3IIKA

The structure of hcinap-so4 complex at 1.95 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
175
structure length
175
Chain Sequence
b'PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
molecule tags Protein binding, transferase
source organism Homo sapiens
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
total genus 66
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iikA00
3CRW1 2QBYA 2WICA 4M2LA 1G4UR 3GJ8A 2A5GA 1MRNA 3A4LA 5B58C 3QXHA 4KVAA 1VG9B 2YV5A 3EXAA 1CRQA 2YOFA 4BLTA 1Q1QA 1NG1A 1TQ2A 2D74A 1OJLA 3NDBB 1LVGA 5LD2C 1QHXA 2QMUA 1GP2A 2UZIR 3GLHB 1KJYA 4A36A 3GLFE 2WPDD 1KDOA 1E94E 2JJ8A 1VDZA 3K0AB 4DT1A 2JATA 3LVRE 2KB0A 3AEZA 3TVTA 2V3CC 2HJVA 5KSZA 4M8NE 2CHVA 1UAAA 4RD2A 3RANA 1W2GA 1W44A 1F48A 3VR1A 2R65A 2N46A 2HYIC 1LF5A 3CNLA 1OYYA 3I92A 5D3MA 1GM5A 2BBWA 2BJWA 3CRVA 4IHQA 1S1CA 1I2DA 2E1RA 1U0LA 1Q57A 4OQFA 3BJIC 5FBWB 2IS4A 1A1VA 1U99A 1VCMA 2CJWA 2GA8A 4ASUD 3P20A 1Z2CA 4GFDA 1A2KC 2QG6A 1VYUA 4Q1AA 2IWHA 1Z8FA 3RSOA 3SS8A 3SE0A 4JLPA 5JEDA 3R9XA 2J0UB 4K46A 3QEJA 4KVGA 4Q7KA 3WNBA 1NIPA 4JVSB 2CCJA 3BFXA 3V00A 4EQ6A 4C7OB 4MGIR 3IEVA 3HR8A 4UXHA 1DOAA 3RC8A 4CT5A 1S96A 4TMVA 2OLKA 4NE2A 1M2OB 4M22A 1P6XA 3I8SA 3W6OA 2RGEA 4G01B 4PAQA 3TMKA 1E9RA 2CVFA 1S2MA 1JR3A 2FSGA 2ZE7A 3K0CC 3NHBA 4TLDA 4WIAA 1U8YA 3WBKA 3LVQE 1G3IA 1Z6TA 2ZRJA 4LJ8A 4Q1FA 5E7JA 3IO3A 1VECA 1ZUNB 2ZRDA 3KKOA 5AJWA 2OFXA 1SKYE 3E70C 4Q9HA 4G5RA 4WZBE 4KO8A 3DL0A 2BBSA 3SHWA 2YOGA 1NY5A 2ODWA 3PXGA 1IM2A 1OXTA 1UKEA 2DWPA 2ASEA 3B82A 4GP6A 2J0SA 1T5IA 3K0AA 3EA5A 1HE8B 3QG5A 2OT3B 2RGBA 2OLJA 1P9WA 3A36A 3U7FB 2YWEA 2OHFA 3FKSA 1XD2A 1OB5A 1G64A 1SULA 1ZBDA 3UANA 4DT1B 3QKRA 1P2TA 4DLSA 4QC2A 1NF3A 1P2SA 5K8LA 4URVR 3KFXA 2GETA 2A5DA 4UNSA 1ZCAA 3OIYA 1GRQA 4HI0E 4KFTA 4NYMR 1AJEA 1E0SA 1TUIA 1PUJA 3GEIA 2QGNA 3X1XA 3QKSB 4PPNA 4PHFA 1IONA 4TMZA 1T3SA 2ZRNA 2P67A 3IHWA 1W0KD 1ZINA 3KFVA 3KQLA 4WAUA 3QXCA 1NY6A 2NPIA 2PMKA 2YWHA 3B1WA 4LHZA 3KTAB 4MQBA 2CL6X 4Q4AA 4Z1MD 1ZCBA 1ZC4A 4KBFA 2JLVA 3VU9A 4M1MA 5KSYA 1JPJA 4B2IA 1L7VC 4Q9LA 2HCJB 2OBLA 3C7KA 1XEXA 1BMFD 3P1JA 5HCIA 2WJYA 2ZE6A 2CMKA 4OK6A 5L3SB 3O47A 1XCPA 1XCGB 1XZPA 4V0ME 5FPYA 4M1KA 4BFWA 3TIFA 4KFRA 2FG5A 4PR0A 4Q00A 4B2LA 3BXZA 1SQ5A 4DIDA 2WKRA 3IUYA 2BM1A 2ZVPX 5GJWC 2CK3A 2HF9A 5M04A 1QHGA 1FTNA 1M6NA 3C16C 2IYQA 4DLXA 2HLDD 3NKVA 3Q3JB 1CEEA 4MYTA 2CEAA 3DM9B 1KZ7B 2JCSA 4Q47A 4NBSA 4ABYA 5CDFE 2D2FA 2DR3A 2F7SA 3SEAA 4MUAA 1ELOA 1H8EA 5CB8A 2JLWA 4A2PA 1SHZA 4DHEA 3CKLA 1F5NA 4PHGA 4CEIA 2DFNA 2AN9A 1KO7A 3RRZA 3LA6A 1Z6GA 2PT7A 3RS4A 3UXMA 1HQYE 1BMFA 2WJGA 4L8GA 1Z29A 1GRRA 2HYDA 2ZE8A 5FTJA 4JLMA 4AI6A 2ODBA 4DRZA 2GF0A 1Z22A 4HAVA 3GLFA 1CR0A 1WBBA 3FKQA 1F2TB 5EZ5A 2Q3MA 2ZI4A 2O0KA 2IA5A 4UJ3A 3WHKA 2QTHA 4CRWB 2ZRGA 2VH5R 1T6NA 2ZRFA 3DHWC 4DCUA 3R7WB 1UBGA 1BH2A 2A2ZA 3LQRA 4FCTA 4RFVA 4MKGA 5JSZB 3C15C 4BRWA 2B92A 4I1SA 4PZLA 3MWYW 4HSEA 1D9XA 3GPLA 4OQXA 1XXHA 1N2CE 2KSQA 1OH5A 4DLTA 1SKYB 2IYYA 2WWHA 1WE2A 3OEEA 4B3BA 3UMFA 2FMXA 3THXA 1HV8A 2G6BA 2IXEA 2ZM5A 1F6BA 2IYSA 1TQ6A 2GK6A 2Q3HA 1E6CA 1KKLA 3GFPA 2OCYC 4KYIB 3EZ2A 2NO1A 2IXGA 3RRNA 3U7EB 3ZYCA 2WSSD 4E5UA 1YVDA 1MABA 4LJ5A 2ATVA 1EG7A 2QAGA 1QHHA 2AX4A 1AS0A 2YWFA 1R7RA 4WOPA 2Q9BA 1XJ0A 2VHTA 1R0XA 2ZUBA 4V0NA 4JBXA 2YVUA 5K8IA 1DAHA 1XTQA 2Z0MA 3UWOA 2JJ2D 1RFLA 4Z8YA 2C96A 3WMEA 2ZU0C 2H7VA 3BK7A 3Q8XB 3NH6A 4S2EA 3THWA 4DLYA 3W5JA 4TLEA 4C0SA 3AUYA 2EFEB 4MRRA 3TQFA 2GESA 2RGNC 1ZM2A 1FQKA 1RVDA 1JPNA 3M1IA 1Z0FA 4LHXA 1E1QA 2EQBA 2H92A 3CH5A 1XTKA 1E0JA 4V0KA 2G83A 2ZROA 2V4ZA 1NVWQ 3IQXA 4JL5A 4NCIA 4PPQA 2GAAA 1OV4A 3LBNA 3FMOB 4WZ6A 2UVQA 3VQTA 4O3MA 2WOOA 1TEVA 4OJQA 3ASZA 1KSGA 3W34A 2A5FA 2X77A 3FGNA 3X1YA 3EZ6A 4CEHA 1XD8A 4B44A 4CT4B 3EAQA 3QEOA 3QF4B 4M9QA 3TKLA 1IBRA 4US1R 2OO7A 1YR9A 3D31A 5TDHA 3RC3A 4MRVA 2BVNA 3ZLJA 4D82A 1KKMA 1LY1A 1QHIA 2GK7A 2NZ8A 3LX8A 1UF9A 1AZSC 2XAUA 3O8CA 5HZHA 1U81A 1Z0DA 4YDSA 3WBJA 5E7IA 5L3QA 3CZQA 3CW2A 1E69A 1W5SA 3TJZA 4EPTA 1TF7A 2V1XA 1E2DA 2ZI5A 5DHAA 3WHLA 3AGPA 4NDZA 4NPHA 2FA9A 1Q3TA 1RW4A 4Y0VA 3QBVA 4BFYA 2G1JA 3QKUA 5JZVA 4OK5A 1ZRHA 1UBEA 4U00A 1AK2A 1AS2A 2OCAA 3CR7A 4R7ZA 4E22A 1TU4A 5KHOC 2DBYA 3K0EA 3NEJA 2AKYA 1XNJA 2ZYTX 4Q4LA 2OAP1 2CHQA 2VP5A 3KUDA 1MO3A 2JLYA 1E0KA 4YXWD 5H1YA 4GP7A 2XTMA 2IS1A 4Q9JA 4JMPA 4US0R 3R8FA 4GL2A 4B35A 2W6JA 2QAGB 3EIQA 2FV8A 2QU8A 2GZDA 1G1MA 1ZU4A 2V6JA 4XIGS 5F2EA 1XDBA 5J4HA 1JXOA 3FHOA 1TF5A 4EJSB 1G8HA 1CR4A 3IGFA 2C8VA 4Z8XA 1EFHA 3OZXA 1NBMD 4HZIA 2J1LA 1YE8A 4QM7A 1XEFA 3BBPA 3U7GA 1CR2A 4JBWA 1W0JD 3KJIA 2PJZA 1UM8A 3DMNA 1DG3A 3A4NA 3EC1A 3A1WA 2C04A 4YMSA 3GJ4A 1GDDA 3LLMA 4GNKA 3UATA 4AYTA 4N0EA 1V43A 3IIMA 4HDOB 1UPTA 1ZMXA 3N2EA 1HY3A 1XMIA 3OIWA 3CB4A 4FXPA 1YR8A 3O8RA 2XGJA 1TQDA 4JLNA 4C3ZA 1Z2AA 3QG1A 4LOAA 4C4PA 1B23P 1EFRA 4JT2A 2FE4A 1E9SA 2LCFA 4BLPA 1G20E 4MKFA 4U5XA 2HXSA 3ZD7A 4AKGA 1IN6A 4MYUA 3I3SR 3B8HA 2W0SA 1WMSA 4W5JA 2ECKA 3W90A 2IHYA 2VHCA 4QJ4A 3U3OA 1QF9A 1ZAKA 2H1LA 1M34E 4FW9A 4BZPA 1E1QD 2B7CA 3ZS8A 4M1SA 4AG5A 1X8KA 3X1DA 1M7HA 1VHLA 2ZJYA 4XWAA 4WBSA 4Q01A 1KK0A 1LB1B 4EPXA 4C0HA 3IPXA 1T91A 1G6OA 4PQYA 1QG2A 1JNYA 4QBIA 4GI7A 5IK2D 2VO1A 2ZS7A 1QDEA 2WV9A 2SHKA 2IYZA 2Z6VA 4LJ6A 4CZ2A 5IT5A 1T8UA 3F8TA 1XTIA 4AC9A 3KB2A 2QY9A 1S8FA 2GTPA 2XOKD 3FFBA 1KJWA 4ZI2A 4NH0A 3BIFA 2XB4A 4LSGA 5E7MA 3QPWA 1BIFA 2C03A 3BS4A 2HT6A 2ZJZA 1EFUA 1EFRD 3CZPA 3UG7A 5FOXA 3KKPA 2ZI3A 5JBQA 1SVLA 2OSBA 2ZYUX 3WYAA 5KNBA 3LDAA 2TMKA 4NP6A 1G6HA 4P4SB 3WP0A 1UKYA 4BASA 2D7DA 1IXSB 1Z3IX 2YNMA 3B13B 3K70D 4NCJA 4BUJA 1G18A 3RLFA 4PC6A 1Z63A 2QGZA 4GMDA 2FPKA 1NVVQ 4M1WA 1G21E 3X1ZA 4A9AA 3FB4A 2GEDA 1R0WA 5EE5B 3SU8A 2I3BA 1W49A 2IEZA 1VMAA 1SKQA 4EQ6B 4C7OA 2CE7A 4PQRA 1DAMA 3EA0A 3VX3A 5F3WB 1A7JA 4HLCA 1XTJA 4A4DA 3ND9A 3GJ0A 1RYFA 5C46F 4EKDA 4ASUA 3H1TA 2CBZA 2FPLA 4A2WA 4BRUA 1WQ1R 3AB3A 4C2TA 1OFHA 4YDHB 1EESA 4JJKA 3KKNA 4A0GA 4PO8A 4MYCA 4TL8A 4XOIA 3NIBA 5CJ2A 2ZI7A 2Q0HA 1X6VA 2WKQA 3QUSA 4G0NA 4GT1A 4JBYA 3W5IA 4ERNA 4A2QA 2PCLA 3ETLA 3I4LA 4KHZA 3LLUA 5IDVA 4M9XA 1AS3A 2DWQA 2RKOA 5SZHB 2CXXA 3UPUA 1CJMA 1VYTA 4GSYA 3ADDA 4URXR 4B34A 2DPXA 2WIAA 1OIVA 1GITA 4ZDIA 2GEUA 2V9PA 4GOJA 3UG6A 4E03A 5EXPA 2OZEA 3ADKA 1BKDR 1N0VC 4U7DA 2ZSDA 1FZQA 2IUTA 3EZ9A 4AIIA 721PA 2CL0X 2EFHB 1KAGA 1WXQA 4IRUB 1TL7C 1MV5A 3CR8A 4MKHA 1II8A 1P61B 4PC7A 4Q4JA 4GZLA 2QP9X 4FIDA 1U9IA 3MWJA 1T9HA 4FMCF 3ZVLA 2ZSBA 1YJ5A 2FZ4A 4DCVA 4ZIRB 1PVOA 1G17A 4E07A 1R8QA 1R0YA 4A6XA 5HPYB 4M9SA 1F60A 2C98A 3MGCA 3KB1A 3TW8B 1E2MA 2A5JA 2VIIA 2P6RA 1XPUA 2F6RA 3SQWA 2FSHA 2PLRA 1N6OA 2QEQA 2WMOB 3KJEA 4WXPA 2VP0A 1QVAA 2QI9C 4C0AC 5JEEA 4OK3A 4UNPA 3O8DA 3KZ1E 3H0KA 4JLBA 4XTCS 3VTKA 3GP8A 2FWRA 1GNQA 2PJRA 1II0A 3AF1A 1YZQA 2ZAMA 1OFIA 2ZR0A 3KJHA 4LV8B 1NMXA 2YYZA 4BFSA 2O8CB 5CM9C 5JWRA 4LC0A 5JJKA 2DCUA 1KY3A 3NXSA 1GAJA 1QRAA 2LKDA 2IYWA 1YZUA 3PQCA 1UBCA 2AR7A 1G16A 1FPMA 1HA3A 4HUTA 4XD7A 4C0LA 4L5BA 2QSZA 3QPVA 4RD4A 4BPBA 2ZSFA 3O8BA 4TQ9A 2MSDB 5CIWA 2BWJA 1AZTA 3TSWA 1E98A 1P9NA 4KFSA 2GJ9A 1CIPA 2XNDA 5FOTA 4E09A 3ZVMA 1CXZA 2FH5B 2ZITA 3EIEA 2CLCX 2ZRKA 3TUIC 1QBKC 3D7MA 5TARA 4YMTA 1KO1A 3IDQA 1W1WA 4CEIB 1P62B 3E5HA 2WHXA 4URUR 3I62A 4MGKR 3CRRA 2W00A 3LY5A 4RY2A 4F92B 1S3SA 3QXJA 1Q1ZA 3PR1A 3KXLA 2KWIA 3E1SA 1CJUC 2X19A 1S9HA 3K8YA 2QENA 2XJ4A 1OYWA 1CULC 2BMJA 4I1VA 5FPTA 2GHIA 3SNHA 4O2LA 1HH4A 3EASA 4RD0A 4UKDA 1NSTA 5SZKB 2CE2X 3T5DA 1K5DA 5B57C 2VLIA 3UK6A 2QMHA 1BOFA 4LCBA 1E2HA 1NN3A 2J45A 5JCPA 1Z07A 5C4MA 5H8WA 3PEWA 3BFVA 3TUJC 3EPKA 3RAPR 1AA9A 2VL7A 3SQXA 4KLZA 4TTRA 1OE0A 4OI4A 4D4MA 2DFKB 3MSXA 4K8OA 1N3BA 3ZDQA 1MT0A 5J4KA 2ERYA 2R8RA 1G4AE 3S1AB 2IYVA 4DC9A 4DSUA 3KKMA 4Q48A 4A1FA 4KI0A 3PJRA 2IHBA 3MLEA 2ANCA 3LO5A 3ADCA 1OLOA 5AJVB 1MABB 5EXTA 3B1YA 2Q3FA 1OH8A 5JWOA 3QXSA 5AUOB 1G7CA 1Z6XA 5CK4A 4DDTA 1N5IA 1H8HA 2VTKA 1G3UA 3EPLA 4TL7A 2W6ID 1RYHA 4YLGA 4TYYA 2ZETA 1KK2A 1RRCA 4R71A 5JI2E 1XTSA 4RD6A 1BO6A 4RD1A 4FWTA 2GKSA 2EFDB 3MJRA 4QRHA 4IFBA 1Z6YA 2XITA 2V54A 4QGGA 4Q1CA 2CK3D 4ZDJA 1N0WA 1XXHE 4RJLA 1XZQA 2O0JA 1XB2A 3TR0A 1R5OA 1G3QA 3GLHE 5DO9A 3PUZA 4ZKEA 4P31A 2IWRA 4YC7A 1ONBA 3NEYA 4IEEA 4G5QA 3K0FB 1U94A 1X86B 2FEOA 4TWZA 1OT3A 2OBNA 3T1QA 3TRFA 3VKWA 4F38A 4X8HA 4YMVA 1US8A 4P4UA 2RGNA 3W8RA 1C9KA 2Q9AA 5KSOA 5G40A 3W3ZB 2ORIA 3QKRB 3ICEA 1QG4A 4NYJR 3PEVA 4XSGA 3B9QA 5CYPA 1MO4A 2AKAB 1JR6A 4P33A 1J99A 4HEJA 3TNFA 5EJEA 3PEYA 1P4SA 5L3QB 1NBME 4D26A 4QJ5A 4RZXA 2GJ8A 4CEJB 5J5CA 4PAMA 1N6IA 1PJRA 2IL1A 1GG2A 3TK1A 1NKSA 2X2FA 3CBQA 2MMCA 1Q3HA 4RZ3A 5C18A 1HURA 2ZR9A 3W9YA 1E2NA 2P0EA 3JZMA 5G53C 5A0FA 3TQCA 2WKPA 1FL9A 1N5KA 5FTLA 1P75A 4TMKA 4OBEA 5K8UA 1PZNA 3QOFA 2JAQA 2XEXA 1JQJC 4F4IA 4OQMA 2BIFA 2CDNA 3PG5A 2ZEJA 4LHVA 3KTAA 1J70A 4Q4AB 4MDFA 3EPJA 3RVBA 5EQTA 3VU9B 2EW1A 4Q4HB 3N2IA 1Z08A 5DYGA 2EYUA 5IK2A 5L3SA 3I5YA 4V0MA 4PPFA 5KDDA 4JJZA 4TYNA 3JZAA 3NHAA 3OHMA 4ZO4A 4RD3A 3VHXA 1J2JA 3ZH9B 2CCGA 1AN0A 3IEUA 4HATA 2VP4A 3CX8A 1IN4A 5FL3A 1II9A 1P7CA 2JJ2A 2WWXA 3B6EA 3ZQJA 2JDIA 4LYHA 5FTNA 3SJZA 1I4DD 1CS4C 4NYIQ 4M1TA 4PZZA 4TQUS 2VHUA 3KJGA 3CM0A 1FW6A 2ERXA 3AM1A 4TZ6A 3U6KA 4ZI3A 5BYJA 3Q7QA 3QE0A 4FCVA 1IXZA 2CCKA 1W48A 5J4VA 3U5ZB 1XTRA 4TZ0A 1NSFA 1XF9A 3FMPB 2IW3A 3HPQA 5FOVA 4FMCB 4QM6A 1DAGA 5A5GA 3QY0A 3DDCA 2ORWA 4V0LA 1JB1A 4HDQB 5CDFA 2OEPA 3T1OA 2HEIA 4LV5B 4IW3B 4LDJA 1OPXA 2W6IA 3B9PA 1N6NA 3L43A 3AKCA 4C0KA 2HT1A 2ZS8A 3U60B 1W0JA 1CLUA 2NZJA 1JBKA 3L8YA 1KI6A 1US8B 1R4AA 3FHCB 1FP6A 4KBGA 3KKQA 2X2EA 5L8VA 5KOYA 1NL3A 1DO2A 1GKIA 3NBFA 1RZ3A 1N6LA 3T1TA 2D4HA 4EPWA 2GBLC 2V55B 4QG7A 5FI1B 3D3QA 1RE0A 4LJ9A 5FL7A 2HCBA 3BWDD 2OCPA 1XU4A 4QKQA 5TB5A 3VHLB 3W3AA 1XXHB 4FINA 3ZZUA 2WZQA 1KK1A 4Q5IA 3B1VA 1HUQA 2EWWA 2VPPA 1TU3A 4AD8A 3AVYA 2RHMA 1DBSA 2OFOA 1G7TA 1NMZA 4JLAA 3T12A 2MSEB 1Q12A 2QQ0A 1KO5A 1G5PA 1GIAA 2D3WA 4BFXA 2R9VA 2ZE5A 1VCNA 4B3DA 1W36B 3FOZA 4HAXA 5EXXA 1GL9B 4YXWA 2C9CA 2AD1A 2KJQA 2XTZA 2R44A 2B8WA 4KLNA 1G8PA 3DOFA 3WRXC 1D8TA 4HLUC 4OHZA 3MCAA 1KI7A 1X3SA 1Q21A 1EX7A 2JLUA 1YZGA 1ZNZA 1E79D 2WWIA 5L3RA 1NN1A 3PIRA 3MAAC 1UKVY 2B6HA 1ETUA 2E87A 5J4YA 2YHSA 4G5OA 3U3RA 2NG1A 3FMFA 4HAYA 2AXPA 4PFSA 1ZNXA 5FTKA 3GJ7A 2QMOA 2I1VB 2OG2A 3W6PA 5H68A 4EDHA 3SR0A 1E2EA 4TMXA 1W36C 2J9RA 4JLDA 4BZQA 2ZUCA 3TGPA 4DLWA 1PUIA 4LPSA 4FN5A 1JQLB 4FCWA 4RVCA 2RAPA 2Q9CA 2ZTSA 2FNAA 3QQ5A 4UNQA 1E1RA 1Q44A 2XZOA 1DAKA 2BC9A 5H70A 3AVPA 4LHWA 5L3VA 2GCPA 4HUQA 3WYFA 1TMKA 1KNXA 2JDID 3VKHA 2H18A 4J0QA 3LXXA 1F3OA 2J5XA 4DZZA 4BEJA 3BAFA 1E9CA 2CL7X 2EFCB 3K0CA 4GOXA 3DKVA 3V4FA 3WMGA 1KDRA 4DUGA 1PLKA 3ICQB 4KSCA 3TLXA 3QIAA 3AVVA 2PZEA 1P2UA 3OFND 4ACBA 2BKEA 4CW7A 4EUNA 2XZLA 2VRWA 1IN5A 5HKKD 1VCOA 5JMTA 3SYKA 3N5CA 4QBGB 2NO0A 1RKBA 4WA7A 4NKRA 3W8NA 6Q21A 4MRSA 5GJVC 5KDOA 4PX9A 4KFUA 3AH8A 1KMHB 4P0TA 4W9MC 1R6BX 3MWLA 3HYTA 4B32A 3HP1A 2QM8A 4JLVA 1OXUA 4TQAA 3K09C 2BMEA 3HDTA 3GFTA 2GCNA 1Z0AA 2RCNA 4RFSB 1Q1EA 3QXXA 3VR3A 3A6PC 5DNYB 4UQOA 4Q1DA 1KDPA 4A0FA 2D2EA 4C0BA 4CDGA 4C30A 2BEJA 3RWOA 1NN0A 3IPYA 1AGRA 1BYUA 1JAIA 1LS6A 3VFDA 1U98A 4EJSA 4NMMA 521PA 1XRJA 5FPHA 4B3FX 2QORA 1DE0A 4Z51A 2F1JA 2VSFA 1EK0A 1JAHA 3AGQA 1KTVA 4IXNA 4M4SA 2C2HA 1S4QA 3GEEA 3RRYA 1MKYA 4F4JA 4G1UC 2O8CA 2NO6A 3L0OA 2GNOA 5C2JB 4URWR 4C9BA 3F0TA 4B47A 4OHVA 4Q7MB 5FTMA 4D25A 3BORA 4G3XA 1T3LA 3ZD6A 3SBDA 1D2MA 4RCYA 1XEWX 4KCGA 4RZUA 1NJGA 4HLQB 1E9BA 4Q02A 1I4LD 1W4RA 2B7BA 2J7PA 5CLQA 4LX0A 1FMLA 5JJLA 2HUPA 3PUVA 3AP1A 3LX5A 1JR3E 1VG0B 1UBFA 2ZREA 2AK2A 2QMEA 3SOPA 5FH9A 4DB2A 2BHRA 2A30A 4DDVA 3AKDA 3U4QA 4P3YA 4JVLA 4K81B 3UMRA 4GBMA 2BBOA 2VP6A 1LF0A 4HB2A 2QT0A 4WXRA 1ZM7A 2B21A 1NNEA 3VMFA 4AYXA 1E79A 4XWOA 5FR2A 5KDLA 1KNQA 3A58B 4TLBA 5AJYA 3Q85A 3ZQ6A 4A92A 1E2IA 1EFTA 5BXQC 2WIBA 5FPSA 3U3KA 3NTUA 1A82A 3QPUA 5F9HA 3HU2A 1CKEA 2VP9A 3ZZTA 2XSZD 3PFIA 2K5UA 2Q6TA 2CLDX 3T06B 1VIYA 1KGDA 2QP3A 4DIEA 3I5XA 2Z4SA 1XPRA 4ZKDA 1Z28A 2PEYA 4LYAA 5KO2A 1WDTA 1KSFX 3EWSA 1LV7A 5CJPA 3A1UA 3WNCA 2JLZA 2DFLA 3FWYA 4RFSA 2O5VA 3TE6A 3X2SA 2QRZA 4OHYA 3LV8A 4C0QC 1E4YA 1M7GA 1YRBA 4M1OA 3Q72A 4NCHA 2IK8A 2QNRA 2QPAA 3QKSA 2GZHA 4KXFB 5EE1A 4BLQA 1NJFA 3AVOA 4NYMQ 2H5EA 1UKZA 4BGDA 1NG9A 2G77B 4LUCA 1IQPA 4BFZA 1KI2A 2GCOA 4TMTA 3CF2A 3OFNA 1AQUA 3SJBA 5G3ZA 5DI9A 2QAJA 2O8EB 2LKCA 1ZUIA 3REGA 2ANBA 4GOKA 3AP2A 1NN5A 4Q7JB 3X1WA 4NZYA 3GLIA 3T5GA 1TPZA 3PUWA 2QTFA 4Q7LA 1G5RA 3FHTA 1G7SA 2ZRLA 4JVMA 5JFGA 3RABA 1O87A 2ZS9A 3KQHA 3BE4A 3NBZC 3PEUA 1SVWA 2ZJOA 1W0KA 3VNVA 4AG6A 2YC2C 1D2NA 3L8ZA 3BB1A 1KO4A 3I1FA 2V7QD 3NBXX 2ODNA 5E3HA 4CF7A 1GTVA 1KIMA 1SXJC 4XSHA 2WWYA 1E2LA 1AM4D 2BMFA 2GXSA 2NTYC 3NWJA 4NTZA 5FUXA 3ZS9A 4EPRA 1XPOA 1X1SA 4M53A 4ZDKA 1E2QA 3LAWA 3I73A 1OH6A 3FE2A 4EJSC 1HT1E 2F1IA 4A82A 2DWOA 4YMWA 2OESA 3GMTA 4NL4H 1E0AA 3K0FA 5P21A 3P4XA 1GL6A 4A6PA 1XMJA 4EAQA 3GLHA 4M21A 3KDSE 5ANRB 4F7WA 2W2TA 5D3QA 3KQKA 1GILA 3CRMA 1OIWA 2RGXA 2NO7A 4TYPA 2PT5A 2PCJA 3EZ7A 5FPKA 4X8MA 3CNNA 2A9KA 5LPNA 2O52A 5EE0A 1XFAA 4Z1MA 5KNCA 1IHUA 5FBQB 1W2HA 3BRWD 3T34A 4OHXA 3U44A 5KPDA 1YHNA 1KSHA 1XBTA 2ZJAA 4B76A 1QHYA 3R7WA 1II8B 3SDZA 1RIFA 4Q4JB 3CH4B 5JSZA 1SVOA 2F3RA 2XX3A 2BBTA 1A2BA 4BE7B 1SXJA 1U8ZA 3P26A 5DN6D 4PSKA 4FMDB 5D3MB 1DADA 3I72A 4R2IA 1R0ZA 5FOSA 4V03A 2JEOA 5DYIA 2BV3A 3BB3A 2PL3A 4KJZA 1E2PA 1N6HA 4ARZB 3THXB 3A1SA 5AR1A 4XH9B 1KSJA 2AFIE 5DE3A 1DS6A 1NMYA 3H86A 3NH9A 4JLKA 1EGAA 2QSYA 5CYOA 2FZLA 2J46A 2O8EA 1G291 2J87A 4O0MA 3FMIA 4CIDA 4IVQA 1E99A 3QKTA 2FSFA 1U9IC 3IIKA 1IAQA 4FI3C 1NI3A 4LPKA 1QHHB 1NVXQ 2J0UA 4JL8A 4X8LA 1IY0A 4LK2A 4OI1A 8OHMA 2R6CA 2WWGA 3WXMA 1KY2A 3TH5A 3PCRB 1E32A 2O8DB 1DAIA 4IDNA 2R62A 2EYQA 4JS0A 1CU1A 1V5WA 2AD5A 1W36D 4HLDA 3AP3A 2ZJ5A 3EZFA 4DSNA 1RJ9B 1X8JA 4JSYA 4M0LA 4W7SA 2NPFA 4B33A 3EX7C 1SVIA 5JRZA 1UFQA 3SBEA 4D4LA 4B73A 1IOZA 2V8OA 4DEXA 4MGYR 3PUYA 1F2UA 4L9SA 1VHTA 3VR2A 4AYWA 1OSNA 2AWNA 2HV8A 5EE3A 4LJ4A 3QF7A 2O8BA 1L4YA 3AQ4A 1TQ4A 3MWKA 2VYFA 3QENA 1XJQA 2GJKA 3LH5A 1BYIA 4LBVA 1R5BA 2FOLA 4KU4A 4DWJA 1NKTA 2OXCA 3HR7A 4V02A 3B85A 4L9WA 3VR6A 5G41A 1ZNWA 1YZTA 1E9AA 2CLSA 2JLQA 3B78A 2N1BA 2WJJA 4LC1A 2F9LA 4TTQA 5SZIA 2IBMA 4JLOA 4KV9A 2E9SA 2MMGA 4LHYA 4PQFA 1W4CA 4FD2A 2YKGA 1T0JB 1LNZA 5UKDA 5FOWA 3K9LA 4FMBB 3N70A 4QHYA 2CVHA 2FPMA 2JLRA 3U44B 1DTSA 4A8JB 2J41A 1D9ZA 2AWOA 2Y8EA 4LI0A 3H84A 3M6AA 2W83A 4Q18A 4TN1A 3RS5A 4DLVA 5GJBA 1XMSA 1AKEA 3OF5A 4MRNA 5IRCD 1Q20A 3VX4A 1TUEA 5DSZA 2H8KA 1A5TA 1ZD9A 3ZZ0A 4D0NA 3OE7D 4D2IA 3G5UA 1UADA 5F98A 4QBHA 5JJIA 4DLZA 1CF4A 1ZIOA 4DBLC 3EARA 1HEIA 3SJCA 4DLRA 5BN4A 3ASYA 4Y0AA 1FMJA 3DVLA 3MD0A 2W58A 5LB2A 5KNDA 2ZYVX 2R6FA 1NLFA 2GXQA 2R6GA 1L8QA 4PO1A 3BB4A 2PZGA 2WJIA 1MO6A 4AY2A 1OFTA 2F43A 2QROA 2KBEA 5JWHA 2C5LA 2VQSA 1NIJA 2FFHA 1XP8A 1DARA 2NO9A 3MRSA 4DCNA 2LWIA 2OV2A 3RDPA 5AJXA 3DZ8A 1FX0A 1IY2A 3TBKA 3JVUA 2XXAB 4BZXA 2Z43A 3L0IB 4DVGA 2GXAA 3Q7PA 1JI0A 2OBMA 1IY1A 2FJUA 3GLGA 3HPRA 4NCKA 3U6BA 5DLQC 2XB2A 3RSLA 1FQJA 2OFWA 1NRJB 1ZD8A 3G82C 1L4UA 2O8BB 3GJ5A 3Q9LA 3RS0A 1ZC3A 2A78A 3LW8A 2WMNB 3U7HB 4I81A 1P60A 3VR4A 1ZIPA 4ILEA 4TTPA 5TVKA 3L2OB 3K9GA 3HU3A 3HYRA 1P3JA 3CIOA 2J7PD 4QHSA 3UWKA 4BFUA 1RRGA 4LYJA 1ZP6A 4HAZA 5EUQB 1ZW6A 4B6EA 2CNWD 3I32A 4QHTA 4PC2A 4NYIR 2GJSA 5KUTA 1AGPA 1N0UA 4V0OA 4DKXA 3GLFB 5E4FA 1ZVQA 5FI0B 5J47A 4B3XA 2IUUA 4UXJA 4IVRA 1G3MA 4GDFA 1E96A 1UDWA 821PA 4QBFA 2QT1A 3RRMA 4MKIA 4IFEA 4HZUB 1RPZA 3LD9A 1VYVA 2G3YA 2IXFA 4LBYA 3B1XA 2J7KA 2OM2A 1GUAA 1M74A 5BQ5A 1P2VA 1VG8A 1K6MA 1E4VA 5KU1A 5EE9A 2HDNB 2ZRHA 4JIMA 1OXSC 4FMDF 5GVRA 3BERA 3BGWA 1XJCA 2BKUA 2WAYA 3JVVA 4LV6A 4Q4HA 1N6KA 4TL9A 5EZ6B 1E9EA 3QVUA 4IJMA 4MH0R 5EXSA 4C0JA 2PX3A 2P3SA 3V9PA 1W46A 1COWA 1WCV1 2N42A 2PZFA 1E9DA 1KYIA 4ZV4A 1X1RA 3AVQA 3CUEF 4IOLA 3LRPA 2P6NA 2ZR7A 4BFTA 3QI2A 5FUVA 5EP2A 1L2TA 3B7GA 4RCZA 4JVNA 3WRYC 3K09A 5JS7A 1VPLA 5EUMA 2GVZC 2DFTA 3A8TA 3THWB 2DB3A 1DG1G 1J8MF 3P32A 4W5HA 1Z0JA 2RHDA 5AK0A 1QHNA 2RMKA 1CJVC 4JYCA 3GLGB 4P32A 2YWGA 4HDCA 1E2KA 4LYFA 4IOMA 4B6FA 1OFUX 2BEKA 2ZAOA 1BS1A 3DM5A 5CK5A 3U3MA 1S3GA 2QM7A 2IX3A 1PV4A 4JKIA 2RGCA 4LJ7A 3K9HA 4LGMA 2HXYA 1ZU5A 3D8BA 4CEHB 2BOVA 2OCBA 2ORVA 3QF4A 4OYHA 2WSMA 2FSIA 1KI6B 1GOTA 3REFA 5JECA 1GWNA 2WWWA 1OB2A 2FFQA 1OHHD 4PSVA 5KTYA 3SHFA 3SZRA 1KI8A 3KXKA 1XD9A 2JJ1A 1ZD1A 5BW8A 3BOSA 3I8XA 4GZMA 1D2EA 3R9IA 4TL6A 5GADl 4IDPA 2B8TA 4MA4A 3DO6A 1SVSA 1OF1A 2AXNA 2ZPTX 3MFYA 2Z5FA 1TTTA 4LBZA 3G0HA 2ZRPA 3F3YA 3WMFA 3GLGE 2REBA 1AKYA 5FUYA 5DIFA 2KE5A 4Q1EA 2FEMA 2QUZA 3CNOA 4PO9A 1KHTA 4RKFA 4LJAA 3GQBA 1CJKC 3CPHA 2IF2A 2W0MA 3HJNA 2V7QA 1U0JA 5G3YA 1FNMA 4D0GA 1DAEA 2Z4RA 3W6NA 5FBVB 3A1VA 4G5SA 3DZDA 2EU8A 4A15A 2GF9A 2NOAA 3ZIAD 5FL7D 4Q66C 4HAUA 1T5LA 1E3MA 1JXMA 3ZJYA 5AUPB 4I1UA 1OXXK 2IYUA 1D5CA 2GCOB 3HU1A 3OEED 2IS6A 1YU9A 3BC1A 1WBDA 2QP4A 2JIZD 2ZRIA 3SC3A 1TF2A 1SXJD 4UJ5A 5DN6A 1C1YA 4IKEA 4A0HA 2CHGA 3RWMB 1W5TA 4AWXA 2VEDA 1UDXA 4F4CA 1IN8A 2F1RA 3ZGXA 2JA1A 1GNRA 4YONB 1QVRA 1SHKA 2OXRA 5DI3A 3T15A 2JLSA 2VA8A 1ESNA 2FN4A 3CPEA 3IBGA 1N5LA 3R20A 1H65A 2ZI6A 3AVTA 1DVRA 1NP6A 3AKEA 4XJXA 1KZGB 1E2FA 3H4MA 3MJHA 1X8LA 2P5TB 4O2RA 1NLZA 2WVJA 4R9UC 1GRNA 2F3TA 2A5YB 3ND8A 4XWKA 2V6IA 3KL4A 1JEDA 3UKDA 3LW7A 4HUQB 3MUFA 5GJCA 2W6JD 4Q03A 1YR7A 4LWZA 1HTWA 3RHFA 4BQSA 4BEBA 2PBRA 2ZRMA 2J0QA 1G8FA 4B2PA 2BMDA 4IOKA 3EPHA 1NBMA 1Q1BA 1GNPA 4PAOA 1Z47A 3AF0A 5LBIA 1Y63A 3OIVA 1JR3D 2IT1A 4MDEA 3QNUA 1ESMA 1MRSA 3A37A 4JZKA 4POAA 4HYYA 2FFBA 1MOZA 1R10A 2W2XA 4BWYA 4OHWA 4CYMA 1QHSA 3V4RA 4AURA 1XD2B 2R6AA 1Y3AA 2QPTA 3BD9A 4R2HA 2ZSAA 4LBWA 2IC5A 2PMDA 2IYTA 3AVXA 1H8HD 1J7KA 1KO8A 3OE7A 2RGGA 4TMWA 3TSOA 4B48A 2P5SA 4PHTA 2BJVA 4P4TA 5EP3A 2MSCB 1OHHA 2Z83A 3EC2A 5DH9A 1W4BA 2ZRCA 1YZKA 3NC0C 1SXJB 4PTLA 4EPYA 2HJGA 2PLFA 2X1VA 4XD7D 4YMUA 1KAOA 4PC3A 2ATXA 5DGXA 2I4IA 3GLIE 2DHRA 4ARZA 2ZYWX 3BFKA 3CF0A 4QGAA 3S1AA 1KK3A 621PA 3AUXA 4URYR 3C8UA 1GL7A 4OL0A 4M1YA 4P4SA 1XEWY 5EP1A 2JIZA 4WVFA 2IS2A 2GILA 3CONA 3VNUA 2C78A 4I4LA 2QZ4A 3TW4A 1JJVA 1SVKA 1XEXB 2D7CA 4WW0A 2P6UA 2W2VA 3CWZA 5TMPA 1JALA 2BCGY 2XNSA 4PZYA 3K1JA 4IXMA 1GSIA 1NLYA 3J81k 5TY0A 3K0SA 4MGZR 5JHGB 1TADA 1MO5A 1WP9A 3LFUA 1HYQA 1U8AA 1XWIA 4GPTA 1FUKA 4N0DA 5JHHB 4XVRA 1ZJ6A 2QRNA 3LNCA 4Q9KA 4OQNA 2QN6A 3C5CA 4D6PA 5CIQA 3E2IA 1PLJA 4Q9IA 3EWAA 1F2UB 5JI3E 1CBUA 1G3RA 3OESA 3U4QB 4KITB 3GCGA 2QE7D 3RS3A 2XSZA 1H8ED 421PA 1UEJA 1MH1A 1YKSA 2FGJA 2J0VA 3THYB 1U2RA 2XZPA 4OI2A 4DCTA 4DSOA 3TAUA 5B64A 2GVDC 4JKYA 4LJYA 4Q21A 4MUBA 1KI9A 1G41A 3C14C 1R5NA 5C4GB 3PITA 1LS1A 1K8RA 1O3YA 2OE2A 3T1VA 3VKGA 1NVUQ 2KBFA 3L0PA 1P5ZB 3K70C 4JL6A 3LXRA 4EIWA 4ZCLA 1E9FA 4R98A 3CRQA 2VBCA 2WM9B 1E1RD 2NGRA 4CEJA 2I1QA 1CRPA 1ZM3A 2A3RA 1EWRA 3OEHD 4KAXA 2HF8A 3CX6A 2IYRA 1TAGA 1VG1A 2GBLA 1YZNA 4MYHA 4ON9A 1K5GA 1KOFA 1DELA 1KMQA 4TLCA 2D06A 2QL6A 3GEHA 1G8GA 2GWHA 1N25A 2J3EA 2R6DA 4RZ2A 4TSFD 2CJWB 3KQUA 4N1AA 3DKPA 3LQQA 4D0LB 4JLJA 5IF9A 5JS8A 2YZ2A 3TVDA 3TUZC 1I2MA 2XTNA 3GLIB 2O0HA 1S9DA 5HE8A 4BECA 2WPDA 3IQWA 4CVNA 5DISB 3TR5A 2L0XA 4IDHA 3SI7A 4H9GA 3WYGA 2AK3A 2F43B 1LFDB 4DDUA 2ZU6A 3GJ3A 2JLXA 2ZI9A 1Q0UA 3OIUA 4B71A 5HZKA 2WSSA 3SFZA 3WNDA 2WOJA 4IDOA 4HLUA 3SN6A 3L0SA 2IF0A 2WWFA 1YQTA 3MMPA 1P9RA 1ZNYA 2XXAA 4YQFA 1WA5A 3L82B 3MG9A 4KSBA 3RS2A 1D6JA 4AKEA 2UZ3A 2ZANA 4D4JA 5JLJA 4DLUA 4BLSA 1I4TD 5B30A 3HWSA 3FVQA 2YINC 2WAXA 1TNDA 1CP2A 1UEIA 2VHQA 1A4RA 3IBYA 4JT4A 1S0UA 1GFIA 2QE7A 4O25A 4RKEA 4TSFA 3KQNA 1EFCA 3QBTA 4ZCMA 5HKKA 5LB4A 3B60A 1DAFA 3ZVNA 1FNNA 3THYA 5FUWA 3DOEA 3A1TA 3FYHA 5F9FA 1LTQA 5SZJA 3B2EA 2IYLD 1G9XA 4PSAA 1FFHA 5TXGA 5AJZA 1SVMA 2FU5C 1RC8A 4OI0A 4DUGD 3BH7A 4IOJA 4QNRA 4QNMA 4MITA 4XVQA 3RS7A 2OUKA 1EWQA 5FOUA 1G8YA 2G88A 1E2GA 2P2LA 3D6TB 4U02A 1XMVA 2R2AA 4B74A 5K8TA 4JSTA 3U2QA 2QQEA 3PUXA 3BH6A 3BH0A 3R8CA 4EFNA 3B1ZA 4UNNA 2FX3A 4UXIA 1ZM4A 3ZIAA 4PHHA 2ZJ8A 1XX6A 4DXAA 3H2YA 1VIAA 4EFMA 3AV0B 4EFLA 1KDTA 1Z5ZA 3VAAA 1OXVA 4Q1BA 1RRFA 4URZR 4XVUA 2A7QA 4M9ZA 2H17A 3EW9A 3QJYA 4QL3A 1T8TA 4DEYA 3TSZA 4DJTA 5KYKA 4TLAA 1SGWA 3DEFA 3P27A 5HR5A 2ZJBA 5AWFC 4ESVA 1N6RA 3LWNA 3B5JA 1G7RA 4W5WA 4NYJQ 5FBRB 221PA 2G9NA 1R2QA 1JJ7A 1TEXA 4L15A 4KYUA 3UIEA 2G1KA 1WF3A 5IHPA 3RNLA 5JRJA 4ZDWA 2PEZA 3IO5A 4DDWA 2DY1A 5J40A 1J90A 1NVVR 2O8DA 3SJAA 2NIPA 4QGHA 2JGNA 4TT3D 1JECA 1PLLA 2RB4A 3THOA 1N5JA 2GXUA 1DPFA 2WTUA 2KI5A 2OILA 4B3GA 4IDQA 1T0HB 4LY6A 1KI4A 4GMXA 4S35A 1RJ9A 2H57A 3PENA 3LBHA 4XTRA 4LRWA 2XJ9A 2ZJ2A 1J8YF 4UNRA 2IEYA 5AUQA 1P73A 2ZRBA 1R8SA 2IUSA 4TYQA 1VTKA 1FP7A 3EG5A 1FUUA 3OAAA 4BLRA 3FPAA 2JASA 2VF8A 4WZAE 2VSXA 1GVNB 1DO0A 3NBYC 3WY9A 1HQCA 5CM8B 4A0RA 4BFVA 2REXB 4D80A 5CB6A 1OH7A 1EXMA 3LBIA 3RYTC 2ZRAA 1ZM9A 2C9YA 4NONA 4H1VA 1HE1C 5JCZA 1YRAA 1GKYA 3IKJA 2ZXUA 1U90A 1QZXA 3SFVA 1M7BA 2O8FB 4US2R 2REOA 2ONKA 2GAOA 3OAAD 3T35A 121PA 4QJ3A 2VSOA 4IEIA 1N6PA 1OKKA 2ZUDA 3GJ6A 5KPJA 1F2TA 4TYWA 2AFHE 2NQ2C 2OAQ1 2EVWX 4ACAA 2Q21A 4A8JA 5ELXA 4IVPA 3ADBA 1G5TA 1DEKA 5HE9A 2VP2A 4GRAA 2WBLC 2QAGC 4PXAA 1LW7A 2UKDA 5TV2A 4D81A 5J4LA 1W4AA 4PANA 1G19A 2RGAA 1YZLA 5BN3A 3FKSD 2ODEA 1T3HA 3NG1A 1IJEA 1ZUHA 3AF2A 4II7A 1KMHA 2IYXA 3IILA 4AKHA 2GEVA 4HB4A 4DSTA 3CO5A 1SZPA 4F91B 1Z0IA 3AKYA 4KODA 4HB0A 1T4GA 2C9OA 1VCIA 2ZVQX 3M0EA 2C77A 5B2ZA 1Z06A 1AQYA 1E2JA 3DPUA 5LDDC 3I61A 2G0NA 3KUCA 3CWQA 2XOKA 4ITRC 4B3CA 3K70B 2FFAA 2FGKA 1SXJE 3DMDA 2G0TA 3ONWA 2BCJQ 5FFMA 3AF4A 2QA5A 3IIJA 4L16A 2GJAA 4A8JC 3U61B 3CLVA 4QXAA 1EX6A 5C1BA 2GDJA 5GVSA 3R9WA 2YJTD 4N3NA 5FR1A 3M4YA 2AL7A 1FX0B 3C5HA 3AVWA 1MR3F 1KJZA 4B43A 3K9NA 2F55A 4DB4A 3GFOA 2VHJA 5DI3B 2RH5A 2F9MA 3TAHA 3IHLA 4B75A 2H16A 1FOEB 2PH1A 4G5GA 4Z54A 2C99A 1ZYUA 1P72A 3CF6R 1CJTC 4CGZA 2CNWA 3U3JA 5CLLA 1B0UA 2BM0A 5BN5A 3GD7A 3UMSA 4OKSA 3NC1C 3FDIA 2WJHA 2QBYB 1IJFA 4HAWA 2QTVB 2RGDA 5BWMA 2O8FA 4NCNA 4JYBA 4PC1A 1S1MA 4L4UA 1GZSA 3NVAA 3PVSA 2ONJA 1M8PA 3ZVRA 4QFMA 1VKJA 3P4YA 1OW3B 3FTQA 4EPVA 2EFGA 1JEEA 3T61A 4OQLA 1M1YE 4LZZA 4MRPA 1W7AA 2FF7A 3SYNA 4ESHA 5LD2B 1TX4B 3ECCA 5HTKA 4AK9A 1C4OA 4D4KA 1Z6AA 2BDTA 1CR1A 4HZUA 2XNDD 2VF7A 3C4JA 4TT3A 2JJ1D 4I1OA 5BYKA 4QGFA 1ANKA 5CITA 1UJ2A 3QVVA 5HCNA 1COWD 2DYKA 2FDCA 2HLDA 3KX2A 4H1UA 1OIXA 2D62A 2GZAA 1WRBA 3SYLA 1RRPA 1CTQA 5DHFA 1Z0KA 2YC4C 2ZSEA 4ZIRA 4OJKA 5KSPA 1Q22A 1IN7A 2J59A 2WJVA 1ODFA 3K53A 3CPJB 4F93B 2C95A 5A4JA 4X8OA 4Q19A 2AHOA 5FBLB 4NU0A 2EWVA 1GKUB 3KXIA 3C41J 4ZPXA 3F5FA 2X8AA 4I99A 1YR6A 1KI3A 3WP1B 2ZIAA 1IXRC 2P65A 1KI1A 3EIHA 4DCSA 2PX0A 1FTSA 1AIPA 5AUNB 4ZCIA 1HT2E 1WB9A 3FFAA 3NDPA 5EP4A 1U0HC 2ZQ5A 4FWIB 3CX7A 3Q5EA 3QSYA 2NMVA 4BLOA 3Q5DA 3A4MA 4C2UA 4PPGA 2V1UA 4NHOA 3GJXC 1W47A 1OKKD 2YOHA 4QOSA 2QPOA 3AVUA 2GRJA 5E95A 4AKIA 1Z83A 3OEHA 3PV0A 4RSGA 2F1HA 3VR5A 4HB3A 3AF3A 1XCMA
chains in the Genus database with same CATH superfamily
3BMQB 2NV0A 2WICA 3Q40A 1G4UR 1MAAA 1GLGA 1JDBC 1ZK0A 5EFZA 3K0HA 4CM3A 2I1WA 3BJEA 5KYWB 1OX4A 3ZH2A 1S2GA 3WZMA 4PG6A 2NYRA 5B58C 3QXHA 1KJIA 2X3FA 1N3YA 1PS9A 1VG9B 2HV9A 3OLVA 5IVIA 3TLBA 1SIOA 2B5OA 3BWMA 1CRQA 1A95A 3TM4A 2ZTLA 1Q1QA 3QMWA 4UNIA 3IEMA 3V8RA 2WFLA 4FEGA 4GYWA 2QMUA 1GP2A 1NYTA 1TQ8A 3ICEA 2WU4A 4JDUA 2A86A 2OV6A 5K20A 3K4QA 1AH2A 1QIGA 2FPOA 1E94E 2JJ8A 2QIOA 4OD0A 2WAOA 2WJPA 1WHTA 5AHWA 3LMKA 5C5IA 5KTRA 1RR6A 1K3FA 3TKAA 4ITUA 5A1JA 2VHEA 3GU3A 4G86A 4J9UE 3THRA 4UHDA 1SCBA 4Y2YA 2DQSA 3I6QA 4C14A 1QGOA 3H5WA 5KQPA 1U2EA 3G88A 2GD0A 3AV3A 5FYDA 3IQZA 2CDBA 1BXGB 1D04A 1K7XB 3RANA 2QVYX 3VR5H 3VR1A 1LD3A 5HP4A 1IBLB 2HYIC 2GM5A 1QFZA 3CNLA 2L2QA 3SF8B 1LDBA 4S0ZA 5D3MA 3TOVA 4BJ5A 1GM5A 1SUFA 1Y9DA 2H7CA 5J59A 2G1AA 3I2YX 4ZYXA 2XYVA 3DUWA 2UUOA 3ABZA 3WKEA 4MUXA 2FFJA 3HP7A 1X7ZB 4XSVA 2XEDA 3HXTA 5SYAA 3RK1A 4ND7A 1ISMA 1CV2A 4PIVA 4ZU3A 4B09A 4D56A 4GFDA 3NYRA 3KAQA 3R0QA 4EB3A 4Q1AA 1YDGA 5EWLB 3DOUA 3ZIDA 4PYJA 4CQLA 4FGWA 4RH1A 3SE0A 1E6LA 3ND5A 3FIJA 3R9XA 2R7NA 4RX1A 3PK0A 2G9QA 4K46A 1QPBA 3QEJA 4KVGA 1I80A 4UOQA 3OM0A 3DDWA 2Q5QA 4HKTA 1NIPA 1VMKA 2VDUE 1GVHA 3RTDA 1PYGA 2NVOA 3SKYA 4JVSB 4L76A 3ZUPA 1DO8A 2ZBPA 4MGIR 3BTOA 1WG8A 4UXHA 5DX8A 1DOAA 3LQKA 3NTVA 4BNFA 2NUPB 4M22A 1CEYA 2XDQB 3V7UA 1FTWA 1ZN9A 4UAJA 3I8SA 4AZ3B 1H1LA 3GGJA 4FJ1A 3HBAA 4G01B 5ALZA 1IVNA 1M5UA 1OLUB 2HA6A 2AB0A 1VL1A 3KYDB 4B3HA 3K0CC 2Q6OA 3TIIA 3V4OA 3LVQE 3OEYA 3AUTA 4KC0A 1G3IA 1VJ0A 3EXIA 1PT9A 3E7DA 4ZQHA 1ZUNB 3KKOA 4EMUA 4BGUA 2OFXA 1SKYE 3F4LA 3ZU5A 2LGJA 4F8JA 4Q9HA 4WZBE 2VDJA 2BBSA 2OXIA 3ZVKA 4PV7A 1JDPA 2YOGA 2CKDA 2X4GA 3ZXSA 4HDMB 1X1DA 2ODWA 4M9UA 1IM2A 2A59A 5TRTA 1U7OA 1DEHA 2P2NA 2AMFA 1BDJA 1PEDA 1BHQ1 2HO5A 2AFHA 5DWQA 3FNBA 1HYEA 1KPIA 3QG5A 3A36A 1GR1A 3U7FB 2WU1A 2JC3A 1F5SA 1ZBDA 1IRXA 4J3JA 1DKQA 2P3QA 4YGYA 1N33B 4DLSA 4ZGWA 2ONCA 2VR1A 3EQZA 1BJRE 1XZEA 4QC2A 2WZBA 1F0PA 2JAXA 1VXOA 1OYVA 1KMMA 1JLHA 4IGAA 5H4HA 2O7QA 2VQ3A 3W5CA 2F3UA 2WJWA 3UBTA 1ZCAA 2EGHA 2XGMA 3PHIA 5F1OA 2I9KA 4H08A 1ZX1A 2PKYX 3HV0A 4M7WA 1K66A 4OAQA 4UVHA 4BOYA 1YI8A 1R00A 2Q3DA 3B1KA 1T6XA 4MSUA 3QKSB 4QBTA 3PNPA 4PHFA 1Q7TA 5LQMA 4KR0A 3KEGA 1LPSA 5EVCA 1ZINA 3KFVA 1Y4UA 5IMBA 2OKGA 3DL7A 3QX3A 2H1WA 3ZWKA 4D8VA 3HDQA 1N0HA 4KWIA 2YWHA 2PMKA 2PZKA 3B1WA 4ZK2A 3L7KA 4IGKA 1ZC4A 1HGXA 1LI5A 1OJ7A 3E3AA 4KBFA 4EYEA 2XUKA 2JLVA 1BGXT 4M1MA 5KSYA 2R8XA 2VPIA 3BQ9A 1L7VC 2Y2VA 4MW0A 1M2NA 4NBUA 4QEDA 1XEXA 1QKIA 2WD7B 1V8FA 3O0DA 1EINA 1XCGB 2YRFA 3SEZA 5EHXA 1LSOA 5FLKA 5KWVA 1EUYA 5HGXA 3L6EA 1FFYA 2H4JA 5EJFA 2OXEA 4Q00A 1XVAA 1V7CA 3F47A 4IYJA 4MHTA 2G25A 4GW3A 1SQ5A 4Q12A 3KTFA 4E2XA 2JG3A 2PX2A 1YZHA 2BM1A 4MIEA 1DV1A 4AS3A 2I4TA 2FMTA 4DV7B 1VXRA 3AR4A 3OUZA 4H17A 1GD1O 1DOZA 5K3CA 1LBEA 2ZT8A 4N7RA 3PWTA 3TTTA 1NBAA 1MAVA 3QV2A 4BU0A 4B79A 3AJRA 1H6DA 5AI6A 2DF8A 2AXQA 5H0IA 2YIVX 4WOBA 3PUHA 4O1HA 1HFKA 2JFBA 4M98A 4R41A 3IL2A 2I8CA 3I83A 4CG2A 1ZUNA 3C70A 1UK6A 5ISMA 3HJBA 3PRKE 3Q3IA 1MFPA 1SHZA 4DHEA 2CLKB 3LTEA 1V9LA 3CKLA 1I6LA 1Q0QA 3QP9A 4QO8A 3T7AA 4QQFA 3NPAA 1KRHA 2DFNA 3AUSA 3AG6A 3HI4A 6CHYA 2D1TA 2HMAA 1WCIA 2JGDA 3RVRA 3ZDEA 4AP6A 4XFKA 4X7RA 2WE7A 5FTJA 4DE5A 3L7AA 5B6JA 2IDMA 4JLMA 2ODBA 2Q3LA 4DRZA 1DKPA 2I4LA 2M98A 4Q82A 5D87A 3GLFA 3C3KA 4JOSA 3GL9A 4MQ6A 4LJKA 4K9OA 4JUCA 1F2TB 3ZV6A 2Q3MA 4MEAA 3EC7A 2P30A 3COYA 4GO1A 4BNMA 4UJ3A 1KARA 2QTHA 1V3VA 3DPIA 1FLNA 3ON5A 2ZRGA 5I01A 2VH5R 1T6NA 3PT5A 1KEVA 3PGXA 2A2ZA 3FCOA 6REQB 5F2NA 5JSZB 3COWA 3GRUA 2ZULA 2ENUA 1KMNA 1XMPA 4I1SA 3RC7A 3IRUA 3KPUA 3LU1A 4HSEA 1D9XA 3OOHA 2AN5A 5BN3B 3GPLA 4OQXA 1TZBA 1VJCA 2GFIA 1AX9A 3ASVA 2IYYA 3OEEA 4MLCA 2HGZA 4BVLA 1YMQA 3JASB 1NVKA 4UTVA 2ZCJA 3THXA 2G6BA 2IXEA 3RF7A 1B8OA 2ZVJA 2XXJA 4RGVA 1TQ6A 1V47A 2Q3HA 2COKA 1PGPA 2BFNA 2X0NA 3Q11A 3E9DA 1F06A 3GFPA 4EK9A 4A0SA 5CXXA 4KYIB 3RRNA 4GP9A 2IXGA 3L1KA 3PHCA 4KGXA 1LBHA 4I3FA 3ZWNA 1MABA 3KFLA 4QXOA 4LJ5A 3HM2A 2WD9A 5FI5A 4B6PA 4ZT4A 1EG7A 2QAGA 5HUQA 3G02A 4TKVA 2AX4A 2SICE 1SD2A 2ZGVA 5F73A 1R7RA 3FKJA 2Q9BA 3RC2A 3ESQA 3NNSA 4FYHA 5IAEA 2XYGA 3KUKA 4FYXA 4V0NA 2Q3EA 3CMMA 3KPWA 4P35A 4GM4A 2QQGA 2W5UA 2YVUA 3DXFA 4L51A 5CYFA 2OB1A 1UCFA 1VE1A 3DULA 1FPQA 4V24A 3TTVA 4FEEA 4RO0A 1RFLA 3UWOA 1WL8A 2C96A 4IJQA 4ML3A 4RELA 4UD2A 2PRYA 3WWEA 3G1WA 3KV1A 3BK7A 3NH6A 4NULA 3LQ4A 2FUCA 4OYYA 3W5JA 4DLYA 2QW1A 4C0SA 5ITZA 4TV8B 1XHFA 2LUOA 2R5NA 2XB6A 4ZOLB 5BWCA 3E84A 4ZHQB 2OMEA 1O54A 1Z0FA 3LKZA 1NURA 4QDXA 1NF8A 3CH5A 1ZN7A 1Y7LA 4DR2B 3EWNA 4CKYA 4V0KA 3ESCA 3P4UA 3W9BA 3G7UA 4C03A 4JL5A 3KVVA 2GCEA 1QUEA 1OV4A 2EHJA 2GM9A 3LBNA 3OZEA 2F8SA 3MW8A 1TEVA 3BGSA 1KSGA 4OLBA 2RCYA 4X94A 3DOJA 3DMHA 1H6CA 1XD8A 3EZ6A 1OBFO 4D97A 1K63A 2R66A 2LE0A 3TKLA 1IBRA 1WB6A 4C6TA 1QRRA 3X44A 1J5EB 1RHKA 1YR9A 5BMVF 3RC3A 4NNPA 2XB9A 2QUAA 2HSWA 5G1PA 4D82A 4QASA 4D9IA 1JZTA 3LX8A 2AFVA 2JFFA 3BAZA 3L04A 4G5HA 1V39A 1X7WA 4MAFA 5HZHA 3QVLA 2B36A 2WRZA 1PNQA 2YMMA 1NGSA 3M2TA 1Z88A 1VMEA 4DR7B 1E69A 2VSQA 4J91A 3DDHA 5ENVA 3VO9A 3KE9A 4R8LA 3WHLA 2R96A 5LIRA 1T8RA 1P5JA 3A3YA 4NPHA 3X1JA 1LKZA 4IUDS 4Y0VA 5CAEA 4Z7OB 2YJ4A 3QBVA 4O4IB 2G0AA 3A04A 1V8DA 3NWOA 2I7CA 1UBEA 4FZRA 1AS2A 4J0IA 1QYVA 4R7ZA 5KHOC 4KREA 2X7XA 1GGHA 4Q4LA 2AKYA 4F5YA 4F9EA 1X80A 1JSLA 2CHQA 4B7XA 5G2OA 1VKRA 4DIOA 1SU6A 2VJPA 1K5HA 3GPIA 4B4UA 4EO7A 4PAGA 4EJ6A 3OOEA 1JEQB 4MR9B 5H1YA 1GGKA 3GQVA 2IS1A 4JMPA 3ZX5A 4DRXB 5AKYA 3OQMA 1JFFA 2W6JA 4GL2A 7REQA 3EXG1 3H3FA 2GFQA 3UGKA 3KS9A 3QVKA 1YDFA 1JXOA 1CX9B 4EELA 2P6OA 1UC9A 4W1PA 2C8VA 4GLOA 4CCAA 4G8BA 1NTRA 4JLUA 3VPSA 3OZXA 4HZIA 1Z5NA 4K6CA 4YBZA 4Q39A 2JGFA 1C9EA 1YE8A 2Q5IA 4ZVVA 4LTMA 3ZV5A 2O3SA 4QM7A 4BKPA 2E4WA 1WV1A 3L01A 4DPLA 5A9SA 1CR2A 2YDXA 4HPWA 3W1VA 3WL4A 1UM8A 3JQAB 1SUAA 3FR8A 5GV8A 1P2GA 1P5HA 1UZUA 3DE7X 3EC1A 3ANSA 1C5KA 3A1WA 4TVBA 4C43A 4B3IA 1GDDA 1XIVA 1E3WA 3E9QA 3F1LA 1Y3CE 4F1KA 1XYGA 5CMLA 3IIMA 4C7XA 3OQNA 1S8AA 1YFJA 3NM4A 4UU8A 3AFIA 1EU1A 1XMIA 2ZBQA 4MVJM 4WXMA 1AKNA 3BMOA 1KEPA 1HOXA 5BUZA 1SCUA 5GM2A 5I9LA 1Z2AA 3L8CA 5REQA 1U8XX 2FRDC 2C8LA 4JT2A 1Y89A 1MFZA 1XMXA 2OCKA 3HHEA 4LOIA 1FQWA 1XQ6A 3ZD7A 1ZA1A 1M72A 4FEAA 1G63A 1LGYA 4AKGA 3I3SR 3ONNA 1R0BA 3NVDA 1DI0A 1ZLXA 4ZQIA 4RTJA 4OBBA 2C7GA 2C2YA 1WMSA 2FEWB 2ECKA 2FWIA 5K2MA 4QJ4A 3KCNA 3RREA 4LWPA 3KYBA 1UQUA 1M34E 3LPLA 4A5SA 4FTWA 1DRWA 2B7CA 2P91A 2C5HA 4J7CA 1T0PA 1VHWA 4M1SA 4N39A 1M7HA 2Q3BA 4X60A 2RHCA 2VJOA 4KQ9A 3X1DA 1ADGA 4K28A 4XCQA 5DGIA 4BTEA 3BUSA 2FMFA 7ADHA 1KQFA 3LHSA 1JJAA 4Q01A 2MSLA 3VUEA 1KK0A 2C9ZA 5LKRA 2C5GA 4KXXA 4V1CB 1P19A 1LC0A 1Q0RA 2AQ8A 2EHDA 3OCYA 2OD2A 3QEAZ 3T3IA 2NVBA 4PLPA 1E1CA 5KJ1A 5CVVA 4BNJA 5NLLA 3Q98A 3W2TA 3KTOA 1TC1A 5SV2A 4GI7A 3VMMA 1NZJA 4AJIA 1QDEA 4IXWA 4JP3A 2IYZA 4O08A 4PNPA 1T8UA 3IQIX 3H9JA 1XTIA 1YS2X 5FBHA 1H9BA 2OHHA 4B9EA 2I34A 1S8FA 3MD9A 2RI6A 5HDBB 3BILA 3ENZA 3SHQA 1J2UA 4I4TF 4ZI2A 4NH0A 4RJTA 4R8MA 1TMOA 4DRXA 4CLRA 5JQWA 5E7MA 3MUNA 4IHJB 7REQB 1A9SA 3HZZA 3H19A 4QYMA 2HT6A 4TXNA 4QOIA 2ZJZA 4ND3A 1EFUA 2ZSJA 4YJHA 1X13A 3E0XA 3CZPA 1KXJA 1S6YA 2F2TA 2WWTA 3TM5A 1ND6A 4UUOA 1GPAA 5KNBA 2VUUA 2W2QA 4P4SB 1IK4A 3A1CA 1YO6A 2YNMA 3HN7A 3G2OA 3K5HA 4FYYA 3NV7A 4BUJA 4ZK6A 2ZCUA 3LC1O 4PC6A 1Y9ZA 2XUQA 1U0BB 1EQ2A 4GMDA 4M1WA 4DBZA 1GG5A 2IGTA 3X1ZA 3FB4A 1JEAA 4A9AA 2CMGA 2GEDA 4BNXA 4B40A 4M1EA 2PKXA 2I3BA 2Z9BA 1Z5WA 4RJJA 4OPMA 3K5IA 2IZZA 1QS0B 1VMAA 4QWMA 5I3CA 1U0NA 4KIFA 1SU8A 3VX3A 4E5YA 3OZGA 4WBNA 4QU5A 5KYTA 1E1NA 1J2YA 5IBCA 3UJNA 1Q0ZA 2BTOA 2KX7A 3FZQA 4FDVA 1PV1A 3PGVA 2IODA 1B16A 3SPXA 4AJ2A 2B82A 2C8JA 3N8HA 4EHIA 8LDHA 4NMWA 3ESAA 4NI5A 3RUFA 4JJKA 4W8GA 3AERB 1XZAA 4PO8A 4XOIA 1DT3A 4FYJA 3O90A 2G04A 3I58A 1X6VA 3QUSA 3QV1A 4ND8A 2BTQA 2C2XA 2JAOA 3R4CA 3UB4A 1X0VA 4BO2A 1WVMA 2C1ZA 1UM9B 1C8VB 4A2QA 3U4HA 4M9XA 5KNBD 1TJ3A 2DWQA 3MQ2A 3ZGLA 3UPUA 3PLRA 1VYTA 7MHTA 4GSYA 3ADDA 5I4BA 1R3DA 5EESA 1ZHFA 4AY4A 4D7AA 3F74A 4ZDIA 1R6TA 4AO8A 4V1CA 1PGOA 4X3OA 4E03A 5CDHA 5EXPA 2OZEA 2LIPA 1P80A 1O94C 4RULA 2ZSDA 5F2KA 4FOPA 1TW2A 3U31A 721PA 1RWKA 4BCBA 1TTPB 4RPCA 3VAYA 5CDTA 2WT9A 2HWKA 3K70B 4ZYUA 5A4JA 3H1GA 4IRUB 3CR8A 4G36A 3D2BA 2X4LA 3UFXA 3HJCA 4YRGA 2VT7A 2FW9A 5T41A 3MOSA 2QP9X 2Z1DA 4J03A 1ADJA 4KE9A 5HS6A 3OQHA 4QIHA 1EUQA 3S3TA 3QU2A 1E4OA 1XGKA 1PI3A 1XZDA 3GO4A 4FNOA 3DKKA 1N2SA 4A6XA 1Y1TA 5HPYB 5IT4A 4TVSA 4MS1B 1UAGA 5I48A 2C98A 2QRJA 4RZSA 1F4LA 5IKOA 1D4FA 1FFAA 2A5JA 2JHCA 1UXJA 2BZGA 5LZ7A 4ENSA 2O2ZA 1YS7A 3LT2A 2QEQA 2GD1O 3KJEA 4K7JA 2G4VA 4DQLA 3ZU3A 4C0AC 1TM2A 1Z4MA 5JEEA 1KWKA 3HVUA 1TM4E 2MINB 4KLRA 3KZ1E 5A3SA 5CEJA 1X38A 2VXBA 4IIJB 4GOLD 4JLBA 2FLVA 2FWRA 3FOCA 1I36A 5CVTA 4E2ZA 5MN5A 4IRXA 1UT6A 4BEVA 4F3YA 4JXXA 2HK8A 4YCNA 3KJHA 2O8CB 5JWRA 1XZBA 2QVLA 3P71T 1PL0A 1QRAA 2ZIEA 2IYWA 3ER6A 4G07A 4YP1A 3OWHA 4TUYF 4HTFA 4RXMA 2IHTA 1ADBA 3T8YA 1LX7A 3OE4A 3E3NA 3QVXA 4BIIA 4UW9A 5E3JA 1FLDA 4LRTB 2JIBA 4ZPJA 2YVLA 2MSDB 4Y2SA 5AVRA 1EWYA 2QLMA 2UUPA 1AZTA 1I7SB 1E98A 1QU3A 1NRWA 1P9NA 2CUZA 3CUTA 2VTVA 1SUEA 5DKFA 1RSZA 5F21A 4CKBB 4CMHA 3ER9A 4NFLA 2C92A 3KPVA 1C0EA 2Z9CA 3LXUX 1DZIA 1JHXA 1VOTA 1P0FA 2ZRKA 1QBKC 3OZVA 4O4JF 1AC5A 2CJPA 4C1NA 2WT8A 3KIPA 4V3BA 3E6AA 3MTEA 5K9ZA 4HH3C 3V42A 5C1OA 1Z2OX 2XLBA 4ODIA 3SY8A 4O4IF 2XQJA 4X91A 4IS2A 4AXBA 4CEIB 3D4NA 1TLTA 2E82A 3LZCA 2BPOA 2GPYA 4BS9A 3TEMA 1M2EA 2IDKA 3HJAA 5BVGA 3QXJA 5LBTA 4LF6B 1Q1ZA 1PR0A 3KXLA 2KWIA 2X19A 3K8YA 3HXOA 2A9VA 4EB0A 4QX6A 1TKCA 2XJ4A 2XW6A 3GCDA 1A97A 3ZW9A 3D59A 3HMQA 3TX2A 3SNHA 1BDHA 4HAOA 3MJ4A 1KEUA 2A1TS 1WKVA 5JH7B 4WJZA 1LI7A 1BSVA 2GPSA 4ND2A 4RPLA 5ENZA 3WGLA 1XA3A 2UZ4A 4ZMSA 5D7NA 4F1WA 2VLIA 4ZMRA 2C0QA 3TNLA 2B4AA 1JGTA 4PXSA 5HWSA 1K1EA 2BH9A 1F8GA 4LCEA 2E6UX 2A33A 5IARA 2VUIB 4MV6A 1A50B 4AJ9A 5C4MA 3EAGA 3ILHA 5LJLA 1C9JA 1AA9A 2VL7A 4L8VA 3UMJA 3SQXA 3DA8A 4TTRA 5IULC 3L02A 3N05A 3R74A 3ZWWA 2PXXA 2QRUA 2Y93A 3PFFA 3QU9A 4QUGA 1MT0A 2J9FA 3D0QA 1KORA 4A8PA 1J1UA 4UEQA 1L6IA 3BRWA 2W2KB 5ALIA 1AKRA 1B93A 1N0IA 3BGVA 3NT5A 4Q48A 5F77A 3UT5A 3U80A 2A5LA 3H5RA 1IAVA 5EWMB 1XDZA 5H9WA 1A7KA 2DGDA 2PQMA 3B1YA 2CDCA 3CY6A 5BSRA 1Y5MA 3EGEA 4C3UA 5JE8A 4QUJA 1G7CA 1DLJA 3OJLA 5EIBC 4I6GA 1Q15A 4DDTA 4PLCA 1ZH6A 2VTBB 3EPLA 2XUZA 1WOMA 3PF8A 1I3NA 2XMRA 1AF4A 1U7WA 4OJYA 4PS1A 1RYHA 3OU7A 1HZZA 3FDZB 3P2IA 2D00A 5TPZD 3SVLA 1RRCA 4XPIA 2BMVA 4RD1A 1O57A 4FWTA 4G5XA 4RANA 3DBLA 2W70A 1UFVA 5CVEA 1P18A 1UDAA 3QI7A 5H80A 3DEIA 3SS7X 4TYMA 4P53A 1OI4A 4G9EA 4IILA 5L51A 4GWKA 4HOYA 4JBIA 4WNAB 4F5ZA 5IH7A 2R7LA 2V54A 1IULA 3FNEA 3G23A 4HZGA 2R1TA 4QGGA 3ES9A 5IKXA 4OUKX 1CQPA 5F12A 4YJGA 1FFWA 2JFYA 3LBAA 3E58A 4WEQA 2Q0XA 3A32A 4JQZA 1JEYB 3WK8A 3UTCA 1OI7A 3G2QA 3RB8A 3W5AA 2JI9A 3WLOA 1YB6A 3G8DA 4JR1A 1CS0B 3HC7A 3SEFA 2B2XA 1QF7A 1U94A 2YS7A 3H3XA 3ZWBA 2FEOA 4LNUB 4TWZA 4DF3A 2EX0A 3T1QA 3N74A 4ECEA 3T99A 2EF0A 2DWCA 4YMVA 3OMWA 1F3LA 4P4UA 5F23A 3OPYI 4R69A 5ICSA 2RGNA 1L5FA 3CX4A 1C9KA 3W8RA 2NP7A 4U2EA 3IA2A 1Y3IA 1WEHA 4CIYA 4JYZA 1QG4A 4J2TA 4NYJR 4OM7A 4OP2A 1H2WA 1J99A 2C59A 3TNFA 2G9RA 4PBTA 5EJEA 1SUPA 1UBJS 4L57A 3RKRA 5F7OA 4KVFA 4GMFA 1YSCA 4IIYA 3WYNA 4CEJB 4E15A 1J97A 1UP7A 3FLBA 3KAPA 1XVIA 3O9MA 1IXYA 3EIFA 2IL1A 1KYYA 1NKSA 2X2FA 3CBQA 1Q3HA 4UZEA 3N5KA 3M1YA 1G1AA 5AH0A 2ZR9A 3W9YA 1E2NA 2P0EA 3BREA 3JZMA 1NW9B 3R0IA 2L82A 4HF7A 2PQ2A 4LN1A 5G53C 4TMKA 5K8UA 2CHUA 4CR7A 4F9FA 4U7TB 1KJ8A 5KMGB 2WTMA 2XEXA 4UBNA 1G2OA 3PIDA 4OQMA 2X1HA 4HEA6 2A4MA 1SM4A 3JARB 1KAQA 3UHOA 1NU6A 2ZEJA 4LE0A 4LHVA 1AZWA 4Q4AB 2AEEA 2QD3A 3ZOKA 5IABA 3EPJA 3VU9B 4Z2YA 4AZVA 4DA7A 3QX9A 4W7IA 2J8ZA 4Q4HB 4C5BA 1A9OA 4AM8A 5TQJA 7MDHA 1Z74A 2J4FA 3JPYA 3PQ8A 1HX7A 4U7FA 2WHPA 4BO5A 1CP3A 1TJYA 1U31A 4P38A 4O5OA 3N0TA 5IK2A 3HKDB 4CL0A 1PWYE 2QQ5A 3MT9A 4RS4A 3JAMA 5JADA 4RH3A 3NHAA 3CVWA 4OIFA 4RD3A 5K6AA 3VHXA 3ZH9B 4IIJF 1BRMA 1KC3A 1ODLA 3IEUA 3MINB 1H2YA 4HQNA 1XNQB 4KAAA 1T13A 3OZTA 1JW9B 4FYVA 2JJ2A 1Z68A 2VH2A 3V32A 1QGYA 3CZRA 1IWOA 1XA4A 5FTNA 3AIIA 3FWPA 3F4KA 4H1HA 4M1TA 1MA0A 3X1MA 3DSRA 3KJGA 4ZQFA 3V2IA 3WGUA 3PDHA 4DA4A 3E23A 4LXXA 4ZI3A 4QXPA 1KBZA 2JEZA 2IPMA 1CUEA 3U5ZB 1NSFA 3BL6A 3HPQA 1PQUA 1J0BA 1Y7IA 1ZGBA 3F7NA 1DAGA 1E7SA 2NU6A 5A5GA 1PHRA 3DDCA 5JAMA 4QM6A 4IV8A 4UU0A 1BRTA 4HDQB 3T1OA 1I24A 2ID8A 1OROA 2HEIA 4GLFA 4KQGA 1JHZA 3S81A 3B9PA 3RUEA 1JEOA 1N6NA 4XB1A 1BKYA 4URHA 4NEHB 1AMOA 1P0CA 2J6BA 3EQ6A 4LNUA 2HT1A 2OK7A 3DLBA 4KUHA 2GBPA 3CCCA 2QTVA 2CZQA 5KYXB 3A31A 2FK7A 3QE2A 2PUJA 1BVUA 3PWZA 3AO0B 3ND6A 2A0XA 5ITWA 3QPCA 3VZRA 3IH5A 3H2JA 2NU9A 5JDIC 4O2AF 3F7TA 2XYHA 3NRCA 1UUFA 2FE1A 3KCQA 4RAQA 2ZBVA 4UCXA 1NL3A 1TJ4A 6NULA 4R68A 2IXBA 5BORA 4LE1A 4QPPA 3IAUA 3HL4A 4DC0A 4KRFA 2VQEB 2VWQA 1LVUA 2W2LD 4HN9A 2C88A 4LJ9A 1QQBA 5B7GA 5E2AA 2HCBA 4MCHA 3MWDA 1BH6A 1BMDA 4BQNA 2I2DA 4MTCA 4Q34A 2X9NA 3VHLB 2R84A 1XXHB 3RBVA 2HMWA 4JD5A 3ZZUA 4M6WB 4YMIA 2HMVA 5DBEX 2BF7A 4BQPA 2VPPA 3O4GA 4IPTA 4TM7A 2DM6A 3S0JA 3DMTA 3ZDRA 3ZNPA 4G81A 2DWUA 3T12A 2PKQP 4OVKA 2EWMA 1KO5A 2W4MA 1G5PA 1GIAA 2D3WA 3CNEA 2R9VA 2VDLB 1P81A 3HUEA 1HNZB 2ZM6B 4HAXA 5HF9A 3HRHA 3PEEA 5HKLA 3VGPA 1OTXA 1VL5A 1E59A 1IMOA 2KJQA 3LCMA 2UUBB 1FQOA 1VYHA 2B8WA 4KLNA 4CWAA 1DGQA 2P9YA 4YLYA 5DP1A 1JDUA 3WRXC 3MELA 4H2DA 2LCIA 1X7XA 2Z8YA 1I8TA 1O4VA 4YT2A 4FFPA 1FBNA 4MQFA 4KPEC 2I6TA 4G5OA 4H35A 4PLFA 1RAAA 1CUAA 3RVLA 1ZKDA 2AC7A 4G1MB 4G67A 3W6PA 2OG2A 3VAZA 1IOWA 2W6OA 4GR4A 3OLXA 3IT1A 4BO0A 3DWEX 1VGQA 3NU1A 1DTEA 1KA9H 2ZUCA 3RBAA 4DIUA 3RYCA 3UB3A 3TGPA 2B4KA 3L0BA 3TI9A 1J33A 4JJIA 4LPSA 3G68A 3KOZA 3T5CA 4YR9A 4FCWA 4EMSA 5JFOA 2RAPA 4YASA 2FNAA 1XKLA 4UNQA 1RXEA 2I7VA 1Q44A 2ACVA 3K0BA 2N1MA 4N8DA 3U62A 1DAKA 3K70C 4RHEA 4JP8A 3ED1A 3RIGA 2BDUA 3WYFA 3T5AA 3WTCA 5A62A 1KEZA 5IC4A 1SBTA 3LXXA 5I7RA 1OVMA 2C4NA 3ZU6A 3WLTA 2X8JB 5FRDA 3K0CA 4GOXA 1KDRA 1OUMA 3I6ZA 1V8BA 4BX2A 4MX8A 2JFPA 1G42A 2XCQA 2IHJA 2OQ2A 2YJNA 4K6KA 5HBGA 3CH7A 3FAZA 3TLXA 3V8NA 3AVVA 1KYZA 3I9LA 4UULA 4ACBA 4FHGA 4GHWA 4CW7A 1QRTA 2N9UA 2XZLA 4LXIA 2K2QB 3DOOA 2X23A 4HVTA 4DN6A 2JCGA 2CNDA 2NV6A 5FX2A 1NONA 1EUCB 4QBGB 4MAMA 4P80A 1L7OA 5D1HA 1C14A 1F0NA 3MWDB 3ROXA 1R5JA 4J16C 4IJVA 5F33A 3CUSA 1LPBB 3NASA 5F3RA 5CGZA 3AH8A 1KMHB 3IAEA 1C41A 1MJGM 3H8SA 1R6BX 1NW8A 3MWLA 4L8LA 4UMVA 4CLEA 5C1DA 2H7YA 2QM8A 1J0CA 1QOPB 1LWOA 2EJVA 3O5AA 4JLVA 4M54A 2DSNA 3K09C 2PFSA 3O1HB 4TQAA 3K94A 1Z0AA 2JAHA 1Q1EA 3QVWA 3QXXA 4AMGA 3A6PC 5ECDA 3ZY2A 3FPBA 4EY5A 4O2BB 1TO6A 4IINA 1QU2A 3WWYA 3PJFA 4GLLA 1A1SA 1D07A 1GFZA 2D2EA 5IXYA 4CDGA 5DVZA 5KYYA 1GPLA 1IZYA 1NN0A 3GUZA 1X7ZA 3KHTA 1LS6A 2Z8YM 3LQYA 1BEEA 2CLMB 4EJSA 2ZVDA 1GEGA 1V95A 1XRJA 5FPHA 2QORA 5HM8A 1G4HA 4HV4A 3AJAA 4E6EA 3EXFB 1X3LA 1QCDA 2GO7A 4N54A 3ZG6A 4KQMA 1K98A 4R01A 3L7NA 4IWYA 1M1YB 5F76A 3IPLA 4BMXA 5AIAA 5AW7A 1NT2A 2ZBUA 3F8WA 4JWTA 3CNHA 3ZDCA 1FW8A 2J31A 3OJ0A 4HDRA 1LPMA 4ARUA 4JBLA 3SICE 2GNOA 3KK0A 5C2JB 1ZOIA 3ONVA 4L08A 4OU4A 1RABA 2B7LA 2OVFA 4C9BA 3F0TA 5K0CA 3KKEA 4OHVA 1GQYA 1AQIA 4Q7MB 5FTMA 1D4AA 3GD5A 3N2KA 4DSAA 3I2HA 1T3LA 3PBKA 4MV4A 3ZD6A 1M2OA 3MHPA 4RCYA 2X0DA 4MO9A 1BXRA 3KEFA 4YUYA 2B7BA 4OTZA 2H0RA 3BXFA 1FMLA 4FLFA 4NF2A 3IOBA 3PUVA 4E1VA 1RM3A 4LTNA 5IH3A 4DB2A 1YQ9A 2W93A 1VP9A 2EARA 3RWBA 1OAOC 4K5QA 4JVLA 4AJJA 1Y5NA 3IP8A 4HCJA 1X7DA 1ZCFA 3HEMA 3GAMA 4HVAA 1BMTA 1Z35A 1UMCA 2PKEA 5CW1A 4AYXA 1NOJA 2QNIA 5KDLA 3A58B 4HNTA 4H3KB 3QJ5A 1E2IA 1M1NB 5EY5B 4JB8A 4RM2A 2HCRA 2PU5A 3ZWOA 4OA8A 4CHTA 5A7FA 5HJ7A 4HX5A 4BN5A 1HSZA 1ML3A 2Q1WA 3VSEA 4YS6A 3N2ZB 1FFXB 1PFYA 3HU2A 4Y8VA 2OB2A 2XSZD 4EX7A 4GGPA 3S1LA 5M5BA 5I9MA 3KWMA 4CTMA 1PWHA 1X7YA 1K8YB 1PVDA 2CLDX 4R84A 1MX5A 1KGDA 1F9AA 4DV4B 2HMUA 1T8WA 4U2KA 3TW0A 1Z28A 2PEYA 5KO2A 1KVQA 3L1IA 5FPPA 1KSFX 3FMGA 1LV7A 5CJPA 5JV5A 1ETHA 1DNPA 3F49S 5C5CA 3ELDA 1WS6A 3DZKA 3WNCA 3X2SA 2JLZA 3L0CA 3TE6A 4UCQA 5CTJA 3RV3A 2LNDA 1PGNA 4M1OA 4NCHA 2I80A 2Z98A 1YC5A 3LT1A 4M49A 2QPAA 1EVZA 2GZHA 1RQPA 2NN3C 3LOPA 1V5GA 3UCEA 1RI5A 5LQJA 2O54A 1BD3A 2G77B 3O9ZA 3DC7A 4ZOLF 4REQB 1IQPA 2ONZA 1MN6A 4BNVA 4Q3NA 4ZI7B 3OU6A 2QN8A 2YL2A 3CWCA 3GGCA 3SJBA 5LMCA 1I1HA 2QAJA 1DZ3A 3CLHA 1ZUIA 3AHJA 2ZTVA 4GOKA 4JENA 1NN5A 2TYSB 3VJRA 2IS2A 3X1WA 1D8AA 3I12A 3T5GA 2QTFA 1XRLA 4NPCA 3WNZA 1E1KA 5TEVA 1ICEA 4YP7A 3FHTA 4JVMA 4L8YA 2AGVA 2WD7A 3WMWA 1E8NA 3UUEA 1O87A 1B8PA 2SBTA 3D4LA 3ERCA 3PEUA 1OX5A 4PX5A 1SVWA 2VPXA 4N6OA 3STUA 2F8TA 2OSVA 1L7XA 2YC2C 1W4ZA 4KR6A 1QBGA 2NV2B 5HNKA 4L4ZA 1VHJA 3L8ZA 3E3MA 2YXBA 1POXA 4CTJA 5LC1A 4COKA 1ECFA 2FAXA 3ZHTA 3EDMA 3HXPA 2PPLA 4JC8A 5FULA 1G38A 3VH1A 1CNMA 4UREA 2IY8A 1SXJC 2FR8A 4XSHA 3W9SA 2CFSA 4P83A 4BQOA 4C07A 4KZPA 2WWYA 1OY1A 5FUXA 1IUKA 1FNSA 5AM0A 3L9WA 5TS2A 3TSAA 3UTDA 3PB3A 3DT6A 2ZTHA 4ZDKA 3VPGA 3FE2A 3KQVA 2O7NA 2BGWA 2Q5EA 3QWBA 3T0GA 4HWTA 4A82A 4V0RA 2OESA 3C3AA 1KZ4A 5BSMA 3NHUA 1FSGA 1K7YA 3T3PB 2PFGA 4G0ZA 2BFDA 4M21A 4ISBA 4X24A 4KQCA 2W2TA 4X1KB 3HFJA 5D3QA 4LECA 3ZC3A 3NGLA 3CRMA 1YGYA 2AJDA 2RGXA 2NO7A 3PTAA 4FS3A 3WKBA 2Z30A 4LDQA 3W7VA 2XOXA 4M8KA 3WGKA 1XFAA 1ZONA 3KZKA 5FBQB 5DLDA 4EHJA 1SVNA 4F5EA 2XIQA 3T34A 3UNXA 2FW8A 5KPDA 1USKA 1XBTA 3OZCA 4MUKA 1GZUA 3R24A 4YJ3A 3DBHB 1TK3A 1DV2A 2IEDA 3T7RA 3WL8A 1RWMA 2QD5A 5JSZA 1HRKA 2XX3A 2HSDA 3DWFA 4MDHA 4BE7B 4F9GA 3PL5A 1U8ZA 3FLAA 4PSKA 2D1RA 4CL2A 3HJHA 3JD4A 3IV9A 4OKIA 4B6GA 4Y3UA 1CEXA 1EM8A 1FS5A 1PFVA 2EXXA 5AK5A 5DYIA 3FUWA 4S24A 5EMJA 5BSKA 2BV3A 2HPZA 1J8FA 4KJZA 1N6HA 2B0CA 1NYRA 4BAGA 3THXB 3WIEA 3BPSA 2PS3A 3K3PA 4KNVA 1D1SA 2BJHA 5K3FB 1D7AA 1Z8HA 2FPIA 1S89A 3NH9A 3Q1LA 1NFRA 3ZGVA 5HFAA 2Z6AA 1RIIA 4E13A 4JB3A 1W6RA 3PFWO 5K3AA 1JRLA 1E18A 4PICA 4YR7A 1NBOA 1P74A 2PSSA 3ABOB 5EUBA 1D2HA 2FSFA 5AVJA 1U9IC 1E3LA 1ORIA 1PZGA 1IAQA 2Q9UA 3P2EA 4R7TA 4LPKA 5A5FA 1JFTA 1SZJG 4EL5A 4JL8A 4X8LA 4LK2A 4OI1A 5DN9A 2WWGA 4I1IA