2N47A

Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
197
structure length
197
Chain Sequence
b'MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Structural genomics, unknown function
total genus 47
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2n47A00
5DXJA 2V7EA 5EMMA 2VZ9A 4DCGA 5JUWA 5IH3A 3DMHA 4MHTA 3OZRA 4ER5A 1UFKA 3KR1A 4K6MA 1VQ1A 4FSDA 1XVAA 2PSSA 2I62A 4PYOA 4DQ0A 1KP9A 1D2CA 2AN4A 2O05A 5EPEA 3NDIA 5BW4A 4U7PB 3EVFA 2YR0A 1DUSA 5T67A 3JWJA 3GXOA 3MAGA 5DRTA 3OCJA 3FUTA 5FTWA 5E9QA 4GOMD 1JG3A 5DWQA 1EJ6A 1RI4A 1XJ5A 2PBFA 1TW2A 1QANA 3KPJA 5DT2A 2EJTA 1TW3A 3EVCA 1QAOA 1HNNA 1JG4A 2GPYA 3GU3A 3KPYA 3LDGA 3HP7A 3PFGA 5CM2Z 3P9KA 1G60A 2G72A 3I5UA 4RTSA 1FBNA 3DXXA 1D2GA 1BHJA 5EZQA 5K8VA 1KPHA 1D2HA 4Y2HA 3PS9A 5EKXA 1VL5A 2YQZA 4P7GA 3S68A 3NDJA 2CL5A 2OPBA 1SUSA 2QE6A 3R3HA 3R24A 1G55A 3G5TA 4FGZA 4KIGA 4X60A 1JTFA 3TQSA 5K0NA 4E2XA 1YFJA 1EJ0A 3L8DA 4OQEA 3R9XB 3A7EA 4P7JA 1WS6A 4GF5A 3EGEA 5HFJA 2IIPA 4POOA 5GINE 10MHA 4GOLD 1X1CA 2Z6UA 3KQVA 5FWAA 3UJ6A 2PWYA 2GB4A 3LBYA 1F38A 4KDCA 1BOOA 5HIMA 3P2KA 1VLMA 4C03A 4PYIA 3EEOA 1XDUA 4GC5A 4PONA 2P7HA 4FP9A 5LQAA 2IP2A 3TKYA 5LQKA 4E2WA 2GH1A 2PX4A 3UBTA 4GUAA 1BKYA 5DPMA 1WG8A 1MJFA 2EG5A 5KS2A 5C9ZA 3UFBA 5EQJB 3LKZA 3T7TA 5EVJA 4Y30A 3UJDA 3DOUA 3G7UA 3FTFA 1QAMA 1RJEA 3AXTA 1T43A 4HC4A 3FTDA 1L3BA 4F85A 3ER8A 2HTEA 3E8SA 3PX3A 3JWHA 2JHAA 4BLWA 4E70A 3HCFA 3SMQA 2HV9A 5EIWA 1X1BA 5E2BA 4DM3A 3G2QA 3HEMA 5FCDA 3TR6A 1ZG3A 3BWCA 1RI1A 3NVMB 5K0FA 2FHPA 3NW9A 3GRVA 5E8JA 1VE3A 4ER6A 1IY9A 1YFLA 4YMHA 2OB1A 5E9JA 5HIKA 1VP9A 3OE5A 4GQBA 5HEKA 2G8NA 2YXEA 2ZWAA 4PINA 5DX0A 4IV0A 2B3TA 2P1DA 1NV9A 4LECA 4EKGA 3B3JA 3CGGA 3H2BA 1P39A 4GBED 4RTRA 2LD4A 2H1RA 4RTNA 4PGHA 1R6AA 1P1CA 1RJDA 2AVNA 2PY6A 2ZIGA 2ZVJA 1XCLA 4GC9A 3KPUA 1R8XA 2GS9A 3SXJA 5KQRA 3NMUF 1NE2A 2HNKA 2K4MA 3GDHA 1SQFA 2DULA 2OBFA 2ZW9A 4FS8A 4PYQA 1N7JA 5EC8A 5FWDA 4EQZA 3SX0A 3UJ7A 2PX8A 1Q0TA 5FADA 3Q7EA 4WVLA 3BGDA 1JG2A 1FPQA 3M33A 1N7IA 2GLUA 1AF7A 3KKZA 4WXHA 2IBTA 1AQJA 2Z6QA 5T6BA 4DKJA 1NW8A 4BLVA 1KYZA 3P71T 5FUBA 4RTMA 4YUVA 1B42A 3Q87B 4E32A 4PYNA 2FRXA 1Q0SA 3DXYA 2Y1WA 4ER7A 3KHKA 5H02A 3FPJA 3ANXA 1Y8CA 4M37A 3B3GA 3UJCA 4AZWA 4YUYA 4QQNA 3BXOA 1NW5A 1R8YA 3C3PA 4RX1A 1JR4A 1L3IA 2CKDA 2XYRA 1YZ3A 2NNWB 3VSEA 5F2NA 4YUWA 4YV1A 3UZUA 1G6Q1 1NKVA 3HCDA 2C7OA 4KW7A 3HA7A 3GRZA 5GP1A 2ZZKA 2YX1A 2C7PA 4DF3A 2NP6A 2E5WA 3G2OA 3NWEA 1XCJA 3DR5A 2VS1A 3T0IA 3HNRA 2BR5A 2OZVA 3DTNA 3SSOA 3MQ2A 1XDSA 1G8AA 5CUQA 2G70A 2AOTB 3SR4A 5CCXA 2C7RA 4RTKA 4PYJA 3FPHA 3IEIA 1RJFA 2G71A 4BLUA 2FK7A 2XYVA 5KVAA 2PT9A 5E1DA 3G2MA 3KR2A 4RWZA 3LL7A 1V39A 1ZGJA 2ZSUA 3TLJA 3EVDA 4OA5A 4XUEA 3UA4A 1SVUA 2UYOA 4ISCA 3UWPA 3OPNA 3OZSA 1JQ3A 1RJGA 4HRAA 3K6RA 2IH4A 2P8JA 3GRRA 4F86A 5P8WA 3FUXA 3HCEA 5BP7A 4AZVA 2ZWVA 4HH4A 5JR3A 1SUIA 1NBIA 5ICGA 1RI3A 3DULA 1QZZA 2I7CA 3B3FA 3LGAA 3QV2A 4BP3A 1L9KA 2AOVA 3DMGA 1YF3A 4PGGA 2YVLA 1BC5A 2UYHA 4RVGA 3A7DA 5GOZA 4E31A 5K0CA 1PJZA 1DCTA 3DP7A 5K0JA 2ADMA 2BH2A 4OA8A 3FUUA 3LECA 2ERCA 4XCXA 1KYWA 4V0QA 1KPIA 4OBXA 2ZTHA 2Q41A 4CTJA 4M7RA 3SSNA 4YUZA 3AY0A 3KR9A 5CVUA 4ER3A 3EVZA 2ESRA 3C0KA 1NT2A 3KQOA 3ELDA 4BY9E 3FUVA 2R6ZA 2EX4A 5EHIA 3TPZA 2AOUA 2CMGA 3NWBA 4IV8A 3K0BA 4V0RA 4GOND 5EGSA 1YB2A 2FK8A 4JXJA 1AQIA 2NXNA 2WK1A 3HVIA 5ICCA 4KDRA 2PXXA 4R6XA 3B7PA 4OBWA 4A6EA 4RTPA 4RVDA 2O07A 4MTLA 3AXSA 2O0LA 4L7VA 5K0LA 5DM2A 4HG2A 1G8SA 3D2LA 3PVCA 5DXAA 5HIJA 3UA3A 3SGLA 4F84A 3BZBA 3FPEA 4XUCA 4HSGA 1VIDA 3JWGA 2AVDA 5K09A 4OX9Y 3FZGA 2PX2A 3LCCA 3EEYA 3TM5A 2PJDA 1X19A 2ZULA 4QTTB 2B9EA 1P1BA 2N47A 2JHPA 2PXAA 3SM3A 1ZKDA 1WXXA 2A14A 2XYQA 8MHTA 2IBSA 2ONZA 3MERA 3OE4A 4ATNA 3MCZA 3TOSA 2NXEA 3DXZA 1JSXA 3P9IA 2F8LA 3ELUA 5E9WA 2PV0A 3E05A 3ELWA 5LQCA 2JG3A 3BGIA 1EAMA 3BUSA 3CJRA 3RIEA 3TMAA 4DZRA 3A27A 2CMHA 1WXWA 3VYWA 2ZBRA 3CKKA 3X0DA 5DX1A 2VDUE 4X1OA 2AZTA 2YUIA 2ZLBA 3FRIA 1L1EA 3MTIA 3T7SA 4C08A 5FULA 4H0NA 2B78A 4CKCA 4RVFA 4E30A 2WA2A 4EMSA 3WSTA 3V97A 5CVDA 1G38A 7MHTA 2OO3A 5U4XA 3LSTA 2JJQA 3A4TA 2UYQA 3ME5A 4PCLA 5DRYA 5EEHA 4DCMA 4C06A 3BWBA 3BT7A 3CCFA 4O29A 5D1NA 1N2XA 3PX2A 1JTEA 3FPFA 4PWYA 3KQQA 2AOWA 2O57A 5CCBA 2BM8A 1YUBA 5BW5A 2PLWA 2OY0A 4QDKA 3EGVA 2IFTA 4IWNA 3I9FA 3G2PA 1ORHA 3DUWA 3TFWA 5KQSA 4FSXA 1SKMA 1VPTA 3KPWA 3ERCA 3HVKA 1O9HA 3EGIA 5DM0A 4QDJA 3HA5A 4RVHA 2G1PA 4RSRA 3I64A 2Z6AA 1F3LA 2YTZA 5FHRA 4DMGA 4RTJA 1EQAA 5ICEA 3P8ZA 3G8BA 4HTFA 5IKMA 3EMBA 1UIRA 4PCAA 5DTQA 4QVGA 2QM3A 1QAQA 3GIWA 3IV6A 2JH9A 4RYLA 2I6GA 4AUKA 2BZGA 4RTQA 2BM9A 3GRUA 3OU6A 3CC8A 1NV8A 4G56A 3FTCA 4YV2A 2P3QA 5LQRA 3M4XA 5GIPE 1O54A 3A26A 2BR3A 3DLIA 3FPGA 3LHDA 3PT9A 4PIMA 3P2IA 3P97A 2QRVA 2O06A 2P3LA 2QYOA 2ZZMA 5GWXA 5HZMA 2VDVE 2UYCA 1P91A 3AWIA 2PT6A 1ZQ9A 3HM2A 2IDJA 3O31A 1XDZA 3BWMA 3RW9A 2GAFA 3RODA 2ZBQA 3C6KA 1KPGA 3M70A 4FZVA 3QOWA 2PX5A 3T7RA 1HMYA 2P35A 4QTUB 4OQDA 1MHTA 2ORED 3KQTA 2AR0A 1M6EX 2FPOA 4P7FA 3FYDA 4R6WA 3EVGA 5E2AA 3GWZA 4AZTA 3PTAA 1KHHA 2PKWA 4KRGA 3JWIA 3I58A 3OU7A 3MB5A 5F2KA 2EFJA 4YMGA 4LWPA 4MIKA 1ORIA 1I4WA 5DM4A 5DSXA 1O9GA 2JH8A 3QOXA 4GOOD 2P41A 2DPMA 3B5IA 1TPYA 3U81A 1I9GA 4M36A 4KIFA 2V74B 3IYLW 5K05A 2CWWA 3EVAA 4UOEA 4E2ZA 1R18A 2WA1A 3EVBA 3GO4A 3E7PA 3GNLA 3FTEA 2PWPA 3KQYA 5CIYA 1UWVA 4PYMA 3O7WA 3HVHA 3KR0A 5K0GA 2P7IA 3ID6C 3LDUA 2AOXA 2BR4A 1SG9A 1FP1D 2EJUA 3A25A 3FYCA 2PXCA 3SSMA 3LPMA 5LQUA 5FA5A 2UZ4A 2FCAA 4C4AA 2JHCA 3KQMA 4HGYA 4ER0A 4QPPA 2B2CA 4FT2A 2XVMA 4A6DA 3M6UA 2VP3A 3C3YA 1IXKA 5G02A 3KQSA 5B1SA 1IM8A 4IKPA 5LR6A 3OFKA 2NXCA 3HVJA 1KR5A 1L3CA 1PRYA 1ZHFA 3V8VA 3LBFA 5LQJA 5EMKA 3B89A 3GGDA 4KVZA 2AN5A 4BP1A 2ZIFA 2ZIEA 3EPPA 1ZGAA 3IHTA 1JQDA 3G89A 5FQNA 3R0QA 4MQ4A 2VDWA 1YZHA 5EZSA 4YV0A 1RI2A 2OB2A 2P40A 2H11A 1SQGA 5D1HA 1RI5A 5CVVA 4QPNA 5EEGA 3M6WA 3UJ9A 5DLYA 4R05A 1NW7A 4CKBA 1FJXA 2XBMA 3NVKI 3ELYA 3I53A 5MHTA 2AS0A 3HCCA 2OYRA 2YXLA 1OR8A 3OZTA 4P7KA 4MWZA 5EMJA 5T64A 5K0EA 2P3OA 4U7TB 5E8RA 3E23A 4E33A 4M38A 4RTOA 5K01A 3GRYA 4RV9A 2QY6A 1R00A 2ONYA 4P58A 2AOUB 4CTKA 1AV6A 3CJTA 5FHQA 1WY7A 2HR1A 5GM1A 5DM1A 3LCVB 3MGGA 3NTVA 4HGZA 2IH5A 3DH0A 4FR0A 5DSTA 5ERGB 3UJ8A 4EK9A 3LKDA 4YUXA 3DLCA 3PB3A 4E2YA 1JG1A 1NW6A 3CBGA 5EOVA 4CXMA 5HOQA 5KYGA 2R3SA 5FQOA 5DX8A 1VP3A 5C0OE 1EIZA 5GIOE 1INLA 3BGVA 5EKUA 2I9KA 3REOA 5FA8A 3MHTA 3F4KA 4C05A 4X63A 3M6XA 3CJQA 3HA3A 3OU2A 4LWOA 3O4FA 2PGXA 5EG5A 3EMDA 1KXZA 3ORHA 3UJBA 5HIIA 4R8SA 2OKCA 3VC1A 3G8AA 3ER9A 1NW3A 5DTMA 4AZSA 2XVAA 3MTEA 5K0BA 5CVEA 2ZZNA 4X61A 1JSZA 1NBHA 2ZCJA 2ZBPA 9MHTA 3FUWA 1EG2A 1R74A 5E1BA 5E1MA 4PYLA 3G88A 3CVOA 2IH2A 3PLAE 4C07A 3THRA 5BXYA 4RTLA 4LG1A 1KIAA 5EIFA 2ZFUA 5M5BA 4NECA 1Z3CA 5K03A 3C6MA 4EVIA 2HMYB 4R8RA 2YXDA 3KQPA 2NP7A 1X1AA 4AX8A 1XXLA 3P9CA 2AOTA 2AN3A 3LCUA 5CVJA 5C1IA 3KQWA 3THSA 5CD1A 5EMLA 4EKIA 3KPVA 2C7QA 4KWCA 1U2ZA 4X41A 1QYRA 2H00A 1X1DA 4QQKA 4CKEA 4GEKA 3KU1A 4XUDA 2OXTA 3TRKA 5LQNA 5F2OA 3P9NA 3PFHA 3UJAA 5HILA 1FP2A 1XTPA 4PYKA 3SVZA 3TM4A 4C04A 3P2EA 5DTRA 2Y1XA 3GCZA 3BKWA 5EHGA 5GM2A 2NYUA 3R6TA 1I1NA 4QVKA 2B25A 3GJYA 3HTXA 5ICFA 2KW5A 3HCAA 2IDKA 3LX6A 2NXJA 1JQEA 2IPXA 5E1OA 4HTFB 4PNEA 1M6YA 4DA4A 3HCBA 3M6VA 4CWAA 5LSAA 3G5LA 3LDFA 3EVEA 4FT4A 3AJDA 3TKAA 2PVCA 3VC2A 4B17A 1M0EA 1DL5A 3MCTA 3DMFA 2GA9A 4ZTBA 4Z2YA 3BWYA 3BKXA 3FRHA 1WZNA 3NJRA 3OFJA 2HWKA 1VBFA 1H1DA 2IGTA 2FYTA 2QRVB 4PIPA
chains in the Genus database with same CATH superfamily
1C1YA 2ORYA 3U9SA 1TU0A 5C46F 4D6YA 1J5PA 4DLUA 3RC9A 1ZXBA 4BQFA 3B70A 4DLSA 5BYAA 1CUWA 1EGQA 2R8PA 1FOEB 1Z2OX 4PYOA 2REQB 3WDKA 1DZIA 1UBMS 4ETWA 2I7DA 3T3GA 2H9IA 3UWDA 5K8JB 3DQPA 3WOVA 4LQCA 2GCOB 1FRQA 3QEKA 1TM4E 1U9CA 3SFZA 3EQ2A 1CWUA 2XB6A 2Q46A 5CK5A 1V7ZA 1P9RA 5I9MA 4YA6A 1WWKA 4IGKA 1DHTA 2ICAA 3ED1A 2CHEA 5I7RA 4LOLA 3GJ7A 2PRKA 5DNWA 1QK3A 3I37X 3THOA 2V7WA 5CBPA 3AV3A 1LQTA 2C4MA 2K7FA 5GQSA 2OGUA 1L5HA 4LWQA 1PNTA 3WLAA 4CQJA 5I7WA 4JX9A 1BX0A 4XR9A 5FTKA 1QQ5A 1IHDA 3ZCTA 2Q6LA 1KKMA 3TIGA 3PTZA 3L7DA 4U7WA 4WN9A 4DT1B 5K2MA 1P0PA 4DA0A 4WHMA 3LHSA 10MHA 3R09A 3GFOA 1CZRA 1X1CA 3DFZA 3PGVA 3AIMA 4EUHA 5BOSA 1F38A 2R6AA 3R5HA 4GSYA 5HIMA 1RP1A 1Q44A 4HQRA 4M83A 1U28A 2LKDA 2WTXA 2IF0A 4JDPA 3QYFA 4X3PA 4B0PA 1TLFA 5L51A 2HA6A 5DYNA 4E09A 3BDAA 3N2NA 2WJPA 1H66A 3G8CA 4EAAA 3EXFB 3QE9Y 3D8UA 3NC4A 3AHGA 5DO9A 3BWXA 4G4SO 5AQ1A 4IP0A 1DKQA 1PYDA 2Q5FA 3UM9A 2FEWB 3WQSB 3W9UA 4U2DA 3WGQA 3JWHA 4NICA 1AA9A 3AHJA 3D7RA 3VTFA 4R71A 1M2FA 3BTVA 5KCMA 1C4XA 3VR2A 2NZVG 1WVGA 2FHPA 2RHTA 4ROSA 4LF9B 1H0HA 4PZDA 1IQ0A 5L7YA 3K70B 4BQRA 4DJ5X 1BYIA 1Z5WA 2Q0XA 4MWOA 3T0GA 3MW8A 2FPIA 2H54A 1UMCA 5HEKA 5HF5A 4WCFA 3SEQA 2BGGA 2ZT7A 2I03A 2ZU0C 2FB9A 1PNVA 1Z5OA 5ALIA 3C16C 2ODBA 2WU0A 1KY3A 4XYEA 3B3JA 1E3EA 1M3SA 1S2NA 3Q2OA 1CY0A 5HPYB 2NU8B 2QTZA 3SAJA 3SQDA 4AF7A 4B3HA 1GZSA 3K32A 3EYAA 2OV1A 4MR8B 1TUBA 1US8B 3PNVA 1S1CA 4Q9IA 3TAXA 2IHNA 2R8ZA 4UM9D 4FDVA 2Y8EA 1FDTA 4FHZA 4JLBA 4LRTB 4CL0A 4F1KA 3TL6A 2Q1YA 3E9ZA 4EQZA 5HKAA 1R10A 2BC9A 4YXWD 1M9NA 2Z5FA 3HR4A 4KB5A 1ESEA 1OLUA 1XKTA 3QY0A 4QPJC 4A8HA 3V1KA 4B3CA 1BMTA 1Y7PA 5J5CA 2IV7A 4EG7A 4ZYVA 4K05A 4OHXA 2W2TA 2YYAA 3ETEA 1FX0B 2XTMA 3CVVA 2WD8A 3RSOA 3WWPA 1ZOIA 1N92A 3EQ7A 4UFPA 3JAKA 1CFZA 4KG7A 1NW8A 2D1SA 1KYZA 1MFZA 1SB9A 2FP4B 1TVCA 1GNLA 2Q1XA 1TJYA 1QO9A 2XNJA 1B42A 4OMUA 1GNVA 4MCHA 1Z82A 1RE1A 1Q0SA 4E32A 3W5AA 5ALYA 4ZJYA 3B2QA 4NBKA 3AF1A 5A0FA 4EHJA 2WMDA 4TMZA 1UADA 3ZE7A 2A4MA 4ZOLA 2V7VA 2OA0A 1HDRA 4GH5A 2OGSA 3IR7A 4PGMA 4C22A 1VLHA 1FNDA 1VJ5A 1W25A 3GRPA 5DI3B 3V4LA 3S7ZA 5BV8A 3WQQA 1F6BA 3PJEA 5B58T 1ND6A 3T4XA 1EXDA 3NBMA 1NVUQ 2N46A 3OCVA 5L3QA 4KXWA 3JQ7B 1JLLA 2VDLB 3EUEA 3ZBPA 3HSSA 4N5HX 1H2RS 4UDOA 2XODA 3BJIC 3A0UA 3MQ2A 1O1YA 4LQLA 4R2JA 3UMVA 2YOFA 4LYHA 1TECE 1J7JA 4UW9A 1CHDA 3M2TA 2XCOA 4BLUA 3G49A 1XL1A 3W79A 1I51A 1S4QA 3O8OA 2P2SA 1YAJA 1CX9B 3WK5A 4XD7D 2EP5A 4BVGA 2G9VA 2Q5OA 3TX6A 2FZLA 1QP7A 4J3JA 3WKCA 1QRUA 1LCIA 1PWZA 1ZK3A 5FR2A 4AL4A 1AMOA 3B7WA 1QMGA 3L4SO 3KWLA 2YJ4A 4FNAA 4JC4A 5EUMA 4DA7A 5J1SB 4KR0A 2QV7A 1K68A 1KO7A 2ZR7A 4TT3D 5ERYA 4MCIA 1MP0A 1QWOA 3RRJA 4C14A 3QV2A 4MI3A 2ZETA 5AXAA 3G59A 1L9KA 1R3UA 2YVLA 4C87A 4BLPA 2X41A 3CG0A 5HCNA 2D13A 1W1IA 1DCTA 2ADMA 1Y4UA 2VK1A 2XSZD 5HZHA 2GKSA 4ZVQA 2RK6A 4ZVOA 4CI0B 2P9CA 4CEHA 2A59A 5FUQA 1GGMA 3AUAA 3FSRA 2ZTHA 2NUAA 5K3FB 3ZU2A 1KAQA 2W58A 1CQWA 1XTBA 3KEQA 4ER3A 3EVZA 3KDSE 3KQOA 3QWAA 5ES4B 4F2DA 1ZP6A 2A0KA 1HYHA 4ZOEA 4KOEC 1JV2B 4DM4A 5EHIA 1JL3A 2NN3C 2AOUA 4IDDA 2ZYDA 4I2NA 4EUEA 1N5DA 4V0RA 1GR1A 1PJRA 1V7CA 4Q9HA 5AKYA 2O9JA 4Z1OA 5IC5A 3EEIA 5A02A 1T6ZA 1TM3E 2H2GA 3S1AB 1I4TD 2B0JA 4FOSA 3RVQA 3GEMA 5AJYA 5FUWA 3U16A 1UAAA 2YC2C 5CA0B 3UAGA 1EVLA 5J5VA 3RUAA 1RFLA 5HYVA 2GEJA 4XVHA 3HA2A 3PUHA 3ZDCA 2J3QA 3NV9A 4Q15A 1UXJA 1B3BA 2YBEA 3BD6A 3VO9A 1T26A 1Y6JA 2X5XA 2PQ0A 1ZK1A 4NYMQ 4DSUA 1AOXA 5DCUA 2HMSA 4IFEA 4LYFA 3DAPA 1E6WA 2ZTVA 3X2EA 721PA 4M88A 1RWXA 4XM2A 4XDZA 2YZMA 1ZNQO 4N0MA 4MYUA 4NQZA 3R9WA 5AHRA 2C0PA 3JQ8A 3IR5A 3OJCA 4IFIA 3F90A 3HYSA 1F0NA 1FDOA 1FTWA 4NOLA 1UFVA 3G0CA 4NJMB 4Z9AA 5J2UF 2VXCA 2DECA 2Z8XA 3NAZA 1MX3A 3O3CA 4QM6A 1DIBA 2JATA 3Q5EA 1AQUA 4IDOA 2WMYA 3P0RA 3ZDFA 1NVTA 4Y1GA 2J0UB 4GKKB 1JU4A 2NV0A 2W2VA 5AW5A 4YJKA 2YWEA 3FCOA 3IO3A 3ROMA 1DRWA 3U0BA 4EYGA 3SC2B 1YRWA 4C08A 4GZLA 2JLZA 4DNFA 1Z25A 2P11A 1NR7A 1I7LA 3HQ4O 3EFHA 5IMBA 3FN4A 1TM1E 5BOVA 3PDJA 4RUKA 4TQUS 3GI1A 4Y3UA 1Z5ZA 1PT6A 5EEHA 3TNYA 4CF3A 2VCEA 4E08A 2H4ZA 1RNLA 2XTJA 3IDFA 1WB6A 1DKOA 3IV9A 3PRJA 1Y4AE 1HKHA 3K1ZA 1UKZA 3QLVA 4L2IB 1KJWA 4WBXC 4Z8YA 1OXVA 1N9GB 5C34B 3LO8A 4DEXA 2VTKA 4N40A 2HO4A 4Q3AA 1TEXA 1UF9A 1W4ZA 3NGXA 4XRRA 1CY7A 1TT5B 2DFDA 2PQ2A 2YOGA 4BV2A 4BGEA 1NQVA 1PJ3A 1QKJA 1DC8A 2DFPA 5KQSA 2ZB7A 4L22A 3DUFA 4M9XA 4AXBA 4WW0A 1IQPA 4N8EA 1QSGA 1E9RA 1CXZA 1VSBA 2GBPA 2FGKA 2WC1A 4LN1A 4R2XA 4EMBA 1U2QA 5CGQB 2BDTA 4F56A 2J9FA 4D46A 4PGAA 3PPVA 4V2UA 1PVDA 4EG3A 4BLVA 1WB5A 1OOEA 3V7YA 3EMBA 1N78A 2V7UA 2KPOA 3FAKA 3A9TA 3B2NA 2WYIA 3EQ9A 4TZ6A 4XWGA 4LMAA 1FFCA 1V8ZA 1KGSA 1BHO1 2JH9A 1DBPA 4RYLA 4M87A 3ZHBA 4AYTA 2YQ5A 1ADYA 1XYGA 4D9IA 3AQIA 1P6XA 1XZIA 3IDSA 2CSUA 5FWXB 1VC2A 2VHCA 3C98A 1E1NA 1WAMA 2A9VA 2IXFA 1ZI8A 2O06A 4PHTA 1J33A 1VYUA 3MMXA 3GARA 1KKLA 1CUYA 1VI5A 3HU3A 3MGAA 4RIIA 1N8SA 3HM2A 4QRHA 5FPPA 3U3ZA 1F4LA 4I9UA 3BWMA 3ZV6A 3ZIUA 2XXAB 3ZDEA 3HB4X 1JILA 3W7VA 1W59A 5AXDA 1OUMA 1PL7A 2ORED 2O1XA 2FPOA 2B4TO 1NVEA 2WWGA 5FI3A 1AK9A 2JZNA 3GMIA 4BNVA 1LDYA 1R4ZA 1VDMA 4EFKA 3PFNA 4H9GA 1ISIA 4R40A 1ZEMA 3DS8A 2UVQA 1WHSA 1I24A 1ZKMA 2VJQA 5HGXA 4LDPA 4YDRA 4K1XA 2IUFA 1ZH4A 5EWLA 3ADBA 1DX6A 1QH8A 2R79A 3GVHA 1K6MA 1SWVA 4XDGA 3C7KA 4ALIA 2CWWA 5ECDA 5A4MS 2AE2A 2OHOA 3F6CA 3JW8A 4Q4AB 3FTEA 1IB0A 3KQYA 2XAAA 5G4LA 4DC9A 3EZXA 4GE0A 4PYMA 1I5RA 1RHJA 1S9DA 1DPFA 1Z8HA 3MT7A 3FOCA 2F67A 3LBIA 1XSEA 2R8YA 5LP6A 1QK5A 3RU3A 4HGPA 3SSMA 4NFHA 3V4RA 3VR2D 5AVQA 5JZVA 3O2QB 4UASA 3INTA 1DAEA 4RSGA 5AVYA 1HYGA 3NHWA 4ENQA 1VA4A 5GTDA 2FDCA 4MEAA 1PHPA 4A6DA 2EZTA 5LB2A 3ROZA 2GUGA 1JHPA 4JOBA 2ZBDA 4A16A 1E61A 1GFWA 3WWYA 4BO4A 3DDNA 3Q7SA 2W4MA 1ISSA 3WRXC 3P19A 1POWA 2PAAA 3NWOA 3R20A 2CJWA 1M8GA 3WGJA 4TMKA 4AYXA 2XKKA 2O8CB 3H9EO 2FV8A 3WYEA 2PKYX 5KTKA 4BKMA 4QSMA 3PLNA 1GSOA 1G8KA 2H4FA 3VISA 5JROA 3K0SA 3PHGA 4G0WA 4HRVA 1NT4A 3CKYA 2BL4A 2Y0PA 1YZKA 3LQFA 3PQ7A 2OC9A 5CVVA 3H3XA 3CUSA 3RNLA 3OJLA 4E6PA 4KACA 2K7ZA 1HI9A 2CSXA 4ENRA 1NW7A 1U0SY 2MCFA 1Q7BA 3OESA 1RYHA 4AZ3A 4PZYA 5JZSA 3RSGA 3OZTA 1PEDA 3H7IA 3KXPA 4KK3A 4U6SA 2I4MA 5JBQA 2RMKA 4G0ZA 5GONF 2WG2A 3GRYA 3FJYA 4BMXA 3F96A 1BE0A 2YH2A 1YDWA 3HUFA 4YJ2A 4DIUA 5JNRA 3I34X 4MPDA 1L4LA 3FLAA 1WQ3A 3WBFA 1Z06A 2PX3A 3LCVB 2IEGA 1E7MA 1YS9A 4FYVA 4LF4B 4YRDA 3TE6A 2FLWA 3W8NA 1XQWA 1X15A 2LCIA 3NATA 1NKSA 2WB4A 4HEJA 3WWCA 3V6LA 2AEJA 2CV2A 1FRZA 1IONA 1JHAA 5JG7A 1L8AA 1SVIA 3TZLA 4ARIA 3IDAA 1INLA 1B8PA 3QKSB 2GGSA 2EGHA 2G1JA 1XTTA 2I22A 3GCGA 4U5XA 4C05A 1XNGA 1U7HA 2ZRNA 3WTBA 5JNVA 4ZO6A 4LGMA 4WESB 3HPRA 5DNEA 2WFLA 4MP8A 3SZ3A 3ZC3A 2G25A 3LVBA 2QMHA 4EUFA 5E6SB 4FM9A 5DTMA 1CIPA 4AZSA 3IH5A 1WRBA 2VLIA 2WYUA 1JSZA 1QHNA 1ENPA 2EC5A 3Q98A 4P82A 1JHXA 2OQRA 3WDMA 4DUPA 4EB0A 2P9GA 4JLUA 5E1MA 3ULKA 5K0ZA 2DXIA 4GLJA 4FFSA 1EFPB 2HJGA 1D6NA 2QA5A 2W71A 2Q7XA 2SBTA 4CMIB 4QZVA 4RJJA 2YZ7A 4ILKA 2WJ4A 3GMDA 1N0IA 5BVHA 2TMDA 1U3UA 1M83A 2XUFA 1PQWA 4B5LA 5A5GA 1MR3F 2XUHA 4QARA 2NP7A 1NXOA 3P9CA 3JAWB 4YJ3B 4NZMA 5IT5A 4PAWA 1T4BA 3G7NA 4JLJA 3F7TA 1ZNWA 4KQEA 2WSIA 4IW3B 1YZLA 2X14A 1GWNA 2XRMA 1C0LA 4ZP1A 5FAXA 4BLOA 3M7IA 3HFRA 5CJ2A 5SZKB 1FYEA 5BV1A 2K5UA 4TUYF 3RVBA 2J3DA 4DJEC 4L8GA 1U3DA 1QLHA 1O8BA 1W4RA 2XGSA 4E5DA 3UJAA 3EIOA 1XTRA 3ZJ4A 5LXTB 4MV7A 1A9ZA 1TO6A 3LUAA 1GDTA 1MEEA 3R6TA 5BNFA 4OU5A 1DQPA 4Y2GA 2DR2A 2ZQ5A 2PJRA 1K06A 4N5DA 3MSXA 5E1OA 4WA8A 4B3TB 3N86A 4XDYA 1XEFA 4J0FA 4ESOA 1B23P 1HDCA 3PF9A 4ON9A 4OQYA 2AJ8A 2FW9A 1QC5A 1TMYA 4RM2A 4DCOA 1PGPA 1T2NA 4QULA 1I0IA 1UBFA 3BWYA 4IDPA 1DQSA 3UUEA 4RZIA 1WDTA 1W8IA 3AFIA 3WB1A 3EQZA 4F11A 1PTKA 4Q1BA 1V8BA 2KSQA 3RM3A 2C0CA 2UYGA 1Y9ZA 2P3SA 1VTKA 3FW1A 4JENA 2WVHA 4Y6OA 3KS9A 3KUCA 1OAOA 1BFUA 1RWPA 1PV2A 4K6MA 4B76A 1YI0A 2SHKA 3OT5A 4YJFB 3Q3JB 3UO8B 4UXIA 3V2HA 1U9JA 3N07A 4KV7A 9ATCA 5ELLA 2BP7B 4A91A 1ZNXA 2ANCA 3JWEA 1Q1QA 1UBEA 1VL0A 3F78A 4JYAB 1Z6QA 3RTGA 3QEAZ 4HEHA 3U19A 2JBHA 2VL7A 4B3GA 4QECA 1VJTA 1M54A 1P2DA 2HSGA 4UCFA 3Q40A 1TIPA 4YRIA 2PLRA 4AO6A 1P7VA 4CQMA 5I5GA 1ZOSA 5KU7A 3HUTA 4UC0A 2B7LA 4OQLA 1GUFA 2ZTUA 3I6BA 2VT6A 3Q1LA 4HDCA 1QIJA 1R9GA 3IOBA 1WLSA 3M4YA 4HNAA 4Q1AA 3WKAA 1SA0B 3Q72A 5EKXA 5J2UA 1O96A 3EISA 1XQXA 2DM6A 4KWCA 4X60A 5TVGA 3GJ6A 5DV9A 5SICE 1E0JA 3TQSA 3Q0TA 1SGWA 1XWFA 2YHIB 5K0NA 1YFZA 4DIMA 4AQYB 3FWHA 3QJYA 3F4LA 3KALA 2JANA 4J1TC 4MGHA 4B3IA 5JRDS 221PA 2PEYA 3OUTA 4TXNA 3L1VA 4UHEA 1U5BB 3DL7A 3N74A 2DWQA 5EXXA 4YRPA 4MTCA 4YAFA 3O1JC 2OUKA 2VJMA 2B0CA 3HY3A 4KJXA 1MB3A 4GUAA 1EWYA 4IEEA 1Z0SA 4EJFA 1P8AA 1Q50A 2EG5A 1PR5A 2WT4A 2XECA 3B6MA 1DCMA 1BO6A 3OZBA 5EQJB 5HW0A 2GXAA 4ZMSA 1H23A 2R00C 3AVYA 2B82A 2WUEA 5ALWA 3D81A 2DQSA 5JXJA 1OZGA 1M5TA 2VPPA 1G8HA 1QGYA 4JEIA 4LPKA 1NDUA 4BLWA 1KI2A 3BD9A 5FA6A 4QTYA 3KTAB 3BQNB 2NSYA 1FPMA 1DINA 5CAEB 5EJGA 5BQOA 3BWVA 2EHJA 1B6TA 2R44A 4XQ9A 5C4MA 1DBWA 3M6AA 4OGKA 3TH5A 3DE5X 1D4AA 3P9SA 1DEAA 2G8NA 1QGZA 3HU2A 4ONEA 5F51A 3ZKAA 1E9VA 2NSDA 1RCTE 3PC6A 4NBSA 2PU5A 5BQ3A 1V47A 2Q0HA 3IE2A 3GJQA 3L8MA 1OZAA 3ZH9B 4BOYA 3EAGA 1JFFB 1E7WA 2ZIGA 2EFDB 1DKPA 1FDWA 3DB1A 2CXUA 4HDKB 4BTVA 2OBFA 1KMHA 5FWDA 4UAJA 2O2GA 3UJ7A 1C5KA 1E3LA 1M2VA 2VJAA 2WE8A 4MO9A 4WZAE 1XD8A 3NHAA 3Q7EA 3SDBA 3STTA 1G42A 3VTAA 2ALJA 4WLFA 2JAOA 2XH8A 3M33A 3DLBA 3I3SR 4Z0PA 4WXHA 1A9XA 5F5XA 4N5NA 2H1LA 3ZXSA 2GFQA 5EHZA 5L95A 2WIGA 4YUVA 4LXQA 2B8NA 1A4IA 1JXOA 3DAYA 2XDYA 2YVKA 3DQQA 3IBSA 4Q4JB 4UCXA 1AUQA 1RRPA 5SYAA 3CTMA 3KHKA 2E21A 4F4JA 3SQWA 2F1OA 1XU9A 2X7JA 3QK7A 4C07A 2Z1NA 3E2PA 5E7MA 4PIVA 3OQMA 4I5FA 1YZ3A 3ANTA 5KX5A 1LJUA 1GYPA 4FFRA 1IHYA 4RDCA 1I94B 4CMJA 4E2FA 4JGBA 2F4VB 5GP1A 1NW4A 2OWDA 3C97A 3BFPA 1XCBA 1Y9DA 4IMPA 1J22A 5B1HA 4DLKA 1L5RA 4XWOA 5HQJA 3GLHE 2IKQA 3PHBE 1L2TA 2EQAA 5DKFA 2FW7A 4YUAA 3PXUA 5BPFA 1UPXA 2VDRB 3LRTA 1SZJG 5JATA 2ZIXA 3AY3A 4R9RA 3FPHA 1AV7A 1JMYA 1EVYA 2VTDA 4OJQA 2JFQA 1D8AA 1I4OA 4MV0A 3LL7A 5ALXA 1XEXB 3ZYZA 4AD8A 2H63A 1BXZA 1DJOA 3AUTA 3VR6H 1RBZA 2QT9A 1L9XA 5E3JA 4EKNB 2CFCA 1SBZA 3OZSA 4HRAA 3IQDB 1XF9A 4O02B 3PGXA 1G64A 1MJNA 2PZEA 3CV3A 5JECA 1QFZA 1VJCA 3FDZB 3PXDA 3TWOA 3SR0A 4BQSA 1PHRA 4C0HA 4OHOA 5TVKA 4C4ZA 3COZA 3B3FA 2R751 3LGAA 5HRCA 4UTOA 1O95C 4NF2A 3AUYA 3ABRB 4LV6A 1SXPA 1W0KA 1XMIA 1UEXC 2V58A 5HM8A 1DJQA 1OKKD 1K66A 3N2EA 2QN1A 3N9IA 1QQAA 4C5BA 2VNHA 1PJZA 5JFOA 4LJLA 4Q3EA 1T9ZA 3TJMA 3VOBA 4DV3B 2GVZC 3WGYA 3WNBA 4FXPA 2D1TA 1COWD 1XK6A 5AM0A 1YU9A 2OLKA 3G9XA 4AMBA 2JIOA 1BA3A 2FX3A 4BFLA 3AY0A 1JTVA 3OZFA 3A04A 4OKIA 5KB3A 4J2HA 1PUJA 1N77A 4N3CA 2OFOA 2E4AA 4U8GA 2HA2A 3JASB 4KIJA 4N76A 4TYYA 2Q3CA 4GD3Q 5ARDA 1GTZA 4G8BA 4CU5A 3WNVA 3WB9A 3JQAD 1GRVA 1GG9A 1ZD5A 3QWIA 1AE1A 3LVFO 5ICCA 1U4SA 4JQYA 3PR3A 4UATA 3GT0A 3JQFA 3MJVA 4ZVPA 4L7VA 5TPWB 2WKWA 2EDCA 1RWNA 5A7HA 1SHKA 1W30A 1GQOA 3ACDA 1AUPA 3I6YA 2ZS9A 1ZBDA 3M9LA 1T5IA 3QUTA 4P6VF 1V26A 4D9FA 1GCGA 4O2AB 4ZRDA 2VWGA 4M1EA 4NMLA 3RFUA 5BV0A 3E53A 2D5LA 3RK1A 1L5OA 3QX3A 5EIHA 5JSZA 1E69A 1IN6A 1P1BA 3RIYA 1RT9A 2Q45A 2WIFA 1N6RA 4J91A 5H59A 5B55A 3IPLA 3UNXA 1XZMA 1SUFA 2CZQA 2GBGA 1GPH1 4U5QA 1AMUA 3C4VA 1TM7E 1ACLA 1WKBA 4MS3A 2REBA 2W37A 2HPHA 4DGQA 4H7IA 3OURA 4HQ6A 1E58A 3P9ZA 1YB5A 2FEOA 3Q8XB 2WV7A 2ACVA 2R68A 2OD9A 3EOBI 4LSGA 4H6XA 3PPYA 3CZRA 1QDUA 4NBLA 2VP6A 1SK8A 4NPAA 4CRWB 2CL6X 4OKNA 1T8YA 1AK2A 4WFKA 4DQKA 5B30A 2CLMB 1MDBA 4RQBA 3U5ZB 2B1JA 3EFOA 3M5CA 4EF4A 2XHEA 4RVFA 4DMKA 2ETXA 2HYIC 2L18A 3K8QA 1MOPA 3LUJA 1KI8A 2SCUA 3VXKA 1SQ6A 5JNWA 4B74A 4WZBB 1A9YA 3N2KA 1Z5UA 3ESDA 4P93A 3H5RA 4DCMA 2M6KA 2WUGA 1T0HB 4MR9B 4DR4B 3GP5A 4BLSA 3PEUA 4D6PA 2WJYA 4NCJA 2IYFA 2OBMA 2OBYA 2PLWA 4GRIA 4LV5B 1O87A 4B40A 2DWPA 3ILVA 1YKFA 4WFQA 1YVUA 1B43A 1UC4B 1VHJA 3VOTA 4DIKA 1DJNA 1RAHA 4MJLA 3ZIDA 5BRAA 1OVGA 3I6QA 4LZAA 2YFYA 1FTYA 2E4XA 3UCXA 5JARA 1EWRA 2QTNA 1EFCA 2FPPA 2W11A 2C3PA 1L7BA 2JK0A 4GR5A 4ZT5A 1UBGA 1C30A 1NX6A 4BUJA 1HZZA 2OC4A 2ZVQX 3HYTA 3P8ZA 4TV8A 5JTTA 3CVYA 3ESQA 4GVPA 1RRGA 4JB0A 1LLCA 3GIWA 3A2NA 3QFCA 4ZHQA 1AGNA 4AUKA 4CQMD 4O8CA 5FFMA 1XZ8A 3M4XA 3TQIA 1KH3A 2WJ3A 3ABZA 4MRNA 4UEJA 3ZU6A 4N7BA 5BR8B 2PGNA 2H1SA 5FD8A 2VATA 2JKVA 4Z4CA 4RF5A 4JYZA 3EDYA 5JCPA 4BQIA 1H8HA 1N1DA 4QNRA 3OBIA 1BZYA 2RE8A 5ES3A 4L8LA 1F2DA 2Z1DA 2GHQA 2REQA 5CYGA 3L18A 3LT4A 4QTUB 4BS9A 1TDJA 4QOIA 3TBFA 2GCOA 3GFTA 4QXQA 4MKIA 1NM5C 1ESMA 1ZQ1A 1Z4JA 3DDUA 4YCBA 5EUCA 1C7QA 4CCSA 3RT1A 4UAGA 1Z0ZA 4UQLA 1UZUA 3K8YA 2JH8A 2EBHX 4RVNA 5IAJA 3BH0A 2PH5A 4GT1A 2X1MA 3OQVA 3FHTA 2C5SA 1FDIA 4WI1A 4B09A 2RDMA 3P0FA 3ZD9A 1RXVA 4REMA 3FMVA 4MXDA 2ZVDA 3GBSA 3G0BA 5DZSA 1KEEB 5IM4F 1RZRA 1M1YE 5BWBA 5KVCA 3GT3A 3ONVA 3AVQA 3C7DB 2NV2B 3DTTA 5KQGA 2QWXA 3IAEA 3LH5A 1P60A 4HJXA 4QQRA 2JGRA 3LD9A 3Q8WA 4DT1A 1SG9A 1GYQA 2XB9A 3A25A 4EGFA 2QE7D 4OXKA 4MI9A 2QORA 4U7DA 3CR8A 1YQUA 3NYQA 2CL0X 4WOPA 2GHIA 4NV0A 4XKJA 2XVMA 1KEWA 5G4KB 5BSFA 3WS7A 4DR1B 3L0YA 3ADDA 1PZFA 2XRZA 1HQYE 1ITZA 3K1YA 4GI7A 4QYSA 3X1JA 4DNXA 2RGNA 5EZYF 2IXDA 1Y1KE 2CVPA 2OM2A 3DSRA 1GZDA 3KM0A 2OO7A 4FMDB 1ZGGA 1ISRA 3WHIA 1SBCA 1YJBA 4TYMA 3ITDA 1GA6A 1VPEA 3A6JA 1NW9B 1UPTA 2YVUA 2ZTMA 3FLMA 2D1QA 1CUDA 3H87A 3LPDA 1T2AA 2ZIEA 3EXFA 1CDZA 4EIWA 4Z7JA 1OE0A 1CEEA 4OM8A 1UC9A 1SC3A 3FVWA 4RVOA 5C7LO 2BKLA 1C81A 3KB1A 3ZDQA 2O19A 4PBRA 5CT5A 1YZHA 5EZSA 3ZGXA 2OP0A 5FAKA 5I4IA 2IE0A 4ZA2A 3ECAA 2ZRFA 1KSHA 1QP4A 5EEGA 1U04A 2GFHA 2VPYA 3K5IA 5EIOA 1G20E 1GTMA 1KAOA 2VHWA 2QLBA 2ZJ6A 2UUOA 1EB9A 3IA7A 3KXDA 3FM9A 3HCCA 1AKEA 1O6BA 2YXLA 1SUPA 2X42A 7AT1A 2JIZA 4RTOA 5DTJA 3EIXA 3ZVNA 3RAEC 2AI2A 1E2IA 2YFQA 5KO2A 2C5LA 1XZKA 3WXMA 2ONYA 2ZM6B 2WWYA 3QLUA 5DTEA 2EKZA 2CNBA 3SEFA 2D8MA 1M2KA 2VTEA 1JIIA 3WLRA 4X94A 2D0OB 2D8AA 1KEKA 4RJKA 2NU8A 3RRNA 4HAUA 1BMFA 3RAPR 1A1VA 4MR8A 1US8A 1ZCFA 1XZHA 4F3KA 2HHHB 4Z9BA 3GDFA 4O5AA 4LOHA 4C1NA 4DFDA 2XVXA 4MKFA 3IT1A 2JBWA 2DKFA 2V9CA 3V2UA 2F64A 2PH3A 4NBRA 9ABPA 1J23A 3WRWA 2FOLA 4C7MA 2XCTB 1DBQA 1J9EA 3C8UA 3EG5A 1A5BB 3EPJA 1TVEA 4IILA 3BIOA 4S1NA 1FX0A 4WT7A 1DG9A 4B33A 3F4KA 1GPAA 4UE3S 1U9IC 3TECE 3O82A 4O4JF 1EHYA 4H7JA 4MQBA 4R8VA 2FP4A 2D4AA 4Q16A 5HMLA 3TINA 3ORHA 2PKQO 4G5YA 4B85A 2C77A 4R8SA 4CDRA 5JY1A 3ETJA 3T3IA 3ZWMA 3VNUA 2XVAA 1TLTA 1PR4A 3AHIA 4W7SA 2RIRA 5J58A 3ZWYA 3DM5A 1ZLXA 3KQLA 8LDHA 3CINA 1OBVA 5AW1A 3NANA 3H1PA 2Q5IA 4H3KB 4GP9A 2P5YA 4K03A 2HMWA 3THRA 2A86A 2PFSA 2CV0A 4A6PA 5ALDA 5DI3A 7REQB 4WXMA 2C9MA 3O4HA 3JQ7A 1DCFA 3DTVB 4IQ0A 3VUEA 3U7JA 2CLIB 4W5JA 1XXLA 4AX8A 4CEIB 1WDKA 2WABA 1P7CA 4KVGA 5EJAA 5SZHB 4LRWA 4C21A 3U09A 3EZLA 1B26A 4G07A 4IF4A 1U8CB 4J76A 4WK4B 2AR7A 4UTXA 3MTJA 4PSDA 2IQ5A 3S8MA 2EZ4A 1FJ2A 3PE4A 4P3KA 3SHTA 4LQ4A 2XT0A 3HKDA 3BILA 2IODA 3GLRA 4NEHB 3SKYA 3R7AA 3S2SA 4EGJA 4BNTA 3GA7A 4M1OA 4XGQA 1EYZA 2HXSA 1R12A 2WOJA 1FLVA 1FP2A 2Z4RA 4W6ZA 4WDRA 4DREA 4D96A 1WZUA 1I7QB 1I13A 2EW8A 2IY7A 1O4VA 1EBBA 2B25A 2F3SA 5ICFA 2EJCA 1L5KA 2NXJA 3TOVA 1QCDA 4L95C 1V43A 3OEEA 3MWDB 4HMPA 5LSAA 3EVEA 1KO1A 3MG9A 4EHLA 1T35A 1JA9A 1KZ4A 2I6QA 1EH5A 5HP4A 3ND9A 1GPUA 5BQ5A 1ZMRA 1XF1A 2CXTA 1V1RB 3OLYA 5K3FA 4KITB 5HKKA 2PL3A 3VKWA 1XLVA 3CO0S 1KK3A 1H1DA 3FTQA 2O3TA 3OJWA 4MB2A 2GDZA 5TEVA 4JHXA 1ZGCA 2VZLA 3DD5A 4YT4A 3D8BA 2AI1A 2Z0MA 1R4NB 4E14A 5DI9A 2PRJA 4MHTA 2HMTA 2A35A 1XMJA 4LYEA 1MFPA 3I1IA 1NOKA 3HJUA 2R47A 4KU4A 2WM8A 2Y92A 3E3LA 3S1AA 3UHJA 2H9YA 1J49A 3UC9A 5CG2A 3KHUA 1VE1A 2GN6A 1YZNA 1FSGA 1LNQA 3GH1A 5CA0A 4B75A 3V9AA 1DX9A 2TS1A 3A9VA 3HC7A 3PL5A 4IJQA 4J0HA 3TIFA 3HO1A 3JV7A 2EJWA 1PEAA 1UQTA 2DP4E 2C00A 1XJ5A 2IDZA 1ADBA 3HACA 1DBSA 3N2IA 4TWIA 1YUNA 2PGLA 4U2KA 3RHTA 4CMCA 5IJWA 3J81k 2HHCA 3ZHOA 4QUEA 1HL7A 3M81A 2JGKA 1VPLA 1ZIXA 1FBNA 3PENA 3D7NA 1R4AA 1D2GA 4LHZA 4RH1A 4D3DA 1LKZA 1SD1A 1TAHA 1JFVA 4JOCA 4RVUA 1IN8A 4UFOA 4B4OA 3G9QA 1VL5A 4P7GA 5LA6B 3NDJA 4NJMA 2OPBA 3IPRA 3R24A 3QVVA 1D5CA 1P4SA 4OXQA 4EG1A 4DA4A 3TXAA 1ONNA 2ILVA 2VTVA 3OSZA 4NCKA 1EJ0A 1GHTA 2PU7A 1N8TA 2MINB 3O2SB 1YA8A 4OJYA 3A7EA 4DW8A 2J0UA 1JIJA 2IIPA 3Q41A 2LCFA 2DPHA 2XQGA 1Z83A 2C2OA 3LPCA 4MEBA 1Z26A 5KAMA 2CF5A 2PWYA 3SC2A 2GB4A 2ZJ4A 2DT8A 3NM4A 4NVRA 1BOOA 4RKFA 4CM1A 4F38A 1UM9B 1V6SA 4L8FA 5K6RA 1XDUA 3NPAA 1FYXA 4C4XA 1IZ9A 5DHUA 2IP2A 5LQAA 4K6HA 3VKFA 3NEAA 1QOPB 2GH1A 2VZEA 3DCYA 2IV3A 4FFOA 4BFVA 4L2IA 1DGQA 3PQ2A 4PNZA 1MJFA 1B14A 2D3TA 3E81A 4TMWA 4PG8A 4AS3A 1N9GA 2JLCA 3QW2A 4GKAA 2ZBUA 2PANA 4YNBA 2BIFA 2XUQA 5EVJA 3IT2A 4CHGA 1VGRA 2RJOA 3L0OA 1H8HD 3VVCA 4R3UC 1TT5A 2F9FA 2JEZA 3IKLA 4HC4A 3WLPA 1CP3A 1M74A 3Q3HA 3QWBA 4PANA 5SZIA 1XEWX 4D8WA 2QQ0A 4UM8B 2I4IA 4RJIA 2VJDA 4MGYR 1SQ0A 2FUKA 3BL6A 3IOYA 1QQ6A 1J0EA 2VPXA 2ZXFA 5AM1A 2A33A 3USZA 5JMTA 3LFHA 2QGNA 4O59O 3OM9A 5AI5A 1HG0A 4EJMA 4KPYA 2A5JA 4NRDA 1DRJA 5G1OA 1OT3A 3ABIA 1E6MA 2QUIA 1RVV1 1ODIA 3LQ4A 5AKHA 4CV2A 4AJ4A 5KMGB 3DEFA 4LNHA 3VTZA 1SKAA 3KXKA 2QAIA 3NO4A 4LECA 1G2OA 3HCPA 2CZGA 2I6TA 2IEBA 1P1HA 3AKDA 4BCBA 4MW5A 5BN4A 4EFNA 1CQPA 4YQZA 3DFIA 5FWXA 1WV1A 1U8EA 1J9ZA 2ODTX 1LNSA 1R8XA 4A7PA 4OD0A 1B1AA 2AJTA 1A72A 2IYAA 2OXEA 2X0KA 2XXJA 1EUDB 1GEGA 2YIJA 3BGSA 1O5IA 3BTUA 4I6EA 4PLHA 5EC8A 1KZHA 4B6RA 4JUAA 1ZPDA 4M9UA 2XXAA 5AQEA 2AFIE 1IRXA 1X7YB 4IZHA 5DOVA 3UW1A 2ZTSA 1EBUA 2XAUA 4QXRA 3CE9A 3BGDA 4PZEA 5CYPA 1JEQB 1FPQA 4X54A 4ZGBA 1E5DA 3UCFA 3DTYA 1KMMA 1L4UA 2VDMB 1AURA 3CZCA 4NMWA 3KAQA 3WL8A 5F9MA 2E5LB 1YVDA 2B4RO 3R2JA 1CUZA 1HT1E 2JLQA 3MBKA 4CI9A 3EAFA 3TB6A 3RT7A 4ISBA 4K88A 1KIFA 1NW5A 3BXOA 3CCBA 4A9AA 1JR4A 1U3CA 3LTEA 3BIFA 1N25A 3PQ5A 4U2FA 4JVOA 1HNWB 1O6GA 1NKVA 2BMWA 2NYRA 4EITA 3H9UA 1SMKA 4Q4AA 1AF4A 3NDPA 3KNZA 1ZA2A 3ZWNA 2G06A 3LQ2A 3DR5A 2PEZA 4PX3A 2FZKA 2GA8A 2YN0A 3QLTA 3FFTA 4Q7MB 2C9DA 2Q99A 2V55B 3OOJA 4UBNA 3D6UA 1SKQA 3RWOA 2HIAA 4LDAA 2J5KA 4FMBB 3T5CA 2CDNA 2PMKA 1AHHA 4XEHA 3C3EA 1K89A 1LPPA 3L43A 4CKXA 4B3MB 3KB6A 1AKUA 5E1DA 1SCKA 1PQ4A 1LSUA 4RWZA 3VR5H 1EGMB 1GOTA 3AEKB 4FJ1A 3V3KA 2ZSUA 1L4EA 4N0QA 1GNQA 5B1EA 3FBWA 2PK3A 4WNYA 2VAXA 1U3GA 5MN5A 4CMEA 2QVCA 3UWPA 1YQXA 1JQ3A 3OO0A 5C5CA 3D4LA 3M4ZA 1OSNA 3WK4A 4E22A 3IRVA 2HY7A 1BMFD 3OP1A 2O8CA 1ZDMA 5KTSA 3GLFE 4HGOA 1K7SN 1NBIA 2CUZA 4RAQA 4XVQA 4BC1A 3PDWA 4BP3A 2WSMA 4YS6A 1WXDA 1MUUA 4LBYA 4C01A 3I5YA 2ZYUX 3FWKA 5HBGA 4D82A 4R0MA 3LUFA 4UHKA 5A05A 3OOYA 4DCTA 5BNWA 4OHYA 1J8VA 2ERCA 1I3NA 2NVOA 2Y0EA 2HWXA 4BRUA 3RC7A 1SCAA 4IOLA 2P65A 1U31A 3UH1A 1IBLB 3SSNA 1NURA 1TQDA 2WJ6A 2QNBA 4KNWA 4PY2A 4G0NA 3B2EA 3D2BA 4RPCA 4TYQA 4UJ5A 4HL6A 2A78A 4BY9E 3QIAA 1A7KA 1KMIY 4ZHSA 2F90A 3OIYA 3TW6A 4DDWA 1MVNA 3A3KA 3GZTB 3V1UA 3ZHUA 1P75A 2D5BA 3E9NA 1FS5A 1AQIA 2VEOA 4UARA 3HVIA 4Q47A 2GAAA 3KUDA 4I9FA 5IANA 4BUCA 2P5UA 2VNAA 5B6IA 2XI4A 4NJEA 4NZYA 5CXUA 2Q3EA 4INJA 3U1BA 3PVCA 4KR7A 5JYBA 3H11B 1SXJC 5LLSA 2IWRA 5H3HA 4YCJA 2SICE 4CTMA 1OBHA 3RFXA 1E1LA 1QMPA 4R83A 4MYCA 2QZ9A 3FDFA 1W5EA 4KLRA 2DHDA 3QKSA 3I1JA 3TM5A 3VSCA 6GPBA 1N2IA 4BX0A 5LZ4A 3HXQA 2JFYA 1PG2A 2JHPA 1LUAA 2X4IA 1CUFA 2GF2A 4R81A 4WESA 3QELA 4XPIB 4H4EA 3FLEA 5FUXA 3NM5A 2ENWA 1LRKA 5B64A 2E49A 2YWHA 4JDUA 3LHKA 4RZ2A 5E6SA 3E05A 3YASA 3L5OA 3MCVA 1A96A 1U90A 2HQRA 5HJ7A 3D0RA 1CDDA 2P9BA 3QA9A 4L08A 5F4BA 2ZBRA 2I2CA 1W9HA 1EFPA 4G1BA 1VB3A 2YV4A 3FOEC 1PS8A 4O63O 2RK3A 1Z16A 4ZV7A 3PSAA 3MTIA 3Q3CA 2Z8YM 1FMLA 4E30A 4EG0A 2VRNA 3WSWA 4CBVA 1TMGE 3EE6A 3OOWA 2WKRA 4YJ3A 2XR1A 4PPQA 2JJQA 5CVUA 4RHUA 4KDEA 4BNFA 2R8XA 1MHPA 4GX0A 4K9DA 3BWBA 2GBLC 3D6JA 3AVXA 4EBFA 1KJQA 1UDWA 3E1GA 3GP8A 2GD0A 5J40A 1QHXA 3NHUA 5LYJB 4PBTA 2E5FA 4KO1S 2IFTA 3KKLA 4O8ZA 4RQAA 4TTRA 3G2PA 5SYNA 1T2UA 1AGYA 5AJVB 1A5SB 1FFDA 2NO9A 2P62A 3VGJA 2BZSA 1DRVA 4MGEA 3EHEA 1O0BA 4L3VA 4UVEA 5LXTA 3PDIB 3UVEA 3ZDAA 2FN8A 3NGLA 1Q7TA 1QTRA 5K8IA 1VCMA 5TMDA 1G3UA 2QTMA 3ZG6A 4RMNA 3RIXA 4O1IA 4EKEA 1PG0A 1BXKA 5HF9A 3OPYI 1AY0A 1UEJA 3X1ZA 3E18A 3MBIA 2VYFA 1G7CA 3IEVA 1UFRA 2PR7A 5JXHA 4CF6A 3CYFA 4E5MA 4E46A 4RY9A 4M4SA 5LM3A 3BH7A 3G23A 5MFZA 2FF5A 4OMFG 1GNSA 1XIVA 2PUVA 3PNQA 4PU0A 1YB6A 2RCNA 1A71A 2JJ2A 3JYOA 4PIMA 5K8VA 3TRJA 2QJRA 3FNBA 6Q21A 3TQOA 1QE5A 5GJBA 5JS1A 4IFBA 2QHXA 2WP0A 4NS1A 4CPDA 3KQNA 2JA1A 1KPGA 2Q3BA 3B12A 2ZU6A 4FCCA 5COQA 3KKMA 1M0WA 4YJFA 5HKOA 2DU8A 5FUMA 1DAOA 2P1ZA 1MHTA 3BHMA 1PK8A 3KQTA 5JDIC 2BP7A 1I5OA 1TQHA 4EVRA 1GUDA 5E2AA 3IUMA 4ALLA 4B5KA 1MQSA 1Y5LA 3OQOA 1YR7A 3SYKA 5IDQA 1L7OA 1ZRMA 1EK1A 1X80B 1Z36A 1ORIA 3FE2A 1KZ6A 5HE8A 1J0DA 1VZ3A 3LHIA 4PPNA 1SPBS 4UPEA 4UVDA 4AG3A 3OCCA 2GYUA 2RG1A 2ZT5A 4R0VA 4CGZA 5ED4A 2I2WA 2QSZA 3V1LA 4D4GA 3SF0A 1LBTA 1E32A 3ZIAD 4CMIA 1EUQA 1SA0A 4OOFA 1Z8DA 4QOJA 1DB3A 1E1CB 4BU0A 3UK1A 4LOJA 4KK4A 1T1EA 2YHIA 5AHKA 3LDUA 1KYYA 4V39A 4UVHA 3KELA 1BDJA 3CX7A 1RFGE 4LGYA 5CEFA 4CQNA 1U5CA 2JHCA 3H4TA 4AJOA 4QPPA 2VH5R 1UPBA 3JPWA 2GN0A 3ZWAA 3A4MA 1NXTA 3EQ6A 3PPIA 1U5BA 4N0DA 1TAGA 3KEMA 4MGIR 4NHEA 2VOJA 1C7JA 2K2QB 3J80A 1VDZA 1ZO8A 3TW4A 4A4DA 5BSHA 5LR6A 4YY3B 4A5OA 3TR0A 1T8PA 4JYCA 3ODPA 3JARB 1S8OA 3IB6A 5LQJA 2JCYA 3AZPA 2OCGA 4OHPA 4P4NA 3SCZA 3VU1A 3O91A 3VDXA 4XVUA 1CEQA 2POCA 1CQJB 3MQ4A 1JECA 1T8WA 3PNYA 5FQNA 3TBKA 4Q4DA 2IY8A 1SXJB 1B15A 1MU0A 1RI2A 1T9DA 2WYOA 3L3BA 7GPBA 1PE0A 3C5WP 4JP1A 5FOVA 1ZGZA 3KTAA 5BSKA 1E1QA 5CAEA 4BECA 4R05A 1UOPA 4KOAA 3MJSA 5ER9A 5K4HA 2ZGVA 1KEUA 2ACEA 2HHLA 3JVEA 3JQ9A 4MJ3A 5KNCA 3EOAI 5CLLA 3OH8A 4JEUA 5KYNA 4DCUA 2CJPA 3SHVA 4IIJF 3GEEA 2P9ZA 3H0KA 1J1UA 4G23A 2C7VA 1KDVA 1HTBA 4H15A 3ES9A 4AVYA 1UC8A 2EIHA 3KQHA 3BG5A 5IRCD 5BY2A 1E6LA 2CUNA 1JFFA 2FSSA 5LIPA 2PYZA 4IFTA 2FWMX 1J00A 1YHYA 1A9QA 2JZOA 3EWIA 4R2KA 4P3PA 2OWEA 2EVWX 2BONA 3DKKA 3LLVA 5DYWA 5JHGB 4HDKA 2J85A 2ODEA 3C8MA 2P9YA 1LBIA 1TKCA 2RAFA 1P17A 4K9KA 1NJ5A 1TJPB 1ZIOA 2JHGA 3ACCA 1N5OX 3PNOA 4LK2A 5B53A 4CXMA 5DX8A 4H16A 1C0KA 1VSTA 3VPHA 1IJKA 3EDCA 4RL4A 3SIPA 1R6UA 3MPUA 4E7PA 4NE7A 5AKIA 9LDTA 3M83A 1SHUX 3ETGA 5HTKA 4D99A 4MKXA 5LVAA 1IEXA 3CJQA 2YNMC 4H35A 4LWOA 4YMLA 1KARA 2OZKA 3JCZA 3QP9A 5I51A 4Q4JA 4QEDA 4V3CA 3KWMA 1NW3A 4L6IA 2HN9A 2B34A 3WISA 4AMVA 3LQQA 1FP7A 3H97A 2EFHB 3BJMA 5AJTA 2Y3IA 3H04A 5D85A 3WVNA 5BXYA 3K71B 4N9QA 3GF4A 2O14A 3M5PA 4C4OA 3WADA 3S2ZA 2AQ8A 2EKBA 4BLTA 2IXGA 5I01A 5I9BA 1LNZA 1G6HA 1HDXA 2QT1A 3UGQA 2A0WA 3C6MA 4G97A 2GCEA 5AMXA 1VHWA 2HMYB 4YO8A 3PUKA 3RYHB 2UZ1B 1ZA1A 3TIXB 4HXEB 1FZQA 3ZWVA 1Q2XA 3QEOA 5A7GA 2FWJA 1ADJA 4M0LA 2BAGA 1XBTA 3BMXA 5HJ5A 2R6GA 2YY7A 2DC1A 2Z3ZA 3CB2A 4Z7QB 3VM6A 1VJGA 3N2LA 4R1SA 4QAJA 5CFMA 5KTRA 5JH7F 3A1TA 4ZVNA 1U8ZA 4B9AA 1XEXA 2W6PA 4HDOB 1LZKA 3G2HA 2HNAA 1Y5NA 2H00A 1IHPA 4FHGA 3Q9LA 4L1KA 5FPQA 2OLEA 2AZDA 3SZOA 3IR6A 1KH1A 2OXTA 3GYGA 3NS7A 3H8SA 4KEAA 4UBKA 1U2DA 4XSVA 3U44B 1DJLA 1NUTA 3AF4A 1ID1A 4AY3A 1P7ZA 3SVZA 1Y3DE 2Q6TA 2WLSA 4P4SB 3ZHXA 1E5XA 2WAXA 2WZCA 3CNBA 2BJHA 3FDZA 5JYDA 3OJ0A 1YZFA 4O2BB 1MJ5A 2DUMA 1BN7A 3DHVA 1B76A 1YS6A 4GGPA 4RY2A 3QU2A 2X58A 1JQEA 1OHHD 1RLUA 3SMVA 3KVYA 4NQRA 3U49A 3MWGA 3TD6A 4KI0A 4E11A 4RE5A 3QOFA 4R2MA 4REOA 1M0EA 2HOQA 4QREA 5AW6A 3S29A 4CMGA 5CDGA 3VZRA 3IT3A 1YKSA 4XLTA 5AI0A 1K92A 3RTEA 1Z8NA 2WJWA 2G8LA 1ISJA 2HWKA 2ZB4A 5J4HA 1FDSA 4Q9AA 5KUTA 4NE9A 1TEVA 2I0FA 2QL5A 4JBNA 5EMMA 4K6OA 2I3DA 3JASA 1BJKA 2GM5A 4U02A 2B1RA 1W8DA 2O2DA 5JYEA 2NADA 3QYJA 4U7JA 3VU9B 2XB4A 2ZSAA 2QXUA 4PWYA 1T3ZA 2B21A 2H8GA 3EGWA 4OHWA 3PL1A 4C4PA 4QASA 5TPWA 2OG1A 1M2OB 1I9CA 3B7GA 1WU7A 5AOVA 4PXAA 2YS7A 3SVLA 3KU4A 4X8HA 3URKA 2NM0A 3TJZA 3HADA 4B9EA 4O2AA 1QTIA 2XGJA 3PNSA 3GDOA 4LQDA 4P2BA 3C41J 1UKCA 4MUKA 1ZD2P 3KSMA 3C6XA 5BSTA 2PMFA 1GZ6A 1V2HE 1BE8A 1X1SA 1U8FO 3FBGA 3JTMA 4IVNA 3J7AC 5B3AA 4A0GA 1JKJB 3BXEA 1G9XA 4Q4HB 1SBNE 1D2HA 4WIAA 3L0SA 3LA8A 4DBLC 2Q3MA 3QBTA 1L7VC 1PV4A 4G63A 1G55A 1GPKA 4CE6A 2QMYA 5DNUA 2A1TR 4K0KB 1P18A 4A2WA 4DLVA 3TGWA 4D41A 1A5TA 3I39X 1PFQA 3FYUC 2O2CA 3NHKA 4GF5A 3M4JA 4ASUD 2ZJ3A 1A69A 1G8MA 3FFWA 3C6QA 4RCVA 3AFHA 5C1OA 4P4TA 2R1VB 4YMTA 5JVDB 3PYLA 1OMOA 4F7DA 5GAJA 2DR0A 2VRBA 1E0AA 3F97A 3E5RA 1U8TA 2LDXA 4RMJA 2Q5JA 4WZBA 4EG6A 4JL5A 1II8B 2GEVA 1VL2A 4RA6B 1BKYA 2VT7A 1FJHA 1WEHA 2J3JA 3FCAA 3GFGA 4MR9A 4WY8A 4G5SA 1ANKA 2IHUA 4P5DA 3TSZA 1PJCA 5BO5A 2W6OA 3PWSA 4CUKA 3CR3C 4L85A 4F3RA 1T43A 1V96A 3IMGA 1VHTA 2VDPB 4J7XA 4GDFA 2HTEA 2YL2A 3MTBA 1O57A 1Z47A 1NXWA 1RYNA 2A0FA 2B99A 2H8KA 2KX7A 2NLOA 2LUOA 3QKIA 4FOOA 5EE1A 1H9AA 2HV9A 5EIWA 3RTDA 4DAOA 1F7VA 2ZRDA 1O7JA 1R9NA 1V5IA 1V9LA 2Z09A 1IZYA 4E1VA 1V5EA 5THXA 3GRVA 5FBVB 3FXAA 5DHQA 4LY6A 4YH1A 2JD0A 8ADHA 3E9MA 2HJSA 3TSCA 3ZCRA 1I7SB 4RC9A 2AJDA 5K3AA 4GVLA 2XKBA 1TD1A 1VP9A 1YUMA 2QX9A 3PXAA 4MLCA 5JCJA 5IFLA 2I66A 1ZL0A 1U81A 1YQEA 1Z2CA 2JH3A 3SNHA 3KCQA 5EE9A 3VPDA 1HV8A 1U0TA 2HSDA 1T4DA 2PWAA 3GJ8A 3FSJX 3T7KA 1EDZA 2PX0A 3IOCA 1XVTA 1CUAA 1QYIA 4K40A 5KQRA 2VQ3A 3NMUF 3V8PA 3OX4A 1FFWA 3FROA 3D6TB 2GZ1A 4TXHA 1A8QA 5B2ZA 3U3XA 4OFXA 1RACA 1UBOS 1ZIPA 2POQX 2ZBGA 2IP4A 2X7XA 3GGJA 4J16A 5GZ1A 1X39A 1M7GA 3TLEA 4BV3A 2C9ZA 5JSUA 1RVDA 1DXYA 1KY4A 2HQSA 1X7WB 2ZAIA 5DYTA 4U00A 1J0CA 3GV0A 2IBTA 4KQHA 4FMCF 2HYDA 2XCSB 4MS4B 2ACKA 4QG3A 2GM4A 3A2LA 4J3FA 5LZ5A 1IEVA 4LZLA 2BFNA 4DMFA 1IWOA 2I6FA 2VQ6A 4A5SA 2PQMA 1CJSA 1RZ3A 2PUCA 3IUNA 1R8YA 3P9QA 4QODA 3K4QA 2BBTA 4HX2A 4C4YA 2F4NA 3QHQA 1QG6A 4XGNA 1RP7A 4H1TA 3UMJA 3WHLA 4RZQA 2IGBA 1KEEA 3N0WA 1Y6RA 3KOOA 4CFSA 2VFAA 4IBOA 1KSJA 1K7EB 4NFSA 5KOJB 5F98A 1NWCA 1QR2A 4XYBA 1E1QD 2Z5VA 3S28A 3SSOA 3TG8A 4YRCA 4NYIQ 2DBRA 3SR4A 1B93A 4UHJA 3W90A 5KNCD 4XTRA 3IIEA 3IEIA 2GNAA 3GUHA 5G4KA 1EGHA 3QM1A 4UNNA 1UBTS 5SY6A 1SK9A 3P9XA 5EKDA 1NXXA 2R5FA 4CM9D 1JHRA 3SYNA 5DW0A 1ZN7A 3NDBB 4DA9A 2UYOA 1DAKA 1MW8X 1YQQA 2DPXA 2JAQA 2ZJOA 4Q1DA 2ZSHA 3CPSA 3G0OA 1DIHA 4ESEA 1OREA 3LIPA 1J8FA 2TRSB 2H2DA 4WDQA 4LISA 4G2TA 2GD1O 4L6CA 5E95A 1DFGA 4CIDA 4R2LA 2GPBA 2Q5CA 5C5IA 5F3WB 4MPPA 3GJXC 1F8YA 5BSEA 2H4JA 5DM60 1G3IA 4BQEA 3PFCA 4BNWA 4X6LA 3OM1A 1GA4A 1QZTA 2HHAA 4MAAA 5GOZA 3O8LA 3RU2A 4CIXA 2COKA 1E3DA 3CXUA 3PNPA 2Q6OA 4G4IA 4C29A 1PUIA 2AWNA 2YXNA 3FUUA 1E8MA 1JKIA 1TUGA 2PA0A 5CHYA 4EMUA 1ZL2A 1TRHA 3LRPA 3T7EA 4UHBA 2JLVA 4XIJA 5DCWA 1L7PA 2NMVA 3DDOA 4AX4A 5MF6A 5LD2C 1OZFA 3MT9A 1QP8A 1OV6A 2BEWB 2WHXA 3FUVA 2R6ZA 1T29A 2OMKA 4LJ8A 4P5PA 4RXUA 1NVGA 2AEEA 3BERA 2HGZA 3ZEIA 2D7JA 1ICIA 1F60A 3IMKA 4RZ3A 2FUEA 4OQXA 4FDLA 2X6QA 5EGSA 2W2OA 1GZ3A 1EM8B 3I04M 4DADA 5JNLA 2DETA 5F9HA 1L4NA 1SKYB 3E35A 1SHLA 1KJJA 1NBOA 4R6XA 1E1DA 4OBWA 1DG1G 3HHEA 1I7DA 4QDOA 4W1QA 1E79D 1MB4A 3UK2A 5ESRA 3ITEA 1OF1A 3UXEA 5B7NA 5L3SB 4F84A 1RHQA 4TV9B 3TMKA 3V4FA 2CLLB 1K2VN 3HU5A 5B6JA 2RHBA 3FZGA 1QQ7A 3A9RA 1TCVA 1SCIA 1MO5A 4OLJA 5THQA 3KTOA 1I2DA 2OV3A 3EXHC 8MHTA 4BZPA 2LXNA 4XJTA 3LQYA 2AJBA 2FRDA 2I4TA 3PWTA 4PCUA 3RQSA 2NXEA 3ZNOA 2AMFA 5FXMA 1G41A 1NF8A 2P2YA 1M76A 2FHSA 3PFFA 4Y2VA 2EWWA 1J0BA 2AIRA 3NYIA 5K45A 3FNFA 4ZQCB 3FPKA 3TXXA 5JXIA 5AI8A 4NV3A 3RSSA 3TAHA 3VYWA 1P4GA 1N5MA 1TFRA 2B20A 3FKSD 3GJ5A 2WICA 4AG6A 2H08A 3H7AA 7REQA 3WAJA 3PJFA 1QFMA 1Q0ZA 3W5CA 2HU8A 4P4GA 1QVRA 2V7QA 1E4VA 3H8VA 3R1IA 1G4AE 3KZMA 4EMSA 5I4BA 5MGBA 3DTVA 2K2WA 3TLGB 1PQPA 3L9XA 4CEIA 4MDYA 2QJWA 4IDEA 3FZEA 2AF4C 5GV7A 1MV5A 2BKUA 3HH8A 4O29A 1FUKA 5AJUA 5H80A 1OXTA 1TI7A 3CNLA 1SVMA 2F3QA 2I7XA 2PVSA 2VBCA 1D9ZA 3TIIA 5TIIA 1N2ZA 1G6KA 3BMCB 4IXNA 4B3SB 1RQLA 1E6EA 2HF9A 4F9TA 3A4IA 1W93A 1ORHA 1ND5A 3OTWA 4ZAVA 1FDUA 3U3OA 5DBFA 5AW7A 4WEQA 1BGXT 4BMNA 1AS2A 3MZ0A 1XJWA 2Q1TA 1TLLA 4RVHA 2HIGA 4WWHA 2ZAMA 1UOQA 2FFAA 1LPOA 1WOMA 5ICEA 3BBPA 5JCOA 1Y7HA 4Y6RA 3V2IA 2Y71A 1VBKA 2WUWE 1JBEA 2MSNA 1XELA 2YW9A 1O03A 4I2VA 1HQCA 2RBGA 3TB4A 3AYXB 2EAUA 3GRUA 4B87A 1NMZA 3S27A 4I5DA 1V1RA 4IH1A 5K7SA 2I4RA 2KLBA 3FPGA 1RHUA 4OOEA 2JBAB 4RHEA 4JT8A 4A0RA 2IYYA 1YDHA 4ETMA 3AHEA 3L7AA 3QTBA 4EX6A 4X95A 1R4NA 4FEYA 2LNDA 4Q7LA 1I14A 2WHYA 4GKJB 2Q7OE 3QOWA 3N3AC 1T9CA 2XRYA 1S3GA 3OLXA 4KYVA 4YTEA 3A3PA 2SKDA 2DBZA 3U7RA 3WYBA 3CW9A 4HLUA 5JU6A 3DEKA 3UV6A 1XNHA 1NR1A 3IVGA 5AIAA 4DQDA 4MLZA 4QATA 5DBOA 1KHHA 1DMRA 4YHHB 1EAYA 1L8LA 3EEQA 3N8GA 1ZM2A 5F33A 1Q1NA 1EP2B 3QE2A 1O9GA 2GZ3A 4INPA 3LL4A 2DPMA 5A03A 2BMDA 3AFNA 3DZKA 5HK8A 5E3IA 3KT3A 4WLNA 1AJEA 2ZR0A 5LC1A 2PLFA 2VUUA 4FE3A 4WH0A 3U3KA 3ZK7A 1O94C 2LVBA 1T2EA 1ZY2A 3CPEA 3PZBA 4FKMA 2A0UA 4IX9A 4OGLA 5LA6A 5KKCA 1WKCA 2UUCB 2R6FA 3K73O 4GVXA 2E0IA 1GLNA 4US2R 2AMLA 2O3QA 1K27A 2MINA 1FP1D 1I3KA 1PD1A 1JJBA 1XLTA 2PGAA 4M1SA 3UHOA 1W2GA 4O3FA 1ZU5A 3CRW1 2I87A 9GPBA 1JQJC 3ZHRA 4JAVC 4BX8A 5C1BA 1CYDA 4CMKA 1UM9A 2FX2A 2O0KA 3B8EA 3TQFA 4D4LA 4ENVA 5JCJD 2XUAA 4QXMA 1KQOA 4MUNA 3TKLA 2XD4A 3CNOA 5JJIA 1OGYA 3MOGA 4I50B 5CMLA 1SXQA 3HVJA 2ZRGA 2WWFA 4XFDA 1C0PA 3DP9A 4Y0AA 4DSTA 1JSCA 3U7GA 4WKOA 2AQIA 1PJLA 1G5FA 2AN5A 2PUHA 4HQ0A 1FQOA 1PW5A 1XTUA 2C58A 4JU8A 4ZI7F 2IDMA 4IH4A 3WYNA 2XA1A 5KYYB 1NN3A 2YXPX 2GWRA 3TEFA 3GB9A 2XOEA 2PGOA 3FWNA 3MQFA 4Z7NB 3ICEA 1X9GA 3NHMA 3ZH2A 5EJ2A 1DIRA 1QKIA 1R0CA 3A1UA 4MQ4A 4J75A 2X7HA 4N82A 4X7PA 2H7YA 5ARCA 2B6NA 4A73A 4HEA6 3LGSA 5D1HA 2QVZX 3I2HA 4DRYA 4QPNA 3ND5A 2ZG6A 4IDFA 1TJ5A 3W7AA 1R0LA 5A1JA 3TBHA 1VG1A 1VSQA 4CT0A 4R3WA 1I2CA 5ICSA 3JRXA 4KQ1A 3FLBA 4TLCA 3ROTA 1JEEA 4I4IA 3SIXA 3TXYA 3A2MA 3VSAA 4B4WA 2R0QC 3OCUA 4B3RB 4JLPA 3L1UA 4P38A 2JAWA 2O2JA 4X9XA 5KMGA 2A1IA 1I4EB 2ECOA 1EUCB 1D6MA 1KFEB 2FF7A 4JJ6A 4JODA 1IRIA 4N8DA 2DUNA 4OREX 3ZIAA 4BNJA 4NEQA 2XCRB 1GPBA 5AI4A 2DUUA 2WNSA 2XCLA 2QB5A 3DVRX 2DT5A 2GPNA 4YJHB 2Q7DA 1FVFA 2ODQA 3DH0A 3TSYA 3T15A 2IUTA 2J5QA 3BF8A 1CDOA 1SC1A 3IMCA 4KXVA 5HBRA 3TCKA 4WZZA 1F6DA 1EUDA 4PHHA 2YMLA 3PB3A 3QNMA 1JWLA 1EX7A 4MZXA 3TI9A 1Z17A 1X7YA 3WYDA 3W6OA 4IZ6A 4OSEA 2ECFA 2X9NA 3W78A 4EG8A 4DB2A 3GPBA 3VDRA 2CFRA 1JEQA 1IBRA 2R4QA 4PC2A 4F7WA 4H7HA 2VUSA 1B00A 4EYKA 1Q7GA 1FFGA 1GPWB 1M34E 1WSWA 3AINA 4C2BA 1U0BB 5EJFA 3UJBA 2HRQA 4QDXA 4O0LA 1VIVA 3TVYA 2CXXA 4NCXA 4JKOA 1G5HA 3RSFA 3ZEAA 4ZZ3A 3IOMA 3BFVA 4IDNA 5ALOA 5JYCA 1F2UB 1B16A 1NP7A 2BEUB 4NH4A 2RGYA 3CVOA 2I99A 5H4GA 5HQ3B 4F1JA 3ZWXA 2CE2X 2H1VA 4C78A 2ZUDA 3IAUA 1NNI1 3A4YA 4LG1A 3W1VA 2PMBA 4MSUA 1NHWA 2WIKA 4Y1RB 4F4FA 4YT2A 4JGGA 4XZ3A 1Z3CA 5DLPA 2WILA 3R5SA 4EY7A 2XMPA 3GLSA 4Q82A 4X1YB 5TJHA 2VA8A 1IWPB 1GQSA 1N3IA 2FMFA 3C4QA 4G1FA 4LZOA 4ZO9A 4XLLA 5JD3A 1UJBA 3UN1A 1QG2A 5LWHA 3IQGX 5KHAA 1JDSA 3HKBB 3JZIA 3KQWA 5C8DA 4L5CA 3SZRA 5JS6A 2GAOA 2QP4A 1VOTA 3KPVA 1FNNA 3AEKA 4BASA 4B6OA 1RMYA 1U1GA 1Z07A 2HF7A 3MRSA 4X41A 5BYJA 3NTOA 2WLTA 3EK2A 3NI2A 3OOEA 1A7JA 4UMFA 3LXXA 4YCAA 2BTOA 3LFUA 4GBMA 3QFHA 1E2NA 1M72A 2VAWA 2QYTA 3TM4A 1NZJA 4PWZA 6ADHA 5KPDA 3T5AA 2Y93A 2OILA 3QXJA 4X6YA 1QCYA 4A92A 2DYKA 3LAWA 4R8KA 3DZDA 1GQFA 4I4TF 1B3RA 4Q7EA 2V7PA 3N8HA 1M6YA 1R0SA 4HTFB 3OTHA 1JPNA 3CEJA 5CB4F 3OF2A 4TVBA 1AKRA 1AN0A 2PH1A 1YL6A 3AJDA 2FFQA 4LDJA 3UK0A 3VC2A 4HVCA 1DL5A 2V59A 4YAUA 1R8JA 4BMZA 1G9SA 4JYPA 4AI6A 4KRXA 1X94A 4MPTA 4G5FA 4QJIA 4L5AA 4RW0A 3T54A 2PBLA 4IXWA 2E4UA 5GVSA 1JZQA 1WNFA 1P5FA 1T2CA 1U0LA 2QTAA 4BO8A 2DTDA 3P7MA 3H83A 5EHQA 1SVNA 1T25A 3GFBA 4EO4A 3WQRA 2B36A 5IT4A 3AOEC 4UUMA 5IDWA 1XNQB 1DWUA 4NBNA 3G82C 4YASA 4F8YA 3DAFA 5F7OA 3TG2A 3ZY5A 2QQGA 3EVFA 4MUAA 4NATA 3BB4A 3ZVKA 3PD7A 1OWMA 1FIUA 2FZ5A 2NYVA 3H11A 3S2EA 4M9CA 1VJDA 3UBMA 1QTNA 5C8YF 3DCJA 4LHEA 5D3QA 3FY4A 3PFWO 1J24A 1NMYA 1T91A 4YP7A 3LDGA 1QAOA 3KEOA 1TQ6A 3STWA 3AVVA 1B0ZA 2Z95A 3KSZO 1QIKA 3A4VA 4XPIA 1YONA 3V42A 1JR2A 1QHFA 2V6MA 1CP2A 1I7NA 3AUFA 3QNWA 4PG6A 1GQQA 4N4AA 2CEKA 1C8LA 2QE6A 1O3YA 2ZR9A 5KREA 1E5QA 1TAQA 4OQEA 3ZUGA 2HREA 3EIHA 1CY8A 1IU9A 1YL7A 1UK6A 3L7JA 4YECA 5HFJA 1L7XA 4D9EA 1YE5A 5GINE 3T1HB 1YZTA 3ZW8A 4MW1A 4ZCLA 5KBYA 1JB1A 5JO0A 2F43B 3ZV5A 1ZM7A 4AMZA 4U3JB 2YWRA 4Y2TA 4J0GA 2HH9A 1ZGBA 2JGIA 4FP9A 2HCRA 5LQKA 2BLNA 3ZV7A 2CHUA 4LHXA 1AK1A 1P1JA 4K9RA 4Q0MA 4AIIA 1KQ3A 4JUBA 3H2SA 5EHXA 1SZCA 3N8NA 4TLMB 2QGZA 1APBA 1H2FA 1MEJA 4PZZA 3UFBA 3UYKA 2G36A 5D5PA 5I5EA 5I9NA 2F1HA 3Q3GE 4JFAA 3LKZA 5LYJA 3VR4D 3L8CA 1IFXA 4IIXA 1JDVA 3G9TA 3WG9A 1L3BA 4BP9A 4HFRA 1J25A 2G17A 3G9UA 5EE5B 4DDKA 1M6WA 1JH9A 3HCFA 4LAFA 3WYAA 3NIBA 4MICA 3S81A 2V1UA 4KFUA 1A4XA 1G0NA 2W5UA 4I8XA 3PDIA 2B9VA 2IYUA 4NFLA 3ZBUA 1OVMA 1VHDA 3NVMB 4QU9A 5E8JA 4IEFB 1YFLA 1GAWA 2FUG6 4PQYA 1XAHA 4I3HA 5C80A 4KTTE 1J6UA 5FYQA 2RARA 2P9FA 4IO0A 4WGFA 3VVBA 3GLIB 2AR9A 3VYVA 1U2TA 1C3VA 2XUZA 2V6FA 3LBNA 4KC0A 1W5FA 2XZPA 3BSYA 3HBNA 4QJ4A 5FI0B 3ODGA 1R0ZA 3WGKA 2Z8ZA 1HE1C 5TX7A 1NATA 4MZDA 1XCLA 4LX8A 4RF3A 3A1WA 1H1TA 1YRQA 2X8JB 3QU5A 4Y18A 3UMCA 5B5SA 5BNTA 2HNKA 2ZSBA 2X1VA 3IDQA 1UJ4A 4FS8A 4FW9A 4IDBA 3ECSA 3IX7A 2BUCA 3U17A 5DGHA 5L7TA 4BPBA 1XTQA 4TQ9A 2ZI4A 3CZAA 4UD6A 1KO5A 3Q88A 5I8ZA 4NPHA 2WB2A 1V1JA 1GA1A 1OWNA 3KLNA 2GEBA 2PUJA 3U3MA 1T2VA 2BEKA 1UOEA 4A2QA 3FMOB 5T6BA 3ZQKA 3TZQA 4YV7A 1GCAA 3K2BA 4P22A 5AW2A 5I8PA 1N3LA 1L5YA 1U3VA 4GIBA 2G5CA 4O4IF 5G41A 3UYLA 4LJRA 1X80A 5JJLA 3EBLA 2P4SA 3F6PA 2FKAA 1CUJA 1I6MA 2O50A 1DEXA 2DG2A 2H0QA 3C45A 2O23A 2QPTA 4W5WA 3UWOA 1K6EA 4YUYA 4EECA 4LKOA 3R8CA 4ZI5A 4FJ2A 1ZUD1 1XZJA 4CR6A 5IT0A 1SG0A 2G1UA 4J94A 4MVJM 5TT0A 2Z43A 1RSZA 3UMSA 3UZUA 2IHVA 1DRKA 3GRZA 3K1AB 3MMSA 5ADHA 4PCVA 1BEZA 2K87A 2VXYA 1E1CA 1W76A 4MRRA 4ZT4A 3WR5A 3TTXA 2MT9A 1JIQA