3IIKA

The structure of hcinap-so4 complex at 1.95 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
total genus 66
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iikA00
3GCGA 2B92A 4TSFD 4TZ0A 4LBWA 4CEJB 3BXZA 3GFPA 3QXCA 2FA9A 3BFKA 5CB6A 4G5SA 3A6PC 4F38A 3AVXA 4FCWA 1Z22A 2IUUA 2CVHA 1D8TA 5JRZA 2AWOA 4RZXA 2VEDA 1SXJA 1ZBDA 4BRUA 5KSYA 1OFUX 4TWZA 3U3KA 4IDQA 4MRPA 3W8RA 4JBWA 3LXXA 1NVWQ 4JYCA 2IT1A 1KO1A 1IN6A 3CNOA 3QPWA 1VCMA 1YZKA 4GMXA 4FN5A 221PA 4BUJA 3HDTA 3KZ1E 3LXRA 2FPMA 4BWYA 1GRRA 4XSGA 3HR7A 5BN4A 1NKSA 3B1WA 1X3SA 1COWD 4A2QA 2R2AA 1KI3A 3O8RA 5GJBA 4BFTA 1XNJA 5HKKA 1CIPA 4QNMA 5LBIA 2F1RA 1ZCAA 2EWVA 5H8WA 3DZ8A 5KSOA 4DLXA 1FPMA 3E70C 5F9HA 5AUNB 4LBYA 1P61B 2F1HA 1YZLA 5A5GA 1DO0A 1XTJA 1E2JA 2LKDA 3SQXA 1R0WA 1W1WA 4IDPA 3Q7PA 5EZ5A 3N5CA 1P9RA 2H92A 1J70A 1ZW6A 2BMDA 1HA3A 4YONB 5ELXA 1PVOA 4C0BA 3CH5A 4MKGA 2HJVA 2YJTD 1S2MA 1VHLA 4N0DA 4DDTA 4GZLA 1F2UB 3ONWA 4UXHA 2NG1A 5EQTA 3RS4A 3NH9A 3SHFA 4PHGA 1IXSB 3ZQ6A 4B44A 2ODEA 1IN7A 1KI8A 3CRRA 1OYYA 2QAJA 2ZJAA 4I1UA 4IOLA 3QXJA 5JCZA 2OCAA 2ZE7A 2JIZD 3LBNA 1ZM4A 1NLZA 1AN0A 4Z8XA 3DOEA 1E79A 3A58B 4UXJA 3VU9A 5K8LA 4HDQB 4Q4HA 5AJYA 1UADA 2OG2A 3CX8A 4D26A 1N6LA 3RSLA 4AY2A 4MKHA 4R98A 4DDUA 3A1UA 2MMGA 4KI0A 4RD0A 3L43A 2EU8A 3KFXA 1KY3A 5KYKA 2HYDA 2ZANA 4KV9A 4ZKDA 2ZAMA 1N5JA 5FBRB 1XEXB 1L8QA 2WWWA 5FUVA 3RS0A 5J4VA 4GP6A 3K0FA 2W6IA 1QF9A 1E98A 2J3EA 4CW7A 5J47A 2OO7A 2RB4A 2O8FA 3B2EA 4KO8A 3B1ZA 5LB2A 1XX6A 2XZPA 3K9GA 5J40A 5HZHA 1GSIA 2OLKA 4M1OA 4AI6A 1QG4A 2R44A 3LLUA 4CDGA 5KUTA 4HUQA 1S4QA 1Z07A 4H1VA 2HUPA 5FUWA 3WRYC 3CRW1 2RGNA 4M1SA 8OHMA 1P5ZB 3T34A 4B48A 4NCNA 2O0JA 3C16C 1NMXA 2ZI5A 5FH9A 2Q9BA 2ZRAA 1EK0A 4Y0VA 2RGCA 3NXSA 1G64A 4FIDA 621PA 2ZJ2A 4HEJA 5M04A 1K5GA 5DO9A 4YDSA 4D4LA 2XZOA 2HCBA 3ZYCA 2FWRA 2XITA 4PTLA 2E87A 1H8EA 4BFSA 5SZIA 3KB2A 3AF3A 3QKSB 2ZSAA 3ZGXA 3M1IA 3EZ6A 1BMFA 1ELOA 4LYJA 4OQNA 3SU8A 1NN3A 1M1YE 2RH5A 3D31A 5HPYB 1S1MA 5CJ2A 2W6JD 1AS0A 4LYAA 1TQ6A 4Q01A 2IS4A 4IRUB 1W4BA 4MRRA 1GDDA 3TAUA 2PBRA 1PV4A 1NSFA 2FSGA 2A9KA 2FJUA 3OEHD 4NCHA 4A92A 2VHUA 1W46A 1KZGB 2ZJBA 2PLRA 1NF3A 2O52A 2V6JA 5D3MA 1UDWA 3UWOA 1FQKA 2RCNA 3BK7A 2IYLD 3S1AB 4LBZA 2VHJA 4DLVA 3THYA 3AUXA 2Y8EA 3U3RA 2X2FA 3GJ3A 1I4TD 1GM5A 5FR2A 3MD0A 2JJ1D 3BJIC 3TW4A 4YMSA 2GCOA 2ZS7A 1F48A 1SULA 3K53A 5CB8A 5J4YA 1GP2A 121PA 1VPLA 4A6PA 1OB5A 1Z0JA 4XD7D 3DKPA 3BFVA 3KJHA 4Q00A 4KBFA 5IRCD 1U0HC 2J59A 5B57C 3LNCA 3C4JA 2D4HA 2YWFA 5FOVA 2IHYA 1I4DD 1P7CA 2IS1A 4MUAA 2RHMA 1C1YA 1ZVQA 1G3RA 1ZU4A 4QM7A 4TMTA 1G8PA 1G8GA 721PA 3PUYA 3CW2A 4HDCA 4EFLA 3K70D 3I92A 1OH6A 5FOSA 4G1UC 3D8BA 4Q7JB 4BLTA 1LTQA 1CRPA 4DCUA 1W36C 4C0HA 1XTRA 4LGMA 2YWEA 3H84A 4HLDA 4HZUB 2NO9A 2KBFA 3SBEA 2CK3A 4B2IA 2QMEA 1OKKA 4MKIA 4X8HA 2ANBA 1E1RD 1U9IC 2QMHA 1XJCA 4GFDA 4V0LA 3TVTA 2LWIA 1GFIA 3PEUA 4GOKA 1R2QA 4JIMA 1U0LA 3W3ZB 2HLDA 5K8UA 5EE9A 3M6AA 5JJLA 4DLTA 3TNFA 4GOJA 2PMKA 1YRBA 3U6KA 1G18A 2CXXA 4B3FX 2JAQA 1UBFA 5EE3A 1OIXA 3BE4A 1MT0A 5FTKA 4NL4H 4PHHA 4BLOA 1U2RA 1ZNYA 2XNDD 3A4MA 3MFYA 4DT1B 1OXSC 3WYAA 4BASA 3KQLA 3LBHA 4CZ2A 1JI0A 4IOJA 4D81A 4OYHA 2GILA 1TPZA 4P4UA 1M2OB 2WAYA 4B75A 5JS7A 4JL5A 4IKEA 5J4LA 5KSPA 3AVUA 4AKGA 1EX7A 1VIYA 3UWKA 1Q57A 2ZRKA 1E1QD 4DUGA 4DWJA 4PAMA 1HUQA 1XF9A 5GVSA 3EARA 4A1FA 4WZBE 3FWYA 1T3SA 4H1UA 2R65A 4NHOA 5JRJA 1R0ZA 1OXXK 1JBKA 5L3RA 3M0EA 1TMKA 4CEIB 5CLQA 1GKIA 4NP6A 3BH6A 3FMFA 3AF1A 3LQRA 4F7WA 3SJBA 1W36D 2XGJA 4QXAA 4F4JA 1IHUA 2I4IA 3NKVA 1KSJA 3U44B 2IS6A 2F9MA 1H8HA 3SYLA 3WP0A 3Q3JB 1TUIA 1Q22A 3QOFA 2P5SA 3RRNA 1L2TA 1UKEA 3BBPA 3QEJA 4ZV4A 3V4FA 1W4CA 4XTCS 4B73A 3FKQA 4NYJR 1R8SA 3LW8A 1UFQA 3UG6A 5BWMA 1F5NA 1CJVC 5JMTA 3QNUA 1FOEB 2ORWA 1L4UA 2YZ2A 3R9IA 5DI9A 5TMPA 3EG5A 1E2MA 1CR4A 3B8HA 2X2EA 1HT2E 2C9CA 3H2YA 4A4DA 1II9A 4TTPA 1W7AA 3BS4A 1XD9A 5HCIA 3KQUA 2E9SA 3P32A 1E9EA 2GTPA 1YR7A 3PENA 1ESMA 4F92B 2G88A 2IHBA 3U3JA 1YE8A 2XNSA 1KI2A 1YQTA 3AF4A 5JLJA 5SZJA 4AYWA 3IPYA 3DPUA 1R4AA 5AJZA 3QUSA 1XD2B 4JJKA 2J87A 4JLOA 2YOFA 3TKLA 3GD7A 2A5GA 4KBGA 1KI6A 1Z08A 1CJTC 2D06A 2Q3FA 4Q7MB 3VR6A 4NYMR 3CONA 3KJGA 4FMCF 3Q9LA 3DMDA 2DBYA 4PPFA 3NBFA 4YMTA 2H17A 3QXXA 1IN8A 3EPLA 3FMPB 1U0JA 1WE2A 4Q4AA 2CLCX 1P6XA 1XEFA 3L0PA 5B58C 2ANCA 4QL3A 4QGGA 5CIWA 2PCLA 4LJ5A 1CXZA 4DHEA 1N6IA 5EJEA 3T15A 1DEKA 2F9LA 2BDTA 1MH1A 2ZYTX 1TAGA 4L9SA 4LX0A 4UKDA 3FHOA 2ZJ8A 2GA8A 1X8KA 3WMFA 5DSZA 2FSHA 4URVR 3U61B 3RRYA 1QVRA 2YWHA 4PC7A 4B3DA 1GILA 1RZ3A 2KI5A 1P2VA 2REXB 2FGKA 2WZQA 1ESNA 1T4GA 4BLRA 2QSZA 5G53C 3FOZA 2XTMA 4BZPA 1XZPA 2D2FA 1E2DA 1NVVR 3THWB 4MYHA 4C9BA 2P6NA 2R6AA 4TYYA 3AGPA 1MABB 4P31A 2F1JA 2ZROA 3AH8A 3SI7A 4Z1MA 5KDOA 2WWFA 3NEJA 2D62A 2CCGA 3ZD6A 1P2SA 5L3QA 1JB1A 1KK0A 1JJVA 2GJKA 4EJSA 3OIYA 1YR6A 2B21A 2GXUA 1YVDA 3T5GA 1HEIA 3QF4B 5GADl 4L16A 3SE0A 4AKEA 4ZCLA 1PLKA 4TLDA 4XSHA 4C7OA 4AKHA 2ZR7A 3TK1A 5H68A 4HATA 4RFVA 4PC6A 3VX3A 1AA9A 1SXJD 4QHTA 2O8EB 3PV0A 3AKYA 4M1WA 1OPXA 1FUUA 4BEJA 4NYIQ 4E07A 1Q44A 1AIPA 3EAQA 3REGA 1KK1A 3KFVA 3AVYA 3BAFA 5JSZA 1NIPA 2FSIA 1N6RA 1UPTA 3LAWA 2VP5A 4NH0A 4WVFA 2QTHA 3B85A 3BOSA 3IO5A 2XTNA 1JR3D 5KDLA 2V7QA 3A1WA 1GOTA 1VYUA 1RE0A 3A37A 3KDSE 3LD9A 4C2TA 3NHBA 1NVUQ 4Q4LA 3QKRA 4BFVA 2C03A 1ZYUA 1G7SA 2CHGA 1EFHA 2QZ4A 1LV7A 3VFDA 2VTKA 4CEJA 1FFHA 2XJ4A 2V1UA 2ZAOA 1CJUC 4TT3D 4G01B 1KO5A 4WAUA 1ZCBA 3CNLA 2GVDC 3FFBA 1CRQA 2ZI3A 4YMUA 1ZAKA 4M21A 1T8TA 1E2EA 3TAHA 3DDCA 4PPNA 1E9FA 4B32A 1G8YA 1AK2A 2WWGA 4FMDB 4P0TA 4YMWA 5E7IA 2ZXUA 3ZVMA 2PT7A 2CHQA 3A36A 1XXHB 5CK5A 1R0XA 3AF0A 1NBMD 1OSNA 2OBNA 1Z0KA 3ND8A 3KJIA 3T06B 4DSUA 2L0XA 2VQSA 3I5XA 3GEIA 3QJYA 4LHXA 3G5UA 5UKDA 4M22A 3A1VA 4GZMA 1NP6A 2JA1A 2OCPA 1FUKA 4RD4A 1E79D 2IXEA 1GWNA 4KXFB 5JJKA 3VR5A 4CVNA 1GRQA 3UK6A 2IYSA 3NHAA 4I81A 1KJYA 4TL6A 4F4CA 2BIFA 1KO8A 4LYHA 1KDTA 1SVWA 1I4LD 3EASA 4UNQA 4OQMA 4C0AC 4HAZA 2YOHA 2C2HA 1F2UA 4EPXA 1LS1A 1KI9A 1N0VC 3KKPA 3GLFB 2G9NA 5GVRA 3SFVA 3T5DA 1PZNA 3ZS9A 2J46A 3O8DA 1P9NA 2FN4A 1HURA 4HLUA 3NVAA 3FHCB 3LQQA 3THOA 2O0HA 4I99A 1KI1A 2ZRJA 2O0KA 2DHRA 3I61A 3EXAA 3FVQA 2QQ0A 3W5JA 5LD2C 1RFLA 4K81B 1N6HA 2WM9B 4R9UC 1E9BA 3MJRA 1TQ4A 4M4SA 4MRNA 2BBTA 5AK0A 1RRFA 2GCPA 2ZUDA 2BKUA 1DELA 1N6NA 2VHTA 2X19A 3EIEA 4ITRC 2UVQA 2ORIA 3RANA 3IIJA 2F7SA 2DR3A 5EXSA 2YC4C 5EE1A 5P21A 3MGCA 1XEXA 5KHOC 2V8OA 4C2UA 2IS2A 4ESVA 2Q9AA 5DLQC 3U7GA 4KJZA 1NL3A 2R6CA 3MG9A 4AK9A 5JI2E 1FX0B 2RGDA 4JBYA 3RS5A 2QM7A 4TLCA 3GEHA 1IXRC 1BMFD 4KVAA 2UZIR 1GAJA 2NO1A 3LFUA 2ZM5A 2BBWA 2VP0A 1ETUA 5JWOA 4XVQA 2HJGA 1NJFA 3C15C 3TIFA 5JI3E 1EG7A 3P27A 3Q7QA 3UG7A 4JSTA 4JBXA 4BECA 4EQ6B 3KQKA 1RKBA 2F3TA 2WJVA 3K0CA 2Z4SA 1E0SA 4U5XA 5CYPA 4M1KA 3FE2A 1XTKA 3OEEA 4B3CA 2IUSA 4ESHA 1TUEA 1AKEA 2RGBA 2RGXA 4TYQA 5EP3A 3K1JA 3B82A 2OLJA 3CM0A 1HV8A 4AD8A 1TL7C 3W6NA 4DSOA 3UXMA 3I4LA 4XIGS 5KDDA 1LF5A 1TU3A 2A78A 4Q66C 3RWOA 2QBYB 3F0TA 4EPTA 1OYWA 4JVMA 4LJ4A 3QKSA 4OI2A 2IWRA 3K0AB 4B43A 3RC8A 3L8YA 1T0HB 4B34A 4V0KA 4WBSA 4B6EA 4HUTA 5IHPA 1ONBA 2BCGY 2F6RA 4NBSA 4LHWA 1ZM2A 3AVQA 2NGRA 1E2IA 1SVOA 1XJQA 2GZAA 4PQRA 1XDBA 3TJZA 2PEZA 3O8BA 3W90A 1RIFA 1WP9A 1G7RA 3QPUA 2J5XA 1HQYE 3JVUA 2WJGA 3ICEA 5CM9C 1KSGA 5C18A 4A0HA 3EX7C 4E09A 2D3WA 2JLWA 3HYRA 1W49A 4HAYA 2WWYA 3MWLA 1KOFA 1W0JA 3LDAA 2AN9A 3KJEA 4M9ZA 1NIJA 2J0VA 4B3GA 4ZIRB 1QZXA 3TRFA 1EWQA 1TQ2A 4LRWA 4TLAA 3S1AA 3QF7A 2CJWB 2D7DA 2OILA 1N5LA 1CEEA 2W2XA 4RJLA 4LY6A 3SBDA 2CK3D 2ASEA 4PHFA 4OHZA 1T3HA 4EPYA 1Z6TA 1OKKD 1JALA 2ZEJA 2FMXA 2ERYA 3IBYA 1OB2A 2XX3A 1UM8A 2FFQA 3DZDA 3VHXA 1S9DA 3HU2A 3SZRA 3P1JA 3P4XA 3EZ2A 1LS6A 4PO8A 5JEDA 3HR8A 3K0EA 2G1JA 1E2QA 2ZRMA 3KKQA 1RRGA 4ILEA 5FBWB 2FX3A 1XMIA 3GLHA 2HLDD 2ERXA 2GXAA 5JJIA 4MYUA 4C0QC 3ZVNA 1X1SA 1ZU5A 4EPWA 2QORA 4KHZA 4MGYR 4OK3A 3LW7A 1EESA 1TEXA 1G7CA 4TL8A 2ODBA 3AKDA 5FFMA 3PFIA 3SYKA 1RJ9B 1WMSA 2YWGA 2ZRDA 1E2PA 3QVVA 4M1YA 4TQUS 5DN6A 1ZD1A 4QBIA 5BN3A 3EWAA 5JECA 4PZLA 1VMAA 4MGKR 4V03A 4Q9IA 4XWOA 2QUZA 2ZYUX 4HZUA 4S2EA 3EZFA 2IYZA 2ZJOA 4N0EA 2FFBA 4QGFA 1IN5A 3FKSA 2IF2A 2EYUA 4A8JC 1J99A 2WOJA 3O47A 1E32A 5L3SB 2QNRA 4JLPA 2N46A 2H1LA 3MUFA 4KCGA 2F43B 3OESA 1XTIA 1XB2A 4F93B 3DVLA 1HQCA 1OFIA 4DLUA 1KMQA 3QXHA 1YU9A 2IK8A 2ZREA 2Q6TA 2O8CA 3QSYA 2QY9A 1KMHB 3K09A 2ZR0A 3KXKA 5SZHB 1H8HD 3ADCA 4ZCMA 2ZPTX 4DT1A 2OESA 3SNHA 1OFHA 1DG1G 2IW3A 4PANA 2VL7A 5C4MA 5FUYA 1U8ZA 5AJVB 1IOZA 3BRWD 1BKDR 3LX8A 1W4AA 1FMLA 1E2NA 2QE7A 1FZQA 3WNDA 1KK2A 1IJFA 3IQWA 2DFTA 2QN6A 3D7MA 3GJ0A 3LWNA 4RFSB 3I8SA 3MWJA 421PA 2NZ8A 3C7KA 5DISB 4ZKEA 4CEIA 2JEOA 4BFWA 4KU4A 1RVDA 1CP2A 2DWOA 3E5HA 4Z8YA 1DBSA 1SVIA 3CUEF 5KSZA 2GXQA 1M74A 4PSAA 4DCVA 3U44A 2CL6X 2IYVA 4Q1DA 5EZ6B 2IWHA 4QBFA 4OBEA 2WICA 5FPYA 4A0RA 4MDFA 4D0NA 2JLXA 1J8YF 2QAGC 3GJ6A 2J41A 4Q18A 4URWR 4TN1A 3NBXX 4M9SA 1EFCA 2RGEA 5JZVA 1DVRA 3A8TA 5EE5B 4GT1A 4Q1BA 1DAMA 4QBHA 3MMPA 1UBGA 4TLBA 3GFOA 4A6XA 2CVFA 2EFHB 2XOKD 3CBQA 3QPVA 1G3UA 1WQ1R 2GBLA 3OIVA 1UEJA 4A0FA 2Z0MA 2V54A 1VYTA 2WOOA 2DB3A 2EQBA 2KSQA 4IOKA 1K5DA 1P60A 2A5DA 2WWXA 2YNMA 5EXXA 1GUAA 1T5IA 1A2KC 2OV2A 2FOLA 1WF3A 1EWRA 1Z5ZA 2WJJA 2WMOB 2BMJA 2I3BA 5GJCA 1Y63A 3VX4A 1G6OA 1XD2A 5F3WB 4DEXA 5BYJA 1IXZA 4P4SB 4CF7A 1AM4D 1YRAA 4MRSA 1A1VA 3THXB 2FZ4A 1M34E 1Z0AA 4TMKA 4M1MA 4DKXA 4UJ5A 1G5TA 1ZMXA 3TSZA 4Q1EA 1P62B 2MMCA 3L2OB 2G83A 4PO9A 1VHTA 4ZPXA 1KSFX 3K70C 2XXAB 2FH5B 1VCIA 4U02A 2CDNA 1G3QA 4A2PA 5SZKB 2I1QA 1T3LA 3ADBA 2EFGA 3CRVA 3ZVRA 1C9KA 1R6BX 1ZM3A 1G3MA 3TR0A 4Z1MD 1NY6A 2IYXA 3DMNA 1QRAA 1TQDA 1W5TA 1Z6XA 2YKGA 4DB4A 4OHVA 1KY2A 5C46F 4LHVA 4D4MA 1E9AA 2WMNB 2V3CC 1NG1A 3C8UA 4LJ9A 2C9YA 4URZR 3PUZA 2AL7A 1G8HA 3VR4A 2PX3A 2O8BB 2C96A 5DIFA 3PXGA 2FZLA 5FOTA 1U94A 4X8OA 3RNLA 3WBKA 4DZZA 1OV4A 1XXHE 3TSOA 4FXPA 1YR8A 3GQBA 4Q7LA 4TL7A 1H65A 4RD2A 4URXR 4W9MC 2QU8A 1G19A 4Q47A 2QPAA 1XCPA 3THWA 1PLJA 3U4QB 1E2KA 4QBGB 3RABA 3QI2A 5ANRB 2ZE6A 1G4AE 4DJTA 4PQYA 5EXPA 2IYYA 1D6JA 1OXTA 2ZI4A 2V7QD 4OK5A 4AC9A 2OM2A 4DLRA 2JLQA 3KXIA 3AKEA 2IA5A 1KGDA 1QHHB 2MSDB 2R62A 4OI4A 4Q1FA 5H70A 1OFTA 1IONA 3QF4A 4DC9A 3BWDD 1HH4A 1HT1E 3ZQJA 1YJ5A 2EFEB 4HI0E 2OFWA 1N0UA 2BC9A 5TY0A 4QRHA 5F9FA 4JMPA 1XPRA 3ASYA 4HLUC 2AHOA 2REBA 1Z8FA 5J4KA 2N1BA 4I1OA 3GLFE 4A36A 2O8EA 1FP7A 1GL7A 1CBUA 3UANA 4NU0A 4FMDF 1V5WA 2CCKA 3KX2A 4MGIR 1LNZA 4NKRA 3BB3A 4OHYA 2IXGA 4LJAA 1L7VC 1EXMA 4TMWA 4PC2A 1Q1BA 2DFNA 3CX6A 5AJXA 1IAQA 2PMDA 3K9LA 4GOXA 1YR9A 1IY2A 4RSGA 1SHKA 1JXMA 1R10A 5DYIA 2NO0A 1R7RA 1XBTA 1VG1A 3X1ZA 1G291 4BFZA 3ND9A 2B8WA 4Q9HA 3LH5A 3RHFA 4O2RA 3I8XA 1R8QA 4KFTA 5JCPA 1GNQA 3T35A 3VMFA 2B6HA 1DAFA 4LV5B 4MYTA 4QG7A 3OFNA 2QENA 2ZRBA 2WV9A 3VTKA 1OHHD 4LJYA 4IJMA 1R5NA 2QRZA 3SR0A 1KYIA 1XXHA 4LV8B 4ZDWA 5E4FA 1I2DA 2V4ZA 3CWQA 2RHDA 2WVJA 3B9QA 4Q7KA 5AJWA 1BH2A 2REOA 1D2NA 4D6PA 1P72A 1AZSC 4JSYA 5DGXA 1Q0UA 4BQSA 2QA5A 3UATA 4V0NA 5FTNA 2QSYA 2JATA 1E2LA 3B1VA 3PIRA 4IFBA 5F98A 3A4NA 4OQXA 4Z54A 5JWHA 2W58A 2CEAA 3I1FA 1QVAA 4IVRA 2NPFA 3B60A 4D2IA 4KSCA 5JEEA 1VDZA 3D6TB 3ZVLA 2UKDA 2P3SA 2GESA 3NTUA 4K46A 5TVKA 3GLFA 5FUXA 4BRWA 1W2HA 4Q4HB 1KK3A 3C5CA 5HZKA 2GK7A 2IEYA 2VSOA 4JS0A 4Q1CA 4ASUA 3K0SA 1KI7A 4JJZA 1FNNA 2ZI7A 1MOZA 3X1DA 4LC0A 4NYJQ 5EUQB 1XPUA 2NIPA 2JCSA 1N0WA 1X8JA 5JHGB 4KAXA 4PSVA 2GAOA 3AVWA 3CPHA 4AKIA 2BM0A 2NO7A 3EPJA 3K0FB 2VSXA 3VHLB 3IIKA 4L8GA 4CT4B 3OEED 1IY0A 4ZCIA 4UXIA 1II8B 1VKJA 4CEHB 2FF7A 2IL1A 2IC5A 4W5HA 1J8MF 4L15A 3HU3A 4X8LA 3VKWA 3GP8A 2EYQA 4B3XA 4BLPA 3MCAA 5AUQA 1E9CA 4CYMA 2PX0A 2WPDA 3PEYA 5IDVA 3KTAB 2FNAA 4TYPA 4Q4JB 3ZZTA 2CBZA 2QTFA 4B35A 1J2JA 2ZU0C 3G82C 3WYFA 2Z5FA 3OIWA 1FX0A 4FW9A 1JPJA 4QGAA 2Q3HA 1RRCA 1S1CA 1OH7A 2R9VA 4F4IA 1RW4A 3VAAA 1LY1A 3IEVA 4EQ6A 1SXJC 2GZHA 1CS4C 1GKYA 4LBVA 1KIMA 1A2BA 3HP1A 3LV8A 1SVMA 3ADDA 2H8KA 3FPAA 1Z2CA 1W0JD 1JPNA 2GEUA 1D2EA 3GLGB 3BORA 4V0ME 4D82A 2GF0A 4BE7B 4D4JA 4BFXA 2GK6A 1HYQA 4EUNA 1DAGA 1E2GA 3C14C 3R7WB 2NQ2C 3RVBA 1DO2A 3BB4A 3GLIB 2XTZA 2JLRA 1FTNA 4RY2A 4TYWA 1W48A 2Z6VA 1SKQA 1NJGA 3JVVA 3U3MA 2XB4A 2AXNA 1E9RA 2F1IA 1ZNXA 4G0NA 2B7BA 4HB2A 4LK2A 3UMRA 5D3MB 3AVVA 4G3XA 3PJRA 4LI0A 3G0HA 2P65A 3NC1C 3BB1A 2OAQ1 1MV5A 1YZNA 2P6UA 4Q9KA 3QG5A 4KLZA 5FI0B 2H16A 3W3AA 4JLJA 4JL6A 2ZI9A 5J4HA 5LD2B 4LWZA 1TX4B 2CCJA 3AM1A 4C0LA 3ZJYA 5EP4A 4KSBA 1OLOA 4BPBA 2MSEB 3GJXC 4G5OA 2GEVA 1IQPA 4HB0A 3JZMA 3RLFA 2ORVA 4C3ZA 4ZIRA 4V0OA 5HE9A 4JZKA 4WW0A 3VKHA 2QMUA 3GMTA 3VKGA 5GJVC 3NC0C 4OHXA 2ZR9A 3AQ4A 2ZRFA 2CJWA 5C2JB 1NN1A 4RCZA 3RS7A 4LV6A 4W7SA 3U7EB 2G0TA 5E95A 2CL0X 3GJ7A 4S35A 4IVQA 4M8NE 4XH9B 2WIBA 1DAEA 4NYIR 5DHFA 2OHFA 1G20E 3DO6A 5AWFC 4PFSA 3D3QA 3FKSD 1DAHA 2I1VB 4YDHB 4YXWA 4GL2A 4Q19A 2Z4RA 5HKKD 2VP2A 1N25A 3SHWA 2WAXA 3KB1A 2C9OA 1NSTA 4XVRA 3ETLA 5F2EA 1Z2AA 4DLYA 2OXRA 2GBLC 5E3HA 4UQOA 2JJ1A 3R8FA 2ZETA 3QIAA 4PSKA 2FGJA 4DIDA 3BC1A 2WJYA 5FOWA 2WJIA 4BLQA 3TQCA 4HZIA 1RJ9A 1US8B 4QJ3A 2A5YB 1VG0B 4RZUA 2HEIA 2PZFA 2ZVPX 1N6KA 2ZJZA 3LY5A 4V0MA 3DKVA 4XTRA 4UNRA 1UBCA 3RS3A 3CNNA 1KJZA 2RGNC 2QP3A 1A82A 2QE7D 4AIIA 4UNSA 3FMOB 1L4YA 4E03A 2R8RA 5DE3A 2D74A 2BM1A 2A5JA 2J0QA 1GKUB 3VR3A 2AFIE 2GAAA 5L3SA 3U6BA 1CR1A 1I2MA 2F43A 2Z83A 3TQFA 3MRSA 2QG6A 2OUKA 2C95A 4M0LA 3AP3A 3R20A 1HY3A 1CJMA 1YZUA 4OI0A 2G77B 1KMHA 5KTYA 1OIVA 1MR3F 1CU1A 4IDOA 4OQFA 1RYHA 4Q9JA 3NG1A 4LPSA 1E6CA 5EUMA 3RSOA 2ODWA 3FDIA 4Q1AA 4QNRA 4B74A 5G41A 1TF2A 1FNMA 3IBGA 1MKYA 2WKRA 4MGZR 1XFAA 5DI3B 1S96A 4LJ7A 2LKCA 3RS2A 1T91A 3NEYA 1JQJC 3Q5EA 2W6ID 4DSNA 2C5LA 2ZRCA 1AJEA 1UKVY 3QQ5A 2VSFA 4B47A 2W0MA 1M7GA 2OCBA 5H1YA 4EDHA 4X8MA 3EC2A 1G3IA 4D25A 1FTSA 3FFAA 4RKFA 5FPKA 3BERA 2RGGA 3T61A 4A0GA 2RGAA 1QDEA 1A4RA 1NRJB 3PEVA 4JVSB 2Z43A 1WBDA 2C78A 1XU4A 1Z0DA 2JJ2A 3K8YA 5FL7A 2NZJA 2NOAA 4Q21A 1ZUHA 3Q5DA 1E0KA 2O8DB 2VIIA 2WWHA 2XSZA 4QHSA 3JZAA 3QKTA 2ONJA 5CLLA 2BVNA 4OJQA 3TBKA 1C4OA 3UKDA 4AURA 4DLSA 1H8ED 3I73A 4J0QA 2IXFA 5IT5A 4HLCA 3WNCA 3AF2A 3OZXA 1Q1ZA 2GCNA 2HF8A 4FWIB 1PUIA 1NNEA 2DWQA 3GJ4A 3AP1A 3TSWA 4A8JB 1YKSA 3Q72A 2CE7A 2KWIA 1ZNWA 1E0AA 4JVLA 2VH5R 2VHQA 2BMEA 2R6FA 2YC2C 4WIAA 2QQEA 1KKMA 2J0UB 4MYCA 1KI6B 3N2IA 1DAIA 4YMVA 5KU1A 1OJLA 2H18A 1S3SA 4D0LB 3ASZA 2JLYA 1F2TB 3PCRB 4N1AA 1XEWY 2X8AA 3OHMA 1DARA 4RD6A 1KTVA 1S9HA 2GJ8A 1G5RA 2YVUA 4P4SA 4C0SA 3THXA 3ECCA 1Z3IX 4F91B 1Q3TA 5K8IA 1GIAA 4TQAA 1VIAA 1Z6GA 3CH4B 1G1MA 2FFAA 3CIOA 3MLEA 4ACBA 4TMXA 2UZ3A 2P6RA 3DM5A 4BZXA 2YOGA 2XXAA 3NBYC 1D5CA 4C30A 3X1WA 1LF0A 1Z29A 4E22A 3VNUA 2DY1A 3BD9A 1Q12A 1GTVA 5FPSA 3BH7A 3ZIAA 4JLBA 3UMFA 3AUYA 4RVCA 2B8TA 3QBVA 5JFGA 4D4KA 3R9WA 3O8CA 5E7MA 1EFRA 2JLSA 3CO5A 1QG2A 3H86A 1JR3E 1E94E 2ATVA 2BHRA 3SN6A 2QAGB 4GNKA 3EPHA 2O8BA 2Q3MA 4DBLC 4EFNA 3T1VA 1BO6A 3IUYA 3A1TA 2A30A 1ODFA 5FBLB 1TU4A 1CTQA 3BH0A 4LJ8A 1LB1B 4NTZA 4AG5A 2ZYWX 4M1TA 4EPRA 4A9AA 1VTKA 1CR0A 2WTUA 2NO6A 4LSGA 3DM9B 3FMIA 2ODNA 3U4QA 5CITA 2QGNA 3T1QA 5KNBA 1MRNA 3KKNA 4QGHA 4OHWA 5CK4A 3AVPA 4EFMA 1G6HA 2RAPA 3NDPA 1Q21A 3B7GA 2J1LA 3H1TA 1NBME 1UKYA 3TR5A 5DNYB 1QHHA 3DHWC 1SGWA 2C04A 1Z6YA 2DWPA 4JLAA 4MRVA 5AUOB 3BIFA 1AQUA 5A4JA 4PPQA 3CRQA 4PZZA 2JLVA 4BFYA 5FBQB 3SQWA 1W5SA 4KFRA 5G3ZA 2QPTA 4HB3A 3RRMA 1W0KA 1F6BA 4IEIA 6Q21A 4TMVA 4DUGD 2VP9A 1FW6A 1ANKA 3RAPR 4YLGA 2ZRPA 1KJWA 3B1YA 3V00A 3QKRB 3ZH9B 1GG2A 2OFXA 2QROA 3K70B 4TZ6A 1VCNA 4OI1A 3TW8B 1VCOA 2ZU6A 2R6GA 2GDJA 1Z0IA 5L3VA 4B33A 2WSMA 2CNWA 2GWHA 4I1SA 1J7KA 2FFHA 2JDIA 1E4VA 4B3BA 1W4RA 3BFXA 1QHXA 1JEEA 2BBSA 1E2HA 2WBLC 4ZDIA 3P4YA 2J45A 5TB5A 3CR8A 3PUXA 2WSSA 4HAXA 1NI3A 521PA 4ARZB 4QM6A 3RC3A 2P67A 2GZDA 2F3RA 1JJ7A 1DAKA 2YYZA 3PEWA 1QHNA 1YZGA 4HAUA 1JR3A 4XWAA 1DG3A 1JAIA 2AD1A 1SKYB 2QGZA 2V1XA 5E7JA 5HTKA 3W9YA 3QVUA 2ATXA 2DPXA 3N2EA 1XTSA 1Z47A 1SVSA 2GKSA 1SZPA 4JLDA 4Z51A 4GP7A 1UDXA 5B2ZA 4TT3A 1F60A 5IK2A 3KKOA 3LX5A 4WA7A 4ASUD 3OE7A 3T12A 2WJHA 1Q20A 2ZUCA 4TQ9A 4NZYA 2JGNA 1IJEA 3GLGE 5K8TA 3B6EA 4XVUA 3T1TA 3EIQA 2Q9CA 4BZQA 4DXAA 2W2TA 1PUJA 1NBMA 3GLIE 1RRPA 3AVTA 1IY1A 1KNQA 3ZS8A 4DSTA 4IFEA 1KAGA 1W36B 4JKYA 1E9SA 4JLVA 2LCFA 1G7TA 5C4GB 2JLZA 4XOIA 1ZD8A 3U7HB 2WPDD 1HE1C 1NMYA 2ZTSA 4EJSC 2ZJ5A 5G40A 2ZSBA 3DL0A 1JQLB 5BN5A 2KB0A 2PLFA 3W8NA 5B30A 4L9WA 4M9QA 4QJ5A 3L82B 3F8TA 4PC3A 1LVGA 2ECKA 1U98A 4B2PA 2HF9A 1CLUA 1BS1A 1OH5A 4QJ4A 1WA5A 3RRZA 3FYHA 4GBMA 4GSYA 1QHSA 3CZPA 1XD8A 1O87A 2JASA 1FL9A 3WXMA 3ZDQA 4DLZA 3J81k 1B0UA 2PJZA 1MRSA 2ZE5A 4MDEA 3WYGA 1JR6A 2J7KA 5JWRA 1II8A 2H5EA 5TXGA 3L0SA 4CEHA 1WB9A 3EA5A 4LUCA 4AYTA 3WHLA 1UKZA 3NIBA 1WDTA 3KTAA 4Q4JA 1TF5A 2G6BA 1ZP6A 2ZS9A 4GRAA 2G1KA 3IEUA 4FMBB 4C4PA 2J7PA 1SVKA 2QT1A 2OFOA 3AB3A 3PQCA 1A5TA 1MO3A 2EVWX 1GZSA 5FTLA 1W47A 3QKUA 4N3NA 4JLNA 5GJWC 2RMKA 3HU1A 3FB4A 3Q85A 5CJPA 5B64A 5KNCA 1M7BA 2FE4A 2PJRA 1K6MA 2GJAA 2ZRNA 1ZRHA 4ZDJA 2ZRLA 2GVZC 5KNDA 1CULC 2R6DA 5CDFE 1A7JA 1WXQA 3FHTA 3C5HA 3SDZA 2HXYA 4P4TA 2B7CA 2DYKA 2BMFA 1NN5A 2KE5A 3GLGA 1NLYA 5AR1A 3VQTA 3F3YA 3I32A 4KODA 2CHVA 3R7WA 4AWXA 3MJHA 2ZVQX 3GLIA 1JEDA 3ZZUA 1JXOA 4IVPA 1W2GA 1UEIA 2X77A 3EWSA 3KQNA 1Q3HA 2VO1A 2IEZA 5KPJA 2VBCA 3DEFA 5BXQC 2BKEA 3OAAA 1Y3AA 1MABA 2AK3A 1P73A 1E96A 4URYR 5BQ5A 2AWNA 4V02A 4L4UA 2QTVB 3EPKA 4YXWD 1D9ZA 4PAOA 4P3YA 1Z6AA 4FCVA 1U99A 4HAWA 4IDHA 4PHTA 4CRWB 5C1BA 2XJ9A 1K8RA 3V9PA 2EFDB 4DIEA 2YINC 1E69A 2J0SA 1DS6A 1XRJA 4NCKA 5KOYA 1T5LA 3QBTA 4BLSA 1FMJA 2G3YA 2PZEA 3HPRA 1PLLA 3X1YA 4MH0R 3E1SA 1Z63A 1OE0A 1ZIPA 2PL3A 1VYVA 4LYFA 4G5QA 1XMJA 1FP6A 4IXMA 2PZGA 4ZDKA 3GLHB 2VA8A 1OF1A 3CRMA 1XEWX 2WKPA 4IW3B 1XZQA 4Q48A 3R8CA 4KFSA 2A2ZA 2IF0A 5DHAA 2IYQA 2V55B 4AYXA 4II7A 1MO5A 4RCYA 2ZSEA 1X6VA 1Z83A 1CF4A 2FEOA 2GEDA 5D3QA 1SXJB 4NONA 2XZLA 4DVGA 1AKYA 2QL6A 2ZSFA 4DCSA 2O5VA 2RKOA 4MITA 1N3BA 4C0KA 4E5UA 3UPUA 1II0A 1EFTA 4RZ3A 3I3SR 2MSCB 3CF2A 2IBMA 3KUCA 5CDFA 3BGWA 2ZRHA 3FGNA 1B23P 4PR0A 2K5UA 2AK2A 1OIWA 1US8A 2VYFA 3IO3A 3KKMA 4JKIA 1R0YA 2GHIA 3L8ZA 4WXRA 3VR1A 4CIDA 4EIWA 3GFTA 2C8VA 2OAP1 2BEKA 3K0CC 4ZI3A 1NY5A 1KI4A 1ZNZA 3TUJC 4B2LA 2GETA 5FBVB 3QXSA 3CLVA 3ADKA 3MSXA 4FINA 4JT4A 4EPVA 4TSFA 5EP2A 1HE8B 2DFLA 3SJCA 1CJKC 2O8CB 3OF5A 2FPLA 4GMDA 3CKLA 3V4RA 1SVLA 2OE2A 3KQHA 1GVNB 1M7HA 2AD5A 3CPJB 2C77A 3L0OA 4JT2A 1OXVA 1U8AA 4URUR 4JL8A 2W00A 1Z0FA 1DADA 4R7ZA 4UNPA 3LA6A 2PEYA 2IYWA 4I4LA 2PH1A 3NBZC 1EGAA 5TARA 1VG8A 1YZTA 1COWA 1KO4A 1T6NA 1NLFA 1N6PA 1TF7A 2JJ2D 4YC7A 5FL7D 2HT1A 3QG1A 5CM8B 4W5WA 3SEAA 5A0FA 2WWIA 2XSZD 4RKEA 3KUDA 5DI3A 1G21E 3IDQA 2VLIA 1NG9A 2F55A 2WHXA 2IYRA 3VU9B 3ICQB 3TH5A 3CF6R 3SFZA 2OSBA 4G5GA 3GJ5A 2IYTA 1XP8A 1NVXQ 3U60B 3HJNA 4TTQA 1T8UA 3LRPA 4EKDA 4YQFA 5BYKA 4OKSA 1TTTA 2KBEA 2OBMA 4TMZA 3R9XA 4K8OA 1Q1QA 4XJXA 1WRBA 5JHHB 4H9GA 2Q21A 2GXSA 3M4YA 3WNBA 5BW8A 1GITA 2X1VA 1KNXA 1WBBA 3IHLA 4MKFA 3W6OA 4JLMA 2O8FB 4IXNA 4PO1A 4OL0A 4QC2A 1IN4A 1N5IA 1Q1EA 3QE0A 4HAVA 4DEYA 1KDRA 1LFDB 4B76A 3QENA 2JIZA 2XEXA 3GJ8A 5LB4A 1XTQA 2O8DA 1ZJ6A 2BV3A 1R5BA 5FOXA 1AGRA 1NKTA 2VHCA 1DTSA 1JECA 2IX3A 4HUQB 4MA4A 1ZUNB 2ZI6A 5KO2A 3TUZC 2IUTA 4CGZA 5FI1B 1OW3B 1N6OA 1IM2A 2GRJA 4OJKA 3HPQA 1F3OA 1GNPA 3ZZ0A 2QEQA 3SOPA 4A8JA 2IYUA 1P2UA 3EZ9A 2J0UA 4O3MA 2BJWA 1G9XA 3UIEA 3Q8XB 4NYMQ 2OEPA 3ZIAD 4JVNA 4QHYA 2XOKA 2ZSDA 3L0IB 4LDJA 1F2TA 4M2LA 5EE0A 2ZS8A 4NCJA 3B13B 4BEBA 1EFRD 3WMGA 1AGPA 4Y0AA 4LHYA 3WP1B 1AS3A 2QRNA 2VRWA 4OQLA 3AEZA 3CB4A 3NDBB 1G5PA 3IIMA 2G0NA 4KFUA 2QT0A 4QFMA 2QBYA 3H0KA 3K0AA 4TL9A 1SHZA 4D0GA 3GEEA 4MUBA 4P33A 4PQFA 1P2TA 3K09C 2WIAA 4LZZA 4PC1A 3WHKA 2KJQA 4DLWA 5FTJA 4LOAA 3I72A 1KZ7B 1Z28A 2P0EA 1S0UA 4IEEA 4PPGA 1P3JA 4Q03A 4RD1A 1UAAA 3LVRE 3PITA 2AKYA 4LPKA 5TDHA 3EA0A 3THYB 3AKCA 3KXLA 1J90A 1ZM9A 3CR7A 3TVDA 2ZITA 5JBQA 4FWTA 1CKEA 1OH8A 1KKLA 2FG5A 1N5KA 1S8FA 2XAUA 1M6NA 1ZC3A 4HLQB 1NVVQ 5JS8A 1SKYE 1QHGA 2QAGA 2GCOB 2W6JA 5CYOA 2HCJB 3LLMA 4LHZA 3PG5A 4NDZA 3K9NA 3ZD7A 4PZYA 2AFHE 5DN6D 4KLNA 2OZEA 5DH9A 2OBLA 1D2MA 3C41J 1QHYA 1DPFA 2J9RA 3OEHA 4G5RA 1VECA 4I1VA 1W0KD 3PVSA 2ZE8A 2P2LA 4Q9LA 1JNYA 4O25A 3TMKA 2TMKA 3N70A 3E2IA 3SYNA 3H4MA 2QMOA 1IBRA 3B5JA 5LPNA 2GF9A 4POAA 4US0R 2NMVA 2AXPA 4O2LA 1E9DA 2CNWD 3HWSA 2JDID 3IQXA 3SJAA 2AKAB 3TUIC 4AG6A 2W2VA 1G4UR 2N42A 1UBEA 2CLDX 3AP2A 3CX7A 4W5JA 5AUPB 4XWKA 2WSSD 5KPDA 3SS8A 4JYBA 4XD7A 2EFCB 1NN0A 3PUVA 1UF9A 2SHKA 1OT3A 1U90A 2D7CA 3TLXA 2HV8A 3WMEA 3IPXA 3B1XA 1T0JB 1UJ2A 1BYIA 3QY0A 3NWJA 1R5OA 1GRNA 1AQYA 2VP6A 3TE6A 4U00A 4B6FA 3W34A 2ZRGA 2FDCA 4DRZA 1MO6A 1ZC4A 3B9PA 4P32A 4NMMA 3MWYW 4WOPA 5IK2D 1EX6A 2A3RA 1KDOA 1ZIOA 4PX9A 3LO5A 3IILA 3NH6A 3OE7D 5FPTA 2BCJQ 3B78A 1MO4A 1O3YA 5TV2A 4MQBA 1GNRA 5FTMA 2D2EA 4ARZA 1E1RA 4CT5A 2HYIC 3CWZA 4A2WA 1XMVA 4NPHA 4UNNA 3P20A 2E1RA 4B71A 3I62A 2FV8A 4ON9A 1S3GA 3U5ZB 1RPZA 1TNDA 3IHWA 1X86B 2NPIA 1WCV1 4LJ6A 1ZUIA 4TYNA 4LC1A 2EWWA 2HT6A 4TLEA 2GJSA 3WY9A 2JJ8A 1XWIA 1AS2A 5J5CA 4RFSA 1G41A 1HTWA 2XNDA 4RZ2A 2CE2X 3PR1A 1U8YA 1XCGB 4ZI2A 1T9HA 2OT3B 4NE2A 4JLKA 1X1RA 1E0JA 4FD2A 3IGFA 4US1R 2BJVA 2PCJA 3EW9A 2ONKA 1E1QA 3VNVA 1RYFA 2FPKA 5DYGA 3AVOA 3SC3A 1DOAA 1EFUA 1OHHA 1YZQA 1LW7A 1E2FA 3KL4A 2GJ9A 3DOFA 4BFUA 4IDNA 4KYIB 3P26A 2YHSA 5IF9A 2QP9X 2VPPA 5L8VA 1D9XA 3LBIA 3AGQA 3RYTC 2XB2A 4R2IA 1KSHA 1G8FA 2VF8A 3FTQA 2BWJA 4M53A 2HXSA 1NMZA 3A1SA 1GL6A 2V9PA 2BBOA 3UMSA 4C0JA 3MAAC 3W6PA 2VP4A 1RC8A 1U9IA 4GPTA 4DDWA 2P5TB 5HCNA 1FQJA 2J7PD 2ZJYA 4HDOB 4U7DA 4RD3A 4ERNA 1P9WA 1M8PA 2C98A 4KYUA 2ZRIA 1P75A 3AV0B 2BOVA 2ZYVX 1E3MA 4KITB 2JLUA 1PJRA 2QI9C 4WZ6A 2GNOA 4Q02A 3EC1A 3T1OA 3PUWA 5FOUA 5HE8A 4O0MA 4M9XA 1V43A 4OK6A 4PAQA 3U2QA 1AZTA 4Q4AB 1QHIA 4FI3C 4DDVA 3U7FB 3X2SA 4EAQA 3ZLJA 2DCUA 1G17A 3GLHE 4FCTA 3GPLA 4ABYA 4GI7A 5HR5A 3EZ7A 1ZINA 3U3OA 4US2R 4A82A 3IKJA 4KVGA 5CIQA 4QKQA 4BGDA 2A5FA 2ZQ5A 1KHTA 1Z06A 3WRXC 4HB4A 2CL7X 2DFKB 4NCIA 4UJ3A 3MWKA 1QBKC 1SXJE 3X1XA 1E4YA 2WKQA 4DCTA 3OAAD 1P4SA 4L5BA 2PT5A 2YV5A 2CLSA 3CPEA 3RDPA 2QP4A 5FL3A 1YHNA 3QEOA 5FPHA 2W83A 2FEMA 3OIUA 3SJZA 4DCNA 4FMCB 4TTRA 1OXUA 3CZQA 2FSFA 1BYUA 1ZM7A 1E99A 1XJ0A 2AR7A 3W5IA 2ZIAA 3EIHA 1XCMA 4HYYA 2H7VA 2A7QA 2AX4A 2QM8A 1SQ5A 1BOFA 5EXTA 4GDFA 1JAHA 3HYTA 1X8LA 1KDPA 2FU5C 2ZUBA 4WXPA 5L3QB 4IHQA 4ACAA 4D80A 2V6IA 2Q0HA 4EJSB 821PA 4IOMA 2NTYC 2EW1A 4R71A 3A4LA 1U81A 3F5FA 1G16A 4C7OB 4ZO4A 2C99A 1XMSA 5FR1A 2OXCA 3LVQE 5LDDC 3K9HA 2H57A 1GL9B 4LCBA 1TEVA 4DB2A 5EP1A 3VR2A 1DE0A 3REFA 4QOSA 4R2HA 3CF0A 2CMKA 3RWMB 5JSZB 1VG9B 3WBJA 2HDNB 1XPOA 1CR2A 2OCYC 4PXAA 1KO7A 1BIFA 3TGPA 2BEJA 1KAOA 3I5YA 2QPOA 2W0SA 1TADA 4Q5IA 2VF7A 4A15A 5G3YA 1N2CE 4WZAE 3OFND 1W44A 4HSEA 1ZD9A
chains in the Genus database with same CATH superfamily
3NB0A 2B92A 3ZK7A 1C8KA 1A7AA 1O9GA 2Z2XA 3O1IC 4M6WA 2FA9A 2PK3A 1IB0A 5CB6A 4MVXA 4EP1A 2CVHA 1D8TA 4EHFA 1EM8B 3ZW8A 3H2HA 1V6CA 2EJTA 4BRUA 3U3KA 4MQEA 3FPKA 5IWCA 4MRPA 4E32A 2VQ6A 3ELYA 3ORHA 2OFPA 1G5IA 1GPWB 1L6IA 1NVWQ 3R3SA 5NLLA 2F3QA 1R6DA 1KO1A 2ZBQA 4GMXA 4NFLA 4BCCA 3N7AA 1KXJA 1OGJA 4MVCA 3KZ1E 3LXRA 3ZDRA 3N2ZB 4LDQA 1P19A 2QYOA 4BQPA 2QR2A 4OEHA 1COWD 1E5DA 3O1JC 5E2IA 1NW5A 1KI3A 3HJGA 1XNJA 2HNBA 3HWRA 2D0IA 3N7TA 4XI9A 2CJYA 4ZCRA 3T3IA 2F1RA 1M2GA 6LDHA 2QJTA 1O96A 4HADA 4OIMA 1ZGAA 3I76A 4JU8A 4CN9A 4DLXA 4ALJA 1WPXA 3IIIA 3C0KA 2ZAIA 1P61B 1V95A 3GB9A 2HR1A 4MR7B 3TOXA 1R0WA 1UKCA 1VRCA 1DC7A 3Q7PA 4WDQA 3W4KA 3W2HA 2P4SA 3ZNOA 4C21A 3K5PA 1ZW6A 4GXTA 2BMDA 4GSLA 4QYWA 4ZU1X 3ZTTA 2YJTD 1H5QA 1SBTA 4BMDA 1S2MA 2VJQA 2XVYA 3O4VA 4FHEA 5CT9A 2I29A 2ECFA 4KK4A 5AI4A 3OD5A 1ZQ1A 4WZZA 3TXXA 4JZYA 2YMLA 1A96A 3CLRD 4PHGA 4ZT2A 1B6RA 1E0DA 4L74A 4C22A 1IXSB 4W7IA 1J00A 1EE2A 3I2IA 3WAGA 5T8KC 1WPRA 4B44A 4CMEA 4YHHB 4EY8A 2OKGA 3ET5A 1LPAB 1SH7A 2VK4A 2QTGA 4JODA 2QAJA 5JCZA 2JIZD 3IEMA 3NGLA 1WMEA 1UWLA 1DFHA 3CT4A 1NLZA 1AN0A 1SCIA 4JFRA 3STUA 3V8NA 4C6TB 3QTTA 4YK7A 3EXG2 1UWKA 2JGAA 5AW5A 3UGJA 1SOUA 2AF4C 4HDNA 5E9AA 5KJFA 2A9OA 5A7GA 3MLBA 4ES6A 5CX1B 5EUCA 2GWRA 1U0SY 2PAFA 2WPNA 4KWHA 4U3JB 4G8JA 5I9SA 1X9GA 3V33A 2A3NA 3WQBA 4AY2A 3TZQA 2PUBA 4DDUA 3LF2A 1U7XA 2MMGA 2ZW9A 4RD0A 1M2HA 4EA8A 3W1EA 1ZXLA 3DOHA 3BUSA 1ADCA 2ISQA 1KY3A 4ZOLF 3OJ0A 1NLMA 4WJLA 3K9BA 4KL8S 3EXG1 4ZKDA 3AZPA 1XEXB 3W2FA 5BT8A 3RS0A 1XOIA 2XUDA 1CPYA 1QF9A 2CJFA 3RS8A 2DF8A 1TTQB 2G28A 2OO7A 3EMKA 4OGKA 4WKBA 5K3AA 3RVNA 5K03A 5G4LA 2XZPA 4R2MA 2QYHA 3K9GA 1YZ3A 3PXDA 1YE3A 5CAEB 4S05A 2IV3A 1NI4A 3DMGA 4WMLA 4TVBA 2D5IA 5HZHA 2XUGA 2OLKA 5DBEX 2V9ZA 2VJPA 2WSIA 4M1OA 3QVKA 3B20A 4IJ6A 4YGYA 1QG4A 4BB5A 4A6DA 2OGSA 3K2EA 1EX9A 2JGFA 1JLHA 3AO0B 4YRJA 1EFVA 1K4KA 1QWSA 3KEGA 2RGNA 5IDYA 2IBSA 1SO8A 3EDQA 3T34A 4C0XA 2JGEA 3MGGA 3DOIA 3SZGA 3UUEA 3QU4A 2UUAB 1U3FA 1ZG3A 4NFHA 2FN8A 3LT2A 4M76B 1EK0A 1HTBA 2J48A 1WLSA 3PNSA 4Y0VA 5AKIA 3T99A 5I48A 3DMHA 1G64A 2PKRA 3CW9A 1R4MA 4FIDA 1WHTB 2QLBA 4GPEA 1K5GA 2RBEA 2A9FA 3EZLA 3B7PA 2J4DA 2XZOA 5L4NA 2QV7A 2CFIA 2AE2A 2G5PA 4ND4A 3QKSB 3EVCA 2WHQA 5KAPA 2FXIA 2AOWA 3ZGXA 1EUCA 1T36B 2W2KA 4Q9DA 1D1SA 1NN3A 1M1YE 4BB6A 1JLRA 1S1MA 3JW8A 3GEPA 4RCVA 5MF6A 1DZ3A 1AS0A 1E7RA 4LYAA 5C8DA 2J3MA 4U7TB 2Z1MA 1NUHA 3INYA 3TAUA 1TVKB 1NSFA 4TRNA 1OX4A 1CRWG 1NVEA 2A8YA 2FJUA 4ZODA 1QH9A 1O5IA 4NCHA 4W9RA 4A92A 1JHZA 3KOUA 1GUFA 1DX6A 4N8SA 3QFRA 1H3FA 3DV0B 4BO8A 3DBHA 2R8BA 3DOJA 1KJ9A 2ZJBA 5CFNA 2ISCA 1FU8A 5LJLA 4MWDA 2JVIA 4GPD1 1AURA 5TQ0A 5JRDS 4C4XA 4EI7A 4NV3A 1IN1A 4LBZA 2VHJA 3RV4A 1QFYA 7ABPA 3THYA 3BCUA 3AUXA 5GM1A 4H59A 1XN4A 3U3RA 2XUOA 3NI2A 4J0DA 4C1NA 1Y89A 4KYTA 4DBLE 5DM1A 2JJ1D 4EVSA 2OMKA 2CDRA 3VJLA 4HVLA 1YH3A 1UOPA 2F90A 1JS1X 1RP7A 4A6PA 4JA2A 1OB5A 1A8QA 3E27A 1EUYA 4Q00A 4H1HA 4KBFA 5IRCD 2J59A 5B57C 1I0IA 2FX5A 2D4HA 3KVRA 2FZWA 3NV7A 5FOVA 2PM8A 2BN4A 1I4DD 4BKUA 1NR7A 1P7CA 1RRKA 1ZKMA 4YV1A 5COAA 1Z33A 1ZVQA 3H2SA 3OE5A 5BV1A 4QM7A 3H05A 3RTCA 3F78A 3DNMA 4MKZA 4HDCA 3QIVA 1GUYA 3K5IA 4MWTA 5HRAA 4OX9Y 4KE6A 1QH1A 4AP9A 1YONA 5CTJA 5DTMA 1YZHA 3RYIB 1GSOA 1OH6A 1W8IA 5FOSA 4PCLA 4L02A 1XRMA 3D8BA 4E30A 3VPGA 4BLTA 3C3WA 4QYIA 4B6SA 1YUBA 2C5HA 3R6WA 3JQPA 5DTIA 2W90A 4I4NA 4J2OA 2O05A 4ZGGA 2Q3LA 3P96A 4HLDA 4R1OA 3OQIA 5CMLA 4JROA 2NO9A 1T24A 1BWPA 4PXYA 4X84A 4ZVRA 3SBEA 4B0PA 4CQMA 4X5OA 1LA2A 1T2UA 4FFBA 4BJ1A 1MQAA 1KC1A 2JGLA 3LBYA 3H04A 1PR9A 2QD1A 4NLLA 4YJ2B 4MVJA 2LWIA 2XRZA 2BUBA 5EJ4A 1TQ8A 3TZ6A 4FLFA 1K7SN 2A7XA 2FZEA 3KVOA 1C2TA 2XT0A 1I0LA 4WNIA 3W3ZB 5KYUB 2HLDA 1ESDA 3KT0A 3M6AA 2V8BA 2C92A 4RZQA 3TPZA 3U6KA 4B3FX 3HBFA 1UBFA 5EE3A 4Q6WA 1MT0A 1XROA 1GT91 4BP1A 3AM5A 4PHHA 3MZ0A 4ZEXA 5CFLA 2BLNA 1IUPA 1JQAA 3EUEA 4OPMA 4J0IA 4UW9A 1V5EA 1B6SA 4FOSA 4WCFB 1Z5VA 3WYAA 2OCKA 4G0XA 5KYNA 1MRZA 3HA3A 4QVGA 1LWNA 1NWCA 2DVMA 2WAYA 4N5IX 4IWXA 4P4UA 4JL5A 4H6XA 4INJA 5DKFA 2UXDB 3DHYA 2YV2A 3DCNA 1ZSVA 3OQPA 3PQ2A 4IDFA 4RHUA 1N2HA 2ZT5A 2WV7A 4MHSA 1XCBA 1WLYA 1XK7A 3ER6A 4DUGA 3GBSA 1KC3A 4PAMA 3D5QA 4PZAA 3CX4A 4XDZA 5FWAA 2SICE 2HJHA 4TTSA 5AVJA 3LIPA 5DM4A 4L0CA 4WZBE 3GWGA 3HFJA 3FWYA 1T3SA 1T34A 5E6UB 3V46A 3WISA 3ZE0B 1EUQA 2IZ0A 2OTCA 1OXXK 1JBKA 1QIJA 2KW5A 2LTAA 1ZOLA 1U9ZA 2VI5A 3B3FA 3FMFA 1IC6A 1F0KA 3SJBA 4BZWA 2YWCA 1D4ZA 3C8ZA 3A6JA 4NBLA 4F4JA 2I4IA 3FX2A 5GPBA 5K0TA 2N3ZA 3GGCA 3GLKA 3P9PA 3HI6A 2PU5A 3OBIA 3L7CA 1OTYA 3OCZA 3DTVA 1H8HA 1V71A 2IHTA 1WCXA 1GU7A 2XI4A 3BG5A 3D5EA 3LGAA 3QOFA 3WBFA 4BCDA 4YS6A 4EI2A 5A04A 1J20A 2YFHA 2B1QA 3GK3A 4UM5A 1K6XA 1WULS 1UKEA 3BBPA 2C2OA 2GM9A 2LE0A 1HC7A 2R97A 1JAXA 4KP7A 4NEHB 5HVNA 1A8IA 4UM9D 4QUAA 2PKXA 3BIOA 2PX8A 3DUFB 1WUTA 2XLCA 4XUGB 4GHWA 3QNUA 3ROXA 1D4OA 5JSFA 3R9IA 2YZ2A 3I9LA 3EBPA 2Q5OA 4C29A 1JE1A 1NXQA 3H5LA 1HT2E 3B6KA 4X97A 5CDHA 2UZ0A 2C9CA 3WLKX 1Y9EA 3H2YA 3B6JA 4D8VA 1T1GA 4R68A 3A2MA 3P71T 3OC6A 3UPTA 4KYVA 3H9EO 4UHFA 3F9IA 3NKFA 4I1IA 5F77A 1XD9A 4G4GA 3IV9A 2HMSA 3TMYA 1N5DA 4ENUA 2KLHA 5FAKA 4F92B 3F67A 3I28A 4C14A 5DX8A 2BF4A 5CPFA 5F5NA 4HNAA 2YX1A 3K4HA 3PNBA 4NZ9A 4WK4B 1T1EA 5JO9A 4Y0NA 2VFAA 5JLJA 5K20A 2O54A 1VBKA 1THMA 1QFXA 3MIZA 1Z0UA 5IUJC 1Y6GA 1XD2B 2JLAA 1XA0A 1S5PA 3KALA 3NBAA 3DO8A 5JZMA 4DV7B 1NZJA 1ORTA 1WCWA 4JLOA 3VMMA 4CKBB 5HRCA 2YOFA 3TKLA 2XBMA 3WLMA 4KBGA 4U2GA 1CG6A 4UTZA 3P2EA 5DNWA 4LDNA 3OMLA 3IOYA 5G0SA 4DCMA 1KP2A 4XM2A 4R2WA 5GZ6A 1GCIA 4XUDA 4E88A 1YDFA 3Q9LA 1SU6A 2JCGA 4MULA 5AK5A 3NBFA 1FC0A 4G97A 3AG5A 4YMTA 1H05A 1R15A 2H17A 1IN8A 2C7VA 3QXXA 3FMPB 3W9UA 1QK3A 1WE2A 2Z04A 1PT5A 1JPUA 1UBNA 1P6XA 3GARA 3H0EA 3S5UA 1I01A 2ZIZA 4R8KA 5B58C 4QL3A 4OB6A 2X86A 5CIWA 3S3TA 1FXWF 1Q1NA 4QELA 2NSLA 4DHEA 2PIAA 3COWA 1N6IA 4EBBA 3T15A 2KM1A 1AV7A 5EJEA 1XYYA 2BDTA 2G5CA 3HCCA 1EK2A 3BTSA 5B1IA 5KYXA 4N0PA 3ILYA 4F5YA 1YXMA 3RRFA 4LX0A 1C1XA 5F73A 2ZCVA 3MS2A 3S6JA 2BFDB 4F9EA 2GA8A 2P2YA 4U2KA 1BDMA 1BMTA 1BXRB 3LYHA 3U61B 4GM0A 2YWHA 1JNXX 1A8UA 4B3DA 3PQ4A 2OCDA 1ZN9A 3HZRA 1QZUA 1MCZA 1RZ3A 2KI5A 1P2VA 3QP9A 2QQGA 1F7UA 1AQNA 3IQHX 7ADHA 2BD0A 4IMPA 3F96A 4NCXA 2QSZA 1FTYA 4B46A 2XTMA 3ENZA 4BZPA 3NMUF 4GZ6A 3V1LA 1E2DA 3THWB 2WWRA 3SLRA 3DG9A 1GXSB 2R6AA 2YWDA 4C9BA 5LNK6 1DU4A 1F0PA 3PE3A 2GUGA 3TTTA 3AH8A 4J03A 4UEOA 5HFJA 5KDOA 4JP3A 2WWFA 2XAAA 1X19A 4ZO9A 1R27A 1IWBB 2CCGA 2EFJA 2MSNA 3GRCA 4N54A 3DJYA 2HO5A 1KK0A 1JJVA 3RYHA 3TCNA 1DOZA 1UMCB 4FT4A 1JYEA 5A4IS 3ND5A 4DXDA 1YVDA 2EOAA 1SAYA 2OXFA 2PS9A 3IP8A 3QF4B 4ZAGA 1Y5NA 3ASUA 5JFOA 3X2FA 4KPUA 1YUMA 5TEVA 4AKEA 3HSSA 5CLGA 1CVLA 4AKHA 4OB7A 1HL3A 2A0WA 2YHIB 4BNMA 3GAFA 3DZFA 4LFAB 4MV0A 1IG0A 3RYFB 1QGED 2O8EB 1SXJD 2GM3A 3S27A 4HVCA 2BHSA 3WGTA 1OPXA 4E07A 3QKIA 1AIPA 3EAQA 3AVYA 3KFVA 3BAFA 3QHAA 4L5CA 1SWWA 1NIPA 2PBLA 3UHPA 4IHJB 1ZXXA 2FR8A 3EJ6A 4PCAA 1A5BB 1I1QB 2QTHA 3B85A 4UU7A 3RVMA 2ZJ0A 4H31A 4XYMA 2XTNA 2YV1A 3NWEA 1IEXA 4RTRA 2V7QA 3J7AC 3EGDB 4C2TA 3KK0A 1V6SA 3NHBA 1NVUQ 1XCJA 2Z1NA 4Q4LA 5H80A 4BFVA 2JAHA 2Q5LA 2CHGA 4FBLA 4HQOA 4X66B 1NQAO 1Y8RA 4AU1A 4CEJA 3QLVC 4O4LF 1O08A 2ZAOA 1FFAA 1L5VA 4JENA 1CDEA 4PM4A 5CM2Z 4EG7A 1B0ZA 1HDGO 4WAUA 1ZCBA 2R00C 3CNLA 5FJIA 3FFBA 3LT5A 4CFZA 1BZYA 4K9MA 1ZAKA 3ZHCA 4PN3A 1U4SA 4M21A 3MMNA 4O2BA 5KTPA 1T8TA 4RKQA 5TQ0B 3MMSA 1XKTA 3DDCA 1Q7RA 2QVYX 5J1TB 3DMTC 5T4BA 1P8JA 5FCDA 1J49A 1G8YA 3BZBA 1AK2A 3OQHA 4YMWA 4OKIA 5E7IA 3R7NA 2K7FA 3B70A 2PT7A 3DW1X 3V34A 2IH4A 1XXHB 3JQBA 5DGIA 5CK5A 3PRYA 1NBMD 4I7EA 4I08A 4OHMA 1DCKA 3JSAA 3KJIA 3T06B 3I5XA 2WHPB 5IJXA 2PSSA 2AC4A 4TWRA 2ACEA 2VSNA 2LNDA 4LHXA 5E6RB 2HQOA 3OTWA 3WGYA 2MYPA 3HDGA 1NP6A 4F4HA 4RLFA 1NBWB 4BNHA 1KPGA 4RD4A 3ZV3A 1E79D 1Y37A 1QC5B 4AJKA 4A73A 5JJKA 5DCLA 5F78A 3OA0A 1A69A 4ZYWA 3NHAA 4I81A 4AXBA 2CJXA 1DUIA 3WJ7A 1JLLB 1KO8A 1TZJA 2CFTA 4LYHA 3W6UA 3Q3VA 2V74B 4LOHA 1DFGA 4EATA 3P52A 1I4LD 2AGVA 3EASA 2Y0DA 3WO0A 1A9XA 1TMYA 1ZJWA 3G6KA 1MJHA 4HAZA 5LZ8A 1H6CA 1KKUA 2WR8A 4W63A 1T9GR 2G4CA 1CQIA 4PTZA 3SR4A 4IX1A 1CCWA 3KKPA 3L4SO 1VGVA 2QTNA 4D9KA 5TVGA 2IRWA 2F3PA 4ISCA 2XKBA 5ILOA 3SFVA 1N57A 4UBMA 1IRIA 3ZS9A 1J21A 3OPVA 5FWXB 4HLUA 3EFEA 3PCXA 1GV0A 2WUVA 3LQQA 1FSSA 5A5VA 2O0HA 4J4HA 3DEHA 2ZRJA 3AT1A 1MF7A 3FVQA 2EZUA 5LD2C 3ISTA 5ALNA 1QFMA 3MCWA 5EHNA 1MJFA 2FWBA 2ZP1A 4XIIA 1FP4B 1JBEA 1JG2A 4MRNA 5HM6A 3JD4A 1WZUA 1QGUA 1ZD5A 4YUAA 5KYTA 2Q3DA 1WW8A 3M5CA 3JASB 1N6NA 4I46A 1TIBA 1XAHA 5D8DA 1DRUA 2UVQA 1QO7A 5FLEX 1ZD2P 3RIEA 4EZBA 1DINA 3ZDCA 1F9AA 4TKVB 4YAFA 3RANA 1FYEA 2DR3A 3PGA1 3WK9A 4DMKA 5B2EA 5BSKA 1PTJC 3CUKA 4UVEA 1KQPA 1NMEA 5CEFA 4C2UA 2CLMB 3IT0A 2JF0A 3JQFA 3T4EA 2HBZA 3MG9A 5LMZA 3V8EA 3WB2A 1FX0B 3F90A 1T8PA 1AQIA 1TO6A 5KC9A 1BMFD 2UZIR 4W1SA 4ZN6A 2XCQA 2BBWA 5IS2A 2IEIA 3IP3A 1ETUA 3IESA 5JI3E 3RSGA 1EG7A 2GD2A 3ADOA 3M89A 3P27A 3SYRA 3UG7A 4AO8A 3O95A 4MS1B 1RKBA 4AJOA 1U0BB 1XCLA 3IALA 5I9IA 4U5XA 4MKRA 4BIIA 4M1KA 3BIWA 1IZ7A 1CUCA 1UBTS 3FE2A 3OEEA 5I8PA 2IUSA 2DAPA 4ESHA 1AKEA 2RGBA 5EP3A 3BSFA 1V11A 3D8HA 1PJQA 1JEAA 2B2XA 5BOSA 4Q3NA 1RD4A 2FW6A 2WUDA 2BI7A 1U3DA 4F11A 3T1NA 5HQ3B 3LP8A 4MR8A 1ZH8A 1TL7C 5ES3A 3AEQA 3AHFA 3G2JA 3SYTA 4EG6A 5IF3A 3I4LA 3EGVA 3UB3A 5KDDA 1TU3A 1IPHA 2A78A 3LP5A 4IMIB 3F0TA 4BB9A 5SV2A 4GKJB 1OYWA 1ZWKA 2CZQA 2W6QA 3G2IA 4IJKA 4KQMA 4MWBA 3IAM6 1DQSA 4I6JA 1T0HB 2IWRA 4B34A 3RC8A 1ONBA 4GBGA 4LXIA 2O7SA 3OC0A 4GYJA 5FD8A 2BP7B 3EPRA 3H3JA 4P5DA 1XLTA 4E6PA 1C30B 3AVQA 4OQEA 5A3SA 3WKCA 3HBAA 1P1RA 5F23A 2BSXA 1B73A 3TJZA 2PEZA 1G42A 1UKBA 3PFGA 4NDNE 4JIGA 3KSMA 4OTZA 1A9ZA 4M55A 3QOWA 1JSZA 4AXXA 1L5QA 4R16A 4TQGA 4RDXA 4YAUA 1YVPA 4YRCA 2ZYIA 5BSFA 2J5XA 3QK7A 3ZHQA 1ISJA 5C8YF 5EIBC 1GR0A 2PVCA 5CM9C 1KSGA 4A0HA 5EERA 4E09A 2QE6A 3TD6A 3ECAA 3NORA 3HYRA 4HAYA 4TX1A 3A6KA 1U9CA 4ZA2A 1A97A 2CLFB 1MB9A 1UM9B 3FJYA 3LKDA 1CK4A 2AN9A 4IHKA 4O4HB 4X71A 4YQEA 3UICA 1HORA 1NIJA 2J0VA 1IU9A 3QA3E 4B3GA 1LQTA 1QZXA 3FOFC 2DKNA 3I4CA 1EWQA 1TQ2A 5CB4B 4TLAA 3S1AA 3QF7A 3HABA 2D7DA 3HL4A 1GNVA 1RAEA 1B3RA 1RHMA 3WYDA 3OTQA 5A3QA 4JI2B 3A0RB 1EXWA 2QJOA 1T5BA 1W6RA 2H7CA 1FFSA 2EP7A 4LY6A 1KR2A 1N5MA 1DWPA 2VVTA 2CK3D 1GPDG 4EW2A 1Z6TA 1ZJZA 2CLLB 5IP5A 1GPJA 4IV8A 1HZJA 1OB2A 3EDCA 2C8JA 2XX3A 4NENB 3DZDA 3AR9A 4ROTA 2EW8A 4QUEA 3SHOA 1BNCA 1Z5WA 4ZMSA 5JEDA 2AI3A 3EZ2A 3V8BA 4BMSA 4OMDA 3HR8A 5KZMB 1BGWA 2EG5A 2G1JA 2QMQA 1V25A 5FBWB 4ILEA 2A5LA 4ZTBA 4Q3CA 5HILA 2AOUA 3GLHA 4BGIA 2GXAA 3HJFA 2GB4A 4ZYTA 4ZP1A 3ZVNA 1E2BA 2J85A 3CUVA 1FFXA 2QORA 1BJTA 4KHZA 3LW7A 4OK3A 1GGKA 4WN9A 4K9LA 5HIIA 1U80A 3LCMA 3A9SA 2DG2A 2J5KA 3UKJA 4TL8A 1K7FB 4CMIA 3AKDA 4H27A 1GD1O 3TDNA 1I5RA 2Y1CA 2E4AA 3SYKA 3OOYA 4I4IA 3VU8A 3S81A 1RJ9B 3QVVA 1E2PA 4L4XA 1ZD1A 1ZHFA 3DEKA 4HS9A 1PWZA 4J0JA 4NPAA 4QBIA 2XBUA 3NBQA 3EWAA 2P35A 4IV0A 3PF9A 3FGZA 2ZR8A 4X54A 4AP5A 3W77A 4ZAXA 4ZZ3A 5EIBD 3I30X 1ENOA 3MTJA 2CNLA 1QTQA 5HKBA 1NNSA 1NHWA 1RLTA 3R3HA 3JSXA 1FNBA 4B4VA 3HEMA 2EX0A 2AFRA 4QGFA 1VPWA 1IN5A 3FKSA 3QYJA 2IF2A 4RZXA 4A8JC 1J99A 1SA0B 2OVBA 4XB2A 3D3WA 2QNRA 2F48A 5A6SA 2I7TA 2RGWA 3PSAA 1N9GA 4MW5A 1XB2A 3M9WA 4ARCA 5DNAA 4DQXA 2XA2A 2E4ZA 3N8GA 1KE2A 3UH0A 2CJPA 4W5QA 2HFJA 2G08A 1T9ZA 4JBNA 2VYQA 2QLMA 4EY6A 3PRKE 3EHEA 2Y6VA 3QSYA 5CLFA 4LOIA 2Q0XA 5SZHB 2Z5GA 4KZPA 4E14A 1JEQB 4P4GA 2ZPTX 1R3UA 4ISBA 4DT1A 1CFZA 3SNHA 3FZNA 4HG2A 1HMPA 4GOOD 5MGNA 2ZUWA 4I5DA 4R40A 2HGSA 2XUJA 4OP2A 1FXSA 2VL7A 4PANA 4QDUA 3CZAA 1XO1A 1Z17A 4GR5A 2D2XA 2PRKA 1IOZA 4ZQBA 5FUYA 4R7TA 2YWBA 5F7ZA 1L3CA 1E2NA 1YBMA 1EVYA 1FZQA 4U2EA 3WNDA 4TVOA 1MAUA 4P3NA 3LWNA 4RFSB 3I8SA 421PA 4FR5A 5DISB 2X5JO 5DHSA 2YMPA 5JZOA 3BILA 1NVGA 2BT4A 4CEIA 5ICCA 3CZ9A 1J07A 2VT7A 3GROA 4HMOA 3E5HA 4Z8YA 4LQDA 5ALQA 5EGSA 1SVIA 3NUZA 2IYFA 2X1HA 4FZ3A 2BR5A 2B7LA 3LRTA 4L85A 1BDJA 4LRXA 3U44A 2CL6X 4Q1DA 3L05A 5EZ6B 1FDOA 3DFUA 1JBQA 4TV9F 4Z86A 5FPYA 3P2MA 5FLXA 3T3HA 4XWWA 4MDFA 3DYVA 3R40A 3AOGA 1J8YF 1UXHA 1YHZA 2QAGC 3SHQA 4CG2A 3ONVA 2OOKA 2XNHA 2H1CA 3PGXA 5J5AA 4TN1A 1JLSA 3NBXX 3NUQA 2QLTA 3ROZA 1J39A 1DVRA 4N39A 4UU0A 4MA0A 2GM5A 1KYQA 3TF5A 2GLUA 5K09A 4B81A 5EHZA 4A6XA 2FR0A 2CVFA 1V3TA 2NUAB 4DNFA 3Q0EA 2HH9A 2V54A 1XA4A 1VYTA 2WOOA 4O63O 3EDRA 1T0IA 2KSQA 1DIBA 3OIFA 4IOKA 4D8UA 2VUIB 3KUUA 3NWOA 3PC8C 3ZW9A 3E3OA 1S3IA 3HCBA 4N3AA 3HJUA 2YDYA 3DB1A 4PRYA 3WRVA 3WWCA 5ADWA 4OFXA 3VR4H 2OV2A 4HH1A 1PX2A 1PZGA 3GXOA 3UAVA 5FOQA 4AROA 4GO1A 1GA4A 3FLEA 2IP4A 3GVXA 2B8EA 2WMOB 4IDAA 4INZA 2F4VB 1EFPB 1JMYA 4IIDA 1C3OA 2CLOB 3TRKA 4K6OA 1HEYA 3G9UA 3T9FA 5JNWA 3NFRA 4OFZA 1G6OA 3K2IA 5F3WB 3RO7A 4CF7A 3IP5A 3D54D 4M8LA 3THXB 5CHEA 2P77A 1BKYA 1GTG1 5LCXA 4PS0A 4M1MA 1JEYB 2WRZA 1QGZA 1UPBA 3NIWA 5EMJA 3M5PA 5AVKA 1ADJA 3LE8A 4K28A 2G83A 1BSVA 1SXIA 3HCWA 3IMGA 4J0CA 4L0QA 2ZJ3A 2PUWA 4TLLB 4ZPXA 5BSVA 5C37A 5LUBA 2R85A 2XXAB 2C9MA 1DEAA 3P9NA 2OYRA 2VNHA 4U02A 5CCEA 4A2PA 5EHXA 4AWBA 3ADBA 1JWAB 1JFFB 2NTEA 3G85A 1LSOA 2B78A 3ROEA 1EP9A 5A7HA 3AIMA 5SYMA 3E2PA 2ECOA 3CQ9A 3FOEC 1YDMA 2OKCA 4KIWA 3S2GA 1QLHA 3RYCB 5HDQA 4U6NA 3P2KA 1KY2A 2O2IA 2JEZA 2AYYA 2Y0PA 4FYMA 1F6WA 2V3CC 1NG1A 2Z5VA 2FZ5A 3C8UA 3OCXA 1HETA 3D8RA 3NHZA 1OV6A 3ME5A 4URZR 3E22A 1VKRA 4MI3A 5F4BA 1LC0A 4WGGA 3NCTA 4JOBA 2DPHA 3PXGA 4MIOA 2HSJA 4X8OA 2JH9A 3D3EA 5EIOA 5JG7A 4BX8A 4DZZA 3AUSA 3SJUA 4DSAA 1F0NA 1FK8A 4EITA 1XXHE 3HKCA 1USUA 1YR8A 2V6MA 3GQBA 4TL7A 2D8AA 4NCAA 5LP6F 1G19A 2EZ4A 4RK7A 1VM6A 3OE4A 4DCPA 2BTOA 2GF2A 3FPEA 4FWBA 2H1VA 2YW2A 3DZCA 3G13A 4I14A 3ZGNA 1XLUA 2E5FA 1CEYA 5KCMA 1P9OA 3U4QB 1E2KA 1J8VA 1EQAA 5ABPA 3Q3HA 4Q4DA 4QBGB 3QI2A 3CNHA 2QTTA 3OLYA 4QXOA 2JLWA 1VPDA 4EJ0A 2NSYA 4PICA 4ID3A 3B8EA 4DLRA 4LQCA 1B26A 5EJ8A 5AMXA 4AZSA 2JLQA 3KXIA 3PVZA 2IA5A 1KGDA 4Q1FA 5KWVA 3GPIA 4GM4A 3PNLA 6ADHA 1IONA 4RKYA 4V0QA 4DC9A 2V7BA 3GPCA 1HT1E 3FUWA 3JQAB 4HI0E 3BAZA 2OFWA 2BC9A 5KMGB 3U49A 4QRHA 1N2JA 1USVA 4JMPA 1UCFA 4YVFA 1Y1SA 4MUNA 2Z6UA 2HUNA 1Z8FA 1ODKA 3KIPA 2ZBEA 3TZEA 1GL7A 1CBUA 1UIRA 2WJPA 3UUGA 1EWKA 1RC8A 4MWCA 4D9JA 3B3QA 1M34A 1SOAA 3OPQA 4RVNA 3G8AA 3GRZA 2QU7A 5MGBA 2UZ1B 4MGIR 3BB3A 3M82A 1OYVA 4ND5A 3EGEA 3JPWA 4DTCA 1YJQA 3BMXA 2YICA 1Q1BA 3CX6A 3G8BA 3QUAA 1M1YA 4GECA 4XPIA 2HMAA 3K9LA 2PMDA 3IVAA 1YR9A 2ENWA 1JXMA 1FJXA 2NO0A 2ZSUA 1YF3A 2ICAA 5AVXA 4C87A 2AR0A 1CQPA 3KZKA 1IHOA 4JI6B 4Z4CA 1XZHA 3T4UA 1JAYA 3I8XA 4RQBA 3KDAA 5JCPA 5GOTA 1MB2A 1R4NA 2B6HA 3E9ZA 4JUBA 4ZPJA 5AIBA 2GCEA 5B3JC 2NUBA 3OFNA 2PBZA 3FFTA 1EXNA 3TCXB 1D0IA 2RBGA 2WV9A 1IRXA 5EKTA 5JMWA 4NNJA 1ZOSA 3A2LA 4RH1A 2QNIA 4Z9FA 1YS2X 2WU1A 4ZDWA 2ZTVA 2H2WA 2PA0A 1EFDN 1DRWA 3CWQA 1RIIA 1VI5A 2C2GA 2Q27A 4NBVA 5AI5A 4PY2A 2YY6A 3AX6A 1D04A 3PIDA 5FNVF 5KQLA 2REOA 1WB6A 2HRRA 3C4QA 4F5ZA 4TWIA 5BNWA 4D6PA 4JSYA 4FGZA 2J3HA 4BQSA 4I5FA 3UATA 2PE5A 4NRDA 1Y8AA 3LL7A 5CIYA 3FWNA 1E2LA 2J6HA 3PIRA 3WI7A 1AMNA 4EL0A 2I2DA 4Z54A 1TM2A 4O4IF 1RLMA 3I1FA 1QVAA 4IVRA 2NPFA 1NQXA 4LGYA 4MPPA 2YW9A 2BEVA 2DT5A 3ICVA 2PBFA 4HNGA 4X1IB 2NYUA 3HY3A 1ZVKA 3RVLA 3O73A 3UTDA 4AZ3B 4K46A 5KNCA 1QIGA 3H1PA 4BRWA 1ZGBA 2BZ0A 4H7JA 4Q4HB 4XR9A 2XBLA 1KK3A 4IEFB 5EN4A 3JARB 5T6MA 3S2IA 4OGWA 4FS3A 2VSOA 5DMHA 3BJMA 1BMDA 3RB8A 5F2NA 1RM4A 1EHCA 4OHCA 1BVUA 3U3ZA 1U9YA 3RKRA 3E15A 1XPUA 3PPYA 1ZISA 2AUNA 1QGOA 2LD4A 3QITA 2G80A 4KKVA 4KVFA 2Q2OA 4NX2A 1OAOA 3T7CA 1L9XA 3G3EA 1QRSA 1DQNA 1B0PA 1XWWA 4ZQGA 3K0FB 3EPJA 3VHLB 4X60A 1USKA 4DMGA 3H17A 1MNQA 4ER7A 3OPNA 4ZCIA 1HX7A 2OOSA 1TM4E 2JGDA 5HF5A 4YUYA 1JKIA 3BF7A 3VKWA 3HU3A 4IGAA 4BLPA 2FPIA 3MCAA 1AUPA 1E9CA 4GG1A 1CE8B 3PEYA 2WE7A 1Z34A 1R0RE 1OLSB 2FNAA 1EX1A 1Y4UA 1YQXA 3C6YA 3PSHA 4Q4JB 2WT9A 1R6VA 1U1IA 1YC2A 2AN4A 5EZYA 2ZU0C 1JSLA 3WYFA 1N78A 2C2XA 4FW9A 2NU6A 5DHQA 5GOZA 4HWKA 2BEUA 1E9VA 2ZUTA 1YRYE 1V1MB 2CF5A 6REQB 2HK8A 4F4IA 2GPAA 3QFHA 2YR0A 2BUAA 2X9QA 3A6EA 4WZBA 4NOJA 1LY1A 1MTZA 1PR3A 3VAAA 3WDKA 1J24A 2ADMA 2BGWA 1CS4C 2IXTA 1CLEA 3IAHA 4ZT7A 3WTCA 1TB4A 2C94A 2FRXA 2J33A 4K9PA 4MMYB 1QTNA 2AUTA 4QSHA 1LPBB 3Q1KA 4NS4A 1Q92A 4TVSA 5A03A 2P40A 3JQGB 5A3RA 1NRIA 3G2QA 5AICA 4B7UA 1JPNA 1M8JA 3W8FA 3AUFA 2GF0A 2MU1A 4O4JF 1RQ7A 3GT4A 4BFXA 1HYQA 1XZCA 2ID4A 2MYTA 3RVBA 1E2GA 1ULTA 1WO8A 3BB4A 3RLIA 2B35A 2B4KA 4MP6A 1PT6A 2QTAA 3L07A 5KQMA 5G1NA 2H1FA 2HDOA 2Q5CA 3H8WA 4QPCA 4RY2A 3ZG6A 1ZK1A 1TFUA 3AI3A 1SKQA 9LDBA 3JVVA 1JZSA 4HGPA 3PWSA 4OYLA 2A4MA 4L2IB 4G9EA 1E9RA 2DU8A 3JD0A 4G0NA 4JKOA 3PDJA 3F6CA 4D74A 3FTFA 1M5UA 1NF8A 2Q07A 2H1SA 1RCFA 1VKNA 1YDWA 4GX1A 4LI0A 3QWIA 1RWXA 3NC1C 5EPOA 1GDTA 4CL2A 1Y4SA 2ZULA 3M6FA 1YZNA 2R7LA 4Q9KA 1ISHA 2H16A 3W3AA 5FI0B 1XDZA 1GPH1 2XNCA 3TLGA 1TX4B 2JCYA 2MT9A 3HGTA 4FFOA 3RBXA 3UCEA 3UWPA 2LGJA 4IUCS 3CZCA 4FGSA 5EP4A 4GNRA 1H2HA 4G5OA 3VNQA 1FDRA 2EZ9A 4E2WA 3O2JA 4C3ZA 2B82A 3BDIA 2QN8A 4V0OA 4BHTA 5CNJA 4V0SA 3SKVA 1HLDA 5D5QA 1Y9ZA 1YKGA 1UOOA 2QR5A 5EMLA 3AETB 3AQ4A 3GPDG 2NQ8A 5CVDA 4ZJYA 4FS8A 1EUDA 1QOZA 2AUMA 5C2JB 1RKVA 3RUAA 3BN3A 1XNGA 4X6UA 1P0CA 2VWQA 4MUKA 4B7ZA 1YGYA 5ILGA 4XA8A 3GJ7A 1GAEO 4IVQA 4M8NE 5DHFA 4YCSA 2DLCX 5BNZA 2PSHA 3DC2A 1AQLA 1IBCA 3DO6A 1YMUA 5AWFC 2VH2A 4HNRA 3JS5A 3SC2A 3UA4A 4BC0A 1QLJA 2PJRA 1Y4AE 1BGXT 3ZZNA 4I1PA 3CS3A 2CB9A 3KBBA 3ETLA 5T3YA 4N0MA 1L4HA 5F2EA 1QRUA 4AQDA 2AC7A 4RS3A 4WPGA 4ZCQA 2V6GA 2CXOA 2XVAA 4L50A 4PSKA 4JYZA 2ZKIA 1DUVG 3GNSA 2WU4A 1US8B 1EM8A 4BXOA 2A5YB 5I5GA 2PZFA 1KEPA 1XHEA 2ZJZA 2RHJA 4V0MA 3KPVA 1SXQA 9ATCA 4DRYA 1YK1A 4ICIA 3TNLA 3RCBA 4BNWA 2Y2UA 5JBNA 3IR7A 2WWTA 2Q99A 2RGNC 4LGCA 3T3MB 4XCXA 4N49A 4MAFA 5JUWA 1CDZA 2PNFA 4UNSA 4FW8A 3Q8WA 5IW8A 3SF0A 2R8RA 2QB5A 4V39A 4D8YA 4GWGA 2D74A 2BM1A 1BQ4A 1PKXA 3UT6A 2XMBA 1N2BA 4KH1A 1GKUB 2GAAA 1CR1A 2ZQYA 2Y1DA 4JBGA 3MEQA 2CV0A 2VPIA 1MC5A 2ETXA 2PYIA 3TQFA 2XVXA 4CLEA 4M0LA 1XMXA 3FWKA 3R20A 3RUCA 4E12A 4ZVPA 1KMHA 4N6GA