3IIKA

The structure of hcinap-so4 complex at 1.95 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
molecule keywords Coilin-interacting nuclear ATPase protein
total genus 66
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iikA00
4UNNA 4HB4A 1TQ4A 2C77A 4C3ZA 4HAWA 1X8LA 1LF0A 2J0SA 1CR1A 1AGRA 3QXJA 1QBKC 5J4KA 2E9SA 4IHQA 3LLUA 5GJVC 3QPWA 3Q7PA 4XTCS 1KO8A 2JDID 4LJAA 1QG2A 3AVOA 4WZAE 4PHFA 2Q9BA 4XJXA 2R9VA 3M4YA 2QZ4A 4X8HA 2OXRA 2EFHB 3ECCA 4ZIRA 2DHRA 5L3VA 3FB4A 2D7CA 5DI3A 5AR1A 2BDTA 5B2ZA 4UXHA 2YHSA 1HA3A 1RVDA 3C41J 3GLIB 2DY1A 1S1MA 1E1RA 2O8BB 3F3YA 3C14C 5IHPA 2CXXA 3ZH9B 3ETLA 2C95A 2ZE8A 5FOVA 1CJVC 1S3SA 2ZI9A 1W2HA 4FIDA 4JVSB 4LHYA 1G3MA 5SZHB 2FSIA 1M7BA 4HLUC 4PQYA 3W90A 5JRZA 5CLQA 2EFDB 3AVVA 2W83A 1M34E 4RZ2A 4A4DA 2H8KA 3CRMA 4M21A 4PANA 4KFRA 4B75A 1IAQA 1DAEA 3X1DA 1Q44A 2WMNB 3K9NA 1VHLA 2H18A 3EZFA 4DUGA 1DTSA 5CM9C 1TUIA 2BWJA 5LB2A 3U3JA 4RCZA 1KDRA 1G41A 1MH1A 1NVXQ 5BQ5A 4TLEA 3UKDA 4DSUA 1YQTA 4CDGA 5F9HA 2GCPA 4FXPA 4KYUA 4AKGA 3BFKA 1HE8B 3BOSA 3KKPA 3Q5EA 4QC2A 3SDZA 1NBMA 3KZ1E 1KYIA 4KU4A 4XSGA 4Q9LA 3SN6A 1II8B 2HV8A 4B6EA 3VR5A 3UWKA 3TIFA 4KAXA 1VKJA 1S96A 1OHHA 2RGNA 5FL7D 3QUSA 2B6HA 2GK6A 4BWYA 1ZMXA 4PC1A 4N1AA 2NOAA 4B3GA 2ZUDA 1NIJA 2IYQA 3ASYA 3K8YA 2BVNA 3T1OA 2GVZC 3PUXA 2OFXA 4GSYA 2QENA 1Z0IA 2OLKA 3AGPA 3WHKA 4DLXA 3W8RA 1P4SA 5JEDA 4GOXA 1BH2A 2PCJA 3WYGA 4JLDA 4DUGD 2QU8A 1Q1BA 4IRUB 2G77B 2MSEB 2ZRLA 4KFUA 5D3QA 4L4UA 3L82B 2CDNA 3WP1B 1IY2A 3AVTA 1SKQA 4H1UA 4F7WA 3FE2A 4CEJA 3BRWD 1G7SA 1TL7C 4R98A 1GIAA 1S3GA 5GJCA 1IXSB 1XFAA 1YZGA 3MCAA 1JAIA 3AF1A 1ZNWA 2GZAA 3KJGA 3IPYA 3B1XA 5A0FA 4AC9A 4B47A 1ZNXA 1KO1A 2DFLA 4TZ6A 2ZSFA 1JALA 2Z6VA 2NO6A 5KNDA 2OE2A 1GDDA 3W5JA 2WPDD 4ZIRB 1UBEA 3F5FA 2WHXA 5JS8A 3U7HB 4LDJA 1CLUA 2MSCB 1NJGA 2IXFA 1P5ZB 4TWZA 1OJLA 2AR7A 2FFAA 5EXTA 3T34A 1EFUA 1TQ6A 1T4GA 1BOFA 4JKYA 3LDAA 4IOMA 3UATA 3AVYA 3BB4A 4EPVA 1BS1A 1A1VA 1GG2A 2V6JA 1JXMA 1MR3F 2D4HA 3AH8A 4EJSB 3P4YA 2VLIA 1OSNA 4QL3A 4RKEA 4EPTA 1N6IA 4KO8A 2AFIE 2D7DA 4Q4JB 4RVCA 5EXPA 3MWYW 4LZZA 3AV0B 4BLRA 2RGBA 5B30A 2XTNA 1KI7A 4L9WA 1MT0A 2HDNB 4KODA 4LYHA 4NYJQ 4PO9A 5P21A 4B33A 1M7GA 1KHTA 4OQNA 1EFHA 5KSPA 3PG5A 5EUQB 2XNDA 2ECKA 2ZJBA 3TK1A 3QXSA 4MKHA 1QHGA 2OEPA 3ZQJA 3TR0A 1N6LA 4BFTA 3U61B 2WJYA 4H9GA 4JLMA 1VTKA 1SVMA 1W48A 1YZNA 2FFQA 1D9XA 2J41A 4AYXA 4CEHA 1YRAA 1T8TA 1Z6TA 2FPKA 4L5BA 1TQDA 2RH5A 3JVVA 3CUEF 2EFGA 1FX0A 5F2EA 1Z2AA 2IYLD 4FI3C 3KXLA 3SU8A 2I1QA 1W5SA 4ASUA 2XZLA 4LHWA 3A1WA 1E9AA 3B85A 3FKSA 4IVPA 4Y0VA 2A5YB 3R8CA 2CK3D 4C0AC 3GLFA 3GLGB 4PSVA 4QJ5A 1W2GA 2GJSA 5HR5A 1JJVA 5FPHA 4ON9A 1OLOA 2FDCA 4TMWA 1FNMA 2ZJZA 1N3BA 1UM8A 1HT1E 1N5LA 3PCRB 4AK9A 1XD2A 2RGXA 3LY5A 3NHAA 3UXMA 3GLIA 5JI2E 3U44A 1E9RA 2PEYA 4PO1A 4NCKA 1CULC 4GMDA 1SXJA 1EFRD 2OESA 3PUVA 2IXGA 1O87A 2O0JA 2UZIR 1DAIA 1DBSA 1QF9A 4C9BA 4DDWA 5FFMA 4OI0A 1UDXA 3LH5A 1XZQA 1L4YA 3J81k 2CEAA 2IEZA 3BD9A 3CPEA 4TTQA 3BERA 3UMFA 1BO6A 2YJTD 3QY0A 4DIDA 3WXMA 1ESNA 2NO1A 3TQCA 3WBJA 3OZXA 1DAMA 2V9PA 1YRBA 4TLAA 1E3MA 2ANCA 4IOLA 4JBYA 2ZSDA 2JASA 3AB3A 4B3XA 2YKGA 3SC3A 1TF2A 1X8KA 1N5KA 2QNRA 4MITA 2FGJA 4HZUA 3THXA 1XMIA 2JLSA 1D2NA 5FUXA 3ZVMA 1IY0A 3U6KA 4QXAA 4TZ0A 1JR3E 5KDDA 4I1UA 1OIVA 1OXUA 4DCNA 2AX4A 4S35A 2OT3B 5JJKA 3HPRA 1AZSC 4IKEA 1OE0A 2OCAA 2YINC 1R8QA 4MUBA 4OQMA 5HTKA 5JFGA 4QGFA 1XTIA 1KSGA 4JLJA 3MJHA 2X8AA 3F8TA 1HY3A 3OEHD 3KQNA 2YZ2A 1XJ0A 2ZI6A 2J46A 4A8JC 4W9MC 2WBLC 3EIQA 2W2VA 5BXQC 2QUZA 3WMFA 3EZ2A 3AF0A 3RC8A 1XEWX 1J7KA 4US0R 1OFTA 3I72A 3AVQA 3A36A 1XD8A 1W4BA 1IN5A 1R2QA 3QQ5A 1E1RD 2F9LA 3ICEA 1S9DA 4IOKA 5CK4A 5EP2A 5AJXA 3NDPA 4EAQA 3B5JA 2J0QA 4IEIA 3W5IA 2G0TA 3A4LA 2XTMA 3TUZC 4FMBB 2KBEA 4BECA 3L8YA 1WXQA 2O8EA 2F9MA 1E9DA 3QNUA 3AKCA 1KO7A 2P6NA 5JSZB 1U8ZA 3RS0A 2FPMA 4GP7A 3SNHA 1OPXA 2F1IA 2GESA 2BBWA 1E9EA 1OW3B 2IL1A 3K09C 5AJWA 2IXEA 1Z0AA 3NIBA 1L2TA 4MKGA 2R6FA 1WBBA 4B3CA 1E0SA 4FCTA 2N1BA 5EZ6B 2QG6A 2JA1A 2JLZA 3U4QB 1W4AA 2IW3A 2XSZA 2QE7D 4IFEA 5EQTA 1XRJA 2C98A 1SGWA 1W36D 4IW3B 1KI9A 1US8A 1E9BA 2F43A 4HDOB 2ZQ5A 1VCIA 2A5JA 1AM4D 4RD0A 1U9IA 4KCGA 5DE3A 1GRRA 4MGIR 3AM1A 1M6NA 3RS3A 4ERNA 3EPLA 1G8HA 2WIBA 4BLTA 2Q3MA 4PHGA 3TMKA 4PZLA 2PT7A 2JCSA 4WAUA 2WV9A 1PV4A 2KB0A 3GJ7A 1Y63A 1DADA 5L3RA 5DNYB 1TNDA 5BN3A 1FL9A 3N2EA 4G5OA 1P61B 5G3YA 3U3KA 4TYWA 4WZ6A 4DLTA 2BBOA 2QP4A 4TYPA 3B7GA 5CDFA 1JB1A 3I62A 2PEZA 2DWPA 2OCBA 1RPZA 4TQUS 1HUQA 1OHHD 2J59A 4LGMA 1E2QA 2OCPA 2BM0A 1TEXA 2FSFA 4M1WA 1GKYA 2WTUA 3K0FA 4RJLA 5A5GA 1LF5A 4YMWA 2GHIA 5E4FA 4XVUA 5M04A 4O2RA 3I92A 2DBYA 3Q3JB 4DLRA 5TDHA 2A5DA 1OH5A 2FEMA 1R5NA 4YONB 1P2UA 2C9CA 4QHTA 2ZJAA 2B8TA 2ODNA 3GJ3A 1HTWA 1QHIA 2R6DA 4NHOA 1XPRA 2V1UA 4US1R 2IWRA 3RRNA 1NNEA 1WB9A 4F4CA 3EAQA 2DFKB 3CX7A 4HLCA 4WBSA 4DB2A 2FPLA 5CB8A 3C5HA 5LPNA 5EE3A 2P2LA 1E2GA 2BMDA 5JCZA 2QT0A 2WJVA 2QM8A 2ZREA 2BBSA 3B13B 1B0UA 2VYFA 1MRNA 2Z0MA 1IJFA 4JL8A 1Q3HA 1XEFA 3FHOA 2QT1A 1ZC4A 3R9WA 1NVWQ 2Z4RA 3NHBA 4PXAA 2AFHE 4EPYA 1P75A 3B1VA 1WBDA 4URZR 5FOWA 3CBQA 5C18A 3TRFA 3RWMB 2JIZA 2GCOB 1H65A 1DO0A 4HAUA 4EFNA 2A5FA 1FP7A 3A4MA 2N42A 4CGZA 1AJEA 4GOKA 2FN4A 4UNQA 3T5GA 3OIVA 5FI0B 4F38A 2ZU0C 1ZM2A 1NY6A 1DAFA 1LTQA 3PV0A 4ITRC 2DPXA 3GEIA 5E95A 3SOPA 1I4DD 4ZKEA 5KYKA 3RHFA 2ZRDA 2O8FB 5H1YA 3THXB 2AD1A 1FQJA 3LXRA 4TT3D 3W6NA 1RYHA 4NH0A 1AQYA 2IA5A 5EXXA 5HCNA 3X2SA 4D4KA 3THWA 5DN6D 3RS7A 1U0LA 1OKKD 1XB2A 2EU8A 2QORA 2XOKA 4QFMA 4DSOA 5C4MA 5JEEA 1ZW6A 1QHSA 2AHOA 2Y8EA 4TT3A 1E99A 4PAOA 5DIFA 1NLYA 1YHNA 4DKXA 2O8CA 1GNQA 2PZGA 4AKHA 1SHZA 2ZRIA 2SHKA 1AIPA 1I4TD 3QJYA 1R5BA 1II0A 3NBYC 2QMEA 3ADDA 2C8VA 2ZROA 2HJGA 3K9LA 4TQAA 821PA 3BH7A 5G41A 2ZYVX 1G19A 1X1SA 4HYYA 4JYBA 1G3UA 3RSOA 1OH6A 4LJ5A 3G5UA 3FMOB 5FL3A 1VHTA 2W2TA 1MV5A 1HV8A 1XTKA 3Q5DA 4LBVA 4LSGA 4CVNA 1KKLA 3G0HA 3W6PA 3NG1A 3ICQB 5GJBA 1IN7A 4Q66C 1OKKA 1SVIA 2CVHA 5KSOA 5FTJA 5H68A 4E09A 3W9YA 2ZRGA 4JLVA 3SJCA 2D62A 4TL8A 4HAYA 4QKQA 4O25A 3JVUA 2OHFA 3QBTA 1F3OA 2R2AA 3E5HA 4QBIA 1NSFA 1MO6A 5F98A 3GJ4A 1ZAKA 4NPHA 4Q9HA 1ZBDA 2CHVA 2KJQA 3W6OA 1VCMA 2GTPA 4B2IA 3GPLA 2Q6TA 2ODWA 1UKZA 2K5UA 3FMFA 4WXPA 4IXMA 1GRQA 5FOTA 1DAHA 3LV8A 2UZ3A 1VDZA 1KKMA 3AF2A 3D3QA 1G8PA 2VA8A 5JRJA 8OHMA 1T3LA 3NH6A 2YOHA 4D4MA 2WIAA 1G291 5AJZA 2LWIA 4C2TA 1XCMA 1O3YA 4TMTA 1ZD8A 3IO5A 2XXAA 5TXGA 2JJ2D 2VSFA 3L0IB 2D2EA 2HUPA 1AKEA 3FPAA 1XPUA 1G5TA 1J70A 1G4UR 1CS4C 2A3RA 1SVLA 2EWWA 1C9KA 4QHSA 1XTQA 2H5EA 3DOFA 1E96A 4G5QA 5AWFC 3U6BA 3EPKA 3UK6A 1Z22A 4NONA 5JECA 3K0CC 421PA 3T1VA 3R7WB 3K1JA 2HCJB 2J1LA 4GP6A 5L8VA 3CRQA 3EXAA 1Z47A 5FPKA 4DDTA 1SZPA 4GRAA 3REGA 2F1JA 3CLVA 2IS6A 4Q4AA 3LFUA 4Q7MB 1MO5A 4N3NA 1XTJA 1S0UA 1CEEA 2A2ZA 1OIWA 2AKAB 2QA5A 1CBUA 2H7VA 1VECA 1SVOA 2NTYC 1SVSA 3LRPA 4TSFA 3VR2A 1NVVQ 4G5RA 1EGAA 2QQEA 2OAQ1 3HR7A 5JCPA 2F3RA 2MMCA 3LNCA 1XJCA 4AKEA 1G64A 2VP4A 3CNOA 1R0WA 2ODEA 2BEJA 4U7DA 2WJHA 4EQ6A 3CONA 1K6MA 3RAPR 4IDPA 2GF0A 1AQUA 1RZ3A 4JKIA 4MYHA 4A9AA 3R9IA 3T1QA 3QOFA 4URVR 3RS4A 4PTLA 4M1YA 3WYAA 1DOAA 4BEJA 1FMLA 1U90A 2JLQA 5FPSA 5E7MA 4ESVA 2EVWX 2GETA 1LVGA 2IYWA 4U00A 2W6JA 5EP1A 4HSEA 2OILA 4C4PA 4TYYA 1JPNA 1ZU4A 1LY1A 2BMEA 3OE7A 1SULA 3X1XA 3LO5A 2KSQA 3P4XA 2CJWB 1KY3A 2CL0X 3VTKA 1WCV1 3QEJA 4KVGA 3VMFA 4BFXA 1RJ9B 3TKLA 1KI6B 5KNBA 4MRSA 1X3SA 2ORWA 2ZJOA 3OFNA 3SYLA 2RGNC 4XWKA 1OV4A 1OYWA 1W49A 2OZEA 4RD1A 3PQCA 5C1BA 3I5XA 2ZE7A 4OI2A 2WWHA 221PA 5J4LA 4C7OB 2ZANA 2ZI7A 3QIAA 1GL9B 4NCNA 5EP4A 4ZDWA 1ZCBA 3K0AA 2FZLA 3KB1A 3ND8A 2IYRA 4HAXA 4PFSA 5E7JA 3TSOA 1OXTA 4Q19A 3CF2A 4X8LA 1MOZA 4JYCA 3CWQA 4TN1A 1RRCA 3TVTA 2VL7A 4QHYA 3ZD7A 2NPFA 1VG0B 3AUYA 2W58A 4ZCLA 3MWJA 4GOJA 1IN8A 4ARZB 3CNLA 3D6TB 3BC1A 1GKIA 4K8OA 3LW7A 2JLWA 3SJZA 1J99A 3QI2A 3QVUA 4WOPA 3A1VA 4R2HA 5EP3A 4PC3A 1M8PA 3ASZA 4NMMA 4TLCA 1DG1G 2CHQA 2FX3A 1NVUQ 3AVWA 2W2XA 1E94E 5AUOB 1MABA 3GLGA 1N6PA 2NZJA 3U3RA 4KBFA 2AKYA 3PVSA 4BUJA 3QF4B 2BMFA 1Q0UA 1UKYA 1AN0A 4OHWA 3THOA 1X86B 1Z07A 3MLEA 1CJTC 1C1YA 1N0WA 3ZYCA 4KBGA 5CK5A 5LBIA 4HLQB 3A8TA 1R10A 4KI0A 4I81A 1UKVY 4BZPA 4B3FX 3SBDA 5BW8A 2IYTA 2Q21A 4JMPA 3KX2A 4B48A 2FH5B 2ZRPA 2IUUA 2GCNA 1XEXA 1GZSA 1E69A 2AK2A 2ZUBA 1AS3A 1Q12A 1XCPA 2P67A 1W0JD 4ZI2A 1E0AA 3T06B 4OHZA 2QAGC 4LYAA 3U7GA 2B7BA 2ZTSA 4Z8XA 2QTHA 3H1TA 2LKDA 1ZD1A 1J2JA 4LRWA 3WMGA 3K53A 1CRPA 1IBRA 4A8JA 1Q1QA 4MYTA 4FCVA 3W34A 1GUAA 121PA 3OF5A 4Q7LA 3AEZA 5FBRB 4A1FA 2J3EA 2ZIAA 1RIFA 2REBA 3GLHE 3R9XA 5FOUA 4YXWA 4HAVA 2R62A 4P4TA 1E79D 4IXNA 4TL7A 3L8ZA 3MD0A 4LYJA 3WBKA 3U3MA 1BKDR 4BGDA 3MAAC 1NRJB 1T0HB 3GJ6A 3PFIA 5FUVA 1UPTA 1E2HA 1RYFA 3NTUA 4LK2A 1Z0KA 1X1RA 4L8GA 4DT1A 2C2HA 2IF2A 3L0PA 3GEEA 1CF4A 4DLWA 3OIUA 2VTKA 3N5CA 2CE7A 3KKQA 1BYIA 1QRAA 2CK3A 1CJUC 2ZS9A 1VCNA 1Z08A 3TQFA 2XB4A 4R2IA 1DS6A 2V7QA 2XAUA 3K0AB 1EFTA 2Q9CA 3QKRB 4MYCA 1E2MA 5HZHA 1U9IC 4LCBA 2FWRA 5FTNA 1LB1B 4OJKA 4D80A 1SQ5A 4N0EA 2CNWD 3IUYA 4NYMR 4QNMA 3Q85A 3BBPA 3PITA 4QJ3A 4CYMA 2LCFA 3NXSA 4YMSA 2KE5A 4BLQA 1XXHE 1E1QA 2CNWA 1YJ5A 4RD4A 2PBRA 1GTVA 2PX0A 4XD7A 2O8EB 1ZUHA 1T3SA 1OYYA 3D8BA 3FMIA 2C5LA 2H92A 2ZYUX 4JLBA 3WY9A 5F3WB 1R4AA 5K8LA 5DO9A 2IHYA 4MH0R 4NYIQ 4DHEA 1PUJA 1U8AA 4KSBA 5KUTA 2ZITA 1L4UA 4C30A 3FYHA 3M6AA 2AK3A 3EA5A 4IJMA 2IS2A 1XMVA 4ACAA 4QGAA 5A4JA 2ATXA 5FOXA 2HF8A 3T61A 1Z29A 1ZM7A 5JBQA 1N6RA 1CU1A 2ZAMA 3TNFA 3RRYA 2P6UA 1N0VC 2QE7A 2VBCA 2XSZD 1MKYA 4FWIB 5J47A 1NG1A 2HLDA 3CRVA 3CPJB 2ODBA 3CR7A 1YR9A 2LKCA 2IYZA 3HJNA 1MO4A 1P60A 1FQKA 2GBLC 5DHAA 1E9CA 3UMRA 5TV2A 3I1FA 5FI1B 4CZ2A 2NGRA 1T8UA 3LXXA 3CW2A 4XD7D 3BGWA 3EZ7A 3VR3A 5LB4A 4BQSA 4ZV4A 3LD9A 4QM7A 2Z43A 1Z0JA 4NBSA 5JWRA 2QBYB 3ZS9A 3IQWA 1G1MA 2ANBA 1YZLA 1VYTA 2FA9A 4IDOA 4C0JA 1G7TA 2J45A 3VFDA 5IK2A 2OXCA 3DOEA 1N6KA 2CE2X 3C16C 2XZPA 3NEJA 1ZUIA 3CPHA 4YMVA 4PC7A 4CRWB 3KTAA 3RDPA 1KO4A 1W36C 1HQYE 1P73A 1JXOA 5K8UA 3BXZA 4A0FA 1A4RA 3AP2A 1E2EA 1ZP6A 1PLLA 4FMCB 1TADA 1NLZA 2YOGA 4O2LA 1OH8A 4Q4HA 4HUQB 1NMXA 1XPOA 2HT1A 2CLSA 4S2EA 1DEKA 2WWFA 4DSTA 5G3ZA 2H16A 4TTPA 2AL7A 2IC5A 3OEHA 5CYOA 3VHLB 1MABB 3PEUA 5C46F 4DXAA 2BCGY 3U2QA 2GWHA 4XOIA 2JATA 1D9ZA 1CKEA 1E79A 1NN1A 3QF4A 1JECA 1KNQA 1Q21A 1NI3A 1A5TA 1AS0A 5JZVA 2ZXUA 4GZLA 1WQ1R 5H70A 2IT1A 3DMNA 1UBGA 1GILA 3FVQA 3TGPA 3QG5A 2QY9A 1EFCA 4ASUD 2XITA 4DIEA 1NKTA 4QGGA 4URXR 2A78A 2B7CA 3QKSB 3B6EA 4CT4B 5SZJA 4DLSA 4P0TA 4DWJA 3T1TA 2JJ8A 1P3JA 1TEVA 3MWLA 2CL7X 2QP3A 4PPQA 4DCUA 3P1JA 1E2NA 2WJIA 3CB4A 1R0ZA 4G0NA 5ELXA 2VP5A 4PX9A 2JEOA 3KXIA 1EESA 1CJMA 3TUJC 3DZDA 2QPAA 1PVOA 3NDBB 1G4AE 5FPTA 4CF7A 1GKUB 4TL6A 3GLFE 4F91B 1I2MA 1GAJA 4B32A 3L43A 3CX8A 3GQBA 4N0DA 4PZYA 3IO3A 3SEAA 2YC4C 4DRZA 2CLDX 3TE6A 1W7AA 3NBZC 4M9QA 2BCJQ 2OSBA 3DPUA 3GJ0A 2G88A 1F2UA 4HDQB 5KPDA 2VRWA 5IK2D 2BC9A 1W1WA 3QXHA 2VHUA 1W36B 3Q9LA 1RRPA 4GDFA 3N2IA 3H86A 1VMAA 4JVNA 4V0NA 5GJWC 4DT1B 1R6BX 1AA9A 1UEJA 4MRRA 1RC8A 3CF6R 3MG9A 4RSGA 4GPTA 2VQSA 5EE0A 2IYXA 3SJAA 2IS1A 3K9GA 1K8RA 4JVLA 2RHDA 3PEYA 5GADl 2RGGA 2EW1A 4OYHA 1PLJA 2FSHA 2VSOA 5FBWB 4NE2A 4DLZA 4E03A 3EW9A 4LYFA 1OB2A 4LV5B 4V02A 1NSTA 1XMSA 2GAAA 2YNMA 4TYNA 2VH5R 2ZJ2A 4A0RA 1N6HA 2ZUCA 1TQ2A 4TYQA 3A58B 1QVAA 4V03A 3TLXA 1G3RA 1NN0A 1S4QA 3BORA 5J5CA 2V7QD 5FBVB 3FMPB 4RD3A 1XD9A 1F6BA 3UIEA 1I4LD 3PUYA 1KJYA 1HEIA 4OK3A 5KDLA 3P27A 4QBHA 2CBZA 3SYNA 3U3OA 4B34A 3CIOA 4MYUA 3U7EB 3A1TA 3I73A 3DL0A 3GLFB 721PA 3IILA 3BJIC 3C15C 3OE7D 2PL3A 3PENA 3Q7QA 3ADBA 1G8YA 1X6VA 2PLFA 1EX7A 2H57A 1XTSA 1YKSA 3I32A 4G01B 2W6IA 4UJ3A 1KAOA 3HR8A 1XXHB 1XTRA 1B23P 4FD2A 4HI0E 4P32A 4DDUA 3VR4A 3HPQA 1GL6A 4HZUB 2G1JA 2JJ2A 4B3DA 4Z51A 2RAPA 2P5SA 1E4VA 2GVDC 4D0NA 1ELOA 3BB1A 2NG1A 2QP9X 1S9HA 2WVJA 1ZM9A 2VP0A 3KL4A 4KFTA 4BFVA 4MDEA 1VPLA 2RHMA 3SHWA 2QEQA 3C5CA 2CJWA 3CX6A 4B71A 2PMKA 4KITB 1VIYA 2AWNA 3LBIA 1G5PA 1Z0FA 1JNYA 1GNPA 3UG6A 1F48A 3B9PA 4BLSA 3FHTA 3K09A 3B60A 1UKEA 3VKHA 1S8FA 3OAAA 5JJIA 3ZD6A 3QSYA 1HH4A 1JI0A 3IEVA 1JPJA 2VSXA 3RRMA 3DVLA 4Q02A 3VHXA 4OHYA 4P3YA 1G8FA 2ONKA 3SFZA 2ZS7A 1U0JA 4YMUA 3RS2A 2OV2A 5UKDA 1KO5A 2OBNA 1SXJE 1F2UB 3KDSE 4US2R 2HCBA 1JR3D 4MGKR 3HU2A 3MJRA 4LC1A 1E2IA 3CM0A 1I2DA 5IT5A 1FW6A 4M9XA 2P3SA 1D2EA 4Z1MD 4EFLA 1EX6A 1OFUX 2XTZA 4LJ7A 3CWZA 2D06A 3TR5A 1ZM3A 4A0HA 4P4SA 4D4LA 4WXRA 1E2JA 3EZ6A 5F9FA 2PLRA 1KIMA 2KI5A 2C9YA 5IF9A 4O3MA 1H8ED 3KUCA 5J40A 4EFMA 2V6IA 3A37A 2VO1A 1Q20A 2D3WA 4HLUA 4QOSA 1Z63A 2JLVA 1KI1A 1EG7A 1GL7A 2QQ0A 4RD6A 1MO3A 2ZI4A 4KXFB 2OFOA 2VF8A 3AKYA 2TMKA 3TSWA 3K70D 3ZS8A 1OXVA 3D31A 2O8BA 4MGYR 5K8TA 4A15A 4XVQA 1S1CA 1N2CE 5FUWA 1G6OA 2L0XA 5EE1A 5JHHB 2BJWA 4M1KA 2BM1A 3U7FB 2FG5A 4CEJB 2FMXA 3L0SA 1QHNA 4GL2A 4W5WA 2PMDA 1RJ9A 1JJ7A 2D74A 2A7QA 2DWOA 4LX0A 4HB2A 4ESHA 1J8MF 3BB3A 2X77A 3ZDQA 1U81A 4C0BA 4JLNA 5TB5A 3PUZA 3E70C 1KJZA 4CW7A 2O8DB 2OCYC 2EQBA 2ZYTX 3KQHA 4C7OA 2ZM5A 3FTQA 3GD7A 1W47A 1M1YE 4LHXA 4BE7B 4KYIB 2R65A 1KTVA 3PEWA 3DM5A 3MSXA 4NL4H 2WOJA 3AGQA 1S2MA 4MRNA 4UNPA 1Q1ZA 3BH0A 2P6RA 4A36A 1BYUA 3TVDA 3I5YA 2IUSA 4AI6A 4DCVA 2ZJ8A 4IDHA 4F4IA 2Z5FA 4NZYA 2WWWA 3AVPA 4LI0A 2X1VA 4DDVA 3BS4A 2JDIA 1W0KD 5BYKA 4V0LA 1XP8A 3TW4A 4UXJA 1M74A 4QJ4A 1E2DA 1RRGA 2J0VA 1YZUA 3HDTA 4P4UA 3KB2A 2Z83A 4C0QC 1T0JB 4OI1A 4LJ9A 4A6XA 5D3MA 2QMHA 3WRXC 3JZAA 1GM5A 4RZ3A 4Q18A 4UKDA 1COWD 1DE0A 4D2IA 2F6RA 1N6OA 4DCTA 4Q1CA 1T6NA 4PZZA 4DLUA 4DBLC 2WSMA 4ZCMA 1R0YA 3WNBA 4LBZA 1IXRC 3THYB 2JIZD 3LLMA 1G20E 3H4MA 4JT4A 3KJEA 2VP6A 5CIQA 3SHFA 1ZIOA 1TTTA 5HKKD 1NL3A 3EC1A 2PZEA 1KDOA 3KFXA 3OESA 3X1ZA 3IEUA 2NO7A 3ADCA 3RABA 3EARA 3FGNA 4I1VA 1P9NA 1XXHA 2CVFA 4UQOA 3B9QA 2CCKA 1U8YA 3BWDD 2HXSA 3REFA 2KWIA 5DHFA 1UF9A 5IDVA 4MKIA 5KTYA 4LJ6A 1DELA 5DH9A 1NIPA 2ATVA 2A9KA 3THWB 1E0KA 1ZINA 4B44A 4G5SA 2ZVQX 1KSHA 2RGEA 1N0UA 3B2EA 4B35A 4AWXA 2WJGA 4JSTA 2ZRMA 3K70C 1P2TA 1YZQA 2G0NA 2GCOA 2GXQA 3NC1C 1ONBA 1XEWY 2Q9AA 2WAXA 1W46A 4AYTA 2HYIC 2WAYA 1A2KC 3VNVA 2QBYA 3AUXA 2VF7A 2FSGA 2J7PD 2GJ8A 3B1YA 2FFHA 3QXXA 2ZJYA 2WWYA 1IN6A 4DJTA 3DKPA 4Z54A 1E2LA 1NN5A 2J87A 2W6ID 5EJEA 4AIIA 2X19A 2QM7A 5AUQA 2EWVA 5SZKB 1W44A 2VHCA 5KSZA 4FWTA 4JT2A 2XXAB 2OLJA 4RKFA 4BFYA 1G6HA 2B92A 1YZTA 4HEJA 3ZZ0A 3RC3A 1U98A 1BIFA 2NPIA 4UNRA 3VQTA 2JLXA 4I1SA 2J0UA 2DB3A 4JBWA 5E7IA 1NF3A 1UFQA 3EIEA 3H84A 3OEEA 2QAGA 4LHVA 3ZVNA 3GLHB 1XZPA 1OFHA 2GZDA 1QHHA 621PA 2FF7A 1P2VA 1G3QA 4PSAA 1RW4A 5TY0A 2O0KA 3S1AB 3K70B 2GXSA 1F2TB 1ZD9A 3FOZA 4TMKA 1IHUA 1XD2B 5TVKA 2REOA 1GSIA 2XOKD 3D7MA 1XJQA 3A1UA 1Z06A 2YWEA 3EASA 4D6PA 1P6XA 3BFVA 1SXJB 4BPBA 1KK1A 5CLLA 3VKWA 2F3TA 1Z2CA 5DSZA 2WZQA 1T5IA 2BBTA 4HUTA 5CIWA 3PJRA 3ZJYA 2RGDA 1CRQA 1CR0A 1LFDB 4PAMA 3ZVLA 1W4CA 2OG2A 4R9UC 3LWNA 4YDSA 4JL5A 1U2RA 2WSSA 1DAKA 2PJRA 2QRZA 2VEDA 4KFSA 1TUEA 3ZVRA 4Q48A 3CF0A 2DYKA 3X1WA 4E5UA 3KQUA 1WMSA 4RZUA 3PEVA 4WVFA 1JR3A 2ZS8A 4TLBA 4M1TA 3ZIAA 2VHQA 4Z1MA 1A7JA 5IRCD 4EJSC 3ZZTA 5HZKA 2B8WA 4I1OA 4LOAA 3PUWA 4LY6A 2RKOA 3KJHA 1SXJD 2WKPA 5E3HA 3AVXA 2REXB 2BV3A 2GKSA 4A2QA 1K5DA 1US8B 3CR8A 3CH4B 4PQRA 1LS1A 3KFVA 3EIHA 1JQLB 4OHVA 4TSFD 3W8NA 4BLPA 4QM6A 1KZGB 1COWA 2Z4SA 4TMXA 4EQ6B 4LPSA 3QG1A 3RVBA 1FZQA 4UXIA 4WZBE 2HYDA 4URYR 3E2IA 2V8OA 4YC7A 2ZI3A 4MKFA 1QG4A 3W3AA 1U94A 1TF7A 5DI3B 4BZQA 1Z3IX 4BASA 4MRPA 5C2JB 3QPVA 1VCOA 3SJBA 1KI4A 3IBGA 5TMPA 4L16A 2V55B 2WWXA 2ORIA 2A30A 1UBFA 3BK7A 5LD2B 2QPTA 4LBYA 3FKQA 3LX5A 2JLUA 3EX7C 4CIDA 2QTVB 1HE1C 1LV7A 3BIFA 1T9HA 5DI9A 5DISB 4J0QA 1KI3A 5TARA 5JSZA 1FPMA 1ETUA 4M1OA 3UPUA 5AUPB 4L9SA 4NYJR 1QHHB 2ZYWX 1KAGA 4ABYA 1F5NA 2ZRJA 1RFLA 2GF9A 4A2PA 1EFRA 3C8UA 4KLZA 1IOZA 1F2TA 4FW9A 1CR4A 2P65A 1T91A 5FH9A 1JQJC 1XDBA 1E0JA 4M0LA 1KK0A 3X1YA 4AY2A 3SI7A 3H2YA 1G21E 1NMZA 5SZIA 2FE4A 1UADA 1SKYE 2EYUA 3NVAA 4DSNA 5B58C 1JEDA 1G17A 2JJ1A 3SQXA 3RANA 3RSLA 3W3ZB 3GFPA 4NDZA 5ANRB 1DG3A 3CNNA 4NU0A 2QRNA 3MMPA 5FR1A 1Y3AA 3B8HA 1SHKA 4YLGA 3WNCA 2I1VB 1G18A 2QSZA 3Q72A 2VP2A 2WWIA 5J4YA 1FNNA 4RY2A 2W00A 1EWQA 2HXYA 4ZO4A 4Y0AA 3WYFA 4P33A 3GMTA 1KI2A 1UJ2A 2XNSA 1FTNA 2ZAOA 4LWZA 2QMUA 1IN4A 2A5GA 3IIMA 4DC9A 3NBXX 3M1IA 1PLKA 1WDTA 1TAGA 2WOOA 3LVQE 1QDEA 4FMDB 2R6AA 3I4LA 5LD2C 4A92A 1AZTA 2R6CA 2ZRNA 1HT2E 3RWOA 3VAAA 4CT5A 2Q3FA 4F4JA 1VG9B 1M2OB 2YWGA 1GP2A 3WNDA 4AG6A 4HB3A 5GVSA 3IBYA 4RCYA 4PC6A 3SZRA 3VR1A 2O8CB 1SKYB 2P0EA 2QAGB 1E1QD 3KJIA 3R8FA 1TPZA 2OBLA 1UAAA 2GEUA 2BEKA 4M1MA 4QGHA 3LBNA 2OUKA 1KGDA 4Q4LA 2F55A 2CCGA 1P9RA 3AF3A 4IDQA 4B43A 4BFWA 4EPRA 3U5ZB 1ZU5A 1IQPA 1E4YA 2FGKA 1NKSA 4GT1A 4PQFA 1U0HC 3U44B 2IHBA 4GZMA 3EA0A 2DFNA 3MRSA 3UG7A 4AD8A 1WP9A 3DO6A 3ND9A 1CIPA 4ACBA 3AVUA 4A2WA 1KDTA 3DMDA 3LX8A 2ASEA 2G6BA 4A82A 4PAQA 3MWKA 2J5XA 3V00A 1WF3A 4XWAA 1K5GA 1W5TA 4GBMA 4Q4JA 3SFVA 3AQ4A 4NYIR 4QG7A 4A0GA 2IX3A 3QF7A 1Z6YA 1NP6A 4FINA 1KMQA 1ZRHA 4NP6A 4A8JB 2ZVPX 2FZ4A 3NC0C 4LBWA 3QPUA 4UNSA 3QKUA 4YXWD 5HPYB 4MDFA 2NZ8A 1ZJ6A 1UBCA 4JS0A 4L15A 2F1HA 2J9RA 4ZCIA 5FOSA 5FTKA 4QBGB 3GJ5A 1GVNB 5J4HA 4MUAA 4EUNA 4DCSA 2AXNA 1EXMA 1EWRA 1N5IA 3TBKA 4MRVA 1HYQA 4LV6A 3ZGXA 1IXZA 4F92B 2HJVA 3QKTA 2ZR7A 2AWOA 1R8SA 4Z8YA 3AF4A 4OBEA 2PT5A 3GJ8A 4PC2A 1W0JA 3OIYA 2AD5A 4FN5A 2ZETA 4IVQA 4OI4A 4Q21A 3ZQ6A 5KO2A 4M1SA 3TSZA 1E6CA 3C7KA 4X8MA 4YDHB 3WHLA 1Z0DA 4IVRA 5CM8B 3TAHA 2VP9A 5LDDC 2YC2C 3R7WA 3QEOA 1G8GA 3R20A 4AYWA 4V0KA 4WA7A 1YVDA 5FBQB 2JLYA 2GBLA 2ZRKA 4Q1FA 4V0MA 3KQLA 3T35A 4GI7A 2XJ4A 2JJ1D 4E22A 3C4JA 3CKLA 1GFIA 1UEIA 1IM2A 1YU9A 3DKVA 2GEVA 3SR0A 2XNDD 1KZ7B 3K0EA 1YE8A 4W7SA 4DEXA 3OEED 5DLQC 1Z6GA 5KOYA 3HP1A 4OK5A 2ZSBA 4Q4HB 4PPGA 1E9SA 3OFND 2IEYA 4ZPXA 2ZR0A 3PR1A 2CL6X 3VKGA 5CITA 1D6JA 2KBFA 3O8DA 3DHWC 1PJRA 4G3XA 2EFEB 3OIWA 5EUMA 3TAUA 4TQ9A 1NBME 2ZRAA 4IOJA 4OQLA 1DAGA 3DEFA 1KMHB 5FTMA 5BN4A 2PZFA 3GP8A 3NH9A 2DFTA 1WRBA 1MRSA 2J7PA 4LPKA 2YV5A 1CTQA 1OXSC 4U5XA 5K8IA 2OFWA 4EPWA 3MUFA 2O0HA 2QGZA 2BIFA 1Z8FA 4LJYA 5FPYA 5FTLA 1KJWA 3KKMA 4BRWA 1TMKA 2C78A 5HCIA 1N25A 2HEIA 4V0ME 1C4OA 4Q47A 2QGNA 3EC2A 4CEIB 1WE2A 1Q57A 3RNLA 2VIIA 4BLOA 1QHXA 1AGPA 2QI9C 4TL9A 2G1KA 2BMJA 1P2SA 2MSDB 3B82A 4C0SA 1P7CA 1Z6XA 4JIMA 3VU9A 3EG5A 3RS5A 1FUKA 3FWYA 1CR2A 1E2FA 2RGAA 5D3MB 4JVMA 4LHZA 4Q4AB 1IJEA 3U4QA 5KDOA 3LQQA 4XIGS 4DLYA 1E98A 1Z5ZA 1KNXA 3E1SA 5KU1A 1Z6AA 4Q1DA 2R6GA 4RFSA 2OAP1 3F0TA 2ZRFA 4KV9A 3LVRE 3Q8XB 4Q1BA 2ZE5A 4MQBA 2WPDA 2ZRHA 3AKDA 5HKKA 3CH5A 2F43B 1II8A 3ZIAD 1DPFA 1V5WA 4JJKA 1XF9A 3LQRA 4LUCA 2ERYA 3V4FA 1GWNA 3THYA 4HAZA 3QE0A 1JBKA 4RFVA 1R7RA 1XMJA 2ZI5A 4OQXA 5FL7A 3GLHA 1YR7A 2E1RA 4D0GA 4B2PA 2IBMA 3IDQA 4TLDA 4BFUA 1IONA 5AK0A 2C9OA 4I99A 2WM9B 2ZU6A 2GILA 3UANA 1VYVA 2WICA 4KLNA 1CJKC 4HB0A 2VHJA 4D26A 3I8SA 2NO0A 1JR6A 3LW8A 3LAWA 3MGCA 2PH1A 3SBEA 3GFOA 2H1LA 4PHHA 3GCGA 4TMVA 5JMTA 2GEDA 2XZOA 2GXUA 2DR3A 1P62B 2IF0A 1YR6A 3SS8A 3OHMA 2IK8A 4DLVA 1NG9A 1NJFA 4WW0A 3KKNA 1OFIA 2F7SA 2H17A 4K81B 4KVAA 2HLDD 4EPXA 3CO5A 3GFTA 1LS6A 1YR8A 2WKQA 4ILEA 4B76A 1FP6A 1VG8A 1Q1EA 2BKEA 3WMEA 3L0OA 2NO9A 4JLOA 4JLPA 1D8TA 1RKBA 2P5TB 5CJPA 4YQFA 1VIAA 3V9PA 2O8FA 1KMHA 5AJVB 1XU4A 2GJKA 4M2LA 4RD2A 2MMGA 2QL6A 3NBFA 1EK0A 1LW7A 1GITA 4HATA 1SXJC 5L3SA 2QTFA 2ZRCA 4ARZA 3A4NA 4G1UC 2W0MA 3VNUA 1JEEA 2EFCB 2UKDA 5HE9A 4EJSA 4TMZA 2FNAA 4XWOA 1ZVQA 2J0UB 4CEIA 4O0MA 3VX4A 3SQWA 2ZSAA 3IIJA 2CHGA 2IYSA 2XJ9A 3BFXA 4JJZA 4A6PA 4BEBA 1NMYA 4X8OA 1OF1A 4Q9JA 4BFSA 4ZDJA 4YMTA 3QBVA 1XCGB 2QPOA 3QKRA 2I3BA 4NCIA 1TX4B 4OHXA 2W6JD 1OT3A 3BAFA 1FUUA 3FFBA 1OB5A 2OBMA 1LNZA 4AURA 4E07A 3I61A 2G83A 2JLRA 3CZQA 1H8EA 5JJLA 2QSYA 4JLKA 3EWAA 521PA 1A82A 5KNCA 5CDFE 4PSKA 3K0CA 3ZZUA 1ESMA 2R8RA 5G40A 5J4VA 2PJZA 1QZXA 1G7RA 2PX3A 4R71A 2VPPA 4BZXA 5EXSA 1Q3TA 4EIWA 3EPHA 4FCWA 3P26A 1NY5A 1OIXA 1E2PA 4IEEA 2IUTA 1II9A 3SE0A 3FKSD 3G82C 1GNRA 1TU4A 1XWIA 2GRJA 4NKRA 3ZLJA 3T5DA 2QN6A 4Q01A 4M9SA 2B21A 2AXPA 2ZR9A 3MFYA 4Q1EA 4KJZA 2N46A 4ZDIA 4Q00A 3BE4A 2RB4A 1AKYA 3DZ8A 1X8JA 4QNRA 1E32A 1ZM4A 1KOFA 2V1XA 4HDCA 4HLDA 1M7HA 2V3CC 5AJYA 1QHYA 1NLFA 3CZPA 4ZDKA 3QVVA 1NN3A 5KPJA 2GZHA 4JZKA 3TUIC 2ORVA 5JLJA 3H0KA 3RYTC 5JI3E 1G9XA 2FEOA 1UDWA 3HWSA 1J90A 2O8DA 1YZKA 1KY2A 1ZC3A 2XEXA 2XX3A 4AG5A 5B64A 2E87A 4DVGA 4EDHA 2FFBA 2FOLA 3IQXA 3P32A 2UVQA 2XB2A 1KI8A 4K46A 4Q7JB 5CB6A 1FOEB 1VG1A 1R5OA 2C96A 4LJ4A 1JAHA 1L7VC 2EYQA 1GRNA 2ZPTX 1ODFA 3O8CA 3KKOA 2W0SA 3K0SA 4B6FA 3KUDA 2HT6A 3UMSA 1WA5A 4PHTA 2R44A 1RRFA 3KTAB 4G5GA 4II7A 4QBFA 2ZRBA 2DWQA 5EZ5A 4D25A 4CEHB 1RE0A 1V43A 2X2FA 3PIRA 1N6NA 3LA6A 4Q9KA 1ZNYA 5CJ2A 5KHOC 4M8NE 4D82A 4F93B 1NBMD 3GJXC 3GLIE 1FX0B 1E2KA 4PR0A 3FFAA 4ZKDA 4P4SB 5BYJA 3AP3A 4PPNA 4D81A 1FTSA 2RCNA 3O47A 1XNJA 3NEYA 5G53C 4BRUA 4WIAA 2CLCX 4D0LB 1F60A 1QVRA 2Q0HA 1VYUA 2D2FA 1D5CA 4NCJA 1KK2A 5JHGB 3KXKA 1ZIPA 5JWOA 1CP2A 5CYPA 1HQCA 5BN5A 1BMFD 3IHWA 3CRRA 3O8BA 1NVVR 1U99A 4M4SA 4M9ZA 4XTRA 3SYKA 4NYMQ 3QKSA 2G9NA 3UWOA 2C04A 4FMDF 1G16A 4BFZA 5L3QA 4FMCF 1H8HD 2BOVA 2OM2A 1XBTA 2YVUA 3PXGA 4UJ5A 2BHRA 3AKEA 4H1VA 3QENA 1G3IA 1TU3A 2WSSD 4POAA 1G5RA 3EZ9A 1FMJA 2ONJA 4MGZR 1OXXK 1IY1A 3WRYC 4IDNA 4MA4A 2WJJA 2IYYA 2NMVA 3B78A 2XGJA 3T15A 5FUYA 2FJUA 1ANKA 2JGNA 4LC0A 2GJ9A 2JAQA 4KHZA 3IKJA 3QXCA 1GOTA 4XVRA 2X2EA 3N70A 3B1WA 5GVRA 1PZNA 2NIPA 1BMFA 1E9FA 2YOFA 2QAJA 5L3SB 4AKIA 1Z28A 4OL0A 4C0HA 2RMKA 3AP1A 1AK2A 1R0XA 2Q3HA 4ZI3A 5DN6A 1KSJA 2ZSEA 4LJ8A 2GA8A 4URUR 4V0OA 5BWMA 4GFDA 3IGFA 4DB4A 3M0EA 2WMOB 1KI6A 4HUQA 2AN9A 2IWHA 2G3YA 4C0LA 2ZEJA 3V4RA 1FFHA 1P72A 4Q9IA 3T12A 1DO2A 3I8XA 2FU5C 2PCLA 1DVRA 2FV8A 2YYZA 3EWSA 2IYVA 1ZNZA 4GNKA 1H8HA 3CRW1 2BKUA 4GMXA 5FR2A 3OAAD 2GDJA 2GK7A 1Z83A 3A1SA 1XX6A 4M22A 1D2MA 1KDPA 2BJVA 1T3HA 2CMKA 1A2BA 3L2OB 1SVKA 2CCJA 3TH5A 4QRHA 4W5JA 4C0KA 3HU3A 1KK3A 2IYUA 2ZE6A 3IPXA 4HZIA 4M53A 4Q03A 4JLAA 1TF5A 3TJZA 2NQ2C 2YWFA 2VHTA 4JL6A 1OH7A 1PUIA 2O5VA 5DYGA 3K0FB 5B57C 3HYRA 3VR6A 4OK6A 4URWR 1KSFX 3ADKA 1ZCAA 3GEHA 5KSYA 1W4RA 2ERXA 3NWJA 3DM9B 1DARA 4KSCA 4XH9B 3VX3A 3FHCB 4LV8B 1T5LA 3S1AA 2V4ZA 2QMOA 4Q5IA 5DYIA 4B73A 5FBLB 3BH6A 2I4IA 2V54A 4XSHA 2GJAA 1CXZA 4NTZA 1G7CA 2HF9A 3FDIA 2YWHA 4U02A 5HE8A 5AUNB 3TW8B 2O52A 3IIKA 5EE5B 6Q21A 4I4LA 4B3BA 1W0KA 3KQKA 2J7KA 2IS4A 4TTRA 2DCUA 3RLFA 1N5JA 4D4JA 2C99A 4R7ZA 5L3QB 1L8QA 2F1RA 1XEXB 2GNOA 4OJQA 1HURA 3A6PC 4W5HA 1ZYUA 4OQFA 4PPFA 5H8WA 1SVWA 4B2LA 3GLGE 1P9WA 3P20A 1Q22A 2OO7A 4P31A 4NCHA 3K9HA 5C4GB 3O8RA 1ZUNB 3ONWA 4RZXA 4C2UA 3NKVA 4B74A 2C03A 4DZZA 3B1ZA 3VU9B 3JZMA 5EE9A 5JS7A 3U60B 2RGCA 3HYTA 3HU1A 3IHLA 2GXAA 3LBHA 3I3SR 1AS2A 3WP0A 4OKSA 2QROA 2WWGA 4Q7KA 4EKDA 3RRZA 5DGXA 4JSYA 4DEYA 4Q1AA 3EPJA 2WKRA 3DDCA 2GAOA 4RFSB 4JBXA 5JWHA 4IFBA 4PO8A 1J8YF 2ZJ5A
chains in the Genus database with same CATH superfamily
1TQ4A 2C77A 2RG7A 1Q0ZA 1IC6A 3MMXA 1AQNA 3DMHA 2BZ0A 3MWFA 1XJWA 3RQIA 4UTPA 1G66A 3MPOA 1ORTA 2NQTA 2AH5A 3A14A 4XKJA 1NW4A 2ERCA 4UNIA 3C97A 2QTRA 3GB9A 3SMVA 3ZE1B 4E15A 4E1AA 3DDZX 4G65A 1KO8A 1WU7A 2PLNA 1H2RS 4LJAA 4ZHSA 1Q92A 3AVOA 4PHFA 1T2CA 1Z8NA 4W8GA 2Q9BA 1REQA 2A84A 4G0ZA 4INZA 4XJXA 2C9MA 1FFGA 4X8HA 3VR4H 5AOCA 1PX0A 1TAHA 2HK6A 3FDJA 8ADHA 3NIGB 5DI3A 5AR1A 5DBFA 4MKRA 2B8EA 2WAOA 2Y27A 2BF4A 3RVDA 1D03A 1HA3A 1RJGA 1DXYA 1RVDA 1RLTA 3I4FA 4L8WB 4YT5A 1ADJA 2IXTA 4G5XA 3WL8A 3IQEA 4KKXB 3F3YA 3LOUA 4J43A 4EKYA 5IHPA 5KNDD 5D3KA 2O8BB 1BWPA 2C95A 3F71A 1A2QA 3VJMA 2WUWE 3GU3A 1CJVC 3TEJA 3X2FA 3OJXA 4N6OA 4W99A 3DMYA 1G3MA 3FJOA 3BWXA 5SZHB 1PDOA 3I5AA 3PDWA 4HLUC 5BRNA 1LBHA 3PRYA 3RS8A 3FSGD 1MDFA 5CD9A 3BG5A 3KOZA 4PW0A 2V6BA 3VO1A 3VU0A 1VI6A 2W83A 4DIKA 3RG8A 3F9CA 2V7WA 2HZBA 1SRRA 5LQMA 4O4LA 1DB3A 4DARA 3MM4A 2H8KA 1CSEE 4TX1A 1ABBA 3WIEA 1HM5A 2RK3A 2VP3A 4FS8A 2D0PB 3MCVA 5DP1A 4UD6A 2JAPA 1DAEA 1QPBA 2OG1A 2QE6A 3U39A 2AZDA 4PAWA 4BX9A 1LDGA 1VHLA 3HFJA 3N76A 3UK0A 3EZFA 3R3WA 4ZJUA 2F9FA 5KKAA 1TUIA 3N6VA 5LB2A 2VATA 5CGZA 3RAJA 1NVXQ 1VYHA 4TLEA 4D4GA 3HBFA 3HACA 3UKDA 4DSUA 4KREA 2R47A 2X9VA 2MSWA 2VYNA 3BFKA 2IXDA 4UMVA 3Q5EA 4KQHA 4NNJA 1VMIA 3ETHA 3KZ1E 3R6GA 2QX4A 4XSGA 2H8GA 2PWZA 2PWAA 1M0SA 2WM3A 3M83A 1TTQB 2HV8A 3NRCA 4RXTA 2RG1A 3VR5A 3B6ZA 3IHKA 3WL7A 4CT0A 3TW6A 3KQTA 5EXEA 3OCJA 4DILA 4ER3A 2CNBA 3A1FA 4C3UA 2PFSA 3W3AH 1VP9A 4EENA 3ESBA 3NHFA 4G2NA 4R8RA 5KNDH 2DUJA 2IYQA 1TW3A 3DL2A 3KHTA 2AG6A 3PUXA 1FFYA 1QORA 3QJ5A 2VHZA 3FXAA 4DLXA 3IQGX 3SXPA 4P4LA 1ATZA 1O96B 4P80A 3WYGA 1ULUA 1ZJZA 2I6QA 4UOEA 5BUQA 1RCUA 1FNBA 1CVLA 3R40A 4DUGD 1YIDA 4NE9A 2EJTA 3RTEA 3S2UA 3WK6A 4D3SA 2PGAA 1JFSA 1YDMA 2G77B 5EKSA 1NONA 1T1IA 1ZY2A 4ARVA 2CDNA 4X95A 2G82A 4ZU3A 4LFBB 2CJFA 4WMLA 2J9XB 3ON5A 4D9FA 1A9YA 3BE8A 5EEGA 4EA6A 3NOXA 1FU7A 4B7UA 4XJTA 4KQFA 3LUBA 3S40A 1RJEA 1JAIA 2AFVA 1FP4B 5CFPA 2IVFA 3I6QA 3DULA 1IY9A 3C1AA 4QYMA 1Y7LA 2XIJA 4R2WA 5LP6C 2DHCA 4BNUA 4RULA 1HRDA 1R0LA 1INLA 1JXQA 4FN4A 3TN7A 1E20A 1ZNXA 2FJ0A 4Y30A 2DFLA 5KC9A 2I5PO 3STTA 3OTOB 4BRZA 2Y6UA 3W5JA 4PX3A 4ZT2A 4P08A 2WHXA 3UUGA 5DTMA 1EUYA 4KPYA 5LMNB 5ER6A 4YJ3B 1CLUA 2Y93A 3QLVA 3URKA 1P5ZB 1WUJS 2FFAA 4V0QA 4ERXA 1IN1A 1EFUA 3G2PA 2M2IA 3IBSA 5AKHA 3KUUA 4ZO7A 2UZ1A 1HFKA 5AOAA 3AVYA 3H2JA 1C9JA 1USUA 2C2ZA 4EPVA 3BDIA 3SKYA 1BX3A 3I01A 5C8XA 4YY3B 1LDBA 4EJSB 4WJLA 3P4YA 2OZLB 2VLIA 2Z8YM 1XDUA 2WKSA 4J16A 1N6IA 1ODIA 3GROA 2CHUA 5DB4A 3OX3A 5LMCA 2D5CA 1Z13A 4LZZA 5EXPA 2GK4A 4ZALA 2IHVA 5KYVA 2RGBA 1U2DC 3A04A 3EDCA 3IT3A 3DFIA 1KI7A 2P35A 3N7TA 1MT0A 1Y80A 4L9WA 4AP5A 3NAMA 4MJ7A 3QTTA 1N9KA 5HILA 3O4RA 1FF9A 1P0PA 1KHTA 3A6GA 1GXSB 1OASA 3FSRA 5IUKC 1M2HA 1N5MA 1SBNE 3PG5A 3F6CA 3F67A 2C3MA 4YJKA 3TK1A 4MKHA 3F9RA 2FMTA 4P5DA 2QYOA 1Z4MA 1P0MA 1CY0A 1BXZA 3G2IA 4BFTA 3UMMA 4WX2B 4ID3A 4H9GA 4YCAA 4JLMA 1VTKA 1W48A 1L7OA 1YZNA 3AY0A 4RYLA 4A73A 1G5HA 1XA0A 4D02A 4CEHA 5KSWB 1UXHA 3EODA 1SUIA 2FPKA 4FSXA 4KX5A 1TQDA 4LDZA 1WULS 3JVVA 2HUNA 1OBFO 3U4MA 2PA0A 1T5SA 1Z2AA 7ADHA 5HOQA 3HN7A 1P91A 1KPGA 2VT7A 3GRUA 3RUCA 3SU8A 2ZBVA 1S2OA 4OXIA 4ZQEA 1E9AA 4ANFA 2XV1A 3G68A 3FNFA 1BGWA 3E9QA 4IVPA 4DDKA 1W87A 1Q3KA 2ZQZA 2B94A 4HDSA 5HR5A 4D3ZA 1JJVA 1FMCA 1U1GA 3GIDA 5FPHA 4UTRA 4G0WA 1NQTA 2OV3A 4TMWA 3VBEA 1JPVA 4LJKA 1N2EA 3RTGA 4G85A 3N2KB 5EESA 1HT1E 1N5LA 1XD2A 1FFAA 1WHTA 3KELA 2AEFA 4N7BA 2QUKA 4OAPA 2WDZA 3U44A 4F60A 1U7UA 4DBLE 3WA6A 1SXJA 3S5JA 3DLCA 4A26A 2Q0SA 3E7FA 3GJZA 2O0JA 2EP7A 1QE0A 2UZIR 3OLWA 1QRRA 3E9EA 3OQBA 2JI6A 1YOVA 2BFFB 4J3JA 1GZDA 5FFMA 1TO6A 4YV0A 2XMZA 4K6FA 4NIMA 1XZQA 3EIOA 1JHQA 4LF9B 1L4YA 5EGSA 4Q7QA 3QLEA 1GUYA 1CUVA 3CPEA 5JUWA 4Y2RA 2E7ZA 2ATEA 4R1PA 3QY0A 1QCZA 3FUVA 3UMFA 4DIDA 2NO1A 5AK3A 3ZE2B 2DH5A 2FZVA 1A5SB 1PX2A 1DIGA 2O8VA 2PX6A 3TQCA 4CLXA 1R6VA 2ZB2A 4C07A 2ZB7A 1DAMA 4FDLA 4JIGA 1B42A 2VXYA 3RC1A 3RVNA 4B0OA 1E3MA 3OQNA 2ON6A 2NXNA 1P4HA 4IOLA 4JBYA 1ZGCA 2VDRB 3AB3A 4ALMA 3SC3A 2CYBA 3PEFA 4R8SA 5LJLA 2WYWA 1NZDA 2FGJA 4HZUA 1N7JA 1XMIA 3RIMA 1HBJA 4CFZA 2I6UA 4LQCA 4TZ0A 2J3MA 3KBOA 1KF0A 1JR3E 4L8YA 5KDDA 2OZPA 1OIVA 1RP7A 1I30A 4HN9A 2QLLA 4DCNA 2VDNB 1RXSA 2HSDA 3PNMA 3DD1A 3HPRA 1GLNA 2W6OA 4IKEA 4LXYA 5LU9A 3LHKA 1PYGA 3L8FA 4OQMA 4PYRA 4CE6A 1GCOA 2EW2A 2A33A 4C7MA 4KFCA 1Q7EA 3AR3A 4MZDA 3MJHA 3IR5A 1JGTA 4OXYA 3PJDA 4OEHA 4G4SO 4FP9A 4YXFA 1PIWA 3ILSA 1JHXA 4J9UE 5ALHA 3SLKA 5IT9A 1XJ0A 4W9MC 4A8JC 4NRDA 5EVCA 2X13A 3V9AA 2XT0A 4D7AA 5LUAA 2PS9A 2QUZA 3EZ2A 3K32A 3MVEA 5DHPA 2HDOA 3C3AA 3UJCA 2N75A 2SNIE 2EL7A 1BJTA 4IQ0A 4C5BA 5JXIA 1OREA 1IN5A 4DRYA 3BA1A 2KLHA 1KAHA 2O7SA 1SUPA 3OFSA 5I9IA 3L8EA 3SF8A 3KR1A 5AJXA 3NDPA 1U9ZA 4E11A 5H80A 3I9MA 1KJNA 2K6GA 3I9KA 2IPMA 4M0EA 4MR9B 5E2AA 4DBVO 1DNPA 3OC0A 3UXHA 4BAZA 3W5IA 2DTDA 2XTMA 4OG2A 4W1PA 2J9FB 3P0IA 1I80A 3R0VA 4BECA 3K8QA 3IX7A 1WXQA 1M73E 2F9MA 2QL5A 1KO7A 1RQLA 2ZZKA 1XWWA 1XKTA 2P6NA 5JSZB 4X91A 2ZT6A 1URPA 4UBMA 3RS0A 1T1RA 4XVCA 4PGHA 3PIIA 3OQ6A 2FI1A 3L7JA 5C80A 1EAYA 1E9EA 4L72A 3K09C 1MJ5A 4RVDA 5CXSA 2IXEA 4AZWA 5CFNA 3IP3A 3JQBC 4MKGA 2HPHA 4OQZA 1RZVA 2IV7A 1NA5A 2B2NA 2J3IA 3FYSA 5IVDA 4B3CA 1WBBA 2EKDA 5J63A 4J0IA 4FCTA 3MINA 2N1BA 4JGBA 4BMNA 3JR3A 2JLZA 4DSZA 1YGYA 2XLBA 2XSZA 2ZBUA 5EOVA 2QE7D 4E21A 1UPCA 1HL7A 4CN9A 4I9GA 2GCIA 4N54A 4XX1A 3RU7A 2PAAA 3DG9A 2A0KA 2VBGA 4MV5A 4N76A 2VT3A 1IMJA 2P78A 3KJZA 1JPUA 4NG4A 1HLDA 4NX2A 4QBKA 4RF4A 1US8A 4LQDA 2WSIA 4HDOB 4DF3A 2ZQ5A 1GPJA 4R16A 5JNRA 2FPIA 1U9IA 2J4FA 3HVUA 1OLXB 4KCGA 5K9ZA 4RDHA 3VYSB 3TLYA 1GAEO 1UOQA 3AY6A 3VH3A 1T9DA 2CVZA 4ERNA 2ZWIA 5CNIA 2WIBA 4BNFA 2WT4A 4PHGA 1XP5A 4L2IB 2PT7A 2JCSA 1FTYA 1QR6A 2WV9A 3TMKA 5BQXA 1PV4A 1U4OA 3NVKI 2KB0A 2Y0DA 2AOTB 1Y63A 4NZMA 1TLTA 3RG2A 3RUFA 5BN3A 3LQFA 3N2EA 2WP8J 3GXBA 3JQ8A 1K6JA 2BBOA 4DLTA 2QP4A 2O2SA 3ED1A 3KPYA 1JQBA 3LT0A 3B7GA 2EQ5A 1G5QA 3U3DA 4XQ9A 4I2VA 2O57A 4TQUS 3IP5A 2J59A 4LGMA 3RU2A 2OR3A 3WGZA 3BFPA 1PSZA 2BM0A 3NPMA 1RAIA 1Y81A 1GKYA 4M1WA 3FOWA 4Z9XA 5F78A 1OGYA 5I4KA 4FS3A 2WTUA 2MINB 4K9DA 1VGVA 3M49A 1L4KA 4YYZA 3LXMA 4W5RA 3VZQA 1G21B 2VTDA 2XWBF 4HGPA 2H1WA 2PS3A 3I92A 1BX1A 1HXHA 5TDHA 3WYDA 1OH5A 3OJFA 1R5NA 2QZJA 2Y67A 3SM9A 4Q15A 1QSGA 4FB4A 1D6SA 1FFXA 4KMOA 2QKYA 1QHIA 2C5SA 4ESEA 3LQYA 1XPRA 2IWRA 4FYXA 1BG6A 2G9RA 5LN1A 1MD9A 1WB9A 1NNEA 3G89A 4WBSA 1J9ZA 2BN4A 2RIPA 5EZQA 2ZT8A 3PC6A 3QA3E 4Y7DA 5LPNA 4YJHA 2WM8A 4RV9A 1MV8A 3MJVA 2QT0A 1BCSB 3IDFA 3T7DA 4ZMSA 3P5SA 1B0UA 2H07A 3K1YA 3LHDA 3PPIA 1IJFA 4FT2A 1E1DA 3VTZA 2WNIA 2O4CA 3D9QX 3BHIA 2WF5A 1ZC4A 4JWKA 3D7KA 4CMJA 3L7BA 5FA5A 1ABFA 3K20A 2R11A 1D0VA 1CS0B 1OFUA 4JVOA 5JZ9A 1SG9A 1TZJA 3H87A 5LYYA 3CBQA 5C18A 4X0EA 1H65A 1NOJA 3ESRA 1JEYB 1SBQA 4H7HA 1HNNA 3E61A 5DBIA 2N42A 4QYWA 3OQOA 1BHO1 1AJEA 4ZT7A 4CCAA 4JQOA 3T5GA 1YB4A 3ULKA 4F38A 1C1HA 5AD1A 1NY6A 3PV0A 5ALYA 4BKQA 2DPXA 2I55A 3LL4A 3MIZA 2PBLA 4FFVA 1YD7A 4TVOA 5KYKA 4I5FA 2QN3A 3OKCA 3KT0A 3KOMA 3RBXA 4B4VA 1TIPA 2AD1A 1FQJA 3LXRA 3OE5A 2IOFA 1RYHA 3CNEA 4QPNA 5EXXA 5HCNA 3SIRA 4DA8A 1Z5WA 4JAVC 4PO3X 4D4KA 3COJA 3THWA 2B4KA 3RS7A 2XOKA 4ETMA 2HJWA 2QORA 2VAVA 4QFMA 1YZFA 4J2TA 4AJNA 4DSOA 4DTIA 4H7FA 1X1CA 4J6EA 2AHOA 4PEVA 3ZK9A 5BN1A 1MBZA 3PGVA 3HKEA 3M82A 3H11A 5H16A 3R3VA 2FPIB 1A8IA 1C3XA 4CIWA 1YHNA 4M98A 4F2HA 2JCBA 3NHSA 3B5EA 2FR0A 3B12A 3ET4A 3LX6A 4NNOA 2SHKA 2ZSUA 1LXCA 4XIYA 4RF5A 5F73A 3CEPB 3EXFA 3OETA 4UE3S 3PA8A 5SY9A 3K9LA 1EWKA 1W581 3BH7A 2QYSA 5BN3B 4ND8A 2C2OA 5IMBA 4KQ2A 2CHEA 3Q87B 3QVWA 4UU8A 1R37A 4F5WA 5KQGA 3O1HB 5DGIA 3RSOA 1G3UA 1RKUA 3OWXA 3G5UA 1M2VB 1IM5A 2GAFA 3FMOB 3TMYA 3EGEA 3BJEA 3G0HA 2NNLD 4CVNA 1CUSA 1IL0A 5JBNA 4Q3BA 3PWKA 1OKKA 1GGMA 5KSOA 3QH4A 2PRKA 3WGTA 1KVRA 1CQWA 3OCWA 2XQFA 4OQYA 1EFVB 4QKQA 5F1PA 4WBNF 5A4AA 8MHTA 2RD2A 2G9UA 1GTG1 1SXQA 4FOSA 2ZBFA 3R75A 1Y9DA 4QBIA 1J1ZA 1NHGA 1JWAB 1NSFA 3JARA 4V1CI 3EYWA 3GJ4A 1VHDA 2R00A 4AMZA 1EHCA 1W25A 1SOWA 1K5PA 1UKZA 1TUBA 2K5UA 4OUDA 4WXPA 1S7GA 2MSKA 1NQWA 1F1JA 2B4AA 4FTWA 7REQA 3AFHA 3LV8A 1JDUA 1EGQA 2C4WA 3AF2A 5KAMA 4R0VA 4Z9FA 2Z1DA 1UJ5A 2ZCUA 1T3LA 3E0XA 4S1WA 4D4MA 3EXHC 4BCBA 4C4XA 3AHFA 5B55A 1O3YA 2IP2A 3X1KA 1ZD8A 2HLPA 2Z3ZA 3IO5A 4BO1A 4DJAA 1C30A 1I2AA 2Z9BA 3VR6D 5TXGA 2SCUA 5ICCA 1MNAA 2JJ2D 2VJMA 2X8BA 1ODSA 3L0IB 2HUPA 1AKEA 4NV1A 2II6A 4FFRA 1F0KA 4RGVA 1J70A 4YHBA 4LF7B 2A3RA 2ET6A 1SVLA 3H19A 4KMSA 2G25A 3QZUA 4LHSA 4QHSA 1E96A 1XTVA 2W4QA 5AWFC 3SZGA 3EPKA 1GV1A 2FVYA 1YVUA 5FWDA 3AR8A 5J2UB 1KMCA 3T7KA 5L8VA 2CYAA 4ND4A 3CRQA 1BXGA 1P2BA 1SUAA 2OKGA 4HGQA 3QLJA 4DDTA 4ZXPA 1AGNA 2F1JA 1EFPA 4HDKA 3V1TC 2PBZA 2Q7XA 4Q4AA 1IWOA 3LFUA 4Q7MB 2W8BA 2MHCA 2PHZA 2H7CA 4X62B 3LFHA 6NULA 2QA5A 1PJSA 3OBBA 4UTZA 3LRPA 4I0WB 1SVSA 4H4EA 1NVVQ 3VR0A 5C7LO 2EX1A 2G5TA 4UTVA 5LXTA 1EGAA 3LCJA 1SUBA 2OAQ1 3JWEA 3OTGA 4F2PA 5JDIC 4J7XA 2F3RA 3TX6A 2JFOA 1FU4A 4GLOA 2D1RA 1G64A 3LUCA 5GIOE 3HK2A 1CRLA 3MB5A 5COBA 2EDCA 3DFUA 4JENA 4YCSA 4IDBA 4JSRA 1T5OA 2FCRA 4UU0A 3Q3CA 1AQUA 4MYHA 2UUCB 2W4MA 3P9NA 4DE5A 3R9IA 5EJ6A 3QOFA 3H6KA 3RS4A 4PG7A 1RVV1 2YYAA 2RK4A 3WYAA 1DOAA 2IZ5A 2JFBA 3PX3A 3J7TA 1JYEA 2IFTA 4AS1A 2IYWA 3R5FA 4U00A 2UZ1B 3HCCA 4GYYA 5EP1A 1M2JA 5G1OA 3LC1O 4C4PA 1JPNA 4PGAA 1QANA 4O5AA 5I7VA 3QEBZ 1D09A 1KZ4A 4R4JA 1LY1A 3QBEA 1VLVA 5EJIA 5IX8A 2X4DA 3LO5A 4L07A 3P4XA 1U2ZA 1U31A 4JB3A 4PF1A 3DV2A 1JH8A 3QEJA 4JB0A 3S81A 2NSYA 3MT8A 4MJXA 1YTUA 1KI6B 4MRSA 5C1OA 1X3SA 1LPOA 2XBMA 1E9VA 1OYWA 4LF8B 5C1BA 4OP1A 4DMLA 1YHYA 1Z2EA 2JPDA 1O0SA 1ZJYA 1QZUA 3KU1A 1H1LA 2MYNA 4OI2A 4BNVA 1U8FO 2A8YA 2ETVA 2WWHA 4C3VA 1J00A 2R4TA 4RC9A 3OCYA 1ZA2A 1PUXA 1WM1A 1WWKA 1K2WA 1WUTA 4M1EA 4OGFA 3QYJA 1RMYA 4NCNA 4ZDWA 1BROA 4FGKA 2IHKA 1VA4A 1ZCBA 3AFOA 4QA9A 5EIAA 3SLGA 1GA4A 2PZBA 5JXHA 5LYJF 4MV9A 4Q19A 5KQSA 1MOZA 5EIEA 2OOSA 4C6TB 1BOOA 2GM3A 3P7MA 3MGAA 3WZLA 3Q8MA 1N4DA 5BQOA 5DW0A 1E2UA 1M2WA 1DT5A 1WMFA 2SECE 2W58A 3AUYA 3HM2A 2CFCA 3HMKA 4ZCLA 4BNKA 3CNLA 3D6TB 3TB4A 2JK0A 1C9MA 3LW7A 1YASA 4ENSA 3QVUA 2G6TA 4WOPA 1DFGA 1X1DA 4UZSA 1P4AA 2CY0A 2QRHA 3S2IA 2P2GA 1NVUQ 5EGNA 1PWYE 5EXDA 3AEXA 4E2XA 4AMBA 2NZJA 4TKVB 2LV8A 2WA1A 1BQ4A 3E7DA 5JSKA 1E6LA 4N12A 1FZTA 3NATA 4KBFA 1KKUA 1RYDA 1JW9B 2JH9A 3ETDA 3QF4B 1BXGB 2BMFA 1UKAA 3AQIA 4OOEA 3TTVA 5LLSA 4RMHA 3THOA 4EYEA 5KIAA 1SXHA 3AWIA 3KSDO 3HCPA 4C3OB 3MLEA 5EKTA 3TZEA 1CJTC 4AZ3B 3KZCA 2NUTB 3DOCA 3HKCA 4KBGA 3T7CA 2R8BA 4DDMA 3L4BC 3PQ5A 2M98A 3F74A 2VQDA 1C4KA 1O95D 2VWGA 5TVGA 3E18A 4BDSA 1QV9A 3B38A 2GAIA 2Q21A 4HRAA 4UW9A 4L9RA 2IUUA 4EW6A 3AHCA 1UXKA 1XEXA 1YVRA 4TWAA 2GEJA 3HUUA 2Q0QA 1XCPA 4UOQA 3T5MA 1ZD5A 2OD2A 1W88B 3HVJA 4NK4A 3T06B 4OHZA 2E18A 3HFSA 3T3MB 2VXOA 1WMBA 4IMJB 3EDRA 2QAGC 1T3GA 3VI3B 1J8QA 2ZTSA 1U7TA 3RU9A 4Z8XA 1XGKA 3H1TA 2LKDA 3GFFA 4X6LA 4Z0HO 4F6RA 4J1TC 1SXPA 1KR2A 4HG2A 2LZ0A 4OM8A 3WMGA 5A4DA 1BRTA 3F7NA 1EXVA 1Q1QA 4BHTA 2NU6B 1LUAA 4Q7LA 5FBRB 1MC1A 1NSYA 2BH9A 4WUVA 3WGYA 4RVNA 2AJLI 3ZGLA 1ID8A 3PQ3A 3GLKA 3F6BX 4RABA 4Z7NB 3F5MA 2HMTA 4YXWA 4EYGA 1QGDA 3H8VA 4PTZA 5AVJA 4M49A 2R84A 5YASA 4CMBA 2JCXA 3VDQA 4ARBA 3MD0A 4KK4A 4YCDA 2JHCA 2OQIA 2QX8A 1KY4A 3FPHA 1JWBB 3GJ6A 5FUVA 1E2HA 1RYFA 2OHVA 1PD0A 1RQ7A 3SEQA 1BKSB 2ZIUB 3AR6A 4QUJA 5CTJA 1WMDA 1QTRA 1XL0A 3N5CA 3JVEA 2XQGA 5BT8A 2P2DA 2VCHA 5EJGA 4BGEA 1TXGA 2CK3A 5AK5A 1JFRA 5BSRA 2ZS9A 5IT4A 2DJIA 5GADl 3FX2A 1Z08A 5CGQB 1OV6A 3OCZA 3TQFA 3HCWA 2PMEA 3ZCSA 4QFBA 2VPYA 1N7IA 4WN9B 3QKRB 3MTBA 3TFQA 1KJIA 3QP9A 1U9IC 2RCYA 4ZAVA 1QGAA 4OJKA 1SQ5A 1NWHA 4NYMR 4ZHQF 3BBPA 3K3PA 3PITA 4O2AA 2B1JA 3L6EA 4CYMA 4QJ3A 1EQAA 1A97A 1FLAA 1JR4A 4M55A 1ZLXA 4RTSA 2KE5A 2IDJA 3FD8A 2CNWA 4OGGA 2PNJA 3UBMA 2PX0A 4YQYA 4H60A 4N6NA 3FAZA 3ZXXA 3T7RA 1E3WB 1A9XB 4EFDA 1N1EA 1EA5A 2A1UA 2H92A 4JLBA 3M2TA 4IGFA 1KBOA 1R4AA 3ROEA 1I7QB 5K8LA 5EWLA 4TS9A 1UQRA 1WCWA 1U0EA 4MH0R 5C4IA 3OZVA 3P2IA 1U8AA 5KUTA 3IL2A 2O06A 4C30A 3FYHA 1TT7A 4MI9A 2AK3A 4IJMA 4H7JA 1ST3A 4BMDA 1XMVA 4QGAA 5EKXA 1JEAA 1I9CA 2ATXA 3PFBA 4YWJA 4KZPA 2ZUEA 1GKLA 3ME5A 2ZAMA 3JX9A 2ZWVA 3QYPA 1PJ3A 1YK0A 2VBCA 4P5PA 1G2PA 1T15A 3RRYA 4YCLA 2ZYRA 4D5GA 5K0EA 1M0WA 3RYHB 4GD3Q 4Y0NA 3CPJB 3L93A 2FWIA 4OBBA 5A2QA 1RXEA 3HJNA 1W9MA 5MDHA 3NTLA 3QU7A 4BO2A 2GBLC 4HWOA 4FGWA 1PW5A 3UWDA 4KO1S 5BSWA 3VYVA 3PB3A 5DIZA 1U7PA 2NGRA 1AQJA 4IIJB 4FGJA 5DVZA 3CW2A 1MVLA 3IEIA 4OFXA 3QLUA 4PZUA 1KMMA 3U26A 4WOBA 3VR3A 4RTKA 2FJPA 2GM5A 2X8LA 3GDWA 1J2TA 4NPAA 4DANA 5JWRA 1SKAA 4NJMA 3RAEC 4I3GA 3JQDA 4UTOA 4OMCA 2HWXA 2ANBA 2I34A 1PNVA 4DCJA 2NU6A 4C0JA 5F21A 3IOCA 4LCEA 5KTTA 4MQFB 4PLCA 5ITZB 4XQCA 1MJGA 4KOAA 3GPCA 5ESDA 2O4UX 1MAAA 3GWGA 3MB8A 4UHHA 4CMEA 1P39A 1JXAA 3EHEA 1ZGGA 2BTQB 2YBDA 2AKEA 2P9EA 4RIIA 3ZCXA 1JDSA 2ZUSA 1KO4A 2JI9A 2P4EA 3KTAA 3RDPA 1HQYE 1FFBA 3SVLA 2I54A 2IZ1A 3GFVA 3E4DA 1NQOA 4CM7A 2JZCA 1U0OC 3AP2A 3P96A 1Z33A 4Z9BA 5K4HA 1RAFA 3COPA 2AJTA 2Q4DA 4O2LA 1OH8A 4Q4HA 5A04A 3I5MA 3L5OA 1XPOA 4YACA 4S2EA 2PZMA 1NUAA 4FW8A 1OAOC 5CYOA 3WKCA 1MABB 4DXAA 4ZMBA 1GZ3A 2WF6A 3RT9A 2OYRA 4I50A 4MCHA 5K09A 2MTBA 1PQPA 1L5FA 1SFRA 1JVSA 2JATA 3MUNA 3PE3A 4NY1A 5LYJB 2IVZA 1ZCJA 1VCHA 3VPSA 2XUIA 1QH9A 4XPZA 4OB7A 1NF8A 2HH9A 4GZLA 1WQ1R 1DUVG 3P9YA 3AILA 3FVQA 1C7ZA 1JUDA 3OFKA 4NVRA 1WLSA 4BQRA 3TGPA 1EFCA 4ASUD 3WZ2A 4KTVE 1JU3A 2C5AA 1OVGA 2F90A 3NDRA 3TJRA 3OZWA 4QGGA 1A7AA 2BF7A 4X64B 4BQIA 4URXR 3PVZA 1DKRA 5SZJA 4BQOA 4P0TA 4DLSA 3GVXA 1P3JA 2EOAA 4B6PA 4C7VA 1E7QA 1TEVA 1Y1LA 2QP3A 3PT5A 1CS0A 4G1MB 5BWCA 3ELDA 1E2NA 5I8WA 1K6XA 5A05A 4ND7A 1R0ZA 2XCQA 3L8CA 2VPTA 5ELXA 2VP5A 4KWIA 4PX9A 3VR5H 3RAGA 1CJMA 3TUJC 1VLLA 4M0DA 1MQAA 3DZDA 5DNCA 4QREA 2IDZA 3C8ZA 1G4AE 5I47A 3STHA 4BVKA 4CF7A 3NDBB 1WQ3A 5GWXA 1PZGA 1GAJA 3ZX4A 5J9FA 3AIOA 1C0IA 3GQBA 1WZ2A 2YC4C 3DB2A 3U40A 2PUCA 4FYMA 1DJLA 1RLIA 5IM4A 2QNBA 1O6CA 3OZEA 5TX7A 2OSBA 3DPSA 4IF6A 1TI7A 4LMPA 5K8VA 2C5BA 2HADA 3NI2A 4RTOA 3T3NA 5LZ7A 3H18A 5KPDA 3IXLA 3ZY6A 4JC4A 4XX0A 2AQ8A 2VPQA 4WCFB 3NBUA 1KIAA 1W36B 3Q9LA 3IT1A 1RHJA 2JZNA 1RRPA 2Q1YA 2CLOB 3RM3A 4FC7A 1K7SN 2B8JA 5D85A 4GDFA 4RKYA 1T2DA 4NZNA 1DCKA 1EJ2A 2XUPA 3D6AA 2R87A 1KQNA 4DC0A 3F73A 1IBSA 4ZK2A 2CNDA 4OYLA 5JNTA 1L7RA 1UEJA 2I3AA 4IJUA 4MRRA 1RC8A 3MG9A 2ORED 5F2NA 3Q7IA 4U6NA 2YMPA 3L6BA 1C0EA 4MR7B 4UEWA 4GR9A 1YVPA 3NYQA 4R8LA 2WU8A 3SJAA 3SQNA 3T5TA 4K6MA 1VJ1A 4RKRA 3HBMA 3EB9A 3NP7A 4J76A 5TPZA 4R81A 2POQX 2Q3LA 4ZAZA 2FSVA 3DBRB 1PLJA 3SNKA 2IEIA 2FSHA 3HLTA 3KR2A 3PXBA 3U13A 5KTNA 1UK7A 4LYFA 1OB2A 2J5BA 3UB4A 1XMSA 3PJGA 1WHSA 1N2XA 1E1MA 2QRLA 3GYGA 3OQHA 1VKOA 4R6XA 1I2CA 3MWDB 1N6HA 2CLKB 4V03A 2PBFA 1OTHA 2PRYA 3C8MA 5EJ4A 1NW6A 1YDEA 3PWTA 4MIKA 1GQFA 1Y5LA 2V7QD 1LQTA 1JHVA 3C4VA 1VHWA 4JR0A 4LS3A 4ZYYA 1F6BA 4BRSA 3KPUA 2VJCA 3PPYA 3PUYA 1KJYA 1WUIS 3KP1A 1ECJA 1K8ZB 4QBHA 4C0XA 3RVLA 4G24A 3OTQA 2F17A 3LCMA 3OUTA 2CFIA 3LECA 3ZE7A 3V8RA 721PA 4REOA 1LSJA 1SUCA 1X7YB 3LUKA 2PL3A 3OM0A 3IDSA 1GJRA 4X7PA 1X6VA 1EX7A 4UJ3A 3I04M 5EIFA 2QTTA 3WNVA 4HNHA 4Z9AA 2WE8A 3WIBA 1U3DA 1E3EA 4JKOA 1SB8A 3CXRA 4DDUA 1AO0A 3SS7X 3HZOA 3O8NA 4NG5A 4C4OA 3W7VA 4RY8A 3CLRC 3W05A 1A1SA 2BFEB 2RAPA 3M70A 1E4VA 3AONB 3K05A 2GVDC 2NZYA 3OVMA 3W5VA 4HFMA 1Y6QA 4UOZA 4MDEA 2VP0A 4UE6A 4PNHA 4KFTA 1N3YA 1ZK2A 3EWIA 4F71A 1QNLA 3C5CA 3QVSA 4B71A 4PLTA 1COZA 3DE6X 3FZQA 2X3UA 1PZFA 3K94A 5AM5A 1CB0A 2AJDA 4QYTA 5HJEA 3U62A 1VDMA 3B9PA 3H2GA 3U7RA 3B60A 4ZAGA 4MMXB 4HX2A 3S0JA 3GRYA 3OAAA 1I33A 2C4TA 4FMPA 3ZWNA 3JASB 3OLXA 3FTEA 1BGXT 1OX4A 2IGTA 2VSXA 3DVLA 4OXXA 1VSBA 1YRQA 3E05A 4Q02A 2EERA 4P3YA 3VHXA 4OXQA 3EE6A 3M1AA 3ZHYA 1OI3A 5BORA 2Y0CA 5CA1F 2X40A 3W79A 3Q40A 3I9V1 3QEMA 4EG1A 5A3JA 2FG7C 1GR0A 1ONNA 1SXJE 4FHGA 4DV6B 1SZCA 4MEJA 4YR9A 2YHUA 1YS7A 2Y1EA 4ND6A 2WWVD 3WB9A 4MS3B 4F9TA 4NK5A 2OORC 2OBXA 4PZDA 1GRVA 3TTYA 1T8YA 1I1NA 2QTLA 3UWPA 3C5WP 3PNLA 4FOPA 1I3OA 1ZN2A 3WNQA 4V0RA 2H3EA 1D2EA 1OFUX 2FR1A 4GLFA 3WGVA 1RWWA 2VDMB 4NR0A 5C81A 5KWIA 4IJQA 2ZUUA 3F1LA 4D4LA 3LTEA 4G8CA 5DWQA 2HXGA 3IAHA 4G25A 3NW9A 4Z3OA 2VZEA 5K0GA 4MA5A 2VHEA 3IP8A 4QQRA 4I14A 4RFLA 1RC1A 3F5SA 5J40A 4DPKA 4O3MA 3A37A 3L0DA 3EBPA 2NV6A 3ECSA 5IAAA 1UWVA 2JLVA 1E5TA 1KI1A 4MWEA 2BFCA 3ROMA 1GL7A 4BQNA 4FKMA 1JSLA 1MO3A 5FBHA 1FA9A 1QMPA 3TS1A 4WDQA 1L7NA 2J33A 2VYVA 2XUDA 4HHEA 3HP4A 1XG5A 2I2AA 5HMMA 1YZ3A 3ANXA 4DV2B 4YJFB 3AKYA 2NZ2A 2PRZA 3IAM6 3MRXA 3PTAA 4Z2YA 2O8BA 1KJ8A 5G4KA 3RIGA 4A15A 2V65A 2YQZA 3MAGA 1XJ5A 4S1OA 1QG0A 3A3KA 1G6OA 2BJWA 1HNWB 4C08A 3WOHA 3U7FB 1KY5A 8AT1A 3H5RA 2QRPA 3L0SA 1QHNA 3AEKB 3V3TA 2PMDA 3DF9A 5LZ8A 5JCXA 4B3MB 1LBIA 3NANA 4R51A 3KSAC 4W7IA 3VTFA 3GLTA 4HB2A 4RU1A 1J8MF 3AI1A 4V2IA 1U81A 3ROKA 4C0BA 4EHKA 5AXAA 1ZW1A 1LVHA 3M6UA 1Z35A 3LF2A 2RI1A 2COUA 2ZBGA 1D2GA 4LHXA 3IQFA 2PLAA 2R65A 4B09A 4R68A 2IXAA 1K7YA 4D9GA 4BMPB 2I33A 4YJHB 5CDTA 2P7HA 1UQUA 3OF3A 1SIUA 2W93A 2ZYIA 2VYVD 5F1KA 1S2MA 4JA0A 4JYPA 4J49A 5DX1A 3BH0A 2D2XA 4N3CA 3QM1A 5LL6P 4QDXA 5IJ9A 1BYUA 2QD4A 3TVDA 3JSXA 5EJ8A 1NVDA 1PAUA 5CT9A 3ZD8A 3LI2A 1UODA 4IDHA 1XU7A 2YIMA 3NHWA 5FX2A 2Z5FA 1W30A 3DOOA 4LZLA 2W70A 3RSSA 1C7EA 1VLQA 5EUBA 1O0CA 5DBGA 4ZEXA 4R5MA 1W0KD 4YP0A 4X44A 5ALLA 1XP8A 4LKRA 4UXJA 1PFYA 4QJ4A 1E2DA 4A8HA 1RRGA 4RHEA 4FCCA 1OX4B 4HR7A 1XZDA 4X9XA 2QN8A 4EHNA 1QFXA 1N1MA 4KH0A 5EIHA 4IY1A 3HB5X 3D6MA 5BOSA 4A6XA 1KP2A 1C3EA 4L3VA 2OHOA 5K0JA 3Q6MA 4HV4A 4FC6A 1ZMRA 2PRSA 2E5FA 4XM1A 2F6RA 1OILA 3MZ0A 1DWPA 3BVPA 1KYQA 4Q1CA 3FNIA 1NVAA 4OD0A 3EXIA 4WASA 2CV0A 4DBLC 4NULA 3GHYA 2H2GA 3AG5A 4I8XA 1F8XA 1H5QA 1RAHA 4MLPA 5AO9A 1R0YA 4JJAA 3WNBA 3ZGZA 3HKEB 4YRBA 4LBZA 1RXCA 1IXRC 6CHYA 4UHDA 1SBCA 5EIOA 1E8DA 3THYB 3EQ7A 2ZIZA 4B82A 1FP4A 5HKKD 3EC1A 2G8LA 4KK3A 3SZLA 1JHDA 3BXHA 4O4IA 1JKIA 2GCEA 3ANSA 4HGOA 4OGWA 3RIYA 1NPYA 4BKUA 2DLDA 3V1YA 3AF6A 3IEUA 1T0IA