2N47A

Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
197
structure length
197
Chain Sequence
MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Structural genomics, unknown function
molecule keywords Slr1183 protein
total genus 47
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2n47A00
3MQ2A 3KQSA 1P1CA 3M6WA 4RVGA 4AZVA 3UJ8A 3QOWA 1NW8A 2ZULA 5E1BA 2NNWB 4PWYA 3FTFA 2JH8A 3DMGA 3CC8A 4AZWA 1AF7A 4HG2A 2ERCA 1VQ1A 2O05A 5CUQA 4A6DA 3FTEA 3EVDA 2BH2A 4DQ0A 5IKMA 5BW4A 4BLWA 5FULA 1O54A 3HCEA 3ID6C 1VL5A 4XCXA 2OYRA 3FPGA 5DRYA 4F84A 4KVZA 1JSZA 4R05A 3A4TA 5HEKA 1JTEA 3TPZA 3JWIA 4PIMA 3TR6A 5ICGA 5HOQA 1VIDA 3NDIA 4Y30A 1XTPA 2CMHA 3EGIA 5GP1A 5H02A 2QM3A 2PV0A 2PWPA 3EVGA 4YUZA 1WXXA 2ZCJA 1AQJA 5K0LA 5FHRA 2Z6UA 3SSOA 5K09A 1KIAA 3ANXA 4DZRA 3IEIA 5EPEA 3I58A 3VSEA 3BGIA 4DF3A 3ORHA 4FT4A 3TRKA 3FYDA 2IPXA 4QQKA 2AN3A 3A7EA 3GGDA 5EG5A 3THSA 3U81A 1NV9A 2ZBPA 1IY9A 3KR1A 5LQUA 4PINA 3FZGA 4FR0A 4R6WA 1M6EX 3P2IA 3UBTA 5CVEA 4RTNA 2G72A 1Z3CA 1XDUA 5EKXA 5FWDA 4E2YA 5HILA 2XYRA 1KPGA 5EMKA 3O7WA 2AN4A 4U7TB 1Q0SA 3KQPA 5T67A 5ICFA 3HVIA 4G56A 1D2HA 5M5BA 3GRZA 2IFTA 3OCJA 3P9KA 1NW7A 4CKCA 4GC9A 1ZGJA 2EG5A 3O4FA 4LG1A 4U7PB 4EMSA 1SG9A 4B17A 2ZLBA 4DCGA 5E8JA 1ORHA 2FYTA 3DMHA 4V0QA 4GOOD 3P71T 5K8VA 4DMGA 5EIFA 2A14A 3Q87B 4GC5A 5DM1A 5F2KA 3WSTA 3PX3A 4OX9Y 2AOUA 3LDGA 4K6MA 3DMFA 5P8WA 3FUWA 3UZUA 2ZIGA 1XJ5A 2K4MA 4E2ZA 3OU6A 3LSTA 5DRTA 4C03A 2NXCA 3AJDA 3TKAA 1Y8CA 3CJTA 2CL5A 3EVAA 3HEMA 4E70A 4F86A 5KS2A 3BZBA 1L3CA 3C6KA 1G6Q1 4ER3A 3T0IA 5F2OA 1N7JA 1KYWA 1RJGA 1NBHA 4MWZA 4OA8A 5LQAA 2ZW9A 5EHGA 3HM2A 3REOA 5DTRA 2G1PA 1QANA 3V8VA 1YF3A 1SVUA 5CCBA 2ORED 5EEHA 2H11A 3KQOA 2HWKA 4E32A 5CD1A 5K0NA 4DM3A 4YMGA 2VS1A 2JHPA 2AOTA 4DA4A 1JQ3A 4CTKA 4PGHA 5CIYA 2UYOA 4UOEA 1NKVA 2ZBRA 1P39A 3OPNA 1RI2A 5HIJA 2CKDA 1XCLA 4ER0A 2XBMA 4HC4A 5EMJA 3GNLA 1MHTA 4YV2A 5E2BA 1FP1D 2I62A 3FPJA 3P9IA 1RJFA 3GO4A 2YXDA 10MHA 1R18A 2PLWA 1Q0TA 2UYHA 4OBWA 3VC1A 4C04A 3UJCA 5FADA 4RTSA 4ER6A 2PX2A 2IBTA 1KP9A 5FCDA 2NP7A 4M38A 3PLAE 4IWNA 1DL5A 3EGVA 3UJ6A 3UJ7A 3PFGA 2O07A 4YUWA 4RTPA 1O9HA 3LKDA 2P3QA 4RVFA 2Z6QA 1SUIA 2B9EA 3L8DA 1KR5A 4EQZA 5GM1A 2ZVJA 3M6VA 4P7KA 3TQSA 1PJZA 5FHQA 3C3YA 2IP2A 3HA5A 3GIWA 3MTEA 1SUSA 3B89A 2EX4A 4P7JA 4V0RA 1TW3A 4GF5A 1V39A 1VP9A 3CGGA 4WVLA 3NMUF 3KHKA 2PKWA 3ME5A 1G60A 2N47A 5DM0A 2ADMA 2AOTB 2IGTA 3NJRA 2GAFA 5E8RA 3NVKI 1X1DA 2AOXA 1D2CA 1JSXA 1U2ZA 3LBFA 1JQEA 1RI4A 3NVMB 3I5UA 2Y1WA 1SQGA 4HGZA 2VP3A 2ZSUA 4FT2A 2Q41A 1X1CA 3SMQA 5K03A 3B3JA 2PT6A 1RJDA 3R3HA 3ELUA 3TM5A 5DWQA 3P9NA 5CVUA 1R8XA 2V7EA 4FGZA 4QPNA 4LWOA 8MHTA 2OPBA 3LCCA 3B3FA 1NE2A 4PYLA 3DP7A 9MHTA 5C0OE 4X63A 3I64A 3GXOA 3UJDA 2ZZNA 4R8RA 2PBFA 2ZWAA 2BM8A 3DXYA 2ZZMA 2FHPA 2FPOA 2PT9A 3NW9A 5FQNA 4BP1A 4C05A 4YV1A 2PJDA 3BGDA 3E7PA 3E23A 1JG2A 1VP3A 4CXMA 3AY0A 3ER9A 4AUKA 2AVDA 1R00A 3GRVA 4MHTA 5EMLA 1SKMA 3DXZA 4IKPA 4HSGA 4O29A 4X60A 5DX8A 1FP2A 3OFKA 2ONZA 4KDCA 2I7CA 1QZZA 2YR0A 3HP7A 3KR2A 4PYNA 1ZQ9A 4WXHA 5E2AA 3TMAA 4R8SA 4RYLA 1IXKA 2B78A 2ZWVA 3R6TA 1EIZA 3FUXA 2NXNA 4M37A 3MCTA 2PVCA 4DKJA 4HTFB 4PYKA 4GOLD 3AWIA 3LHDA 4FSXA 5K0CA 1BOOA 4BY9E 3KPJA 3PB3A 3ERCA 3IHTA 5CVDA 1JG3A 3NDJA 1KHHA 2JHCA 2YVLA 3M33A 3MTIA 1NW3A 1JG4A 5DSTA 1HMYA 1WXWA 3KQTA 5EGSA 5K0JA 1G55A 3AXTA 4XUCA 4QDJA 3OZSA 1QAMA 1QYRA 3KR9A 1F3LA 4OA5A 5EZQA 2IH4A 1I9GA 1WS6A 2ZZKA 4ISCA 2YUIA 5EZSA 5EC8A 3KPWA 3CBGA 4ZTBA 2QRVB 1QAQA 5K0BA 4XUEA 5GINE 4RTRA 5DLYA 3KPVA 2R6ZA 2XYQA 4P58A 1SQFA 3VC2A 3S68A 3LDUA 4PCAA 1JQDA 5F2NA 2P7HA 5DX0A 3A25A 1QAOA 3RW9A 3UJBA 1YZ3A 3CVOA 5K05A 1NV8A 3TOSA 2GLUA 5LQJA 1ZG3A 3UA3A 3BT7A 2IBSA 3DUWA 3FUVA 2VDUE 2NYUA 3KKZA 3RIEA 3M6XA 1JR4A 3MB5A 4F85A 5CCXA 3G8AA 3KQMA 1RJEA 1X1AA 2ZIEA 3MHTA 4KIFA 2QRVA 3EVEA 4KIGA 4E2WA 5BW5A 1L9KA 3EPPA 2PGXA 3P2EA 3UJAA 3B3GA 2VDWA 2E5WA 4M36A 5DXAA 3BUSA 2BM9A 1T43A 2BR5A 3SGLA 2AN5A 3PTAA 3HVJA 2EJTA 4FSDA 1R74A 4PCLA 3ER8A 3G7UA 5CVVA 2F8LA 2PX8A 5HFJA 2UYQA 1D2GA 3BKXA 3R0QA 2Y1XA 5HZMA 2IDKA 3P9CA 4EKIA 4LECA 4RV9A 3DULA 4HTFA 5E1MA 1WZNA 3D2LA 3EMDA 3SSNA 2GS9A 2P35A 2AOWA 3ELWA 5E1OA 4C07A 5BXYA 2Z6AA 5EIWA 2YX1A 3DH0A 3E05A 3MAGA 5G02A 4A6EA 1H1DA 2HMYB 1UWVA 2G70A 1G8AA 3QV2A 3RODA 4POOA 5EHIA 3JWHA 2HNKA 3PS9A 3A7DA 4R6XA 2O06A 5D1HA 1YB2A 1YZHA 4EK9A 1L1EA 2OO3A 2ZTHA 1G8SA 3C0KA 3G8BA 4DCMA 1FJXA 5JUWA 2ZBQA 3SX0A 4IV8A 4MIKA 3EEOA 5CVJA 3CKKA 3JWJA 1EAMA 3M6UA 2PY6A 3OU2A 5D1NA 5LQRA 3FUTA 1G38A 3TLJA 5LQNA 3FUUA 5KVAA 4RTOA 2C7QA 3AXSA 3P97A 3LL7A 5LSAA 2IH5A 3QOXA 3G5LA 1KPHA 3GRUA 4ER7A 1MJFA 2OY0A 3G2PA 2DPMA 3B7PA 1R6AA 1FPQA 3EVFA 3M4XA 3SM3A 1KPIA 1VPTA 3UJ9A 4OQDA 3GDHA 2NP6A 1IM8A 5CM2Z 1XDZA 3LGAA 4LWPA 4X61A 3GWZA 3BWBA 3DLCA 4X41A 2DULA 5KQSA 4GOND 5LQCA 5FQOA 4C08A 1X19A 1AQIA 3P2KA 3LCVB 2EFJA 2H1RA 5E1DA 5DTQA 1NBIA 4ER5A 2PXXA 1PRYA 4HGYA 2JHAA 3G2OA 3ELYA 3LDFA 4P7FA 3SXJA 3T7SA 3FRHA 4AZSA 3OFJA 5KQRA 4QVKA 2I9KA 5FA5A 2P8JA 5T64A 4H0NA 4E33A 3HCFA 3EVCA 1HNNA 2GH1A 4CKEA 5BP7A 2B2CA 2JH9A 2FCAA 1ZGAA 3HA7A 3KQVA 3BGVA 4IV0A 4RWZA 2VZ9A 5HIMA 3TFWA 4EKGA 1XDSA 2CWWA 2KW5A 4KW7A 4KRGA 5E9QA 5K0EA 1AV6A 2YXLA 2QY6A 3GCZA 5FTWA 5K01A 1VE3A 3FTDA 5DM2A 2I6GA 3BWCA 4E30A 3MERA 1X1BA 4QVGA 5GWXA 3HVHA 2IDJA 1P1BA 4XUDA 4PYMA 3OZTA 5B1SA 2IH2A 2WA1A 3LBYA 4RVHA 3JWGA 3H2BA 5EVJA 4JXJA 1BKYA 4YUXA 5GIOE 2JG3A 4RSRA 1FBNA 4BLUA 3T7TA 3KQYA 5HIKA 2BR3A 2JJQA 3BXOA 3NTVA 4E31A 4X1OA 3G5TA 2P3LA 2AR0A 4NECA 3OE4A 3C3PA 2V74B 5EEGA 3PVCA 3FPFA 5ICCA 1BC5A 3OE5A 1RI3A 2OZVA 2AZTA 3X0DA 4CWAA 2G8NA 2P3OA 3O31A 1N7IA 4P7GA 3CCFA 5C1IA 1M0EA 3MCZA 3KU1A 3UFBA 3A26A 3EVZA 2PXCA 4GBED 4L7VA 4QDKA 4YV0A 3SR4A 4RTLA 3KPYA 2BZGA 4Z2YA 3DLIA 1JTFA 1ORIA 2P1DA 4PIPA 1INLA 2EJUA 2YQZA 5LR6A 1F38A 3EVBA 2H00A 1XVAA 1YFLA 2NXEA 3LECA 3NWEA 1UIRA 5DT2A 5DTMA 3HTXA 3SSMA 2PSSA 4FP9A 3G2QA 3BWYA 3FRIA 3UWPA 2AOVA 4BLVA 2ZFUA 3A27A 5EQJB 5MHTA 2IIPA 3HVKA 3KR0A 2XVAA 4GEKA 4RX1A 1WG8A 3HCAA 3I53A 5ERGB 5EKUA 3HCDA 3GU3A 1O9GA 1ZHFA 2FK8A 2GPYA 2OXTA 2C7RA 1NW6A 3IV6A 2UZ4A 3GJYA 2XYVA 2AOUB 1L3BA 3CJQA 1YFJA 3FPEA 2ZIFA 4MTLA 5FWAA 3G89A 4CTJA 1RI1A 4M7RA 1UFKA 3HCCA 3HA3A 5DXJA 3BKWA 3FTCA 2OB1A 4C4AA 5LQKA 1L3IA 3VYWA 5FA8A 4C06A 4YMHA 1VLMA 5ICEA 4AX8A 2B25A 3K0BA 3M70A 4PYIA 5DPMA 5EMMA 3PT9A 3V97A 3G2MA 3C6MA 3LKZA 5GM2A 3R24A 4GQBA 2C7PA 2FK7A 3KQWA 2HR1A 5DM4A 4KDRA 3EMBA 3DOUA 4Y2HA 4FS8A 2NXJA 1M6YA 3F4KA 4OBXA 3T7RA 3TM4A 4QTUB 1YUBA 3UA4A 3OZRA 1DUSA 3E8SA 3ELDA 3DXXA 1BHJA 3FPHA 3PX2A 2P40A 4AZTA 1TW2A 1I4WA 2OBFA 1XCJA 3EEYA 3P8ZA 4CKBA 1KYZA 4PNEA 1VBFA 4RTJA 3BWMA 3DTNA 2GA9A 5T6BA 2C7OA 4RTQA 2QYOA 5K0FA 1RI5A 3K6RA 3OU7A 1P91A 2R3SA 1N2XA 2FRXA 4PYQA 5KYGA 3EGEA 1OR8A 2CMGA 4PGGA 4BP3A 3DR5A 2WK1A 3LCUA 5IH3A 3R9XB 2AVNA 5DX1A 2XVMA 1I1NA 3IYLW 4MQ4A 5U4XA 1DCTA 7MHTA 2LD4A 4YUYA 4HH4A 2QE6A 1XXLA 4E2XA 2WA2A 4RVDA 5HIIA 3CJRA 3LPMA 2OKCA 3GRYA 2PX5A 2OB2A 3B5IA 5E9JA 3SVZA 3TKYA 2B3TA 3KQQA 5C9ZA 2O0LA 3MGGA 3HNRA 2ESRA 2G71A 1EQAA 2BR4A 1EG2A 2GB4A 3FYCA 1B42A 3HCBA 4FZVA 4GUAA 1ZKDA 4QPPA 5EOVA 4PYOA 2ONYA 1R8YA 5E9WA 5JR3A 2P41A 3PFHA 1WY7A 2PX4A 4KWCA 4HRAA 3NWBA 1TPYA 3G88A 2YXEA 3I9FA 4GOMD 1KXZA 4OQEA 5K0GA 4YUVA 2UYCA 4PYJA 1EJ6A 4PONA 4RTMA 2HTEA 2PWYA 3Q7EA 4QTTB 1NW5A 2AS0A 1EJ0A 2P7IA 3GRRA 4EVIA 4RTKA 2VDVE 5DSXA 5FUBA 5GIPE 1NT2A 5GOZA 2PXAA 2O57A 3KPUA 4ATNA 1JG1A 2HV9A 3LX6A 2YTZA 4QQNA 3THRA
chains in the Genus database with same CATH superfamily
2X23A 4MVXA 2HQOA 2V59A 4NBUA 3L9XA 1P1CA 3FGZA 3IAAA 4H77A 4HQOA 1XMPA 4PLWA 4U7JA 5ELMA 4BBJA 2ISCA 5EJ4A 5FUVA 4NZYA 2DKOA 1ZRNA 1ZGGA 2FRVA 3I8XA 1RXIA 1UMDB 2ZK7A 2QI9C 5IMBA 1FSPA 4EJMA 4LC0A 2D13A 4NHEA 2PD6A 3EG5A 2WFZA 4A36A 3ILSA 4K1LA 4EGCB 3NP9A 5KYUB 4PPQA 4MR7B 3N8KA 2AGVA 3I0ZA 3CZQA 3LO8A 1ZICA 1DVRA 4DYHA 2H8GA 2OYRA 4GXNA 2VZ0A 3KHSA 5AUPB 3F49S 3TQHA 4U8GA 4JGBA 4LMAA 1BRTA 3ICCA 1E7YA 1GPUA 3DWGA 2ATIA 1KY4A 4DUGA 3A3YA 3PIDA 4WFKA 3S5JA 4OXXA 2OLKA 2R0QC 1DIAA 4GG1A 2E18A 1GDDA 3TDKA 5EJ8A 1HKUA 2PVPA 1FU7A 3IC5A 2X0KA 4S1OA 5JI2E 4TVBA 1D07A 5CT5A 3BDVA 4J03A 2FQXA 5M04A 3V1MA 3FD8A 3WBJA 2VBFA 1MB0A 2VK2A 2C7VA 3H4IA 4JAVC 4KFTA 1H2BA 2WAXA 4D9MA 1YB7A 2EZ4A 3HUDA 4IKEA 4ND6A 1HDOA 3PKIA 1JT9A 5GOTA 5LQUA 2J0QA 2V6FA 3G7SA 5TEVA 4CDMA 4NY1A 1BMFD 2G72A 2WM9B 4UZEA 4C22A 4RTNA 4GR4A 5C8VA 2BT4A 3HMKA 1BG6A 2XYRA 2WWHA 2ZE6A 2ZIXB 3L7MA 3QVJA 5EJAA 3TCNA 3VR3D 4DXDA 3AHHA 1X70A 1SUEA 1U9IA 3JD0A 1S96A 3MT9A 3WYEA 4BFCA 3COWA 3HVIA 3MYRA 3PUXA 4GL2A 4O0LA 3AM3A 4C0AC 2BI8A 1VPEA 2J08A 2BHSA 2J3EA 4FCVA 3WRYA 4COOA 5JYDA 1M67A 4ZARA 4C14A 4B17A 2DFLA 1PR2A 4FHDA 4UNPA 4M6WA 2ZSHA 3U17A 3IT3A 4V0QA 5G40A 1Z2AA 1X92A 4XB6B 1U63A 1NRWA 4XLZA 3F78A 4M54A 5H16A 1D9ZA 1Y1PA 2I54A 1MJGM 4IWXA 2C54A 1FE8A 3PX3A 3R41A 4KUEA 3TG8A 4X84A 1RRPA 2DPYA 1TO6A 4AD8A 2ARKA 3FOAA 4LXHA 1XJ5A 2RIPA 3UMFA 4E2ZA 2GFHA 4ZO8A 3CJTA 1CVIA 4YPOA 1NDHA 2Y8EA 1Y9AA 4Z4CA 5TQ2A 4DPLA 4M87A 4Y1EA 2ZUDA 3TZLA 1XLVA 3KIPA 3HLTA 3O91A 4R1UA 4D8XA 1XEFA 1WOYA 5J4LA 3PQ7A 1VG0B 4FI3F 5EGNA 1QHGA 3REQA 1XLWA 1IHYA 4PBSA 5E4TA 1A8SA 2HWKA 1DAPA 2XRMA 3VC7A 4UTOA 3TSWA 1OBHA 4YAIA 5KQMA 3FZQA 5LIPA 3PPWA 5K3BA 1U7ZA 5LXTA 3BWXA 5F3WB 3AILA 1CQPA 1TUGA 2F90A 3HBJA 1I2CA 3LQYA 2R1TB 1F2TA 3FNFA 3D64A 5DYWA 3ETJA 1DRKA 1MCZA 5JWHA 4EDHA 2J5XA 3DOHA 5SYAA 3QI2A 1GV1A 2XMRA 4X1IA 2C9YA 3RSOA 1KP9A 1ULZA 3DE7X 5G0WA 3BGWA 2AE1A 3CCCA 3ZWPA 1DL5A 1L5HA 4WESA 3UJ6A 3ZBUA 4GPD1 1C7FA 4TLCA 5AM2A 2OILA 2WDZA 1SUIA 1NIPA 2PZFA 5HX7A 2F43B 3RHZA 1US8A 5AI6A 4U3JA 1U3VA 2O5VA 1EEXB 4UFPA 2A9VA 3AGPA 5LQMA 4RA9B 4M3NA 3O84A 3TPCA 2QZZA 2YWFA 5A5FA 3O26A 2XTMA 3C3JA 3HXPA 5LNK1 1QWSA 3KFLA 3ADPA 2W8BB 3D81A 3HU1A 1Q3TA 2C59A 3OM8A 4JQCA 4L75A 4M6WB 1LA2A 3IJ5A 4UVDA 1KI6B 1FS6A 2OC4A 3KHKA 1AM4D 4NWIA 3UK2A 3U19A 4Z4QA 3DE1X 2MYPA 5MGNA 1IWBB 1L5WA 3HBNA 3TQIA 2PO5A 2DY0A 2VH5R 3D8BA 3MXTA 5HZGA 2P68A 4TMFA 3RJZA 2P4EA 1XA0A 4QYIA 4KR7A 1CLUA 1THGA 1Z73A 2W2LD 1UBFA 2IF2A 1JALA 1JUDA 2FLKA 5CRIA 4EYQA 4A27A 2WR8A 2O5EA 5JLAA 3SEQA 1YNSA 3S70A 3CZ9A 1ILWA 2IODA 1HYGA 1ZITA 2O4CA 3OA0A 1CDDA 1R8XA 3N39C 4HNSA 4LC9A 2F62A 4Y67A 5IBPA 5B6JA 4WN9B 2VDPB 4V0MA 1B23P 3OTGA 5L7WA 4BX8A 4D4GA 3SZMA 4Z5XA 3KYCB 3T4UA 4XVUA 3GBSA 2BUAA 4KFRA 4PAQA 1CR0A 3H9EO 2ZUBA 4LIPD 3FDXA 4QUJA 1QH0A 3RJMA 2IHZA 2ODAA 4N0MA 3RKSA 1M2KA 1TCAA 4DBVO 4JEHA 1PR6A 2OZKA 1U0FA 1EESA 4JBHA 4FNOA 1MVLA 1W9MA 4KHPB 3EXHA 1RHRA 2YR0A 4MO2A 4WJZA 3KR2A 3EPLA 2ZIXA 3AYZB 2FEWB 4MRPA 5BQOA 2AC7A 1EUCB 1MPXA 4IIFA 4KDEA 1C4XA 3VH1A 5JMOA 3HGTA 2PSDA 1KSHA 3UKDA 3RAFC 2X14A 1ULSA 4TTIA 4GKJB 4XTCS 1HDEA 5I9TA 2PRYA 5EIOA 2I91A 3CUWA 4QBIA 4BB9A 2EBFX 1D04A 3IGFA 4H3HB 3CTMA 4FCTA 4X8MA 1GT91 3QEOA 4FOLA 1FTGA 3SZGA 2HREA 2Z8YA 3HUTA 5TMDA 3WMEA 4O4JB 3HSSA 4DV1B 1G9XA 4MQ6A 4OREX 1V1RA 1QYRA 2GO7A 1PVVA 1ZH4A 3BA1A 1EE9A 2ZT6A 1F3LA 1QFYA 3AM4A 3D8HA 3GT4A 3HLKA 4CR7A 5LP6B 1WS6A 4NS1A 4IDHA 3LP5A 4UU8A 3EXG1 3R5KA 2B83A 2IXBA 4KQWA 3A4MA 2OM6A 2QRVB 4OGWA 3OP1A 4URYR 1V25A 1Z08A 5FJIA 3SU8A 3WWYA 3AF0A 3B20A 1HO3A 1TAHA 2FCRA 2LKCA 3LCMA 2P3SA 2W0SA 4OFXA 5TPZD 3WICA 3VISA 1P1HA 2PJUA 3L8FA 4RSGA 3ZH9B 1V9CA 4UASA 5ITWA 3RS7A 3I28A 3NVAA 1IONA 1RMYA 4E5SA 4NESA 2VDOB 4Z0PA 1YNOA 4BKRA 1X7ZB 4QDXA 4CKXA 1XCBA 3N53A 2X7JA 1ML4A 1CULC 2JIBA 4IGFA 3VZSA 1DU4A 4G9BA 4KO4S 3H7IA 1O0SA 5LQJA 3QZUA 1ZNYA 2GGSA 2IHVA 2NUAA 2BGNA 2DWPA 3VC3A 2CK3A 4UBOA 5IJXA 1FDOA 3OC6A 2OV4A 3PIIA 5HKKD 1NYQA 3U13A 5K6AC 4DV0B 4M60A 1SVOA 1GL3A 2O7VA 2W2KB 3G8AA 4QXRA 4JX8A 4XWTA 3KO8A 4S1PA 3WYGA 2IITA 3OIUA 3AP1A 1X77A 3L7JA 3B3QA 4QM6A 5GQSA 1GSIA 1T2FA 2ECFA 1ODKA 1CK4A 4O4JA 1JJAA 2J3MA 4K6CA 3FLAA 2I4TA 1DXOA 3G8DA 4WNYA 3UCXA 3ER8A 2ZR0A 1BHQ1 4CODB 1MMFB 4OXNA 1QB8A 1UT5A 3KWLA 5HFJA 4EATA 2GCIA 1QGED 4EHHA 1Z28A 3V8EA 1ISIA 1NOKA 1N0VC 4NIMA 5JQGA 4KYUA 2VYVD 2CSXA 1EFLA 1SOUA 4F46A 4GT1A 2AOWA 1ZD5A 2LIPA 4BNKA 2IYVA 3DH0A 3GUZA 2AEEA 3QPVA 5AVTA 2BC9A 1I33A 3H8VA 4ITUA 2HMYB 3UKOA 1DNPA 3CE6A 3JY6A 4YRGA 5CDSA 4R71A 4GMFA 5EHIA 2RH8A 4XKJA 4ARZA 2ORVA 4ZI7A 2FSVC 4G0QA 1CF9A 1D2NA 1L1EA 2CKMA 2W6ID 3FYTA 1MDFA 1OPXA 3O8CA 5AHOA 4V39A 4IRMA 3QUBA 5HZKA 3LX8A 5C5CA 4Y6RA 2M32A 4LHWA 4BB5A 2B3DA 3QOXA 3GRUA 1KPHA 2BAGA 4NMLA 2CVPA 5K99A 2PFSA 1MJFA 2XW6A 3OBIA 4Q9NA 5GPBA 1NP6A 5IEJA 3EVFA 4G8CA 3IOEA 3MCWA 3UFXB 3ZHVA 1UQRA 2NP6A 3DMTA 1IM8A 3ZDDA 4A92A 1WLSA 4U5XA 3V8NA 2XNDD 1CB0A 3JPWA 4X61A 3A37A 3EXG2 3JZIA 1IUNA 4WFJA 3HVUA 2I3GA 2R8YA 4AXXA 3T7KA 4GX0A 4COKA 1X19A 2E4WA 3HA2A 4IFTA 1MIOB 3WGIA 4DUYB 1V8PA 4WACA 1JH8A 1P72A 3EH1A 2MYNA 1QXSA 3EQZA 3IPAA 2B35A 3AHDA 4WHMA 4GGMX 2VQ6A 2QTFA 2KWIA 4RPHA 1QOPB 2XEXA 2I67A 4ARUA 2VEDA 2B2CA 1F14A 4QPJC 3UEOA 2XZDA 3ONDA 4ZVKA 4IVRA 1YDFA 2PL5A 4GO1A 3URMA 3ZE8A 1LXCA 2C5HA 1O4WA 3BCRA 1I2ZA 1S4MA 4W9MC 1XZAA 1MB3A 1KNXA 3IAS6 1UZMA 4JVLA 4RIHA 2AQ8A 3EODA 1O97C 2FP4B 3FZEA 2EZ8A 2PKEA 3GCDA 3KDPA 1E4EA 1N0UA 4FFOA 4U3JB 2IDJA 3C4QA 3DUFA 3KBOA 3PXUA 2RHMA 4RXUA 1QRSA 2GSWA 3I2IA 2JGLA 1J0CA 1YQXA 3EWSA 5DKFA 4EYEA 5GIOE 2PBZA 2WI8A 2PG3A 4S1TA 3HCOA 1DIBA 5IYZA 3DHYA 1QVWA 2NU7A 1W9HA 3K05A 1XRMA 3IT0A 1EM6A 5DVZA 4RPIA 4AG3A 2E2WA 3VSBA 1R4NA 2OWDA 2NO7A 4DLUA 3ICOA 3IQEA 1C7ZA 5ICCA 1U0EA 1V4VA 1PFQA 2OCAA 6LDHA 2AZTA 2BEUB 2GN6A 3TLKA 2O52A 2PBRA 2FX3A 1JE1A 3K9WA 3EZ6A 1FFDA 4IRXA 3CX7A 3KU1A 4UNQA 4ALJA 3PJRA 2AV6A 2HIGA 4Y2UA 5G41A 2G0TA 1CHNA 3O4GA 5BN5A 1IWPB 2VP0A 4EFNA 1OI2A 1JZSA 2WMDA 2ZB4A 1A50B 4OGFA 3ZU2A 1P5RA 2JHGA 5GMOA 5TX7A 2QI9F 2ZS9A 5CVCA 1XTJA 2IPOA 4Q1DA 1I4DD 2HO5A 4RDCA 4DHWA 3PA6A 5E38A 1IWOA 1UP4A 4IDBA 2QTGA 4FMDB 5A9RA 3HKCA 3EBLA 4OXRA 2X2FA 5EINA 1YAJA 1P4JA 3B9QA 1SK9A 3RUCA 1GJRA 4NFYA 2JFVA 3HEBA 5AKKA 4G0ZA 4YJFA 4M9SA 2NVWA 1U5BA 4XX0A 5KVQA 4EG6A 3BXEA 3GF4A 3DKVA 4H1UA 5ALYA 1TU0A 2Z1MA 4IINA 1MG5A 1YR7A 4H35A 2RHCA 1PFKA 1XGKA 4JASB 4M7RA 4Y2SA 3UK1A 3ND6A 3LE8A 1GNQA 1X6VA 2ET6A 4WDQA 5DHSA 2JIPA 5BR8B 1E2EA 4M0KA 4YMSA 4C6SA 4B2IA 1NNEA 3CZPA 2BMEA 2FJUA 1VLMA 4WK0B 3UB3A 3PT9A 3KBBA 4JBIA 5KYTA 1EP3B 3PUKA 4YS6A 5BPHA 1E18A 4ZA2A 1MW8X 3VOBA 4NKRA 4R2JA 5TS3A 3T0GA 4KDRA 2CZCA 4JYAB 2QG4A 1E3MA 2AC4A 1EFPB 3O3MB 4UTRA 3MRTA 2ZRFA 1K98A 3KNZA 4ZIRA 3MGBA 4EABA 4E13A 1A95A 4CWAA 1FW6A 3QF7A 4FX5A 1UOEA 3B6IA 3AU8A 3BF8A 3BH0A 3CH4B 3HKBB 4RETA 2P40A 4GPEA 1CU1A 1TW2A 4Q4AA 4C3VA 3LPDA 3GLFA 4Q4JB 4TKVA 2WE8A 4FR5A 4ON9A 1RI5A 1NVDA 1PZXA 2RDMA 2X22A 3KAQA 4XE5A 4F2GA 5AFSA 2R3SA 3GOHA 1OASA 2FSGA 3L0IB 4HR7A 4C7VA 1NSYA 2HMAA 1TUIA 4K88A 4NG4A 5LUBA 4NDNE 3VHXB 1EFUA 4NK5A 2H92A 2J4FA 3EDMA 4J91A 5GAJA 2WV9A 4YR7A 3ZV3A 2QYHA 4U9IS 3D0OA 1DC3A 3UVEA 3VYSB 3NEPX 2NUTB 1FFXA 3WRXC 4DCSA 4RIFA 4ALIA 2FWIA 3PQDA 1GYRA 4FZ3A 2WJWA 1NX6A 4GZLA 2PUWA 1T1EA 1KDPA 3NZEA 2FN8A 4B3RB 3FAZA 4MCAA 2R6R1 2WUGA 1EG2A 4B6SA 5DULA 3L0PA 4PG6A 4F6RA 5FBKA 1CWUA 2O8DA 1DKNA 3L79A 3EY4A 4D41A 4H3KB 2Q6VA 3LHFA 2JLCA 5IMSA 3GT7A 4JBLA 4QFDA 2RH9B 1TPYA 3AR3A 3D4NA 2ZPUA 1P0CA 4IMIB 4ZVSA 3JQDA 1DZ3A 4IH9A 3LIIA 4LHXA 1OILA 2B7LA 3OT1B 4BX0A 3WOHA 3ZVKA 2AWNA 1LBQA 1C0KA 3ZHTA 2CLHB 1RLUA 1ONPA 4HN2A 3UMVA 1M6WA 1QRAA 1FYFA 1Z2OX 3C3EA 5JZ9A 1BDIA 1UBGA 2ZDGA 2YTZA 4FZRA 5ERXA 1G7TA 3K0CA 2O9JA 4TS4A 1IN6A 3KQSA 1KEVA 1SBTA 4GXRA 1D2RA 4IMJB 4KKXB 4RVGA 1VL6A 2ZXEA 3BRQA 1KE1A 4BGEA 1KI8A 5ICMA 1KGSA 2C29D 2BDUA 2NNWB 3E35A 3TBFA 1TZBA 2R5FA 1D0SA 5BOVA 5A1TA 1Z0KA 2OL4A 4AZWA 4HG2A 4A6DA 4M7OA 3N2GA 5T3UA 1ZDMA 5AVOA 4OLAA 1GL6A 1LI7A 1N2BA 1WKBA 2HQRA 2FWJA 1RWWA 1QJ4A 2C5AA 2YBEA 3BFJA 3H86A 2H4JA 3QXJA 1Z4KA 1KYXA 5BOSA 1Q92A 2OD2A 3IBFA 1C4OA 3DBRA 1E2MA 1E89A 1QVAA 2GZDA 3N2NA 4PVCA 2F3TA 2XZLA 3AOEA 2O8CA 2R1ZA 3AQIA 3TQRA 1RKUA 4HLUA 4PIMA 3GI1A 1AT1A 1I80A 4AUEA 3X1KA 1XTPA 4M0PA 4E1AA 1XEAA 3AB7A 3ODGA 4AAYA 4YUZA 5C53B 4OM8A 4HI0E 3AKZA 3WBFA 5DV9A 3DNMA 4GLLA 4B3DA 5G1OA 1S2IA 4WVFA 4Z54A 2W2NA 1UC4B 3N87A 3PX7A 1IJKA 4DZRA 1T13A 4MUYA 3VTFA 4R0NA 2JLZA 5KSYA 3MTAA 2RGEA 3TSAA 4EKYA 1UXKA 1K7FB 2YHAA 4LE0A 4G4IA 3IVRA 3MWDB 4FR0A 1V2GA 3EC1A 1VPVA 2QRPA 3P2IA 3PXXA 4QG7A 2QJTA 5SYMA 1X7WA 3LLMA 4XVHA 2YN0A 3PR1A 3ZWWA 1XDUA 3O4RA 1GPDG 4X93A 4KR9A 2ZM5A 3AEQA 4OG2A 2H51A 5JSUA 3KQPA 3OOYA 3RSLA 2EKDA 2G7MC 3G13A 4IO0A 1N33B 2ZS8A 3PD1A 1OH5A 4Q3OA 1QTQA 3ZWMA 5KTKA 2XXAA 5F52A 1B93A 1EGAA 1KGDA 3M8KA 1Y4DE 3MWEB 4U7PB 4IDEA 4EMSA 4CL0A 1JYSA 1WSAA 1QNLA 3WRWA 4D57A 3NBAA 2IV7A 4TT3D 3ILHA 1LQUA 1QNFA 3L2OB 4N9WA 5ALKA 3VBCA 3LDGA 4RHYA 4BFZA 1HZZC 1ZH2A 1DBRA 3DZDA 3N75A 2DZDA 3W90A 3PIRA 4DA9A 2WHPA 3TQOA 4NENA 4V03A 2EBUA 2YIMA 2GK3A 2GD6A 3CB2A 1BGXT 4TWZA 2CYAA 5DRTA 4C03A 5CB4A 4DJ5X 2F4VB 1O2DA 1G6Q1 1RLMA 2Y99A 3O0DA 2R8EA 1K0UA 4NYJR 4YP1A 2PS0A 4BFXA 5AKIA 1TPZA 5ED4A 1XR3A 4BIIA 1XKXA 2A58A 4M98A 2WHQA 3CWCA 3BL8A 2VZ8A 1YR2A 3L0CA 5AVXA 3MLEA 2FEMA 1U02A 4JXKA 2XUJA 3QEMA 5K0NA 3ZNQA 2BRUC 4K86A 1ZUHA 3ZI0A 4CLOA 1TD1A 2GZ1A 5LD2B 3VJKA 4DW8A 1V1JA 3LWBA 1BH2A 1W2HA 2XUFA 3RRXA 5A0TA 1NKVA 3QYPA 3IIMA 4L5AA 2C2YA 5TQ0B 2AK2A 1XVVA 2CKDA 1QBKC 3CE9A 4HRYA 2HA5A 3QTLA 2OM2A 1Z47A 5ALSA 4EARA 2QXYA 4JH0A 5BW8A 4ESVA 5JU6A 5J2UA 3OCYA 2AI3A 1DP4A 1C30A 4HNHA 2AX3A 1ETHA 1GGHA 3UJCA 2O14A 3OD5A 1SZDA 2VJYA 3GDGA 3D3WB 2Z56A 1B73A 2N46A 3K2EA 1E4YA 3LSYA 1SA0A 4JELA 3UJ7A 5HYVA 1SPBS 1HYQA 1R6BX 1K6IA 1YK0A 1U2DC 4OU4A 3VTZA 2VHVA 3OY2A 1O6BA 4IDOA 5HK9A 4EPWA 1SRRA 4MUJA 2A0KA 4BLSA 1PCXA 3G82C 4O2AA 1WF6A 3H9UA 1SZPA 4G36A 3K1TA 2PSEA 2FE1A 3JYPA 3WK4A 4GPZA 1PJ2A 3AI7A 1G60A 4RH1A 3W3AD 1E0JA 2ADMA 2GAFA 3KDAA 1N36B 2GN2A 2PYZA 5KOIA 2WPDA 1RYEA 1EJBA 5HRCA 2C98A 3NBQA 4QKQA 2FPXA 1N1EA 1MAAA 5FL7D 2JFQA 4PC3A 5FV7A 2QN3A 2XTJA 4O0MA 5CFQA 3COJA 5IDWA 2J7PA 4TROA 4A2CA 1V96A 1PZMA 1JJVA 4ND8B 4O4JF 3QBJA 5C1PA 5KCZA 4BVLA 5CVUA 3NANA 3JASA 1NMYA 2F9MA 4LRTB 4AJ1A 3RS3A 3AW8A 4RM3A 5LWQA 4JC5A 1FBTA 3GBVA 2EWVA 1U28C 4DJAA 1C7QA 3GXOA 1Z4QA 1ANKA 5IXSA 1JJFA 2O2YA 3NC0C 2ZZMA 1HDRA 1SG6A 2BE9A 2FHPA 2WZBA 1VLHA 3HL4A 1PX2A 2PT9A 3H9QA 3TZHA 1N2CB 4R40A 4D3DA 3M6MD 1GXSA 3E23A 3SS8A 2JCBA 2JFOA 2ODPA 3NV7A 3C5HA 1Z4OA 1O96B 3V4VB 1KP3A 4NCAA 1YI8A 5C51B 3QNUA 4MI3A 3RIXA 2ONZA 3ZWOA 2PM8A 1XYGA 4MUNA 4IMRA 4JI3B 1JTVA 2JVJA 2VYNA 4Z0HO 2IDZA 2WUEA 1JBKA 1X8XA 1K9VF 4UMFA 3S1AA 1RKBA 2QPLA 1PWHA 3TLMA 1VJCA 5BRJA 4H7EA 2MSDB 1EXNA 3IXMA 5H9VA 3P9XA 3HZOA 1XMXA 1QYDA 3EEBA 1QKJA 4MAFA 1IN5A 4HF7A 4NV1A 3SYMA 4KR2A 3SJCA 5IKPA 2PR2A 1HUQA 4G26A 2J32A 1ADCA 3FWZA 4G37A 3GMSA 1PHRA 1O7JA 4WKBA 3UWKA 3TUZC 3N2EA 3P9SA 1DJNA 3TVTA 2IIQA 2ZPAA 5ECDA 1JDTA 1KBOA 1VHJA 2AKYA 3F3SA 3W8NA 3AFMA 2X1HA 1L5QA 2QUBA 1C7EA 3AOEC 4MRMB 3FSRA 1NNUA 3RVKA 1F6BA 1SQFA 4TWAA 4HGQA 3DPSA 1VI6A 3O47A 1H4SA 1H0SA 1E9RA 5DBOA 5LA6F 4H7PA 2YIDA 3ZJVA 2A9KA 1ISMA 3OFND 3ISJA 2AFHE 4YBRA 3RFXA 1LVHA 3X2EA 1P7CA 2Q5HA 3UA3A 4MQFB 3HDTA 1KK0A 4CKBB 1XZMA 4ND1A 2VDUE 2WHPB 3IBGA 3IAS1 5CCXA 1JR4A 3VAZA 1R0ZA 1A5TA 1WABA 1XD2A 2DQYA 3EVEA 3GAZA 5CA0F 5K5EA 4MB0A 5HJ7A 3DBIA 5CH3A 3I76A 1KO1A 1WCYA 1H05A 2XKJE 3Q1KA 4C7JA 1F12A 1U3UA 1Z16A 2BIFA 4PO1A 4E6EA 2PK3A 4M0UA 2CL7X 1ITZA 2OENG 4OOFA 2QUZA 4TN5A 3A1TA 3TFOA 4UEKA 3TQQA 5BN4A 3A4NA 3UPDA 3AFHA 1JHYA 1XZIA 2PWZA 1PT5A 3KZXA 3SF8A 4CEJA 2Q4DA 5KI6A 1X1TA 3VPDA 2C4HA 1GADO 1F2UA 1NVFA 5AHWA 2QTHA 3P9CA 1QDLB 4OFBA 4EKIA 5BN3B 1QU2A 4TKLA 3EZYA 4EX6A 4DPMA 2YYAA 1T24A 2JF0A 3P4YA 2VG8A 2Z6AA 4DCTA 3K09A 4D45A 4WY8A 2EAUA 1H1DA 3UY4A 3OLQA 1BA2A 2NW6A 2FMFA 1NONA 2YRWA 4A0QA 3QV2A 1L7VC 2QMEA 2P1RA 2HNKA 4HZIA 3OE7D 4ENUA 3IDOA 3FKSA 4P3NA 1EFRD 1C2TA 2BISA 2LRHA 3L1UA 3NV9A 1LLUA 2WWIA 4J07A 2OLJA 1ZK3A 3K6JA 4GMGA 3RAJA 4BNJA 1FFBA 2W43A 4OQXA 4R1NA 4XVCA 1TYAE 1QHXA 3KXIA 3FCAA 3ENWA 5JYEA 5KX5F 5FWXA 3UXMA 3KSUA 2ZUUA 1KAEA 2NTEA 2A3RA 3A6EA 3PUZA 3UPTA 1Z0IA 1LPNA 3V8RA 3GLIB 1YRLA 4RHUA 3JSAA 4MHSA 4UBNA 4WOKA 5K3CA 2A8YA 4WMLA 3UJ9A 1KTVA 1E6MA 3UXEA 1GA6A 2UV8A 1B8OA 2R6AA 2R97A 3I4LA 3C1AA 4PICA 4QHSA 1P1FA 3EQ9A 4MKIA 1K3FA 3GWZA 1ZD4A 2PZBA 1NUQA 2JAOA 1IZ0A 2WG1A 1FDRA 2XSZA 1G20A 2Q3MA 2Y9MB 1YQTA 4HPXB 4PYRA 4OQZA 1M2OA 1DG9A 3GJZA 4TZKA 1J7KA 4F4CA 5CPBA 2VAMA 2P9QA 5KWSA 2PXXA 3C1TA 4EG7A 5ALFA 2VPZA 4Q6BA 3JWEA 2BZSA 2CLCX 4QYIB 4X95A 2OXIA 1SCKA 2XKAA 3DTVD 5D3ZA 5ANRB 2W6CX 3BH7A 2C03A 3KQVA 4XX1A 4EL0A 2VZ9A 5B7QA 5KEIA 4AKIA 1XLUA 1DHTA 1T3LA 1LK7A 2QZJA 1J0EA 3EC2A 4LDQA 4BAZA 3FNIA 1MO5A 1VE3A 4E5YA 2I6GA 5KWEA 3OQ6A 1JHUA 1PL6A 2FDXA 3DW1X 2JK1A 3F98A 4YNBA 4MKGA 3IP8A 3ZWBA 5E0KB 4N47A 4BNNA 4BNYA 4EHIA 5HBGA 4MEJA 4JBNA 2JFXA 2QDKA 3HKEB 2YN4A 2ADFA 1J4AA 1ZBQA 3H2BA 3LBYA 4JKOA 1KJYA 1ZXXA 4YB8A 1JFVA 4J8PA 1H0HA 2W6ZA 3E03A 3L84A 2HO4A 1L7MA 1G9SA 4NEHB 3E3AA 3EG9A 2XE8A 3E22B 1HL3A 2Q3LA 2ZYVX 3NLLA 2R4QA 2QTVA 4IY1A 1RAEA 5IC6A 3VI4B 5H4GA 3PVCA 4NSNA 5A1JA 3C41J 2PUHA 2PZKA 3TG2A 3PKZA 3WK7A 5EIXA 4LFAB 4E14A 1NJFA 1FW8A 1GNVA 1T4BA 2O5CA 4ZAFA 1J7JA 4QUHA 4DWJA 3NKVA 1QLWA 2GZMA 1IVNA 3HJFA 4I4NA 3C7KA 1P4RA 3QKRB 5EIBC 1O3YA 2GRAA 4TXLA 2A5DA 1MQ8B 1SB9A 1I01A 3ZVMA 3FMOB 3KPYA 1EGMB 2XCOA 1WKCA 4RTLA 1JTFA 1ORIA 2RGNA 3BJZA 4YHBA 2YQZA 4R2KA 1B15A 3EVBA 3QFHA 1IJFA 1MO6A 1PJSA 3EDYA 3FFXA 3JZMA 1EVKA 3K5HA 3GMDA 1RZVA 3SNKA 2Q3EA 3SSMA 4QX6A 4AM8A 2IV3A 1EQUA 4FP9A 3SHQA 5CDHA 2VQSA 2C97A 2WFLA 3KVOA 4G0OA 2C2HA 5KNDD 2HOQA 2SKEA 3GIDA 4TXNA 4YDHB 1DADA 2CFTA 3HVKA 3CWZA 1ZL2A 4KQFA 2IS4A 4FGUA 3EIHA 1XZFA 1FJHA 1D3AA 2IZ7A 4LYYA 5JCJA 2R6JA 3ODPA 4C7MA 4ZVQA 3T0FA 5EWLA 3GJYA 4MJ3A 4ZQGA 1WR8A 2P79A 1M6HA 3AF1A 3FPEA 4F6RB 4X85A 4HB3A 3U5ZB 5DLEA 3G89A 1IVSA 2C95A 2IEYA 4UDOA 3FHJA 1UFKA 4K9SA 4BFWA 2HDHA 4OAQA 5EXTA 1RJWA 3VPXA 2OECA 4F5YA 1OXVA 2ZRNA 4HNRA 4JD5A 4ZICA 1MABB 2EX1A 3OI7A 3VYWA 4JYPA 4YCCA 1YS6A 5BSFA 3L6OO 3NATA 1NNLA 1SEVA 1CUDA 3WNDA 4YMHA 2CV1A 3OEWA 4G1CA 4KAJA 5IKEA 8OHMA 2ZIZA 1FVXA 3D4PA 4BJ5A 4P3YA 5AVSA 2ZRMA 4H3VA 1H4QA 3HHEA 1AS2A 1TK9A 4FS8A 3U4CA 1QRRA 1T2CA 4NCIA 4HY3A 1QPBA 3T7RA 5DGXA 2VNSA 4A0FA 4BNZA 4R1SA 5GV7A 2YWDA 4QOEA 1E1RD 5CK5A 3VR4H 1G8HA 4B8ZA 3PX2A 3FPHA 4F9EA 4DQXA 1GAXA 2E89A 3CZRA 3WGOA 4MI1A 3AV3A 4LDJA 1EUYA 4TTJA 3DE3X 4HLQB 1EK1A 1ODSA 3WJAA 5FUXA 4EENA 3JS5A 4XWYA 3TMKA 3IHKA 3HJUA 1E1RA 1MJNA 5FPSA 3FB1A 3IOBA 4JWKA 4IZ6A 4LGYA 2A78A 2H4YA 4DV2B 3KDSE 4N8EA 1SBYA 1ID8A 1BXGA 2C3PA 1LF5A 2HMVA 1QK3A 4GX1A 4LRUA 1DARA 3K1AA 4FXPA 2H2FA 1EFCA 4XFDA 5HIIA 1Z5GA 1KBQA 2QOEA 4BVAA 2VSXA 2LXNA 3EUFA 3GW8A 5FO0A 3GUHA 2AZMA 1T1GA 4WGFA 1EWTA 5C8YF 1V7PC 4NAVA 1YR8A 2BONA 4MRVA 3MJCA 2VCEA 1UK6A 2QPTA 2VHJA 3BORA 3HGQA 3GPDG 1CJUC 1LPMA 3TR0A 3H84A 3JYQA 3O90A 3ZBQA 1U8TA 4ID9A 2PLNA 4L4XA 3ZLBA 5KBYA 3RKUA 3G88A 2HA3A 3GFTA 3JZAA 3BB4A 3IR7A 3KJFA 2W2PA 4MVJF 5FJJA 4ZYWA 3TNDA 1IQRA 4RZ2A 4EL5A 5CT8A 1HLDA 4FHEA 5B1YA 4Q3EA 3W7VA 3SZOA 4EEKA 3JYLA 2RHWA 4KGVA 5GVSA 1G3RA 1NT2A 3LVBA 4J2HA 2PL1A 5L9AA 4M9ZA 4GXTA 3CZMA 2H59A 3LYAA 5LU8A 2W2MA 1E6WA 2VTEA 4HK4A 5EWJB 3D6MA 3M6WA 2HPAA 3U2QA 1DOAA 4MJXA 3BG5A 2HCFA 3VTKA 1WUIS 5H82A 4GLBA 2D7DA 1E2KA 3CC8A 4HV4A 3OX1A 2HGZA 2ERCA 5EZ5A 3NYWA 4EELA 1GDTA 2DCUA 2GN4A 4ZKDA 1E4OA 2NXWA 2VT3A 3B6EA 4EDFA 4J0EA 1YRWA 2HK9A 2GM3A 1JTEA 1BD4A 1B4DA 3DAPA 1GGJA 4PZLA 1GNTA 5A4FS 3NDIA 5I4BA 1SD1A 2CMHA 4PY2A 5FV4A 5JAMA 2AD1A 1OAKA 2PWPA 2O2EA 3NRBA 4I3HA 2VBCA 3ADDA 2X5OA 3F7MA 3NHSA 3EIWA 4BMPB 3THXA 1YBFA 1QK4A 2ZDQA 1NXXA 5F1OA 1X8KA 2VJQA 3GLHE 4HS4A 1YDGA 2DECA 2OYCA 3WKCA 1FX1A 4TLMB 1ZJZA 4DIOA 1XCMA 3AJ8A 2PPLA 7YASA 1NJ2A 1W4LA 3AVOA 4RKRA 3NIDB 1VJDA 2AN3A 3H75A 4FLEA 4ODIA 4Y9UA 3THSA 1NV9A 4P83A 4TWRA 2HSWA 4K05A 4LHEA 4QOJA 3EGDB 1N92A 1Q12A 3LPCA 5CMLA 2XUOA 3GEEA 2HWUA 1CERA 4MDHA 5EKXA 3IODA 4AMZA 1I2AA 1QIMA 5IK2D 1E3EA 1KH3A 4AY4A 5U1PA 4QODA 2F4NA 3D02A 5T67A 1NHWA 3ZW8A 1MAVA 3AWDA 4UBJA 4WOJA 4KUGA 2WU3A 4FQ7A 3P9KA 5DN9A 3PNBA 1MABA 3TIVA 5CDGA 4GC9A 2H2AA 1JLLB 1NMSA 2B2XA 5TY0A 3HB1A 2WF8A 6REQB 4YONB 2X2EA 5DW0A 5TNXA 3K8OE 3DMHA 3W34A 4JL6A 2RH5A 3A6KA 1ZLXA 3LF2A 1I1OA 4JOBA 4U2BA 3TEJA 2QRNA 4AKTA 4E0BA 4ZP1A 4I1VA 2OK8A 4OX9Y 2J3LA 1VCNA 1T2UA 3U0BA 4K6MA 4IDFA 1ISJA 4YC7A 2OA0A 1RKXA 3EZ2A 3MJEA 1K6XA 3PRKE 221PA 5B1DA 1NBWB 3AJDA 3VU3A 2D3WA 3ZD8A 2KLHA 4XRGA 1KEEA 1JR6A 2I6XA 2LW7A 5CLGA 2NSDA 1RWPA 2AQHA 4Q82A 1NLZA 1CPYA 2Z8YM 3DPIA 4YO8A 3ZNPA 1RBZA 1WUTA 4DV7B 1BH6A 2OZPA 1VL2A 3CNQS 4ZDWA 3ZLVA 2YN2A 4F71A 5G2OA 4BRUA 1B0ZA 4QO7A 4RBNA 4E32A 2VNKA 5CD1A 1DEXA 1P6QA 4C3OB 1ECBA 4IJVA 1IZYA 3AESB 2HYDA 2FF5A 4PO9A 5EKDA 5KHAA 2LCQA 3UWDA 1JSCA 4G0VA 3VOSA 4CTKA 4PGHA 2OO7A 4ZVTA 4AJ4A 3GPLA 4IS2A 2MR6A 3N86A 3QVGA 4IZHA 4X71A 4L5CA 1TD9A 1CV2A 1TCBA 1XMJA 4NZ9A 2X9QA 5E2BA 3RF7A 4B2PA 4DUPA 2O8CB 1RJFA 3CX6A 3MGKA 5JNRA 5ALLA 5LIRA 1ECJA 2UYHA 4FLMA 2XUDA 2I3AA 2P91A 5IVDA 4Q15A 1Z0DA 1XEXB 3HRKA 1T4CB 4MRNA 4XDYA 3W2IA 4INZA 2VXCA 4M38A 2H9YA 4KI0A 3I5YA 1LJ8A 1YBVA 2ILVA 3WOVA 4MINA 3B85A 3OBBA 3IVGA 2XIJA 4O4HA 2PIDA 3SE0A 3L8DA 3WGVA 1A9ZA 1NN0A 1PR5A 4EQZA 3RLIA 1SEPA 3HZZA 3M6VA 1Z8DA 4UJ3A 2V65A 2IP2A 2VRNA 1DPGA 1T5LA 3QVXA 4KWHA 4N3NA 3ZLUA 3GIWA 3LLCA 3LBNA 1ZISA 3W6NA 4BV2A 3Q98A 4EY5A 2CXHA 4I4TB 4GF5A 2V1UA 4ZHQF 2QTBA 4H59A 4LX8A 4J0CA 4RVSA 4UD2A 2Q4BA 3KKMA 4UNNA 3DOIA 2H65A 2PKXA 1KMHB 1QFZA 3RYHB 3B1KA 3ZCRA 1IUPA 3RUDA 2HWWA 3LH5A 3TLBA 4YX9A 2CZQA 5CD9A 1ES9A 1U0OC 1C3OA 3WZLA 4WH0A 3D2AA 3M1LA 1PEKE 1AUXA 3AUXA 3UGKA 1BXZA 4GI7A 4FYIA 4GZMA 3ZZ0A 2IHNA 1NVVQ 1LSOA 4FT2A 4ZTZB 4XWKA 5L53A 5K03A 1GZ3A 1UKVY 1MVNA 5DP1A 3JALB 3ELUA 4YP0A 3NORA 1H8ED 1QOZA 4CV3A 4GLOA 3EFHA 2Z09A 2MYTA 3QP9A 2WWTA 5GV8A 2QA5A 2IOFA 3R09A 2V96A 5LJLA 2BMVA 1NG9A 2RJNA 4BV8A 5FBLB 2VRCA 3AGQA 2FR8A 1ZAYA 3JR7A 3DZJA 2YCBA 1QTRA 2JFNA 2FKAA 3DXYA 2EWMA 2FPOA 1XKTA 4WZBE 2IUTA 4MVJH 4MWBA 5IH7A 4ND3A 1CEYA 3E7PA 3TCKA 4L57A 4L0CA 1JEEA 1P8JA 4B46A 5U9CA 1HT0A 1QP7A 2G5GX 4CG3A 5EJ9A 1MAWA 2JLAA 1Y8QA 2B6HA 2CJWB 3N2YA 1E92A 3IE1A 3TMAA 1ZQ9A 3VR5H 3IOCA 1BVUA 1TJ5A 4XEUA 2GLTA 2D62A 1COZA 4EUFA 3AVTA 3C6BA 4DKJA 4FGKA 1GUAA 1ZN8A 1FRVA 4F06A 2C04A 1ZL0A 1L8AA 2AMFA 2XVXA 4Q7LA 4M0FA 1CUFA 1T2NA 3OJ0A 4HAIA 1EK2A 3VI3B 5J4KA 3VDRA 3CKYA 1KI9A 3MTIA 4G07A 1P0MA 5DSTA 4A03A 5K0JA 3DMYA 1TYEB 2EKLA 3TOZA 3DDZX 3VU9B 3ANTA 1LU9A 3FDIA 1PT6A 1KKMA 4G0MA 4WADA 5AKGA 5EIBD 1T4GA 4G1UC 2NPIA 1E1MA 4I46A 4LDNA 2BELA 1SXJB 1LNQA 3VSAA 4J1TC 4C89A 4JR2A 4ISCA 4S12A 3K0FB 1SM4A 3FYUA 4CIWA 2F3QA 3LUGA 4QYWA 4CETA 3N0VA 1GQFA 3CBGA 3ZHCA 1YGPA 4EGSA 1VJ5A 1NASA 1QAQA 5CFMA 1FUYB 1U7WA 1QTIA 4BO7A 4BZPA 2ZOSA 3E2IA 4IH1A 3TF5A 1BE1A 2EF1A 3H5WA 3DLAA 4GXQA 4PZDA 4UDXX 3PFIA 4UARA 1J22A 1DDIA 1UWLA 5COAA 3ZE9A 4JSYA 2PIAA 4I36A 4RZQA 5JEDA 1ZSVA 5E6SB 1YZUA 1OUMA 1QDUA 1DLIA 2A1UB 3OCWA 1V4NA 5LQSA 5ALQA 2FFRA 1OB2A 4IIEA 2GCNA 1Q20A 4RC9A 3G0OA 5LU9A 3DUWA 5DH9A 1CNEA 2I71A 1DAGA 2GNPA 3T1NA 4HAXA 5AUOB 1U0BB 2PH1A 3WFIA 5EHXA 3PEUA 2MR5A 4YP5A 4FDVA 3OTHA 1OOEA 1Z7WA 4D9NA 1BTOA 3RC2A 3UJAA 1GRQA 4F5DA 4JLUA 1MNAA 1TGVA 4L08A 4RW0A 1VE9A 2CDBA 2JAPA 1FQOA 5I9LA 1VB3A 2FOIA 4JODA 4J0IA 4PQEA 3T5BA 4ZDJA 3MJ4A 1GPBA 1CRQA 3OF3A 2H16A 1GFZA 4GRIA 2YYYA 4P93A 1R0RE 1WBBA 2REQA 4J75A 1A4UA 1ZK2A 4HRVA 1GNLA 3FI0A 4KGDA 4R2IA 2IXEA 3BXPA 1N6IA 2KBFA 4R98A 5EHQA 1QORA 3L4JA 2Q29A 3L40A 2WD8A 4HRXA 4EKNB 1NY5A 4ZDKA 4QJIA 4B3SB 3WKDA 2VJOA 3H2JA 3RFVA 3H0KA 3ESYA 2E4AA 4C87A 5JJCA 3KK0A 4GWKA 3DOEA 2PUBA 5ILGA 1MC5A 4QAJA 5J2UB 1YB2A 2FUG1 2OO3A 3G8BA 1ZM3A 2PTGA 1BROA 1RYZA 1O57A 3JD1A 3ZWYA 4PPNA 4CU2A 3H13A 4IV8A 2A59A 4R8KA 3SBOA 2FVYA 2CNLA 3ZOKA 4A8JA 4EQ6A 5LMNB 1RVDA 1XJ0A 1GCAA 5C8XA 1CRPA 1FMJA 4RTOA 2YY6A 1QC5B 3L4EA 5HP4A 4H7DA 1QRTA 3RK1A 4AUNA 1ZJJA 2DPMA 2FMKA 3SM3A 3TECE 1PUIA 5HFAA 3THOA 2H31A 2GKSA 3GGCA 1GRCA 5BV8A 3GEGA 2BEWB 4YMTA 4QZVA 2MINA 4MVYA 4V3CA 1IYZA 3ROFA 5TQ2B 4GI1A 2WIBA 2BTQB 4RKEA 1F1JA 3GRKA 3X1WA 1XTBA 5LZ7A 2IEGA 3NAGA 1PRYA 2CMDA 3G2OA 5FTNA 1G16A 1F8YA 2J3IA 3S6JA 4U0KA 2PH3A 1H65A 3MRXA 4MGKR 3W2HA 1BMTA 5IJ0B 2AFIA 3I4FA 5BP7A 13PKA 1GGEA 1JKIA 4S1VA 5JZOA 2ZE8A 1M73E 5T57A 2JH9A 5AVJA 3V2UA 4KQKA 2HA6A 1N8TA 2B4TO 1BX3A 4JXZA 3LAWA 4RLSA 1R4MA 1VKNA 1HX7A 4QQ8A 5DM2A 4OCZA 5B58C 5GTDA 1P74A 3A11A 3I2FA 1YQQA 1AF4A 2WEKA 1U8XX 4Y9RA 2ILTA 1OFUX 1IRXA 3C45A 2O7QA 1N6RA 4QU8A 3CIFA 2DJIA 3QVLA 5DHFA 4NJEA 2O59A 4GDFA 1OYOA 1RQ2A 3A3OA 3F9IA 1J33A 4UDNA 2XUAA 3DZKA 1BHO1 5JHGB 1BGWA 3BJEA 4GNKA 2NADA 4UHBA 4WI1A 1ACMA 1YMQA 3C3BA 5EEGA 3MLBA 3GT0A 4Z8YA 5B1HA 3S44A 1G291 1WXHA 4AIIA 3IKLA 3T99A 5JFGA 4BZZA 4A0GA 1J8VA 3QEJA 1RI3A 2GSDA 4O4HF 4P86A 5A3QA 2A5JA 4AUMA 1V1MA 4TLBA 1SR8A 1YJAA 2XBLA 3A10A 5DCLA 5A6SB 4L7VA 1MJGA 2CV2A 1A8PA 4GL4A 3EZXA 4KE8A 3AIKA 4D98A 1Z39A 4N5LA 1YVPA 2OPHA 2HUNA 1THMA 1G6OA 4M49A 5A0VA 3IE0A 4AQ7A 4FYJA 2BBWA 4G1FA 4GFDA 3WIDA 1YS9A 3VTAA 2JLRA 1M1YE 1TLFA 3QXXA 4Q1BA 4OYYA 4GW3A 1TZJA 2Q7XA 4A6PA 2ZRPA 1GPH1 3AUYA 4J7XA 1ZA1A 2MSKA 4XCVA 4G1VA 3U40A 1KAOA 4Q1EA 1DRUA 3MHPA 1FS4A 3PNPA 1NF9A 1UMBA 1AKWA 2QPOA 3O4JA 1MF7A 5F12A 2FK8A 2FMXA 1EXWA 1ZHFA 2QY9A 3NXKA 3TVYA 4CMGA 3AR5A 4IAOA 3GGPA 4IVNA 4H1WA 1DWQA 2IPLA 1IZ7A 3FVWA 2D7JA 2R85A 2YRFA 3SEZA 5FWAA 2P8SA 3DV2A 2EDCA 1XKLA 4P1ZA 3NRCA 3UWOA 4GNRA 1NC3A 5FT9A 1YZQA 4DQVA 2Z2KA 5DSZA 3L1KA 4C06A 3ANYB 4E6PA 3GLQA 4DEXA 3PJEA 3OLZA 5EHZA 4ZOBA 1XTIA 3TRHA 3BYZA 5D00A 3QU4A 4JKIA 3W6PA 4CLOB 3BMNA 3V00A 2F9LA 1IBRA 1FRFS 5SYNA 3GWGA 1T4CA 2NX2A 4A23A 1LKZA 1ZESA 2FW0A 1WEKA 3OZRA 1RMQA 1S3IA 3OKAA 4TZ0A 4RKQA 2UUAB 2AG8A 3DDHA 3QJ5A 4XWWA 1S2LA 4Q05A 3MCVA 5BWOA 4QA9A 1IN7A 2QLJA 1LDBA 1Z0ZA 3K6RA 5K0FA 2EOAA 2B2NA 3EFOA 3GD5A 4IGEA 4KO2S 5ITZA 1N2XA 1DGQA 2FRXA 2GPNA 3HPRA 4FD2A 1QGYA 5CEFA 3L1JA 2HRCA 4M89A 1BKDR 1OIXA 4LWZA 1X80B 4GUDA 3RVLA 2EBHX 7MHTA 1SBNE 1IQUA 3ZTTA 2HMUA 3IDFA 5DBHX 2WT4A 4FOOA 3JQ9C 1HQCA 4FWIB 5BYJA 3WJ1A 1G3MA 4IQ4A 1CR6A 2RI0A 1Z56C 3UW3A 1EGVB 4BVHA 1DAOA 2Z9DA 4MLZA 3VV2A 2RC5A 1V0JA 2OB2A 2ZBGA 2XJ4A 4O2BF 1CVLA 3OO0A 1QP0A 2VBGA 4QG3A 5B58T 2JNWA 2CLLB 2NZWA 4O25A 1CR4A 4MNTA 3ZN2A 4KPEC 1J0BA 1SIOA 3TZ6A 2GRUA 3FYCA 3HEAA 4GUAA 3SK0A 4KAXA 1P0IA 3L0ZA 3H11A 4GP7A 4RADA 4ZHSA 2QLFA 4Z3OA 1I5EA 5FUQA 3NNSA 4R1LA 1N2SA 2G9QA 3MRVA 1TLTA 1UJCA 3R7BA 1KSJA 3HN2A 4NOJA 4B83A 4G1MB 4MRAA 4DADA 3GVPA 3T5PA 1WBDA 1NATA 3G0DA 3LX5A 4N03A 4P4NA 4QTTB 4TUYF 1V2HE 4CLRA 5F7XA 2QZ9A 3PCTA 3QVUA 2VDVE 1J56A 4LJ4A 4W5TA 2ZUEA 3TRJA 2O57A 3RYCA 3IIEA 4DUGD 4FEYA 3ZDZB 3EOZA 1SKUA 1GCOA 1W0CA 3EISA 2JFFA 3EW9A 3O1IC 2Z1NA 1IEWA 2P1ZA 2P2GA 3QFRA 4HYQA 5T3YA 3HXOA 4PV7A 1XRNA 5FB3A 3FHCB 4KBGA 2V3CC 1ADYA 2JLSA 1N8SA 3HDQA 2HRDA 3T5GA 1Z63A 1UFVA 5KZMB 4JV5B 4BTEA 4UHJA 2V0GA 4UPDA 1CZKA 1E9AA 4TMVA 1OU0A 2YFQA 2ZTMA 4QYTA 5AD1A 3MMXA 2PD3A 1CYDA 3QMVA 3TNFA 1O54A 1DLJA 3I01M 4P4GA 3C3KA 4DCOA 5A04A 4N3BA 4ZOCA 1QPGA 4FIZA 1T5HX 4GZ3A 4R7GA 1CJTC 1G4AE 1NF3A 1U7DA 2LDXA 3LUAA 2OAEA 4Q24A 3VR6D 3ETCA 4TTTS 3CINA 5M2QA 4NE7A 1XNRB 4LZWA 3B1ZA 4QNMA 2QUHA 4LQDA 1Y4ZA 4YRIA 5ABPA 1YQDA 3ZHZA 4IDNA 3K6SB 1FUIA 2H1SA 3LCJA 3BM5A 4PZPA 2QM3A 4C4XA 2PMKA 5LCXA 2ZCJA 4YACA 3LFUA 3WK5A 3SSOA 1ADJA 5H68A 3RBVA 4FKZA 2YFHA 3AK4A 5C5DA 1E1NA 2CY0A 2MDTA 1E77A 1KBZA 4BQPA 3DG9A 1N5JA 4LUCA 3UIEA 3AIOA 4XWGA 1A5SB 4K87A 1ZGHA 5BRNA 3NBFA 3OQOA 4XGRA 3ZWVA 4N5HX 3H4TA 3H87A 4MVJE 4C20A 5K8LA 1LQ2A 5GONF 5TVKA 3CNNA 3SLKA 5IM4A 3ORYA 2G08A 2CF6A 3ILXA 4KNYA 3AUAA 4HYEA 1J20A 3I5AA 3IBYA 2WILA 3MPUA 4XUGB 1Z5UA 1WBJB 1CY0A 4UUNA 2Z2YA 1LPOA 3DM9B 1JHXA 3EF1A 3QWHA 1GG2A 2ENWA 2X19A 3OD1A 1FDTA 5AUQA 2IFTA 2O48X 5BRAA 1Z6YA 2C5SA 3P9YA 4P08A 5B53A 5KC9A 5FEMA 2QAIA 3N8DA 4Y2RA 3O4FA 5H3LA 5BR4A 5JPDA 4JUCA 5E8JA 1RXSA 1U80A 4EZBA 3NIFB 2D1FA 3K7EA 4JJZA 4HVAA 4MW9A 3X1XA 4RFLA 1YUNA 1YQ9A 2XNDA 4JOSA 4Y3UA 1OZGA 2GPAA 3IPCA 5FOVA 1I0IA 2QQ0A 4D0NA 4PTZA 1ZWLA 1C8BA 3QWAA 4GMDA 4HEHA 4Y2VA 5EIEA 3VPFA 2V9PA 3OAAA 3OOSA 3C85A 4MYHA 2CL5A 4X64B 1CEXA 4MCIA 2AN9A 3HE3A 4A1OA 1L1RA 1T25A 1YZKA 2YXPX 4Q1VA 1GZUA 2XKBA 4Q37A 1JPJA 2B1GA 3GQBB 4NZMA 3GLRA 4UBLA 3MMZA 3HM2A 1ORRA 3ZE7A 1FLNA 1RPNA 4L0QA 1R0SA 4HKTA 5DLDA 5IULC 2Q6LA 4DRYA 3OLCX 1F4LA 4O4LB 1II0A 4D1YA 2EX0A 3QSYA 3WHPA 4WUTA 3SVLA 1SUPA 3GCWA 3HRIA 2B82A 5EPOA 2VWGA 1BDHA 3KOYA 4K6HA 4LSWA 2ST1A 3DAOA 3OSUA 1Z06A 4M21A 5LZ2A 4KTTE 2HJ9A 2XA1A 5ECYA 1NJ5A 1MHTA 3JQ7A 1SK8A 5EAIA 5F78A 2JZNA 3AEKA 4YROA 3VUEA 2HCRA 2RGBA 4CEIA 3UXHA 2DR2A 4Q9IA 2JIZA 3I2HA 1KTIA 1M8KA 1DWPA 2CSUA 3B6KA 4UMVA 2ON6A 4RK5A 4A9AA 4JUDX 1MZVA 1M2WA 1R5NA 2IOFK 2JVKA 3EJ6A 3GROA 3NETA 4NENB 1RLJA 1OC2A 2O0KA 2B9EA 3KQKA 1U2GC 3OQHA 4H0FA 3A0RB 2YOGA 3ZJYA 5C7IO 2ZVJA 5B4UA 5E4JA 3QY0A 4LSZA 3LK7A 2G5TA 5C46F 4E4RA 5DHPA 3ROKA 3IXLA 3UO8B 3R9XA 4KXFB 3CZAA 1C3JA 3TZBA 3RKRA 2HYIC 2FV8A 5MFPA 1A9RA 1ZAKA 3V48A 1HEUA 2AE2A 4NBLA 4BIMA 1CQIA 1CYEA 2B30A 3WTCA 1OBOA 3MIZA 3OFSA 1S4QA 2AOTB 4JJ7A 4ZYLA 2I7VA 5ECWA 2ZRIA 5CJJA 1VDZA 4LYEA 4MW1A 2GTHA 4CMIA 5I7AA 4BV9A 3RVOA 4BJ6A 2ODBA 3KTFA 1A9TA 3CVJA 3ZHUA 3BJMA 2XB9A 1HORA 2XF8A 2ZYDA 2VJNA 3VMFA 4AJ2A 4ND7A 4RLQA 2W0MA 4KBFA 2HDWA 3ONNA 1U2TA 2GNOA 2J5BA 2BSAA 3IBTA 1LC3A 1OX4A 4LZAA 1M83A 2OE2A 5CBPB 4WXMA 3GCXA 4B6OA 2WINI 2AD5A 2DTDA 3QENA 4QUAA 3HZRA 4F5EA 3CEJA 4P4SB 3RQSA 2A67A 1L0BA 3F7OA 2XIQA 3OZUA 5EP1A 1WDTA 4BE7B 4EG8A 3JAWB 2VL7A 5JTTA 1NFQA 3EW7A 1GQYA 4CPDA 2B4AA 3ZZUA 2JGKA 4KR6A 3SIRA 1XDGA 4AQDA 4ETIA 3UAWA 1TKBA 4RLHA 1XEWY 1RVV1 4CXMA 1JG2A 4R5HA 4ZVRA 1XMIA 2G9UA 1V1RB 3WHKA 3SDZA 4ZI2A 3BULA 5AK3A 4DMMA 7MDHA 5DX8A 3IAUA 2P6OA 3NOQA 5J4VA 4RFVA 2HN9A 4WZBB 5C31A 4FUQA 1GKUB 2YZKA 3AEUB 3DBLB 2B78A 3DKPA 3COVA 3PGVA 4WSOA 2GEKA 4XSHA 2FUG6 4OHMA 1VZ3A 1FQWA 2HF8A 4QEZA 1CJKC 2CCKA 4NARA 4TKMA 4BQNA 2FEKA 5F7OA 3WLNA 4DUZB 1L2TA 1V5IA 4M8NE 4DSOA 3ERCA 4ZVVA 3CXRA 3PGKA 1I4TD 2IHUA 1JPUA 3SF8B 4W63A 2WY2D 5ALZA 4CW7A 1WA5A 4DLLA 1GQQA 4DLPA 2ZSJA 1IULA 2IOQA 1FNMA 2NU8B 4RJLA 4CUKA 3FW1A 5KYWB 1MENA 3KUKA 3HN7A 5TLSA 2Y68A 5C7YA 2CXRA 1HLGA 1Z8HA 2ZZKA 5A4MS 4R2LA 3HRHA 3KZNA 2AQIA 2XCRB 2R25B 1HFKA 2BDEA 4JJ4A 4ZU1X 5KHOC 3EPRA 1DX9A 1VB5A 1WMSA 3F5QA 1V8DA 2WDPA 5CG1A 5L3SB 4P58A 2EQAA 3EXEA 5I7RA 1Q7TA 1YGYA 5BQ5A 3SSAA 1Y34E 5BR7A 5B64A 3Q5GA 5JAOA 3ONFA 2A1TS 4K9PA 4DDHA 1GGVA 1VHDA 1KMIY 1FFYA 3DCYA 1RAHA 2V6MA 4HDMB 2I6SA 2O0MA 3TOSA 1NVGA 3R3VA 4DCNA 4AJLA 4L7QA 4RZSA 1G6KA 4Z7QB 1GCIA 2UZ0A 1J8QA 2O7SA 2VTBA 1X8JA 1LCIA 4U1RA 3D5QA 4ZRMA 3QRWA 1E61A 3RIEA 3CKMA 4RGBA 5LOVA 3QKUA 4BC1A 4BQOA 4ZK6A 5PNTA 4R0VA 1ZFNA 3R7SA 3JQ6A 1Y8QB 1P7VA 4KIGA 1T1SA 2CD9A 2VP2A 2BP7B 3DCJA 3HCNA 1DTEA 1P18A 2FPIB 3NWJA 3G9TA 4ILEA 1CEEA 1GZSA 1NN5A 1VMAA 1Z6GA 2EJBA 1GSHA 2WFAA 3BUSA 4X0EA 1VA4A 5DNCA 3PTAA 4Y2YA 2BOVA 2EJTA 1R74A 2P0YA 2FSHA 3D7NA 3GX1A 5J5VA 3KHUA 2RGUA 3OC0A 2Q5LA 1YOBA 1VSBA 4XEHA 2WYWA 3LY8A 4IDGA 3H5RA 1DO2A 2HH9A 5BXQC 2GS9A 1GZ4A 2AMYA 2IEAA 4YRCA 2YX1A 4L07A 1HE8B 3IMEA 2EFEB 3Q11A 3RC9A 3RRZA 2B8JA 1T36A 3CUEF 4CCSA 1OMOA 2PGJA 1NJ8A 1JNXX 1XTKA 4HQ0A 3MT0A 4MWTA 4ESEA 3RSCA 3CUVA 4GPAA 1JDVA 2ZBQA 4HDAA 3R9KA 1CZNA 2E87A 3N2KA 1GXSB 3HJTA 1TX4B 4WK6A 3TJMA 3EEOA 1C9EA 3E9RA 3BREA 1RBMA 4RD4A 4F4DA 1U7HA 1H94A 3DJFA 3GV0A 2AG6A 3QE2A 2DWOA 1SG0A 2QMQA 1T0HB 5E2IA 3VR1A 1IMOA 4UVHA 3BIWA 3PYMA 1ISGA 1E9CA 2D1TA 2ECQA 4S2UA 3S7ZA 2ZM6B 1IXRC 5AW7A 1VKHA 4WY5A 1E3IA 1KYTA 1Q11A 5HTKA 3W6OA 1H5QA 2WYIA 2QLLA 4NX2A 2CFOA 4O4HB 5FH9A 1SD2A 1J2UA 4ZO4A 1I5OA 1LPBB 1U31A 3AKCA 3Q10A 4PZ9A 2I66A 4GE3A 4HGPA 2Q3CA 5BURA 3OOEA 2H3EA 1EHYA 1V5WA 3PCXA 3O2JA 4CM6A 4CRWB 2J46A 1CUGA 2GNAA 5CYOA 5A5VA 2Q3DA 3DMDA 1FP6A 1UPAA 1VKJA 4PVDA 4AZ3B 5JADA 2IQ5A 1GILA 4ZGBA 3JAMA 2YWBA 3DXFA 1WVIA 1X15A 1MIHA 2ZRGA 3SC6A 3VNRA 4D4MA 1SQ6A 2BFNA 4W82A 1DTWA 4REMA 1NE7A 1PEYA 3VDQA 3KVVA 4JLAA 2XQJA 5LYJA 3GCZA 2QY6A 4RD1A 3RRMA 4J90A 3MT7A 2BGRA 4IUYA 4BO9A 1RKQA 1DFGA 2Z08A 1Z6ZA 3SHFA 3LYUA 4Y18A 5JD5A 4HWRA 4BVKA 3GXBA 3OZGA 3KOZA 2BCJQ 3UMBA 1WTCA 2XMPA 1DUIA 3VOAA 4NEQA 2X8BA 2GJAA 3BSFA 3G1WA 2JASA 3GZTB 3K8ZA 4XUDA 4URXR 4LKRA 4UULA 4DR3B 1MBZA 1W96A 2CUNA 2XZTA 3Q7PA 4W9NA 2ADOA 5BSTA 2OHFA 3KXKA 2DKNA 4WLVA 2LDBA 2DM6A 2YNMC 3LDHA 4TMXA 2NVUB 3OE4A 3S28A 3MWJA 2FEOA 2JLYA 1NM5A 1C81A 1C30B 1USIA 3FX2A 3FUCA 3LLSA 4PAMA 4RHTA 4WZAE 1BC5A 1Y7PA 2RB5A 3BILA 2E7ZA 5BNFA 2C2WA 4GLJA 4ALMA 1HE5A 4PR0A 3R3JA 2HADA 4JUBA 1E2LA 1NRIA 2DHDA 3SQWA 1AKMA 1CY6A 3V2GA 3VZCA 3A26A 3VYTB 1PGNA 5FWNA 5LL6P 1SURA 1Y7TA 5TVGA 4YV0A 2PL3A 2EW8A 5L3QA 3OTOB 1E1QD 4HLUC 4KSYA 1KQNA 3SIWA 5F9HA 1ZU5A 3QMMA 1UUFA 2RI6A 4BO1A 2R1VA 4UTXA 4YUAA 3U3ZA 2EGGA 4OJTA 2Q7DA 5B6IA 3RGWS 3I9OA 1UK8A 3FCEA 3QLVA 2PA3A 5KYYB 1P73A 2OHOA 1SKBA 3JYHA 3FYHA 4XH9B 1OI3A 4RV4A 3IE2A 3GJRA 1R50A 2XYGA 5EQJB 3WIOA 4DLVA 1JLRA 4RQUA 3KR0A 1AJEA 1U3WA 3BHJA 2XB2A 2IU4A 3KSRA 1VCHA 3COYA 3PEEA 2WP0A 1M7HA 4QVIA 4WRRA 2A4KA 4AY3A 1OTXA 4TKUA 4OBBA 2JLVA 3GJTA 1G2PA 3TB4A 1RLIA 4BWFB 4MTLA 3CZCA 2IYXA 1GTJ1 1WSBA 2AEFA 1C0PA 1RI1A 1Z33A 5DXJA 4F4UA 1VL8A 3GP5A 3QPDA 3TKLA 5CG2A 3INGA 2QTLA 4WBNF 1UOPA 2VDLB 4KXNA 3USCS 3D6UA 1JFSA 4EX7A 3A4IA 1X3SA 4JZKA 4RDXA 5HUJA 2P9YA 2TS1A 2DUMA 3IDZA 1QZTA 2Q6TA 1B1AA 4QARA 1W1IA 5KYNA 5DIZA 1QYCA 4DMLA 1Y1TA 3OP4A 3PWKA 2WJ6A 4US1R 4ZIRB 3L4BC 2CHFA 1T0IA 4B85A 1A4RA 3OPYA 3ND7A 1XF1A 1JFFB 3I9JA 3JVVA 2AHRA 2D0DA 2VOEA 3I3SR 3EUAA 5KIAA 1J2JA 3P8ZA 2ACVA 1I0LA 4PS1A 4OV6B 2GA9A 4YJ3A 4UE2A 3TRDA 5C52B 1DKQA 2TMGA 3OU7A 4MS4B 3K1YA 1T8TA 1OVGA 3M0EA 1MQAA 3C48A 1E7RA 1XFAA 2CHUA 5JO0A 2GD0A 1MC8A 3P1JA 3LCUA 5CTAA 5FPPA 5GJWC 4P53A 3ZWXA 1E2UA 4ZZ2A 3WLSA 5JRDS 2H4HA 2ALJA 4G9EA 4OXIA 2XCLA 2QE6A 4E2XA 3G2LA 2D0IA 1FCJA 2WA2A 4CMKA 2NU6A 3SYLA 1YMVA 4X8LA 3PUYA 2FPGB 4MB2A 1GEGA 4RJIA 3TQCA 1ONBA 1FQJA 2E1RA 5K9ZA 3HNOA 1EQAA 3KLNA 4AKHA 3NUZA 3BVPA 3DV0B 3K31A 5LMZA 3ED1A 1OLOA 4R9VA 2V3VA 4XM0A 1LWOA 4A8PA 1VHTA 4IGIA 1V37A 3PC3A 5IT5A 3U3DA 4U6SA 1DEAA 2YXEA 4EFDA 1VPDA 1SH7A 1Z7GA 1K8QA 4DYDA 2LNDA 2YJGA 2UYCA 3MTDA 1JAHA 1U3FA 3EXFB 4EG4A 3DVSX 1UM9B 1FVFA 2QZ4A 3TBHA 2MYUA 1WW2A 2UUOA 4BUJA 1K5HA 1JG1A 1U81A 3V46A 3UWSA 1C9MA 4KFCA 4A8TA 2I8AA 3P94A 5C1BA 2POCA 2YJ5A 4Z4IA 2F8SA 1QG6A 4HGNA 3AKDA 3T4PA 4R1TA 3UJ8A 4BO0A 3F8SA 2RARA 3MJRA 1FK8A 3L7OA 1KDYA 2G63A 2Y67A 2FSSA 4I14A 2C4VA 2R6GA 4TVOA 4BNMA 3BXXA 1KK2A 2W71A 4KXQA 5BO5A 2IE8A 3CEPB 4HDNA 4N40A 4LJYA 4Y8VA 2AF4C 2C9DA 4HB4A 1UFOA 5BW4A 3VPCA 4AO7A 3R0IA 5IU6A 1WQ1R 1YJXA 5IRCD 2QBYB 4FDTA 5T5QA 4UNSA 2X7HA 3TW8A 1ORWA 4B40A 1A96A 4Q9AA 1TGYA 1D8TA 1JSLA 2Z2XA 3SF0A 5BW6B 4DRZA 4XYEA 4ED9A 1RRGA 1UADA 3VR6A 5KWIA 2JGIA 3EEIA 1Z25A 1KRXA 5HRUA 1KK1A 2BF7A 2GXSA 2IOHA 2W8ZA 3FVTA 1V48A 3I8OA 4P92A 3STTA 2WKSA 4HLDA 5K0LA 1GD1O 2B4YA 2L42A 3B7GA 4G85A 4PF1A 1C1HA 2D5LA 4YASA 2B0JA 1ODIA 2VNIA 1H66A 3FZYA 4O8CA 1JKJA 1G42A 1U9JA 2LPMA 3IT1A 4I6EA 3VSEA 2A9QA 3UAXA 3GLFB 4YCLA 4N76A 3FYDA 5EG5A 5I8PA 3A7EA 1ZIYA 3LL4A 1A71A 2OHJA 3CUTA 4MR8B 1H5UA 3UBTA 3KZOA 4J0HA 4OLJA 4N12A 1SBCA 4MV8A 2ECKA 1Q1QA 5JNSA 2R8RA 3K70D 4E07A 2XMCA 3CX8A 3IXQA 4RY8A 5H81A 4G56A 3PU6A 5AJUA 1FUKA 3NIGB 2YV1A 3N07A 5A2GA 4LOAA 1CY8A 3OX3A 5DNUA 1XG5A 2Y71A 1P6UA 2ZLBA 5IN4A 2EG9A 2FYTA 2ASVA 1EX7A 3M6LA 1Z18A 3P71T 1OGYA 5A7FA 4NZZA 5K8VA 4KODA 2MTBA 4CHGA 5M7EA 1RWQA 4JB0A 4RLFA 1XD8A 1R3DA 2A14A 1JNYA 4LYGA 5E7IA 1BIFA 5FWYA 1TF2A 4O1MA 5P8WA 1EFAA 5CAEB 2J3QA 2K4MA 3SX2A 2I22A 1ZIXA 2YMLA 4YR9A 1UPXA 2OEPA 4CF4A 3ZHRA 3BZBA 1RM0A 2YFYA 3HKCB 4AI6A 621PA 1VRCA 3UTCA 3TTUA 2BMAA 4AYTA 1AGRA 3TL3A 3B9BA 1Y9JA 4LTNA 2HDNB 4UUMA 2OV6A 4LXGA 1UPBA 2YRXA 4V1CI 2RH4A 1IPEA 2A1TR 3QVVA 3R2JA 5D3KA 1K7SN 4LCJA 2HSGA 3RG8A 3OKFA 1A5AB 1NUUA 2DE0X 3RVRA 5BYAA 3I04A 3ZGXA 2HTFA 2CFIA 3CLVA 2IOYA 2FVXA 1BWSA 5JCOA 3KSDO 4B9AA 4ES6A 1ZA2A 2F1RA 3HFJA 5CIYA 1Z29A 2FU5C 2ZU0C 4PPYA 4ER0A 4F38A 3R7WB 5KNCH 2IP1A 2ZCVA 5TF0A 1T4MA 4JEIA 4KYTA 1K1EA 3GEPA 2P4SA 1HBJA 1ZU4A 2PLWA 1TF7A 2FSVA 2J5QA 1R4ZA 5JZMA 4HH1A 1P1RA 5IYZF 3HDVA 3A2MA 4TV8F 3DBHB 3DONA 5C3UA 5FCDA 3GYGA 3STUA 4F21A 1QK5A 2NU7B 2J45A 3WAGA 1E2PA 2PH7A 1IRIA 1PF7E 2IYSA 2XHZA 3HI6A 3M5CA 2WKQA 1MU0A 3GH1A 4LY6A 4MR9B 4N39A 4O08A 5T8KC 3OUUA 2Y1OA 4Q00A 4DGQA 3O3OB 5E3HA 1QH1B 4HUQA 3ZTYA 1E20A 4L02A 4G67A 1HKHA 2BI7A 2ECOA 1W4ZA 4FE3A 4LRYA 1TMYA 4N3CA 3SLRA 1IXSB 3STWA 3W6UA 1IXYA 2Q1UA 3KTAA 3MTEA 4DDUA 1NLYA 5AIAA 3JTEA 3WHIA 2YASA 4WL0A 2FTKE 4L6AA 5DT9A 3B3AA 1QCCA 4EMBA 2N47A 3W3AA 4UAUA 4DLTA 4PSUA 3RU2A 4UE6A 4CFYA 2IS1A 1PZHA 6ABPA 1HT2E 4P82A 3KWFA 2AOXA 3MSXA 4I5GA 4RFSB 3IP1A 3KQNA 1VLZA 1XYYA 2GD1O 2PYDA 3CLTC 1R9GA 4M46A 4WKGA 2QBYA 3TE7A 5C4IA 2Y9PB 3A1DA 1L7BA 3H1BA 1NUTA 4ML3A 4O2BA 4BE4A 4E5MA 5B4TA 3HXTA 4BMVA 4FM9A 1IC6A 2GHQA 4YCAA