1JFVA

X-ray structure of oxidised c10s, c15a arsenate reductase from pi258
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
131
structure length
131
Chain Sequence
MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords arsenate reductase
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 39
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jfvA00
4O1HA 4W5RA 2JK1A 5KC9A 5KQGA 2FEPA 1DP4A 2A9OA 3A3KA 3IP6A 1YVUA 3CHYA 1Z2DA 5FBKA 2QU7A 2FLWA 4G0OA 1ZITA 2FQYA 3QX8A 3OLWA 3EULA 1JFVA 1GCAA 3H5IA 3QLVC 2PJUA 3C3MA 2FVYA 2VUIB 4OG2A 4PYRA 1GUBA 2F8TA 2V0NA 3T38A 4FE7A 3F6PA 5TE9A 2NZVG 3H5WA 1ISSA 3ILHA 5TPWB 3H1GA 2WJWA 3C6QA 5EWMB 3N0XA 4Q6WA 2L19A 4WUTA 1APBA 5JS1A 4F06A 1GCGA 1YTUA 4L85A 2RGYA 4UHKA 4YLEA 3URMA 3VNBA 4RU1A 3RVPA 3ILYA 3LUGA 2WRZA 3IP9A 1QQBA 3HS3A 1VLZA 2QR3A 3F7NA 1S8NA 1SD5A 3N0RA 4L4UA 5T3YA 2PUBA 3O1IC 1ZHHA 3MF4A 1MB3A 1BDJA 1UDRA 4F3TA 1DRKA 2LPMA 3I42A 4W5QA 1QP7A 1ISRA 1ZGGA 2AYXA 1USIA 4F12A 1RPJA 4KK4A 1JHZA 4B09A 4Y9TA 5C5EA 3G85A 3NNNA 3OQOA 3D8UA 4ZMSA 2BGGA 4RWEA 1D4ZA 4W5NA 2RJOA 4G0MA 4F8JA 3EAFA 1K66A 2L18A 2JVIA 3MA0A 2CHEA 4RK7A 2LIVA 4Z4GA 2LBPA 2VUHB 4IF4A 3N0WA 2A9PA 3EQZA 1PNTA 3GYBA 4QICA 1QP0A 3QEMA 3N8IA 4YCSA 4ZPJA 4EY3A 1EWKA 1DCFA 3RVLA 2MYPA 3Q7RA 1K68A 4Z4FA 1LJLA 4JAVC 1NXVA 1RXEA 1SXHA 2B1JA 5EWJB 4MR7B 4N41A 2TMYA 4IMJB 4QYWA 2FMKA 4G0YA 2M98A 3FFXA 1D1PA 3QLUA 4Z4EA 2IDMA 2FXIA 2QVGA 3QLTA 5BQ3A 2GKGA 1F4VA 1ZDMA 1SXIA 2HJ9A 2PMCA 5TPZD 3Q7TA 5IUJC 2PAFA 3ROFA 1KMIY 3CLKA 4TN5A 3R0JA 1QO0D 3OMXA 2B4AA 2IPNA 3DGEC 1PNRA 1U04A 2FLKA 4HNSA 3SG0A 4QYMA 2F8SA 1M5TA 3H1FA 4LZLA 2PUDA 1JF8A 1AB5A 5TPWA 5TQ2B 1NXPA 3OLVA 3CKMA 1RZRD 4HNQA 4Z4HA 3LUHA 5EWMA 2IPMA 4RKRA 3O2QB 3KYJB 3HCWA 4P98A 5KQPA 3M6MD 1U8TA 3NHMA 3H5TA 2DRIA 2CWDA 4G0PA 5DTEA 1TVMA 4KZKA 1I3CA 3JVDA 4H3HB 1E2BA 1JLKA 4RY9A 4MS4B 3W9SA 3MM4A 3O74A 5KI6A 5TQJA 3QEKA 8ABPA 2R47A 5IUNC 4ZYLA 3FFWA 1E6MA 1F51E 2NUBA 1ABFA 2IOYA 3H1EA 4MGEA 1U2PA 2FEKA 2FQWA 4ZMRA 1ZGZA 3RQIA 3GBPA 3N6VA 3IDOA 1YK0A 1VRVA 2A9RA 1ZAYA 4EVQA 2NT4A 4XASA 3CS3A 4RK1A 3GL9A 1DBWA 2P9HA 3LMKA 5CHYA 4YWHA 3TB6A 4KRFA 2MYTA 2ZAYA 4ETIA 3EJWA 4YP9A 1USGA 4JA2A 1AB6A 4HYEA 2W42A 1LBHA 1JWLA 4ML3A 4RXUA 4RY0A 5DGCA 4WXEA 4D6XA 3CZ5A 3UKJA 1NXSA 3NNSA 4OBBA 5IEJA 3CRNA 1DRJA 2Q5CA 2IKSA 4OTZA 2I6FA 4ETMA 1XHEA 4MPTA 3OLZA 5EWJA 1JFTA 4MR7A 4PE5B 2LUOA 3QK7A 4M88A 5DLEA 3MQ4A 3GV0A 2QXYA 3CNBA 2PL1A 3RVQA 1CYEA 3LKVA 4H3KB 3O2SB 1YS7A 1MIHA 4EYKA 2R25B 1B00A 2FMFA 3CU5A 5HSGA 4DQDA 3TX6A 2PUAA 1JYFA 4KFCA 2FKAA 1VPWA 3M9XA 3H5LA 3OO1A 4YO7A 3CG4A 3TD9A 5ED4A 4RK4A 4GNRA 4Q7EA 2YHAA 2MYNA 1JX6A 1P8AA 1Z15A 3HEBA 5TQ0B 4KPYA 2ZWMA 2HSGA 4WXMA 2A9QA 4WZZA 5TQ2A 4Z99A 3SM9A 4RK6A 4MLCA 2PLNA 1ZH4A 2FMHA 1E6LA 3D02A 2QW1A 1FFWA 5D2CA 4RK5A 1ZVVA 5E3JA 1IIBA 1PHRA 3KHTA 4KQ9A 2IYNA 4YGXB 3BREA 3MMNA 3Q15C 3DBIA 4XXHA 3A0UA 1P6UA 3SNKA 1U2QA 1RXIA 1SRRA 1SXGA 1GUDA 2OQRA 4TLMB 3BILA 4MS1B 3P9YA 5GQSA 4MS4A 1DCMA 4MQFB 3QLUC 1DG9A 3I45A 3EDCA 5FWYB 5F64A 2QV0A 1Z12A 3L6UA 4JP1A 3RVRA 4EVRA 1C4WA 4KQCA 4MR9B 2H3HA 4EYQA 4G0XA 4H60A 4XARA 3BRQA 1Z26A 2PUGA 5KC8A 4W5TA 2J48A 1DC7A 1JL3A 3KS9A 4XFKA 2JB9A 3S99A 6CHYA 3GRCA 1ABEA 3B2NA 3HO1A 1TLFA 1YK1A 3G1WA 1W25A 2E4WA 3T95A 1CHNA 4MQEB 2GX6A 4IGAA 4O1IA 4OLBA 4MRMB 3O1HB 3KCNA 1U0SY 4RK0A 3KTOA 3HUTA 3RVOA 4D6YA 1M5UA 1DJMA 4RZSA 3LTEA 5CNKA 5IC5A 2R4QA 1NXOA 3LUKA 5CNIA 5BRAA 3T8YA 3HK2A 3H5OA 2L2QA 4KK3A 4TMYA 5KQLA 3H6GA 3K4HA 1GLGA 5IBQA 1W9HA 2P4UA 3RVJA 4ZJPA 5KQMA 3LUJA 4MYRA 2HQBA 3GA5A 1VKRA 3RVSA 3EQ2A 4Z9AA 3FGZA 5TQ0A 1NY5A 4MLDA 3FMVA 4F11A 4WWHA 4Z9BA 4JOQA 1DBQA 1NXXA 4JB0A 1BDIA 1FQWA 3GT7A 4RV5A 1USKA 1C0EA 1MAVA 3LOPA 4NV3A 4NQRA 1ZH2A 5ABPA 3KJXA 5GOTA 3JPYA 3OQMA 2QSJA 3DGFC 2GBPA 3IP5A 5PNTA 2IPAB 3HUUA 4FE4A 4MS1A 1Z2EA 3DZDA 2NT3A 4Z4IA 4MQFA 2N9UA 2E4UA 5FWYA 3F73A 1YS6A 2ID7A 2H0AA 2KYRA 3HDGA 3OO0A 4KMRA 5JNVA 1FFSA 5TPZA 3UUGA 1FSPA 2FW0A 2WJAA 2XDYA 2PE5A 2L17A 1H9CA 4MR9A 2FN9A 4MR8B 2HQOA 1L5YA 1QO0A 4KV7A 3SAJA 2X7XA 1ZN2A 1EWTA 3N53A 3EGCA 1OXKB 3SY8A 3RVNA 1LK0A 2WY2D 2WMYA 2E4ZA 3F6CA 1TMYA 4RXMA 5JNUA 1PEYA 2AYZA 3JPWA 1BDHA 4EUKA 2IPLA 3SQNA 9ABPA 1RZRA 3EODA 3OM0A 1XHFA 4S04A 1JBEA 3A10A 1FFGA 5EWLB 3FFTA 3OLYA 4LE0A 5DCLA 5JS2A 4MQEA 1JYEA 2WB4A 3DLHA 3GWGA 4UHJA 4XAQA 4MRMA 2MSLA 1R8JA 3HSYA 3IP7A 1D1QA 4PICA 5HQJA 1OXBB 3HM9A 2R48A 3UK0A 5T7BA 1URPA 4O5AA 5HKOA 3E3MA 4MAAA 3JVIA 4ETNA 1WETA 4YS6A 3I09A 1HEYA 3O21A 4N76A 1DC8A 4G97A 4N47A 5BR1A 1QPZA 4LRQA 2MSKA 3A0RB 3OM1A 4D74A 3I5AA 4KNYA 1M2EA 4IRXA 5IEBA 4OLAA 5FWXB 1E6KA 5B3JA 3C3WA 4JB2A 3NHZA 3Q7SA 4CBVA 4P1ZA 2NZUG 3QELB 4LX8A 4EYOA 4IILA 5IUKC 1A0OA 1T34A 2VK2A 2FTKE 2JVJA 1ZESA 3KKEA 1Z18A 3O2JA 2MYUA 4RDCA 6ABPA 4MS3B 4G0ZA 3O75A 3LUFA 2HQRA 4N03A 5CNJA 1KGSA 5HM6A 1NXTA 3IPCA 3DLBA 2PUFA 3CFYA 4IMIB 3C97A 1A04A 5KWSA 4LE1A 1ZY2A 1EWVA 1QQAA 3CTPA 3QLVA 1YMUA 4Q6BA 3LUCA 4DADA 3K9CA 5BRJA 1TM2A 4FB4A 1Z25A 2RJNA 4EYGA 2FEWB 3M9WA 1MVOA 4PEVA 4MR8A 3HV2A 1DZ3A 2FQXA 4Z0NA 2WWVD 5CNMA 4YRZA 2JBAB 4G0QA 3CG0A 2JCGA 7ABPA 4JASB 3LUAA 3HVRA 4DN6A 1L5ZA 1QMPA 4RSMA 1RNLA 4NCBA 3BBLA 1P6QA 3JY6A 3NBMA 4RXTA 3LFTA 4TLLB 5IULC 3OQNA 1DBPA 4LDAA 2CHFA 3O1JC 3N75A 4N0QA 5EWLA 1LJUA 5JNTA 5JNSA 4E7PA 1TJYA 3H5VA 4LE2A 4GPAA 4S05A 5I4CA 4KREA 5JNWA 2E4YA 1P2FA 3NNDA 1DCKA 1KRXA 3OMWA 2FSPA 3VNAA 3QX9A 2OENG 1A2OA 1JFSA 4RY8A 1YMVA 3HDVA 1D5WA 2GI4A 4YV7A 4NICA 4KVFA 3MYYA 4N0PA 1PUXA 1BA2A 1Z13A 2GWRA 2PL9A 1JDPA 1PEAA 1M2FA 3TMYA 3HXMA 3MIZA 2FN8A 3KLNA 4XLTA 5DKFA 1JDNA 2QZJA 5FWXA 1EFAA 2LP4Y 3RH0A 3Q41A 3JS5A 2FMIA 1CEYA 3LUDA 1YIOA 3QELA 5IX8A 3TO5A 4RS3A 4EGSA 4W5OA 3KG2A 4MS3A 1EHCA 3T6KA 3ROTA 2RDMA 2JVKA 4E7OA 5JNRA 2HPHA 3KLOA 3C3KA 3Q9SA 1NATA 3GBVA 3KYIB 2VYCA 1QKKA 1BVHA 3CZCA 2QVCA 4QPJC 1KRWA 1BAPA 4G86A 3JTEA 2YHBA 1JH9A 1NTRA 4EVSA 1Z17A 1QNLA 4WT7A 3HJFA 3H6HA 1MB0A 1NXWA 3IPAA 2PUCA 3KSMA 2M1ZA 2O20A 2MSWA 3RVKA 2E4VA 3HZHA 1Z16A 3RVMA 3FDFA 2E4XA 3LKBA 3BRSA 4Z4CA 1QP4A 3L49A 2JBAA 5B3JC 3OLXA 2JRLA 1Y1LA 2PUEA 2PKXA 3QEMB 2ID9A 4OATA 2CD7A 4PZ0A 1EAYA 1D2AA 3E61A 5FBHA 4YR7A 1LBIA 1XWWA 5C5CA 4NCAA 3H75A 4HNRA 4LDZA 4RKQA 1J56A
chains in the Genus database with same CATH superfamily
4JCCA 1COWD 1M76A 1T0HB 2ZW9A 2A9OA 4ZRMA 5KQGA 4CM8A 5LP6F 3LHKA 4QYSA 3QNWA 2YUTA 3CH5A 1JIQA 5LXTA 3FI9A 4GLBA 5KREA 1M7GA 1ND6A 4FX5A 5AK6A 2J08A 3DJYA 4GLOA 4GPZA 4Y98A 1MX5A 4FDMA 4AJIA 3AU9A 3AVYA 4IYJA 3DBHB 1QYDA 1XZQA 3S55A 4AY6A 4RS4A 2XVYA 3Q8KA 1W2WB 3QPWA 1ANKA 3F6PA 4DQUA 5I51A 3G2LA 3THSA 3CNLA 1A5AB 5CLFA 8ATCA 1NOIA 2A1TS 5MFPA 2G9QA 4JU8A 1HL3A 1Y5RA 1NPYA 4UM7A 3PHBE 4DM3A 1JEYA 4RJ2A 4ZWNA 1HL7A 4GQIA 3LPNA 2X2FA 2AMJA 3C3CA 1U9YA 1XL0A 1PZXA 1QZZA 2Q2NA 4EG0A 1U63A 5FUXA 3SQLA 1I01A 4ACAA 1ODLA 4OSOA 1WCWA 1QJ4A 3BWDD 3H2KA 4TLEA 3I37X 4JBNA 5LMUB 2WUEA 3Q0TA 3MWJA 3ZDEA 3ZI0A 3AEUB 1QIGA 2ODAA 2ZIXA 3DW1X 3IP9A 4DJJA 3B6JA 4LMRA 4IQ0A 4YIKA 4CL2A 2RI6A 1ZG3A 3VAAA 1E3IA 5AW3A 4W5QA 3ORSA 1E2HA 2C5FA 4G23A 1CZOA 2WG0A 1T6ZA 1I2CA 4JJFA 4DCSA 5JD5A 4MKHA 5TDHA 2G7ZA 5THXA 4B44A 4M0MA 1KERA 3GUVA 2Y77A 3D4OA 3L8MA 4HWTA 4KK4A 4L76A 4OHXA 4B09A 4QG3A 2OO5A 1TKCA 5F23A 1MC8A 4RWEA 1T6NA 4FOOA 1MRNA 2ZJ6A 2NAFA 4DTCA 1ZI8A 2QA5A 2WFMA 3D0RA 4P4NA 2LBPA 4RZ2A 1JKJB 3EQ8A 4W9RA 2A9PA 5CAEB 2FUEA 4KZPA 1EDDA 3VZBA 4YCSA 4E5DA 3GLSA 5LC1A 2AFIA 1UOOA 2PBLA 4MHOA 2X58A 1JPUA 2J45A 4D3ZA 1M1NB 2AFVA 5ALGA 4F5WA 1PLJA 1UJCA 3PJGA 3WISA 4ARBA 1I3LA 1QX4A 1XXHA 3VNQA 5LPNA 3IAEA 3FBGA 1ZR2A 4DC1A 3OH8A 2HF7A 2CXHA 3NT2A 1F5NA 1JQEA 2E87A 2QZ4A 3QF7A 1A9YA 4G26A 4GWGA 2R4UA 2MJLA 2ZVJA 4LSGA 4YWJA 5LA6F 4Z4EA 1F3OA 5BQ3A 1QG6A 1YL6A 5DN6D 2PKCA 3QXJA 2AKAB 3HBFA 4FB5A 1WXIA 1V43A 5AJYA 1M5RA 1XTJA 5K8JB 4S0ZA 4IV0A 3W6OA 4XE5A 2NXCA 3W6UA 4XQ0A 1U2ZA 4RTKA 3EIEA 3ENWA 4QQRA 3L4JA 2P2CA 1U04A 1XVLA 4GQBA 4D9BA 1LI7A 4TX1A 2DY1A 4M8KA 3H8JA 3LECA 3EVNA 1BGWA 3JYLA 4HAVA 4KUEA 3CKMA 5C8XA 2PT5A 1XQXA 3JYQA 5AVQA 2ZB7A 1Q0QA 2NTNA 1X2EA 1QWSA 1Z4MA 4ZYWA 1YDMA 2IIBA 1IZYA 4HLUA 4CIVA 1U7WA 3ZWPA 5BT8A 5LR6A 2EZ4A 1CUZA 3L6EA 4V0ME 4K8RB 4J3FA 1C1XA 1IG3A 2JLXA 1U0EA 4MS4B 2HIHA 4Y6RA 3W9SA 2FR0A 2N75A 4X6XA 1JU3A 1VLQA 3CKYA 3K0HA 3BD7A 3LX6A 4DNXA 1RSZA 2PLFA 2ZUDA 4FMDB 5IUNC 1NNI1 5AW4A 4QT0A 3ZI4A 1PSWA 1RWKA 3KQYA 4G8DA 4J2HA 4MYCA 2GR9A 1WLSA 3ANLA 2VJOA 5JE8A 3JYHA 2SBTA 6ADHA 1KA9H 1KMHA 3WGHA 1V7ZA 3MGKA 1Q3KA 3Q0EA 5I8PA 3ZWKA 3RIYA 4AO8A 4Q7LA 3ORQA 1NQ5A 4BNLA 4U3JA 4Y9DA 1J7KA 1DI0A 2CCKA 4KLRA 5I7RA 2VAMA 3Q8LA 1DQNA 3ODGA 3VO8A 4EMSA 1FFDA 3PXDA 2VXOA 1N9KA 3DWIA 4OSEA 5E8JA 3IURA 3FIUA 1USGA 4YP9A 1K4KA 3T35A 3T5MA 3SP1A 5T4EA 3F9CA 2ZRNA 3HVUA 4U02A 5EHIA 1CDDA 2PQ0A 4UMVA 3OX3A 3GLRA 2V5AA 5HG0A 4EI9A 3CZ5A 3R6WA 2F9LA 1SKYE 2QW8A 2FFJA 1DRJA 4OTZA 4AKSA 4F9GA 4UNRA 1FU8A 1G1AA 4HAWA 4JITA 4B3SB 5K4HA 1HETA 1QVRA 1BU5A 4PLCA 2AD1A 4AJPA 4ZAGA 4KOAA 2XRMA 3TW8B 4QJIA 1ZNWA 2IZ1A 4CIXA 2PZLA 4YCNA 1EA7A 5COAA 2FI1A 2PWBA 3GNTA 1NN3A 3IOEA 4EUFA 1MIHA 4H0FA 2MTBA 3WLJA 1V6SA 3IKLA 5HSGA 4O0LA 5HZGA 2TRSB 3M2PA 4DW8A 3L8HA 4HS9A 2WSLA 4CGZA 4GPEA 2BLNA 2QJWA 2GZ3A 2P69A 3SIWA 3LDUA 4IIJF 3AF0A 3GRFA 1IJKA 1U3TA 1BE1A 2BV3A 1DWUA 1EM8A 2OORA 5TQ2A 5JALA 1FRZA 2AOXA 4L15A 2Q99A 4LZOA 4DV7B 1FFWA 4TWBA 4X3CA 3PFGA 1RC1A 3VZDA 3DHNA 1FP4A 4FNMA 3SS9X 4P9NA 4OI2A 4XXHA 3L0YA 1CUEA 3FKSA 3L02A 4ISBA 3WSWA 2J0QA 3VVLA 4RHTA 3SNKA 2CFIA 2D5BA 1YQ9A 3TL3A 5GY7A 3NDBB 5SV2A 3FPGA 4RSRA 3GLTA 4NULA 3K4QA 1K9VF 1G20E 1UZUA 3EDCA 3A8TA 3PYXA 4TUYA 1NI3A 4C5BA 4CTMA 4HVTA 4NOJA 1D0VA 3GFTA 4QUGA 1X1BA 4RHYA 1F2TA 3FZEA 1YS4A 2H92A 2XXBA 1VYVA 2NX2A 1J24A 1C50A 3LT5A 4H60A 4OGKA 4TS3A 3L0IB 4XLZA 2YBDA 3HU5A 1A9OA 4RVCA 4XOUA 1LF5A 5E7QA 3V6MA 3TD2A 5KC8A 1DXHA 5G4LA 2QUBA 5FT9A 1HT0A 3P5BA 2JGLA 1BO6A 2DJ5A 3H9EO 1U1EA 1P1HA 1V71A 1KTIA 2WHRA 3FCYA 1H0HA 2FUG1 1CULC 1KZGB 4F8YA 1V11B 1TLFA 2Q3CA 4DZRA 1X6VA 4BLVA 3PEVA 5AI4A 3DMNA 1W35A 4CEHA 4HB0A 1ZIYA 3GHYA 5CA1A 3K0KA 3PXGA 4X64B 1SU6A 4A15A 2C0QA 3R76A 4GS5A 3HUTA 3R8XA 3SJBA 1UMCB 3WRXA 3OCZA 2YWDA 1SVKA 1PGQA 3CRZA 1NYTA 1W73A 5H9WA 1MHPA 2VSNA 3PFWO 3C5CA 4UPEA 1KMQA 5BRAA 1VC2A 2KJQA 2P78A 1NVDA 1ZGHA 4Q7KA 1QF7A 1PLLA 2KSQA 3TSZA 3C7AA 4A7PA 1KK1A 1C1DA 4LC0A 2DAPA 4L28A 4CTJA 1QH1A 4URVR 2W0SA 3MINA 1DJOA 1MF7A 1LK5A 2B25A 1U0JA 2B30A 4LDQA 3X1KA 3WFZA 1XU7A 5JJBA 3COPA 4O4JB 4YAOA 5HKLA 4EGAA 1CW2B 1M2JA 1M75A 1OHHA 1VKRA 1SG6A 2O2JA 3BA6A 3EQ2A 3NJ4A 3QE4A 1W52X 4WFIA 5L3QB 1PW7A 2D1QA 1TVCA 5CVJA 1RCUA 3HR8A 4HWSA 4RPHA 3X1WA 4KWEA 3GPDG 1KF0A 3ZD6A 2Y67A 3ESAA 1XF9A 2WWRA 5HK8A 1FP1D 4JBYA 4O4HA 1ENYA 3FPLA 3NKVA 1HMYA 2VNHA 1ZH2A 4BFTA 4EGQA 3PNSA 2UVDA 1X8XA 3K7EA 2DEUA 3MPUA 3HG7A 3KTDA 2VOJA 2H00A 4QRHA 4QBHA 2NXEA 1Z5OA 5LB2A 3AIKA 5ECDA 2AW3A 3EHDA 5AVVA 2VNIA 3AW8A 3AEKB 1SZCA 3BDAA 4YDHB 2NPFA 4BMCA 1KORA 4DR5B 2H0AA 5MFZA 1FDIA 4J75A 2ZS7A 1Q6ZA 2FNAA 3IDAA 4QTZA 3SVLA 2CDAA 2HMUA 5TGZA 3WL6A 1LQTA 2VHTA 4MYSA 4Y67A 1ZJJA 1F8UA 3WKBA 4KPFC 3HXPA 2EVWX 2W6OA 3RVNA 2IY9A 2J4DA 5C80A 4IV5A 3M83A 2OHOA 3HU3A 3V48A 5B7NA 4ZHQA 3PE6A 4CQMA 3PJRA 3D6FA 4A0FA 4BX8A 1MR3F 2C59A 3RD5A 2HM7A 3W6ZA 2C7VA 3OLYA 3FSJX 1OIWA 4MQEA 5H7XA 2IUEA 4BZWA 3GWGA 4UHJA 4DE5A 4NS1A 3SEZA 2OY0A 3R77A 5JAUA 1Y3HA 1R8JA 4A0SA 4RC9A 4TROA 1SGWA 5IKEA 3P5SA 3SCZA 4LJSA 3R75A 1GNRA 4D96A 3GD7A 3H4VA 5FWAA 1ENPA 3GLVA 5T7BA 4K6MA 4O5AA 3WGZA 3EY9A 2WINI 1UMKA 1US8B 1YZFA 1U4SA 3H11B 3K0AB 2VWQA 2GXUA 3E23A 4RMHA 4XH9B 3URKA 1XTSA 3LDGA 3W2IA 4DLBA 5AVSA 3DTVB 2QMUA 1WB5A 3F9RA 4G97A 3HI4A 4E3WA 1E98A 4EF6A 1ZUD1 1JG3A 2HCJB 4KE8A 3NIGB 4RFVA 2BEWB 4D74A 3A6GA 5DM2A 4DV6B 4H27A 1VSVA 1KSFX 1NP3A 2HQ1A 4JC4A 4JQCA 5IEBA 4DREA 1E6KA 1JDTA 2MHCA 2O2HA 1RHMA 5FTWA 3UM9A 2BEVB 4EYOA 1AUOA 1Q3TA 4UXJA 4JEIA 2O9JA 4IILA 4NNPA 2FTKE 2B6HA 2JVJA 1YQEA 2WR8A 1ODFA 1QTIA 1RHQA 1WMAA 3A4NA 5MGBA 2Q5OA 5CYGA 1KGSA 2KQUA 4GOND 1E7SA 5I9BA 3AC0A 4MYTA 1LS1A 4MLPA 2MT9A 3HZZA 4I4IA 2LTAA 2W2KB 3G5TA 1C4OA 2GSWA 5FLKA 5KWSA 4WFJA 5IAEA 2LDBA 1PG5A 1JAZA 2ODWA 3CH7A 3B12A 3KVNA 3KOMA 4ZREA 2HPAA 3TMKA 2C4TA 2VXCA 1E2GA 4K28A 1OFIA 3JQ7B 1FF9A 5AP9A 5LMCA 1S1CA 1O95D 1AZWA 1DOZA 4CLEA 2WIBA 4YEDA 1OBOA 1UH5A 1ENOA 3TZBA 3MJCA 2A9JA 1PBTA 3KT0A 4Y6GB 2AZXA 1I0IA 3IDSA 4LJ5A 4E4YA 3H0CA 2GEDA 2JGIA 3CBGA 1Y8QB 3VQTA 2OV1A 4V02A 5K0LA 1QYRA 1T3ZA 2VDJA 3WQQA 1M6WA 3MG9A 5TV2A 1AN9A 1K7EB 4WOKA 4CKYA 3N75A 5ALXA 4Q1DA 4BQEA 5JH7F 3CE9A 4TM8A 2HSJA 2ZKIA 2HV9A 1HFEL 1N0HA 2E1PA 1TJYA 2QMHA 3KKOA 4JUFA 3Q8XB 4LPKA 4CJXA 5I4CA 2VZ0A 1OI3A 1V96A 2D6FA 3PBKA 4HDSA 2PKWA 2XUHA 3NNDA 1VLMA 1KRXA 1ZK3A 1ZUHA 4ZJUA 4K3VA 5FBQB 4CKCB 1KH2A 2QZZA 2Z5LA 3U7FB 1ZM7A 2UUBB 3EF1A 4MCHA 2QVLA 3I2JA 4XUGB 4M0LA 1NONA 2WTMA 1BKDR 4L50A 4C9BA 4BRZA 4JLDA 1K9SA 1JNXX 3DVLA 3TW6A 3ZZ1A 3E5NA 1I3NA 1I8TA 4UD6A 5TARA 3F5DA 3VPAA 5BVHA 3CWCA 3MXTA 3U44B 4UBKA 2PH5A 3D1LA 1VE6A 5CDGA 5CLJA 3IFSA 3EA4A 1Y1SA 3QELA 3WQSB 2XB2A 1CY8A 1MCZA 1Q7RA 2R5WA 1E2KA 1H1LA 3AG5A 4B3IA 3LY7A 5FV7A 1TF7A 2LKDA 1QZTA 2ZYUX 3B70A 2J3JA 2AV6A 4U9UA 3PR3A 3QTLA 3EVBA 2EDCA 4Q3NA 2DUNA 3BICA 2IYRA 3PNPA 4DDKA 5JCJD 3KYIB 3HJGA 3OE4A 3X1YA 4A0HA 1Y6QA 5K8LA 2PH7A 1G4HA 3GPBA 3OZFA 4HJRA 5JJKA 2DMRA 3KV1A 3CVYA 1XMQB 2P9TA 4IEFB 3L1UA 4W4TA 4DIKA 4ZARA 3RSHA 4B84A 2COEA 2GUGA 4EW6A 3RRZA 3PF9A 1Y4SA 4ALKA 5EMKA 4F4CA 2DGDA 1JAIA 3WRYC 1A4RA 4PZZA 1ADGA 1KK3A 2D06A 3IBYA 3LT2A 3A1FA 3N7TA 3ZQ4A 4OQMA 3TQQA 4QU0A 4L02A 1JQ5A 2PX0A 3SN6A 2PUTA 5JCZA 1UT6A 3LGXA 5FBHA 3Q10A 3VHQA 1I4TD 3NAQA 1UWLA 1X80B 2VUTA 1KO5A 2NU7B 2Y3IA 3H19A 4AYXA 3EEYA 3L46A 3UV7A 3PTZA 1GG8A 2JH9A 1YDFA 2EL7A 3COYA 4K9OA 1QDEA 3OI7A 3SLRA 4X7RA 3QVXA 4Z1MD 1YVUA 4NZPA 2PHZA 4AG6A 1S8FA 2AFHA 4A0QA 2FFHA 3BE6A 1K3TA 3GLKA 1XOIA 4PF1A 4ITUA 4F21A 1MC1A 2NSHA 3P2YA 4MVJE 2V0GA 2ZVPX 1FTSA 1GAEO 2AN4A 2NSLA 1JR3A 2P0YA 2IXDA 3LLVA 5DNYB 2G17A 3K8QA 3NASA 3QKSA 3ST7A 3WK5A 1YDGA 3I2FA 3ZIUA 4BVGA 1VHLA 2GJKA 4DMRA 4HLQB 4H7IA 4N0DA 3KQNA 2EATA 3R8CA 1VL5A 2C2BA 1IULA 1Z88A 3BSSA 3CLSC 4I6JA 4N5LA 4CIDA 3D3EA 5EWMB 2RH8A 2G5CA 5CDFA 5HE9A 4NBUA 3VDXA 1QZUA 2JA1A 1K6EA 2LIPA 3SBOA 1GILA 4OK6A 4EMUA 1Y3CE 5DU2A 1RAFA 3IOBA 3R3ZA 2BKUA 4GMXA 4DQKA 3I64A 1MJGM 1V0JA 3TUJC 2XGJA 3EARA 3RNOA 4C0SA 2C3PA 1YBHA 4HDKA 3MW8A 3RGWS 1FRNA 1JHUA 1WVMA 1ZHHA 1JA9A 3QZUA 1WO8A 4URUR 2ZPTX 1N7HA 4BMNA 4U8GA 1R0XA 2G7MC 3C4QA 2JLZA 3VZPA 3IEMA 1T3LA 2OTCA 3NZEA 1USIA 3L7AA 2B69A 5A9TA 4BO5A 4DDHA 3WQRA 1Y5MA 2FPPA 2IY7A 4OYYA 4ZJYA 2X4LA 3G85A 2BMEA 4GOMD 4HSEA 2EQ5A 1EUCB 5AHOA 5K8VA 3KIPA 1I5EA 3VHXB 1XALA 3HDQA 3NOQA 4NZZA 2NSDA 3EAFA 4HQ0A 4XGNA 4O3MA 4WOBA 4G4JA 1KS9A 3ZH9B 4QX6A 4V38A 2VHEA 3RFTA 2FF5A 4UHBA 5JCOA 3M6UA 3OWHA 5E2IA 4XDGA 4JYAB 5CH3A 2HU8A 2XMDA 3EN0A 5IJ9A 1VCOA 4GMHA 3AL3A 2YHUA 4P38A 3VO2A 2VRWA 3JWJA 3AHHA 4BY9E 3L43A 1LJLA 4V1CA 3D3JA 3KD2A 1KMMA 4MW6A 5E4TA 3B82A 4FFVA 2CB0A 3ETCA 4UJ5A 2VHUA 4GSYA 3U6BA 5T6MA 4ZI7A 4HXYA 4G0YA 4AP9A 3QLUA 1F4PA 1NN1A 1SK8A 4B4WA 3FAKA 3OOEA 2IIVA 3QX3A 3FKQA 3HH8A 2CVOA 2DF8A 3RS8A 5KOJB 2WSSA 4XRGA 2I76A 1KMIY 2YDXA 1N9GA 4I55F 2PK3A 4YAFA 1GU1A 2YICA 4YQZA 1H6DA 1HDOA 4X95A 5K0EA 2QAGC 2W6MA 3UMRA 5J2UF 1AKVA 4HLDA 1JZTA 4NWIA 3D7RA 3SG0A 3I0ZA 2F8SA 3TLCA 5A06A 2B37A 3O3OB 3DEHA 3O7MA 1WKVA 4C6TA 2VPIA 2IYVA 3T06B 5E9JA 1V2GA 1Y7PA 3LVBA 4DA4A 5J1SB 3TQOA 1E9SA 2G1UA 2OZLB 2NYAA 3HTXA 4HG2A 1PFWA 3FWZA 1Y8CA 1N3IA 8LDHA 5F3DA 1UL1X 3G13A 3IALA 1XCBA 2X1HA 3PEFA 1VL1A 5E0KB 3RIXA 3U31A 4E32A 3K35A 3G82C 3T5DA 3PRHA 2AIRA 2CJWA 4EB3A 5K3EA 3C1AA 3OQHA 3UAXA 1EX6A 1GEEA 1OREA 4HDQB 2VRNA 2WIDA 4QUAA 5C1IA 4E33A 3O74A 3RKUA 1W6UA 3GVPA 2AHRA 3L0CA 5TQJA 5C5IA 2H57A 1XU9A 1KAMA 3M0EA 4BLWA 4FZJA 5ALOA 1GKUB 1VMKA 2MMGA 1S6YA 3ZZUA 1XMJA 4B3FX 2WFLB 3HFJA 2LV8A 3SSNA 5E7JA 1WXWA 1ZGZA 4KXWA 2JHFA 5FRDA 2KI5A 3C15C 3LL4A 3PEEA 3LA6A 3K0SA 3CTMA 1UBHS 3O91A 3OZUA 1VYUA 2H65A 1F6DA 4E5VA 4EKNB 4PN3A 3ZCSA 1RJEA 3M4NA 4I4TB 4YDRA 1RRFA 4ZCIA 3STHA 4QBTA 3ETGA 3TLMA 2IQIA 1HNZB 1AB6A 2WPNA 3UW1A 4EJSB 5IC6A 4N3BA 3ER8A 2BKEA 3GLIB 1B6TA 3WK4A 3WGTA 1AKYA 1HDEA 5FF9A 1YR7A 3JD2A 4Z0HO 1CY6A 3KJEA 1NX6A 3LF2A 4YRAA 2VF7A 2IKSA 1Q91A 5DOZA 2AOVA 1N1GA 1DKRA 2G8LA 4HQOA 1AG9A 4RA6B 5IK2A 3UJ7A 3V8EA 2YNMA 2X77A 7ADHA 4OLHA 2O59A 2LUOA 3ORHA 4MA5A 5TMPA 3IT1A 1ECGA 4RYLA 4JLBA 4FFNA 1HYEA 4FNGA 4YQEA 2AH5A 2AB0A 1AUPA 1CRZA 2IIQA 3VISA 2XUOA 3K30A 3JQFC 1KR5A 3H99A 3LKVA 4F4UA 1UIMA 2PX6A 1ZOLA 1VI2A 1NV9A 1SIOA 3A28A 4H31A 1UWVA 4M1OA 4M6WA 5LQCA 4PIPA 2WTUA 1R6VA 1UZMA 1Y3DE 1QE5A 3IJ5A 3D4LA 2FUKA 3JWPA 2EP8A 4GVPA 2AVDA 1E63A 2FEOA 4BWFB 4DFDA 1MAWA 4EO7A 4KDFA 1G5FA 8OHMA 2I67A 1I24A 2KS6A 2A9QA 3SM9A 5IABA 2O6LA 1RQLA 1CEQA 3W06A 4CQNA 1Y5NA 4NVRA 5LWQA 5D2CA 5AJVB 1RAHA 1PHRA 4KLNA 5DGTA 5DLDA 2HSWA 1A9ZA 2IYNA 5ECYA 4BU1A 4CNBA 5CFNA 1XB2A 4YJGA 3CRRA 3ELYA 2ZUFA 4PNPA 1TUGA 2CW5A 3BGWA 1XLVA 1SRRA 1K8QA 5ALKA 2QG4A 2P7IA 4PONA 5F77A 3R3XA 3IA7A 1SPXA 4HJXA 1ZA2A 1Q77A 1DHTA 2RIPA 4RJIA 3HA7A 4U2EA 4O59O 1TAGA 1EVZA 3GGPA 2QV0A 4GX0A 5L6LB 3BH7A 2Q8PA 3HDTA 2FPWA 2ODEA 2IW1A 4J49A 2GVNA 4MJLA 2A3NA 4KQCA 3OQBA 4BNNA 5IJ0A 4GM1A 4RF3A 1W1IA 1OF1A 3WIBA 3ZWAA 5FBRB 2MCFA 4E2ZA 1DC7A 1I7NA 1HNXB 1YBAA 1JILA 4PNZA 3H2YA 1ZHOA 2IU4A 4FINA 4JJIA 3QBEA 3D1VA 4JYPA 3HXLA 2RK3A 3EIHA 4ZOCA 1MMFB 1ZLYA 3M4JA 2Z2IA 4Q48A 3P94A 5EFZA 3ICOA 5AW7A 3WWOA 1UM8A 4D4HA 5JCXA 1U02A 3NVMB 1ORRA 2OP0A 4JR1A 2GETA 3RE1A 4F7WA 4ZDJA 1SC1A 5MGNA 3THXB 4QGBA 3OURA 1QQTA 3U9TA 4GRAA 4L3VA 3BTUA 2JGKA 4PG6A 1LWOA 3N8NA 3IIJA 1I32A 3D6TB 2VZLA 3EZFA 3QJGA 4WQMA 1KR2A 2CYCA 4ICIA 2OP1A 2VBIA 3EWSA 4S35A 5HF9A 4D1YA 1M5UA 1G9SA 5C3UA 1V48A 4QGSA 4CR6A 4RKFA 1BH2A 3P0IA 2PTGA 3IXLA 4DB2A 2YJGA 1AQNA 4OL9A 2Q3JA 1JFLA 2R6DA 2YIJA 3OM9A 2IPOA 4DCPA 3KQSA 2JAQA 5LMNB 2YZ7A 4ALNA 1W9HA 2A30A 2GZSA 4E70A 3E0QA 3RS3A 4OMFG 2A0KA 2CLEB 4IIFA 4F91B 1OPRA 2C3UA 2UZ1B 3KLBA 2H9IA 5K3FB 4BNVA 1BOFA 3WGIA 1LFDB 1K2WA 2BM1A 3QOFA 1WLYA 1YTLA 2VNKA 2PKQP 2PXAA 1G64A 2N46A 1NY5A 1GSAA 3LGSA 3MJTA 1FK8A 4QASA 5DNUA 4IUCS 3SDSA 4YCBA 4Q93A 4IIEA 5U1PA 1PGOA 3QMMA 1SEPA 1EQAA 1VRCA 2I7DA 3K16A 2P5YA 3ONVA 2ARKA 1X7GA 2OCYC 1QV9A 1SNYA 5GOTA 1V4BA 5TSDA 4B8ZA 3RUDA 1GTG1 1QVVA 2QSJA 3DGFC 1TEHA 1YQXA 2R97A 3TL2A 1O96B 4B2LA 4DCTA 1XCPA 3A25A 1TGYA 2DX7A 4HVAA 3T1OA 1N8SA 1JS1X 1GADO 4G25A 1I3KA 4DV2B 3JVUA 4ENRA 4LTNA 4DLKA 1PJ8A 5FL3A 4G5YA 4QUBA 1NBAA 1RAGA 2PCLA 5JASA 2PKQO 5F2EA 4IIUA 4NXNB 1D1TA 3B20A 2DR3A 3PHLA 3I4LA 2QROA 1IVNA 3HY6A 3RODA 3OU6A 1NURA 1XKXA 3ASVA 4Q37A 3TW0A 4B79A 5JNUA 5KVSA 2OO3A 1CUVA 2FX2A 2GSDA 4FCCA 4J2TA 4Y18A 3W77A 1OD6A 3N6RA 1ORWA 2CZGA 2GBLA 2H5EA 2OO7A 2ZG6A 4KLAA 1VA5A 5ALVA 1OWPA 5I7HA 3E4DA 3WADA 4BFLA 3W5HA 1W5SA 1P60A 5LLSA 4HV4A 4I1UA 4UDOA 2O19A 3TVTA 1PG0A 4QARA 1UC4B 3C5HA 3EGOA 4JELA 4R2WA 4BKUA 1I9GA 5HZHA 1DIHA 4K05A 3VVCA 4BP9A 1V16B 3LBYA 1X94A 4MULA 1IUPA 1HOXA 1LSOA 4EG1A 1NUAA 1E3SA 3KQKA 4F2HA 4RPLA 1SELA 3KSAC 1AKRA 3EZXA 1I4EB 1ZP6A 4P82A 3UJPA 3EMBA 1CY1A 2DB3A 4AJHA 1NW3A 2PIDA 3C43A 4M0CA 3TG2A 3A2NA 4K9PA 4L22A 4KSCA 2PCJA 4J43A 3K31A 4OL0A 1NDQA 1VMAA 1YT5A 3IRUA 3UAVA 2IHKA 4YMVA 2JRCA 2AQKA 2RH5A 4KTTE 3KKMA 4LI0A 3WJ1A 5E6RA 3PNLA 4ILKA 2QOEA 4FYMA 3W1WA 2R6JA 4D41A 1EK1A 3EQ6A 4ENSA 6YASA 2FK8A 2AKEA 3UQYS 4OFXA 3QKUA 4RNDB 3UHPA 1J0EA 2I8CA 1QO7A 4FILA 4U8HA 3WKDA 3PL1A 2RI1A 2JFOA 1KU6A 3BMNB 3DD1A 1TF5A 3HL0A 2B20A 1S0UA 2PXXA 4I1OA 1DO0A 4CCYA 1RWWA 3TE7A 4QM6A 2NO0A 4WKPA 4YALA 3CGGA 2PUFA 1CTQA 2R1TB 4A92A 3TECE 2F8LA 5IJZA 4URFA 4EYEA 4LWOA 2XUKA 4CM9A 4D4MA 1HKUA 4GQAA 2JJ1D 4BIMA 3PTAA 3D0KA 4PX5A 5LN1A 2LCFA 3QVTA 4EKIA 3T4PA 4F4JA 1KYWA 1YC2A 2R44A 4X8HA 3K53A 4B17A 2BDUA 1OLOA 3NRJA 2F62A 3BH6A 1CV2A 1PYDA 5IWAB 4B7UA 1LTKA 1MVOA 4PNEA 1XD2A 5CNMA 3UENA 4ZIRA 5I6DA 4F3RA 2VKTA 1G60A 4FT2A 3W0LB 3SDZA 2JGNA 3QQPA 5J58A 1P6QA 3JQDA 2HHLA 3KFLA 4RD3A 5JVDB 1TUIA 2WP0A 3EZ6A 5J2TB 4DMMA 2OD2A 1NQXA 4D9NA 3A26A 3FCAA 2WSIA 3ANSA 1RKXA 4DIMA 1BG6A 1F9AA 3V32A 3ZTTA 2JGEA 1B41A 5TMDA 3EZ7A 3M1LA 3ZG6A 4CUJA 3DR5A 2VJMA 3A4LA 4K87A 5E95A 1CF9A 2CKMA 2QPOA 4FYWA 2WLTA 5TF4A 1MZVA 2YVUA 3AT1A 4ARAA 3O8NA 1MRZA 1MFPA 4M0EA 4OJNA 1JFSA 1PD0A 5FX2A 3R1IA 4FW8A 1ZCZA 4NY1A 4URHA 3IPLA 4NE7A 4Q7JB 1BGXT 1PJTA 1SD1A 2GI4A 4NICA 3UTDA 1U81A 1YFLA 2H7CA 2R6AA 5FYQA 1PWZA 5DX8A 4D25A 4Y9UA 5DNAA 3G2JA 5HQ3B 1YE8A 4J7AA 2OPHA 5D6NA 3HBJA 2Z3ZA 3CW9A 4ZT7A 4C4OA 1J0XO 2R00A 4J1NA 1ZWLA 4QGHA 2LP4Y 2EJVA 4GZLA 4OGLA 3RH0A 4F38A 2NPIA 2PQ2A 4PQYA 4Y6OA 5IF9A 3M34A 2PX5A 3LE8A 3QHPA 2AA3A 1MV5A 3DDSA 4Z4QA 5L7YA 4BB6A 3W5DA 5CT6A 1KAGA 3N2KA 2HSEA 5JLAA 1A71A 1XQ9A 4BLUA 3ANNA 3G0GA 3LC0A 2W2XA 1FYVA 5BN4B 3BT7A 2AK2A 1CJVC 3HA3A 1V5WA 2X0RA 3ET4A 2O2YA 1FNCA 4KMOA 4EMTA 1PDWA 1VIMA 5ESDA 1QGED 4U2CA 3OSUA 1OLUB 1O08A 4OLFA 3T94A 1GNSA 1R5NA 4HTAA 3Q87B 4OHUA 5HKAA 2I8LA 2XZOA 3GPLA 1UDBA 3VDMA 3HJFA 3H6HA 3BCSA 3DEIA 3FUUA 3QWIA 3F6BX 3GDWA 4QKQA 1LQUA 5EIXA 1DRVA 2Q6LA 3KSMA 4DA0A 1Q57A 1UMDA 1KJ8A 5ITSA 2O3SA 3PHHA 1M2GA 3D7SA 2K6GA 5HWSA 1EUQA 1OXMA 3DE4X 3WLPA 1XDSA 1MAAA 1V8PA 2AI1A 1VI6A 1YU6A 3R3UA 4MXDA 4OV6B 4TSFA 3MGCA 3PD7A 3NWEA 3ZS8A 1YRQA 3OZDA 5TJHA 2CD7A 2XITA 4MVYA 4PZ0A 4BFZA 5HZKA 4JT4A 1MRSA 4Q7MB 2XB6A 2EF0A 4FMCF 1FFEA 3A3OA 1GDDA 1NW7A 1ZD8A 5H3CA 1EZZA 1VDZA 3WYCA 4BEJA 4KFTA 2FEPA 3Q6IA 4WHMA 4TYQA 3JSAA 1J21A 3CHYA 4LIPD 3SR0A 2YMQA 4MV9A 3A1DA 1R37A 2J07A 3GFRA 3QX8A 1TT5B 2O7RA 1IRXA 1Q1BA 1N0VC 1W0KD 3DVSX 1RXUA 4NU0A 5KAPA 1NVAA 3ZDBA 1Z73A 1MAHA 2ENWA 2ZUCA 1NXQA 2ZJ5A 3R7FA 3VTFA 2NZVG 4ECAA 3L6CA 3T5AA 1MV8A 2A4KA 2WUDA 3HKEA 4K9MA 1BA3A 3MGGA 3U37A 5E6SA 4DCOA 2DQKA 4Q3EA 3SM3A 5BUQA 1DE0A 2D0IA 3W5UA 5K6RA 1T4CB 2XKAA 1GPLA 4FZRA 1K3FA 1UC9A 5IYZF 2NSYA 1JSXA 3LKZA 4H4DA 3ZBPA 3S1AB 3CNOA 1VE5A 1QHYA 3EUAA 2NOAA 3A4TA 1ZEMA 5DBFA 3EZYA 2IYQA 2VT6A 4YC7A 4MIEA 1OWOA 5IM4A 5FOVA 1K97A 2CNBA 1D04A 5G4KB 4Q03A 4MDEA 2P77A 3VFDA 3BTVA 1GAJA 1SH7A 3MQFA 1FX0A 1D0SA 1ZISA 5FOUA 1NI4A 5KYXA 2JLBA 1BDJA 1KS2A 1G21A 2N1BA 1VFPA 1BXKA 1YZNA 3DKVA 4JSRA 5CLQA 4W9NA 1XBTA 2YOHA 3NUQA 1Z6PA 4GXNA 4DB4A 2CMFA 2QN2A 2Y05A 3K0BA 4OB7A 3QV1A 2BN4A 3TPFA 2YY6A 3HGTA 2J5QA 3IEXA 3L0BA 2C8KA 2R62A 3GPCA 2VDQB 3GLHB 3K1AB 4LVUA 3SC2A 3ZR4B 1CDOA 3B7WA 3CLTC 4C06A 5HQTA 1JU4A 2ZBUA 1LW7A 1EDBA 2ZRGA 1ISHA 1DAHA 1VBKA 2JVIA 3W3AH 3E8XA 4DRZA 3U3JA 3SQMA 3NTVA 4OO3A 5JT1A 2ZI6A 1UBLS 3PNBA 1Z2NX 3AESA 2YN0A 3TUIC 4L57A 5LYJB 2O54A 3PKZA 1KARA 4QICA 4DLYA 5DNVA 4OXYA 3BB1A 1I13A 1ZICA 1C5KA 2YFQA 3QPVA 3UJ8A 2XNKA 5L45A 5FUYA 4PPYA 3EUWA 1YDHA 3JAMA 1F38A 1RI4A 3UH1A 1GZ4A 10MHA 4S1TA 1RYZA 2F3QA 2V3CC 1QH9A 4UD2A 4MKXA 3C16C 4C87A 4ENWA 2C8LA 1RYEA 2OKCA 4MNTA 5LU9A 5BW6B 4HPWA 3ZV3A 3VGPA 4Z7QB 3R9WA 4Y2SA 4P22A 2GKGA 5DI3A 5JDCA 1P7PA 4Y0NA 1W47A 2GAJA 4NFHA 5TPZD 2IXAA 1U5BA 3QU4A 1EGQA 1FJHA 2ZKLA 4DQLA 4X65B 1QO0D 3OMXA 3QIAA 1F5SA 5AKKA 4LKOA 2Q3HA 2OECA 3ZEAA 3P97A 2EFCB 1SWWA 5JEEA 4M4SA 5B5SA 3K2EA 2BFNA 5E4YA 1BEZA 5LNK1 2IZZA 5L7WA 1E0JA 1GUZA 3OLVA 5U9CA 2HUPA 1TM1E 3K96A 3VPFA 4XIGS 3AOEC 1Y6ZA 4KP7A 4UPDA 1DC3A 4NTZA 3GJ3A 2VF8A 5LQNA 1R4ZA 2IYWA 4XEUA 3RHTA 5EXXA 1EVQA 2IK8A 4GMKA 2Q3BA 3DO5A 3RREA 2A1UB 3O93A 1E2BA 1H2BA 2ZREA 4Y2RA 2RGDA 3NDJA 2LVBA 1JT2A 1HQDA 2YWHA 3FCOA 4ARCA 5KJ1A 3CVJA 3GDGA 4JH0A 3SKVA 1DIRA 1T4GA 2P1ZA 2WTBA 4BO8A 1KOGA 1NHWA 2X13A 1O89A 4D46A 3GJTA 2ZCVA 4QGGA 3FA2A 1UXGA 3ECSA 3KLPX 3C1OA 3KQTA 1Z7GA 2Z4TA 1EKXA 1YJ5A 1Z4JA 2RGBA 2XAAA 4OGFA 1M6VB 4L4YA 4Q16A 2YNMC 3DVAB 4IVNA 2AXEA 3F6YA 4LJAA 1DEAA 1XWIA 1ZOPA 2FK7A 4X90A 2VPXA 4QL3A 4DJFC 1ZAYA 1IBRA 2VOEA 3F49S 5DM1A 5AKIA 4C7OB 2XGSA 3TB4A 3OTIA 3MRTA 3GL9A 3ZJ5A 3OE7D 3SYNA 3NBKA 4Y1FA 1JG4A 3EPKA 4KRFA 1LSJA 3NPMA 1V6CA 4MQLA 4Q24A 4LRSB 2FWMX 4B0OA 2ERCA 4RXUA 3IAAA 4ZEWA 1S2MA 3DBVO 1B3BA 1F4LA 4MA4A 3ZGOA 1L7PA 2J33A 3AF5A 1ODCA 1E2JA 1NKVA 2HFKA 4KQXA 4CODB 2O0KA 3A9UA 5C31A 3ICEA 4GLFA 1EFDN 2EERA 1XP8A 1XHEA 4BLPA 4JXZA 4MPTA 3VMMA 5EWJA 1SUEA 3KXDA 3Q9UA 5DLEA 1HKHA 2P35A 1M1YB 2I6QA 1U9IA 2Z6VA 4IKPA 5J59A 3C8UA 1EUYA 1MO4A 2QSUA 2R60A 2X0NA 2PL1A 4N6NA 1CKEA 5AICA 3CR3C 3IVRA 3LXUX 1CQJA 5HM8A 1W2GA 4PZ9A 4R1SA 4TLBA 3BXGA 5GADl 3L7CA 1BCRB 4M1YA 3TAXA 3QY9A 1A88A 121PA 2F1RA 2UYQA 4EYKA 3G2PA 4ZAZA 4JK3A 3QGMA 4DQDA 1XYVA 2IVFA 3ZVKA 4M37A 3ZU4A 3KJFA 3KSBC 1AQYA 5GWXA 1KFCB 4IGKA 3V55A 2P2YA 3KUDA 2N1MA 3CG4A 2DUMA 3OJEA 4DYDA 5FH9A 4ITRC 4Q7EA 5AVYA 3MHPA 2I1LA 4YAJA 3WLMA 1J25A 1P8AA 3P9RA 5EHNA 1LRKA 3I3OA 2XBLA 1IHPA 1KNQA 2P5SA 4HZGA 3K9QO 2XR1A 3QVWA 3HZOA 3B3JA 1D7AA 5GONA 3PYLA 1ZO8A 2QF7A 1EEHA 2PWZA 2QTVB 1TZCA 5D01A 3WWEA 4AULA 4Y2YA 2VSXA 1P9OA 3DBLA 4FOTA 1O54A 1MVLA 2ACKA 2GTPA 4HN2A 2BEJA 4OI1A 3PA6A 1G4AE 1IN8A 1T8SA 1YS9A 2C61A 2X86A 2ZRAA 4IICA 4L4ZA 4HWKA 2G83A 5AOCA 2JLWA 5IT5A 4X93A 3SOZA 2I6UA 4MDHA 4LVCA 4NKRA 4OOEA 2EV9A 5CVUA 1XNGA 1PL6A 1WS6A 4C08A 4K03A 1LBEA 3HY4A 1U1CA 4Q82A 3SE7A 4EVRA 3QY0A 4F0JA 5CVDA 1LSSA 2L69A 3WJAA 2BEUB 4IEEA 4DR6B 3CZAA 4P4LA 5KNDH 1FVFA 2ICAA 5B3AA 3EFEA 3SJAA 3AVWA 2FFRA 2QRJA 4YJDA 4DAOA 3QE0A 4DLNA 4EARA 1DWQA 2NZWA 3AJAA 4KKVA 4KUGA 4Q9LA 2B35A 3P4XA 3BXPA 4AKGA 3UN1A 3L6OO 3ISTA 3M2TA 1HT3A 3SFVA 1U0LA 2VZ8A 2GEKA 3W05A 3EPPA 3PRJA 1LBSA 3IMFA 2WW8A 1F06A 4H77A 4LXYA 3KZKA 4N7JA 4KYTA 1LU9A 3UMMA 1MQAA 1JA1A 4OLBA 1OBVA 3RTBA 3HHEA 4HBGA 4D80A 5B6PA 2J3HA 4JOBA 3KR0A 2KBFA 3FOCA 4ZVLA 3MZ0A 4I1RA 4KYIB 3SLGA 5E8RA 3VC3A 2HGSA 3Q3HA 1BD3A 2HLHA 3E9RA 3ZQJA 1UBEA 4BPBA 3FGNA 4HP8A 4R98A 1OYYA 4J0DA 3FB4A 3T8YA 2A4MA 2XUGA 1TZBA 5LBTA 3PNOA 3QYAA 3UOGA 4CT5A 5KQLA 3IMCA 4S1VA 2Y0DA 3DAHA 2YIMA 2H52A 2ZR9A 5DRYA 1DXQA 1SBQA 1FBTA 3LDHA 1E3DA 2J3IA 1UR5A 3ASZA 4CMHA 3OOWA 4L8LA 5JTTA 3GA5A 3TSOA 4CG0A 1JEOA 1J9ZA 3FRJA 4UNQA 4ZVMA 3UWKA 1NSYA 1N2GA 1QF9A 3BD6A 1XTKA 4RO0A 5BPHA 1EFCA 1IU9A 3CH4B 1GG9A 3KCQA 4INOA 5FA5A 5ITZA 1XFDA 2V3WA 1DBSA 5CDYA 1ZU4A 2EKBA 1DEHA 1RRGA 5A1TA 1IBMB 3KJXA 3OFNA 3AUUA 1XEFA 2I9PA 3JPYA 4OMDA 4OJYA 4YJ2A 2CXSA 3S5UA 2MSEB 1Y80A 4ZQIA 1XCMA 2IPAB 3HUUA 3NXKA 4FE4A 2C2XA 2EKDA 3DZDA 4YA6A 3B6EA 2EOAA 1WMSA 5K0NA 5FHRA 3UFXB 4X66B 2ZDHA 3P4UA 1WKCA 4WLFA 3IEPA 3PE4A 2H18A 1OAOA 2EYUA 4MUAA 3DMDA 2I80A 1D6MA 2QL9A 4TL8A 2ZPAA 5DIFA 2DG2A 3WRWA 1QAMA 1SKAA 2C9BA 3AF6A 4TQGA 1JGTA 3BE5A 4BEVA 3T5PA 2QMOA 1L6IA 2XODA 2QLTA 4PG4A 3OPYA 1ODKA 4O4LF 4RXMA 1F0YA 2CDRA 4E03A 3H84A 1R6UA 1XD8A 2I03A 2ONKA 2QNRA 2ZR8A 3GHHA 3W2GA 3R7WB 5LOVF 1KGDA 3TJRA 1XHFA 3TFQA 3BL8A 3RT7A 4MRVA 3FFTA 3GARA 4X92A 4RSGA 4Q9JA 2XDQA 4YMGA 4TMWA 4XAQA 3QSGA 3DMHA 4XPIB 4F9FA 4GKJB 2XD4A 1ECBA 2WWFA 2LR0A 2VJLA 4XWTA 4Z0PA 5I48A 4OD0A 1KI8A 2AC7A 3VTKA 3O8LA 1IBKB 1S7GA 4RZUA 4Q1AA 4NQZA 1NF2A 3AOGA 1FJXA 2BJWA 1S8OA 1URPA 2MR6A 3IQXA 4E15A 5HKOA 3E3MA 2HNKA 3FCCA 4HNGA 3JVIA 2ZSJA 4ZVRA 2QP9X 3CLRC 1B0ZA 2CLFB 3QNUA 4MEJA 3VSEA 4BNGA 1U7UA 4QLBA 3BAZA 4RL4A 4HN9A 2H5LA 4EB8A 1Z06A 2XCQA 5ESXA 1XTBA 4LYDA 3OM1A 2AF3C 3I5AA 3PDJA 1HWYA 3D2LA 5EIAA 2TMGA 1M2WA 3ELBA 3RT9A 2BUCA 2ZRBA 2E3JA 1NUUA 2D4HA 3NHZA 4WNIA 4X5OA 4LXTA 1WBJB 3C3YA 4UCQA 2FVXA 5H16A 1TZ2A 3C6MA 5DYTA 2XUJA 4JQYA 1FFYA 2DBRA 1RYMA 1XHLA 5ALPA 1BYUA 3L04A 1OAAA 5J5VA 1NSTA 4EJSC 5GIPE 2P6RA 3RS7A 4HXGA 1Q6YA 4YMWA 4ZQBA 3V3TA 5JAMA 1F0KA 2UVPA 2DHDA 3DFMA 2VDWB 3OOSA 3VYRB 2Q1WA 4EY8A 1H23A 3TKAA 4OH1A 2D3WA 2AFIE 3ANYB 1DKPA 3LAWA 2F43A 2FPRA 3K9WA 2F2TA 1GAQA 4LJYA 2RIRA 3AUAA 3FXAA 4Y1EA 5HILA 3OT5A 3RRJA 1KO7A 5KYYA 3CO5A 1RXSA 2Z04A 5F4ZA 2B3DA 3PFBA 2HWUA 3PUKA 4KGVA 5JWRA 3GLQA 5G0VA 3BGOS 1XRLA 3QHAA 4YUYA 1C7EA 1MPXA 4LJ7A 4ZZ0A 2W2QA 1A77A 4PU0A 3TEFA 3VR5H 4DADA 2L42A 4IHJF 1B0UA 1BMQA 4CFYA 4CLHA 2QDXA 4DGSA 3MGBA 1EBBA 3KELA 4FGZA 5HFNA 4ABTA 3DDHA 4IHQA 4BNHA 3GNQA 5ARBA 3TFOA 4QLOA 3U80A 5FPTA 3UYKA 1NUTA 1KJYA 2QIOA 1XAJA 4ENUA 4BFUA 3F2VA 4RMIA 1E6CA 3IEVA 2HJGA 1PP4A 2DSNA 1LTHR 2HK9A 2IYLD 4QQNA 2AI2A 1NFFA 2KW5A 3ZUPA 4ARVA 3UGJA 5DT9A 3MRSA 3V2UA 2WKWA 1DQZA 3ADOA 2FHSA 4B6JA 3AKYA 1LJUA 4OKSA 1ULBA 1TO1E 2AJCA 2EC5A 2PMDA 2VZ9A 4OJKA 1FNBA 2QI9C 1TD9A 3ZLBA 4OAQA 3LIPA 2IYFA 4H9GA 1VPVA 1JR6A 4QVIA 2WD9A 2H17A 4LSMA 1DCKA 5A4AA 1JEAA 2IX9A 2J5BA 3KB8A 4BE4A 1Z35A 1CUSA 1MO5A 3HYCA 3R3SA 1EFPA 1NM5C 4HUQB 2ADFA 3EZ9A 3VOAA 3ZW9A 1BDBA 1FTGA 3R5HA 4F6CA 5D87A 3RUFA 3WLNA 2XMRA 3PA8A 1EX9A 1ND5A 2I34A 5IH7A 2D2VA 1FS6A 3GEIA 4KMSA 4P3PA 1QGDA 1VL2A 1LK7A 1XTPA 1DQRA 2OXCA 3MWDB 3W1VA 1M2FA 4QOHA 2RARA 1C8VB 2ATCA 3FHOA 4XLTA 3QH4A 3SMVA 3D54D 4C7JA 4AUEA 2QTZA 3A9WA 1PWEA 3Q41A 4HQLA 2DT5A 4RAQA 2WT4A 4QYIA 3NYIA 2X14A 5CB4A 3LUDA 3JR3A 4C7KA 2YHSA 3KAJA 5C3MA 3ER9A 4IGEA 3L18A 2CNWA 3VNUA 1UEIA 4PAOA 5AM1A 2W70A 1AA9A 1TZMA 5CYOA 4IWNA 2RDMA 4HNUA 2HPHA 4HZIA 1O94A 1OWLA 1TDJA 3C48A 2NV2B 3A14A 4D8XA 1YKGA 5KKCA 3AEZA 1ZH8A 2OKGA 1A9XB 4HZUA 3CVVA 4M8NE 4HEQA 4CKBB 1W4ZA 1QG4A 1B4DA 2EG5A 3BQ9A 3JWEA 3KOXA 5AUPB 5DFAA 5FPKA 2X1LA 1X7YA 4UMEA 5LQSA 4JT9A 1YB4A 3P4YA 2EIXA 1NXWA 1PW5A 4BZZA 5COQA 3AVPA 4YH1A 3U16A 1MJ5A 1W96A 2IQ5A 4RTQA 5KJCA 3LVQE 1WHTB 2AE1A 1XG5A 5LVAA 5JARA 1IDN1 3RK1A 3U9SA 2JL1A 3LBAA 2H2HA 4YK7A 5D86A 1M8PA 3MTQA 3BRSA 2RKBA 4HWRA 2Z0MA 1ZKMA 4KXFB 4RBNA 3LFUA 3QVOA 4PZLA 2CXNA 1Q1ZA 1AMNA 3Q5GA 1IH8A 1RM3A 2D5AA 2CNLA 2R6GA 3IE1A 1PSZA 3ZVMA 3R5TA 1FXUA 1XRQA 1YQUA 4RZHA 1VE1A 1N5MA 3VDQA 4D99A 1IIRA 3V8BA 5B4TA 7REQB 2ZIEA 1K4MA 2PR2A 3JWIA 3FKSD 5FYDA 4C3VA 4ZDIA 2QXUA 3DOFA 3H75A 5C4MA 1QQ6A 2I3AA 2IX3A 1PIWA 1DRWA 1JSCA 2H6EA 4ZCLA 5D3MB 2BFAA 1ZHFA 4LRTB 4AIIA 5JPCA 2PSSA 1SZJG 1DKMA 1H0RA 4DG8A 2QW0X 3IESA 5LZ2A 1QHHB 1P3Y1 2OR3A 5JR3A 3OQ6A 3OX2A 5AM2A 3ISVA 3SPXA 2EKPA 2FQYA 2EZ9A 3G8CA 2VHYA 3P0FA 3H7IA 1EU1A 3QMPA 5E0OA 1U7XA 2PJUA 4OG2A 3PL5A 5BYAA 2P0AA 2NO1A 3OCWA 3CV3A 1SMKA 3OETA 2G9RA 2AF4C 1OU4A 3P0JA 5E6UA 4S12A 4EFDA 5KYKA 4TKLA 5CX1A 2CLHB 1DO8A 1W1WA 1EBUA 1PS9A 1GYQA 2WDPA 3H1GA 5AYVA 4ZYVA 4RTLA 3U4IA 3FYCA 4XQ9A 4BQOA 5BW8A 2ORVA 4KMMA 2Q4RA 3DAOA 1DRUA 3GFBA 1RLTA 1SHUX 2I4TA 5JS1A 2RGYA 1MTOA 3CCBA 3K32A 2Q1UA 3VNBA 2YASA 5HF8A 1TYEB 2C9YA 4L6IA 3FHJA 4PX9A 1G3QA 5C46F 5I7AA 2VHZA 3HFRA 4K6CA 4X61A 2JD0A 2H06A 2QVBA 4R51A 1TO6A 4MAMA 4C78A 1PR2A 4DCNA 1SVIA 5FUQA 4H7PA 4MIYA 1SVMA 4WK2B 1JKFA 5A04A 1UOQA 3PG5A 1UPUA 5FB3A 2B5OA 4G4SP 4EDHA 5GJCA 3BJEA 5DYGA 3FG9A 4F8JA 1OHHD 3BD8A 4P53A 4YTEA 4ZC8A 2NVUA 3WFIA 4IDGA 3MT7A 1J49A 3T7KA 1CUYA 4M8LA 1DT5A 3W2EA 1G5PA 2WABA 1V26A 2HY7A 1AXRA 3IV9A 4IF4A 5KOHA 2PUHA 2W8ZA 2QQFA 2JLQA 3DQZA 1HI9A 2I4NA 5LWHA 4UC0A 2F9FA 2P40A 3OWXA 2UYCA 4L16A 4PAQA 4RQBA 3FOFC 4TZTA 3T0IA 4J1QA 2Q5LA 3Q7RA 2OCBA 2W58A 3HUFA 2FZ5A 2CLSA 3LLMA 4YCAA 1J6UA 3OICA 3S44A 3TW4A 4F5YA 1Q22A 4Z3DA 1JSRA 4GNKA 1C3OA 3PXXA 4I7EA 1V39A 2Z9BA 3DTNA 3O1LA 4NOLA 4QYWA 4ZOLB 1PR5A 3E82A 1EUDA 1W9MA 4IJ5A 3QLTA 4QBGB 3MPOA 3THRA 4G4SO 4P4SB 1D5CA 2W2NA 4LZZA 2G9NA 4K7JA 1DC4A 3BHMA 3IXMA 4IBOA 4UFPA 4Q66C 1GFSA 2R8YA 5F5LA 1JAHA 4A82A 5B6IA 2FG5A 2OCAA 5IF3A 4KI7A 3HE3A 3ADBA 2QGFA 2ACWA 2FLKA 4ND8A 4PFQA 3S6JA 4M1MA 3H1FA 2FFAA 3QU2A 2PUDA 4D4LA 3NVAA 3FPHA 4CQMD 1G8YA 2GCNA 3DE3X 1ZZEA 4V0RA 1MJNA 3DZBA 5HPYB 2WVAA 1XZJA 3C3BA 3SZUA 2CY0A 2FWPA 2JATA 3NHMA 2GN9A 2AOUB 4B6EA 5DTEA 1L7NA 3PK0A 2NU8A 1N0IA 4AYWA 1RAEA 1BN7A 4LZNA 4YLGA 3C3PA 4XWKA 5KUTA 1E2DA 4RY9A 5COBA 2R5NA 2TYSB 3C6XA 3AR6A 4XM2A 1H05A 1T1IA 2KHZA 4UE3S 1JDJA 1TM7E 4M3NA 1OGIA 5LMZA 1AHNA 3L6DA 3WV4A 2CL6X 1TK3A 1X1DA 2QB5A 2VPQA 4G1FA 1F6BA 3DT9A 1ZN7A 2JC3A 4BNTA 3BWEA 2YQZA 4NENA 2A9RA 4XRRA 1KI1A 5AM4A 4RD1A 2O8EA 1H65A 2Q6IA 3VOBA 4ER5A 4RK1A 5CLGA 3WQHA 1KEKA 3LMKA 5KHOC 4YWHA 4EL0A 4QUKA 3ETNA 4H7HA 1PT6A 2QRHA 3KWLA 2QWXA 1C0IA 4TSKA 1JWLA 1GGFA 4W5HA 5AKJA 4MPJA 4B6GA 1QFXA 1I0LA 1OI7A 3HC7A 1GARA 1GA1A 1U6KA 1PL7A 2VP6A 4BJ1A 1P18A 2XWBF 4DMFA 3VH1A 4OBBA 3WLEA 2ZM6B 2DQYA 3EXHA 4XGQA 5CMLA 2ABWA 1XVIA 4LBYA 4WJKB 4DLVA 5IN4A 1NNLA 4MV0A 1T9DA 2Z8YM 1IWOA 1DV2A 2W0MA 3IVGA 4KBGA 4CE6A 2QN8A 4M7OA 4J0FA 4B9AA 1JALA 3T9AA 3AIIA 3EG9B 1VKZA 3ZGZA 3ITNA 5J4HA 4L7QA 1B00A 5K7SA 3DDWA 4QQ8A 2P5UA 1ZK0A 2BFFA 1AF7A 1UWKA 4QBFA 2FKAA 4BRSA 4UTNA 4YO7A 3K1ZA 2GM3A 4JZYA 2QLFA 3K6JA 1SVSA 3TR5A 1OMOA 4NRDA 2ODTX 3OQPA 4PGGA 4BQSA 3JCZA 4BWYA 4N3CA 3V97A 1ZJ6A 3C14C 3VGJA 4TLAA 1T9CA 2ZWMA 1AX9A 5K0ZA 4D9MA 4RK6A 3L7NA 1G4UR 4MLCA 5KPJA 1NW5A 3QPBA 5CP8A 1CZKA 1QS0A 3FPCA 1XJQA 1CLEA 1SIUA 3KEGA 4R69A 5E3JA 3O8RA 2C5EA 2EU8A 2PSDA 3KBOA 2BTQB 4UUPA 3QEOA 1Z83A 3DPSA 1OJ7A 3UWOA 1RLUA 5FTNA 4ESOA 3C85A 2PPLA 1Y8RA 1HTBA 2K7ZA 4TLMB 2XQIA 2I7CA 3BSFA 3CWZA 1F7UA 3HP1A 1YQGA 1VL8A 1K8RA 2NWQA 3DXZA 4JJKA 1DG9A 1HZZC 3PC3A 3H9UA 5F64A 1X1AA 3U62A 1ECLA 1Z12A 1Q2XA 3I9OA 4YV2A 4DIFA 5LIRA 1ESNA 2VNSA 3IAS6 3NKFA 1IRIA 4D79A 5DP2A 2C42A 4N7RA 5CA0A 3AL0C 2IUYA 3DV0B 5CXSA 2GGSA 4JDPA 2GCIA 2WJ3A 1YRAA 2GLTA 2JFGA 4KE7A 4YECA 4A10A 2R7MA 4MKZA 3TLJA 4GI2A 3HYRA 1JDUA 2PZMA 1V5FA 3FH0A 3K8ZA 4Q3BA 2QBYA 1RZ3A 2UZAA 4KJZA 3RU9A 4AP5A 1KP3A 5A3JA 1RWBA 3QXXA 3EISA 2C1XA 3INGA 2CZCA 1N6LA 1QO9A 1RMYA 1VKHA 3IBCA 3DKPA 2G4CA 2QK4A 4X1OA 3DO6A 3VPCA 2OSBA 4X91A 3I9NA 4C5AA 3L4BC 2DLNA 3Q8WA 4UEKA 4OAPA 1BVYF 2JFWA 3CUKA 1DL5A 3BIWA 4LEIA 2I7TA 3ID6C 2AR9A 3BVPA 3HK2A 4LY0A 1GPKA 4A8PA 2EEZA 5DH9A 3SBXA 4CEIA 2QXTA 3INTA 4LDNA 4LXGA 1GLGA 3DE7X 5JQGB 1KI2A 1Z45A 4XTCS 3T7EA 1A9RA 3AFOA 1R8XA 4O2BB 3RVJA 5BW5A 5L53A 4F6LA 4HOYA 4KJXA 1PT7A 3ABOB 3LOQA 1S96A 1V37A 1Z08A 2H07A 1UFQA 3C2QA 1HORA 2J5XA 2OXRA 5LP6B 4BMYA 1NJGA 5GINE 1WSDA 4QECA 4E4RA 3CNHA 4F7DA 3K6SA 5CPFA 3C7CB 2PGDA 2PFGA 3RUEA 1R7RA 3VO9A 1NMYA 2UXBB 4DNPA 1CZNA 4AAYA 3B9QA 3IUSA 7YASA 3G88A 2C2ZA 4NQRA 3WB0A 1XPUA 3O8QB 4RA9B 3T3EA 4GPIB 2Q7OE 3FYSA 3IUMA 1MX3A 5IW8A 1GP2A 2JLYA 3BC1A 1ZWKA 1CF2O 3FCXA 3D8RA 1ARZA 1WP9A 4R9NA 3A31A 1JR3D 4H35A 4I8IA 1L7OA 2VN8A 3KE9A 5GV8A 4MP3A 4L3OA 1E92A 3R44A 3I58A 3LPMA 2C2GA 4K9RA 3WLFA 2PPVA 1JI3A 2JHAA 2AFHE 5J4VA 4GX5A 3B1JA 3SAJA 5B36A 1ZLXA 4AUMA 2ZJYA 3KOWA 5DXJA 2W5UA 1OXKB 5H8WA 2XCUA 5EZYA 3WA7A 5BYJA 3X1ZA 5A7GA 2IOHA 1JR3E 2VHQA 1QSGA 1PK9A 5ARCA 4H16A 3WYDA 4GOOD 3B5JA 5C1OA 2H4JA 2I0FA 1XMOB 1ZD5A 2A1TR 3W3AA 4IO0A 2QTFA 4TVKA 1I4DD 5EWLB 3FDZB 4LGMA 1G5TA 2AQHA 1E9FA 5E38A 5EJ2A 2WB4A 2HCTA 2RKOA 2ZRDA 5CDFE 4GP6A 3D6HA 3GJQA 2MSLA 3WNBA 2WIGA 2D1TA 2ZIGA 4W8OA 3NOVA 4P34A 4Q5IA 4E88A 1MN6A 3KYDB 4LHEA 2ZJOA 1ISJA 4FGKA 2R7NA 3U2QA 5HIJA 3R7NA 3B5IA 2EBWA 2JI7A 4RGYA 3U26A 1RM5A 4D3FA 3H2SA 2GPSA 4G84A 4FD2A 1FFBA 2WE8A 3HDHA 5LKAA 1W4CA 3QLJA 1VBFA 1OW3B 1P5RA 2OGWA 3R0XA 3UT5A 3WZMA 4IRXA 5AVXA 2CMHA 2BE9A 3C0KA 3I8OA 4LV5B 2FW7A 3S2FA 4A5OA 3OQ1A 4CBVA 4NYJQ 2IS1A 2Y4NA 3KK0A 5ALFA 4BBZA 1F2UA 4OPMA 1IN6A 5LA6B 1M2HA 5IUKC 1JQJC 1T34A 3OZIA 4JI4B 1NBIA 1JLLA 1PQWA 4A1FA 3H9CA 2XE8A 3R0VA 3SX2A 4C2BA 4E09A 1K6XA 3TR6A 2EJTA 1SN7A 5CNJA 4NC9A 4BWGA 1TZKA 4NABA 2JIZA 1RE1A 4P3YA 3T41A 3U9LA 2QV7A 2X4DA 5A6SB 3AKZA 5EPUA 2G71A 1SC9A 2J0UA 1L7BA 3EXFA 4V2IA 2YL2A 3LJKA 4OHMA 4UAGA 1FTWA 1V8BA 1ZSYA 2WSSD 3B5EA 1RJDA 3Q98A 5TX7A 4D02A 5JFTA 1VJGA 2WJHA 4DWJA 5BQXA 1QIDA 5IAJA 1QVZA 1CUAA 4DMHA 4M8SA 3CT4A 4G85A 4TWZA 3O7WA 3NEAA 3B6IA 5DBEX 3KTAB 2BIFA 3Q6MA 4GFDA 1YA6A 2GT1A 4B32A 1I33A 1XTQA 1ZGAA 2I3BA 4G0QA 1UK7A 2JCGA 7ABPA 3SZOA 2Q6KA 4JBWA 1GM5A 5CM9C 1AKUA 2GARA 1SCJA 1D6JA 4BAZA 1F12A 3HMKA 4Z7OB 3V46A 2ZZMA 2KPOA 1GZDA 3C98A 5KEIA 1QH0A 2WILA 4JVNA 5AD1A 3O1JC 4KO1S 2NG1A 3M49A 1XQWA 2IIPA 5B53A 4ZO6A 2OXEA 2X9NA 1AU9A 3TOXA 1WCIA 1E4EB 1EJBA 3K2QA 2WJ4A 4REQB 4RV9A 3CVWA 1Y4UA 5K51A 3E18A 5TRTA 4Q4LA 5EKUA 1P2FA 1FPQA 1UPCA 5JD4A 1W93A 2C2WA 4LHWA 3ZE0B 1PDVA 1QWOA 3GLGB 4M8IA 1T5DX 4DCVA 1NC1A 1J00A 4QT4A 2HF9A 3ZDQA 1R16A 1O0BA 3SF8A 5EI5A 1OZFA 1RE0A 2EGHA 4JIGA 1IK4A 2JFXA 3DL0A 1PZHA 4M76B 3P9ZA 5EZSA 3VMFA 1DT3A 1AXGA 1P1CA 3FY4A 2CNOA 3AF1A 3L92A 4IDQA 1NAHA 1ZVKA 3AINA 5D3KA 2OZEA 3LM8A 1SM4A 3EAGA 2IWHA 1WUJS 2AOTA 3N07A 4M53A 1TJPB 2D7JA 4WY8A 3U61B 2FV8A 1T5IA 1V1MB 2GLXA 3JQGA 3OX4A 4HLNA 4HRAA 1KL7A 5HMLA 1L8AA 1DXOA 2X41A 3AI2A 4JN6B 4MKFA 5H3LA 1WXXA 1A72A 4MQ5A 3PENA 5K0CA 3RRNA 2ZATA 1POWA 3NTUA 4FU0A 1L4MA 1NVXQ 1LDNA 2QX9A 2ZEJA 3GJ5A 4LWPA 1MO6A 4RFSA 2YNMD 4EMBA 2OA0A 4FGWA 3UXYA 3I1YA 5AM5A 1ODJA 2ZDQA 4FNAA 5HCNA 3IC5A 2ISCA 5JWHA 4IIJB 1S5PA 5ENDA 2XYHA 1G42A 1HC7A 1R6TA 1KFBB 3OTGA 3R6GA 5FOQA 1MOZA 1JXQA 3RF7A 1R4AA 3Q4GA 3IXQA 2RAVA 4R3UC 4V0QA 1QNLA 3IUEA 4MIOA 4PIVA 1R74A 2HJWA 2YOGA 1GGVA 3IA2A 1KI6A 3K0FB 4HI0E 1VGVA 3UB3A 4CUKA 2VNJA 3EIUA 1OV6A 4XI9A 3DBOB 4EWLA 4UCFA 5LYYA 3TLGA 1B14A 1REQB 2CSUA 2QTMA 5GMOA 1BW9B 1Z28A 4L3WA 4A8JB 3ZK9A 2GDJA 3F0TA 1BX0A 1X19A 4MUFA 3W5IA 3ZHBA 1BEEA 2RCNA 1RBYA 4LISA 3R3HA 2PKXA 3WLOA 1L1FA 1XA4A 5KNDA 5K20A 5AK0A 4PO8A 1Z8HA 4UCWA 3RKSA 2BBOA 3UATA 4C3UA 2RC5A 3KNZA 1XR3A 4DG9A 4FBLA 3WDLA 4F86A 1IHDA 1QZXA 3OCUA 4G9GA 4CKXA 7AT1A 4RIGA 3VNVA 1Y8AA 2PU5A 1TXGA 5LSAA 3AB8A 4U2DA 2JS7A 5C8YF 3E3AA 4WLUA 3AR5A 1PE0A 3NBYC 4RE6A 3M5PA 3S2SA 4EF5A 3P20A 1C14A 2ODPA 3MLEA 5JBQA 4AJ4A 1QUEA 4QOEA 3ESZA 3NUGA 3UBTA 3E8SA 1KEVA 4YP6A 4LOJA 2VSFA 4JLOA 1PEKE 2ZAIA 3KQUA 3U5ZB 4MGKR 1AMUA 1KK2A 1G17A 4N82A 1NJ2A 3U56A 1Y1RA 1GZHB 2B1IA 1U0FA 1E18A 1XO1A 4LWZA 3HKDA 1P29A 3SU8A 3TTUA 3C3DA 1RD4A 4X6LA 1XNJA 1EXWA 2VT7A 5FI0B 4D26A 1QVWA 4HDCA 2RHBA 1E3JA 4ZCQA 2RKWA 4LDJA 2Y2UA 3WNDA 2VSOA 1LDYA 4AZ0B 2ANCA 1KQFA 1BHSA 3SJCA 1WJGA 1YA4A 4AJ1A 3OZBA 3GJSA 1APBA 5EJ6A 4PLHA 1JR2A 3ZI7A 1G7TA 3O3NB 4F2GA 1MT0A 4TXJA 4YLEA 1BWQA 4QUHA 2FPLA 1Q92A 3ETLA 3HL4A 4JOSA 2C07A 4NIMA 5TY0A 3TGPA 4ZOEA 1SCNE 2JFQA 1YHZA 3DWFA 3ACBA 2ANBA 2B7LA 2QL6A 3QJYA 4DDUA 2ZAMA 1MHTA 1SKMA 1SXJB 2EHJA 3KOUA 4MV5A 1QB8A 3G2NA 3M6XA 3OKCA 4TZKA 4BX9A 2C7RA 2HLPA 4MTCA 2Q07A 3FSRA 1Q7EA 3QKIA 5LDDC 1O97C 1YJAA 2DTXA 5AJZA 3H83A 2IEGA 4HGRA 3CRW1 3UKDA 5JOQA 1UT8A 2FRDA 3LXRA 4ZGGA 4FYHA 1X1QA 5C5EA 4GI5A 1SBCA 2O23A 5HGXA 5SZIA 1UBKS 2Z98A 1PR6A 5A3RA 4ARIA 4WDRA 5HS4A 4NMMA 5EP2A 3UHFA 5H83A 1U3WA 2DR0A 4YMHA 2IYAA 2NV6A 4HY3A 1LY1A 1QIIA 4BMPB 1HDIA 5I4KA 4BEWA 3NLLA 1IEWA 1LPPA 1V3VA 2H5IA 3ZE2B 1IHXA 2OQIA 2ORYA 3PQ2A 1VG1A 4KXNA 1ZIDA 4R8VA 5B4UA 5DLPA 1W0JA 3GEGA 3T9BA 4ZPJA 1UKBA 4NE2A 3DONA 4EDFA 3P45A 1LF0A 1UBNA 1Q7GA 3GAMA 5JAQA 2W7TA 2GJ9A 3AI3A 3BM5A 3WHPA 3B36A 1NR5A 1B1AA 1RYNA 2D54A 3NJ8A 4CV3A 5AHRA 4HH0A 3RHZA 5IK2D 4RKYA 3M1YA 4PV7A 1NA5A 1VECA 3CIFA 3EFOB 5ENVA 3IEUA 2ZSFA 3AWDA 4UMDA 5IZCA 1ZRMA 1J5EB 2YRXA 2Q3LA 1PFGA 1KAOA 4UQPA 1WULS 2XB4A 2AJBA 2FE1A 2DM6A 3R41A 1AD2A 2V59A 3EGIA 2MDTA 2YDYA 2VWPA 3CNEA 1GDTA 2IPNA 1X7WB 1LX6A 1RYFA 4LOAA 2ZBDA 3NDPA 3A6FA 1JEDA 4JXKA 4UUMA 5A4FS 1XK6A 4YJFA 3NO4A 4EUSA 2B61A 1A4UA 3INNA 2JGDA 3GMSA 4QNRA 5M7EA 221PA 4R9UC 1RBMA 2EP5A 3E1GA 3U3DA 1Q12A 1SG9A 3BN3A 1T0JB 1VYHA 4RVDA 2RG1A 2F6RA 2VH2A 1M8KA 3HLKA 4ZN6A 2VJQA 3O2QB 4OI0A 3HCWA 1U8TA 3ES9A 3ELDA 2IITA 2J46A 1T91A 2WNIA 3AEQB 2HPVA 4NZYA 4X8OA 1Y6FA 2ZB2A 1R0WA 2PVSA 1JLKA 2X3UA 1GAWA 3WGUA 4EPTA 4UE6A 2G36A 2A5LA 3DR3A 3H9BA 1XTUA 3FPJA 1WOYA 3MSXA 4MUJA 4QEKA 4RPIA 2QY9A 1VPTA 2GZ1A 2X1VA 1TC1A 3G2MA 5A9RA 1HE5A 4QGAA 3AY0A 2EWVA 2BDTA 4O2AA 4PZPA 1RIFA 4TV9A 3QEKA 4L78A 5KI6A 4B34A 5C8DA 1CE8A 1VOTA 1PNQA 1E6MA 1J09A 1Z3CA 3REOA 2Z5VA 6REQB 3H1EA 1M34B 4N5IX 1BVRA 4ZP1A 1GRQA 2FEKA 1UJ5A 5C34B 1UPTA 1E3QA 3R5JA 3CGWA 3GUZA 2FJUA 3V7NA 3W6NA 5DTMA 3IELA 3ONWA 5AH0A 3VBCA 3VR5A 1G5RA 3E3OA 4EVQA 5A4IS 2EGGA 5A6VA 3CVUA 5G0SA 1GZVA 2GF9A 4XASA 5EMMA 5K9ZA 1CQWA 1DBWA 3NTRA 1QGUB 3RHFA 1LI4A 4GWKA 4B2IA 4BYGA 5A0TA 2WF6A 3ASYA 4JP8A 4P4GA 4TLDA 5BWOA 3EZLA 4MVCA 4R81A 4RY0A 4KO2S 1Z6TA 1E4EA 3AR7A 3DVQX 4AJNA 4D6XA 1ILEA 4FQ8A 3MWEA 4V0MA 5JZVA 2WIJA 1GRCA 2DE0X 3VR6H 4B4UA 3PC8A 2JFBA 3S8MA 5I4BA 4ZCPA 3QI7A 2FMXA 3ISJA 4PX2A 4CM9D 3MS2A 4RJLA 1JQBA 4LJLA 1OLXB 4OIFA 1EVLA 1CETA 1TCVA 1Z07A 1BD4A 1Z74A 2WSBA 5JYCA 4FFOA 3I3SR 3JQBA 4EHLA 2Z2ZA 3Q7PA 5G1OA 5EE3A 1DAGA 1AUQA 3ABIA 1JJVA 3EEIA 3GN2A 3OWOA 3U0BA 2OB2A 2XE7A 1VJRA 3AFIA 3D8NA 1H4VB 3DEZA 1CZHA 3L77A 4JLKA 3SOPA 4C04A 4CKEB 5JH7B 5J3JA 2PUAA 5JJIA 4KNVA 5CJJA 1JZQA 4DQ0A 4CF3A 5CDSA 4LVOA 3COVA 2MYNA 4L6CA 4JLAA 4PQFA 2WA2A 3IP3A 2NUPB 3B2QA 4IDHA 5D84A 3I1FA 3D02A 2H48A 4KRYA 5C32A 4TTTS 3GQVA 2CNKA 5B2ZA 3VPXA 4DCMA 2WE7A 4YROA 2JIQA 1N2CA 1CQZA 4R1MA 3Q15C 1B2LA 4ZZ3A 1Z0ZA 3DBIA 4BO4A 3FCUB 1LC3A 3OIUA 4F72A 2NU9A 2RGNA 3ZWNA 1ZPDA 1J1IA 4YCDA 3EX7C 5TVKA 721PA 3NIWA 2BBSA 4HDRA 3RJMA 1GYPA 1SOUA 2BZGA 4G5SA 4IIDA 3VPDA 4YAIA 1M67A 2CMGA 2GZ2A 2WF7A 3D3WA 3OPMA 4QPCA 1WW8A 2PD4A 3KKPA 1IEXA 2G1PA 1A7KA 1OZHA 3Q3CA 3GZJA 1KDTA 2KWIA 2ADMA 5DCWA 5JANA 3FVVA 5JSQA 4JUIA 5FI1B 4GMDA 1IM8A 4D9FA 2PRSA