 1U99A 4PAQA 2D7DA 2JLXA 4HLCA 2ERXA 4PFSA 4JKIA 1OFTA 4PQFA 1DAMA 3ZQ6A 1X8JA 3THYB 4Q1CA 4TMXA 1DELA 4CVNA 2Z83A 3BB4A 2FMXA 2ZUDA 4KI0A 1BS1A 2FN4A 2HCBA 2VF7A 1NN1A 1OIWA 2CL0X 5DI9A 1QG4A 3W9YA 1GNQA 3U7HB 1E9RA 3B13B 5CK5A 5FPSA 1NF3A 2J59A 4DDWA 1SVLA 1FZQA 5E4FA 2OBNA 4UJ3A 3RABA 3LFUA 5DHFA 2ZI4A 2CJWA 2ASEA 1WXQA 4PANA 2YOFA 4TMTA 5D3QA 2ZVQX 3K0SA 1U98A 4PSKA 4MYHA 3KXKA 3THXA 2ZI3A 2GWHA 5CK4A 1ZYUA 4DLXA 4XH9B 2CK3D 4W9MC 3PEYA 1VECA 1EGAA 1OXXK 2KSQA 1OPXA 4A92A 4K46A 3WMEA 1JQJC 1W5TA 1YZLA 5FL7A 4QBIA 1R4AA 4F93B 1K6MA 4M1KA 4BFXA 4AYTA 1TU4A 2B6HA 4TMZA 5FTNA 3C14C 3Q85A 2GCPA 3M4YA 4HUTA 5A0FA 3CNNA 1KGDA 2ZJZA 3W8NA 1Q3TA 2FFQA 2CMKA 5IT5A 1N5JA 5KDOA 2H1LA 2FGKA 4TMWA 1P2VA 4IOMA 2IYYA 3L0IB 4B33A 5JZVA 3SFZA 2CLSA 4Q1AA 4R9UC 5CLLA 2GCNA 2G0TA 2WJJA 1IXSB 1KJZA 3KTAA 1Q1BA 4N1AA 2IYVA 4KBFA 3RC3A 4DT1B 4F4CA 2CE7A 1MOZA 2XZOA 4TZ6A 3LLMA 2IA5A 2J0UB 1D9XA 1MO4A 3VQTA 2V55B 2YWGA 2X19A 3QY0A 3BH0A 4JLAA 3TAHA 2JATA 4KU4A 4KFUA 1QVAA 4TTPA 3DZDA 2H92A 4D0LB 2YC4C 4LPKA 4JJZA 4M9XA 2G88A 5CJ2A 1E2NA 1DS6A 2DWQA 5FPTA 3FVQA 5A5GA 1DO2A 1OFUX 1WRBA 5LB4A 1JR3A 3ASYA 2WJHA 3DEFA 3VTKA 2HJVA 1GITA 1Z5ZA 3AF2A 3IDQA 3IPYA 4JIMA 3ZVRA 2TMKA 3KJGA 3CR8A 2WM9B 4IXMA 5FR2A 3V00A 4ZCMA 4QGGA 2X2FA 2BC9A 3HR7A 3PUVA 4HAWA 4U5XA 4CGZA 2WWIA 1NLZA 5HKKA 1J99A 1J90A 3TQFA 1E2IA 5EXXA 2IYWA 4QBFA 4TSFA 1XRJA 3CH4B 2WAXA 1SKYB 1RIFA 4RY2A 3SE0A 3NVAA 3VKGA 4RFSB 2CLDX 3WMFA 4ZDWA 1S0UA 4LSGA 3CX7A 4Z54A 1GRQA 5ELXA 3I62A 3IO3A 1BH2A 4TYPA 1OHHA 1E9FA 4H9GA 4JMPA 1KO7A 2O0HA 2GZDA 2MMCA 4JL5A 4TQ9A 2J5XA 2GCOB 2P5TB 2FSGA 2EFDB 4YMUA 4NP6A 1TEVA 1RRGA 5BW8A 1FPMA 3A1VA 1ZNWA 3O8DA 3QXHA 1RZ3A 3A1SA 1BMFD 1NBME 3R8CA 1ZUIA 3K53A 4B71A 2KJQA 3E1SA 2B8WA 2CVFA 4G3XA 3Q7QA 2PMDA 3AV0B 3KUCA 1YZGA 3FWYA 1IJFA 5FUVA 1VPLA 2VA8A 3BE4A 1NMXA 4GI7A 4GOJA 4PPNA 1S9DA 1Z6XA 1U8ZA 5K8LA 4P4SB 4EPWA 2F43A 3VHXA 1U8AA 4GT1A 4G0NA 4LHVA 2P6UA 3BD9A 1VCIA 4LBVA 3VFDA 3B5JA 3F5FA 2ZRKA 3B1XA 4LV5B 3AEZA 4IDOA 4NYIR 3LXXA 2ORIA 4DLSA 4NHOA 3H1TA 1V5WA 3QPWA 2A5DA 4IHQA 2QSYA 4TYQA 1L2TA 2QTFA 4PC6A 1ZNXA 2R6CA 1KI2A 1ZU5A 1S96A 5EUQB 2N1BA 5IRCD 3V9PA 2V6IA 3GEIA 2OT3B 1JAHA 2JJ2A 4NCHA 2W6ID 1N5LA 4LK2A 2A30A 5KNDA 1E1QA 3QF7A 2ZU0C 4IJMA 3IO5A 1T3LA 2VTKA 1E0JA 4TL7A 2ONJA 1OT3A 3A6PC 4US1R 1AJEA 4EFNA 1KI8A 1VKJA 2HXSA 1HURA 2YC2C 4URWR 3WHKA 4F7WA 1DG3A 2PZGA 1W36B 1ZD1A 1QHYA 4J0QA 2KB0A 3WYFA 1HE8B 1KDTA 2XTZA 4C9BA 2DYKA 4KO8A 2DBYA 4FINA 2QPAA 4Q7JB 2AWOA 4C30A 1M2OB 1XZQA 4MDEA 2WPDA 2FF7A 2BWJA 1E9SA 2EU8A 3I3SR 1E96A 1GL9B 1X6VA 1IBRA 3B6EA 3ZIAA 1U81A 5JRZA 3CBQA 1XD2B 2DWPA 3QQ5A 5FUXA 2O8BB 4A0GA 5F9FA 4M9QA 2ZRFA 4A0FA 2O52A 3U3RA 5GVSA 3AVPA 4IOJA 4C0QC 2ODEA 2IHYA 4M0LA 4PPFA 1ZIPA 4RZUA 4B74A 3PENA 2JDID 4RKFA 4TLBA 3UG6A 5HPYB 3FMFA 3AP2A 3TUIC 2W2XA 4GMXA 5TV2A 2IT1A 1ZD8A 3O8RA 1E1RD 1WF3A 1R10A 2AXPA 4ILEA 4IKEA 4YDSA 3TVDA 2RHDA 3X1YA 5FTMA 2GJAA 4TTRA 2W2VA 1VCMA 1W49A 4TLAA 5K8IA 2GVZC 3K8YA 4CEHB 3B1ZA 2WWXA 3A1TA 1CU1A 1P4SA 2QQEA 4F91B 1DEKA 4LC1A 4ARZB 5L8VA 2REOA 2XX3A 2WIBA 2FPKA 4I1VA 4IW3B 5DO9A 2OILA 2F3RA 2WJVA 5L3RA 2QMOA 3ZJYA 1CP2A 1P2TA 1BYIA 3GJ3A 2RGEA 3BJIC 4HUQA 4A0HA 1QHHB 1SQ5A 1P6XA 1U0LA 1FX0B 3RS3A 4YMTA 3OAAD 2O0JA 3R9IA 3DVLA 3HWSA 2ZUCA 3F3YA 3LBIA 1YR6A 1CJKC 1ZU4A 3SYLA 4HLUA 2NO0A 2A5YB 1CXZA 1T5LA 2C95A 3GLIB 1T91A 1KK3A 5D3MB 1MO6A 2GHIA 2X1VA 2ZR7A 1JNYA 2ODNA 2Q0HA 1N0UA 1GVNB 1R8QA 1C9KA 2OLKA 2QI9C 3OE7D 4C4PA 3RC8A 1XTIA 1KTVA 4PQRA 2ZE7A 4QHSA 3PQCA 1Z83A 5TXGA 5JRJA 5KPJA 3KQNA 2GBLA 4ZDJA 3L0SA 3BIFA 1XTJA 1R2QA 2YOHA 5J4HA 2ZE5A 1XMIA 4BWYA 1ZM2A 1EFTA 3GJ6A 4DRZA 4DSTA 2HJGA 2RGAA 3ECCA 4KODA 4KFTA 2JASA 4Q4JB 2H16A 2CCJA 1TQ2A 3EC2A 3GLGB 2BMDA 1AGPA 4NCNA 1TPZA 1Z47A 1PV4A 1Q57A 4EPVA 3B1YA 5KSZA 2IYSA 1A2KC 3SBEA 1SXJE 1E98A 3TSZA 1YR7A 4LHXA 5FBLB 1VDZA 4RD0A 4HB2A 2JLWA 4HDCA 1P9WA 5FOVA 2ZI6A 5BYKA 2PEYA 3B9PA 4JBXA 1ZAKA 1YVDA 3MFYA 3U7FB 2EFHB 3HDTA 3WBJA 3TGPA 3VNUA 2ZEJA 3PITA 1CTQA 2B21A 2GXUA 4JVSB 1E2HA 2PMKA 2FH5B 4TYNA 2ZRDA 1EFCA 3KUDA 1N3BA 2J7KA 3U3JA 3I73A 2W6JA 1KI3A 4B32A 1I4LD 4QC2A 3AVVA 3OHMA 4ZV4A 5FTKA 1FQKA 4JVNA 1YRBA 2I3BA 1Q44A 2F9LA 1M8PA 1P2UA 2FZ4A 4P3YA 1CJUC 4CYMA 3RS0A 3AVOA 4GRAA 2O8FA 4IOKA 4DDUA 5AJXA 4B44A 1E2PA 2VSXA 4AC9A 2RGDA 4OQXA 3CO5A 4DDVA 2WOOA 4Q4HA 3ZZTA 4R2HA 1WP9A 2R9VA 1E9EA 2PCJA 3ZYCA 1CR0A 1LF5A 3NBYC 3T34A 1TMKA 1TF5A 2A9KA 5J4VA 1JR3D 2VQSA 5C2JB 4NH0A 2Q9AA 3QENA 4DCUA 1KKLA 4URYR 1EXMA 2IWRA 3RWOA 1YZTA 1M7BA 3ADDA 4Q4AA 1HYQA 1OB2A 4RKEA 3Q5EA 3D31A 4JT2A 1M6NA 1JECA 5EXSA 3G0HA 2R62A 3EXAA 3X1DA 1KK1A 1MO3A 2D3WA 1VG9B 2V6JA 1N6HA 1JEDA 4MYCA 1T3SA 4TSFD 3ZVMA 3OEHA 5JMTA 2EWVA 3NIBA 5JSZB 2SHKA 2PT7A 2NG1A 3KKQA 5FH9A 4XD7A 1TEXA 3GLFA 1RW4A 1OB5A 2GAOA 4FD2A 3BFKA 4LHZA 4M21A 4Q1DA 1ZNYA 1XXHB 1KY2A 2ORVA 2RGNA 2YJTD 4H1UA 3DMDA 3LH5A 3T1OA 5FOUA 2QP4A 3WRYC 4GP7A 4RJLA 1DOAA 2WSSA 2BKEA 1J8YF 1R5BA 1YRAA 2VEDA 2IYUA 4Z1MA 4URXR 4FWTA 3BOSA 3OIVA 4M1SA 1HQYE 1KMHB 8OHMA 5FFMA 1KMQA 2WTUA 1CRQA 3T12A 2ZM5A 1Z07A 4LY6A 4F4IA 3B85A 3K0FB 3ADCA 2BOVA 1V43A 2Q3MA 3IILA 3SNHA 1RRFA 4Q66C 5TARA 1U0HC 5EE9A 1KZGB 2GXQA 2OFOA 1ZM3A 3K0AB 4Y0AA 3AKEA 3T35A 2J0SA 1PLLA 1SKQA 4KSCA 4U00A 2WHXA 1O3YA 2VP5A 2I4IA 1G41A 1II9A 2RHMA 3P1JA 4OK3A 4RFVA 4A8JB 4AG5A 1ZC4A 2Z4RA 2OUKA 3B82A 1G18A 3VR3A 1IY1A 1T3HA 3PUYA 1FTSA 1N5KA 2ZQ5A 1G21E 1W2HA 2VP9A 2Y8EA 4X8OA 5JEEA 4GDFA 1G6OA 2IUTA 1E3MA 4C7OB 5JJIA 2YWHA 4PC7A 1IAQA 2F1IA 1XJCA 1MH1A 4YDHB 3EW9A 2QAJA 1G8FA 4GMDA 4HZUA 1NN5A 4PHTA 1KKMA 4UXIA 3MGCA 4FMDB 2R8RA 3BORA 3PFIA 2CHVA 1Z06A 2PZEA 4JLNA 4F38A 1GWNA 2JJ2D 3Q7PA 1LFDB 2IXGA 1AN0A 3I92A 4P4UA 1E1QD 1GL6A 2ZRLA 2QBYA 2PLRA 1A7JA 3GJXC 5J40A 2F1JA 1CJMA 1E4VA 2QP9X 4XSGA 1DAEA 2NPIA 1GOTA 5C1BA 2GTPA 3MAAC 1OIXA 3LAWA 2BBSA 1AZTA 1PUIA 3CX6A 1W46A 2FPLA 2NZ8A 2O8EA 4AKHA 2HUPA 4ABYA 3U7GA 1CR1A 2FJUA 2FFAA 4QJ4A 4S2EA 5SZIA 1NIJA 2WPDD 3JVVA 2XB2A 4IFEA 1R5OA 2GZHA 3N2IA 1E2QA 2JLSA 3H86A 3MD0A 4V0MA 2VP4A 3ZIAD 3AVQA 3QVUA 2RGBA 1H65A 1AKEA 4HLUC 1WA5A 2Q21A 3TKLA 3TSOA 4BEJA 3I5XA 5FR1A 2C98A 2P6RA 1HH4A 3EPJA 2FSHA 2ZVPX 4US2R 5M04A 2IW3A 4B3XA 4LJAA 1G8PA 5E95A 1BYUA 2ATXA 2ONKA 2QNRA 3MCAA 5LBIA 2W0MA 3R7WB 1W7AA 3DOEA 4WZBE 4UNSA 3SR0A 1FQJA 2Q9CA 3RRMA 5KSOA 4TZ0A 1TTTA 5GJWC 2GBLC 5FUWA 5FBVB 2QL6A 1XEFA 4DSNA 2Q3FA 5EJEA 3C8UA 1KI6B 1G3IA 4RD4A 1Z3IX 3C5CA 2J7PA 3U6KA 3PJRA 5LD2C 1UADA 1O87A 3ZGXA 3AKYA 1IXRC 5FBQB 1JXMA 1D8TA 5ANRB 4KV9A 1H8HA 1GL7A 4BFSA 4EIWA 4EFLA 2IL1A 4D0NA 4B47A 4LJ6A 1K5DA 4MUBA 4QBGB 2H7VA 3EX7C 2AWNA 3THWA 3MJHA 5IDVA 3VR4A 2GESA 4LRWA 2G9NA 3HYTA 3QBTA 4HLDA 2VLIA 4A2QA 3CNOA 4ACBA 3MLEA 4PPGA 521PA 1F2UA 5DN6A 4IOLA 4L5BA 3RSOA 3CRQA 3THXB 1F2TA 5G41A 1XZPA 4M1WA 2J45A 3S1AA 3FTQA 4BEBA 2Z43A 4XIGS 4MDFA 4Q02A 3IEUA 4B73A 2KI5A 3QG5A 2ZAMA 3N5CA 3VR1A 2ZREA 3RS4A 2X2EA 3RVBA 1SHZA 4PSVA 1OE0A 2GF9A 3CH5A 4P0TA 4U02A 2MSDB 4C0AC 1HT2E 3IQWA 1P9RA 2QUZA 5LPNA 3EPHA 2QE7D 2GKSA 3RNLA 3CONA 2BCJQ 1WB9A 3BH7A 3RAPR 2D2FA 1ELOA 2YOGA 4QKQA 1X86B 3TK1A 2XNSA 1HE1C 1U9IA 3UKDA 1SXJA 1NL3A 1OV4A 1QRAA 2A5FA 3ZD6A 3VX4A 2IUSA 1FP6A 4D81A 2NMVA 2YINC 4ITRC 1Z6GA 4KYUA 5L3QA 2IXEA 2HT6A 3A1WA 1Q0UA 3AUYA 3KTAB 2XXAA 3U4QB 1EX6A 3Q9LA 5DSZA 4M1OA 1Z6TA 2DY1A 4D2IA 4MRPA 2ZR9A 1AKYA 2CBZA 1Z0KA 3A36A 4KCGA 4D26A 2AL7A 2HLDA 3NKVA 4RD3A 2O0KA 2PCLA 1XTKA 2BBWA 2UZIR 3DDCA 4HSEA 1YJ5A 4FI3C 4M8NE 1NRJB 3K70D 4G5RA 3CPEA 4B6EA 3A8TA 3GLHB 2YYZA 4DLVA 4GZLA 3CRW1 1WCV1 1KO4A 3VX3A 2ZITA 2V1UA 5UKDA 1HEIA 1UEIA 2P67A 1VTKA 2OCPA 4FMCB 4U7DA 3BB3A 1ZJ6A 3MG9A 3K0EA 4LCBA 4W5JA 2RGNC 4CW7A 4DLZA 1ZC3A 2N42A 1MABB 4LOAA 1S3GA 1E2MA 4DIEA 1NP6A 2W6JD 4V0OA 5DHAA 3KJIA 4QJ5A 2W58A 2Z5FA 3C4JA 4DCVA 4ZO4A 2QAGB 1DAHA 3QVVA 3V4FA 1E99A 1G4UR 4KITB 2V3CC 3L8YA 3LNCA 2ZJOA 4UNRA 2LKCA 4NMMA 5H1YA 1BOFA 1FTNA 3P26A 5DGXA 4PX9A 4L16A 5CB8A 4PR0A 2IUUA 4V03A 4BFVA 1S1CA 5JI2E 3QKTA 1Y3AA 2WZQA 3FB4A 4A1FA 3WRXC 4D6PA 2ATVA 2AK3A 1G17A 4LGMA 3H2YA 1TX4B 3PR1A 5A4JA 4A15A 2VHCA 2JLYA 2WKRA 1N6PA 2XOKA 5SZKB 4D4JA 4PQYA 2WVJA 2MSCB 4HZIA 1GKUB 5HR5A 4MRRA 3U2QA 4POAA 2JLQA 4TN1A 4QGFA 3X2SA 3TE6A 4LC0A 4IDPA 3PIRA 2XZPA 1DBSA 1CS4C 2ZROA 2L0XA 2OAP1 4Q7KA 1XEXB 3DHWC 3CM0A 4DLWA 3GLIE 1Z0AA 1A5TA 1KK0A 2V8OA 3UIEA 3K9GA 4KHZA 1N6OA 3OEHD 2ORWA 1T8TA 2F43B 3EIEA 3FE2A 4XD7D 1RFLA 4FCWA 4LJ4A 2P3SA 4M53A 3BH6A 4EJSB 1GRNA 2IBMA 1VCOA 3UXMA 1YHNA 1T0HB 3MWKA 2YKGA 1XJ0A 3CR7A 2WSSD 1E0KA 3JZAA 4HI0E 3RANA 1RYHA 4PZZA 2FPMA 4Z1MD 1FNNA 3JZMA 4JSTA 2MSEB 5DH9A 4WOPA 3R9WA 2AKYA 1NN3A 3GLGE 4NL4H 1UF9A 4IRUB 1YZUA 4PPQA 2CE2X 1TL7C 3CF0A 4FCVA 3VU9B 4N0EA 3FOZA 2ZSFA 1EFHA 4FCTA 4NYIQ 4EQ6B 1W44A 2WV9A 1SVKA 4JJKA 1P61B 3AP3A 4Q48A 1G16A 1US8A 3GFOA 4HLQB 2AXNA 5G3ZA 3QIAA 4M9SA 3U3KA 3GD7A 1XX6A 1LVGA 4WAUA 3AVYA 2ZR0A 1CF4A 4NYJQ 4IEIA 4LYFA 1AIPA 4MGKR 3T1QA 4KBGA 3NWJA 3K0CA 5TVKA 4DT1A 2OM2A 3CWQA 3ND9A 3OESA 1TQ4A 4OQMA 3VR5A 4DCNA 1EFUA 1P3JA 4Q9JA 3VR6A 2PJRA 3C41J 1CJVC 2ZI9A 2GK6A 4HAZA 3U44A 2WKQA 1KO8A 2OO7A 1IONA 2HYIC 2NQ2C 1G3QA 3WP1B 1YZKA 3NBFA 3W6NA 1Z6YA 2CCKA 2RGCA 2P5SA 5SZJA 1W2GA 3IHWA 5JWRA 4JZKA 3T5GA 2QQ0A 3NHBA 2ZRCA 1S4QA 3R9XA 3KX2A 4P4TA 4D4LA 4JS0A 4UXJA 5BN3A 4QM6A 1PZNA 2AHOA 4DLTA 4DWJA 2ZRJA 2ZRAA 2GJ9A 2ZAOA 1EFRA 5P21A 3NBZC 5KSYA 1Q1EA 2FV8A 1Z08A 4QG7A 5HE8A 3SQXA 2XGJA 2QTVB 1T6NA 2ZETA 1IOZA 4YLGA 4JLOA 1G7TA 4OJQA 1E2FA 1QF9A 1R6BX 3QEJA 4NYJR 3SC3A 2PX3A 3ZD7A 1LNZA 1ZINA 2OEPA 3OIWA 2OE2A 2JLZA 1J70A 3CW2A 3FMIA 1P7CA 2BBTA 2WICA 2FFBA 4ZDKA 5C46F 3MSXA 2G83A 2FX3A 3F8TA 2YVUA 3EZFA 2LCFA 3AM1A 4CRWB 1OKKA 1SVIA 4DIDA 2ERYA 1FMJA 1BKDR 1N6IA 2QRNA 4V0KA 1U0JA 2G3YA 2H8KA 2GF0A 3BK7A 4B6FA 4BLTA 4V0LA 5CDFA 3Q5DA 4YONB 4CT5A 1G6HA 2OAQ1 2OCBA 4MQBA 4BUJA 3CZQA 5BWMA 3FKSD 2ZI7A 5KO2A 2BBOA 1AS3A 2ODBA 4R7ZA 1B0UA 4JLDA 2MMGA 4HUQB 2QMHA 1GM5A 3QPVA 1ESNA 1I2DA 2GCOA 1QHSA 1XEWX 3AGPA 3UG7A 4D4MA 3FMOB 3UMRA 3VR2A 2IYZA 3LBHA 2R2AA 3PEUA 4KLZA 4KSBA 3SJCA 1EX7A 1XXHE 1A2BA 3J81k 2FG5A 1XPUA 1DVRA 2GK7A 2PZFA 1UPTA 2YWEA 3TR5A 4B75A 2J7PD 1U9IC 1SXJC 1UKYA 4G5SA 1UJ2A 1IN7A 2OCYC 5G40A 3BRWD 5GADl 5EE0A 3R20A 4C0SA 4P4SA 1UEJA 2JIZA 2C9OA 3AF4A 4XOIA 3W5IA 1OFHA 1OYWA 1D2EA 4WIAA 3L82B 3CRVA 1Q3HA 1E0SA 1GP2A 4TTQA 1ZUHA 2N46A 1GIAA 5F2EA 1L8QA 2QP3A 4LJ8A 1S9HA 1M74A 5KUTA 1R0ZA 2J46A 2IWHA 4IDNA 3DM5A 2EQBA 3QG1A 3D3QA 2ANCA 1P2SA 4M9ZA 2ZTSA 2XZLA 1AK2A 2BDTA 2CXXA 2OHFA 5DN6D 1GTVA 1NSFA 1R0YA 2ZE6A 1W0JA 4Q9IA 3QXSA 4Z8XA 2B7BA 4JVLA 4OHWA 2O8DA 1ZM4A 4LDJA 3GPLA 5BN4A 3C16C 3WNBA 2ZYVX 1AQUA 3SOPA 3MMPA 3P4XA 3DZ8A 3TR0A 1E6CA 4ZKEA 5KOYA 5HZKA 2VHJA 1G8YA 3AKCA 4AURA 3K70B 2ZSEA 3N2EA 2C96A 1YE8A 3LRPA 2GRJA 3QSYA 5AUQA 1ZUNB 2YNMA 3N70A 1KIMA 1IJEA 2WBLC 3AVUA 1MR3F 2KBEA 4ZCLA 5FPHA 3SEAA 2FZLA 3AF1A 3CX8A 4TWZA 4JLJA 4RD1A 1S2MA 3KB2A 2PJZA 2X8AA 4B43A 1K5GA 5AUOB 5TMPA 1E2KA 3REFA 3QOFA 3CLVA 3OFNA 1XD2A 5C4MA 3TLXA 3B1VA 1GILA 2O8BA 2J0VA 2HV8A 4V0NA 1IY2A 2HT1A 1NKSA 3BGWA 4OI4A 4QGHA 4RZ2A 1RRCA 4WVFA 2BV3A 1XP8A 1OJLA 1LY1A 2E87A 1T5IA 1EESA 1U94A 3PVSA 4FN5A 3TVTA 1KI7A 1VG1A 2D74A 2HLDD 5JECA 1DAFA 1LS1A 4IVPA 3WXMA 1KNXA 2C03A 4I99A 2GXAA 2F7SA 2NO7A 2O5VA 3EPLA 3RHFA 1Z0IA 1ESMA 4TT3A 3GJ0A 3AP1A 4JBWA 3TW4A 4Q4HB 2RB4A 3IQXA 4BLSA 3UPUA 2GNOA 3KZ1E 4OHYA 3LX8A 1Z2AA 1AS0A 2B92A 1T4GA 1FL9A 3K9NA 3UK6A 3KJHA 1T9HA 4RCYA 2JEOA 4DZZA 2QZ4A 2R6AA 5FL7D 1T8UA 4MYUA 4BGDA 3NEJA 4JKYA 5JS8A 5EP2A 3U7EB 4GFDA 5AJZA 3ND8A 1GNRA 4ZCIA 4L15A 4ARZA 2W2TA 1XFAA 2JLRA 3M6AA 2VHQA 3UMSA 3W6PA 4C0KA 3OEEA 1QBKC 3CPHA 3IKJA 4GNKA 5JJLA 2EVWX 2QY9A 2LWIA 1TF2A 4K81B 1J8MF 4P33A 1Q20A 3CWZA 2ZANA 2CLCX 3SQWA 4LJ9A 1DAIA 1JAIA 2WJYA 3TRFA 5FTLA 1NG1A 4Q5IA 1QHHA 4OQLA 1KSJA 1VMAA 3GLFB 1FX0A 3QNUA 3U61B 3CKLA 4LJYA 5C4GB 4QOSA 3AUXA 5EP1A 4BFTA 2O8CB 3L8ZA 1L4UA 4LYJA 2J3EA 3VKWA 1YR9A 1G5TA 3PG5A 4UKDA 1XCGB 1Z6AA 2QM7A 2R6DA 3W3AA 2JJ8A 4BRWA 4JVMA 3WYGA 3GLIA 2XOKD 1Z0DA 4FMDF 5D3MA 3QF4A 3RS7A 2ZYUX 4JLPA 4OK6A 2VHTA 3TAUA 1CKEA 3P27A 3K0CC 2A2ZA 1HV8A 3R8FA 2C9CA 2Q9BA 4PC2A 5EUMA 1OXUA 1A1VA 3VKHA 1HA3A 4LYHA 1II8A 4ZIRB 2DWOA 2FGJA 1OXSC 3NTUA 4DSUA 1E69A 1KI9A 1FUUA 3QPUA 5L3SA 1XD9A 2GJKA 1OH6A 4A6XA 4HAVA 2V1XA 5JHGB 2BEKA 3M0EA 2AR7A 4HEJA 4KJZA 4CEJA 2J87A 4GP6A 2I1QA 4US0R 5JWHA 1CR2A 1SGWA 4GOXA 3W90A 4BLOA 2CHGA 3AB3A 3W6OA 4Q4JA 4D4KA 1JR6A 3ADKA 5HKKD 1PVOA 3GLGA 2VRWA 2IF2A 3P32A 1XDBA 2OXRA 3Q3JB 3IPXA 1Q22A 4QM7A 1E2EA 2QTHA 5JS7A 5CIWA 4ESVA 1COWA 4UNPA 4BFYA 4EPTA 4N0DA 1DARA 1CULC 1DAGA 1D6JA 4LBWA 2V7QA 2ZI5A 1NBMA 4FMBB 1YZQA 1OHHD 1G3RA 3HP1A 4M4SA 4JLBA 4EPRA 1OH7A 3TUZC 2DPXA 1WBDA 1TUIA 5DISB 5DIFA 4JYCA 2WJIA 5JWOA 1N25A 1YZNA 3E5HA 1JPNA 3HU2A 5DYGA 4BZQA 2IS2A 3SI7A 1HUQA 4LZZA 3A1UA 4MRNA 3GLHE 3QEOA 1OF1A 721PA 4HDQB 5FOTA 2E9SA 2GZAA 1E2GA 1E9AA 2DR3A 3A37A 2BM1A 2AKAB 1IQPA 2JAQA 1LW7A 4Y0VA 2G1JA 4W5HA 2BJWA 2RMKA 3EPKA 5H70A 4LBZA 1F5NA 4ACAA 2QGZA 4AYXA 1W1WA 4NCKA 5GVRA 2DFNA 1NLYA 2ZS8A 4DLRA 1Z0JA 2KBFA 2IF0A 1E2LA 1TQDA 1HY3A 2ZSAA 4G5GA 2DFLA 3AVWA 2ZRHA 2KWIA 3SJZA 2J9RA 3O8CA 3P4YA 1M7HA 4NE2A 2DB3A 3RRYA 4Q1BA 4JYBA 4K8OA 1EFRD 4L8GA 4DCSA 2QORA 3B78A 4XJXA 4KYIB 1TADA 1S1MA 4PC3A 4WZAE 1FW6A 2P65A 5GJVC 5F98A 1S8FA 2NIPA 2QMUA 2XEXA 1UFQA 1J7KA 1VYTA 5DLQC 1ONBA 1EG7A 3T5DA 5AUNB 4CEIB 5H8WA 5JJKA 2RKOA 4CIDA 2H17A 3AKDA 5B64A 3IIKA 4KVGA 1G5RA 4QFMA 3NH9A 2OZEA 1CIPA 1DTSA 5JSZA 4LI0A 4AYWA 4C3ZA 3SBDA 4ZKDA 5EP4A 1JJ7A 4FIDA 1OKKD 3DO6A 2AD5A 4DBLC 2CNWA 1KI1A 1MT0A 5KDLA 1GFIA 1OIVA 5AJYA 3U3MA 1X1RA 3THWB 3KJEA 4GOKA 4E03A 4MKHA 1RJ9B 2HDNB 4GL2A 1UM8A 5FI1B 3MRSA 1KSFX 4Q1FA 4LHWA 4BLPA 5GJBA 1W36C 1KMHA 3QKRB 4B3CA 1HQCA 4MGZR 1YQTA 4B35A 1XEWY 3K0FA 3U6BA 3RRZA 1F6BA 4PHGA 3S1AB 4WW0A 1HTWA 5FTJA 3TQCA 5JFGA 5DI3A 3KQKA 4O2RA 3UWOA 3X1WA 5KDDA 3K0AA 2IX3A 1CEEA 1R5NA 5G53C 5FOWA 1UKEA 2HEIA 4R98A 2JIZD 4D0GA 3FGNA 1NKTA 3CF2A 5FBRB 1ZNZA 2ZE8A 2XTMA 4FMCF 4A4DA 4A8JA 2K5UA 4D82A 3GJ8A 2NGRA 4MRVA 1KYIA 3KQLA 2WIAA 4Q9LA 3FMPB 1XCMA 2G6BA 1OSNA 2UVQA 3TH5A 2RGXA 3K09A 5CB6A 1E9BA 4OHZA 2GJ8A 4PSAA 1OW3B 4JBYA 4LWZA 1NVUQ 4XVQA 1AZSC 2DHRA 2HF8A 1NIPA 3TW8B 2QEQA 1W0JD 4E22A 2IEYA 5FUYA 4XSHA 3MJRA 4MA4A 4OI1A 3I72A 3AVXA 1JPJA 3K9LA 2VP2A 2ZJBA 4YC7A 3EZ6A 3RS5A 4YMWA 2CJWB 2REBA 3WP0A 5FL3A 3FHTA 1P72A 4Q18A 1MV5A 2C2HA 2GXSA 4BQSA 1L7VC 2PBRA 3KQUA 5FPKA 2ZSDA 2VPPA 4MITA 3EZ7A 3LWNA 3RYTC 3NHAA 3B7GA 2H5EA 5B57C 4AKEA 3I8XA 4OHXA 1G1MA 4B2LA 4EAQA 2ZUBA 3KFVA 1DG1G 3G5UA 2V54A 4I1OA 1WDTA 2ZPTX 2ZYTX 4NONA 3FPAA 5J5CA 1NLFA 1H8EA 2DFTA 2FA9A 1U2RA 3QKSA 1KNQA 1GSIA 2WWFA 4N3NA 5B2ZA 5EE3A 4FWIB 3AF0A 3CUEF 1VG0B 5KU1A 1N0WA 3NDBB 4DXAA 1GKIA 2ZJYA 1K8RA 1N6KA 2HF9A 1Z63A 1AA9A 2QA5A 2FEOA 3PUXA 3U5ZB 2IYLD 3R7WA 3PEVA 1UKZA 4NU0A 4WXRA 4DHEA 1EWQA 4WXPA 2JJ1A 4TT3D 3EA5A 3CB4A 3EIHA 4W5WA 3BC1A 4NZYA 4HB0A 1G7SA 4OL0A 1PLKA 4RCZA 3UMFA 4BLQA 3AF3A 4JLVA 1KI6A 2OCAA 3F0TA 4OBEA 4QHYA 1FUKA 4B2IA 1VIYA 3GJ4A 4DKXA 1NSTA 4ON9A 4JLMA 5CM9C 1UDWA 5HCIA 5C18A 2BKUA 1LF0A 1XMSA 4LHYA 1CBUA 4XWKA 2EFCB 1ZRHA 3GMTA 1UDXA 1N0VC 1W0KA 2VP6A 4HAXA 2JLVA 5TB5A 2R6GA 4UXHA 5E7IA 3WHLA 1A82A 4TYYA 2ZRMA 3TBKA 3OE7A 5JI3E 1NVWQ 3NBXX 3OEED 4DDTA 5FOXA 1XD8A 3THOA 3SHWA 3WNDA 4YMVA 4C0JA 5J4LA 2P2LA 1CLUA 2QROA 5IK2A 3ZDQA 4UJ5A 5J4YA 1G8GA 4V02A 3IEVA 1JI0A 4TYWA 1N6NA 4C0LA 1I4TD 1W47A 4A36A 4L9WA 3FFBA 2ZU6A 3LY5A 3PV0A 4KVAA 4OI2A 1U90A 4KAXA 1KJYA 1W48A 2QT1A 3AH8A 1ZW6A 4C2TA 5CYOA 3WNCA 3H84A 4NTZA 4BLRA 3Q8XB 1I4DD 2FE4A 4QBHA 2IEZA 4JL6A 2GEUA 5EXPA 1DE0A 2HCJB 4R71A 1MRSA 1KY3A 4I4LA 1CRPA 3I61A 1N6LA 3EA0A 3GJ7A 4JT4A 1ZP6A 2QG6A 2GAAA 4O0MA 3L0OA 3DMNA 2DCUA 2UZ3A 3LVRE 1D2MA 4M2LA 3THYA 1US8B 3E70C 2BJVA 4YQFA 4BFUA 5FI0B 2D06A 1YR8A 5TY0A 4L4UA 1KAGA 3QBVA 1NVXQ 3ZS8A 2ZRPA 4AK9A 2YWFA 3JVUA 4PZYA 2NO6A 3U4QA 4IVRA 1II0A 4HDOB 4OHVA 2D7CA 4KFRA 2W0SA 3ZZUA 4BZPA 3FHCB 4PZLA 3WMGA 4B3FX 1COWD 1RRPA 4TLCA 1UKVY 4QRHA 3U44B 3LW8A 1GZSA 3KB1A 5FPYA 2QU8A 3OIUA 4EFMA 3I1FA 3LD9A 4RZXA 4URUR 3BS4A 1OLOA 1UBFA 2V7QD 1NBMD 3CIOA 5KTYA 3GLHA 4UNQA 1JEEA 5G3YA 4LJ5A 3QXXA 5IHPA 4ZDIA 1ZCBA 4MKIA 4YMSA 2FEMA 3ZQJA 1SVWA 4UNNA 4DCTA 4PAOA 1JBKA 1R7RA 2R65A 2F9MA 4EUNA 4IXNA 3BFVA 1A4RA 4CT4B 1MABA 3EC1A 4B3GA 2QENA 2OBLA 1LV7A 2A3RA 4Q1EA 4KXFB 4TMVA 1IN6A 3KKPA 1TQ6A 2B7CA 3CRMA 1OXTA 4RD6A 4B34A 1KHTA 4BZXA 2J0QA 4G5QA 2QAGA 2JCSA 3DM9B 1GRRA 2PLFA 3SYNA 2Z6VA 1G7CA 4OJKA 1FMLA 5EQTA 3NEYA 4OQNA 3EWSA 1WBBA 4B2PA 3ETLA 1OH8A 1VYVA 2QMEA 2GA8A 1E79A 1XTQA 3DOFA 4XTCS 2J0UA 2G0NA 1R0XA 1ZMXA 2F1HA 3HU3A 4URZR 3P20A 3QJYA 4DEXA 3ZVNA 1G3MA 4QXAA 1M7GA 3K1JA 4A8JC 4JLKA 3GLFE 4MUAA 2FNAA 2WMOB 2AX4A 3D7MA 2GETA 1NMYA 5KNCA 2XITA 4Q47A 2ZJAA 3NXSA 4NKRA 1ZVQA 1GG2A 2FFHA 1GDDA 2IHBA 3K09C 4M22A 1XEXA 4OI0A 3SYKA 2XNDA 1NG9A 3SFVA 5JBQA 3NH6A 1P5ZB 1J2JA 4A2PA 2QM8A 4OK5A 3BXZA 4Q7MB 2VF8A 3X1XA 4BE7B 3V4RA 2ZJ5A 3I8SA 4NPHA 1W4AA 4DSOA 2CDNA 4KFSA 1QHGA 3LO5A 1XF9A 4WA7A 1IXZA 4DUGA 1G7RA 2A5JA 1VCNA 4EJSA 2CNWD 1JQLB 2C9YA 3I32A 2PEZA 1KSHA 2ZIAA 2C5LA 2B8TA 3EAQA 3FYHA 3ZH9B 1W5SA 2GJSA 2YV5A 1D5CA 4ZPXA 5AWFC 5DNYB 3ICEA 4EPYA 1XTRA 1QDEA 1F60A 4TQAA 1Q1ZA 1EK0A 4RFSA 1G3UA 1E9DA 2AD1A 3EIQA 1G5PA 1M1YE 1D9ZA 4URVR 3VU9A 2WWYA 1W4RA 2G1KA 4ASUA 1XMJA 2WKPA 2O8DB 1G64A 4G1UC 3DL0A 2RAPA 4EQ6A 4WZ6A 1P75A 1JALA 1XTSA 3OZXA 1RPZA 1E0AA 3NG1A 1AM4D 1KJWA 2XB4A 1C4OA 4MGYR 3HU1A 1QHIA 2EFEB 1M34E 2UKDA 3CPJB 1YU9A 1AS2A 2AK2A 3DKPA 5EE1A 1I2MA 1Q12A 4E07A 5CYPA 3SU8A 3UWKA 2XSZA 3LW7A 3GEEA 4F92B 4A2WA 3CZPA 4Q4LA 4LV6A 5HTKA 3LXRA 4DB2A 2EW1A 4EKDA 5E7MA 3EG5A 2F6RA 3LV8A 4H1VA 1SVOA 3AQ4A 1E2JA 1H8HD 3EASA 2AFIE 2P0EA 1WMSA 2GDJA 1ANKA 3B8HA 4PHFA 5KYKA 4JL8A 4NCJA 2FOLA 821PA 1CJTC 2PL3A 2NZJA 1KDOA 2ZXUA 4XWOA 3I5YA 1E4YA 3GEHA 3BWDD 2WMNB 2FDCA 4LBYA 2F55A 1YKSA 2FSIA 5FOSA 2IS6A 3D8BA 2GEDA 4A0RA 2EYQA 5KSPA 3REGA 4V0ME 2QRZA 4BFWA 5EE5B 3TUJC 5LD2B 2ZRGA 4IVQA 4AD8A 4TL9A 3K9HA 1SHKA 1XWIA 1RVDA 2GVDC 4HYYA 3RLFA 2CEAA 1ZD9A 5EP3A 4YXWA 5L3VA 3W8RA 3CRRA 2OFWA 3WYAA 2QGNA 4DVGA 1LS6A 4PO9A 1P9NA 2C78A 4W7SA 3SJBA 4FXPA 4XVUA 2C77A 3PXGA 1G19A 4G5OA 1QZXA 1NVVQ 1E2DA 3RRNA 1G8HA 4NBSA 2BMFA 3A4NA 1OXVA 1H8ED 4I1SA 1DPFA 4JSYA 1VG8A 3HYRA 3GJ5A 4XVRA 5EZ5A 4XTRA 4AKGA 1IHUA 3T1VA 1N2CE 2OFXA 4PC1A 4UQOA 3SDZA 3AVTA 1Z0FA 3RSLA 3A4LA 4QL3A 2JA1A 4Q9HA 4ZI3A 1FP7A 1XB2A 1SXJD 2Q6TA 3RWMB 4DB4A 3VHLB 3QUSA 2IS4A 2JJ1D 1C1YA 3EZ9A 1S3SA 5KNBA 3MWLA 3QI2A 3ZZ0A 4EDHA 4AY2A 1D2NA 1VIAA 5CJPA 2BMEA 3QXCA 3MWYW 2OG2A 1BO6A 5FBWB 4TQUS 3KFXA 5DYIA 1Z28A 1XCPA 1W4BA 3KKMA 2ODWA 3QF4B 2IYRA 4MYTA 5F9HA 1Z29A 3ONWA 1NN0A 1W0KD 2O8FB 1Q1QA 3PUZA 1R0WA 3CF6R 1NVVR 3O47A 4Z8YA 1Z2CA 5CM8B 1RC8A 2CHQA 1II8B 1DAKA 5TDHA 1E9CA 4PAMA 2GEVA 5L3SB 2FWRA 2QE7A 3BFXA 2LKDA 4BRUA 4CF7A 3HR8A 5IK2D 1G291 1SVMA 4DLYA 4KLNA 4CEHA 4CEJB 3ICQB 2GILA 1P62B 4HB3A 2ZRNA 5LDDC 4Q4AB 1RKBA 2FSFA 3VMFA 1RE0A 2X77A 2REXB 1GUAA 4B3DA 2NOAA 4QNRA 4GPTA 1P60A 5BXQC 3KXLA 3FHOA 3B2EA 1FNMA 2C04A 1JXOA 2BEJA 3LX5A 1VHTA 1FOEB 2W00A 1GKYA 3IUYA 5J4KA 2NO1A 1G4AE 1L4YA 4TLEA 1GNPA 5JCPA 1PLJA 5KHOC 2RCNA 3A58B 3B9QA 2QAGC 1UBGA 1TU3A 2EFGA 3EARA 5HE9A 2CK3A 2JGNA 3VAAA 3O8BA 1E32A 1FFHA 3L0PA 5AUPB 4QJ3A 5JHHB 4OYHA 1QG2A 4QNMA 2CL6X 4BPBA 2WWWA 2A78A 1U8YA 2QSZA 3GCGA 1KDPA 6Q21A 4FW9A 3LVQE 3GP8A 5H68A 2VL7A 3IHLA 1XJQA 2F1RA 4PO1A 4E5UA 1X8LA 4A82A 3KKOA 1MRNA 4NCIA 4Q00A 3H4MA 2KE5A 2NO9A 4M1YA 1VHLA 4LYAA 4MKFA 621PA 4A9AA 2BCGY 2ANBA 2G77B 4GSYA 1G9XA 2BM0A 4AKIA 4LJ7A 3H0KA 4O3MA 1X3SA 1UBCA 3PCRB 1RYFA 3BAFA 3VNVA 3X1ZA 1ETUA 2CVHA 4LV8B 3IGFA 4MH0R 2OXCA 4HZUB 4B76A 4EJSC 5BQ5A 3WY9A 1TAGA 4AIIA 1MKYA 2OBMA 4C0HA 4S35A 3W3ZB 1VYUA 1QHXA 4G01B 2D2EA 2E1RA 4PTLA 1SVSA 2QBYB 2EYUA 2YZ2A 3FFAA 3ZLJA 4C0BA 1IN5A 2VO1A 1GAJA 4I81A 1KO1A 5AR1A 1N5IA 3L2OB 4IFBA 4TL6A 1XNJA 3MWJA 2WWHA 2OLJA 1SULA 1PUJA 4Q03A 2O8CA 2R44A 1E79D 3DPUA 2O8EB 1CR4A 1JR3E 5JCZA 2C99A 5F3WB 2QPTA 4B3BA 2NTYC 2H18A 221PA 4Q7LA 3CNLA 1UBEA 2DFKB 3SJAA 1NY6A 4PHHA 3T61A 3PUWA 4BECA 3I4LA 2PX0A 3RS2A 4D80A 2V4ZA 2BMJA 2VP0A 3UATA 5DE3A 3TJZA 5HZHA 3MUFA 4HAUA 4MRSA 421PA 1KDRA 3ZS9A 2IK8A 4X8LA 4IDHA 2PT5A 4ZIRA 2IXFA 1XMVA 2QN6A 2XTNA 2XNDD 3C15C 2C8VA 1X8KA 2IYQA 3RDPA 5DI3B 2PH1A 1KO5A 1B23P 2ECKA 3KL4A 5AK0A 3SS8A 2VSFA 3GFPA 4NDZA 4XWAA 4F4JA 5E3HA 1EWRA 1NI3A 3SHFA 4PO8A 1IM2A 1IY0A 4P32A 4Z51A 2A5GA 4HATA 2QT0A 1AQYA 1DO0A 1X1SA 3EWAA 3LQQA 3NDPA 1BMFA 1HT1E 1NMZA 4TL8A 2NPFA 4DUGD 3EZ2A 3KQHA 1XU4A 1ZBDA 2BIFA 2VYFA 4O2LA 3IBGA 121PA 5K8UA 3GQBA 2ZS9A 1BIFA 4DC9A 5CLQA 2ZJ8A 5K8TA 3LBNA 3PEWA 1ZM7A 4AWXA 3AGQA 1QVRA 1KAOA 4X8MA 1E94E 4OQFA 3B60A 2Z0MA 4QHTA 3BB1A 3U60B 1SZPA 5CIQA 5BN5A 2JLUA 4MGIR 1JJVA 5JLJA 3T15A 1OH5A 1XXHA 4B48A 3HJNA 5EXTA 4ASUD 4NYMQ 4DEYA 2R6FA 4GBMA 4C2UA 2WWGA 1F48A 4Q01A 3D6TB 1R8SA 1QHNA 3NC1C 4PXAA 4RSGA 1NNEA 1WQ1R 2ZRBA 1KZ7B 2XJ4A 3SZRA 2OV2A 1F2UB 3HPQA 4RVCA 2ZS7A 2XSZD 3C5HA 3FDIA 4RD2A 4Q19A 5GJCA 1F2TB 5JEDA 2AFHE 2W6IA 1OYYA 3QXJA 4HAYA 2VH5R 2Q3HA 2AN9A 2VIIA 4I1UA 5LB2A 1TF7A 2RH5A 4GZMA 3LA6A 1Q21A 3OIYA 3ADBA 1OFIA 4II7A 2F3TA 1T0JB 3B1WA 1TUEA 4AG6A 2FU5C 3ZVLA 3T1TA 1AGRA 3A4MA 3QKSB 2J41A 3LQRA 1LTQA 4Q21A 2VBCA 2ZRIA 3KDSE 1KK2A 3T06B 4DJTA 3TMKA 4MKGA 2WSMA 1Z22A
chains in the Genus database with same CATH superfamily
1NQVA 3S4YA 4OHBA 4HT3B 3KLPX 1HFKA 1ULTA 2FK8A 3HCCA 1E6WA 3IBYA 4Z3OA 3DKVA 3N2YA 1O8CA 4P4NA 4C7OA 1CRLA 1SXJB 4K1XA 1Z2DA 4E5YA 1HR0B 4YB8A 5JW6A 2V9PA 1PEKE 3P94A 4CTNA 2QM0A 1SVUA 5B58C 4RHFA 2CMHA 3DVAA 2I65A 4AO8A 1Y82A 3N58A 2YV3A 2HYDA 3QA3E 4UUNA 2HA5A 1JZTA 3HXPA 1H2FA 2I5PO 2Y1LA 4KLAA 3SHQA 4RM2A 1ZCAA 3L7NA 3KLNA 4ZAWA 1Q2UA 5F1PA 2ENUA 4E2XA 1W76A 1R3DA 1A7AA 4B84A 1P7PA 1EEXB 2NACA 2X7XA 3OZAA 4E1AA 2XRZA 3ANSA 1NHGA 4I1IA 1MX1A 1EB9A 2H57A 4M1TA 2JDIA 3DA8A 2D62A 4C29A 2C2KA 3OOJA 2ZJ2A 1SU7A 4TMKA 3I28A 5CHYA 3SN6A 1A8PA 1IN8A 4DIOA 3EMBA 2I4TA 2P62A 1P7ZA 5CFLA 1NDHA 2AF4C 2YNMD 3TQRA 5LIRA 3ZTYA 3IIMA 1JB1A 3IIJA 1M1XB 1PYGA 1T4CB 2PM8A 5JQGB 5HJEA 2AQKA 3VDNB 3BERA 3E8MA 3MRXA 5LFAA 2H9YA 4YRPA 2ATCA 5DBGA 3R9KA 4TLDA 1Z8FA 2XA9A 1ZGJA 4QGAA 2ZSBA 4CU5A 4CDGA 1Q7BA 3K30A 1I7PA 4EPXA 4LRYA 3A1DA 4KDCA 2ZXFA 3F6YA 1SC3A 3RG2A 3TIFA 4TXMA 2C97A 3P52A 1C7RA 3BBPA 3EXHA 4X8HA 1SIBE 3QE0A 4AI6A 2JRLA 4LOLA 2I1VB 3G82C 3TIIA 1TMGE 3NUZA 4RQAA 5COAA 3RPEA 1ND6A 3TSWA 3H2KA 5CDGA 5BV1A 1XBTA 4ERNA 4QO7A 2RGGA 3VISA 3DTNA 5DMHA 1QU3A 4G4IA 2QRLA 4FOOA 2G1PA 4BYGA 3MGAA 5ENDA 1TAHA 5JAUA 4KR2A 5GINE 1UWKA 3KOZA 3K94A 4B82A 4DMHA 5CITA 1N2GA 3BRQA 2Z58A 4A73A 5KPDA 1WZ2A 3VZCA 4PAQA 2E89A 1NOIA 4FYPA 1C1HA 1PV1A 2K2WA 4CLHA 1QE5A 4JKIA 3SZUA 3WKDA 1Z37A 1P4JA 4MKZA 4R2JA 3SIXA 1XYYA 4G4JA 3O4JA 1P7VA 4IDBA 1DAOA 4CVNA 3TNDA 4JI7B 4DR4B 1PIWA 4ZAFA 1WDWB 1XI2A 1Y6RA 1QIKA 2FN4A 5E1BA 4YPOA 3DBLB 5L4LA 3VC3A 2VF7A 3DULA 3H6HA 5DI9A 1QUEA 2SBTA 1E9RA 1AC5A 3H8SA 2JFVA 2R8BA 5CK5A 3PUKA 5FPSA 3T94A 3WB9A 3ZXXA 3HCAA 2BJHA 2W4QA 1O6BA 5LUAA 3SEFA 2YWDA 3G3EA 3SR4A 2GPNA 1WCXA 5E4FA 2OBNA 1NXVA 2QN8A 4KQMA 3RABA 5A6VA 5IC4A 3HXLA 5DHFA 2NZWA 3JQ8A 4WE3A 3I8OA 4ZZ3A 3RIMA 1A4IA 1CR6A 4INZA 4TMTA 3NHKA 1YAJA 3LQKA 2F1KA 4O0LA 4Y9UA 1U98A 2QV0A 2C2OA 3GY0A 4OH1A 2QMYA 3KXKA 4CQLB 1EXVA 5F64A 1UFKA 3AERB 2WTAA 4A5SA 3TKAA 3K6RA 4P8RA 2CK3D 4YUXA 4W9MC 2AOTA 3H5LA 3FJOA 4E51A 1VECA 2HJHA 4QUKA 3EOBI 2DQ4A 2GRAA 4JP2A 4QXRA 3DLIA 3SYRA 1W5TA 4QTYA 2WABA 3HM2A 4JGGA 1DT5A 4JROA 3SD7A 1L7BA 3WC4A 1J00A 3MJVA 3HVUA 1DIHA 1RPTA 3S28A 1QCYA 1ULBA 3TLGA 3Q85A 1NLUA 1RAFA 2GCPA 2QJTA 3M4YA 1U4SA 3SLRA 4XDYA 5ILGA 2F3UA 2CMKA 1YR1A 3TLZA 3J7AC 2H1LA 4IGFA 4WLFA 2WEKA 2BUCA 4NOLA 4ARAA 4IOMA 3F78A 3B3QA 3FVVA 4H1HA 1JXAA 3C6KA 3FWHA 2R85A 4R3WA 4U2FA 2GCNA 5IXYA 5BV8A 4KH0A 3DCYA 4AJ1A 5DU2A 1RNLA 3PQEA 4J7UA 3LOPA 2CL5A 3KTAA 5JDIC 1KR2A 2ZYRA 4G1MB 4N1AA 4D74A 4F4FA 4DT1B 3RC3A 4F4CA 3OPYB 5BMVF 1LDNA 4BO1A 4JXKA 3QJ5A 4MWBA 3LLMA 2IA5A 2POCA 2O9JA 5DBEX 3LC1O 3IRVA 2Y05A 3JQBA 2JZCA 4ZYTA 4EMTA 3MBOA 2OCIA 1FYDA 4JLAA 3TAHA 2JATA 3NR2A 3OI7A 1HDOA 4D0LB 1CERA 3G23A 3EISA 2YC4C 1B1CA 4UQPA 1UWLA 1M33A 2G88A 2O2JA 3CEMA 3FOWA 2Z8YA 3UFXA 4BNDB 3VZQA 2VQFB 2WE7A 3FVQA 3O90A 3CRZA 4FOPA 3WLLA 1SD1A 3A70A 5T7BA 1L6RA 3KQOA 3SS7X 3VTKA 1GITA 1LLQA 4JIMA 4MK4A 3A27A 3R7DA 1LC3A 1FDTA 3M2TA 3VYWA 4MARA 2WM9B 1IWPB 3V00A 1R66A 5C7IO 1SG9A 4HAWA 4G9GA 2PKRA 2CKDA 3ZDEA 5CUQA 2WWIA 4LZJA 2Y77A 3V4VB 4BQEA 1NLZA 3S8EA 1J99A 2V7PA 3L0YA 1H42A 4N5DA 4QYIB 2R8OA 3TQFA 4GOND 2CZCA 1JPVA 3BEDA 3LNTA 4UOQA 2A94A 3CJRA 4FEGA 1XRJA 1Y98A 2FQYA 3CH4B 1SKYB 3QPBA 4GQIA 5B1HA 3WGQA 1ZA2A 4NNPA 4B6QA 1T4BA 3NVAA 4KXMA 1JEYA 3NANA 4NXNB 1I4WA 3QI7A 3CNEA 3CLRD 2JCBA 4WY5A 1S0UA 4EW6A 3KU1A 1JHVA 4KQKA 1JFFA 1GRQA 1YZHA 3IO3A 4AN1A 4IJWA 2A0KA 2YXNA 3BUSA 5ELXA 2PGXA 4TYPA 1L1EA 1QZTA 16PKA 4NEHB 5AQEA 3KZNA 3P9NA 4FNOA 4HO1X 4B45A 4EYQA 2CJXA 3HNRA 1RHRA 2PUJA 4PWZA 4QUIA 2MMCA 3W06A 4TOIA 2GCOB 2ZTHA 2P5TB 3RJZA 4N82A 2EFDB 1FU7A 2QUKA 1TEVA 1DIAA 3ANYB 2QR3A 1WPRA 2Y1XA 4Z5XA 1HM5A 1EP9A 3C5EA 1TLFA 1W85A 3JYNA 3K53A 5DOVA 3K9QO 3R8CA 4MO2A 2RBKA 2H4XA 3E1SA 3ZCXA 1VHWA 3FRJA 2WTEA 5T8KA 4YRBA 4ZZIA 3TTVA 1N1EA 2AXEA 1IJFA 2N1MA 1DFGA 3DAHA 2A92A 2ST1A 2P3LA 3ZEAA 1D7AA 5AQ1A 3DZJA 2I2DA 2IQIA 2ADMA 4PPNA 4R8VA 2JFPA 1Z6XA 2CBGA 1U8ZA 2ON6A 3LGAA 3N05A 4P4SB 2DM6A 2F43A 4I1YA 1GAEO 5JARA 2NPOA 3MJCA 4LHVA 3H5IA 5DCWA 3PNBA 1BD4A 1O0CA 4EVIA 4XIJA 1Z5PA 2RHJA 5D84A 3SLGA 2Y9MB 9ABPA 4LBVA 2IGTA 2WNSA 2CC2A 2JGIA 4FYWA 4YJ3B 2XT9A 1QFJA 4UVGA 2WU4A 2BI8A 4KNYA 1WMFA 3F5FA 4EYKA 3L0BA 1C3XA 4J3JA 3RO7A 1JLKA 1HZZA 1UFRA 3EZNA 5FI3A 1C5KA 1U2DC 1Y4ZA 1V5WA 1JX6A 2QWXA 4YLYA 5K2OA 3UHPA 2YJ4A 3R0XA 1Y9ZA 2P6MA 4YT4A 2R6CA 2PU5A 3NCHA 2CF5A 1PRYA 2B4RO 4Z2AA 1UK6A 3AR4A 3C3CA 2V6IA 3V9PA 2OT3B 2WFZA 1QLJA 1D09A 2IZOA 4D43A 5B55A 1TTPB 2G82A 5HBRA 3WO0A 1GDHA 1N5LA 4LK2A 4XQ0A 5EMJA 4PN3A 3QF7A 2AG5A 3KZCA 3UGQA 1N9GB 3R5FA 4WDQA 1DQYA 3CLSC 4IJMA 5HJ2A 4CM6A 2PDAA 4CMIA 3CN9A 5AW9A 1LLCA 1HXHA 3MRTA 3QX7A 4US1R 1P4AA 4EFNA 1VKJA 2YC2C 4F97A 3MJ4A 4URWR 5I7FA 1DG3A 2YXBA 2AZXA 1JVBA 1V8OA 4MQEA 4C9BA 2KB0A 3TEMA 2O7RA 4KO8A 2B4TO 3GRRA 4F5ZA 3VNSA 3W5CA 3TPFA 1JHAA 1O89A 5BWLA 4G2TA 5IVIA 1D1PA 1FXUA 3ABZA 4FZJA 4GU5A 4IWYA 1IZZA 4MDEA 4X97A 4C7XA 2H08A 5F76A 3KD3A 3ZNOA 5ICCA 1ENYA 1GTZA 2C1EA 2IZ6A 3PA6A 3PXEA 1ZFNA 2PV7A 1CK4A 4XA8A 5C1IA 2AN5A 3V8BA 1HORA 3VOBA 1VIMA 3KOMA 3CLKA 2O8BB 4ZCQA 3HH8A 4UDXX 4M9QA 1Y4SA 1B26A 4F06A 4W5OA 3U3RA 5GVSA 4W5TA 5KVQA 4BVFA 3USCS 3FHJA 3AVPA 4IDDA 5JOQA 1XE3A 1LWOA 1JHPA 2A0UA 3CUSA 4BRZA 4KPUB 3M33A 4JP8A 2WM8A 4BWVA 4CQMD 3PXDA 2VCYA 4RKFA 3UG6A 4ARBA 1Z5UA 3FMFA 1MPXA 2C5GA 3PI7A 4QX6A 1X7HA 1R64A 3B1JA 3IAUA 5LIPA 3T1NA 2XMRA 4KO2S 13PKA 1WF3A 4Z7NB 3T3NA 3GH3A 4IKEA 4YDSA 3TVDA 2W2PA 1VLZA 4G0ZA 4ISBA 4UMDA 3S70A 3ZDRA 1PWHA 2GJAA 1XQYA 2VCEA 2X6TA 1COZA 3AYZB 2R8ZA 2XWSA 3ELUA 1QQ7A 4UTRA 5BW5A 2I67A 4I4TF 1E1LA 4CEHB 1LQTA 1ODJA 1VPDA 3A1TA 3QEAZ 4MB2A 3ACBA 3RUCA 1P4SA 3KUUA 4F91B 1QGYA 4DLPA 3Q9SA 1BD3A 3CLSD 4RVOA 2NADA 5L8VA 3P9IA 1CY1A 1FFXA 4A23A 1VL5A 4JHLA 1FIUA 5MFZA 2FPKA 3ED1A 2JHFA 2QD3A 1G38A 1TC2A 3JZIA 3DTVB 5JU6A 1ZAYA 2QMOA 3WXBA 3HA3A 1I1HA 3ZJYA 5CDHA 1PGJA 1BYIA 1OZ0A 4QUAA 3AESA 5L40A 4N7BA 3AO0B 3N7UA 4NCBA 2WM2A 3AT1A 3RB8A 1DJMA 1J0XO 3MM4A 3MCZA 4X1YB 4YIHA 1W4ZA 4NC9A 4QGSA 1T6XA 4I55A 4E94A 5J1SB 1H66A 5AK6A 4YMTA 4V24A 2ZXEA 3N8DA 2BFDB 5IKMA 3OQOA 1MB9A 5ESWA 4YHBA 3FTPA 1YR6A 3CKMA 4PX2A 4MYRA 1NXPA 4X7PA 3MQFA 5E7QA 4QUGA 4HLUA 4EGQA 1S01A 1T5LA 4CMBA 1E7SA 3WMWA 3DAFA 1C9NA 4BV8A 2W11A 1PYDA 4WVLA 1U8TA 1E62A 2R25B 3IPRA 4M87A 2YW9A 1N0UA 1R8QA 1YT5A 2QI9C 3PWSA 3U9SA 3AFNA 1R8YA 4JYAB 2DRIA 4PQRA 4NQRA 2A9RA 3BMCB 4ZOCA 3L0SA 2B2XA 5HS4A 5J4HA 2KX7A 1XMIA 4HWRA 4BWYA 4JEMA 5IN5A 4DRZA 1G0NA 3BG5A 1PT8A 2HJGA 4IH1A 4KODA 4TLMB 4CN9A 3BL8A 4Q4JB 1T9GR 3D4BA 4NWIA 4B2YA 1EDBA 4YCBA 1YUNA 2QZZA 1J0EA 2AE2A 3RVLA 4B3IA 4ZC8A 3OE1A 1GA1A 4TRJA 3LX6A 1Z7BA 5HUQA 2EKBA 2ABWA 5GV8A 1Z47A 4AS3A 2WIDA 2DQZA 2IYSA 3WWDA 5G0TA 3TI9A 1E98A 1WW3A 1YR7A 4LHXA 1XYVA 1BFUA 1DKRA 1CZNA 4EB3A 4EGAA 3F7NA 1VDZA 5BURA 3EGIA 4HB2A 3STUA 1C3OB 2VT3A 3ENZA 1P9WA 4RF2A 5EWLB 2ZI6A 2AOUA 5FOVA 4GPBA 1QVZA 4YVFA 4CCYB 3U16A 2PEYA 3OCCA 2C00A 3B9PA 1R0KA 3A28A 1XWWA 3OQ6A 4OSPA 5ALXA 1YVDA 1YWGO 3WLEA 1E64A 3HDTA 3ROZA 1ZJ5A 1LSJA 2VNSA 1EQAA 4FFDA 2WQ6A 1GZHB 4TKMA 2VUTA 3JWEA 5B7QA 2ZEJA 2XI4A 2ID8A 1ZQ1A 1IEQA 2B21A 1A9OA 1PFVA 1H23A 4TYNA 2J6IA 4PTYA 3UVEA 1YB5A 4JNKA 3ZBUA 5LXTB 5AKYA 2XMGA 3U3JA 4AICA 3EDQA 1PK9A 4ML3A 1BWRA 3AEKB 1KI3A 1MZVA 1INLA 1I4LD 1W5FA 1YB2A 2FP4B 2I33A 1F12A 2YJ3A 3E05A 5F1KA 2C4WA 2IV7A 1JKXA 2P0YA 3KE9A 4PG5A 2CWWA 3L1UA 3ILVA 1Q44A 2F9LA 1A69A 4FR0A 1HKUA 1M8PA 1SCAA 3MPOA 1QLHA 1YL7A 5TGTA 5HJ7A 5I8PA 3MGBA 3NAMA 3KLBA 3ORSA 2DPGA 4NBKA 1I1NA 3T5TA 2YHIA 3GRAA 1NT2A 2CMGA 4IOKA 2Z09A 3CXRA 4DDUA 2VH2A 1U4NA 2Z1DA 2VSXA 2XHEA 4OQXA 1KVUA 1KFBB 4B71A 3NYIA 4ZI7B 4Q4HA 4EG3A 5TJ9A 2IOYA 2R9VA 5BQFA 4NI5A 2F9FA 3NHMA 1LF5A 2PR7A 3T34A 9MHTA 1DLJA 3FA2A 3UB2A 5J4VA 1JR3D 5CG2A 3ZDAA 1NPYA 2Q3JA 4NH0A 3ZYZA 1AX9A 1YQXA 5TGDA 1PYOA 2Q5IA 3OZFA 4DCUA 5L45A 1KKLA 3V97A 1QIFA 3RSQA 3HXKA 5E8JA 4GC9A 2IWRA 1YZTA 5JMOA 1C1XB 1Y8RA 1F38A 3BDVA 3I04A 3C8ZA 4LZOA 3A1EA 1N4DA 1D2AA 3FUXA 2ADOA 1Q0ZA 3T7TA 2BGWA 4DC1A 1U6JA 1JECA 4TWAA 4B83A 2R62A 4EHHA 3X1DA 1MO3A 2I71A 2M6KA 1RHMA 4MYCA 1T3SA 4AL4A 1RP7A 5JMTA 2D5IA 2YHAA 1PR6A 4BWFB 3BCRA 4JA0A 5CW2A 4PYJA 1H2HA 3HJCA 1HL3A 4J7CA 3DD5A 3NP7A 3Q3EA 3ZXIA 3VO2A 2JHPA 3PSHA 4LHZA 1MB4A 2XYHA 2PD4A 4M21A 4Q1DA 1CZOA 1ZNYA 3LZDA 4CLRA 3T3MB 4H1UA 4ZT3A 5BQ3A 3DMDA 3LH5A 4YRKA 2WFAA 2Y92A 4PU0A 4XQCA 2WP0A 3RU9A 5BNWA 5HP4A 2OC4A 2BKEA 4H4CA 3ZCTA 1JEJA 2X5OA 1ENPA 2IYUA 2PS3A 3S55A 2XWPA 3ML1A 4CIAA 2K87A 3QEMA 3UUFA 2POQX 3ZI7A 3GAMA 3AQIA 3JXEA 3BOSA 4ZCSA 4FWTA 3ZY5A 2MYTA 4RDCA 4E5KA 3CLUC 3F3SA 2WTUA 4E2WA 4HNTA 3W1EA 1QZUA 3E9DA 1ZR4A 1VBMA 3EBLA 1Q0RA 3JQCA 1GPWB 2BOVA 1XZJA 2ZZNA 3I2IA 2IHNA 5LP1A 4U39A 1TKBA 5CNIA 5JDIA 4JFRA 4E70A 5EE9A 4BMOB 1KZGB 4PNZA 4RHYA 4O33A 4U2GA 2VNIA 1WW8A 5CB0A 2PXCA 2XRYA 3V2IA 4BGUA 2QVXX 2NYRA 4QA9A 2FSPA 1PLLA 1UKCA 2OWEA 4KSCA 4YR7A 5BNZA 1O3YA 1EWTA 1G41A 2H9AA 2I4IA 1ZXBA 3P1JA 5AM5A 5ETJA 3KYIB 3A0RB 2GCEA 2OUKA 3ORRA 5HXAA 3RVDA 1IATA 1FTSA 1N5KA 1FDUA 4WSOA 1W2HA 2O1SA 2VP9A 2Y8EA 4X8OA 4JLUA 3RIYA 1G6OA 2IUTA 3TO5A 5JEEA 4LF5B 1Y42X 4C7OB 1R0RE 2YWHA 2EZ9A 3MUOA 2RJ3A 4K6KA 2DT5A 1PL6A 4M7OA 4PC7A 3BGIA 1RWKA 2FWNA 4FYIA 1BX1A 4UHHA 2QSUA 3MNFA 3BHNA 3I2KA 1DCKA 4LSWA 2MU1A 4HZUA 4RIGA 5B3LA 3FIUA 1KKMA 3DVAB 5CLHA 4UXIA 4FMDB 3O2JA 4BNGA 4JLNA 4X63A 3GNTA 4MIYA 2PZLA 4UVHA 4N7RA 1ADFA 3C5WP 2AMVA 3HBNA 4P4UA 4XGNA 5KTTA 5KNDD 3DV0B 1A7JA 4AZVA 1BX0A 2ZUUA 3E9NA 4HHEA 5J40A 3V1MA 1KETA 4URFA 4JJ4A 2DTDA 1CJMA 3NRCA 3DYIA 4XSGA 4N0PA 1GOTA 2GTPA 5C5IA 3PHLA 1Q7TA 1V7CA 2VYCA 2XBUA 4C7BA 1X1EA 4MULA 2CFRA 1JDTA 1AZTA 1LJUA 2Z3VA 2ZUSA 4FVTA 4CV0A 2FPLA 3W9SA 3NJ4A 4YLEA 4AKHA 3DAOA 1DX9A 3RF6A 4ABYA 2XR1A 4CM7A 1CR1A 3IVCA 1WUJS 3EK2A 1QP8A 4OLHA 2WPDD 3JVVA 3VYRB 2REQA 4QUHA 4YAWA 1PFGA 3GFQA 5L7YA 1E2QA 1U2PA 3H86A 3ZIAD 4D56A 1RWBA 2B9EA 3AVQA 4Z7JA 1NNLA 4F6CA 2Z98A 5IULC 3BXPA 4FNMA 4HWTA 1IVNA 3HG7A 4FILA 4M8LA 8ATCA 3I5XA 5CU7A 1HH4A 2FSHA 1Q95A 2BGGA 2DJ5A 2Z2ZA 3NX4A 1RRKA 2G67A 2HJRA 2PL9A 1BFDA 3LS2A 4HDMB 1B14A 1FCJA 4ZVLA 2ONKA 2QNRA 1TI7A 3BXXA 1QF6A 1UMCA 2PQ0A 2CNKA 3DMGA 2W0MA 1K68A 2PS9A 1J8DA 4R1OA 5FWYA 4BMDA 1DJNA 3SR0A 5K0LA 2ZCVA 1KVSA 3RRMA 1TTTA 4KQ9A 4AP5A 2ZSKA 1HDZA 1NMSA 2Q3FA 2OLEA 4EECA 5AVQA 3EFOA 4RD4A 2H1OA 3AETB 3PXBA 1NUPA 4CKEB 5KYGA 3W8DA 3UWMA 4N3CA 3U6KA 1K8XB 2QYOA 3URMA 2EATA 5C5DA 5LD2C 4MICA 3NHYA 1V5GA 3GPDG 1ECGA 2AGVA 1FRNA 4OGGA 3L4BA 4N48A 3AF6A 1YQWA 1E4EA 4RSHA 3ABQB 3F2IA 3KSMA 4IDAA 1FVOA 1Q5PA 3S2FA 3IR7A 4B47A 4LJ6A 1K5DA 3TB4A 3K9WA 2XWJI 4CM4B 4LXIA 3EX7C 4D8TA 1ORIA 3N76A 2HRQA 4O3FA 4WN3A 3WJ2A 4F0JA 1MV8A 2P9FA 3U4HA 5DGIA 3F9IA 4IDCA 4RMHA 2G9NA 2ZYDA 3JQ8B 5KQGA 1T2AA 5AVVA 4HLDA 5HSGA 1NXTA 3CNOA 5KC9A 1GAWA 2UUCB 4BX2A 4AZSA 2E85A 2OL4A 1PVDA 5TS2A 4F6RA 2GN9A 3RSCA 2ZYSA 1V8DA 1VIVA 1CVRA 2UZ1A 3CRQA 4IOLA 3VPFA 3H8JA 5C52B 3R1IA 3S1AA 4UM9B 2J45A 3AY7A 2FXIA 1J56A 1KFEB 2AOTB 2Z43A 3VR5H 4MRAA 1ZIXA 2RHRA 2KI5A 1ISMA 3RG8A 3QG5A 3SMVA 5H9WA 2C4NA 1M0EA 3VR1A 4RDXA 1VPEA 2X2EA 2FJ0A 1SHZA 1BQ3A 2C3YA 3RVNA 3VZDA 2GF9A 1EE1A 4JIGA 4BQQA 3CH5A 5LZ8A 3TLGB 2I6QA 1GXSB 3KNZA 5LPNA 4PZPA 5B53A 3ICVA 2BP7A 1E61A 2HIAA 3FROA 4YV7A 1KJ8A 5KU1A 2GKSA 3CMCO 4QWWA 3RNLA 5J2UA 5DHUA 3COZA 2D2FA 2YOGA 3V3TA 4C2BA 1W9MA 1U3VA 4QKQA 3TK1A 4BO8A 2XNSA 1XLTC 3ZD6A 1OV4A 1QRAA 2AR0A 2Q5OA 3VX4A 1U5BB 3R77A 4D9HA 2YINC 3IC5A 2PWZA 3RIGA 2IXEA 2VN8A 3T9EA 2I2CA 2GZ2A 2G4VA 3HJBA 3KTAB 4UBLA 5IYZA 2XXAA 1IUNA 1H2BA 3PKIA 1Y33E 2HO4A 3A6KA 4N41A 4JEIA 3I2GA 4PNPA 1WD7A 5CURA 3X1JA 3ZKWB 2FI1A 1VBFA 1YBVA 2DY1A 2GCIA 4ZEXA 2ZR9A 4W63A 1L8LA 3OJCA 5DBHX 1P91A 1YMQA 3CVJA 4NDNE 2CLIB 3NKVA 5C7OO 2PKYX 4M8NE 5AO9A 1WABA 3DDCA 1YJ5A 4FI3C 3Q8MA 1NRJB 3EZLA 1E77A 4PLHA 3KSRA 1YB6A 1XDDA 3Q8WA 1VJGA 4CG1A 1P8JA 4RSMA 1WDLA 4DLVA 5JLAA 2IRWA 3CRW1 1WCV1 1WSAA 3E3AA 2ZITA 3MCUA 5AKEA 3MS2A 3T7SA 3RJ9A 1FRFS 2W93A 4GM0A 1UEIA 5L4SA 4WESA 1HC7A 3HRKA 3V4LA 3MK31 3MG9A 3AIKA 1G66A 4FKBA 4CW7A 2RGNC 3HKBB 2N42A 1FJHA 1L5ZA 1Q15A 2R11A 4L85A 2IH5A 1PDWA 4WHMA 4Z4FA 4LFBB 4DIEA 4D42A 1NP6A 3IL2A 3L18A 3UWDA 3KJIA 3I53A 4HZGA 3ILHA 3AJ9A 4C1NA 3M4ZA 1EKXA 3AIOA 1SC4A 5TF0A 4ZO4A 1DAHA 5BRAA 3PJGA 4KITB 3AOEA 4E08A 4MGEA 1L7AA 2XMZA 3MTEA 3JQ7A 4HBZA 2LKCA 5IX8A 2TRSB 4NMMA 1BOFA 5GIPE 3D6NB 3HEMA 3OPXA 3CLTC 3WFJA 4PR0A 4UCQA 1JBQA 4JD5A 5JI2E 1G55A 2CUKA 2I87A 1JFFB 4AQ7A 3WRXC 1QIIA 2ATVA 4R8SA 1J2RA 1RZRA 3U56A 1XRNA 3ZCVA 5A03A 3PFFA 4Q4DA 1T5SA 2VHCA 1S4MA 4URHA 4B3JA 1IQ0A 5ALHA 5IAEA 5HWSA 4QD3A 4HMPA 1OZAA 1GKUB 4J0CA 3DEZA 1E1CA 4POAA 4QGFA 2FZVA 4BV2A 1IJBA 3TE6A 4LC0A 1FNSA 3D2AA 2JHGA 4IDPA 1CY7A 1KEPA 1FSPA 3OZTA 4OHPA 4QUBA 1NT4A 2G0AA 1NM5C 1W5AA 1LSSA 4BKOA 5AM0A 2E4AA 3FPKA 1YCFA 4JH0A 3SZMA 1O0SA 4Q3LA 1TVKA 4B7CA 3K9GA 4KHZA 2XKBA 5BUSA 1UXIA 2FEWB 2HR1A 2YJGA 5ELMA 1T8TA 2F43B 4W1SA 3ROXA 5JNTA 5I7UA 1HO3A 5DJ5A 4UAJA 1RPJA 4P54A 5JJ5A 1JJFA 5EJ7A 1MFZA 3SEQA 1GRNA 2IBMA 2CVPA 2R79A 3LRTA 4RXMA 4DCJA 4HNAA 4DKJA 1XJ0A 4OUDB 2AW5A 3WL5A 2M98A 2UYQA 4ZT2A 5G2OA 3MJTA 2JJMA 1U1FA 1FNNA 4IX9A 4PYRA 2YYYA 3ZGYA 5DH9A 3CUWA 7REQA 5KX5B 3E9ZA 1NOKA 1U2GC 2I2BA 4H1WA 1SK8A 3GLGE 3OCUA 1LPPA 4FFOA 1YZUA 4YCAA 2CE2X 1TL7C 4FCVA 3SNKA 4MPRA 4BO7A 2A1IA 3K1YA 1L4EA 1EFHA 2YY7A 1CY2A 2ZSFA 3E0QA 2NXNA 2XWQA 5ALQA 2EL9A 1WM1A 4L4XA 4EQ6B 2O3JA 1WVIA 1YV9A 1P61B 1TM5E 2TYSB 3AP3A 3M9WA 3C3BA 4Q48A 3YASA 2H00A 3K6JA 5I6DA 1CNEA 5COBA 4BDSA 2AXNA 1K08A 3U3KA 5JAMA 2XMBA 3GD7A 1LVGA 4RU1A 4H1TA 3UK1A 1CF4A 3HCDA 4IRXA 4P6VF 4CNBA 4MQEB 3ORQA 3VR3D 1DC6A 2BELA 4IRMA 3ND9A 4OQMA 3K9BA 2W2QA 4DCNA 2ZAYA 4Q9JA 4TXNA 2WILA 5E4YA 3AG6A 3F7MA 3RV3A 3C41J 4DMGA 1M54A 3VZSA 4EI2A 1XNRB 1C9JA 1JHXA 1ZZEA 2GK6A 2O06A 3OTGA 3U44A 2OO7A 4FHEA 2HYIC 3M70A 4DG5A 3NBFA 3W6NA 3QPCA 1TM2A 4FB5A 1CHNA 2BL4A 2IPXA 3P0EA 3MUNA 2PAFA 3AI3A 1PG5A 5TX7A 4EB6A 1X13A 4G8JA 1USVA 3M5WA 1AKRA 4JI5B 4JZKA 2OQVA 1YR2A 2H2FA 2QQ0A 3NHBA 4J2OA 4JC5A 2AFHA 1S4QA 5ALJA 4EEXA 1JFTA 1GADO 5JAOA 4JS0A 4UXJA 1GJRA 2XCQA 3ZDYB 2QIOA 3B7PA 3L7CA 1PZNA 3Q7EA 1IZ8A 2ZRJA 2ZRAA 5CH3A 1PEAA 1ZO8A 4UBKA 1PAUA 1SC6A 3HUDA 2OMKA 3KT3A 2PV0A 3KOYA 3NBZC 3Q3CA 4GG1A 4MHSA 2F4NA 1PJSA 2FV8A 4QG7A 4Q05A 1EIZA 3W04A 1XLVA 2QTVB 3SQXA 1IOZA 1PR2A 2I4NA 3PDIB 4ZCRA 1JEQA 3BSYA 2BGJA 1I4OA 3VPBA 3USZA 1OLUB 1XZAA 1LNZA 2JW5A 1ORRA 2ECQA 3HDQA 3OIWA 5L95A 2OE2A 5JYDA 3EGXB 1J70A 1V5EA 4UEKA 4YRSA 2BYTA 4O59O 2BBTA 1T5OA 3GZTB 3CINA 2WG1A 1Q77A 3NWEA 4RZSA 4BYMA 2HWWA 2YVUA 3L1IA 2LCFA 2QUIA 1FFXB 3JZFA 4CRWB 2ZSUA 4ETMA 2O05A 1XVVA 4DWWA 2K7ZA 2QRNA 3QHQA 1TZ2A 2DY0A 3DC2A 3S2UA 4YYEA 1BDIA 3GUZA 4BLTA 3IESA 3UBMA 4ADSG 1G6HA 1ZG3A 4BNHA 1KEZA 2JL1A 3AESB 3CZQA 1W19A 4OB8A 4C06A 2BBOA 1H3FA 4BUJA 4Z9FA 1GM5A 4JLDA 2MMGA 2H1FA 2WJ4A 2IU0A 3UG7A 1QHSA 3AGPA 3KYDA 1UC8A 2Z57A 2XMCA 3L7BA 3KAQA 4KLZA 4DUYB 1Q50A 3C3WA 4QRDA 1XPUA 1Z7EA 3R3WA 3UJPA 1M75A 2NW6A 3TR5A 3DXZA 4B75A 4M0DA 2OD7A 2ZGVA 1MX5A 1NW8A 3C4QA 1DFIA 1JYFA 4JVOA 1Z4NA 4ZODA 4CMJA 2M1XA 4IMJB 4OQDA 2CY0A 4G5SA 3WGTA 3IV7A 1XZCA 3I52A 3WYEA 2OCYC 2NUTB 3BRWD 1PF7E 1Z74A 2HWUA 4BZZA 4LF8B 4C6HA 4W1PA 1PR9A 3EMVA 3TCXB 2G06A 2P8JA 1S3IA 3WGGA 1RI2A 2C9OA 1EVYA 3AF4A 3GGCA 4RW0A 2GOYA 4XOIA 5ER6A 5AXAA 1OFHA 3KCNA 1RZUA 4G07A 2SKCA 3QVTA 1J06A 4IGIA 3I2HA 5CJJA 4KREA 3CRVA 1Q3HA 3WB2A 1R0BA 2N46A 3P96A 4HDKB 2ZBPA 5KWSA 3WTBA 2YIVX 3NIGB 3AUTA 4HK4A 2A33A 3WAGA 2NU7A 1VE1A 3ZK7A 3HC7A 2LZ0A 2AHRA 5DBIA 2QLLA 1AGXA 2WJ3A 3STVA 1IQRA 1FUEA 1T2DA 3DW1X 3MTBA 2F64A 3FR7A 4OXNA 4KJXA 3VSCA 3HADA 1TM4E 1G1AA 2CNDA 4Y9DA 4EHAA 2OHJA 4UMEA 4LVNA 5DTQA 1NSFA 1R0YA 1BGVA 1ZD5A 3Q0IA 3SKYA 1GQOA 4Y6SA 2B1RA 1SRQA 4LDJA 3U3XA 4CE6A 3BIXA 3C16C 2X8JA 1NWCA 5LM3A 1NQXA 1HYEA 1R12A 3DHVA 4W1QA 1AQUA 1L7XA 3EODA 2J9FB 3TOCA 3WSTA 3TR0A 2E1PA 3ZBPA 1ZBQA 1UWCA 2DKOA 5JNUA 1R37A 2VHJA 1G8YA 3ZWMA 2AOUB 2Y27A 1CETA 3N2EA 4S04A 4EEZA 2G36A 4N5MA 4IZHA 1YB1A 3TQIA 3ZY2A 1YFKA 1YE8A 1KYYA 2BSQA 1H1LA 3QSYA 4JUBA 4BQPA 6CHYA 1WCYA 4DV2B 2WW8A 1SCUB 2KBEA 2ZRQA 3R6TA 3OQJA 5BMOA 5BP7A 5TXGA 1M2OA 3AF1A 1O03A 1IFXA 4TWZA 3FSGD 5BWBA 2IBTA 1NUTA 2X8AA 4OG2A 1K5GA 5TMPA 3BTOA 3REFA 5EJ5A 3HDJA 4FYYA 1Z62A 1NQTA 1SRRA 3IP8A 4W7IA 1NVBA 2BFFB 2XIQA 1XD2A 4OIMA 3B1VA 4HN2A 2J0VA 5IAKA 1D6SA 2O1WA 1EK2A 2OHVA 3JWJA 1NKSA 1AZLA 1K6IA 1KBQA 1XNHA 2X9LA 2BV3A 3BJMA 2FPPB 1OJLA 1A72A 3BWVA 3CU5A 1BHO1 5HYVA 4W4TA 2P91A 5D51S 1CIVA 1VG1A 2AXQA 2HLDD 4MCHA 3WXMA 2J85A 5JECA 4WN9A 5FF9A 5JCOC 2F7SA 1AY0A 3JSAA 5H59A 4A3SA 2EX4A 4FZRA 5IC5A 3DC7A 1ESMA 1GLGA 3ZHRA 1J5EB 1IYZA 1JMKC 3AP1A 3M6XA 4H7EA 1IEXA 2JGAA 2QZJA 4JDUA 4N3GA 3T7CA 4Q4HB 3UHAA 3W2FA 1SXPA 2I7XA 3ENQA 5ALRA 4BLSA 5ICGA 4MSUA 2X5NA 4QQKA 1PFUA 5BNFA 4O1HA 1T4GA 1SA0A 5J5AA 1OCEA 4TXJA 1C3JA 1KDZA 4B6JA 2ATIA 1L4BA 4JJIA 4E11A 1PWEA 2QPLA 2R6AA 5AI6A 1IM5A 2QOEA 1IPHA 2VDWB 1AKVA 3EXG1 2C4UA 1OV6A 3BMNA 1ZK0A 3LL4A 4A7PA 5JS8A 4GKKB 1CUIA 2WNIA 1V8FA 3GA7A 1UC4B 3HYSA 4E31A 3QVGA 4C0KA 5IJWA 2J09A 5JJLA 4GNKA 2QY9A 4H7FA 4MV7A 1ID8A 2WU0A 4OA5A 4JI3B 3ROQA 2ZANA 2BKVA 4QFCA 1M67A 3ZHSA 5KAMA 2BW0A 2QTWB 1JAIA 1YI1A 1KJIA 2WJYA 3O03A 3TRFA 1U0TA 4NARA 1KE2A 1KSJA 2RIRA 2VC2B 3V48A 1WUIS 1O2DA 2E6KA 5I4KA 1QDUA 4HDNA 2CLLB 1H0HA 1I7NA 1ZN8A 1TCUA 3SICE 1OASA 2TMDA 2O8CB 1SHTX 2YW2A 1UBJS 3I42A 2PK3A 2PUGA 4LWPA 5E1OA 2J3EA 2DSTA 1R15A 1UBOS 1YR9A 2GNAA 2A0FA 2CHEA 1XCGB 1Z6AA 2QM7A 2RG1A 2X15A 4H0CA 1GQRA 1NUAA 2IELA 4JVMA 3QEMB 3LHIA 4FMDF 4JY7A 3T38A 1Y7LA 5LQRA 5LYJF 4IQ0A 5TS3A 3TAUA 1QIGA 3K0CC 3IAS6 1GZ5A 4FDMA 5DDIP 1N0IA 1GNSA 4PC2A 1KAMA 2MIIA 5DHSA 4ZU3A 3RYHA 4LDRA 3ZWWA 4EABA 1OXUA 2GMWA 1NUHA 3ND5A 4I2NA 1JDPA 1HA3A 4LYHA 1II8A 2QX6A 1OXSC 1Z45A 4UTXA 1E69A 1A8IA 2GJKA 4CL3A 1VI2A 2AR7A 3CF4A 4F6LA 2RI6A 2V4UA