2N47A

Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
197
structure length
197
Chain Sequence
MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Structural genomics, unknown function
total genus 47
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2n47A00
4V0QA 3TM4A 3LHDA 4P7JA 2P41A 4RSRA 4XUDA 4DF3A 3R3HA 4RTSA 3AXSA 2FK8A 3KQYA 3R6TA 4GC5A 3CGGA 4E2YA 1R18A 3K0BA 5K0LA 5GINE 2JHPA 2ZTHA 3PFGA 5DSXA 3T0IA 2V7EA 3E23A 3HEMA 4YUYA 5HIKA 5K03A 4ER0A 3JWGA 3E8SA 1R8XA 3EGIA 3EGEA 4YV2A 5KYGA 4RTJA 3I9FA 4OBXA 3UA3A 1HNNA 5EG5A 3HCAA 2GS9A 1UIRA 3ORHA 2AOXA 2YUIA 1KYZA 3HCFA 8MHTA 2XBMA 3R0QA 2AVDA 3LCCA 4LWOA 3G2OA 3BGIA 2PXAA 1ZGAA 3FPEA 3TM5A 3UJCA 1KHHA 1JTEA 1Y8CA 4R6XA 3OFKA 2OPBA 4PONA 5D1NA 5E8JA 3BT7A 2AN3A 4PYIA 3G2MA 5CVJA 4QTUB 9MHTA 3JWHA 1NW5A 3G2QA 2ZW9A 2ONYA 4RVFA 1NE2A 3T7TA 1JQEA 5C0OE 3HVHA 1XVAA 3C3YA 2PY6A 3LKDA 5EOVA 5F2KA 1AQIA 2Q41A 2YX1A 5T67A 4DM3A 5KQRA 3FTCA 2OKCA 3BKXA 1UFKA 3CCFA 4F85A 3JWIA 1QANA 3B3GA 3FUUA 3OE4A 2QY6A 3GO4A 1ZQ9A 5CVEA 4QVGA 2C7QA 2QE6A 2P7IA 5ICCA 3VC1A 5F2NA 3KPYA 2E5WA 2R3SA 2JHAA 4CWAA 3FPJA 4EKGA 3NMUF 5DTRA 4AZSA 5EGSA 4E30A 1VL5A 2ESRA 2JH8A 2NXCA 2QM3A 1DL5A 1N7JA 2ZBRA 5EPEA 4CTKA 5JR3A 3KPJA 5CUQA 5DLYA 3LPMA 3KPVA 3A4TA 4GUAA 4MTLA 4DQ0A 1M0EA 4XUCA 3MQ2A 3LSTA 4PYOA 3IYLW 4PIMA 4DMGA 3PLAE 4HC4A 3GU3A 1FBNA 3BWBA 4RVGA 3UJ9A 4C04A 2OBFA 4Z2YA 3DR5A 4M36A 1R74A 5FA8A 3TOSA 4R8SA 3HCBA 5ICGA 2AOTB 3P9KA 3CBGA 4OQDA 3AJDA 4HGYA 3UJ6A 4GF5A 4ER5A 3FTDA 3GRZA 1DUSA 1KXZA 1OR8A 2EJUA 1ZKDA 2B9EA 3O31A 3ELWA 3DLCA 3A27A 1KP9A 2XYQA 3HCDA 1O54A 2P7HA 4OQEA 2AOVA 1NW7A 5DX0A 3KQWA 4RVDA 5EMJA 4YUXA 2BR3A 1WXXA 2PBFA 4OA8A 5M5BA 2G8NA 3C3PA 5HILA 3G8BA 2ZIGA 4FSXA 4DA4A 2YXDA 3SSOA 4E70A 4YMGA 2C7PA 4E33A 1QAQA 1NBHA 4FZVA 1YUBA 4QDJA 1VQ1A 1XTPA 3DXZA 3OU6A 4FT2A 4ISCA 2IP2A 5DTQA 4O29A 4PWYA 3A25A 5LQJA 3IEIA 3SVZA 1M6EX 4AZVA 3CJQA 1RI1A 4QTTB 4PGGA 1RI5A 1RI4A 5EVJA 5DXJA 4M7RA 1RJDA 3U81A 2VP3A 2ZCJA 2HNKA 4RTOA 3TMAA 2P8JA 5K8VA 1ORHA 2CMGA 5EMLA 5BW5A 3DTNA 2BR4A 2A14A 4HH4A 5BP7A 4QVKA 4X61A 4ER6A 3P2KA 3BWCA 5DSTA 4PYJA 3E7PA 3FZGA 5CVVA 1YZHA 3M6UA 4DCMA 3JWJA 1P1BA 1VLMA 3GJYA 2Z6UA 3M33A 3EVAA 2HR1A 1KPIA 1X1CA 5EC8A 3GCZA 4PIPA 1EQAA 2ZFUA 1R8YA 3SXJA 3UWPA 1JG4A 1IY9A 2GH1A 1WZNA 2P3LA 5K0JA 3I5UA 5CCXA 2QYOA 1INLA 3OFJA 2PX5A 4E2WA 3GDHA 4EK9A 1NBIA 2AZTA 3EVFA 1JQDA 1L9KA 2PX8A 3DMFA 3B7PA 3I58A 3IV6A 3LDUA 4L7VA 2IH5A 2IH2A 3C0KA 4GOOD 4LWPA 3G8AA 2BR5A 4YUWA 2CWWA 1RJFA 2ZWAA 1ZG3A 3LCVB 2NP7A 1SG9A 4X60A 2O05A 3KQOA 5LQNA 3EMBA 1YF3A 2GAFA 2YXEA 1Z3CA 1NW3A 2FRXA 3UJAA 2R6ZA 3GWZA 2P1DA 5E9WA 2NXNA 1N2XA 5EKXA 3MCZA 5D1HA 4WVLA 3UA4A 1RJGA 5BW4A 3HVKA 3UFBA 2GLUA 2Z6QA 4XUEA 1VP3A 4GC9A 5HIJA 3FPFA 3H2BA 4RV9A 1IM8A 1VIDA 1I4WA 2B2CA 3G5LA 3DXXA 3G7UA 2JHCA 3M4XA 3P2EA 4MWZA 3THSA 2I9KA 3FTFA 3KKZA 4UOEA 3R24A 2Z6AA 3EVBA 2ADMA 1FP2A 1I9GA 3BKWA 3LBYA 2AN4A 4R6WA 3FUTA 1RI2A 2DPMA 4X63A 3OZSA 5T64A 3GRYA 1XCLA 7MHTA 5FCDA 4EMSA 3V97A 3FTEA 4KIFA 2AOUA 4POOA 2UYQA 3DP7A 3OU2A 2FPOA 3PT9A 3QOWA 1SKMA 4HRAA 5FWDA 5CD1A 3KQMA 5EMMA 3VYWA 1QYRA 2ZBQA 3TKAA 2GPYA 1N7IA 1VP9A 2PT6A 3UJ7A 4CTJA 4AX8A 1P91A 5DRYA 5P8WA 1SUIA 1KPHA 4H0NA 4LECA 4CKBA 3TRKA 5EMKA 3G2PA 5E1DA 4RTPA 4A6EA 3DH0A 3L8DA 1XDUA 3P9IA 4KWCA 3TR6A 3MERA 3P9CA 2YTZA 2JH9A 1D2GA 3P71T 4EQZA 3GRRA 1G55A 3BGVA 4OA5A 1O9HA 2H11A 3OCJA 1KIAA 5CM2Z 4C06A 4C03A 4F86A 2OYRA 4BP1A 5C9ZA 4BY9E 1KPGA 3KU1A 4P7KA 4RTQA 1XJ5A 3MTIA 2AN5A 1EJ0A 2H1RA 4ER3A 3KQTA 2CMHA 1AF7A 3Q87B 1TW2A 3HCCA 3C6MA 2NXEA 2B25A 2OZVA 4BLWA 3MCTA 5LSAA 2VDVE 1G60A 2F8LA 2K4MA 4RTRA 3LDFA 4E2ZA 1R6AA 4E31A 3ELUA 2V74B 2UYHA 2ZWVA 1YFLA 1QAMA 3HA5A 1M6YA 3WSTA 1QZZA 1TW3A 3HP7A 4PYMA 5F2OA 5KQSA 1WY7A 2O07A 1MJFA 3K6RA 5LR6A 5DM2A 2WA1A 2PWPA 3QOXA 3I53A 3ELYA 4ZTBA 4QPNA 3NVKI 3FRIA 3ID6C 4PINA 3B3JA 1L1EA 1PRYA 5FHQA 3EMDA 2AR0A 2YVLA 3FPHA 3BZBA 3LX6A 1SUSA 3V8VA 2VZ9A 2FHPA 3PVCA 4PYKA 2HTEA 5FUBA 3IHTA 4P7FA 2AS0A 2PXCA 3CKKA 2HMYB 1V39A 2ZSUA 3ME5A 5DTMA 3THRA 1BKYA 5JUWA 1YZ3A 2GB4A 4RX1A 10MHA 3M6WA 3GRVA 1JG2A 4KW7A 3EVDA 5EIWA 4Y2HA 4B17A 3KR1A 2ZIEA 3AY0A 3AXTA 4U7TB 3SR4A 1L3IA 2PGXA 5DPMA 3NW9A 3OE5A 4KDCA 1BHJA 1JG1A 3PX2A 4YMHA 3DLIA 4EVIA 3VC2A 3KQVA 1QAOA 4QPPA 4P7GA 5FA5A 1AV6A 5FHRA 4M38A 4RTLA 1NW8A 1AQJA 3KR0A 2I6GA 4IV0A 4RTMA 2AOTA 3SMQA 3UZUA 2YR0A 5G02A 5HIIA 1JR4A 3DULA 2ONZA 2BZGA 1G6Q1 5ERGB 3A26A 5KVAA 1FPQA 1EG2A 2HV9A 2PWYA 4M37A 4EKIA 3HA7A 3PFHA 5ICFA 5FQNA 3UBTA 1G8SA 3RIEA 2I62A 1RI3A 3NJRA 4F84A 2IIPA 3GGDA 3OU7A 3NWBA 1G8AA 5EZSA 1Q0TA 3VSEA 3NDIA 4JXJA 4RYLA 3UJ8A 5EKUA 5IKMA 2WA2A 1I1NA 3BWMA 3Q7EA 3DXYA 4GOLD 2IPXA 5GIPE 5CCBA 1DCTA 3MHTA 3GIWA 2PSSA 1NKVA 2VS1A 1X1DA 2EG5A 4X41A 2CKDA 3GNLA 4DZRA 1L3BA 3NTVA 3HNRA 5E1BA 5E2AA 5KS2A 4R05A 2ZULA 3EPPA 3CVOA 5HEKA 4PCLA 2ZZKA 3HVIA 4R8RA 4OX9Y 3KPUA 5EIFA 3PB3A 5CVUA 3G89A 3CJRA 2PX4A 4V0RA 3HCEA 1FJXA 3P97A 1SQFA 4FT4A 4DKJA 4FS8A 5DM1A 1U2ZA 5GWXA 2O06A 3ER8A 1G38A 3ER9A 3RODA 4U7PB 5E1MA 3SSMA 1F3LA 2YQZA 2FK7A 1JSZA 1O9GA 2N47A 4PYQA 4QQNA 4BP3A 2BM8A 4Y30A 3A7DA 5EQJB 4KRGA 1NT2A 2EFJA 3DUWA 1JTFA 5DRTA 3DOUA 1EIZA 3FYDA 4IV8A 1NV9A 2H00A 3EVZA 5K0BA 4YUVA 3TKYA 2PX2A 2AVNA 5K0FA 1VE3A 3G5TA 2FCAA 3CJTA 3M6XA 1R00A 3BUSA 3DMHA 3OZRA 5BXYA 5K09A 2NP6A 3NVMB 3TPZA 3O4FA 1ZHFA 1X1BA 2I7CA 4BLUA 4PNEA 1D2CA 1JQ3A 5GP1A 4GBED 2PLWA 2ZZNA 3ERCA 1B42A 3PTAA 4FR0A 1BC5A 5LQUA 5FWAA 3LKZA 3E05A 3MGGA 5K05A 3BXOA 5MHTA 3SM3A 4PGHA 3D2LA 4C07A 1ZGJA 5CVDA 2P35A 2XYVA 3HA3A 5K0CA 1P39A 3MTEA 3QV2A 2GA9A 4FGZA 5E2BA 5CIYA 3C6KA 2PV0A 1WG8A 3ANXA 5EEHA 4OBWA 1NW6A 1Q0SA 5DT2A 1T43A 1D2HA 1WS6A 3O7WA 5GM1A 4AZWA 3LECA 3RW9A 2ORED 3P9NA 2OY0A 2PKWA 3HTXA 3FRHA 3HM2A 3P2IA 5DWQA 4A6DA 2P3OA 5GOZA 5LQCA 3X0DA 5HZMA 2IBTA 5FTWA 4AUKA 3SGLA 2LD4A 1HMYA 5DM4A 2PXXA 2YXLA 5T6BA 5LQRA 5DXAA 2JJQA 3KHKA 2BH2A 4KDRA 3EVGA 4IWNA 4PCAA 2NNWB 3NDJA 5ICEA 2G1PA 3DMGA 1NV8A 2NXJA 3OPNA 1FP1D 1XXLA 3S68A 2Y1XA 2XVAA 3EGVA 1X19A 4HSGA 4MIKA 3LCUA 3R9XB 3EEYA 1YB2A 2PVCA 3T7SA 5HIMA 4RTKA 1VBFA 2Y1WA 3FUXA 3KQSA 3KPWA 2ZBPA 4ATNA 1SVUA 2G72A 5K0GA 3M6VA 1X1AA 2XYRA 3AWIA 1YFJA 2HWKA 4C05A 4P58A 4E32A 4XCXA 1KR5A 2ERCA 3HVJA 5DX8A 4X1OA 3SX0A 1BOOA 2VDWA 2IDJA 5EHGA 4PYNA 2WK1A 2UYCA 4GOMD 4BLVA 2ZIFA 3F4KA 4DCGA 2IBSA 3B89A 3T7RA 5H02A 3B3FA 2QRVB 4IKPA 3UJDA 4CKEA 1EAMA 2B78A 3FUWA 5E9QA 2EX4A 2IDKA 4G56A 2NYUA 4HTFB 3LDGA 4LG1A 5IH3A 3ELDA 4YV1A 5K0NA 2UZ4A 3LBFA 2UYOA 4C08A 1XCJA 3GRUA 4GQBA 1PJZA 5EHIA 3B5IA 2P3QA 1L3CA 1F38A 4KIGA 4GEKA 4PYLA 1VPTA 3PX3A 3LL7A 3P8ZA 4RWZA 4C4AA 3EVCA 3FYCA 2KW5A 5DM0A 1SQGA 2BM9A 3PS9A 2JG3A 4MQ4A 5GM2A 4HGZA 3BGDA 4QQKA 5FQOA 3REOA 4E2XA 1JG3A 4FP9A 3SSNA 5HFJA 3FUVA 5LQKA 4AZTA 2C7OA 2O0LA 3A7EA 1KYWA 4QDKA 5B1SA 4ER7A 2IFTA 1H1DA 4WXHA 2DULA 2CL5A 5FULA 1TPYA 1P1CA 3KQPA 2VDUE 4CKCA 1MHTA 4GOND 5C1IA 5K01A 1RJEA 2XVMA 3GXOA 3FPGA 3I64A 3KQQA 2IH4A 3MAGA 2O57A 5FADA 2OXTA 4YUZA 1XDSA 4FSDA 5LQAA 4CXMA 2G71A 2QRVA 3TFWA 4MHTA 1IXKA 5U4XA 5E9JA 4K6MA 5DX1A 1EJ6A 2G70A 2ZVJA 4HTFA 5GIOE 3NWEA 5E8RA 1WXWA 1UWVA 4YV0A 2OB2A 4NECA 3TLJA 3CC8A 3G88A 2PT9A 4KVZA 3EEOA 2AOUB 2C7RA 3KR2A 3TQSA 2EJTA 2FYTA 4RVHA 5K0EA 2ZZMA 2AOWA 5HOQA 2P40A 1ORIA 3EVEA 4HG2A 2OB1A 2OO3A 3LGAA 2IGTA 5EZQA 2PJDA 4RTNA 1XDZA 3BWYA 5E1OA 1JSXA 3KR9A 3MB5A 2ZLBA 3OZTA 2B3TA 3M70A 3UJBA 5EEGA
chains in the Genus database with same CATH superfamily
1PJ8A 1R0BA 2A92A 3LLUA 3RRMA 1OH5A 1F14A 3CTPA 3OQHA 1YIDA 4FGLA 5A4JA 2EQ5A 3USCS 4ENTA 5AKKA 4WQMA 1IJEA 3CT4A 2FK8A 3P9XA 2HCRA 1QQTA 4KQJA 2WIAA 1MBZA 4BFCA 3CF4A 2V98A 5KTYA 1PGNA 4UNQA 1NVXQ 1XMXA 4PPFA 5LBIA 3WRVA 2QKYA 1YZLA 2YICA 5GGXA 1S3IA 1E7YA 1E5QA 3R9IA 3AEZA 3E7WA 4QJ4A 1Y8ZA 2P9EA 2D0IA 2X4GA 3HYRA 3IP7A 1AZLA 4HRVA 2YH2A 2YUIA 1B26A 4JT2A 3VMMA 5AI8A 4Y2PA 4LWOA 3ESRA 2HK7A 4IFBA 3C3XA 5HTKA 1VLQA 2XCRB 3VBCA 2ZATA 2EFCB 3NEJA 4CETA 4XJTA 2YOHA 1CQPA 4P38A 1L6IA 3CGWA 4FQ8A 4H59A 4DWWA 5I48A 3U4QA 1H8EA 3AX6A 4DXDA 1TLLA 2YIMA 3A0UA 3T1QA 4G86A 4TLAA 4GH5A 4Q3KA 3DZIA 2UXCB 1OA0A 2B9VA 4Q66C 4DCNA 5CNIA 1DO2A 1NE2A 1T6NA 2A4MA 4OPMA 1WQ3A 4N18A 2ZR7A 5F2KA 2EWVA 3QKRA 4O1HA 3LVBA 5ALVA 1N6KA 2YHUA 3OKAA 4U4AA 1SOVA 3SJZA 5LU8A 4OHPA 1M1NA 1Z63A 1YZUA 3R8FA 4C88A 1K88A 1KP3A 3GDFA 4TLCA 3GLHE 4JT4A 2R48A 4PEVA 5DLEA 2C7QA 5CIQA 3STTA 2HL6A 3GLIA 5D84A 3HGTA 4Q3CA 1OASA 3M5WA 3QPAA 4DAEA 1LDNA 2C9DA 2RG1A 1C9KA 3L7DA 3KWJA 4BDSA 3GLTA 1BN7A 1PE0A 1JDJA 2JLBA 1E1NA 1BEUB 3GU3A 2XE4A 4I9FA 2BELA 3BILA 2WG1A 4RQUA 2R96A 3GRFA 1KC1A 2WJ3A 3KOYA 5IBRA 1RS0A 4HAZA 4URHA 4ZVTA 3X2SA 1DAFA 5A3QA 1G6KA 1P1HA 2CXRA 3Q8XB 4TKZA 1USKA 4G9EA 5BOSA 2W6JA 4II7A 3LYUA 4C3ZA 3H2ZA 3U9SA 4MUMA 4YUXA 5ITZA 1JA1A 4M22A 3TSWA 2C94A 2GVZC 1ULHA 2FEOA 2VTVA 3H97A 5AWFC 1KQPA 1YBAA 3G8BA 4Q1FA 5JO9A 5BUZA 3PV0A 4D98A 2NZWA 2PVPA 3RB8A 2DP4E 4TV9A 1WZEA 2P2NA 2PH1A 4JZYA 1M2OB 1FRNA 1E2HA 2R6JA 2V65A 3SFZA 1E5XA 5JCJD 3N86A 1KDZA 1U0RA 5FTMA 4NFHA 2V0CA 4O25A 3RG2A 4WNYA 2C59A 1NOIA 1QO0A 2OUKA 2OBLA 3EA0A 4I50F 4J91A 4L9SA 4ND5A 2HNKA 4Y1RA 1HDXA 2IP4A 1LSOA 5BNTA 1DP4A 3EOAI 1MFZA 1SMKA 4JUDX 1Z73A 2QRHA 3OEEA 1F2TA 1UMCB 1XQXA 1YNSA 2ICAA 4M0PA 4X61A 2VBFA 3GUYA 3AO0B 3QLVC 3RAEC 1SRRA 3JWJA 4E07A 1FRFS 1T10A 2QZJA 3M33A 1ESEA 2JFUA 4FOPA 4NICA 2DWOA 4DF3A 2V4UA 1JHAA 1WXDA 2WHQA 1THMA 5EXSA 3OJ0A 2P79A 1OVMA 3RYIA 2GH1A 1QFMA 4JHXA 1LDEA 2X1HA 3PKJA 3QVVA 2FPPB 4H31A 4H7FA 4RPKA 3W5UA 1KA9H 3WGVA 3DFUA 4ZJUA 1H93A 4HRXA 1JU4A 2AKEA 4KPFC 3W04A 3VO8A 2VYVD 3BK1A 1MOQA 5ICSA 2FKAA 3K0KA 4GOOD 4LWPA 3G8AA 1TEVA 4U5QA 4DTIA 4ZI3A 1RJFA 3L5KA 4BFSA 4DMMA 2WT8A 1X2BA 1YL6A 1PSZA 4WIAA 4ZVOA 5AXAA 5KSWB 2UZ3A 1Q17A 3FPLA 2JGLA 3G8YA 1ZD3A 3RVQA 2EW1A 4JEUA 2FRXA 2PAFA 3OHPA 4A23A 3E0QA 4Q21A 1QHSA 5CFNA 4L9RA 2CB0A 2QYTA 3H1GA 1YTUA 1ML3A 3SLGA 4JJ8A 5FFMA 4FI3F 1SD2A 3L0BA 3EG9B 4QFCA 1X80A 3ZHXA 3LL4A 2E37A 3OKFA 3FTFA 4BVLA 4FN5A 1R0LA 5IK2A 1PG2A 2O7VA 1G21B 8AT1A 4JENA 4LKOA 4M0KA 4EZEA 1LRKA 4XDZA 1N3LA 2DYKA 3HMKA 4KIJA 2XUQA 4LY3A 5CGZA 3ROXA 721PA 1N5OX 1ZINA 1T4CA 4OD0A 3SQLA 1V8OA 3EGXB 2QBYB 1YOVA 2B1GA 4GZ3A 4CNBA 2CNWD 4NZ9A 3BHIA 4OHZA 5CHEA 5J3JA 5KJCA 1H4VB 1G4AE 3C3WA 2LRHA 5F9FA 5BSUA 5CP8A 3BMNA 3RT7A 4NKRA 2ZBQA 2XB8A 3M8KA 5EQFA 4ESEA 5TLSA 4DR5B 1U2QA 1R6BX 3DHYA 1P91A 1WW8A 4RFSA 1U1EA 2B61A 5FOXA 1L8QA 3IUPA 4LI3X 3WLPA 3G2PA 3RRJA 2HGZA 4QKQA 3HDJA 1HF3A 1QH8B 2BZ1A 4HLQB 1KZ7B 5F4BA 3ZTTA 5HE8A 2AEEA 1JLRA 3U31A 1V26A 5CEFA 2CJYA 1W5TA 3KT8A 2JAPA 5C9ZA 5JLJA 1RHUA 5HDBB 2EZ4A 1M6WA 2FFJA 2J6IA 2VQFB 4HAWA 1L7RA 3L4SO 4PO1A 2VZ0A 3KLBA 4GPAA 2VUIB 8OHMA 4PNPA 2EV9A 5ELMA 1JI3A 2EIXA 4ZCQA 2NQTA 2ECOA 3C6MA 1OIVA 4C3UA 2CCGA 3MCTA 2F8LA 3SWWA 5HHTA 1QPGA 4A10A 4F21A 3U4MA 2GXSA 2K87A 3ILXA 3LLVA 2C9MA 3MBKA 4ZC8A 2DPXA 3E53A 1QAMA 3OCWA 5TY0A 1M5TA 2O2HA 3QIVA 4PYMA 3R0JA 1IB0A 2FVYA 4L5BA 3AYXB 3E22A 1Q1NA 4W63A 4OMDA 3ZWXA 1MJFA 3CW2A 3FJYA 2PUCA 1GGJA 2O0HA 2PWPA 3IURA 5ITSA 4BV8A 1L7QA 2RBEA 4JOSA 4ZTBA 1WIWA 4J3JA 5EKTA 2L18A 3GMTA 3ZVLA 5LOVB 1BYUA 2QHXA 5FHQA 2JFQA 3AUSA 4L2IB 2QT1A 4MUKA 4PX3A 2WWFA 1VSBA 2VAXA 4IFIA 4Z3DA 1VHWA 3DOIA 1YS2X 2CL0X 1PNVA 2C2GA 5JNTA 2AL7A 1RAIA 3TCKA 2FMFA 2HSZA 2XKAA 3A8TA 5LU9A 3EZ9A 5DB4A 2HA5A 4KJXA 1JHRA 2ZRPA 1AB6A 1G5PA 3K1ZA 2WD7B 3AH8A 4WN9A 3M2PA 2Y9MB 3OKCA 3WHIA 4ZDKA 2HMVA 1CZKA 3DMYA 3CWZA 4AYWA 4N7RA 1ULUA 3NW9A 4BBZA 1OA1A 1UFOA 4F91B 4KDCA 1OHHD 3JZFA 4IFTA 4D9CA 1MT3A 3A1SA 1I6MA 1PWYE 5FFNA 3H5VA 1OD6A 4AF7A 5AI0A 5B2ZA 4CMGA 3DB1A 5JDCC 4C7OB 1RHRA 2JA1A 4EJMA 4L5JA 3SJ7A 4DA7A 1PD1A 2DPYA 2P30A 1RQPA 3T1OA 4C2UA 1A77A 3S2EA 3C8UA 3IDQA 3VJKA 1O5OA 1YVEI 2BZGA 2YXPX 3BE5A 5C7LO 3A26A 5L3QA 2EVWX 4BS9A 4Q7KA 4PS0A 1X14A 1SXIA 3RBAA 2KYRA 4Q9IA 4TMXA 3RYFA 2EP8A 4WCFA 4BQIA 4UTZA 3C4JA 1KETA 1N1EA 3IJPA 3V8PA 2ASEA 4C0LA 2DECA 2K7FA 1JIKA 2H65A 4U8GA 2R9VA 4WKPA 5IWCA 3TG8A 3IODA 1Q0TA 3UJ8A 2F90A 4V3CA 2CMDA 4CEHB 5CNKA 5JFOA 4JBXA 3QWHA 2BEVA 3ITNA 1K3FA 1YS7A 5AQ1A 1JEYA 4PIVA 4A8HA 1SBYA 2ZAGA 1J90A 2JIRA 1CP3A 1GNSA 1R10A 4ARVA 3W5SA 2CL7X 3ASVA 4NCJA 4AS3A 4IHKA 1U8XX 4ZPXA 5KS2A 2QTHA 1J7JA 3E8XA 4G0VA 4R05A 1BDBA 4RKEA 2AXNA 2D5AA 1DOHA 2CY0A 3UUFA 2BGTA 1T1JA 5FO0A 4BMSA 2V5AA 1V96A 4YJHA 5KTRA 4A0FA 5CB6A 1CS0B 4M89A 5DCWA 5CM9C 2BONA 2R6DA 2ZSDA 2PMKA 2W93A 4I9UA 3PICA 4P6VF 3K6KA 4ZI2A 5HF6A 3KL2A 1WRBA 2C4HA 3V8EA 1XU9A 4OB7A 5TE9A 2Q4TA 2N47A 5IM4A 1H65A 5F3RA 3QEBZ 1G21E 2FUG1 1GP2A 3GZ4A 3REFA 3KZ1E 1ZJWA 2GUGA 3DE7X 4HB3A 4JJFA 5EUMA 1NMZA 3PEEA 4ZXFA 2NUPB 1F60A 4HNAA 5BW6B 3WMEA 3HBLA 3NRJA 4TS3A 4YRLA 5FKJA 2H3HA 1Z0KA 1AS3A 1RVDA 3NETA 3QYPA 5DYGA 5HZGA 1QHFA 2AN9A 1SVKA 3D6VA 2IYAA 2J9RA 1CD5A 3ERCA 2PLWA 4B85A 5K8CA 3JQGB 4HEA1 4YJ3B 4DYDA 1Q0ZA 4YLEA 3MTQA 4FNOA 2JD2A 3BIXA 1H2FA 3DC7A 3W4IA 1QYIA 4D1YA 2O1WA 4DRXB 2AWNA 5ALDA 2ZB8A 3O9ZA 1Y81A 2R7AA 3F5MA 4PWZA 5CVCA 2P35A 4MIEA 2HCFA 4LZOA 3AUYA 4Q9AA 4FW8A 3MTEA 2MSEB 3R41A 5E4YA 5TNXA 5BVGB 2O8BA 3T54A 3CWCA 4MGHA 2QMOA 4H7PA 1HH4A 3UY4A 2ZJ2A 2QGFA 4OOFA 3R7LA 1U7UA 5DT2A 1NR5A 2A5DA 2IY7A 4RDCA 2ORED 3IXLA 3O26A 4Q1DA 3E70C 1RDFA 3FRHA 3ZIDA 3QY9A 4ZOEA 2WD9A 3E1KA 3GJ8A 3LY5A 1LX7A 1GZ7A 1V25A 3IP5A 3T12A 3TXXA 3JYLA 3K35A 2OBYA 3PIDA 3WMFA 3RUPA 5A02A 5DM4A 3ZV5A 5T6BA 3ZXSA 3FMVA 1JMKC 5TQVA 2NIPA 3LDAA 4I6EA 1ULZA 1Y5NA 2X4DA 3SPXA 5THQA 4L4ZA 2FY8A 3IE1A 2NXJA 3IQFA 5ALYA 5C7YA 2ZRKA 3KZKA 2HRCA 1IZ0A 3EQZA 2W8BB 3ML1A 3LCUA 1MX9A 2Y9PB 2FE1A 3H2HA 1EHYA 5GVSA 2PGAA 2HEIA 4MVJM 4PZLA 2C92A 1LW7A 3M6VA 1TZBA 4K8RB 5SY6A 5CCDA 4EA6A 4C05A 1VGQA 1ZI8A 3WLMA 4I5EA 1DLJA 1KKMA 1VLVA 1Y1RA 3IPXA 4R1SA 4U2GA 3ZY4A 2TRSB 1J70A 3PUHA 3UUGA 4GZMA 3D8SA 4EVQA 1XTQA 1J0EA 3IT3A 4I4NA 2SNIE 1WQ4A 4BLSA 1LVHA 3HKCA 4IIXA 1OGIA 1T2VA 1WMBA 2QL6A 3G1TA 3IUQA 4Q02A 4WOBA 5HCUA 5HJ2A 1PV2A 2EG9A 3UAGA 4IVNA 5CB4A 1WX1A 4X7MA 2GO1A 2HA6A 3BHJA 1H22A 1RQ2A 2NYUA 3LDGA 4PYRA 2QZPA 5LC1A 1GOTA 5TVKA 3SDBA 1A98A 3BBPA 3CEMA 3WS7A 1JQAA 2HA2A 2G8LA 2X76A 2Z08A 5JAHA 3OJXA 3B9BA 2BDEA 2JLYA 2Z5GA 2GRUA 2AQKA 4NR0A 5DMHA 5L3SB 1LSJA 4Q6BA 1YRQA 2WFZA 3LL7A 3EG5A 3K30A 4O2AF 1AKRA 1L7XA 2QZ4A 2ZBGA 3HFJA 5REQA 4DDHA 3DBLB 3QXJA 3AGQA 3ZWOA 4D80A 1L4MA 3ZV3A 4OQXA 5AVYA 5FQOA 3TZBA 3ZDEA 1RZRA 5LB4A 3SSNA 2VTDA 1GFWA 3LPAA 2ZKIA 4LF9B 3L8ZA 1OT3A 4R1TA 1TA9A 2E6KA 3I01A 4N3NA 2OO5C 3HL0A 3TDKA 2X9QA 2PHZA 5JS6A 3WY9A 2ZRHA 3NOVA 5CK4A 1XRMA 3BS4A 4YUZA 3D64A 4C7KA 5JASA 1SN7A 4YEDA 1OXBB 2ZVDA 4WFQA 5IDYA 2C2YA 1W7AA 4PGFA 2HU7A 2IE8A 1WDMA 1YULA 2HWYA 3K20A 4HTFA 3EOBI 4N12A 5E8RA 3WL5A 2SCUA 2FPIA 4YY3B 4G25A 2VHWA 3TBHA 1QUEA 1TEXA 4M1YA 3U17A 2Q5LA 5JS7A 3WL3A 3A1VA 5CA1A 1CS4C 3EEOA 3AY6A 1PR5A 5JBQA 4EGQA 2PBZA 1V16B 4B6JA 1ISPA 1XALA 4HG2A 1JJBA 4DN6A 3S2FA 1E9BA 1F1JA 2PRZA 4MO9A 3VVBA 3QX8A 1FFYA 4BZPA 1E79A 2G6TA 4EATA 2QVXX 3NYQA 3U48A 3UJBA 1W5SA 1OU4A 1SBTA 2J3LA 3DNPA 5GQSA 2BGJA 3TM4A 4BQOA 3WJ7A 4HZUB 3TEMA 3ZW9A 3TIIA 3KSAC 1FRQA 3MFYA 4XQEA 1DJPA 1UPCA 2HM7A 4UKDA 3R6TA 2ZXEA 4ZODA 5K8TA 3TVYA 4FDAA 5JI2E 3K0BA 4TYWA 5AOBA 1TK2A 3B6IA 4ZEVA 2XMSA 1A8PA 2WW8A 1UINA 1WXHA 2ID8A 2CNWA 1MD9A 3HABA 4GBMA 4MCAA 3HEMA 3AY7A 4K0RA 2IV3A 8ABPA 2ZTUA 1JHXA 1B3BA 1PW7A 1RXUA 4R31A 4ARZA 2XR1A 4OBXA 1HE2A 2WU4A 4Q4AA 1UEJA 1PYDA 5JV5A 1J23A 2VO1A 4EOGA 4RHCA 1PT7A 3JYOA 4FGWA 2PN1A 2COUA 3PC8A 4M7PA 4LISA 3ZU3A 2ORVA 3PUVA 2P91A 3RRFA 4BGVA 2X41A 4B3XA 4FFVA 5FTJA 4X1KB 1R7RA 5EXTA 1BXKA 3MCUA 2QVCA 2N1MA 3AILA 3BVPA 2O48X 1IOWA 4L8VA 4UFPA 5IT5A 2B4AA 2MYTA 3K09C 1J20A 1W4RA 3JS5A 3PJEA 1E7MA 2B8JA 3VO1A 4FHFA 2ZB2A 5M34A 5CAEA 4WBNF 2HU5A 5FOQA 3MHPA 4NAHA 2BTEA 2MDTA 3C3YA 1GR1A 4Y9RA 4B5LA 1PFWA 1WKVA 4Z1MA 4QXMA 1UKAA 2HPAA 2CFCA 3WK6A 1NVUQ 4ZTZB 3ZDDA 2REBA 4JX8A 2QVYX 5EHQA 5DYNA 2JD0A 1R6UA 1E98A 4D9NA 4RJTA 5TVGA 3UK1A 3K9GA 4JS0A 3O74A 1E2UA 4CFSA 2D1YA 2F1KA 2WHYA 2X4LA 3F6BX 2I03A 2O3JA 3DYIA 2CVPA 3KPYA 4GT1A 5ABPA 1ENZA 3P94A 4RTNA 1OPXA 1Q44A 2UYYA 1U8EA 2RJ3A 4II3A 4BB5A 4E30A 2I2CA 2YJ6A 4HYEA 2C96A 2ZBRA 4IHJA 1VKJA 5DLYA 4EPYA 3UXHA 4JP5A 3T7DA 4B7XA 1E0DA 1OY1A 3LSTA 2AYZA 4BEVA 4DMGA 1VYHA 4EDFA 3KS9A 4LMAA 4HBZA 2KE5A 3AOGA 1R5JA 3N75A 3OZAA 2B37A 4CIVA 2BSAA 1XGKA 1CVIA 5DGCA 3I5AA 4FE4A 3DL0A 4IICA 3RC7A 2CXPA 2D1TA 2AQ8A 3EXG1 4HL6A 4OA5A 5FTKA 1YDHA 3VR6H 3ELWA 3DLCA 3F71A 4WFKA 1B93A 1T5BA 1PX2A 1Y63A 2JFFA 3OM9A 1BSVA 3AVTA 3ILYA 4LWQA 2J3QA 3O8DA 4FNGA 5HILA 1KDVA 1DQYA 4AP9A 3A9WA 1C14A 4MV3A 4TLBA 4EA8A 4OHXA 4YMUA 4EG3A 4DGQA 4FZVA 3FFWA 2P2LA 2RHWA 3N2GA 1J2TA 3CRMA 4ISCA 1OHHA 3C1UA 1CUZA 5E6SB 5LIRA 1OB2A 4UXHA 1TAGA 4AZVA 1BX0A 1D1QA 3GIDA 3GZJA 3UKJA 1ZOPA 1M2FA 4BO8A 3FOWA 4AKSA 2GTIA 4QXOA 3WAKA 2WPDD 1A7AA 3HSYA 3G2KA 4GOKA 4OL9A 2GSDA 1K6EA 3BN3A 3D8HA 2R1ZA 4QPDA 2E55A 4HH4A 5E95A 5BP7A 3C7DB 4AI6A 3S8EA 1FQOA 1C7ZA 5I5GA 2KHZA 3H1AA 3P2KA 5EUQB 3C4VA 3FVRA 3NBQA 1T3TA 2ZJ5A 1UL1X 3NEAA 2WY2D 4DCMA 4DA6A 5MFPA 1KL7A 2OV4A 2A1UB 1OU0A 3GJYA 3O8QB 4PFKA 4L02A 1VCHA 1P18A 1C1DA 3ON5A 5DYWA 3WWZA 4AN4A 2XAUA 1E3DA 3A9RA 3TWOA 1NC3A 1Z0DA 2HF7A 3QBVA 2GXUA 4WBXC 1JNYA 3EMKA 1JDBC 4KE8A 2CCJA 4E2WA 5ICMA 1CJCA 4U0KA 4W1QA 3AU8A 5B6IA 5LKAA 2GPNA 5BO5A 3FZNA 3OI7A 2QW8A 1L2TA 4UDYX 1DB3A 3W2FA 1J0XO 5H5JA 4FFNA 1RBMA 5FI1B 1BE6A 1X1SA 2B7LA 2QVGA 2X58A 3AM3A 3WK8A 2IGBA 5C1DA 3M2TA 3EBOA 3I2FA 1I3CA 3V00A 4OVKA 2YXEA 1KJ8A 3CZ5A 4JHLA 1TJ5A 1WD7A 2GZHA 2CJWA 2ZSAA 3S1AB 1TKAA 2QLLA 2KS6A 4ZAXA 5EXXA 4CG1A 3IR5A 5KTMA 3UA4A 1P4AA 1YE5A 1E64A 1DAKA 2A5YB 2L0XA 4W7HA 2GLUA 4WNIA 5CX4A 4ZVMA 1JR6A 1XJCA 5HIJA 4KRFA 3FPFA 2H16A 5K05A 1SBIA 3BCSA 2YV2A 2Q5QA 1GTRA 2WV7A 3JPYA 3T4EA 2I9KA 1BO6A 4K6KA 5HBRA 1JGTA 1FP2A 1II0A 1PWXA 3I1IA 2PMEA 3ZWMA 4R6WA 4FS3A 4BGIA 4BQSA 1WVGA 3OA2A 1U3DA 4O4IF 1FSSA 3UFXB 3INGA 1Y8RB 4RD0A 1ST3A 4POOA 3CUKA 1PZNA 2RGNA 4MJ3A 1T9CA 1FJ2A 3ETDA 5HZKA 1G2OA 5JRZA 4ZEOA 4JT9A 1KI6B 1DMSA 1EFVB 2IU4A 3A1WA 1YQEA 4J90A 3CUSA 5A3RA 1D4FA 5HZHA 3QF4A 1Z4LA 2NSJA 2H7YA 3VH2A 5E6UB 4DVGA 2GESA 1H6DA 2Y0PA 3T3MB 1RVV1 1SUIA 2VP6A 3MOGA 4ND8B 4BB9A 5CDGA 2VJDA 4RJKA 5BT9A 2NTEA 4MQEB 3NYIA 2QMUA 3AJ8A 3NKVA 1IQUA 2OYSA 2XCOA 3S27A 3TR6A 3VYRB 2XQVA 4NMLA 3ZZNA 1IK6A 4MULA 2V7XA 5LM3A 3E5RA 4EABA 4FLMA 3TPFA 2CFSA 3BIWA 5HF8A 5EWLB 4DEVA 1UC4B 1V8FA 4B3JA 5A4DA 4N0PA 2BOVA 3RT1A 3LLSA 4BFXA 1TW2A 2CHEA 2XXBA 3IAEA 1PHPA 1GT91 2IC5A 3GLUA 3C7CB 1M0TA 1KEKA 1RLIA 2L69A 2GWHA 2RGYA 5H16A 4E31A 3BB4A 3CT6A 3OG9A 2XMZA 3RS4A 1YFLA 1BDJA 2ZT8A 4IIFA 1CQWA 1URPA 1ZEMA 2CNLA 2AEFA 3M1IA 1TW3A 3OP4A 3WSTA 3TOCA 2PT5A 2BUBA 1PLKA 1VKRA 1WY7A 1Z8NA 4IDBA 4YN3A 3OPQA 4ICIA 4E5UA 4V0OA 1NYLA 1TZMA 3D0QA 3QXGA 1UJMA 3NTXA 4KXFB 1W4ZA 2WA1A 1L7EA 4PAQA 5ALJA 3I53A 4CM1A 1KJ9A 1TYAE 1G17A 2WIKA 3OTIA 5A9SA 4UUPA 3NVKI 2WMOB 2BFAA 4CBVA 4IDGA 4MHOA 3B3JA 3FYSA 3MG9A 2BV3A 2QF7A 521PA 1TMYA 3FWZA 3L1KA 3EFEA 3ZS9A 3FSEA 1G20A 3OMXA 4MR9B 4P2BA 4N8DA 2JANA 3LGSA 3E6AA 2J9GA 1UIMA 3CKKA 1BGWA 1JKJA 2B2NA 4FSHA 2O6LA 4M8SA 4UHHA 1BKYA 2VAPA 2Z58A 4LQDA 3UICA 2HA3A 1HO3A 5CBKA 1KJNA 1P9OA 1TD1A 4Q3LA 3SBXA 4P8RA 3WKCA 4CM8A 5CT6A 3WL8A 4ZFNA 1KQGA 1Z2PX 4OU4A 3L6CA 1ZRSA 4B17A 2HA0A 3G7SA 3CEAA 3VQTA 2PUWA 3TI7A 4DLTA 4U7TB 4CT0A 1L3IA 2RHDA 3EK2A 4YGXB 3LMKA 3EXAA 1W5EA 1GKUB 3RC2A 1QK4A 2JBAB 2O2EA 4TYNA 2QPAA 4ALJA 1WCYA 4ACBA 3KZNA 2BDUA 2WTXA 3WRYA 2IS1A 4DR1B 4KFUA 4NJMB 1K8XB 2HJSA 2Q9CA 4UZFA 4FDTA 2B6HA 1BAPA 2J32A 1RC8A 3AB7A 2VHXA 4ID9A 3AIOA 4WACA 5I4IA 3D6AA 5I8PA 2ODQA 3MAJA 1XKTA 2PWYA 3PWTA 5LDDC 1RAHA 4WJKB 4NCHA 4LYDA 5CYPA 1I4TD 4JNKA 2GKGA 1XN4A 3GDWA 3SS8A 4F3NA 2F1OA 1P7PA 5HP4A 3GYGA 4FN4A 5M3BA 2X6TA 2CC2A 2HUPA 3RJTA 1ISMA 5LYJB 4Z9FA 5DNYB 2CDCA 3KKLA 4HH3C 1A72A 2FUEA 4H3HB 1RFGE 4MNTA 1NUTA 3HJGA 3PGMA 4JKYA 4OX9B 3EXEB 1DCTA 2XJ4A 4P5DA 2ASVA 4UHCA 3IRVA 3GNLA 2YVKA 3JU3A 3NTVA 4L3VA 5E2AA 5FLEX 4EHDA 1PU2A 1PAUA 2J48A 1OGYA 2OSBA 3HYTA 4FFOA 3VPXA 1PJ4A 2I6TA 4UU7A 1NN1A 3P9QA 4DLYA 5H68A 1HURA 1CBUA 4C1BA 2DERA 5JADA 3VNVA 3BMQB 1ISRA 3NC1C 3BMOB 5BV1A 2EOAA 3BDAA 1Q0RA 3OSUA 3SYRA 1N57A 3ICPA 3Q5GA 5AVXA 3CB2A 2D1RA 5IZCC 4GAEA 1PG0A 1KERA 2N1BA 1KI9A 1U2ZA 1VHDA 4HN9A 4MPTA 3EUAA 4XB6B 4DYVA 1S9DA 2HK8A 1G38A 1HDOA 2CLFB 4FYMA 4G1VA 2OFWA 3SSMA 4BQRA 1Z5NA 5JSZA 3DDZX 1VYUA 1NL3A 1RE0A 4TT8A 5AW5A 3JQ6A 2GVDC 4EI9A 1GKIA 3BIFA 4P4GA 3M1LA 2QUJA 2WJWA 1FNSA 1JIIA 4I46A 4IOMA 4MH0R 1NT2A 2VSOA 4G5HA 2VK8A 4QL3A 1XZDA 3QMMA 5A0VA 3B70A 4QREA 4WINA 1MDBA 2QTVA 4QD3A 3GPLA 4BNFA 4HLCA 4MQ5A 4U9HS 1HGXA 1YZYA 3G5TA 1NHGA 2BLNA 3A9SA 2JLQA 3DEHA 1FTGA 2PRIA 3PQFA 1RBQA 3B1JA 4GLBA 2WIFA 4PV7A 2GR9A 4R2MA 2C5FA 4CLHA 3IEMA 1SM4A 2FN8A 3RSQA 2FDCA 1B42A 1VGVA 1V1RB 2PLNA 1B8NA 4H9GA 3QY0A 4R0NA 5AHWA 3GFPA 4E4RA 1OB5A 1VL6A 1QMGA 1VRVA 2PLRA 3OZVA 1DRUA 3GFGA 3KVRA 4PGMA 2G9ZA 2BHLA 3RVPA 1PN3A 3HA3A 1SHKA 5KOHA 2AFHB 3HKEB 3ND5A 3A70A 3SCZA 1UUFA 5TR9A 4M4SA 2AK2A 3ANXA 2BM0A 3W90A 4B0PA 3T3HA 4OBWA 1P5FA 3RU7A 4WEOA 2FP3A 1Q0SA 4ILKA 1T3LA 3MUOA 3I2JA 5EJMA 3IP1A 4J16C 5C8YF 3VPGA 1P0QA 2PIDA 2YMPA 4A0RA 1WAMA 1F8XA 2P3OA 1U0LA 1ATZA 1CZRA 1FVOA 1USGA 2I3AA 2PK3A 3LHFA 3TBFA 4D8XA 5LQCA 3WA7A 1LKZA 1A4IA 2WTEA 1E3EA 2QNBA 2ZDGA 3T5AA 2UAGA 2CBZA 1WR8A 4NFSA 4XEUA 4HDSA 1Q1BA 4KK4A 3A4MA 4DGSA 1VMAA 1Y1TA 2VWHA 3A4VA 2ZB4A 5CB8A 2DLDA 3EGVA 3IT0A 4B9EA 3EEYA 1ZD9A 2LIPA 1CY7A 4E4TA 5MGBA 6Q21A 1RYFA 4DC9A 3O82A 6ABPA 1I7SB 1DWUA 4MRMB 4B82A 3U3RA 4WXMA 1JHZA 5DCLA 4BFZA 2J4DA 1ZXBA 1IN8A 2DTDA 2ZIXA 1R4NB 1JDTA 4MRVA 4ASUA 4PU0A 1ZVVA 2PH3A 4ZHQA 2B83A 3WKDA 4D5GA 1YA8A 2PZKA 1HE5A 4CNQA 4DG9A 4MVJE 3VHLB 2IDKA 5GVRA 1LWOA 3EZGA 1SEVA 3P9SA 3R5HA 5LOVF 1UOPA 5C8VA 3K1AA 3BF8A 1FIUA 3DWIA 3TTWA 4CIBA 1Y7IA 1PJZA 2ADOA 1ZJJA 1L5LA 1OLSB 2O2CA 4G6ZA 2ROQA 2A33A 1UBSB 2JVIA 3OT1A 1EE9A 5FUVA 3JR7A 5D86A 4ZOLB 3ENQA 2QTBA 3AR2A 4D46A 4BX9A 1A04A 1SB9A 4B8WA 3AHJA 3EDRA 1SXJB 4HATA 4MRAA 4QQKA 4E2XA 2V7UA 4AZTA 3DV0B 2VDRB 2WYHA 4M6WA 1XROA 2RHBA 4AC9A 4H6PA 4A92A 1D6MA 4UCXA 1YBMA 3AKDA 2XWJI 2EGGA 2C9BA 3C15C 2DSTA 5AK5A 3TL6A 4QU0A 4CLOB 3F6EX 4TYQA 4ZVQA 3SC2A 2X40A 1M2GA 1OPRA 2X0FA 1L4NA 5KI6A 3KUCA 3WDKA 4ENPA 5IJ0A 4ALMA 4DG5A 3CEHA 3L49A 4IUCS 1E4EB 3T1VA 1PLJA 1T4BA 2PFKA 4ZVNA 3K32A 2OXTA 1B15A 3R7AA 2QMEA 5DBOA 5LQAA 1GL7A 1RWMA 3U7EB 2ZRIA 3Q3HA 3U7QA 3IPCA 1E3JA 1Z0ZA 3WIVA 2IEIA 4JUBA 4P0PB 3EEIA 1ESCA 4M7WA 2PFGA 2OCPA 3R2JA 4HUJA 3IMGA 2P90A 3ND9A 3BMCA 1AB5A 4ZKEA 4D57A 2RKBA 2SBTA 1XU7A 4CVNA 1C7IA 1GILA 1NKTA 2ZJAA 3NNSA 3RWMB 3GDGA 4CKYA 3AF4A 1GTL1 2Q9AA 2H17A 3PC4A 5HX7A 3M81A 1I0ZA 3EZYA 1MENA 2QPTA 5BYBA 3T41A 1XMSA 4KPUA 3UK0A 3FOEC 3MB5A 1O97C 2Q4BA 2AG5A 1JA0A 2J5RA 2ZE5A 4G2NA 4B3CA 1T2AA 2JB9A 1NHWA 1IHDA 4YONB 4GWKA 7REQA 4N7JA 2JGDB 2C07A 4O2BB 3WYGA 1Q21A 3F8WA 2V7TA 2VCHA 3HN6A 2H5LA 3I9OA 5LP6A 1O4WA 3GGJA 2AJTA 4IJKA 2ZJ8A 2WWVD 3A6FA 2QJFA 3HBJA 1XDDA 2FSHA 4NBWA 3VFDA 2BH9A 4GQAA 4DIKA 3M9WA 3KQHA 4NIMA 1XMOB 3SVLA 2A67A 5ER9A 3SAJA 3BHMA 4S35A 4TVBA 2BBWA 1WUYA 1BRMA 3L4BA 3N0VA 4EGAA 5A6SB 3VR5A 3HJNA 4BVFA 3FUCA 2ADFA 4EEXA 4I8DA 1HNNA 1Q7TA 1TUEA 1VMDA 3IA2A 3T7KA 4AECA 1XPJA 1YHZA 1RPTA 1UDWA 3HCFA 4UUAA 1P0PA 1ZVJA 3F5DA 2HF2A 2C3MA 3IE0A 4G26A 1UZMA 3KXIA 3ADDA 3ONFA 3WGZA 3PHBE 4QICA 4TWIA 1QP8A 3VKWA 4IO1A 1X42A 4MUBA 5AXBA 3U1TA 3X1KA 3PYLA 3KJHA 2AFHE 3MMNA 2NTJA 4BATA 1CNMA 4QE3A 2BI4A 3IUEA 1U81A 1FQJA 3SE7A 1ID8A 1R0YA 1VIYA 2VF4X 2ZRGA 2R8RA 2ZR9A 1DEKA 5IC4A 3MIIA 3TMKA 5HTOA 2OILA 4EY7A 3GVXA 1F51E 1BKDR 4FDUA 4YJ3F 4DM3A 4MQ6A 4HWGA 1XCBA 4HEJA 2R2GA 1PJ2A 1W6UA 1OZHA 1U7XA 1WMAA 2Q5HA 4URWR 2X2FA 1AO3A 1ZGBA 3N8IA 4H27A 4YFVA 4Z9BA 1L5KA 3RFTA 3SOPA 2NU8A 4F85A 4YRSA 4HDNB 2JFHA 2CF6A 1H2EA 3HCNA 1RC1A 1XZIA 2P3SA 3GO4A 3LU1A 4AJLA 3AHFA 5ECDA 4V1CB 1YQQA 5ICCA 2V96A 4B40A 1B74A 4FBMA 1W0KD 3K5HA 1V95A 4G4SO 2JIPA 3NHKA 2ESRA 2IHZA 2JH8A 2BSXA 2NXCA 3BJMA 3EHEA 4UM5A 2IK8A 3U39A 5JR3A 3KPJA 3TXYA 1LQTA 2UKDA 1S7GA 2GN8A 3IX7A 3K0AB 2GN9A 5AKLA 4IQ4A 4AUEA 1SCJA 2CVFA 2AQIA 4YYEA 2AWOA 2HSWA 4FZ3A 5FA8A 1HTBA 3P9KA 3CBGA 3VYVA 1XRPA 2R68A 1WF6A 4UUBA 2IYRA 4KO3S 1DC7A 3G9UA 3RTDA 3T52A 3T0FA 3RU2A 1Y3HA 3NJ4A 5EVCA 1M2NA 3CNEA 4CQNA 1ETUA 4J2OA 4O5AA 4RVDA 4LQ4A 5MF6A 5GMOA 1HE1C 2QRZA 5K3CA 3TLEA 4Y9TA 3WXBA 4R01A 3AF3A 1RWOA 4G0NA 1EK6A 2VLBA 3EXFB 4LNHA 2D59A 4RZHA 1GV0A 3KZXA 4JP2A 3EYAA 4XIFA 4XQ9A 4C9BA 3TUZC 4MQBA 3ZY6A 1NPYA 3FGZA 1G9SA 4KN5A 3CJQA 1RI1A 1MLDA 4QTTB 3G2LA 2OYCA 3UPDA 5DNUA 4WLEA 3EFOA 3NORA 4PHFA 4UE6A 4IJ5A 4OK5A 1SXJE 3EZ6A 3U4HA 1V4NA 4PLPA 4DLWA 3JYQA 2DZDA 4G24A 4QNMA 1T25A 2BI7A 2BR4A 3EGCA 4FNMA 1DC8A 4WFJA 3RV3A 4Y3UA 2NUBA 4RLQA 3U3DA 3UC5A 3UKOA 4DJJA 5FOUA 3F7MA 3UHJA 3LWNA 2VDJA 3N5CA 3K0FA 3N28A 4FGSA 3WBKA 3ESDA 3LG2A 1YIOA 1RW4A 2AD5A 2V03A 5B36A 1ZR2A 4LC0A 4QNNA 3W3AD 2CCKA 1TB4A 5KJFA 3X43A 2X0NA 1CRQA 3KSZO 3UWPA 1OLXA 1RKBA 1RAAA 3F49S 1PWHA 1DE0A 3MJCA 4MV6A 3N1UA 1QWSA 3FVTA 3FGOA 1SUAA 1SHTX 4A6PA 1U65A 3RIXA 1GRRA 1OT5A 3PD1A 4MA4A 5IT4A 3PJRA 2QRJA 1J8VA 4BVBA 1G7TA 3CURA 2CSXA 2OZLB 1WHTA 1OC2A 1TAQA 4G97A 3DLHA 1S8FA 1UJ5A 1X1RA 2PUGA 3QVSA 4LF7B 4F45A 4RMHA 4LBWA 4KVGA 1DHRA 4P4SA 2F48A 5T57A 3D3QA 2GM5A 4G67A 4KQGA 3EGDA 4ZQHA 2AH5A 2GEDA 4X71A 3OT4A 1IIBA 2J41A 4UMVA 4E15A 1AE1A 3U7IA 1PT8A 3IDZA 2C3YA 3AOEA 3GL9A 1BS1A 4J0IA 3TS1A 1T6YA 1BOFA 1U80A 1GNLA 3H86A 3ZBUA 5EZYA 4EB0A 2F55A 2QN1A 5JYDA 3QPVA 3GCWA 1XCLA 2FZLA 5A7GA 4EYGA 2E2WA 4RETA 5JIBA 1XBTA 2SICE 1YI8A 1EPUA 3FPCA 4UUOA 2Q7DA 4D3YA 1M6VA 1BHO1 2ZS7A 4INJA 2JKYA 3FNBA 4DQLA 3FIUA 1T29A 2OOSA 2P78A 1RRVA 1H2AS 4G41A 4TVKA 5E9AA 3AF0A 1U6JA 4NDNE 1IBKB 1VOTA 2GEFA 1WBDA 2DEUA 1HYBA 3GMSA 4QHTA 1HDGO 1DC4A 1BD3A 3R1IA 4PE5B 4M7OA 5BSTA 3RUIA 2VXOA 4LAFA 3T35A 3R3WA 5P8WA 3UUWA 4DL9A 5E7IA 4A2WA 4TM7A 3STWA 2WB2A 4M54A 1Y5RA 4LMRA 2HMTA 1LK7A 3E4DA 2DFVA 4MAMA 3UHPA 2C5EA 2DLNA 3H7AA 4MGIR 2CDRA 5EJ4A 2C31A 3TNDA 3UQZA 5AW4A 2PZGA 1AQLA 3ZH2A 3COPA 3P71T 1A1VA 3SP1A 4D45A 5G1PA 2Z1NA 1FNCA 3LZCA 1O9HA 4LXQA 3U80A 5KQMA 5MN4A 5J23A 4CL3A 4BY9E 1MO4A 2D8AA 4GPTA 4UDXX 1A8SA 3LNTA 3KBOA 5DNAA 5A71A 1RIFA 1AF7A 3M1YA 1XL0A 3OY7A 4LZPA 3UV3A 3ZNQA 3PXUA 4BBJA 3AFHA 1FRVA 4MO2A 1QHEA 1YK0A 2XZDA 4HNHA 4UW9A 4WNAA 5F51A 4DMUB 1EX6A 3QTTA 4OI0A 4I5FA 1EVEA 1K97A 3S29A 4IZIA 4NZZA 1EFCA 2R25B 3FWYA 5CFPA 2IU3A 3BTSA 2YS6A 3ETLA 3LDHA 3PUYA 4KN8A 5HRUA 1KVQA 1W19A 3E35A 3DMTA 2V7GA 2PJRA 4RPCA 4YCBA 3GZNB 1G2PA 4G63A 1GKYA 1VJ0A 1WPXA 5DM2A 3IBTA 2IJGX 4KR9A 1W2WB 2DT5A 4HZGA 4BVKA 2ZE7A 2HFKA 3HP4A 2SKCA 4OJQA 1LPMA 3CZQA 2TMYA 1NVWQ 3WNBA 3FPHA 1BIFA 3D8TA 4YH1A 3H8WA 2JJ2D 4W5JA 2ZB7A 2VZ9A 4CCWA 4BB6A 1PS8A 1J06A 1H1LA 5T4BA 1M67A 1E9EA 2AS0A 2PR2A 2QMQA 3UYKA 3VISA 1CV2A 2H5IA 3IIEA 4EF5A 3K9CA 1XDBA 2GB4A 1IY0A 2FA9A 2NU7A 3B8EA 4LC9A 4NI5A 5E6RB 10MHA 1BVUA 1UM9A 3IVAA 4EY5A 4C4XA 1LW6E 2FGJA 4PLTA 3UHOA 1FW6A 2GZ1A 4DSZA 3L18A 3JARA 3IDFA 1DKUA 1U3TA 1Y8QB 4OLHA 3AXTA 5LXTB 4DLVA 2Y0BA 4U0JA 2J59A 3WNQA 5DPMA 2XTZA 5CX1A 1RKUA 4XVQA 1AGRA 1KVRA 4E51A 4CR7A 3PXGA 3Q41A 5KYWA 3LUCA 1A9YA 1NVEA 4P7GA 4JFRA 5TQ0B 1WDTA 3RTAA 4YPOA 3WZLA 1CEEA 5KQGA 2INGX 2QQEA 4RK0A 2IZ7A 3O6VA 2YR0A 1Y3AA 3GBVA 3AINA 4G0XA 1WJGA 2ATEA 4P4UA 3RVOA 3I1YA 1G6Q1 5B3LA 2J3MA 1QGOA 3VVCA 4V0ME 1ZD5A 4E09A 1KC3A 3BRWD 4RF2A 5ALTA 1I3LA 3BSWA 1JLKA 3I9V6 5TMDA 4ZMRA 4YLYA 4IDFA 2QLFA 4G9GA 2O2YA 2WIDA 1U2DA 2HIMA 1POXA 3AQIA 3NT4A 5ALXA 3OTOB 5C4MA 3IR7A 2XUAA 2FUCA 1AVTA 3KOWA 1H8HA 2JAWA 3ABOB 5EKUA 4ZGWA 4BHTA 3HL4A 1XFAA 1F06A 3JQBC 3Q7EA 1VA4A 1FP7A 2OVBA 4ZCRA 1CCWA 5DK4A 4DZRA 4X1IA 5E1BA 4YXWD 1LNQA 4PZUA 4QYMA 1U2SA 3WL6A 3WNZA 4LDQA 2P9YA 4K6GA 3H2IA 5I7EA 1DC3A 4YRQA 3WB1A 4KG7A 2J87A 2Z3WA 4O2RA 1XE3A 4CM7A 3TAXA 4HPXB 1NJ1A 1QDEA 2VRCA 3HNOA 1IOZA 3L92A 2DWPA 3HO8A 1S2NA 4NG4A 2XE6A 4TS4A 1YDMA 3VNUA 1UWLA 4PZPA 4ZQBA 1H94A 1H9AA 4BNJA 1HFWA 3QQPA 3LBHA 1KH2A 3EF1A 2CBXA 3BIOA 4QGBA 1DAHA 4X6YA 1W94A 4NS4A 4QQNA 2FVXA 3CSUA 3EN0A 3FJOA 3GI1A 3TLXA 1Z8DA 1K7FB 6ADHA 1GL9B 3DM5A 1U5AA 1T36B 3BB1A 4JYPA 1Q16A 2V6JA 3DKIA 2V7QD 3VU8A 3O2NA 1S4MA 5K5EA 4XPIA 3RYHA 1QLHA 3DFZA 4J6EA 4CDNA 3OOSA 1C9NA 4COKA 2NP6A 2JAQA 4Q3OA 4NY1A 3CNNA 4R0VA 1VXRA 4XOIA 1WW2A 4KWHA 1YQTA 1ZHFA 3GD5A 1X9IA 4FFDA 3AVUA 3D54D 5D3MA 1UKYA 3CS3A 2V5VA 4WCFC 3AEXA 1BE8A 1BU5A 4QUBA 1NR1A 1U2GC 4RFVA 4F97A 4S12A 3VPFA 3KKNA 3O8OA 4RHEA 2D3WA 4CV1A 3DD5A 2O3RA 4K9DA 4HYTA 2VP5A 2ORIA 3PLNA 3L7NA 4HKTA 2O2SA 4JN6B 4RZ2A 3ZXUB 2A58A 5J2TA 3SS7X 2H1VA 3CR8A 4X62B 4BLTA 3L0DA 2IS4A 2ZJ0A 3ZVMA 4BWFB 1U02A 5CDHA 5HCNA 2HT6A 1K7YA 1EHCA 1ESNA 5MN5A 6CHYA 1V5EA 1QUFA 4I4TB 5A4FS 1SXQA 3PUZA 4NBSA 1WZUA 2XECA 4O4LB 4J0GA 2NO0A 3ZD9A 2ZQ5A 4DCTA 2N0SA 2EKLA 4PCAA 4JDPA 3S28A 2G1PA 3R44A 3QXHA 3SF8B 1TCVA 5FOSA 4OJYA 4CMEC 1E7QA 2VPPA 3ZHYA 3IPLA 3KFVA 2KMLA 4BVJA 3JQRA 1QYVA 1GQSA 3P32A 2W2QA 1HRKA 4OQLA 1SUFA 4AMUA 4BLQA 5CYFA 4CV3A 2EEPA 3C3BA 5DHUA 2NN3C 3FW1A 2IX9A 3CSSA 2DJ5A 4RD1A 3FPBA 4B3GA 1KP2A 1RXSA 1GNQA 2EEZA 1JQKA 2JATA 3KWFA 2QPLA 3PHLA 3V46A 4F06A 1KEEA 3JATA 3T95A 1DAOA 2XEXA 1C4KA 2AYYA 5TMEA 1FYDA 1YZKA 3CXRA 1WU7A 3O2JA 4Z7NB 2ACEA 2WVAA 1D2RA 4F9FA 3BXXA 5D5HA 3BRSA 2G06A 5FUQA 4ZHSA 3AEKB 2J6HA 1KQOA 1CUVA 1FUEA 1YV9A 2LGJA 1UKBA 2XUOA 4JJAA 621PA 3LNCA 5LL6P 4UHEA 2CHUA 5ES4B 3ZJTA 3MGKA 3WTCA 4DA8A 1L4EA 3IHLA 4IQ0A 2HK6A 4Y6QA 3BFPA 5FF9A 1LGYA 1VPTA 3GVIA 4CLEA 3FDFA 3FD8A 3WR5A 2ISSD 4NOJA 3GUUA 2JGFA 3ZU2A 1IVNA 1WMDA 3ZKWA 3DE4X 4BU1A 4DQKA 2W6CX 1A88A 3A3KA 3GVHA 4MVJF 1FMCA 3T7EA 3WWPA 1LDMA 5LQKA 3U40A 5B1SA 3KEGA 2Q3MA 1C0LA 1QP7A 2EWWA 4PPNA 3Q15C 5A5FA 1TPYA 4G3XA 5EFOA 3OJEA 5TT1A 5IH7A 3N8KA 2E6UX 1E3WA 5C1IA 2NU9A 3FPGA 1FDVA 3R5JA 1H2YA 1V8PA 4WLNA 2EX0A 1MR3F 1EXMA 3EXIB 1GNPA 4UBOA 2XCTB 3JQ9A 1SGWA 1IXKA 3HH8A 4GU5A 1I5RA 2E4ZA 4M21A 4TWZA 4AD8A 2I3ZA 1SA0B 3A3NA 5CEJA 1YB4A 1G5TA 1O58A 4G8CA 4OMCA 2NTVA 2ORYA 3OEWA 3AESA 4P0TA 3TLJA 1LBSA 4BE7B 3DAPA 4LTNA 3UQYS 3OMWA 2IYNA 3DZDA 3G88A 2XWPA 2QM7A 2F64A 1MF7A 2VPWA 4JLOA 3LQFA 3KR2A 3K16A 4KVZA 5DMXA 1YS9A 3QVGB 3ZLBA 2C7RA 1E2EA 2EFHB 1NF8A 3BXPA 3ZLJA 2D3TA 3AI1A 3Q3GE 1MJGM 1V37A 2OO3A 3LW7A 4AY3A 1ST2A 4J7UA 4JWTA 5G1OA 2AHOA 3R7DA 1ZHOA 2C77A 3OZTA 1PJRA 5C37A 3D7NA 4BNKA 1DV1A 1XZLA 2O3QA 2OO7A 3W1WA 4DDKA 4DV5B 1QQ5A 3EJ6A 3ASYA 3QUCA 5B1EA 1GUBA 1L4FA 1NJ5A 1IMJA 1WCIA 5ALKA 4N0QA 1J2JA 2DWUA 2MINB 4H6VA 4RIEA 3U5TA 3RADC 2GFIA 1L7VC 4MARA 1SQ0A 3THXB 4JBIA 2L42A 1Z25A 2XMQA 1UDAA 3KXKA 2H4JA 3HLKA 4G5FA 4U5XA 2I99A 3RFVA 1EJ2A 1ONBA 4DXHA 1L7MA 1CY8A 1QWOA 3RSLA 2ZE8A 3LXMA 6PFKA 5FUWA 3E23A 2JGIA 3KB2A 4IIEA 4ZALA 2Y0CA 2VHCA 2QX7A 3DEZA 3E3AA 2NX2A 3BGOS 1GJRA 4F1JA 4IGIA 1Q19A 3B60A 5KYGA 2XMDA 2BCEA 1XYGA 1XDGA 1FJGB 1UIRA 2JCGA 1U7HA 2DU8A 5L9AA 4ITUA 2Q50A 1WLYA 3ZX4A 2PYZA 3SYLA 3H75A 1F5SA 1FUIA 2F9FA 2ZT7A 4Q15A 4Y2SA 2Z83A 4RU1A 1XVLA 4ZZIA 4U7HA 5C3MA 2D0PB 3OFKA 2FZ5A 3PFBA 2V54A 4H1HA 5DGXA 4URXR 2NXWA 3HO1A 3FSRA 4Q1VA 4EW1A 4BLOA 1U2TA 3L0SA 3HJRA 3FFTA 3P2YA 2E7ZA 1U9JA 4F96A 2RBKA 1L7BA 1JQEA 1O4VA 4YP6A 2D62A 1I8TA 4ARSA 4ZIRB 1FX1A 2ZAOA 2RKWA 4UVEA 5TF0A 2CLSA 4IH9A 2BFOA 3D3EA 2QYSA 2XLCA 3Q0IA 1T5LA 3T3IA 1DG9A 2GBLA 1JB1A 4C0QC 2VQSA 2RHGB 3NBXX 2QV0A 3UT5A 2E48A 4ALKA 4BNLA 3OPVA 4N0MA 2JZNA 4ND3A 3VTFA 1JHMA 3ZCXA 3C8ZA 1EVIA 2E5WA 2FDRA 5EIAA 1BCSB 2EW2A 3NMUF 4J9VA 4JC5A 3ZYZA 1UPXA 4LVNA 1XZFA 1JS1X 5IDXA 2HW8A 4ZYXA 2JLXA 2XTMA 5G3ZA 1L5ZA 3DKPA 3RGGA 5IXSA 5KAPA 5CGQB 1Z47A 3TVTA 4C5CA 5K3FB 1ABBA 1DKPA 2UV8A 3ESBA 2QGNA 3LVFO 4K9KA 3SJUA 2OBFA 2CUZA 4R7ZA 4M36A 2JJ2A 1OFUX 3I0NA 3IJRA 5IDVA 1OGJA 3CLRD 3SEZA 4ETMA 2NT4A 2B9EA 4CF6A 1G4HA 1Z2NX 3CTMA 5BMOA 1JF8A 1P44A 3KQWA 3I39X 3CFYA 2ZM5A 1E2BA 3TZ6A 4YCNA 1RKQA 1NDUA 2O0MA 2ZIWB 3IQGX 16PKA 4IRXA 4JEHA 2XOKA 3IDOA 1HDCA 3U3JA 3OQVA 2QI9F 2JIZA 1FXWF 2X13A 3OLYA 5FL3A 1JEQB 1VQ1A 3QH4A 3CLSD 5FNVB 1VE5A 4MPRA 5B1IA 4XFKA 2PRJA 4L95C 2MJLA 2P9CA 4PGAA 4Q9NA 2XAAA 1M7GA 2YS7A 5EYPB 5HMMA 1M2VA 2VN8A 4PO3X 4BC1A 3R7WB 1E9RA 1UQTA 1YJCA 3QVKA 4M7RA 2Q3BA 1JW9B 4PZEA 2QMHA 4QAQA 5EFZA 3VJLA 2CKMA 4TV8F 2WYIA 4DIUA 5H4GA 2FZKA 1T0HB 2NVWA 4AJNA 5BURA 1PNOA 3FMIA 1EWQA 3LT2A 1QNFA 2ZKLA 1NPTO 2ALJA 3OIUA 3BRWA 5EJ8A 1LTHR 3QX7A 4I50A 4RL6A 3GJZA 2QVLA 4LXTA 2IOFK 3T4PA 1C4XA 1E77A 2REXB 4B3FX 1NONA 3LA8A 1BW9B 3L02A 1BU8A 2FX3A 2PEZA 1FB5A 1ZD1A 2DPLA 2W83A 3B36A 3P5SA 4M1TA 1PDVA 5EKSA 3RVKA 2IE0A 3SXJA 5F12A 1WZNA 3NRCA 1PT9A 4LV6A 5NULA 1EE2A 5KNDD 1UJ6A 2YY6A 1KMMA 3PZBA 3V55A 2AZTA 4B8ZA 5KC9A 1OKKA 2B35A 2YZNA 4ME6A 2BTQA 3V4PB 2O5CA 2REOA 4NF2A 3QW4B 4NCIA 3I28A 3U0BA 1UOOA 3K9LA 1A50B 1ZJ4A 2FCRA 1MAAA 2ZWAA 1UBMS 3QHQA 5ALZA 4CM6A 2TMDA 3DDUA 3D4IA 2GAFA 3IAM1 1V1JA 3NHPA 5ALRA 4HDRA 3ZDCA 1EFKA 1HZZA 2XGJA 4WVLA 1K75A 1SKAA 1IIRA 3EZFA 2X7XA 2XDQB 1A9OA 4Z3OA 4KPGA 3E3OA 3HACA 3EASA 2NO7A 4NOLA 2DUNA 5IAEA 1LS6A 5IBQA 4MA5A 3ZPXA 3AGPA 3U44B 2GM4A 4CQMB 1X92A 3QVJA 2V7QA 2CFIA 2X8LA 3G2NA 3WLEA 3P96A 3QZUA 1NP7A 3VR5H 1MW8X 1IN6A 1WEHA 2J07A 1VYTA 3PR3A 4EI8A 1TYZA 3TX6A 3FBTA 4DDWA 3V97A 2JLZA 3ANYB 2R8OA 1N2EA 3I73A 4F38A 4W1PA 2IEBA 3C3EA 3KUKA 3ZHOA 4Z1OA 3D3JA 3WADA 3FNRA 1IY1A 3JSAA 3OETA 4HQLA 1RAFA 3QEMB 4LVUA 1TT7A 5FEMA 4HUQB 2GYWA 1RBZA 3PD0A 4NCNA 5TQJA 1ZCAA 3IT1A 4NDZA 1BN6A 4Q05A 4XDGA 3U09A 4DLLA 5ALWA 4KIUA 5JXGA 2B1QA 1R5OA 3M4YA 4DQUA 1CF2O 2ZTSA 2G5CA 3GUCA 4H0NA 4MX8A 4CKBA 3G5MA 1ORWA 3CU5A 3NHAA 3QLJA 1ZUHA 4PQRA 4DSAA 1TU0A 3TIGA 4R0MA 1TC2A 4MYCA 4UEWA 3U13A 2OA0A 3ZZMA 5CFOA 5FR2A 5I5EA 2FLWA 2E4AA 2QB5A 2C9ZA 4MJ7A 4QWWA 4EQZA 1DINA 5EUBA 4UBJA 4FKBA 2ZUTA 4X7RA 2P2DA 3BGVA 3D6NB 4E03A 4R69A 4YT2A 1P5JA 1VI6A 3R75A 4XUGB 3H3XA 2AN5A 5BRNA 1S89A 1L4YA 1M0WA 2OP1A 1CEXA 3MJFA 3OPMA 4M1OA 4Q9JA 1P60A 3PQ6A 2FNAA 2RJOA 3ROGA 4FMDB 5KUTA 3OM0A 1IUNA 1G60A 2BT4A 3PXXA 3R8XA 2AI1A 2BGKA 3QBEA 4IV5A 3CMMA 4DILA 3EPHA 4L9WA 4RMIA 2QA5A 4UOZA 2O7NA 4D0GA 1ONNA 1TI7A 5FLXA 4XSHA 5KHOC 1T1SA 3HBAA 3HXTA 4OP3A 4UVHA 3W2GA 2JI9A 5KQSA 5C1BA 2I4LA 2O07A 4WLVA 1Q1AA 4CEJB 3P19A 3VVMA 4QXQA 1VPDA 1NVVQ 4ARCA 5FTNA 1ECLA 4HUTA 5D51S 2HCBA 2G67A 3WWEA 3NC0C 1L4HA 3FRIA 1L4LA 2GWRA 4YRDA 1EB8A 1AZTA 2FWNA 2ZRDA 4PC7A 5FD8A 4FTWA 1W5FA 4J1TA 2CLMB 1YRHA 3PVCA 3L0ZA 3WGYA 3SYNA 2L19A 1K4KA 4IQGA 1UANA 4KOEC 2GI4A 1KZ4A 2AMFA 1ZH0A 1V39A 3CIOA 3IIKA 2AJ8A 1UAGA 3HQ4O 5DTMA 1UKVY 2CLIB 4YMTA 5HW0A 4BO9A 4B87A 5BUQA 4A2CA 3DQZA 3EQ9A 1AX9A 2VWPA 2Z8YA 4LNUA 3OPYB 4TN5A 2QTGA 3B78A 3TAHA 1JG2A 3ZWYA 2ZIAA 3PXDA 2XDAA 1LJUA 1Z16A 1SNYA 2PQMA 1COWD 5J1TB 1F8UA 2BJVA 2QLNA 1HFEL 3ZWKA 4WTOA 1BYIA 3NT5A 4WESA 4YRGA 3J81A 1NLYA 1H6BA 3CLVA 4JJ6A 3FTQA 4FE7A 4W6ZA 3VBEA 1JR3D 3WDMA 4BKRA 1Y9DA 3QU4A 4JVSB 1VL8A 2LUOA 2VHTA 1JLLA 3OLZA 3BQ9A 3C3DA 1E9VA 3P0FA 3SMQA 3UZUA 2VNAA 1N6PA 1R4MB 2W98A 3KD3A 4Q7EA 4ZAVA 1XRRA 1ZUNA 4Q4DA 1N6RA 3JAKA 4O4HB 1Y9AA 2ANCA 1HV8A 1O08A 2WTMA 2FG5A 2A0XA 3C5CA 3TOXA 1RI3A 4L8LA 1GFSA 4RZSA 3LBIA 3SC4A 2Q49A 3GGDA 1Z33A 4A1OA 3KTFA 1V0JA 3Q9NA 4L4UA 4YDSA 5LDGA 3NDBB 4ZEXA 3TAUA 1D0SA 3I4LA 4K6HA 4TWBA 2A84A 4ZVPA 1FMFA 2IUTA 4CM4B 1KY5A 5CDSA 3AETB 2DAPA 2O7QA 2PSSA 3ROZA 4J75A 1KI7A 3BBLA 3AVVA 3MTBA 1RADA 5ALQA 4YJGB 2A9PA 2O52A 4K3VA 4XLZA 1ZSNA 3B9QA 4O4JB 4ALNA 1OI4A 3LQ4A 4R2LA 4HNVA 1OAOA 5ED4A 4KXQA 3FHTA 2I6FA 5C5CA 4EHAA 1KWGA 2PUBA 5BN5A 3L9WA 4IF6A 5CU7A 1L1FA 4AM8A 1REQA 2C4VA 5HIAA 2A9OA 4P5PA 4OJMX 3AV3A 5K51A 2CXHA 4HDKA 3P5BA 3PGVA 1IZ7A 2VLIA 4FYVA 4KKXB 1ZEJA 3BDVA 4U7PB 3PF8A 3IMKA 2B4QA 1P2VA 3AVPA 3DVAA 4EAAA 4EKEA 1E92A 1OFHA 3O38A 2HUNA 2UUCB 1MZVA 3PGXA 1KSFX 3EZ7A 2F62A 4RGQA 1XCOA 4KGVA 2NQ2C 2PDAA 4M87A 1JTFA 2X86A 5AMXA 4F3CA 1Z6GA 1YQUA 1W25A 2JGEA 2W0SA 3DT6A 4ZOBA 3S0JA 1GPMA 4IWXA 4C3VA 1SY7A 2LCIA 3M6XA 3VDNB 3OZRA 3BUSA 1GRNA 3IH5A 4QTZA 1DXOA 3H9BA 2PX3A 2N3ZA 4BLUA 1LC0A 3WK7A 4EWLA 3T7CA 1H6CA 4QLOA 3KWMA 3DUFB 2WWGA 1CFZA 1XTIA 2JCVA 3OZUA 4LHSA 3GPCA 2XMRA 3HEAA 4PGHA 4UFNA 3JQAD 4C07A 3FAZA 4BE9A 3M9LA 3OLQA 2ON6A 2Q28A 3ENKA 1WVIA 4G81A 1XT6A 1ENOA 4I81A 4IS2A 5L3RA 3CZRA 4KR7A 4P31A 4I1YA 4QBIA 3UW3A 3RYCA 3UWOA 4NDAA 5EEHA 4WA8A 3BFKA 2FOLA 3SKYA 3WGUA 3GLQA 3ILHA 2DRIA 2HMSA 3LECA 4L51A 2YMLA 4QRHA 5J4LA 3D1LA 5BUCA 4J7XA 3QWAA 5KMGA 5K6AA 5FI0B 1Q83A 4O08A 5IS2A 1AKTA 5DIFA 3DOJA 3T7AA 4MV4A 5B4VA 2CLOB 1WCXA 1SAYA 1GPLA 1FFGA 1T9GR 2VJMB 3QRWA 3MAAC 1NXXA 5HE9A 3II6X 2FPRA 1IN7A 4I1SA 4GLOA 4P2GA 1K3TA 3ZI4A 1OXVA 4ESHA 2IXAA 2W90A 4MA0A 1OAKA 2QTRA 3OZDA 5F5NA 3HZZA 4D0SA 2XE8A 3QKWA 4RANA 2XXAA 4LQCA 2Y1WA 3OFSA 1UDBA 1AA9A 3QA3E 4AUMA 4CFZA 2WYOA 2PLAA 3M7IA 5B58T 4G0MA 4EG0A 4LYJA 4G5RA 1JBQA 4M9QA 1TTPB 3F6RA 5DX8A 3O8CA 1BOOA 2VDWA 3GAMA 4ZVSA 2QNRA 4RH1A 2N42A 3X44A 1D0VA 3ES9A 1Y34E 1YJAA 5HM6A 1WKCA 4GR5A 2JCSA 4L16A 3W05A 5IAOA 1XCPA 5FA6A 1TM1E 4QDTA 5BQOA 1Q11A 5P21A 3I6YA 2IBSA 2JD1A 2BFCB 1EUDB 1XJQA 3T7RA 3ESQA 2JFYA 1A7UA 4FINA 3DPSA 3PA6A 2B78A 4NWIA 2JIQA 3UH1A 1J5EB 3FROA 4EPXA 3VDQA 4G56A 5LR6A 5IM4F 1QTIA 2VSXA 4M0UA 1E2QA 1WU8A 4YYZA 4XVRA 3OOWA 4NL4H 3LSYA 1Y4AE 3B1XA 1Y4UA 2CVQA 3Q7RA 4IIJF 3RSGA 2QAGC 4NABA 4A0QA 1I2MA 3KV3O 3WYDA 3HNPA 1RPJA 1QR6A 1R4ZA 3CKMA 3G0CA 5DH9A 4DY4A 3RI3A 4AJJA 1GNVA 4MQ4A 5FV4A 5K99A 1TMOA 4IM7A 1UBOS 4OQFA 2GCGA 5DHRA 2D5LA 1OBVA 1U31A 1CUIA 1QBKC 3DYBA 3NHSA 4R8MA 4Q18A 2C8VA 3HFSA 4O2AA 1KYWA 2F3PA 3DE6X 1GLNA 3JZAA 4MDYA 1H1DA 3TNJA 1RHJA 3L7JA 2CL5A 3ZCTA 3NHFA 4OO3A 2P5UA 3KQPA 1Q2UA 2XF8A 4NESA 4CKCA 3IOBA 1SVOA 2Y0EA 5KC8A 3PYMA 3DDCA 3ZHZA 5G4KB 5IX8A 2IWRA 5JDIC 3MRTA 1RQNA 4YCJA 4YWJA 3SS9X 3ZK8A 4BN0A 3LFTA 1QZUA 1HQDA 3KUUA 5U4XA 5KNDA 3ZIAA 3SJBA 4EHHA 3DCYA 1TDJA 1H69A 2ZVJA 1D9ZA 5IW8A 4RLFA 4B7CA 1R12A 4F7WA 1CXZA 3KDAA 4LOKA 5F21A 5AIBA 4EDHA 3SYKA 3QE2A 2H7XA 4D5EA 3FBWA 3JD2A 4YP7A 3TK1A 1V1MB 3NHLA 1L7AA 4IF4A 4Y2GA 4TMZA 5B5SA 2XE7A 1BXZA 3T5BA 2DETA 4YIHA 3ZXYA 4AKHA 4IBOA 2SKEA 3GLGB 2P6RA 1UFVA 1Z6TA 1VI5A 5HOEA 5DBGA 5AW0A 5EA2A 5CXQA 4EJSA 5F78A 4D7AA 4EYKA 4JSTA 1UXKA 2N75A 1WNTA 2FF5A 3KNZA 4NPHA 4TQAA 2QTLA 3IQWA 3LQ1A 1PI3A 1RRPA 3OC0A 3R3HA 5JNLA 3COYA 3ODPA 4Z4IA 3YASA 2RGWA 3PQCA 4Q01A 3INRA 5TC4A 3ZWWA 2GPJA 1CR0A 2JHPA 3GEEA 4AMZA 5JQGB 1E61A 2R11A 1L5GB 1I1OA 1LSSA 2QDXA 4JLNA 3RARA 4YP0A 4LFCB 3QJ5A 5CITA 3E18A 3IVCA 1Y98A 3C8DA 3EGIA 4K46A 2FN4A 1CR4A 3ZCSA 4EGJA 8ADHA 1SVNA 1KO1A 3UA3A 3W8DA 1X7XA 5FPKA 1JRLA 1E3MA 2WHPA 5AI6A 1FEZA 4EZBA 2BMEA 1KYZA 5AK6A 1QSGA 5CDTA 4OKNA 4X8OA 1ZGAA 1E5VA 1JA9A 2PCLA 3CX7A 2BGNA 4UTRA 5J4HA 5HKKA 1JDBB 2V45A 4IDCA 4LNAA 1I32A 4TL8A 4TZKA 1DFHA 4NATA 4PYIA 1KDRA 3HRKA 3H17A 3NBUA 1J8MF 4RLHA 4KHZA 1FVFA 1PK9A 2WKSA 4EUKA 2RHLA 1J24A 3OO1A 4GD3Q 3B53X 4IXMA 4NV1A 1FSFA 2OGZA 3HVHA 4LGCA 3QFFA 5EE3A 5THKA 5T67A 4TVOA 3MTJA 4G0QA 2ZUBA 3MWLA 2C2BA 3GFBA 4LX8A 2VK2A 4TKUB 4QZVA 3RBXA 4MHSA 2ZPTX 4XVHA 3ZDXB 4TKVA 3FY4A 3TW6A 1R8SA 4RGVA 4WBNA 2WJPA 4HN4B 2G76A 4UM9B 4IILA 4XGIA 1Z8HA 5I8ZA 2XUZA 1T2NA 4RJJA 1XVTA 4BLPA 4E3ZA 2X0EA 1XZMA 3TW8A 1IATA 2PU5A 1XRNA 2R3SA 2C2MA 3C39A 3HFGA 3FSJX 1ENYA 3LI2A 4BE4A 1O96A 1ZOLA 1E1DA 1FL9A 1N7JA 1Y7PA 3OTHA 4PZ0A 3PU6A 2BEWB 3LPMA 4FC6A 1AHIA 1BFUA 1FE8A 5KWJA 5B1HA 1OH6A 1RCTE 2XADA 4MMXB 4P7BA 2CV2A 2GM3A 4I4TF 4TTSA 3HBNA 4Z86A 3UMGA 1BXGB 2CLEB 2GNOA 2W42A 3E84A 4O4LF 4RZXA 3LUGA 1DZ3A 5JCXA 5M04A 1AQUA 2G82A 2P65A 4QJBA 3PLAE 3O31A 4HTAA 4I3FA 3W4KA 2FV8A 1GEEA 4L4XA 3VI4B 1R9GA 1Y42X 1QQ6A 1WXXA 2CDAA 4CIAA 5U9CA 1TTTA 1TFRA 1ZXXA 2V3WA 4YPVA 2OQIA 1HE8B 1MGPA 2VXCA 1DEXA 4IYRA 4RPLA 5J63A 5I9TA 2OVFA 2YHBA 4WK6A 3C6YA 4A2QA 1J49A 2FUNB 3I4FA 4N0DA 5AJZA 2UZ1B 2CUKA 1EQ2A 1L7OA 2VWQA 3T9FA 3UEOA 1SHZA 1XXHB 2HZBA 5KPDA 1BKSB 2Q3FA 4H08A 1C8KA 1JR3A 3EDQA 3UB3A 1RI5A 2X3UA 3P4UA 1E9FA 3G0BA 2VP3A 4RESA 2P8JA 3KALA 3LT1A 2NTNA 2FWIA 5EMLA 1MH9A 4MVXA 3HR7A 1QG0A 4XIIA 2HSDA 2P9TA 4D42A 2ZAMA 4NZYA 5LD2C 4O6VA 1ECJA 3M6UA 2RJNA 4EY6A 1ZA1A 2I2FA 4D8WA 1HZJA 1ZRHA 1DO0A 3HB1A 2ZSFA 1MO5A 2BMDA 3I72A 3OOHA 4QYXA 5JMPA 2NUAA 2MMCA 2XWSA 3LLCA 4IRUB 5F76A 4CV0A 3WNDA 1ZOSA 5HPYB 1TQ8A 3HZHA 1JFLA 4RHYA 1I01A 1PTJC 4KNWA 1XKLA 2YWEA 2WZCA 5HVNA 2PX5A 3VDRA 2GHIA 4HCJA 4LYFA 1BX3A 4ARAA 1DQZA 5KVQA 3BA6A 3GGGA 3C0KA 1UC9A 3JQ8B 4FDMA 3VHQA 1PK8A 5D6OA 1BHSA 4BNDB 4F4IA 2FPMA 3RG8A 4YUWA 5SZIA 1TQHA 5M7EA 4YQFA 3EMBA 4DUPA 3UJNA 3SZMA 2ENUA 3UJAA 1FFHA 3GLGE 2WTNA 3TLAA 2F43A 4LJ7A 5D1HA 4KRXA 3CRNA 4LHWA 4LZNA 3NS7A 1JLHA 2QN8A 1IM8A 4AY2A 2G4VA 2YWRA 3KEMA 5TS2A 4CQLB 4X5OA 1FTSA 1YCHA 1ZGZA 3LBYA 3U3MA 5C34B 1LLQA 4F2PA 2XDYA 4U8HA 4DDMA 4X63A 1LRLA 4X95A 2R6CA 4F72A 5JAPA 5T64A 3NWJA 3AI2A 2Q1TA