2N47A

Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
197
structure length
197
Chain Sequence
MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Structural genomics, unknown function
total genus 47
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2n47A00
4V0QA 1AQJA 4GOLD 3CJTA 5T67A 3FRIA 4RYLA 3FPFA 3T0IA 5BP7A 3KR0A 5K0EA 2PLWA 4E70A 2FCAA 3LDUA 4QPNA 1KR5A 2AVDA 1FBNA 4RVDA 1WXXA 1WG8A 3GWZA 1YF3A 1RJGA 3KPWA 3P9IA 3NJRA 4BLUA 1JTEA 4C08A 2FK7A 4PYLA 4DF3A 1FP2A 3NDIA 3E8SA 2NP6A 4GF5A 4HGYA 2VS1A 5EMLA 4EKGA 3MERA 1XJ5A 4QDJA 3BWCA 3KKZA 1PJZA 1JQDA 4RTMA 2B3TA 3EEYA 2BR5A 5K05A 3ER8A 2JHCA 3LHDA 3VYWA 3JWJA 2IH5A 3PX2A 5K0CA 3DLIA 4E2YA 2IIPA 3EVCA 2FK8A 3M70A 3LX6A 3KHKA 3HNRA 1VP3A 1NW5A 3G5TA 3C6MA 1NE2A 4MQ4A 2XYQA 1X19A 2AZTA 3PLAE 3H2BA 4PYIA 3HCDA 5T6BA 4PYMA 3EVDA 2AOTB 5B1SA 3CGGA 4F84A 2ZULA 4HH4A 1R8XA 1SQFA 4OBWA 4P7KA 4ATNA 3EVEA 5EMJA 4HTFB 3REOA 1IM8A 1XCLA 4HRAA 2HV9A 4F86A 4RTSA 1P39A 3O7WA 5DRTA 3BXOA 4ER3A 2FHPA 4ER0A 3E7PA 2WK1A 3EVAA 5DTMA 2OB2A 1P1CA 2ZIFA 5E1OA 3M6WA 4M7RA 5EKXA 5K03A 3LDFA 3I53A 4NECA 2YQZA 4EKIA 1VLMA 2B25A 3KQVA 3M6VA 4RX1A 2YTZA 4QTUB 4XUCA 3P2EA 5DPMA 4AZVA 2R3SA 4K6MA 2OYRA 2XBMA 1ZG3A 1SVUA 2P3LA 1RJEA 2YR0A 4PINA 5K0LA 5FUBA 4PIPA 2CL5A 1KYWA 3G2MA 3GRUA 3G8BA 3TOSA 4PYJA 5DX1A 3B89A 3G2QA 3UA4A 3TFWA 3FPHA 2ZZMA 5M5BA 2PGXA 1D2HA 1UFKA 2H00A 3O4FA 1QYRA 3QOXA 3OE4A 1M6EX 2CMHA 3OE5A 4YMGA 2JHAA 3DR5A 2ZZNA 4E30A 3JWIA 2PWPA 5E8JA 2O05A 1I9GA 2IFTA 3BWBA 3MTIA 4M37A 4YUVA 4EK9A 2A14A 1X1CA 2CMGA 2IDKA 4R8RA 2BZGA 3DMFA 3ER9A 2Z6AA 4RV9A 3BGVA 1HNNA 2YVLA 2YXEA 3FUTA 2P7IA 5CIYA 4Z2YA 5CVDA 4GBED 3V8VA 4HGZA 3VC2A 5DM1A 1ORHA 3A25A 3GIWA 3KR2A 3EGVA 3UJ6A 4G56A 5DWQA 3KR9A 3OFKA 1X1DA 3M33A 1G60A 2OY0A 3C6KA 3LBYA 4RWZA 4YV2A 1TW2A 2G71A 3LPMA 3AXSA 5FULA 4XUEA 3NVKI 3UBTA 2P40A 3UA3A 3VSEA 1N7JA 5K0GA 5DTRA 2QRVB 2AOXA 5FHRA 3TMAA 3M6XA 1IY9A 2BM9A 2UYOA 4HSGA 1EQAA 4YV0A 5LQKA 2PX5A 2HMYB 4PYQA 2QYOA 3UJBA 5LQCA 3LL7A 4QDKA 5ICCA 4LWOA 5HIJA 2CKDA 3ELDA 2ZFUA 2ZSUA 1Q0TA 4KIFA 3A27A 2B2CA 3TQSA 5K01A 5BW4A 3RIEA 3NW9A 3G2PA 4AZTA 4R05A 5D1NA 2NXCA 3EMBA 5HFJA 1QAMA 1N7IA 2ZBQA 3TKYA 1RJDA 2DPMA 2O06A 3HVHA 3MTEA 4FSDA 3ANXA 3LCCA 1JSXA 1NW6A 3PFHA 1VIDA 4YMHA 3MCTA 2ZTHA 4CTJA 3ID6C 1BHJA 3LBFA 3A7DA 1HMYA 5IH3A 4B17A 4DMGA 3OCJA 3DH0A 3B7PA 4AX8A 3LGAA 4P7GA 2Z6QA 2GH1A 3GCZA 3PS9A 5FA5A 2XVMA 3P2KA 1O9HA 4OA5A 2V7EA 3P9NA 1WXWA 4GC9A 4QTTB 5DSTA 5FHQA 2UZ4A 2ADMA 5E9QA 4V0RA 7MHTA 1EJ0A 4RTLA 2UYHA 4FZVA 1VL5A 3A4TA 3MAGA 4RSRA 5ICGA 5EIWA 4AZWA 5DXAA 2H11A 2PXXA 5GM1A 1QAOA 3JWGA 5EKUA 5C0OE 3RODA 3TM4A 1RI2A 1XDZA 3OZRA 3TM5A 3HTXA 3GGDA 3ELYA 3G2OA 2P3QA 4QVKA 1KYZA 1VP9A 3DLCA 3DXYA 3QOWA 3KQYA 2P8JA 2PY6A 5D1HA 3TPZA 1G6Q1 5EZSA 3M6UA 2NXNA 2LD4A 4FR0A 2GPYA 3C0KA 3OU7A 1BOOA 2FYTA 3E05A 1F3LA 2IPXA 3B3FA 4PCAA 5U4XA 1SG9A 2XYVA 2YXLA 3MGGA 3G89A 5H02A 1BC5A 3BGDA 1SUSA 4KDCA 3FUWA 4KVZA 4CWAA 3UJ9A 3CJRA 3WSTA 4RTNA 5HIMA 5FCDA 2PWYA 3BWYA 5EEGA 3RW9A 5K0FA 1ZGJA 2O07A 3UJCA 4Y2HA 4X60A 2JHPA 2AOWA 1YUBA 4POOA 3JWHA 3ORHA 1JG2A 2WA2A 1NW8A 4YUXA 2QM3A 3CKKA 4P7JA 2ERCA 3BKXA 5LSAA 2ORED 4OX9Y 4R6XA 4DA4A 3IYLW 1VPTA 3FTCA 2HNKA 3EVFA 4KWCA 1DUSA 4RVGA 2WA1A 4OQDA 3FUXA 5E8RA 5KVAA 1EG2A 1DCTA 4U7PB 2GB4A 3FTEA 3M4XA 1O9GA 5LQNA 3R9XB 5FTWA 4L7VA 3I58A 3UJ8A 5FQOA 4E31A 4PCLA 2G1PA 5C1IA 3BGIA 1UWVA 5DXJA 5DLYA 5F2OA 5ICEA 2DULA 3NDJA 2ZWVA 4KIGA 4RTPA 2VP3A 3OFJA 2NNWB 3IV6A 3K6RA 5HEKA 4E32A 3LECA 3HCCA 4DQ0A 2PSSA 2AN5A 2YXDA 5E1BA 5EHGA 2B9EA 3FTFA 3G8AA 2ZZKA 3AJDA 4QPPA 4EVIA 2ZIGA 2NP7A 2AR0A 4HC4A 1NV8A 1RI1A 3HVIA 2IH2A 3FPGA 4MWZA 1KXZA 3KQSA 2BH2A 2JH8A 4A6EA 2I6GA 2K4MA 3R0QA 4PNEA 1KHHA 1H1DA 3LCUA 4DM3A 5HOQA 3NVMB 3R24A 4GOMD 3GO4A 2Q41A 5MHTA 4PWYA 3HM2A 2Y1WA 2JH9A 3F4KA 3ELUA 4MTLA 3SSNA 2V74B 3FPEA 1L3CA 3EMDA 5P8WA 5JR3A 1Q0SA 5CCXA 4PGGA 2I62A 4ER5A 3A7EA 4FP9A 3LCVB 3NWEA 3NTVA 1INLA 2XVAA 5DX0A 3FYCA 2IP2A 3KU1A 5EGSA 3EVZA 3U81A 3V97A 3E23A 3HCFA 5K0BA 2PT6A 1FP1D 1N2XA 1V39A 1ZHFA 5KS2A 4DCGA 3AXTA 5LQUA 4DKJA 1M0EA 4MIKA 2AOUA 2EG5A 5CUQA 3I9FA 2YX1A 4C4AA 5EHIA 3THSA 2I7CA 1L3BA 1EIZA 4RTQA 1XDUA 1WY7A 3DULA 3P71T 4XUDA 3T7SA 5GOZA 2VDVE 2E5WA 3DP7A 3SVZA 2ONYA 4ISCA 5EC8A 5F2KA 1ZGAA 5KYGA 5DM4A 3KQTA 1R6AA 2FRXA 3MCZA 3GNLA 2F8LA 3HVKA 4KW7A 3HVJA 1JSZA 3KPJA 3FRHA 1D2GA 4CXMA 3SX0A 4EQZA 2CWWA 10MHA 3BWMA 4FS8A 2YUIA 2ZW9A 2IH4A 2P41A 3UJ7A 3CCFA 1O54A 8MHTA 3Q7EA 4OA8A 1BKYA 1KP9A 1JQEA 3OZSA 2PX8A 5EPEA 5EQJB 1M6YA 1NBIA 2P1DA 5EVJA 5CD1A 1ZQ9A 1JTFA 5C9ZA 2PT9A 3Q87B 4QQNA 3ERCA 2C7OA 2AVNA 3DUWA 1G38A 5EIFA 5DM0A 3FPJA 2OZVA 4PGHA 1SQGA 4C05A 4ER7A 3PTAA 3EEOA 3FUUA 3TLJA 3EVBA 4GEKA 4JXJA 1JG1A 3TR6A 5KQRA 2OXTA 3P9CA 2ESRA 2OPBA 1XDSA 1DL5A 2AN3A 2O0LA 1YZHA 2PV0A 1UIRA 3B3JA 3HCAA 2P3OA 3KPVA 5E9WA 5GP1A 2Y1XA 1X1AA 2BM8A 2ZVJA 2NXJA 5HIKA 4WVLA 2IBTA 2KW5A 4HG2A 1RI3A 4GOOD 5GIPE 3DTNA 3KR1A 2ZWAA 5E9JA 1R74A 3PFGA 2C7RA 4BLWA 4YUZA 5IKMA 4MHTA 2AN4A 1RI5A 4LG1A 4PYNA 3SSMA 3UZUA 5K0JA 2HR1A 5G02A 3SGLA 2GAFA 1KPIA 4EMSA 4BLVA 2QE6A 2ZBPA 3DXZA 4KDRA 4O29A 4OQEA 2H1RA 4PIMA 5DTQA 3HA7A 4RVHA 4OBXA 3MHTA 2G8NA 2ZBRA 1KPGA 4BY9E 2O57A 4CKBA 4PYKA 4X41A 5DM2A 5DT2A 3S68A 1SUIA 2PBFA 3GRYA 5HILA 3SSOA 1R8YA 5LQRA 5E2AA 1G55A 4CTKA 1YFJA 3LDGA 2PJDA 5LR6A 5BXYA 1R00A 4CKCA 3LKDA 2AOTA 2HTEA 1Y8CA 3GDHA 3OZTA 2JJQA 3PX3A 1I4WA 3THRA 2PXCA 3CJQA 1NKVA 1Z3CA 2IDJA 2ZIEA 3FZGA 3QV2A 2NXEA 4HTFA 4RTRA 3SM3A 3HCBA 1FPQA 3SXJA 4ER6A 1SKMA 4R6WA 5EG5A 1ZKDA 3KQWA 3P2IA 4R8SA 1NBHA 3IEIA 5CVUA 5FWAA 3G88A 1MHTA 3CBGA 1R18A 2G70A 3BUSA 1NT2A 1VE3A 1KIAA 3CVOA 2GA9A 2BR4A 1B42A 1AF7A 4X63A 3UFBA 3HA5A 1ORIA 1JG4A 3UJDA 3KPYA 1L1EA 1P91A 2C7QA 1YB2A 4RVFA 1MJFA 3GRRA 3AWIA 5FWDA 2Z6UA 3MB5A 4FT4A 1YZ3A 5CVVA 1QANA 1VQ1A 2EJTA 5E1MA 5HIIA 3HA3A 3R6TA 3C3YA 4BP1A 3KQMA 4BP3A 2EX4A 4CKEA 3EVGA 3FYDA 3HP7A 4XCXA 4E33A 4YV1A 3I5UA 2BR3A 5F2NA 2ZCJA 4E2XA 3GRVA 1G8SA 5FQNA 5BW5A 2B78A 2PKWA 5DX8A 5T64A 4WXHA 3UWPA 1XVAA 3C3PA 1WZNA 4IV0A 4IWNA 4PONA 4GOND 4P58A 5EOVA 5GIOE 4H0NA 5E2BA 3AY0A 4GQBA 5DRYA 1G8AA 2ONZA 3A26A 5ERGB 5CCBA 1TW3A 3P8ZA 4KRGA 1YFLA 3NMUF 2UYQA 3B3GA 4FSXA 3GRZA 1KPHA 2HWKA 3EGEA 5LQJA 3UJAA 2C7PA 3KQOA 4Y30A 1NW7A 5KQSA 5FA8A 3T7RA 4M36A 4RTJA 2OKCA 5GINE 1EJ6A 1JR4A 1PRYA 1QAQA 3K0BA 3R3HA 5GM2A 5K0NA 4F85A 2ZLBA 2PVCA 4DZRA 3PT9A 5JUWA 4LWPA 2QRVA 1L3IA 3LKZA 2VZ9A 2EJUA 2AOVA 2FPOA 2PXAA 3X0DA 5EMKA 5CVEA 1IXKA 1AV6A 3OPNA 2VDWA 1NW3A 3G5LA 5K8VA 4RTOA 2N47A 3PVCA 2OBFA 1AQIA 3B5IA 3DMGA 3KPUA 1XXLA 3OU6A 2P7HA 5E1DA 4C07A 4YUYA 9MHTA 3CC8A 1D2CA 4C04A 5K09A 1P1BA 3GXOA 1X1BA 3FUVA 2OO3A 3BZBA 1TPYA 1XCJA 1RJFA 3LSTA 4GUAA 4FT2A 4GC5A 4QVGA 3TRKA 4YUWA 4FGZA 5CM2Z 4AZSA 4DCMA 3SMQA 1QZZA 5DSXA 4P7FA 4AUKA 1XTPA 3TKAA 2AS0A 2AOUB 2JG3A 5CVJA 4IV8A 4UOEA 3NWBA 1U2ZA 3DXXA 2GS9A 5EZQA 3ME5A 5HZMA 1FJXA 3MQ2A 3GU3A 2VDUE 4X1OA 4A6DA 2NYUA 3P9KA 4QQKA 4PYOA 4U7TB 3O31A 1VBFA 2PX4A 2QY6A 3EPPA 2IBSA 3EGIA 3T7TA 5EEHA 3ELWA 3I64A 1JG3A 1I1NA 4X61A 2G72A 2P35A 2GLUA 3G7UA 3OU2A 4M38A 3VC1A 1F38A 2XYRA 2UYCA 1EAMA 3D2LA 3SR4A 1RI4A 3KQPA 3GJYA 5FADA 5LQAA 1WS6A 3HCEA 2IGTA 4E2WA 3DMHA 1L9KA 3DOUA 4E2ZA 1OR8A 5ICFA 1T43A 4C06A 3P97A 3HEMA 3PB3A 2R6ZA 3KQQA 2EFJA 3L8DA 3IHTA 3BT7A 4C03A 4LECA 5GWXA 1JQ3A 4ZTBA 4RTKA 2I9KA 2OB1A 5EMMA 4IKPA 3BKWA 3FTDA 2PX2A 1NV9A
chains in the Genus database with same CATH superfamily
1R16A 3B8EA 3OJEA 1GUYA 5GQSA 1OWMA 3OZ7A 4GOLD 1H85A 2PZAA 4NCIA 4RHTA 3DHEA 2ZT5A 5DCUA 2QSUA 4L4XA 3I6YA 3THYB 2IHJA 1J2YA 4LX8A 2AZXA 2VNAA 4XFKA 2FPIA 2YWJA 3KS9A 4Q5IA 4D0RA 3H97A 5HF6A 1ADYA 4JI5B 3KOOA 3QHPA 4HGYA 1XLTC 2F9MA 3G9ZA 3ON5A 5EMLA 5FOTA 4ZQFA 2XE6A 4C1NA 1Z73A 3E18A 3ROPA 4BBAA 3B1KA 1H5NA 1W6UA 1JQDA 4KPUA 3DLAA 4W5OA 3RS4A 1H3EA 3SFVA 5LYJF 2G88A 3DZDA 4YJFA 2Z8YM 4FOOA 3OCXA 3DLIA 3R5SA 1CZKA 3UXYA 5DI9A 3HNRA 1VP3A 1RJ9A 3JYLA 4IOJA 4PE5B 1LPSA 3VOSA 3AP3A 1T3GA 2OV6A 4FDTA 4GKJB 1U5AA 2Z8XA 5TR9A 4K9NA 1B26A 3W05A 3ZLBA 4CQLB 2J6BA 2E5FA 3QVVA 4YT4A 5U4QA 3F9RA 4JROA 1V0JA 4JT9A 3AHDA 2Q1YA 1GL3A 3H5VA 3ZI0A 4DY4A 1JQKA 4I5DA 1SJ9A 1SVMA 1I3LA 1J8QA 4J43A 1C1XA 4O08A 3REQB 2WW8A 2G5CA 2GEUA 3JQFC 4HZIA 3U48A 3NETA 4UBJA 2JAPA 1D5CA 1J9ZA 4LC9A 4PFSA 4EKIA 4YCMA 4LJAA 1PYGA 1FMTA 1GAEO 2O1SA 3Q1KA 1CLUA 1V95A 4XUCA 3AC0A 2OPHA 2Y0CA 2ZYWX 1X9GA 1XPJA 1L4KA 4MA4A 2WJ6A 4LIPD 1ZWKA 3HWX1 3OUUA 4HQ0A 2QSJA 2CZQA 1RJWA 2GD1O 3NPMA 1ULHA 4JITA 3IEXA 4HAVA 3DCJA 1V6CA 3PPWA 1E5TA 2A5GA 1NYTA 1NNLA 3FPHA 2PGXA 5KU7A 4L6AA 2H00A 3O4FA 1M1YA 3OMWA 3QRWA 3ZWKA 3FNBA 1A9ZA 2CMHA 3E35A 4YMGA 3WA6A 2VNHA 3GRAA 3VISA 1OU0A 2J5KA 1B74A 3D8TA 2AZMA 3MTIA 4EYKA 1D09A 2EYUA 1PV4A 1B2RA 4WX2B 2CXRA 1E94E 1R10A 1RLTA 5TEWA 5LJLA 4AQ7A 1GSOA 3CM0A 1GM5A 1QX4A 4ZU6X 1AQUA 2D5AA 3VDQA 3FGNA 5TQ0A 5TQ2A 1Z8DA 4ZO7A 1U2TA 5A4FS 1W59A 3O5AA 5E3JA 3W2EA 1JFSA 1LW7A 2VHWA 1WPXA 2VRNA 3HZOA 1P1RA 2NU9A 3KVNA 4MKFA 3C4QA 4C4OA 1XNRB 1XFDA 2WG1A 2IYTA 4PSVA 2XNCA 3LPDA 3D6FA 3NNNA 3L0CA 4RE5A 3LRTA 4H17A 5ESRA 3LPMA 5DTEA 4YV2A 1QC5B 3UA3A 2A57A 4M0PA 5DTRA 1OBOA 2XMCA 3ZGNA 3NDBB 1OA1A 2GJ4A 3DAPA 4G5OA 3SC2B 2GRAA 1XT6A 2JGNA 2D13A 2VDNB 3IPRA 2PNJA 3TCKA 3Q5DA 3N0TA 5KU1A 1PL6A 4AKIA 1ZDMA 3BIOA 1DQPA 1JDTA 1WDTA 1Z34A 3H16A 5FNVF 4KWEA 1YOVA 4B6GA 3II6X 1PX0A 3RU3A 4G37A 3L8GA 4BMNA 4ALNA 1PNQA 4BNYA 1JIVA 1FFGA 3H8WA 2HZ7A 5ADVA 1RU3A 4X1KA 3L2OB 5AOCA 3QWHA 4EUHA 3FKSA 4NENA 4C5CA 3UMYA 3FHTA 3ZJ4A 5HUQA 1RQNA 1RXIA 1YZGA 1STOA 3RJTA 1A8QA 1RJDA 2X8JB 2AL7A 3QQPA 3WB9A 3A3KA 2YHBA 2VTVA 3QUSA 4QREA 4D9IA 2NM0A 1Z5WA 2PS0A 4I3FA 3A4VA 3QJ5A 3VPBA 3LC7O 4GSLA 1MA0A 2QTCA 5JG7A 1RCFA 4HI0E 4BTEA 3JPWA 5BMVB 1PK9A 3EBLA 1IG3A 2RG1A 5ESWA 3SMVA 5A3SA 2WU8A 4BCDA 4EY7A 1SXJE 3GGPA 2DX7A 3OZCA 3VO2A 4CFSA 4B40A 5JXHA 1G5QA 1UMDB 4X9XA 4ZAFA 4QTTB 4MDEA 1OH5A 1W75A 4B7ZA 3V3TA 3RSCA 4RSRA 3TMKA 3OX4A 3GPBA 4HMQA 4NZNA 2VZEA 2WU0A 3D81A 2V7QA 4N3CA 4XW2A 3ZWCA 3ED5A 1VTKA 4U9UA 5KJ1A 3KEOA 3BH0A 1OYWA 3IC5A 4ZQGA 4RH3A 3IJEB 1I0LA 1VCIA 4TLCA 1AQYA 1SO8A 5DGCA 1TZKA 2HXYA 4HGQA 4FBMA 4IQ8A 4NV3A 4S3MA 2DEUA 3UWMA 5CAEA 2NXNA 1KEUA 2GPYA 3R3SA 5FPTA 1QH1A 1WB6A 3O03A 3BWDD 3KJQA 2OAQ1 5I7AA 3GG2A 3R8CA 5U4XA 3Q7PA 4JYPA 1T4BA 3BSYA 2PUFA 3EVTA 3A6HA 4HB4A 2AF4C 3UH1A 1FRNA 1LEHA 1KEVA 2I4IA 2ID9A 2O5VA 3JVEA 1FMJA 1P7YA 1CUJA 4OGFA 3UK2A 4RPCA 2P9JA 1A8IA 3OQNA 1N9ZA 3BWYA 1AIPA 2BEWB 3HLYA 4L9AA 1CF9A 4LYDA 3AVTA 3ZEAA 2OG2A 3X2FA 2CFCA 1AKWA 3X43A 1L5VA 2OSVA 2BBOA 4MR9B 1JECA 2HA3A 4NAVA 5IKPA 2FE4A 4H4CA 3OSZA 3CKKA 2OZKA 4XLTA 2B9VA 1K8XB 3LOPA 4Y9UA 4Z0TA 3MBIA 2EEZA 3SIPA 2WSYB 3AUXA 4QRHA 3WBBA 1S3GA 1PX2A 2C3MA 4P3XA 2A0YA 3MAAC 1LA2A 2XHZA 4GO1A 4JUDX 5IT0A 3F8TA 4RANA 1DO0A 2EHJA 1M8FA 2RDMA 5KVAA 5F12A 4A23A 3J81k 4MWEA 3OIVA 1W85B 4JELA 2C4TA 3M4XA 4ZMBA 1W36D 1JRLA 1ZK3A 1CX9B 5TDHA 3R9XB 4WACA 3HYNA 4XYBA 3V5NA 1SB9A 2UUPA 2YV5A 1HYQA 1JI3A 3A8TA 2G5PA 3INGA 5EWMB 5F2OA 5TEVA 3TIFA 3NFRA 3U7RA 3W1EA 5IS2A 2DUWA 3KFVA 2FG5A 5DN9A 2J9RA 1YDMA 2JAXA 2NNWB 2XQGA 1SCJA 2CUZA 4RYDA 4V0KA 3I52A 1T9GR 2OSBA 5EKSA 4ZHQB 5IAOA 4R40A 4PPQA 2UZIR 2QNIA 4EJSA 1NV8A 1RI1A 2C9BA 3HVIA 5IC6A 1IZ0A 2DFTA 3GZTB 5E6SB 4Z7JA 5KDDA 1QP0A 3ZXIA 2O8FA 5IEBA 2VF2A 5ECYA 5FOWA 4MV5A 3M1YA 2WMOB 4HLUC 4L78A 4XOIA 3TTTA 1JLMA 3VOTA 2J31A 3C3XA 4WWHA 1UIMA 4GOMD 4O1MA 1F8UA 1AUXA 1L2TA 3AO0B 2J7PD 1AKVA 1DJLA 1TVKB 1N5IA 1GGVA 3ELUA 2IY7A 3VRHA 1QHYA 3MC1A 4ND4A 4WOKA 3D4PA 2NZXA 3WYBA 5I48A 4LQ4A 3LCVB 3LPNA 2RGBA 5HJ5A 4HP8A 2UVDA 1IRIA 5CT8A 5IUKC 3KU1A 3HXOA 4UJ5A 4NC9A 2FP4A 2GHTA 5EGSA 3HCFA 3FMOB 1UBLS 2H08A 3H6GA 5AI0A 4YV7A 3C8MA 1Y4AE 5CB8A 4KUGA 2FEXA 2RONA 1ISJA 4MIKA 4R8MA 5K0JA 1DBPA 1QIMA 4PO8A 2FPUA 3L79A 4F5DA 5CBPA 1Q5PA 1XTSA 1Z2PX 1OA0A 2CFRA 3IBYA 4WECA 5CA0F 3O4HA 3HYCA 3AJ9A 1JMKC 5F78A 5AW2A 2WFLB 2JFFA 3VYTB 4CCYB 3HY4A 2JI7A 3LLUA 4TWZA 1PFUA 3H9BA 2H29A 5H68A 3W8NA 4UNSA 4WBNB 5ALHA 4E4YA 4C22A 3HVJA 4CEHA 4ARIA 1ODFA 2B5OA 3S7ZA 3HCOA 1GA4A 1UEJA 2AEFA 4L3WA 3K8OE 4RVUA 4DF3A 2W2KB 3KRTA 2HA7A 3AF4A 3N8HA 2VDLB 1IONA 1U65A 5HZKA 4M99A 4CV3A 1U6KA 2E48A 3FSGA 3HV0A 4F11A 2F3QA 1V3QE 1S1CA 4QUJA 1FE8A 5BQFA 2OCBA 4BECA 2H0RA 4HVCA 3VTKA 5HRAA 1TM7E 3AMVA 2YOFA 4EGAA 4F4UA 3A9SA 1D3AA 3K2QA 4PGHA 3MLBA 3M49A 4EY3A 1LSUA 3GVCA 1WU7A 3FUUA 4DRYA 3BJEA 4BNXA 4PAQA 4GEKA 1O7JA 3CF0A 1A88A 5SZHB 4W9RA 4KPEC 1P2BA 2OPBA 3CNHA 3RVDA 1GO2A 1ZLXA 1BGVA 1EMDA 3A6KA 1F0YA 1WUIS 3W2TA 1LTQA 5J5VA 3NTXA 3PDCA 4PLGA 1K89A 1QK5A 2ZYUX 2BFAA 5BT8A 5HIKA 2AC2A 4HG2A 4QDZA 5KC9A 4GM4A 4KQ2A 2V7GA 1H94A 2NU7A 3HSKA 5DOVA 3TBHA 3TD6A 2ENUA 3CN9A 3NEYA 1DRKA 4Q4DA 2M6KA 3ZDAA 3STYA 3D0RA 3DHVA 4TLDA 3ZWNA 5KDOA 1OBVA 1UBKS 3UZUA 3C7CB 3SJ7A 2C97A 1JBQA 5ALUA 1W19A 5IVDA 3D3WB 3MGCA 4JVNA 4O5OA 3A37A 1ZNZA 2HDNB 2V55B 1VXOA 3OPQA 2HMUA 1PW7A 2WVGA 4G0OA 3ZWQA 4KXYA 5AVXA 4JJ6A 2H1RA 4ZVVA 1UPXA 3H75A 1F12A 3S2IA 1FVHA 5AM4A 1SD1A 3AUTA 2Y77A 2YUTA 1HZZA 3OAAA 3OTGA 4LK2A 1O96B 4RH0A 1KBQA 1YB5A 1J8MF 3FA2A 1XKXA 2BJWA 2IKQA 2R87A 2Q3DA 3PFNA 1MJHA 4IIDA 4C76A 1U80A 2P5UA 3DDHA 3OJLA 2VK2A 4GI3A 4ITVA 1I2ZA 3MT0A 3TMYA 2C4VA 2ETVA 4BX0A 2RGNC 4WESB 5KYWA 1AK1A 4EARA 1EINA 3B85A 2JGAA 1QP8A 3G68A 3L01A 3L9WA 3WGOA 4RADA 1P2DA 4U02A 4QWMA 4BO5A 2VP0A 1Z0AA 4CF5A 3BH7A 5BUZA 5ALGA 4MV0A 2P30A 1S96A 5TX7A 4OSEA 3WIDA 5FWXB 3I04M 4H77A 2C1EA 4JSYA 3T4PA 5DW0A 3HEAA 4YJ2B 3KPYA 3UGJA 5HQ3B 4AKTA 4FE4A 4Q3DA 3CB2A 3PC8A 1MJFA 4N7MA 1YZUA 1W76A 5FWDA 1BYUA 1JKJB 1UINA 4YI3A 4BIMA 1K5PA 2VG8A 3LC1O 5IVIA 4CKEA 4C88A 5FA6A 2PL5A 1C7FA 4YRCA 5DLEA 1PZXA 4BMOB 4XD7D 2IUSA 1JE0A 4JLOA 1XZIA 5KTRA 2AQKA 3EFOA 1NR5A 4UMEA 5FI1B 2WNIA 4IH1A 2AG1A 4TV8A 1SCNE 3CKYA 2V4MA 1E5QA 1L0BA 1YBVA 4MWBA 4S35A 2BEVB 1GR1A 4M0UA 4DIEA 1BGXT 4OFBA 3UJHA 2VF8A 1WDWB 2X2OA 1JI0A 1GV0A 2CKMA 4C2TA 3ZBTA 3SZOA 4FI3F 2PD4A 2GHIA 3GRZA 3S1SA 2C7BA 3BTSA 4KUHA 1SBCA 1S2LA 4EQ6A 3AM3A 2H2FA 1EFRA 2EQAA 3TUIC 1Q15A 1PUXA 4AF6A 4Z5XA 4K6CA 2FKAA 3U6BA 2O3RA 4UVGA 4DIKA 4M49A 1IDN1 1H8EA 3R9KA 4R1QA 4EGCB 3NBQA 4HAYA 4BPBA 2AFIE 3TTYA 3I4FA 5ITZB 3H0EA 7REQA 3ENKA 4I55A 3CVWA 1JSLA 2SKCA 1NLZA 3ICOA 3UB2A 1IXKA 3CPJB 2ZB3A 4IDPA 4NFLA 1T8PA 1HNZB 4D9MA 1ZXLA 1HZJA 1TL7C 2QTAA 4S1NA 5D6OA 5KIAA 1E1RD 3EH1A 4YUYA 3EY4A 4U5XA 3HR7A 3L8EA 3KYDA 2Z98A 3DXFA 1TEVA 3CC8A 4E11A 1VIVA 2J0QA 3O73A 4JXXA 4GUAA 5D51S 2I6FA 4WBSA 1LLDA 3LOUA 4GPD1 2UXDB 1H9CA 1IY0A 3PRYA 1Z6QA 4CQJA 4DDKA 4P9NA 2JG3A 3F5DA 2ILVA 4N1AA 4MW2A 3W1VA 4H7HA 4DDVA 5FLYA 1UP7A 2Z2YA 1YR2A 2O0HA 4L75A 1BJKA 2IW1A 4B6SA 1I33A 2RJ3A 4JKOA 5KYWB 4QU0A 4MJ3A 5AYVA 3G0OA 1TU0A 3GH3A 3EB9A 1PT6A 1Q11A 1RVV1 5H5JA 3L7NA 4L5AA 4EF5A 2RK6A 2RGGA 2REQB 5KWSA 3IIIA 8OHMA 2I3AA 1K3UB 3TUJC 5LNK1 4PM4A 1SKYE 3WICA 3JTMA 3SU8A 3T6KA 2P35A 3D7NA 4HNAA 5IAGA 3Q9NA 4DUGD 4IIJA 3PFKA 3VC1A 5M7EA 2XYRA 2WD7A 4YLYA 1KVUA 2ERYA 1ZNWA 2VA9A 5DHSA 1JHVA 4EWLA 4IDOA 3LFHA 2HNBA 4FE7A 4G1BA 1D1SA 4P3NA 1W5SA 4MKZA 2DPLA 2QP3A 4L28A 4UVDA 2EBFX 1WXFA 2OWDA 4Q39A 1ILEA 1Y6QA 1C3LA 4YJGA 3QSYA 2O8BB 4GGOA 4XVQA 2A1TR 3AR8A 1YS7A 2AKYA 3N0VA 2JB9A 3BT7A 1ST2A 4QA9A 1ODKA 1JB9A 2G1AA 4ZTBA 3WLTA 3FIJA 5FWYA 5MFZA 4TT3D 2IPLA 1LFAA 4TTAA 2I99A 2RGDA 1ADBA 3JXEA 1GAJA 1AQJA 3I4LA 1HYGA 2X6TA 2D62A 5TJ9A 1HV8A 3F6YA 2FFJA 4X71A 3ZC3A 4V2IA 3THOA 1V25A 3IVGA 2FCAA 5JMTA 4KLAA 2AVDA 3T4UA 3MHPA 3HSSA 5TLSA 1GPBA 5TV2A 4F56A 1EBUA 3HRIA 4ZCIA 3UFXB 1KI3A 4IIUA 4F3CA 4J2HA 1S2OA 1ULTA 1TMYA 3HU5A 5CVCA 3BWCA 2ZXUA 5AW3A 2FY8A 3G23A 3JQPA 4N0DA 4JVLA 3LWZA 3L0PA 4AWBA 1U2GC 2AFHB 3JWJA 2K7FA 3A3PA 3VBCA 3W4JA 1MJGA 5KINB 2YZ7A 3JR3A 1HEIA 2AYZA 2PVPA 3H17A 1NE2A 1NJ6A 2E9SA 5HKLA 3WLFA 1XD9A 1K06A 1ZH4A 5K4HA 5LLTA 2CK3D 3EVDA 3HS3A 3DFFA 3KZOA 4ATNA 3KX2A 1YUMA 1N5KA 3REOA 4DCPA 5J2UF 3I2GA 1NP3A 4F86A 1PNVA 1QG2A 3BTUA 5DO9A 5EP1A 3BWVA 3HHEA 3Q7RA 4W8HA 1M0TA 1FUUA 5KI6A 1NSYA 2F3PA 2YYAA 3MOIA 5ERYA 3Q2OA 4MVXA 5EJEA 4S04A 3CLRD 2I6SA 4JLBA 2FXIA 5JXIA 3KQVA 2Q8QA 4MWDA 3P2EA 2AK3A 1XALA 1F9EA 2R3SA 2AI2A 3IP5A 4K6MA 4QO7A 5DPMA 3GLHB 3U80A 2ZETA 3OD1A 4R9RA 1ZUWA 4DWWA 4UM7A 3IVMA 4CU2A 2JCVA 3G2MA 4JJZA 5DIZA 3V4SA 3ACDA 4BFLA 5C8ZA 3DBHB 1GNSA 2GJSA 2P2CA 4IMPA 5L8VA 5CR9A 4GE0A 4KI7A 4DBVO 3ZLUA 2VXBA 2OMEA 2CNKA 5JFGA 2BCEA 1EEXB 2RHRA 1M6NA 2CHFA 4IBOA 4D26A 1MIOB 1NJ8A 5AOBA 3L77A 1YNOA 3KKEA 3NOQA 4P3OA 4YUVA 5IXYA 4W8GA 3K9NA 4CTMA 1CUIA 3NKLA 1THZA 1V5IA 3OZBA 1KFJB 4DIBA 1XTKA 1H1LA 2QTRA 3DMTA 4RPLA 5K1ZA 3ZU6A 1DTWB 2Q62A 1IEXA 2HZBA 2MMGA 2SCUB 1G8KA 1JDBC 3L7KA 5K3BA 2RHGB 4O2AB 3HJGA 3TXYA 1EFKA 1NURA 3N5KA 5IT9A 1J0DA 1N0WA 2R1TB 3NC4A 3M33A 1G6KA 2QN7A 2W6PA 3F97A 2GZMA 2ZUDA 2HQSA 2ZJ8A 3EIHA 5J4KA 4RLHA 2GBFA 4RJKA 2IOHA 3KZCA 5JAZA 1WW8A 3KXDA 3WBKA 1KVQA 1Q77A 5JWRA 2X7HA 2OP1A 1CIVA 4Y6LA 3SQMA 1N2IA 1QWOA 1TF7A 5FKJA 1EXNA 4IIXA 4FU0A 1KWKA 4ADSG 4C5BA 1DDGA 1BHQ1 1R0CA 2HMAA 2IZOA 2MYPA 3IUBA 1YA6A 4IDGA 3S28A 4QDKA 2C82A 4Q4HA 1ISHA 2X5XA 2MWMA 1VJ1A 2G7MC 1JHQA 2YIVX 3KD2A 1M2OB 4J0IA 2ZSJA 3A27A 2B99A 3E82A 4WD3A 2YMLA 3PSAA 3NRCA 3QE2A 1WQ4A 4H1HA 4WE3A 2Y66A 4F06A 3PGA1 1VLLA 4LNAA 3Q3IA 4IH4A 2BP7A 5FORA 3N2KA 1ENPA 2ZJ3A 3MCTA 4N49A 2P27A 5LMCA 1JJAA 1HFEL 1KNQA 1M74A 3L4BC 4YS6A 1UXIA 2P6OA 1UC4B 3AR5A 4IFBA 5IJ0A 3A7DA 1EFAA 4YXWA 4PXYA 1O6CA 3LLSA 3RO7A 4MRPA 4ROTA 4M86A 5ELLA 3TO5A 4P7GA 1N8NA 4BVAA 1XZ8A 3DVAA 1S8OA 4CM3A 4TYNA 2J3JA 3HJBA 3TLAA 1CYEA 3W7AA 3WXBA 2HCTA 2WAMA 2JFZA 3P9NA 3FX2A 3PUYA 1E9EA 1M2FA 2FSVA 2GAAA 2OLEA 2IHUA 1PCXA 4CF3A 3LMKA 4AZWA 3HGMA 4LSGA 5DXAA 4E08A 4YRIA 2B34A 3CB4A 5EKUA 5CA0B 1N0HA 1RWXA 2PNFA 3FBWA 2R86A 2BBSA 2IT1A 2O1WA 2QB5A 3GGDA 1QP7A 1G7SA 4OHKA 1MGPA 1NG9A 2WHXA 1C8VB 4G89A 3VNUA 4DADA 1WKVA 1Z6YA 1KAMA 5TQVA 3KQYA 3QFRA 1GG5A 3EY9A 2IYOA 1XZKA 3G2LA 4MVJP 2J3QA 4QYSA 1XTJA 1BVRA 1NQUA 5KYTA 2HADA 4ESHA 5TF0A 3PV0A 4MI9A 1T3ZA 3PVSA 5JSYA 4HEA1 3OEED 1LPBB 2FYTA 4B3IA 1UKBA 2QT1A 4MUMA 3VU9A 2GTIA 4ZZ3A 5FX2A 1WUYA 3C1TA 2QLMA 1EVZA 3LUKA 1E8DA 5CM8B 1GG9A 1DAKA 4Y2SA 2YINC 1W52X 1U0OC 3LDHA 2H65A 3RFUA 4HL6A 4F3KA 5A03A 1E7MA 4TV8F 1C7QA 4H2DA 1E99A 3F78A 4WKGA 3ZG6A 4FEGA 4MUGA 2CN1A 2VAPA 2FPIB 2V3WA 3ASUA 1DLJA 1T5LA 1P2SA 2X0NA 2XMRA 3ESRA 2GEVA 4Y9DA 2F4VB 1NQXA 4M4SA 1Z7BA 2R66A 1SCBA 2H51A 2XTMA 1R4AA 1FP6A 3KAPA 2GXSA 2BFPA 2IUTA 1WUTA 4JNCA 1JJVA 3RWBA 3L4KA 3FUXA 1OBFO 3G5UA 1UADA 4KPUB 3TPFA 1SK9A 3LHFA 3N1UA 2WWFA 2DCUA 3GFPA 4K9QA 1CS0A 3AIMA 2BY4A 4YJFB 3SHOA 3IE1A 3OT1A 4ML3A 3L8FA 3QVSA 3COJA 1SKQA 2QV7A 1CJVC 4PEVA 5D6NA 5C1IA 4CHGA 4Z7OB 3TGLA 3DDUA 2G1PA 2PGNA 1RJ9B 5ICEA 2XB2A 1FPMA 1EVYA 5LWQA 3MRSA 5F7JA 3L7IA 3HCCA 4K26A 3VZQA 1JSCA 5AK6A 4TKUA 5AM5A 5AVVA 2GF9A 4YMWA 1DTSA 2HHHB 4ARVA 5M2QA 2WUFA 4D9EA 3GF4A 2NW6A 3W4IA 4LTDA 2WMNB 3O1IC 3ZBQA 1C9YA 1I14A 4BQRA 2JD1A 3EIXA 1SC6A 2P4UA 2VDMB 5AJUA 4PNEA 1P4GA 1EKXA 1TPZA 3KJNA 1CEYA 3A6FA 3OQVA 4MB6A 2W98A 4P33A 5B64A 1SKMA 4M0MA 2QRKA 5MHTA 4DB2A 3KB1A 2VA8A 1A5AB 2P2NA 3HRKA 1N7GA 5DVZA 2ZRIA 1F3OA 4MS1A 3RRFA 1LD3A 1OD6A 3DW1X 3GGGA 4LSZA 4D4IA 2O3UA 2SKDA 4LRXA 4IUCS 1S4QA 3RSFA 2NUAA 1SBIA 2BGUA 2GZHA 4OJKA 2GN2A 3U81A 5AM2A 4IQFA 4IO1A 1V39A 2ZJFA 2OZPA 3QU5A 4B4UA 1WPQA 3P45A 1M1YB 3EULA 3GP5A 3C3AA 5A9SA 2Q0SA 3MRTA 1Y4SA 2X7JA 5EHIA 5HF5A 1VKRA 1EIZA 4J16A 3ZK8A 5CEFA 1KYTA 1AXGA 1YS6A 4IIJF 4DL9A 1TJ5A 1YR6A 2QL5A 1DOAA 3AJ8A 3B12A 4ISCA 3CUWA 3WWEA 1ZGAA 2NZJA 1FFEA 4QODA 4GXRA 3MCUA 1RT9A 2HJSA 2V6MA 3NATA 4UMDA 3DA8A 3GC6A 4GI5A 3HVKA 2D0PB 1NUQA 1JSZA 1UJBA 4M9CA 1W5EA 4FC6A 2W9XA 1QDLB 4OF4A 3FFWA 3IIJA 4TSFA 5TQ2B 4D98A 1NVBA 1FRZA 2YUIA 2PFSA 3GUVA 2NSYA 1T4GA 4IVNA 5LFAA 2IXBA 2WT9A 2NU9B 4D9KA 1U1DA 1L4EA 1QQ5A 4I36A 4QFMA 1LSSA 5LZ7A 1YOBA 4MRRA 2WF5A 4EKYA 5CD9A 4XYLA 5C9ZA 1Y8AA 2MT9A 2AVNA 3AJEA 2ZCUA 3O2NA 4L8YA 3RVLA 2LDBA 3T1VA 2WUWE 3PTAA 1UWLA 2PWZA 4TGLA 2P91A 4JT8A 4UEQA 1D1PA 2X5NA 5DLDA 2DCMA 4J75A 3K5HA 4NBNA 1D4ZA 4Z3OA 4H27A 4EHDA 1YOVB 2XI4A 1P62B 4W63A 1DDIA 1XIVA 2ZAMA 2IDZA 3BRWA 3HO8A 4ZD6A 2X2EA 1Y6GA 3C3KA 2YICA 2Y1XA 4X1KB 5EP3A 1O0CA 1X1AA 5E4YA 1MDBA 3VZSA 5INTA 2XTJA 1QYCA 2YC2C 3N0WA 4KNWA 1RI3A 2RE8A 1UC8A 4D41A 2ZJ1A 4P54A 3D6MA 1N6LA 4EVRA 1PT7A 3OURA 1E2MA 2CSUA 3ETNA 2YYZA 1R88A 3BDAA 3CIFA 4QD3A 4AURA 1GYQA 3B3AA 1XMXA 3IULA 3OY7A 3ZTYA 1V4VA 1RWVA 4XEUA 5DNVA 3W5BA 1XK7A 4U00A 1TCAA 3VU8A 3LXRA 4LI3X 4XVRA 2ZBPA 1FUEA 1R6VA 3DYIA 3Q7QA 4FMCF 1YACA 2FN4A 3FM9A 1H2ZA 4LOJA 5HDBB 5BN5A 4MO9A 4WZ6A 3RREA 4P32A 3SSOA 2WVHA 5HGXA 5AW4A 5JBNA 1NRWA 2CXQA 4RULA 3U5TA 1SXIA 5KPDA 3QLUA 5FBKA 1IOZA 1Y8CA 3B51X 1CY7A 3K8QA 1BJRE 4H18A 3TINA 2JLWA 4AB1A 3CJQA 3FVWA 3FZGA 4J7UA 3EGCA 3R74A 1TF2A 5CT4A 1PLKA 4XCQA 1ZPDA 1FPQA 1B8OA 2OQ2A 3AIIA 1MX5A 5AVOA 2C1XA 5CAEB 4F6LA 3KQWA 1P7CA 1QYXA 2ODEA 4HAOA 3STHA 2CLKB 4IF4A 1DBSA 2WFAA 1T2DA 2QY9A 3RVOA 1H42A 3W06A 1HM5A 4CDGA 4P92A 2GN8A 5BSKA 4RC9A 1ZY2A 1X7WA 1RWBA 1KE2A 3AGPA 2IY9A 3A70A 1FQKA 4AO6A 1ORIA 4QECA 1R0BA 1P91A 1YB2A 3DEAA 3WS7A 4LZAA 4XJSA 3B1WA 5EFZA 1DEKA 3H87A 1WA5A 2MSCB 2FW7A 4RETA 1QANA 1AA9A 4OYLA 1JEDA 1ND5A 4XE5A 3RG2A 1QTQA 4LBWA 1J5XA 1R5BA 1X2EA 2ZUWA 3EVGA 4YV1A 1GKUB 4HYTA 4MGEA 3ZE2B 1ZZGA 1G8SA 2DKOA 1KY5A 1GZDA 2PVSA 3M2TA 3M6LA 3ZE9A 3L0ZA 1P72A 1Y3DE 1YIDA 1I3MA 1FTNA 1VJ0A 2V58A 3STWA 4QDUA 1EHYA 2B94A 2XNSA 5H59A 3PITA 2JZOA 4H4EA 4CN9A 4QOGA 1Y5MA 3LZCA 2P77A 1H22A 2BGJA 4JBNA 4Y7CA 3ZLJA 3BIXA 1NJSA 3P8ZA 1M66A 1JDJA 1CUVA 2D2FA 4PU0A 1A5ZA 1B6GA 2EDAA 4QFDA 1POXA 3KUDA 1RMQA 4JEMA 2PJUA 4TN5A 1SPBS 3TRJA 2HBZA 2XUDA 1DP4A 2FSGA 2XGJA 2ZBVA 3V1KA 5FR1A 1A8PA 4EJSB 5JU6A 1HL3A 1UBFA 1QUFA 1OASA 2GKSA 2OBXA 2ID8A 2VAXA 3O8CA 3ZUPA 2O8FB 1JPJA 2AOVA 3X0DA 5CVEA 1CY0A 1AXRA 2ERXA 3A4NA 5FLEX 2APJA 2DM6A 1E7QA 5FOQA 2IW3A 2Q1SA 3MVEA 2N47A 3SDSA 4B3JA 3ORRA 2DQKA 2A9PA 1L7NA 2BI4A 4OP3A 4A1FA 4UU0A 2B8EA 5IPFA 5K09A 3E6AA 3EPLA 1RHJA 1IWOA 1XXHA 4PC2A 1C8BA 2GTPA 1ZA2A 2I2DA 1U4SA 1K6XA 1T9ZA 2QM0A 4DJEC 1FCJA 1EWRA 2XZOA 3HCPA 3JWPA 3FRJA 1A0OA 2UVPA 1IVNA 2AEJA 2VDJA 3ILVA 1E62A 3LUAA 5DGDA 1JB1A 1WHTA 2P0AA 3AI3A 1SU8A 4EVSA 1FJXA 2H5JA 2TMYA 1M0WA 1QHHA 3ANSA 1AB6A 4N5NA 5SYNA 1BWPA 1VI6A 4L9SA 4B6QA 5JZ9A 3NANA 4H16A 2OCPA 2IHKA 1D6SA 3FZEA 2BFDA 4O0MA 4F93B 4RKQA 3A9UA 3IP1A 4CEHB 3JQAA 4KXLA 4L57A 1L5MA 1W5FA 1E18A 5ALWA 3ELBA 5IDYA 3S2EA 2QRGA 3IR6A 4DLLA 5DM70 1G7RA 2VXYA 3MIIA 3BMQA 1S3IA 1BVUA 3G7UA 5CYPA 3RC1A 3CZRA 2ZIWB 3QIVA 1Y1RA 3GJ4A 4B85A 4V0OA 3C39A 4LYHA 1RI4A 1OGYA 2XYPA 3TQOA 3WNZA 1EP2B 1RYFA 4UFOA 3RCBA 1YRLA 2XSZA 2GAIA 3D02A 2BAGA 4GGPA 4IGKA 2JL1A 5EIBC 5TS3A 3VVMA 4B3SB 4LMPA 1IJKA 4FI3C 3ZLTA 4AJPA 4QBTA 3O8BA 3L0DA 1YTUA 1SOMA 3EZXA 4G1EB 2P4QA 3QVMA 4U7HA 2HSJA 3FMGA 3LT0A 4H1TA 4XQEA 3TCNA 1Q2XA 3TZCA 1EWKA 2C2XA 2VYQA 1QH0A 4U7GA 4BGVA 3JD2A 2WU1A 1Y8QA 3EZ6A 3S81A 2CXOA 3U26A 1RIIA 2JAHA 3K5IA 4AG6A 3K70D 3TZLA 3V8BA 1JHDA 4KSCA 1HLFA 2KQUA 1NXQA 4MV9A 3RS0A 1UOQA 3LOQA 1IAQA 5BY2A 2OD7A 4R84A 2PKQP 2NU7B 3UN1A 2COKA 4G5SA 2ZRKA 3BH6A 4NBKA 2VKQA 1PWYE 1FP2A 3E8SA 3QPWA 4GF5A 2VS1A 1CZOA 5KPJA 1V5WA 2WIDA 3EGOA 3DO8A 3FNRA 1L4UA 1XSEA 2HFKA 4QDJA 4WXRA 4EKGA 5KJCA 1UXOA 2C9DA 2HT1A 4MO2A 1OCEA 2A0KA 2ZVQX 3EEYA 4LRSB 3CS3A 3I34X 1MRZA 3VI3B 1XWFA 2JHCA 4UM5A 3P52A 4H3VA 1P77A 2ISQA 2H7VA 2FK8A 1FS6A 2FW1A 5C8YB 2B8TA 1RQLA 2C1ZA 3DBRA 4M1EA 2VRBA 3E7FA 1YE3A 1EPUA 4YP6A 2GO1A 4H7JA 5JS7A 5L3VA 4NYIQ 3JYNA 3OX3A 3VTAA 4ALLA 3HCDA 4CUZA 2IP4A 1BKDR 2XCSB 4GMFA 4DR6B 2VBGA 1UDAA 4R69A 1E1QD 4EGQA 4LOLA 3UV6A 4L5BA 1A77A 2NTEA 1GG8A 1PBNA 2OQIA 2RAPA 4OHUA 4XAQA 2ZXFA 4BWYA 1NIJA 3LPAA 1P39A 1JBEA 4QGSA 1QOQB 3KXPA 4PXAA 5DNUA 2DC1A 5J3JA 1ISMA 3IUEA 1BX1A 1N2CE 5KX5F 2J0UA 3OLZA 4NYJR 1AQNA 4HR7A 5AM0A 1R4ZA 3P9SA 5CDYA 5AP9A 4NECA 1UMCA 4BNUA 4OYHA 4ZAVA 3E4CA 5FT9A 2JCSA 5J1TB 1I7QB 1EFHA 4ERXA 2YWRA 4G4JA 4X8LA 1J00A 1VCNA 5JANA 4OG2A 4FUTA 4PNZA 1TIPA 1DV2A 1WB5A 1T5BA 3USES 2VCEA 2QW1A 4D25A 4EF4A 3AVWA 3FB4A 3FKJA 4RHUA 4ZDWA 2B3DA 2CFTA 1TJPB 4KMOA 3SXPA 1QFMA 5ER6A 2BKXA 2FR8C 2X23A 3EQ7A 3HUFA 3EIEA 3NHPA 1F51E 1QYRA 5LQSA 1S2MA 2IOQA 2NADA 4WFIA 3CPSA 4ZAGA 4QJ3A 1C41A 1IY2A 2AR9A 2NPIA 4TTPA 4U2DA 3W6OA 3H99A 4E30A 3JWIA 3EFOB 3OT5A 4LQLA 4TV8B 1XZNA 1BCRA 2C04A 3MT9A 2FOXA 4LZWA 2WG2A 1SUWA 1WPGA 2BHRA 1YR9A 3B38A 4FR5A 3IEKA 4MLZA 3V2GA 5J5AA 1HNXB 1TT5A 3RSHA 1SXJA 5G3YA 4GLBA 3EIWA 3G79A 1CDZA 5TVKA 4EQ6B 3RTAA 1KZYC 4HS4A 4G1FA 1Z4OA 1T6XA 3AHGA 4JLPA 4RWZA 3B52X 3H84A 4G5GA 3N70A 3R7SA 3W6ZA 1RIFA 3O8LA 4EB6A 1IHOA 2WB2A 5FULA 4XUEA 1KK3A 1X80A 3FH0A 4MW5A 1O5TA 2XA9A 4XWKA 5JSQA 1XD2A 2J5BA 3A9WA 3N0RA 3D43A 4QC2A 3DEZA 4CV2A 3IIEA 7REQB 2FGKA 3O92A 1NDUA 1Z62A 2LV8A 2PX5A 3LT5A 4I55B 1GT6A 4A0FA 1SD2A 3PNPA 4RZXA 1XZBA 2GM5A 4ZARA 1L5LA 3TYXA 4BNHA 2Q0QA 2UDPA 2VSYA 3PUZA 4HF7A 3UKDA 2B1RA 1U8AA 3ZD9A 3WAKA 2PUEA 2R44A 3KYDB 5CXQA 4JUFA 3IP6A 1UKYA 5FOUA 3NUZA 3VZPA 5C1PA 4FHEA 4DSZA 2Z8YA 3AVOA 5BWMA 1JHRA 3ZHXA 2Q1WA 3NWOA 4JB3A 4WLOA 1Z0JA 1IJEA 3CUVA 3RWMB 1C50A 4EW6A 1U2RA 5JSZA 1QKJA 1VLZA 2VP4A 3KYIB 3PUIA 4EITA 2JEZA 2BGLA 2VUHB 1UDCA 3LBFA 4B1FA 1I8TA 1P3Y1 4GMGA 2K87A 3R0ZA 1PTJA 2P62A 4F3TA 2X7XA 5H9WA 4M1MA 2HWWA 1B76A 1QTRA 1TA4A 2WTXA 1GQRA 2WQ7A 2CJXA 1WXWA 2LPMA 4GC9A 2WHYA 1F2DA 4MQ6A 1GU1A 2YWEA 3BPSA 4MEJA 4E5VA 1GUDA 4HNAB 4IJ5A 2MIIA 4NCAA 4RCVA 4IIJB 4TVOA 3U4HA 4DA6A 2W6QA 2KX7A 2WD7B 4D4MA 4KOAA 5TMEA 4D8YA 4IIYA 2AT1A 4EHKA 3X2EA 3LC0A 1GUAA 3K9BA 3Q8WA 5H70A 2F1OA 2XT9A 4QVKA 4AQYB 5TPZA 3CEPB 5I3ZA 1K7EB 4UAVA 5HF8A 4D81A 2IIVA 3LA8A 5AJZA 2ORVA 2P8JA 2OAGA 5D1HA 3T3IA 2HU2A 1X13A 1XVUA 3X3HA 2XWJI 1BOOA 1SQ6A 2VJQA 4WUTA 1FSPA 2IPXA 2A78A 3DTYA 4P7BA 4TV9A 4NOKA 4PCAA 4RVCA 5FWYB 3WNCA 3WTCA 4ZV4A 4BQQA 3NBZC 4KVZA 1S89A 1Z0IA 1ZOSA 3A4IA 3B9BA 3MCVA 5IC4A 4K9DA 4G86A 4Q9NA 2QVXX 3WRVA 1JXOA 3A3NA 2PTHA 5F4ZA 1Q21A 2AZ4A 1RAFA 4GMXA 2FKNA 1YUBA 4BBPA 1NWHA 9ABPA 1FVXA 4KRYA 1KSJA 4UM9D 4YI5A 5ED0A 5DHFA 2J59A 4NG5A 4N7RA 4BAZA 2WILA 3KYJB 3MTJA 3ULKA 5FUWA 3HWWA 1LX6A 1QJCA 1U7TA 2WPNA 1VPTA 2IYNA 3FTCA 3TX6A 4WA8A 1F2VA 1DUSA 1JJFA 1G19A 2HIMA 2Q4EA 2QIPA 3A1NA 1VHJA 2L42A 3ZCVA 4K2HA 5KNDA 4MRMA 3AHCA 4L08A 5T7BA 4QYIA 5A02A 3GLRA 4R1LA 2V9CA 4NAHA 2ZUUA 1P1HA 4X6YA 1ESEA 1CIJA 3V4FA 1HZZC 3IT1A 3OM8A 4FSHA 2QG9A 3H1EA 4LJ5A 2PLFA 4WN9A 5THQA 3SLRA 4D2IA 5HBRA 4PG5A 5BR7A 3UUGA 3LK7A 3KZMA 1KRHA 1WETA 1WTCA 5EZ5A 1TNDA 1XTIA 3FCCA 2AN5A 1UPAA 3SSAA 2V7PA 3VH1A 2DERA 3G2IA 4FMCB 3HUEA 3G2HA 1Q20A 1F06A 3EXG2 3QBVA 2AR0A 2SKEA 4PG4A 1GQYA 3S3TA 2A3NA 1JQAA 1PWEA 4I8DA 1Q0QA 4HQ6A 4A6EA 1YC5A 2I6GA 3SX4A 1AQ6A 4FFBA 5FOXA 2A3RA 4Q1VA 2HN9A 3GO4A 1K5HA 1H2WA 2QQFA 3RIYA 5B58C 3S8EA 4PWYA 4TS4A 2WNHA 1L7RA 1OWLA 4TYMA 3CG0A 3VAZA 3HXTA 3UBMA 3U7HB 3TAUA 3GLFA 3A2MA 3IKVA 4Q82A 3E53A 1C9JA 5THXA 5E7QA 4EHJA 1D9XA 2A9JA 2JGRA 4OXYA 5EESA 4YQEA 5A3QA 3WGYA 1AKQA 3G0DA 3HN2A 5E9AA 1GQQA 1BXRA 2I6XA 3FROA 4UUBA 5HE8A 3OTOB 3W4KA 1RWWA 3MLEA 1H3NA 3LTEA 2XPCA 4DLXA 5KNLA 2YL2A 2I2XB 2J9XB 3CT6A 3D7SA 5CYFA 3TNLA 4N3NA 1Y1SA 4QLAA 4G07A 3INTA 5HMLA 3WO0A 1JGTA 1YFZA 4KE6A 4A7PA 4OB6A 1H1LB 3N6RA 4KW7A 3J7AC 1U0EA 3LI2A 3TS1A 1CUXA 1GZ4A 4I99A 1SB8A 2LCFA 5A4KA 5I4IA 2FG6C 3IXMA 1XB2A 8MHTA 1N1GA 2HO4A 2J4CA 1P5ZB 1DHTA 3MBKA 3OZSA 5KNCA 3BMXA 4WZBA 1HYHA 4NPCA 4E5DA 3PC4A 4ABTA 1YZVA 2X41A 3L6RA 4FFDA 5B3JA 5L3QA 2QXYA 1DO2A 1W0KA 2FPMA 4MV1A 2O1EA 1JZSA 1OXUA 1N57A 2PGAA 4U2BA 4DLVA 4EA9A 4V0ME 2H0AA 1HH4A 3OCWA 4TSRA 1OE0A 4FZRA 2VJBA 5CEJA 4FNMA 3K0SA 2I33A 2GCOB 1L5SA 5IZCC 4Q4HB 3R3WA 2A5FA 2I4TA 1KYXA 2XT6A 3OF2A 5DN6D 4INAA 2PSJA 3FBGA 5B7GA 3D8HA 2G04A 2GHRA 3KR9A 4ZRNA 2PV0A 4UE6A 1QGUB 4H7KA 3V4OA 1O9BA 1T9BA 2BE9A 1U7OA 4JT4A 4W5HA 4EFLA 4EG7A 4UMFA 2BKUA 2DTXA 4F60A 3GPLA 1PWXA 3L46A 1J8VA 3VR1A 3ENWA 1DKQA 3DTNA 1BVYF 1X7GA 1IMJA 2BP7B 4DV4B 5JE8A 3N2KB 3O4JA 3PFGA 3VR5D 5HKOA 4K9OA 1Z2AA 5ADUS 5AVUA 1OGIA 5IJ0B 3KKPA 2GMWA 4IRUB 2QUJA 1OZFA 2V6FA 4W8OA 3VSDA 1ECLA 3H0KA 1CR2A 4WT7A 5FEUA 2ZJ6A 3DVAB 4UXJA 2ZUFA 2RJOA 1AGPA 1ZI9A 3DM5A 4N82A 5EVCA 1FF9A 3MHTA 1HLDA 2WIFA 4CKBA 4Q4CA 5DM2A 1U9CA 1RYMA 1EP9A 1QRRA 4UREA 3EHEA 4WOBA 2W2PA 5AVZA 1R9MA 1FW6A 2WT4A 4LXYA 4EW2A 3MWDA 5C7LO 1JF8A 1H9AA 2JW5A 2PANA 2ZGVA 1E7WA 2G3YA 3NALA 3CSDA 1DC3A 4DWJA 1Z2OX 1Z47A 3L1HA 1T5HX 1TOAA 4WCFA 2XRZA 3COSA 4QOSA 1KDTA 1DMRA 5LDGA 2PBRA 2P2YA 3KUUA 5DYTA 3GBSA 1L1FA 3DAGA 3F7NA 3V1MA 4MW4A 4C2UA 2Q49A 4M8NE 3B9RA 4Y2RA 3O0TA 1L7DA 2CV0A 1CUWA 1ESCA 4CL8A 2D1RA 1T2UA 2EC5A 3C43A 5CVUA 4RY8A 3G88A 3VU9B 1LF0A 5M29A 1KETA 1ZOPA 1YZNA 1ICIA 1PNRA 3K92A 4DCNA 2BCJQ 1Z0KA 2JJ1A 3GEDA 4JLSA 3R7LA 2AX3A 2I2WA 3RROA 2BHSA 1IOVA 4HVTA 4X8OA 3BA1A 2Z6UA 1F4VA 5ITWA 4FT4A 3S0JA 3VJMA 3SG0A 3ADCA 1YKGA 1IDOA 4JI1B 2PZBA 1WMSA 2XVZA 2GD6A 2FUKA 3JV7A 3T1NA 3EG5A 2G6TA 4JY7A 3K5PA 5FQNA 3PGLA 5FPSA 5BW5A 4BVKA 3TTSA 2QX8A 2P1RA 2XYGA 3UENA 1H0RA 4PZ0A 5B4UA 3M1LA 3Q85A 2Y4NA 3FLAA 4O4LA 2VP2A 4Y0NA 3C85A 3IEVA 3D3JA 3AH8A 4ID9A 1CS0B 2ORYA 1JEQA 4UFPA 3ZWBA 3ZHOA 1ML3A 4KGVA 1CS4C 1DPGA 1EGMB 1BMFA 3OT1B 1RPJA 1BXZA 2KB0A 3VNQA 4FSXA 3GRCA 4BLWA 3A1VA 4S1VA 3RQIA 3RVBA 2HWKA 4DKXA 4N6OA 1MOQA 5JS6A 3IOMA 4J91A 1Y8ZA 4LXQA 1ZGGA 4S1WA 1DB3A 2NLOA 1HT0A 1K7XB 1IY1A 1YBHA 3GJQA 1OLSA 2XNDA 5LBTA 4TKUB 5GVRA 3WWYA 3O1LA 1QAQA 4FYWA 1KFKB 3IBFA 3TW6A 4EG4A 4HNRA 1WWKA 2CVOA 4S0XA 3MD9A 2VQFB 4B09A 2YCLA 1AD2A 2I4RA 3LKZA 3UVEA 2OXIA 4QKQA 1CYDA 1VG9B 5JNRA 3K1ZA 2H54A 2IXDA 4NMXB 2EJUA 2FMXA 3WK7A 4HQKA 3ZKWA 4BO6A 2BONA 1T2NA 5CT5A 3G0CA 3AU9A 5C81A 4NPAA 2NV6A 3G5LA 3F46A 3OFND 3C97A 3P4YA 4PAOA 2M1ZA 5F1YA 4U7DA 1Q83A 4C07A 1TO6A 1GITA 4O1IA 2XB6A 4MS1B 4DDUA 4C04A 2WSSD 5DU2A 1IZZA 1P9WA 5HKBA 3KNZA 3G3EA 1EFDN 3LSTA 3WNVA 2YZNA 2ZB2A 3C6BA 5KX5B 5CM2Z 3QG5A 4EYOA 4Y2JA 3D2CA 1H5UA 4L7QA 5DSXA 5HNKA 5CVJA 4MEAA 2GYWA 5A9SB 1DKMA 3DP9A 4GOKA 2Q5CA 2CHQA 4IV8A 4PICA 5AM1A 5EIHA 3UATA 3QOYA 1U2ZA 2WNSA 1E2HA 5FO0A 1K68A 2H3EA 5IAJA 2Q45A 4DAEA 2RGAA 1ZZEA 2WTBA 4N39A 5BYAA 1LSJA 2R8YA 3V2HA 1TCVA 1P74A 1Z6ZA 1LDMA 3GQBA 3N86A 4Q1FA 2R0QC 1CQIA 1VBFA 3O4VA 3OA2A 4Q47A 3T9AA 1QV7A 3V7UA 3SYLA 3WLOA 2NO1A 4PSDA 4OLJA 5J9FA 5DGHA 3SVLA 1ZK4A 2HMWA 2QMOA 4G2TA 4LDRA 2F4NA 1XPRA 5DYYA 2PBLA 1XA0A 2GXAA 3I04A 1FDIA 1RHRA 1GY8A 2FX3A 2QZSA 3LNTA 1AVTA 2QRQA 4G0XA 5CH5A 4YO7A 5FADA 4TV9F 3MTAA 4RMJA 2J7KA 3DOUA 2WJIA 1BMDA 1VBMA 2F64A 2Q4RA 4G0YA 4HDKB 4ZJUA 3E15A 4OQPA 5AJHA 3RF7A 1OT5A 5J40A 2EFJA 1V4BA 4EPYA 3L8DA 2OWEA 4DAOA 2XDAA 1XU9A 4W9NC 4BUCA 1ZMXA 4UBNA 3Q3HA 1TYEB 4TKLA 3W78A 5LZ2A 1VLHA 4FDUA 4OAPA 4L76A 3NT5A 4S2UA 4O8CA 3UJ7A 1WCIA 3DDCA 1PN3A 1QCDA 4MMZB 1EX7A 3QELB 3SHFA 3UGTA 3W5JA 1N5MA 4TLAA 1RRFA 3QU9A 4ESVA 5JXWA 4UPEA 3KXIA 1SRRA 2E4YA 4DCSA 4KLCA 4RM3A 1RTKA 4J7XA 3HUUA 1UBSB 1ZAKA 3A31A 5AHKA 2WINI 3L8CA 5EN4A 1XUOA 5AW0A 4Q7MB 4KIJA 5B37A 3SQDA 4E09A 1KXJA 1RJGA 1SULA 2IXTA 2EERA 3F7OA 4WKOA 1C3EA 2VPPA 3NDIA 4WERA 3PRKE 1SMKA 2PUVA 3I9KA 4OUDB 3WIEA 3CV3A 4CL3A 1A97A 1QONA 1CDOA 1CVLA 2RKOA 5JTTA 1JIQA 4BE7B 1PJZA 4GW3A 4LZZA 2EKQA 4QNNA 4BO0A 4GRDA 2JGLA 2FPLA 2ZTLA 1DCMA 1VLJA 4HRXA 4JUIA 3VYWA 1ODJA 1XRRA 2VT2A 1NQVA 8ABPA 4ZHSA 2EFCB 4YNBA 3LX6A 3KHKA 5BR1A 3I9JA 3QQ5A 4L9WA 4LZOA 3TLBA 3R09A 5CFOA 3PENA 4PW0A 2ZJ2A 4HH4A 4MW6A 1GIAA 2I0FA 4W5WA 4YIKA 4RFLA 2XKKA 3VMFA 3BXOA 2CUTA 4ZCLA 3TN7A 2XV1A 4B6RA 4O4IA 4I4IA 4NU5A 1Q1AA 3Q12A 1C14A 1VJRA 4GWGA 4Q4AB 4IDHA 3AGQA 2QMUA 4I1UA 3F0TA 3V00A 2G7ZA 2X0IA 1R50A 4HNVA 2ZYAA 5KOYA 1M34A 1VA5A 2I29A 3OO1A 3M6VA 3DL4A 4AY3A 2ZIXA 4DR7B 1X7WB 3H2YA 3KJZA 4TZTA 2OYRA 3R8XA 2BPOA 4BAGA 4PLWA 2W22A 1X39A 3CNEA 3SC4A 1DRVA 1KQOA 1ECBA 2YW9A 2WJ3A 1ETHA 3HKDA 3LO8A 5TGDA 5G53C 4E4RA 1QF6A 1N2HA 3ACCA 4A5OA 2IF2A 4PS1A 3WRXA 3DPUA 1V6SA 1MVLA 3FDFA 3N5CA 4Q1CA 2ONJA 3WJAA 3LWDA 4JC8A 4HDRA 2LW7A 4YFYA 3M89A 5C8DA 1KI8A 1RKXA 3LV8A 5IM4A 4M37A 5A9RA 4JI8B 1QE0A 4LDAA 1D4FA 4AMVA 2IEGA 3S40A 1QJ4A 2P90A 4MULA 3VDMA 3VHXA 4DUPA 4F3NA 3CUYA 3E0QA 3DM9B 4DA0A 1RWOA 2C99A 2YXEA 1FJHA 4DJ5X 1U8XX 4UDOA 4Q3EA 2HCJB 3VKUA 1D9ZA 4L9RA 3A25A 2XDWA 3OCCA 3KR2A 3UJ6A 3OFKA 3AR7A 3N59A 3RYIA 2OY0A 4HUJA 1JKXA 1TCCA 2JD0A 3M4YA 1NXWA 1CUDA 4K5QA 4NOMA 4QYWA 2V7WA 3DF7A 5F51A 4JA2A 4UPVA 5BSUA 3AB7A 1N5RA 3G2NA 1X8LA 4MQUA 4RZIA 3LYLA 2WG0A 3WSVA 1W5AA 4D02A 3DMNA 1NVVQ 2BMDA 4BC1A 2JIBA 4BFTA 4UBKA 2GAOA 3D3QA 1NNEA 2F1RA 1EQAA 2C8LA 4HQLA 4RDCA 1HDYA 2F6RA 3OF5A 1Y3AA 1HEYA 1N7HA 3KAJA 5BOVA 3VA7A 2Q3EA 2RHOA 3TQIA 4BWGA 3OO0A 4FFWA 5IDXA 3N7TA 1KI6A 4WY2A 5HRUA 2CBXA 1L7QA 2W6MA 3F6BX 3O38A 3L1JA 5HFAA 3V55A 3WBFA 4IDNA 4ETIA 4TM7A 1A9SA 1MVOA 1XXHB 1NA5A 3CISA 1QG0A 3IR5A 4FWBA 8LDHA 1AS3A 2H9AA 2Y1OA 4R5HA 1ZMBA 3BRCA 3OIFA 5HFJA 2RMKA 1K0FA 5KQGA 2Y71A 4HPJB 1KQ3A 2CNBA 3VU0A 1PTKA 2CMFA 3ILSA 4O63O 5D85A 2EKBA 2UVPB 4EB8A 4YMHA 5HK8A 1SIBE 2WWGA 4DNOA 1H2EA 1WHTB 2JFBA 1G3UA 5IT5A 3OOEA 1T15A 4DMGA 1KKUA 1SQ0A 2ZRGA 1KFEB 3WIUA 1QHHB 4FHGA 4M55A 5BOSB 2Z6QA 3LSYA 3R5FA 1SFRA 2QTHA 4YALA 1B4DA 5JDCC 3TE7A 4YCLA 2C3YA 3WGMA 3B6JA 4FYKA 2UZ4A 5CH8A 2CZCA 1E77A 3B2EA 3IP3A 2ZE7A 1EJ0A 4NICA 2ALJA 3BMQB 3U9TA 1FNMA 2J85A 3PK0A 4DSAA 1KYIA 2PMFA 5FAXA 2VP6A 4OHFA 3RJMA 5CFLA 5I3CA 4LF9B 3WK8A 1LSOA 3SHVA 2X4DA 1Y3IA 3BQ9A 3T5GA 4A8PA 1GSIA 1REQB 1R4MA 4L8FA 4BMSA 1KQNA 1DKUA 1KYZA 3O3NB 3PXGA 1KMIY 2DBRA 1C4XA 2AE1A 3QOWA 3IELA 3JD1A 4AZ0A 4BO4A 4YHHB 1KZGB 5EJ8A 3ESDA 4H1VA 5HCUA 3AK4A 3KB8A 2YJ3A 2ILTA 3EN0A 2JVIA 1NDQA 1T8UA 2GVDC 4FJ1A 3RU2A 3VHQA 4NS4A 4E32A 1JJIA 1YZLA 4J9UE 4TMZA 2WPDA 4XGIA 1PEKE 1Y8QB 2YFHA 4A82A 4BNFA 4EJFA 4D3DA 3Q10A 1U7ZA 2C77A 2R6GA 4X3PA 3UMFA 5L7TA 5JJIA 1Z4KA 2O07A 2O59A 1Y7TA 2VF4X 4O4LF 1X2BA 2Z8ZA 2JLUA 3THWA 1JL3A 3MS2A 4IG4A 5T5QA 3DVQX 3GFQA 4ZAYA 1NW8A 2JLBA 1JSRA 3S6JA 5LPNA 3CNLA 2X9VA 2ERCA 1BO6A 3CH4B 3NBXX 3ZLVA 4BFUA 2JKVA 4DA8A 3G13A 4DN6A 4RY9A 5JECA 5JJ5A 3KQKA 2YRWA 3JZAA 1EX9A 3W5VA 2IOFK 4DA4A 1FDRA 3Q2KA 1V9LA 4ZO4A 2FOLA 5FDFA 4B3MB 2D6FA 1VPDA 3EAQA 3QUTA 5HZHA 4GIBA 1U6IA 2AMYA 4Q3NA 1L5HA 4MUXA 1ODIA 3VYVA 2E89A 3BYZA 2W2LA 3LA6A 5DW3A 4ARZA 1RXEA 3S29A 4EATA 1H05A 1VI5A 2GXQA 2ZSEA 4DRXA 2PZKA 5DJ5A 3DBRB 1TJ3A 2X1HA 2OCDA 1T1RA 2Q9UA 5CLIA 4GM0A 1XEXA 2EW8A 5LM3A 1U0HC 4LYJA 2ZOSA 5FBHA 3NOVA 2AMLA 4N6NA 4R7ZA 4CKWA 4CMGA 3L7JA 3QLUC 3S2GA 2I7XA 2YXDA 4D9FA 2C07A 4B73A 4OGGA 5IK2D 1T29A 4X20A 1ZM7A 2VKTA 4D96A 1LWOA 2VBIA 4IYJA 5ETJA 4JQOA 3GFVA 5NLLA 2CNOA 1YDFA 1H1DA 2J0UB 3WP1B 4A91A 2CBZA 1MVNA 1NFQA 2QN8A 3JQBC 3R24A 4HPWA 4MSUA 3MQFA 5DF1A 4ZZ1A 1HDIA 3AKCA 1WLSA 4ECEA 4EMBA 3WIVA 2JFYA 3GH1A 4DOMA 4AZ3A 4CMJA 2IU4A 3K53A 1QIDA 1E7SA 1NR1A 1OB5A 2EATA 3CUUA 3DPIA 4R54A 5FIUA 3NTVA 2C92A 4PO9A 1H8HA 5DX0A 2NU8A 4PSUA 2CE7A 5DEIA 4WRRA 4XDGA 4Y9SA 2PT6A 3FJOA 4Q24A 3MJSA 4D4LA 1UJMA 2QUKA 3CLTC 3H5WA 4PHHA 1G7TA 4U6QA 2HEGA 3R7NA 4ZKDA 5DHAA 3EVNA 1PKXA 1P1KA 4EG0A 1YCFA 3L8YA 1PK8A 1YB1A 1DXYA 4NESA 3DMRA 2V6GA 5GMOA 4KB5A 4BYMA 3KSAC 2WLTA 4LCBA 4KE7A 3TRFA 3BILA 2X19A 3F1KA 3AKZA 2C3OA 1UAGA 1A8UA 4HNHA 4EGSA 1S7GA 4X44A 4CMEA 4DTIA 5BN3A 1SXJB 3AHHA 5NULA 3VU1A 10MHA 1RNLA 3AR6A 1P4RA 2VQ3A 3NS7A 1KEWA 1BKSB 4ZYXA 1ZK1A 3MJTA 4QPCA 4C87A 1HE8B 4EB6B 4YRNA 1Z6GA 1X80B 4GPTA 5CYOA 3UK0A 3UWOA 2J9YB 1VXRA 4Q01A 1PQUA 3EOZA 3AF3A 2ECPA 1XD2B 1GEGA 1NVMB 4WOCA 4TS1A 3K2BA 2YY6A 2NZ2A 2RH4A 3ZHSA 3O4IA 3OEHD 3SNHA 1TZMA 3CH5A 2I55A 2ZI7A 3GFTA 7YASA 1NVEA 3CF4A 2FZEA 3EFBA 3KQUA 3ZWDA 3I73A 4X1YA 5BSFA 2RI6A 4ZI7B 2DVMA 1YBMA 1ECFA 2V7UA 1QHSA 4HDQB 1WSBA 4OPMA 5AKIA 4FGLA 4LNHA 1N1DA 4PZLA 3U4MA 4HFJA 1CR4A 4B4VA 7GPBA 3EBOA 3H5AA 2ZR8A 1FEZA 4JD5A 4REQA 3LUPA 1W88A 3FFAA 4TMVA 2PMBA 4YACA 5H3CA 1T8SA 2Q8PA 3R5HA 1W48A 4M7PA 1SCUB 1P4HA 1SBHA 5TT1A 1EU1A 3DE7X 4RF2A 1NZFA 3PCXA 1XMSA 4J6FA 4YO8A 1J8YF 4NFYA 4F91B 4CHTA 4BFSA 3SGLA 4BGDA 1KPIA 1Q1ZA 3LW8A 4YJ3F 4GZ6A 4LCJA 2HPVA 1DIGA 5KTYA 3KWMA 1E20A 2A67A 5DTQA 4UUPA 1Q22A 4YRMA 3WQBA 5L51A 2ZBFA 1YJ8A 4PN7A 4JXKA 2HXGA 3FCAA 4UOZA 2P9HA 2CB0A 5DT2A 3DEIA 2R65A 1P0QA 1NX6A 1ZU4A 2DWOA 2W4QA 3GRKA 4O4IF 4B46A 2OV4A 4FBLA 4H3KB 2DXIA 2DR0A 3GLGA 1ZXBA 1JDZA 2FFQA 2NTNA 3GDHA 4ZT6A 4GHWA 1E3MA 4X7PA 1ZITA 4PXSA 3EW9A 5A1JA 3AEZA 1KJJA 4XI9A 3RD5A 3MW8A 3NIWA 2FJUA 2CT8A 5AOAA 1LTKA 3EIFA 4R8SA 2XCQA 3AI1A 2XUJA 1OMOA 4TLBA 3CBGA 4KQKA 4ZC1A 3WDMA 5HF9A 1JLKA 4BASA 3EZNA 3NWPA 1KH3A 3I0NA 3T4XA 5A4MS 4M98A 2BR4A 1D4OA 1VL2A 2IGBA 3HBFA 3HLTA 4G9GA 4KYVA 5I9MA 2FV8A 2LDXA 1CB0A 1OXXK 1N5LA 2Q6OA 3K8ZA 3NUGA 3RTDA 5JRDS 5IM4F 4IIFA 4HNQA 2FZCA 1VQ1A 3T7JA 4K40A 5KVCA 1GTRA 2G1JA 4EJ2A 1GR0A 1QIKA 2VATA 3I5UA 3IKJA 3WK9A 3BCRA 1EFLA 3IV7A 5JJBA 5F23A 4RSHA 4IEIA 4IV0A 1XA4A 5FF9A 3SR3A 2I4NA 3V3KA 1E4YA 1O58A 2CLEB 4MRMB 1E60A 2WD8A 1GLVA 2C8KA 4QYIB 5I7WA 3H3XA 4MVJE 4KRGA 4RDHA 1CIPA 1DNPA 2QX7A 4URHA 3RVQA 2Z57A 2I1WA 2NG1A 4O3FA 4A26A 1ML4A 3C6ZA 2IQ5A 1EM6A 2RHLA 4RXMA 4L02A 4XR4A 1UCFA 1M75A 2OLKA 1S9DA 3DQQA 3CEMA 3BOSA 3GJ0A 4RV5A 5AFSA 2PL9A 5B1DA 4GI1A 4KBFA 3OJCA 4M8LA 4FDAA 1GZSA 1U02A 2ID7A 1PBTA 2RHJA 1M5UA 3C3MA 4QJIA 5EJMA 1JDNA 3TIGA 4CFYA 3FMFA 1WE2A 2VYFA 2XTZA 3LFTA 4BLTA 4DG5A 3FNHA 4FFBB 4NDNE 2XMGA 2VQDA 1DMSA 1QTIA 3KT0A 3D6NB 4UM8B 2PFKA 1AV6A 2O19A 2CDRA 3E5HA 4UHEA 2Q1TA 1N9GB 1AUOA 1U81A 1SCDA 1A82A 3A6JA 4ZGBA 5JYBA 3GLFB 2I80A 1N2GA 3I5AA 1XV5A 4OQNA 3FDJA 4GP9A 4QVGA 3WVNA 4BLPA 5BV0A 4FGZA 1NQTA 3SMQA 1DXOA 3NDRA 4L5JA 2AS0A 3TKAA 5CCXA 1BXRB 3LDAA 5GOTA 3UV3A 4FYHA 3KQLA 2Q5FA 3A2LA 2QT9A 2YZKA 1MF7A 1MAAA 4AJ1A 2OD2A 2QLLA 3O47A 4BS9A 3A2NA 4YRTA 4B74A 4RF5A 2O7SA 2UXBB 5EFOA 1SHUX 2PX4A 4N40A 1DAOA 5FRDA 421PA 3BDVA 4P4LA 4Q3BA 1XRMA 3IODA 2IYWA 2VWPA 4FPXA 4JJIA 3HB4X 1OX5A 1JE1A 1W5TA 3JASB 4HAWA 1XTRA 3N2GA 1G20A 3L3BA 2V7BA 1LBEA 4GZMA 1F38A 4FFPA 1IZ7A 3NC0C 1U0LA 1I80A 4RMGA 3MTGA 4JDUA 3RYFB 4YGXB 1JHPA 3PFIA 2GF0A 4QJ4A 4KXQA 4QU5A 4B32A 2JFXA 2CNDA 2IGTA 4E2WA 3FOFC 4WZBB 3FOEC 2H0QA 4C06A 2PG3A 2W2TA 2FX2A 3PJFA 4EG8A 1H23A 4F5ZA 2G9RA 3Q3JB 4KMSA 4Q4JA 4UUAA 3S1AA 1N5JA 4JOQA 3WMFA 4BNDA 5BWBA 2WP8J 5JHGB 5KNBH 1FLAA 2XMDA 3I2JA 5LP6A 2FH5B 5G40A 1ISIA 3OZXA 3RVMA 1H2AS 4YMLA 4BEBA 4XIYA 1THGA 1P5RA 5DCLA 4UTRA 5CMLA 2FRVA 3WNBA 1LI5A 1G21E 1NV9A 2YC4C 1ZC4A 2XECA 3I1FA 5BNWA 1EYZA 3ESXA 3FVTA 1DQZA 1RFLA 2PJRA 3KTDA 3T7EA 3FPFA 2IX3A 1N6NA 4CMAA 1PJBA 4Z3DA 2VJOA 4TQAA 1KR5A 1BSVA 4B8WA 2ATXA 2V9PA 2Y1LA 3FPBA 2OESA 3VO9A 3NJRA 5JD3A 3FGOA 1EQ2A 5AICA 5CIQA 3T12A 4D3YA 4C6RA 1PT5A 1PI3A 4DNQA 5J47A 1LK5A 1ZJWA 4KL8S 2IZ6A 2QN1A 3ZDCA 5C4IA 2ZRJA 1OWPA 2FI1A 3QMWA 4K7JA 1RKVA 5K05A 1RE0A 3HNPA 2EARA 3T3MB 4M3NA 2UZAA 4K6GA 4RELA 4Z9BA 1D07A 3VR6H 4CKBB 2NNLD 5K0CA 1AXEA 3EVCA 4JB8A 1NBEA 4JI0B 3QGMA 1TXGA 2IXGA 2FJPA 2D1TA 4G09A 3HZRA 5DULA 5EHNA 4B4DA 1F7VA 3MWDB 2ECOA 1W0CA 1XROA 3PE3A 5T6BA 5IFLA 3GGJA 5EJGA 4F84A 3FR8A 2AJLI 3GROA 2X58A 4WCFB 3QMPA 4COOA 1L4MA 2CL6X 5LD2C 4B8ZA 4KR2A 3WLLA 4AWXA 4TYQA 3HYRA 1PGNA 1XCLA 2E82A 2FUNB 4GKVA 3GMSA 4DZTA 2Q4DA 4EA7A 4L8GA 4AU1A 1V16A 3NB0A 3PR2B 5CHYA 2W6ZA 5FTNA 1Y37A 5AW5A 3C24A 5J4LA 2WK1A 5E1OA 4BLRA 1G8JA 4AJNA 1TEZA 2PUDA 4IGAA 2Z2KA 2HCFA 2QIOA 5CB0A 1I2BA 1NX9A 4JI4B 1EK1A 2YQZA 4JUBA 4R3NA 1Q3TA 2EF1A 1MD9A 1G4UR 1NPDA 3H9QA 1KJZA 4TT8A 3H2KA 4BB6A 4BLSA 4QTUB 3N76A 1Y6RA 5CA1A 3ZJYA 2HPHA 3SEZA 4C4SA 4FHFA 3RRZA 2Q46A 3VKGA 5K0LA 5FUBA 2JFNA 4K28A 4JBXA 1GPYA 3M3HA 3WWDA 3GRUA 2QJWA 4ETNA 3I2FA 4L0MA 3G2QA 1P80A 3V4LA 3P0HA 3QBJA 4ZT4A 3WQSB 5C7OO 2ZZMA 4IOLA 3FYUC 3P0EA 2Z5FA 1Y48E 1GV1A 3W2HA 1MB3A 4G36A 4JBGA 1CTQA 3EC7A 1KSFX 2GTHA 2DFKB 5FTJA 1IJFA 3RLFA 1CXZA 1ZCAA 4I0WB 2O4UX 5KWEA 1IAVA 2CNNA 1GN9A 1NFFA 4QFBA 4NMHA 4O4LB 3PF9A 4YONB 1A2OA 3R44A 4J0GA 4B83A 4E3ZA 1E3QA 1W4BA 3CNBA 4M1OA 4WA7A 1GZHB 1OTHA 1ZSNA 4UE2A 1FFAA 4MYRA 1I6MA 4L3VA 5EAIA 4FCTA 3EWAA 2HQBA 3ZXYA 2W42A 1ORHA 3FHCB 3GIWA 4GP7A 4PTZA 4UULA 4E7OA 2XUOA 2ZITA 1KJIA 1W96A 1X7XA 4YT2A 2VQEB 4ZQIA 1SKYB 2ZRNA 4XGQA 4DREA 2VVTA 1O57A 4PS0A 4EGFA 4PVCA 3VPFA 1UK6A 5LL6P 4DSNA 2OAEA 3CRRA 3I09A 3NNSA 1PVDA 1DXQA 3DL7A 3DJFA 3ZKWB 2BM9A 4RL6A 3NV9A 3QLEA 1LI7A 2D1SA 2QYOA 1J0CA 5ICCA 1KMNA 1NLMA 4C0QC 2P79A 1FX0B 1TYAE 3FVRA 2DSTA 1EWQA 2JFQA 2ZFUA 3RVSA 2O2HA 4KIFA 4LOHA 3F71A 2ZXEA 3ZCRA 5IG2A 1WMAA 3WNDA 1WBBA 2BHTA 4JIGA 1OYYA 3ND8A 5TT0A 3W8DA 4QOEA 4QU8A 4CI0B 4EB3A 3DGEC 4KNVA 1I01A 3CONA 4XM2A 4OJNA 2PZFA 1IZYA 4QRIA 3IMFA 5EXDA 4LBVA 3MTEA 3DMYA 4EEXA 2GYVA 1CUFA 1NW6A 2VHJA 1JIJA 4G65A 1GD1O 2AHRA 3P7MA 1JA0A 2FLVA 2YOHA 1HTWA 2GPSA 3HWSA 2QLBA 1DG1G 3GJ5A 3PI7A 3I9V1 4MR7A 4CTJA 4DDTA 1D0SA