3IIKA

The structure of hcinap-so4 complex at 1.95 angstroms resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
molecule keywords Coilin-interacting nuclear ATPase protein
total genus 66
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iikA00
1NN5A 3T1OA 2IS4A 2IWHA 3OZXA 5FPTA 5G3ZA 2ZRIA 4D81A 2OUKA 4QXAA 2BWJA 5DI9A 4YQFA 1DEKA 3OHMA 4NCNA 3KQUA 2BJVA 1GILA 621PA 2CLCX 3AVPA 4DEYA 4A36A 1MV5A 3T5DA 1US8A 1HE1C 1R5BA 5DHAA 2X77A 3TKLA 5KSOA 5EZ6B 1RYHA 4IVPA 1KYIA 3KUDA 3LO5A 4US2R 1W0KD 1VDZA 1N5KA 4MYHA 3U3OA 2R62A 4KODA 1ESNA 1AIPA 1JI0A 3VKHA 4MYCA 2FGKA 4RFSA 4Q02A 3GLHB 2HYIC 4ERNA 1P73A 4BFTA 3SOPA 2XTMA 3I8SA 2GJAA 3WBKA 5BW8A 1AM4D 3WMGA 5F9FA 3VHLB 4R9UC 4UXHA 2KWIA 2ECKA 1HUQA 4ZPXA 3UMRA 1OIWA 2C8VA 1BMFA 4A0HA 4Q01A 5B30A 3GLGB 1KSGA 5KDLA 2VSFA 2ZXUA 4BRUA 4FD2A 1Z6YA 1FP7A 2H7VA 5SZKB 1QG4A 2PMDA 4BUJA 3U2QA 4D6PA 1E9BA 3MWJA 4URXR 1HA3A 5CB6A 4XJXA 3MSXA 2P6UA 4RZ3A 2BC9A 1UBCA 4X8LA 2ZSEA 1P2VA 2QMEA 1YE8A 1TUEA 3ZD7A 4D0GA 3QEOA 3SFVA 4BLPA 4G0NA 1ELOA 3LD9A 1OFIA 4PPNA 4WW0A 5FPHA 2EYUA 2ZSAA 2LKDA 2PCJA 2WJJA 4NCJA 5FBVB 4Z1MA 1NY5A 3QUSA 1D2MA 821PA 3ZH9B 3AP2A 3D3QA 5FOXA 3O8BA 3EAQA 4GZMA 3PEYA 2ZS7A 1E4YA 2VP4A 1LFDB 5FUVA 4C2UA 3O8CA 1G3IA 3CX7A 1Z0AA 1YVDA 1KK3A 1JJVA 2BBTA 3QKUA 5KSPA 4OI0A 2HXYA 2BDTA 3GFPA 3L8ZA 2ZJYA 5BN3A 2YINC 5CJPA 5L3QA 3IIKA 5HKKA 2JASA 221PA 3L8YA 4LY6A 3CR8A 1CJTC 3T12A 3UG7A 3RRNA 4LPSA 4NYIQ 4FMCB 4D26A 4B34A 1A2BA 1E2KA 4FMBB 2OT3B 2RGXA 3RC8A 1NSTA 5DSZA 3WMFA 1X1RA 2AD1A 1E9DA 3AB3A 3VMFA 1Z0IA 1ZC4A 3LLUA 1E9RA 4HAYA 4HAUA 2YC4C 1T91A 2GF0A 2IYZA 4OHVA 2H17A 1JPNA 4DLVA 3M6AA 1BKDR 4JBWA 4PC3A 2W83A 2Q3FA 4A6XA 4DSNA 1I4LD 2RHDA 1E96A 2C98A 1P2TA 4OQNA 4PAQA 4YMWA 3WRXC 3SU8A 3Q7QA 2BM0A 3KQKA 1N5JA 1U81A 2VP6A 4P4TA 5FTLA 4L9WA 3B6EA 3LQQA 4HB2A 1NJGA 4MGKR 4TYYA 1GNQA 4AC9A 4B76A 1PLKA 4YMSA 4GNKA 4E22A 1KMHB 3K9HA 5AUQA 2JJ1A 3B1VA 3I72A 2YZ2A 4LJAA 3IUYA 4MUAA 721PA 4F91B 4W5HA 3X1YA 1XTJA 1NBME 1XXHE 1ZD9A 5TB5A 4LJ9A 4Q19A 2F6RA 2QAGC 1CBUA 4PX9A 4KLZA 4TZ6A 5AUOB 4D4LA 3AUYA 2AD5A 1NKSA 3RRMA 3R7WB 1H8HD 4W7SA 2XITA 1ZUIA 3CLVA 4JBXA 4UNNA 3K0CC 4LBZA 4OHZA 3ZDQA 2OCAA 2F3TA 4PAMA 3CWQA 1VHLA 4PQRA 2KB0A 1QHYA 4Q00A 5HZKA 2C77A 4OBEA 4XSHA 3U3KA 2MMCA 2IUUA 4JL8A 1ZMXA 2ANBA 3KJIA 4U00A 4Z54A 4CF7A 3CR7A 4Q4JA 2QP4A 1IQPA 4FINA 2FPKA 2ZQ5A 4TLBA 2O8DB 3W6PA 1D6JA 5J4HA 1Z29A 4AG6A 3BWDD 4RD3A 1TTTA 3SNHA 1ZINA 1OXVA 2CHQA 3NBZC 2H1LA 3ZJYA 4B2IA 4B6FA 2JGNA 1KDPA 1Q20A 5FBRB 2XOKA 1Q22A 2G1JA 4KI0A 3TVDA 2AXNA 3W9YA 1W4BA 2OM2A 4TTPA 4DXAA 1SQ5A 2WIAA 4EPTA 3QBVA 4QFMA 3I4LA 4IOMA 1G20E 3A1WA 2WWHA 3NEYA 3N2IA 2IA5A 5IHPA 2QAGB 4GOXA 4CEIB 1DAHA 2GJ9A 3LFUA 4FCVA 3TQCA 2PJZA 3GLIA 3CPJB 5H8WA 1XB2A 4QGGA 4QGHA 3K09A 4JKYA 2R44A 2SHKA 1DAEA 3T1TA 4ON9A 3LV8A 3THXA 1HTWA 2XNDD 5FUYA 4GRAA 3CNLA 3V9PA 5F98A 3BH7A 1ZUHA 2G77B 1KK1A 3N2EA 4NU0A 2WOJA 4CVNA 4YXWD 2J41A 3CX6A 4YDHB 5J4LA 2YKGA 2P5SA 3CPEA 2D7DA 1MO6A 1IOZA 4P4SA 3X2SA 4BWYA 3VHXA 4NCKA 4N3NA 3EWAA 3ZZ0A 4HUQA 2BMDA 1DG3A 1YZGA 1G7SA 3A1UA 4BFUA 5F3WB 2NO7A 3ZQJA 4IXNA 3BB1A 1RW4A 3VKWA 1L8QA 4Q4HB 1GRRA 3EPHA 2JIZD 4CZ2A 4U7DA 2IXFA 1ZCAA 4IDOA 4TQ9A 4PANA 3KZ1E 2FNAA 3BH0A 1NG9A 3SHFA 3ZS8A 1XZQA 2HUPA 1M7BA 5A4JA 4L15A 1AGPA 4B75A 3SE0A 5EZ5A 1OKKA 1Z0DA 4IRUB 4AI6A 2PLFA 2JDIA 3ZVRA 4KFSA 3EZ9A 2WIBA 1G7RA 4RZ2A 1E2QA 5EXPA 2JLQA 2FFBA 3PUVA 2EYQA 5KTYA 4YMVA 421PA 3RRZA 5TDHA 2EQBA 3WHKA 4LSGA 5JEDA 3CW2A 1G3QA 1XEXB 1J70A 3EZFA 4LYFA 3ZQ6A 1KK2A 4Q1BA 2QTHA 4R71A 4Q4LA 1T9HA 2QE7A 4V03A 2AK2A 2ZYVX 1U99A 1XU4A 2G6BA 2VYFA 3SC3A 2IUTA 2GK6A 4XTCS 3EA5A 1SVLA 4P33A 4D2IA 5JRZA 4JT4A 4EJSA 2ORVA 4WZAE 3IO5A 3CF2A 3AKEA 1N6HA 3BB4A 1PUIA 4RD2A 4F92B 4ACBA 2QY9A 3MWYW 3VX4A 1VYUA 4OK6A 1QZXA 4EPWA 5J4KA 4MKGA 1U90A 2C78A 4FIDA 4JLBA 2DPXA 1XEWX 4JYBA 1OXXK 1VHTA 2GDJA 2JATA 1G18A 3B1XA 3CB4A 1ZD8A 3SYLA 2OESA 4RKFA 3AV0B 3WBJA 2RGGA 2VLIA 2Q9AA 5EQTA 5KUTA 4QHYA 1KO8A 5FOTA 2VF7A 5G3YA 4AWXA 5KU1A 5M04A 4URWR 4UNRA 1M1YE 4BLOA 3PJRA 1F60A 1XCMA 2F43A 4LJ8A 4O0MA 4TSFD 2ZRDA 3SBDA 1G9XA 2R6DA 2BM1A 5L8VA 1XBTA 1PV4A 1DARA 3LVRE 4L5BA 4HLUC 4JLDA 1DVRA 1TNDA 3NBXX 4LGMA 4LK2A 5FOWA 4ZKDA 4L9SA 3K0EA 1XF9A 2ORWA 2CLDX 4ZCMA 2HJGA 5TV2A 3CF6R 1VCOA 1QDEA 4P0TA 4RFVA 2CVHA 3FGNA 1KI1A 4P3YA 1HV8A 4UNSA 2Z5FA 3ZVLA 3Q5EA 4FWIB 5DN6A 2ERYA 1OW3B 5KNDA 1ZM4A 4HLUA 3GJ5A 1IXZA 2G0TA 4V0ME 3ZIAD 4PHFA 4C0KA 1LTQA 4FW9A 5FTKA 2E1RA 1XPUA 2WSMA 4UXIA 3TSWA 1A1VA 1KGDA 3TQFA 4ZDKA 1E32A 4S35A 3C5CA 1YZNA 3EIEA 3KKMA 4HYYA 4D0LB 1VECA 1P62B 1Q1EA 2OBMA 3A37A 4AY2A 3QXCA 4QKQA 4GL2A 1F3OA 4FI3C 2ODWA 4KO8A 3BRWD 3B60A 4B3FX 2VP5A 1IN5A 1II8B 2HYDA 3QKSB 4IFEA 4OL0A 5D3MA 3C4JA 1II9A 2K5UA 5HE8A 3BFVA 4CYMA 3BORA 4CEHA 2JLWA 4PC2A 2ZYUX 3LBNA 1T0HB 3VX3A 5FR2A 1CJKC 4XTRA 3OAAD 5G40A 1E2MA 3GJ4A 4D4MA 3QSYA 1WCV1 4OI1A 3RABA 2B21A 3F5FA 1K5GA 3SEAA 4EQ6A 2VHQA 4EAQA 2ZROA 1KAGA 1U9IA 2DFNA 4JLMA 4NYJR 1FMJA 1N6OA 2BEJA 4MRRA 4PXAA 4Q1AA 1R8SA 1EX7A 5KSZA 2F43B 1D9XA 3MG9A 2H5EA 1KI9A 5GJCA 1MO5A 2IF2A 4EQ6B 2C9CA 3NBYC 4HLCA 4UJ3A 4KHZA 1P4SA 4NKRA 5K8TA 3T1VA 2X2FA 3AF1A 2GEDA 2NZ8A 3ADBA 2CK3D 4R98A 4BE7B 2F9LA 4R2IA 4LCBA 3C14C 3AGPA 4CEHB 1GNRA 4I1UA 1KMHA 5AK0A 4I81A 3O47A 4DJTA 5AUNB 1CF4A 2QROA 1X6VA 3LRPA 4B43A 4OYHA 3OIYA 5HCNA 1G4UR 5HCIA 2W6JA 4ITRC 2A5JA 1NRJB 2QN6A 3B8HA 2ZYWX 1FNMA 3R9XA 1M74A 2CLSA 2BBSA 4Q4AA 3WYFA 3BBPA 2OZEA 2NOAA 3IBGA 1W7AA 5C18A 4RD4A 2OLJA 1AA9A 5JWHA 3FMPB 2W2XA 2WJYA 1DS6A 3CO5A 3L0IB 1GKUB 1BYIA 2OCYC 4AG5A 1NVVQ 4B2LA 1NIJA 2GBLA 4M0LA 1CU1A 2DHRA 4G3XA 3JZMA 1W48A 3CRQA 1E2JA 1G7TA 2FZ4A 2IYUA 2DWQA 4C7OA 3B78A 5JEEA 2O8DA 1SULA 3GJ8A 4N0DA 2FH5B 4ABYA 5JJIA 3BXZA 2I4IA 4KFTA 1NN1A 5L3QB 3CH5A 4J0QA 1IN6A 4M9SA 2GBLC 2VHTA 1G3MA 1WMSA 4PSAA 1RRGA 1E6CA 3KL4A 4NONA 4YXWA 2J9RA 4MYUA 4YDSA 4C2TA 3U4QB 2BBOA 3HPQA 5FBQB 3UMFA 2NQ2C 5TY0A 2F55A 4DLRA 2V9PA 3SQXA 3VNVA 3GFTA 3SYNA 1IAQA 3RLFA 4JLKA 1KI8A 1P7CA 4JLVA 1FX0A 1JR3D 2PT5A 3W3AA 4V0LA 4ESVA 1T3SA 2VIIA 3LXRA 2UZ3A 2ZE6A 2ZS9A 2WZQA 2GTPA 2PEYA 3OEHD 1NSFA 5JBQA 4TSFA 3ZVMA 3DMDA 1VG9B 2GF9A 5KDDA 1US8B 2NO1A 3KXIA 1LF5A 1FNNA 2ZRFA 1YR7A 4DIEA 1W0JA 2QM8A 3UMSA 1OPXA 4BLRA 1NY6A 3DVLA 2J59A 3HU1A 2Q9BA 1N0VC 4EPRA 4BGDA 1H8ED 4LBVA 1E98A 5J4VA 1Z6TA 1OF1A 2CE7A 4WOPA 1GUAA 4W5JA 4XSGA 4Q48A 3R9IA 4IXMA 3B13B 2W2VA 1R4AA 3NBFA 1X3SA 4S2EA 3CRMA 2GAAA 3P1JA 4POAA 1W0JD 1ANKA 4XD7A 5AUPB 3RS0A 5GADl 1SVMA 3NHBA 5JCZA 1AN0A 1G41A 2FOLA 4MGZR 1KO7A 2WJGA 4B3CA 4OK3A 2IYXA 3ICEA 4CIDA 1VTKA 5JSZB 1N6NA 2G3YA 1BYUA 1H8HA 5FBWB 1W46A 2EWVA 4DLWA 1C9KA 1DG1G 4RD6A 5JRJA 2QPTA 5L3VA 2JLYA 3EG5A 3LDAA 3PCRB 2HV8A 3S1AA 4IOLA 3GLFA 1G19A 1Z28A 2CHGA 3RYTC 4CRWB 4TLAA 3EWSA 3W90A 1QBKC 5A5GA 3IQXA 4O3MA 3VKGA 4CEIA 2EU8A 5G53C 4NBSA 5JI3E 2O8CA 3K0AB 3I62A 1MKYA 4HUQB 3AM1A 3GJ7A 4AIIA 2YYZA 3TIFA 3PQCA 1M7HA 4R7ZA 3VTKA 1Q0UA 1UBEA 4O2RA 3QEJA 1IONA 2QNRA 4TN1A 3SJAA 3K9LA 5KO2A 1YJ5A 2VH5R 4GP7A 2C96A 4Q9LA 3DOFA 4JLJA 2FZLA 1CULC 2J0VA 3EARA 1XMIA 1B0UA 2OV2A 2EFHB 2BMEA 3H2YA 4JZKA 4W5WA 2H18A 1JXOA 2W0SA 3DHWC 4TMVA 5CM8B 1XZPA 3M0EA 1S4QA 2EFDB 3RSOA 2F1IA 3UK6A 2NZJA 3LAWA 2XSZD 3GLHE 2HDNB 5J47A 4C9BA 1RKBA 4X8HA 4KFRA 3TGPA 3NXSA 1KNQA 5FI1B 4M8NE 3BFKA 2YWEA 4ASUD 1SKYE 2EFGA 2VSOA 2JLVA 2RMKA 4DLXA 1JPJA 3A4LA 3OIVA 1U0HC 1LW7A 4PTLA 3V4RA 2ZI5A 5H70A 2R6AA 3F8TA 5SZJA 3TSZA 2WWYA 2YWFA 4PO9A 3GPLA 2IYVA 3AVYA 1E69A 2JDID 2QAGA 2W6IA 1IBRA 3LW8A 1AS0A 4B3BA 4B74A 4EDHA 3ZS9A 2GJ8A 5HR5A 1UEIA 2BIFA 2ZI6A 3O8DA 3R20A 3LBIA 4HATA 2FGJA 4PQYA 1GP2A 2XX3A 2QEQA 1P9WA 2RGNA 5FTNA 2QA5A 1N3BA 3C41J 2FSIA 1NMYA 1JALA 1XD9A 3I32A 5DE3A 2GAOA 2QMOA 4CGZA 3CNNA 2ZJZA 1AQUA 4C4PA 1G16A 3OE7A 1RRPA 1ZUNB 2B8TA 3EC2A 3KJEA 1YZTA 4G5OA 1UKZA 4GI7A 1D2EA 2ANCA 2ZSBA 4C0AC 1ZP6A 4PFSA 1JAIA 4NZYA 2ODEA 4Q7KA 2CL7X 1LF0A 4QOSA 1P61B 4M9QA 2FFAA 1NLYA 2ZAMA 1COWD 2FE4A 1D9ZA 4B3GA 2Q21A 5FUXA 4JL6A 3NG1A 4DT1B 3OEED 5KOYA 2QGNA 4C30A 4HI0E 1G8YA 4LC0A 5DH9A 5IK2A 4DC9A 5KSYA 2B7CA 2QPAA 2V6IA 1ZU4A 2ZITA 4B71A 4PSVA 4HAZA 2OFOA 2IC5A 1R0ZA 2VRWA 1S3GA 1SXJB 5LD2B 1E0KA 2QPOA 1U98A 4DCTA 4C0SA 2QTFA 3BIFA 4RZXA 1Q3TA 3WNBA 4EPYA 4D4JA 3TR0A 1P75A 2WV9A 3H86A 4Y0AA 4TQAA 1ZNYA 2DR3A 4Z8XA 3EPLA 4E09A 2R6FA 2WKPA 4C0QC 1Q21A 1YR9A 2D2FA 4X8MA 1U9IC 2ZSDA 5HTKA 1K8RA 2F7SA 3AF3A 1E2IA 1T8TA 2W2TA 2ZRNA 3PEVA 1UPTA 1G5PA 4JVLA 2HT1A 1ETUA 1Z83A 1E79A 2QTVB 1MABA 4B73A 2ZM5A 5B2ZA 5E7MA 1FX0B 5KPDA 4AK9A 3VR1A 1E9EA 4KVGA 1AQYA 3RANA 3IEVA 1UKVY 2NTYC 3C8UA 2ODNA 4AKGA 4GP6A 5FOSA 2C9OA 3M1IA 2JCSA 5K8UA 2RCNA 1CLUA 4WXRA 1SHKA 1E2PA 2ZPTX 4KLNA 4JYCA 5CDFE 2NMVA 2DFLA 2F9MA 3B2EA 3I5XA 2ONJA 4OI2A 3QNUA 2DB3A 2WWIA 1IY1A 3EC1A 4Q1FA 3T06B 1IXSB 2YC2C 1OE0A 4PO8A 1IJEA 2CCGA 4LX0A 1GKIA 5CM9C 2GZDA 4YC7A 3TBKA 4QBFA 3TUJC 2YVUA 1DTSA 4DLSA 2VP2A 3GJXC 2FMXA 3AP3A 5JJLA 1PVOA 3CM0A 4H9GA 1YKSA 2UKDA 1P9NA 2QAJA 1U8YA 4IHQA 1W5SA 2QGZA 3KKQA 3AEZA 1UEJA 1KI6B 3AF4A 1Z08A 5K8IA 3HU2A 3PVSA 4TL7A 1DAKA 1OH8A 1KKMA 2GESA 4C0BA 2YOHA 3HYTA 3EIHA 1AKYA 4TMXA 3UANA 3FHOA 2OILA 1M2OB 3PEUA 1FUUA 5LB2A 2ZR7A 4A1FA 2YHSA 4D80A 1E2GA 1XMSA 2WAYA 3JVVA 3NC1C 1Z22A 4M1OA 3IPXA 4P31A 5EP2A 4CEJB 5DO9A 1XJQA 2IS6A 2FG5A 3MJRA 4V0KA 4F38A 4QJ3A 1VG0B 4JJZA 4IOKA 3EZ7A 2ZRLA 1CR1A 1OJLA 2REBA 4WIAA 4HDQB 3VNUA 5JI2E 1ZVQA 3FFAA 1ODFA 2CL0X 2ORIA 4RSGA 3X1XA 2BMFA 4I1VA 2FSGA 5LB4A 121PA 3D7MA 2JLXA 4G01B 5H1YA 3R8FA 1SGWA 3FHTA 1GNPA 3MAAC 2REOA 2EW1A 1SXJE 4RCYA 2JJ8A 2RH5A 2GVDC 4OQMA 1Z0JA 5FTMA 2NIPA 3AVOA 1GTVA 3CRVA 4JLPA 2GXUA 4RVCA 3T1QA 2ZANA 3NWJA 3FWYA 2QU8A 1KI2A 2MSEB 5BN4A 3VR3A 3QQ5A 1U0JA 2WJHA 2CK3A 1KIMA 3HPRA 3W6NA 3FMOB 3TH5A 1GDDA 3U4QA 3DZ8A 3THXB 2ZUBA 2GJSA 4FMDF 4NCHA 1DPFA 3EA0A 3CRW1 3CZQA 5DI3B 2GVZC 2ZI7A 3LNCA 3B1ZA 1XTQA 1F5NA 1KO4A 5C4GB 3QXHA 2RGDA 1GG2A 3IEUA 4MITA 4EKDA 1SKQA 3GQBA 2IYWA 2NO9A 4BFYA 4LRWA 4IKEA 1DAIA 3W5IA 3GJ3A 2GHIA 3WNCA 5BWMA 3DMNA 2GETA 1XTSA 1RYFA 1CKEA 2H8KA 2PMKA 3AP1A 3GJ0A 3LY5A 3Q7PA 2BMJA 4A4DA 1OFHA 1KK0A 4HDCA 3THWA 2BKEA 4PAOA 4EFMA 1QVAA 1M6NA 3NDPA 4B2PA 2J0UA 1XRJA 2IYRA 3NC0C 1S96A 2I3BA 2XNSA 3IHLA 4LV6A 3GP8A 2CCJA 1TL7C 4CT5A 3Q3JB 1GM5A 5FOUA 4MKHA 3BS4A 3P4XA 4P32A 4F7WA 1MO3A 3MFYA 2AK3A 3LBHA 2CE2X 4K81B 4BFWA 4KVAA 4MQBA 2YJTD 3DKPA 5CK5A 4M1TA 3G5UA 1UKYA 1XWIA 5SZIA 4OJQA 4Q7MB 2CBZA 2QMHA 5FOVA 4FXPA 2D4HA 3Q85A 2PT7A 4LHVA 2WICA 2QENA 2WSSD 1G21E 1JEDA 4V0OA 521PA 4LJ5A 1TX4B 4JVSB 4LOAA 4Q4HA 3THWB 1NI3A 1G4AE 4CDGA 1C1YA 1KY3A 2V54A 2ZE8A 4Q1CA 1G7CA 1JNYA 1Z8FA 5DLQC 4F4JA 4Q7JB 2GJKA 2O52A 3NKVA 3MGCA 3QF7A 4QBGB 4ARZA 1J99A 2J87A 3IHWA 1KMQA 2GA8A 4LJ4A 4OQLA 3H1TA 1VCMA 3IGFA 1F2TB 5G41A 4QM6A 3M4YA 3NIBA 2X8AA 4A6PA 1R8QA 2WWXA 1R5OA 4FWTA 1IN7A 3TAHA 2G9NA 4A0GA 3QE0A 5KNCA 1XEWY 2RGAA 3DDCA 3RS4A 1BOFA 1RJ9B 4XVQA 2R2AA 1N6RA 4OJKA 1OIXA 3W8NA 4KCGA 4ZV4A 2QORA 1ESMA 1I4TD 2AKAB 5IF9A 5FI0B 4V02A 1MOZA 1TU3A 4Q03A 3PUZA 4QNMA 2JAQA 2O0JA 2WWFA 3IKJA 1G8GA 4URVR 1I2DA 3DOEA 2QL6A 3U7GA 1F48A 2LKCA 5JS8A 3FKQA 2XEXA 4MRSA 2ZUDA 2ZU0C 4XWAA 1EFRD 3PFIA 4D4KA 5FUWA 3NDBB 4JVNA 5HE9A 3W8RA 1Z5ZA 1NF3A 2FV8A 2PJRA 3ZGXA 2PZFA 5CIQA 2GCOA 1QHHA 4M4SA 3SJBA 3N5CA 3SJCA 1G64A 1QRAA 5TMPA 5D3QA 2A5GA 3HWSA 3FYHA 4H1VA 4DKXA 2IT1A 2FX3A 3W34A 2O8BA 1XXHB 2ZSFA 4DLZA 4DCUA 3FTQA 3KJGA 1Q12A 1E1RD 2G83A 2WOOA 3I5YA 2ZREA 4XWOA 3QY0A 1S9HA 3OESA 1E9FA 4A2PA 3SYKA 2ZRCA 5DI3A 1S9DA 5J4YA 4DSOA 3B85A 1BH2A 4B48A 3ZLJA 2PLRA 3EXAA 1AK2A 5IK2D 1G1MA 1N5IA 2DCUA 1OFUX 2ATVA 4YONB 1JECA 1S0UA 1A82A 1V43A 5JZVA 1YQTA 4HZUA 1KJWA 4PSKA 5C4MA 3PUXA 2ZE7A 3K70D 1Z2AA 1G291 2WBLC 4G5GA 1WB9A 3G0HA 4TL8A 3A4MA 3QBTA 1U94A 4FN5A 3R8CA 1SKYB 2A5FA 3OE7D 4QBIA 1N0WA 1JR6A 4BFXA 5CJ2A 1NN0A 3K9NA 3RHFA 2JJ2D 1CXZA 2ZRKA 4KU4A 2J0QA 4OK5A 1WRBA 4N1AA 4PR0A 4F4CA 2HT6A 1X1SA 3UPUA 1M8PA 4LPKA 4HAWA 2P65A 5F9HA 1RIFA 1F6BA 4AKIA 1F2TA 3T35A 1G8PA 3E5HA 5E4FA 2L0XA 2ZJBA 1N0UA 2JJ2A 3AQ4A 3DO6A 5EE1A 3DM5A 3BH6A 4GMXA 3V4FA 2O0HA 1BMFD 3A58B 2ATXA 5KYKA 4BQSA 2XJ9A 5DYGA 5EJEA 3NHAA 2BBWA 1Z0KA 2H16A 4I4LA 4JSTA 4ASUA 1CR2A 1U0LA 5EE0A 3QJYA 3FOZA 4IDHA 3TJZA 2KSQA 4HB4A 4E07A 2GWHA 3K0AA 3AF0A 2ZJAA 2A30A 2H92A 3OEEA 2BOVA 4HSEA 4PO1A 1ZM3A 1L4UA 2C9YA 1GITA 1WE2A 4ZO4A 3TMKA 3X1DA 4EPXA 2IK8A 2AHOA 1FW6A 4UQOA 3CIOA 1EWRA 3ZD6A 4CEJA 4PHTA 4WAUA 2IYYA 3L43A 5ANRB 1XD8A 2BJWA 3UWOA 4C0JA 2UZIR 2ZR9A 1B23P 3RNLA 1IM2A 1F2UA 4GMDA 5TARA 2ZI9A 1NJFA 5JCPA 4JBYA 1FTNA 4TQUS 3G82C 2QRNA 1NVXQ 1VMAA 2B6HA 4UKDA 4JLOA 3L0PA 4DSTA 3K70B 1JAHA 4BZXA 1OXTA 5TVKA 1Z6AA 1NP6A 2R6CA 4EJSC 3PXGA 2O8EB 2AXPA 1RJ9A 1TQ6A 1OV4A 4AYXA 2JLZA 1FUKA 1PZNA 4GT1A 3RVBA 3I92A 1NVWQ 1GZSA 3MCAA 4TYPA 3UXMA 5JJKA 3THOA 5C1BA 3N70A 1QHHB 4EFLA 1M34E 1LB1B 4Q9HA 1J90A 1ZNWA 1ZC3A 4CW7A 4K8OA 1XD2B 3AKDA 3ICQB 1E2FA 4QJ5A 2E9SA 1OB2A 3KB1A 1CJMA 2D74A 3CH4B 1HH4A 4DDUA 2VHJA 4A92A 5BYJA 3R9WA 2J7PD 1GFIA 5CIWA 5CLQA 4A0RA 4F93B 2TMKA 4RJLA 2P0EA 3DZDA 2OFWA 3IO3A 2QMUA 3L2OB 1XTRA 3I73A 2XTNA 5E95A 2HF8A 1VG8A 4LZZA 4BZPA 3DEFA 4II7A 1XMJA 3QPVA 3U6KA 4Q9KA 2A7QA 1ZRHA 4L16A 5J40A 4Z1MD 2BCJQ 1OXUA 3IILA 3QG1A 5FR1A 1KZGB 3ECCA 2DYKA 4X8OA 1UM8A 1ONBA 2N1BA 1YZQA 1UADA 3K0SA 3VR6A 2OAP1 2JA1A 4TYWA 3RWOA 4JT2A 4OQFA 2KI5A 1QHSA 3GFOA 3ADDA 3KXKA 4LHWA 5LPNA 4JLNA 3ND8A 1JBKA 1KY2A 1L2TA 1NMZA 4O25A 3ADCA 2O8FB 4TLCA 4JKIA 1H65A 2F1RA 4TTRA 1BO6A 3FMIA 2KBFA 2EWWA 4MGYR 3K53A 5HKKD 3Q9LA 1NLFA 1UBFA 1JJ7A 1JR3E 5DGXA 1GWNA 2RGBA 2I1QA 2ZI3A 5GVRA 3CZPA 4XH9B 3MMPA 1S3SA 1TPZA 4XD7D 1Z06A 2Z83A 2IX3A 1KI4A 1Q44A 1P5ZB 1E2HA 3AVXA 1TU4A 2HLDD 3Q8XB 1I4DD 2IW3A 1Z63A 5EXXA 3WHLA 5GJVC 2RAPA 1IN4A 2YV5A 1EFUA 3AVQA 2OBNA 3HP1A 1MH1A 1UKEA 4LWZA 1DELA 5JFGA 2WHXA 3CNOA 4ZDIA 4LV5B 4K46A 1SHZA 3CUEF 2PCLA 2MMGA 2OLKA 2CL6X 2HLDA 2IF0A 4GSYA 1E0JA 4NTZA 2OFXA 4MGIR 3OAAA 4ZI2A 4A15A 3X1ZA 4WA7A 1Q1ZA 1QF9A 3K9GA 4KSBA 5FTJA 1GRNA 4WZ6A 1EFRA 5EP3A 2RB4A 1FP6A 3QVVA 1GVNB 3C7KA 4U5XA 3U7EB 3CRRA 4DCSA 1M7GA 3NH9A 2CVFA 3QKRA 2PX3A 4UJ5A 1RRCA 3V00A 5DHFA 5IRCD 4U02A 4LJ7A 4A8JA 3GMTA 1UDXA 5A0FA 2A2ZA 2C5LA 4ZIRB 1AS3A 4QBHA 1YHNA 2AR7A 1A4RA 2CHVA 3D6TB 4RD0A 3E2IA 2FSHA 3ETLA 1O87A 4YLGA 2D7CA 3TW4A 1DAGA 4XVUA 2ODBA 1E99A 4NCIA 1I2MA 3VFDA 1FOEB 4DCVA 3U7HB 2RGNC 1VYVA 4MH0R 4IEEA 1G6HA 2XSZA 4M53A 3QXXA 2DBYA 5HZHA 4M1KA 4NYIR 2ZJ8A 3KUCA 3E1SA 4BRWA 2JIZA 1VPLA 2ZETA 4KBFA 1V5WA 3OFNA 5L3SB 3U3RA 2X2EA 2IUSA 2QI9C 5AJXA 5JECA 4KITB 1R5NA 2XGJA 1P72A 1W4AA 4PZLA 1DAMA 2FFQA 4IEIA 4WVFA 1MO4A 3RC3A 1EESA 1T0JB 2O8EA 3OIUA 4KAXA 4A2QA 5EUMA 3R7WA 1MT0A 4PQFA 1FQKA 1U2RA 2FJUA 4KYIB 5L3SA 3WNDA 2D62A 4JLAA 1SVIA 1OB5A 2QBYA 1KDTA 1G8HA 2Q3HA 1ZIOA 1KHTA 2ZRPA 2V7QA 2PX0A 2ZI4A 2CDNA 4HAXA 4D25A 4FCTA 3OF5A 1HEIA 1ZW6A 2OG2A 2HEIA 2IWRA 2C03A 1XD2A 5L3RA 3EZ6A 1AS2A 3H0KA 3I8XA 5EE3A 4BFVA 5CK4A 2J0SA 1R0YA 1W2GA 3QVUA 5LDDC 4IDPA 1RVDA 5DIFA 2Q3MA 3PUYA 1RPZA 1Z2CA 4IJMA 2YWGA 2Z0MA 4TT3D 5JHHB 4GOJA 4Q5IA 2VP0A 4M9XA 3CX8A 4BZQA 1UAAA 2G0NA 2D3WA 2O8BB 3KTAA 3TLXA 2A3RA 5GJWC 1LV7A 1XP8A 4I1SA 4KSCA 2FU5C 1N6PA 2RKOA 3DL0A 1DBSA 2GZHA 4B3XA 5P21A 2Z4SA 2P6NA 1GKYA 1OYWA 2BKUA 2J7PA 1HQYE 3L82B 1W49A 4ESHA 3A36A 1QHNA 1W47A 2HCJB 4MUBA 4GZLA 3QKRB 4US1R 4BASA 1E9CA 4DVGA 3B9PA 4GBMA 3WXMA 3LX5A 1VIAA 4AYWA 2VL7A 1XNJA 3AF2A 4URZR 1TF2A 3UKDA 2BHRA 3BJIC 1AGRA 4M1SA 2JLUA 3RSLA 4Z51A 3AKCA 3NTUA 5AJVB 2QG6A 2PEZA 1CTQA 5IT5A 4LV8B 1E9SA 1QHGA 4EUNA 2PH1A 4RCZA 4FMCF 3W6OA 3BD9A 4BPBA 1SXJD 1IXRC 3MLEA 4MKFA 1XFAA 4A0FA 4DDWA 1NL3A 5HPYB 4US0R 3IIJA 1WXQA 4EJSB 2CJWB 5C46F 3WRYC 4DB2A 1MR3F 3FHCB 2UVQA 3HJNA 3ZZUA 2CCKA 1NVVR 1FQJA 2VTKA 4EIWA 4OHXA 2WTUA 4E5UA 1IJFA 3DM9B 4DUGD 2ZVQX 1XXHA 1KI6A 1NBMA 3KFXA 3NEJA 2NO0A 2Z43A 5EP1A 2PBRA 3O8RA 1CS4C 3UIEA 3RWMB 1OYYA 4URUR 4B33A 1X8LA 3UATA 1AKEA 2V6JA 2C99A 4G5RA 1FMLA 3PEWA 1MABB 4C0HA 1WBBA 1XCGB 3PITA 2XXAA 4GOKA 1FPMA 1J7KA 3LH5A 3D8BA 3QKTA 4Q47A 4B47A 3EPKA 2ZS8A 4QRHA 2HXSA 1KKLA 1W4CA 4IVQA 4JL5A 4MDFA 3UWKA 2P2LA 3GLFB 1W36C 2CEAA 5CDFA 1TQ4A 3WYAA 2LWIA 1KO1A 3BFXA 2W6ID 3MD0A 4D82A 4PC7A 1W36B 3TK1A 2J0UB 4AKEA 1GAJA 2IS2A 5BQ5A 2ZYTX 3AVVA 3BAFA 2FPMA 1RE0A 2YNMA 3VR4A 5SZHB 4DDVA 4QHSA 1VIYA 3JZAA 1HQCA 3FE2A 5E7JA 3B7GA 5CB8A 1YZKA 4Q9IA 1OFTA 2H57A 1QHXA 1QVRA 2IBMA 2VHUA 3QI2A 1EXMA 2VF8A 3SS8A 1NBMD 3SFZA 2IXGA 2IL1A 3BGWA 2D2EA 3TVTA 2GXAA 2ZEJA 3B82A 4TLDA 4P4UA 1EGAA 5FBLB 2P3SA 1W36D 1IHUA 3IIMA 2NG1A 1XPRA 3ZIAA 4M1MA 2C04A 2W6JD 4A8JC 3REFA 2Q0HA 2E87A 4PPQA 1D8TA 5FL7D 2DFKB 2IXEA 1N2CE 4IOJA 2XAUA 4A9AA 1OIVA 3I61A 3FPAA 1QHIA 5F2EA 4LHYA 2VO1A 3KQLA 2JEOA 4WXPA 2VSXA 2IHYA 3GLGE 1ZD1A 3LQRA 4M21A 1E94E 1OHHA 4DB4A 3P27A 1ZCBA 3GLGA 4LHXA 2V7QD 4JVMA 1TF5A 3AVTA 1DADA 2CJWA 2YWHA 2A5YB 1VYTA 3DPUA 4MRPA 4BEJA 4DT1A 4KFUA 4OHYA 3THYA 1TEVA 5BN5A 5GVSA 2WJIA 3HR8A 3AVWA 1II8A 1O3YA 5D3MB 1E2DA 1UFQA 1E2EA 4HDOB 1D2NA 1U8ZA 1WQ1R 2GCNA 5H68A 1Q3HA 1EFTA 1Y63A 1ZAKA 2ZTSA 1EG7A 3P26A 2GRJA 1BIFA 1ZBDA 2QBYB 1CJUC 1TUIA 2BCGY 2QP3A 2WPDA 3A1TA 3BE4A 1DOAA 4JJKA 3MJHA 4Q1EA 4UXJA 5JWRA 2XB2A 1SXJC 3MRSA 4DLUA 2O8FA 4M1WA 2FPLA 4I1OA 4NYMR 2XZOA 2IEZA 1IY0A 3MWLA 3CWZA 5DYIA 4RKEA 1X86B 5AJZA 1GL6A 3ND9A 1JR3A 1Z07A 1T6NA 1XMVA 4LYAA 4TMTA 3FKSD 4IDNA 1QG2A 2RGEA 2WPDD 3U3JA 4PHHA 4ZCLA 1BS1A 3SZRA 4HAVA 3U7FB 3F3YA 2WKQA 2QT1A 3PIRA 3OFND 1KAOA 2AWNA 3KTAB 1MRSA 4UNPA 4ZKEA 4Q66C 4Q9JA 5JSZA 5KHOC 2JJ1D 5KDOA 3GLIB 1PLLA 4LC1A 4PPGA 2GXSA 4AYTA 3VR2A 2F3RA 3AUXA 3B1WA 4RY2A 2EVWX 3ADKA 3WY9A 2WKRA 1PLJA 2A78A 2AFHE 3I1FA 2C2HA 1Q1QA 5FPKA 2HCBA 2RHMA 3TUZC 1NLZA 3KXLA 4FCWA 4WZBE 1XEXA 2AWOA 4XWKA 1W4RA 1JEEA 2ZRAA 3ASZA 4ZDWA 3VU9A 1NN3A 2PZGA 1YR8A 5CITA 2V1UA 3P4YA 2NPFA 2B8WA 4MA4A 1Z6GA 5EXSA 4LUCA 3B1YA 4OHWA 2GKSA 1TF7A 2KE5A 2OXCA 2P67A 2XTZA 4G5QA 4B44A 3A6PC 1NKTA 5FL3A 2GXQA 2OE2A 1G5TA 4M2LA 2ZJOA 1KSFX 1PJRA 3GJ6A 5KPJA 4TYNA 3EPJA 4TMKA 3SN6A 4EFNA 2WMOB 4QNRA 4BEBA 4HB3A 1CEEA 3FB4A 2AL7A 2GNOA 4PC1A 3IPYA 5B58C 2OO7A 1HURA 3PR1A 3GEIA 2IHBA 2ZVPX 5EE9A 1ZJ6A 2J7KA 1RRFA 2D06A 4HUTA 1GIAA 2ZJ5A 5LD2C 3Q5DA 1WA5A 2EFCB 1TQ2A 1VKJA 4XVRA 8OHMA 1VCIA 3EZ2A 3PENA 1KDRA 4TYQA 5JWOA 4UNQA 3U44B 5BYKA 4YMTA 1ZNXA 1G5RA 2R6GA 4KBGA 1E2NA 2WM9B 5KNBA 4Q4JB 2REXB 1WP9A 2QQEA 1KJZA 4TMWA 3AVUA 3U6BA 5DISB 5B57C 1DO2A 3LVQE 3FFBA 4NPHA 2R65A 4ZCIA 2QSYA 5BXQC 1N6LA 1E1RA 1OH5A 3T34A 2KBEA 1HT1E 1FL9A 3ONWA 2VPPA 1NIPA 2B92A 1JQLB 4HB0A 3C5HA 1R10A 4KJZA 2ASEA 2QUZA 3AGQA 3MUFA 3K70C 1CRQA 1G6OA 3RS3A 4MRVA 5AJYA 1SVSA 2NPIA 3RRYA 2ZRGA 4PC6A 1T3HA 1AJEA 2GILA 3LWNA 4G5SA 1OH6A 2LCFA 4Q4AB 1S8FA 2XJ4A 2WAXA 2GEVA 2BEKA 3A1SA 5AWFC 3K1JA 4JS0A 4M9ZA 4DRZA 4DUGA 1F2UB 4IVRA 1ZM7A 2FEOA 5UKDA 1FZQA 1TAGA 1LS6A 3HU3A 3TRFA 3WP1B 3EIQA 3IQWA 3W5JA 1YZUA 2ZUCA 4AD8A 1A2KC 1X8JA 4TZ0A 4KXFB 5EXTA 5JHGB 2VEDA 4QGFA 1FTSA 1G8FA 2ZIAA 3BC1A 3TE6A 2WVJA 3T5GA 3S1AB 3WMEA 4BFZA 4TT3A 1NMXA 3REGA 1E9AA 1OT3A 3U44A 1KSHA 2RGCA 1EK0A 4I99A 3NVAA 1COWA 3KFVA 2GK7A 2G88A 4TMZA 1E3MA 2FWRA 5J5CA 1K5DA 3KDSE 1NG1A 1Y3AA 3DKVA 1Q1BA 4NDZA 1EX6A 1T5LA 2IYSA 2OEPA 1ZU5A 1KI3A 4C0LA 4AKHA 5C2JB 2FF7A 3HR7A 2W0MA 3KKOA 2OBLA 5FPYA 2ONKA 5JLJA 3GEHA 1ZM2A 2J5XA 2V3CC 1Z3IX 2J3EA 3QKSA 3SJZA 4QC2A 1KNXA 4OKSA 2NGRA 3GLHA 2V1XA 3MWKA 2QE7D 1XX6A 4ZIRA 2ZU6A 4LYHA 1E0SA 1CJVC 1KZ7B 1W0KA 1G3RA 4QL3A 2FFHA 4LJYA 4TL9A 4LDJA 1OH7A 2CNWA 2BV3A 2W00A 1SXJA 4B35A 1TADA 4QGAA 1J2JA 2AKYA 5FL7A 1CRPA 1OLOA 3TR5A 1E79D 1KOFA 4LI0A 3TSOA 3RS5A 4B32A 4DWJA 4GDFA 3VAAA 4PPFA 3PUWA 1R7RA 4JIMA 4NYJQ 3KJHA 5IDVA 1L7VC 3GD7A 2QM7A 4NHOA 4QJ4A 3TW8B 4BECA 1Z6XA 4KV9A 3PG5A 4RD1A 2CNWD 3TNFA 3FVQA 1N5LA 1DO0A 1IY2A 1KI7A 2OCBA 1S1CA 1YZLA 3GLFE 3GLIE 4DIDA 1E1QD 4A2WA 2VP9A 2JLSA 4GFDA 1ZIPA 3P32A 3EX7C 1VCNA 4OI4A 2IYQA 3ASYA 3EW9A 1LVGA 2G1KA 3KQNA 5ELXA 2R9VA 4FMDB 3LA6A 2ZRHA 4D0NA 4M1YA 2GCPA 5E7IA 3UG6A 2YOFA 3OEHA 1KTVA 3ZZTA 3D31A 1K6MA 1E1QA 5GJBA 4H1UA 4URYR 1EFHA 1P2SA 3EASA 1WF3A 2VQSA 2HJVA 4W9MC 3WP0A 4NH0A 2P6RA 2OCPA 3GEEA 1SVOA 1TQDA 2V4ZA 4PZZA 4XIGS 2F1HA 2ZRMA 4P4SB 3F0TA 4C3ZA 3SQWA 3ZVNA 4XOIA 4ZI3A 4LYJA 1P3JA 4HLDA 1N6IA 5LBIA 1CIPA 4LJ6A 1OHHD 2KJQA 4L8GA 2F1JA 3CKLA 1DE0A 1XTKA 3C16C 3SR0A 2XZPA 4RZUA 2V8OA 2PL3A 1J8MF 2A9KA 1GOTA 3TAUA 1JQJC 1ZYUA 5CYOA 3I3SR 3L0OA 1RC8A 2ZE5A 4Q1DA 1N25A 4TWZA 2O8CB 4R2HA 1CR0A 1UF9A 2WWWA 3FDIA 1VG1A 2B7BA 1NNEA 1YU9A 4DDTA 3U3MA 5K8LA 1CR4A 1KJYA 4YMUA 5AJWA 3C15C 1UDWA 1XEFA 1P9RA 4TL6A 3OIWA 1N6KA 3LX8A 3L0SA 3VR5A 2IS1A 5FPSA 4Q21A 5DN6D 4V0NA 4DHEA 4RFSB 5AR1A 2DWPA 2O0KA 1GRQA 1ZM9A 4EPVA 2ZAOA 1A7JA 1XDBA 2QZ4A 1G17A 1TMKA 3CF0A 6Q21A 3QXSA 4Q18A 4LHZA 1RFLA 5JMTA 1JXMA 3THYB 3FKSA 1SVWA 4LBWA 2J1LA 1OXSC 4DZZA 1LNZA 1OSNA 1UBGA 3P20A 1SZPA 3CBQA 2WSSA 1AZSC 3KKNA 2VBCA 1RZ3A 5EP4A 5E3HA 3KQHA 4B6EA 5JS7A 4QHTA 2W58A 5CYPA 3B5JA 1R0XA 2GZAA 1U8AA 5TXGA 5FFMA 2XXAB 1XTIA 3QENA 4ZDJA 1TEXA 1EWQA 1S2MA 4PZYA 2V55B 4BFSA 1R6BX 1W44A 1FFHA 2YOGA 2GEUA 3LXXA 3QF4B 3U61B 1XPOA 5B64A 3JVUA 3WYGA 1NVUQ 1J8YF 4N0EA 4NP6A 4IDQA 3FMFA 1W1WA 2CMKA 3QPUA 4DSUA 2X19A 1D5CA 1LS1A 2I1VB 2R8RA 4TTQA 2VA8A 3KKPA 3B9QA 3U60B 4Q7LA 1YR6A 2QSZA 2XB4A 1S1MA 4O2LA 1Z0FA 3CPHA 1WBDA 4BLTA 1T8UA 3QG5A 3LW7A 1XJCA 1W2HA 2ZRJA 4IW3B 2X1VA 3GCGA 2Y8EA 3K0FB 4A8JB 4QM7A 4BLSA 4B3DA 3K0CA 4DLTA 2O5VA 1P60A 3E70C 2XNDA 3RAPR 4DCNA 2IYLD 1R0WA 4ACAA 4HLQB 2FSFA 1UJ2A 4OQXA 1DAFA 3NH6A 1CP2A 1KDOA 4L4UA 1HY3A 1GL7A 3K8YA 3QOFA 3T15A 2XZLA 1R2QA 3T61A 2QP9X 2OXRA 2EFEB 4M22A 4LBYA 2C95A 2WMNB 3KB2A 2OSBA 3K0FA 4MKIA 2IYTA 2DY1A 1HYQA 4MDEA 3BERA 1A5TA 3KX2A 3A4NA 4C7OB 2J45A 2Z4RA 1T3LA 3BB3A 3ZYCA 3CONA 1E2LA 1XCPA 2IEYA 2ZRBA 5EE5B 3RS7A 1L4YA 2A5DA 2CXXA 3PV0A 3LLMA 1E0AA 2AN9A 2DFTA 4DEXA 1II0A 4PHGA 2MSDB 4NYMQ 1GSIA 1T5IA 1XJ0A 1KSJA 3SBEA 3SHWA 4HZUB 2GCOB 1IN8A 2FN4A 3J81k 4Y0VA 3BK7A 5FH9A 2FDCA 1EFCA 1OKKD 3A1VA 4NL4H 4A82A 4ILEA 3Q72A 2WWGA 4MYTA 3QXJA 4E03A 2JLRA 3W3ZB 4V0MA 3U5ZB 2HF9A 5DNYB 4HEJA 4Z8YA 2ZJ2A 3AKYA 3IBYA 2FEMA 3H84A 4NMMA 3RDPA 4WBSA 4G1UC 1E4VA 4ARZB 2J46A 1C4OA 2Q9CA 1JB1A 1MRNA 4DBLC 4GPTA 2Z6VA 2ZR0A 3HYRA 2N46A 2QT0A 3AH8A 2AFIE 2XOKD 3K09C 3IDQA 3QIAA 4NE2A 3TUIC 1LY1A 4TLEA 3A8TA 2N42A 1YRAA 2OHFA 4MRNA 2QRZA 4HZIA 1YRBA 2P5TB 5CLLA 2Q6TA 1HT2E 2WJVA 1G3UA 1Z47A 3SDZA 5EUQB 1AZTA 3QF4A 1HE8B 2PZEA 2ERXA 3HDTA 2VHCA 3X1WA 2FA9A 3RS2A 3VQTA 1W5TA 2NO6A 2QQ0A 4IFBA 2AX4A 2OAQ1 4KYUA 1KO5A 3BOSA 4BLQA 1PUJA 1SVKA 1T4GA 2DWOA 1P2UA 1ZNZA 4JSYA 1GL9B 3H4MA 1H8EA 1P6XA 2BVNA 4DLYA 4JMPA 4CT4B 1Q57A 2MSCB 3QPWA 4AURA 1WDTA 4F4IA 1X8KA 3SI7A 4QG7A 3VU9B
chains in the Genus database with same CATH superfamily
3T1OA 3LE8A 3W0LB 2VDQB 2VYVA 2IS4A 3M3PA 3PKZA 4JSRA 4AY5A 2OA0A 1D07A 1RZVA 2BLLA 5SYNA 1GQ2A 2WYOA 2WUWE 1WO8A 1W30A 2X3UA 4UEKA 4K9DA 4E2FA 3SBOA 1Z13A 3EVFA 4DTIA 4G09A 2BJVA 4G5YA 1GILA 4RQBA 2BGWA 3AVPA 4DEYA 3VBEA 3M49A 4G8BA 4BGUA 3LECA 2A0WA 5KSOA 1XDDA 2ACKA 2H2GA 3PRYA 3ZUPA 4MWGA 1T2CA 1ZK3A 4WQMA 3I9V6 5AM0A 1WZ2A 1VDZA 2XCIA 3U3OA 1M83A 5K20A 4G5XA 4QFDA 3BWEA 3E3LA 4MYCA 2Z2ZA 1QPBA 3AT1A 1K08A 1VBKA 1JV2B 3QW4B 4U2KA 3ZDZB 5L7TA 2VPIA 3ZE9A 1MB3A 2QR3A 1P4GA 5JJ5A 1RWWA 4RTPA 2C1ZA 2BFBB 1NF9A 4PYKA 1AM4D 1LPBB 3MRTA 1DFHA 3WMGA 5C7YA 4UXHA 5F9FA 5A3VA 3MD9A 4XXHA 2ECKA 1HUQA 5KTPA 3HCPA 3NUGA 4UDXX 2BZ1A 4YHBA 4WACA 3FLMA 3R76A 4HN2A 3UMRA 3L8EA 3F6RA 3IBTA 4G84A 3TM5A 4HDKA 2X40A 1WB4A 4OKNA 5AKXA 2AEEA 3EXIA 1G8AA 1KSGA 5CH8A 2ZXUA 2C31A 4L0QA 2Y71A 4PFQA 2FW8A 1CNFA 1DSSG 4YO8A 1BC5A 3T5MA 2VNJA 3KEMA 3UT0A 4DGQA 1M2OA 3EQ7A 3EGWA 3V7YA 2PMDA 1RRVA 4YP7A 4D6PA 3JWEA 3M9LA 4Y30A 5HJ7A 2A1UA 4URXR 5CB6A 4OHUA 3TX6A 5LN1A 2BC9A 4O5AA 1GCIA 2ZSEA 4FHZA 1GL3A 4I50F 3QEOA 4BLPA 2HJSA 1KL7A 1NW4A 4GBGA 1ORWA 4MMYB 4N12A 2ZUSA 3U48A 3UGJA 5GINE 1ZR2A 1IG3A 1XF1A 3SC2A 1XZLA 3OU6A 1OFIA 3EDQA 3FFTA 4PPNA 3C8DA 4LDQA 2EEZA 2PCJA 4U39A 2WJJA 4NCJA 4ZK6A 5FBVB 1OJ7A 4O33A 3G8YA 3QUSA 4W7IA 1D2MA 1P4JA 3O03A 3ME5A 3AP2A 3Q9NA 1P45A 2YFQA 3KV1A 4MV4A 4BVJA 5FOXA 2GQ0A 3EAQA 3WR5A 4XJVA 2OPBA 4MVJD 4EUHA 2AEFA 3VNRA 3O8CA 1P6QA 1G3IA 3WLHA 1FFBA 4F1WA 4OI0A 3QKUA 3AY6A 1ND5A 3LP5A 4I6EA 4Z9AA 2GEFA 4DAOA 5IVKA 3UV3A 1AUXA 1FJXA 4LZOA 4EARA 3VPDA 1PGOA 2YINC 1E92A 4IXTA 4AZSA 4LDAA 4BVGA 2PYDA 1GPKA 5HKKA 9ATCA 221PA 2PE5A 1HSZA 4NBWA 4LY6A 3KAPA 1ARZA 3KAJA 2FAXA 4LPSA 1CRZA 1F12A 1N8NA 4WL0A 3ETJA 1OU0A 4FMBB 4AUMA 1X1CA 3RC8A 4LK3A 3W04A 5DSZA 3TZCA 3WMFA 2AF4C 1PGJA 1QO0A 3OD5A 4YS6A 1O77A 3C1OA 3FOBA 1PD0A 3HBFA 1QPZA 1E9RA 3HA5A 4HAYA 5KX5B 1EFKA 1QG6A 4HAUA 1IVNA 2IYZA 4IFIA 3GRYA 1BW9A 2B99A 2FZEA 1T5SA 2XUKA 3FZQA 3BN3A 1BKDR 4P84A 3V7WA 3WLMA 3RSQA 5JNVA 4Z53A 1U8CB 2ORYA 3HNPA 3GJSA 5CCBA 1C1HA 3OE4A 4YMWA 2XYVA 3BDIA 8ADHA 4IUDS 4K6GA 4TXLA 5L95A 2CV1A 1U81A 4UPDA 4EY7A 2GLTA 5IVPA 4L9WA 4GC9A 4BQQA 2VHZA 3TW6A 4ID3A 1JUDA 3PYMA 4EECA 5FUQA 5E2IA 2QVYX 1GNQA 5I9NA 4CMBA 5EJFA 4JCCA 3WLRA 5FI3A 2R79A 2ATCA 4AC9A 3HVHA 3D4BA 4B76A 1V8FA 3IDZA 4GOOD 1M1YA 3DUFA 4LGCA 1BGWA 2JEYA 1JHPA 1SQSA 5AUQA 3B1VA 2ZW9A 4RJIA 4MUAA 3ZW8A 3IUYA 6NULA 4Q9NA 4F91B 5FBHA 4BV9A 3X1YA 3IL2A 3B36A 2HSWA 2WT8A 4RKWA 1ZD9A 2XUPA 4IYRA 4UOQA 1B0ZA 1O57A 3Q3GE 4HNAA 5DHSA 3X44A 5DYTA 5TEVA 4AD8A 4YCCA 2J07A 3AUYA 2J0EA 1T8YA 1DWPA 3AXTA 2I54A 4LKOA 4RPLA 2BRUA 3WQSB 1YAHA 3NNDA 4DEVA 4UE3S 1MQSA 1XFDA 2QJFA 5BSMA 4JP3A 5EMHA 2I6TA 2YH2A 1SNYA 1Y5LA 1JRLA 3C3YA 4FYVA 4KQ9A 4PAMA 3T4XA 5BV7A 4PQRA 4EG8A 2KB0A 2XMPA 2YW9A 4FFDA 2WB2A 3OX4A 4OBEA 4HLNA 4XSHA 3U3KA 1Y3DE 4L5JA 2MMCA 1R4NA 1TYBE 2CV2A 2FQYA 2I4RA 1EEHA 1HKHA 3AFNA 3LL7A 3ANNA 3H2ZA 4MP8A 1NQWA 3NYIA 3B3JA 4Z54A 1CY1A 5K6AA 1JHVA 2PFKA 3OJCA 3LDFA 3T4EA 4R41A 4H4CA 2VK4A 3O94A 3G0CA 1MX1A 5HM6A 2LNDA 1EM6A 1NZFA 2KLBA 1PFVA 1R27A 2P77A 3PA8A 4YWHA 4TS4A 2QLNA 2BFBA 4LXIA 1TTTA 3CEPB 4I2VA 3KNZA 1F9EA 3NBZC 3PC3A 4YMGA 3DE7X 1PCXA 1U4NA 4IV0A 4RF4A 3C5WP 4BMXA 1Q20A 1W87A 5FBRB 4CLRB 1V7ZA 4JJGA 1BWPA 1TKAA 4EGCB 4J29A 4DNXA 2FQWA 5LKRA 2QUIA 3K2IA 4YR7A 2KPOA 4MJLA 4JJIA 3QBVA 3I2YX 1WETA 3BF7A 3T94A 5FF9A 1J8VA 1JT2A 2DC1A 1JFRA 1Q7RA 3AQIA 4RWZA 2E5LB 3RIHA 5EWLA 4X62B 1J5XA 3QEMA 1SU6A 1FIUA 1ST3A 3TQCA 3GLIA 3H6HA 5HK9A 4AF6A 3QY9A 3QHAA 1XB2A 1NMEA 4QGGA 3SSAA 3W1WA 4K28A 2HDOA 3E1KA 1KQGA 2FPGA 4JKYA 5SV2A 5BN1A 3HBNA 1X13A 2HCFA 3BHMA 3SGLA 3V8BA 2OECA 2QV0A 4FTWA 1CUHA 4IXWA 4XUDA 1CUXA 1QC5A 2WIGA 2IELA 3IVRA 4NU0A 2PL9A 2XMZA 2J9FA 4O2AB 4CVNA 1GTSA 2J41A 4YJFB 1YGPA 4LJKA 3B8EA 3F6SA 2XRMA 1GG9A 1WPQA 4YJDA 5JSHA 4P4SA 1FRZA 3VHXA 2GWRA 3ORFA 3EZXA 2BR5A 5CYGA 4U2DA 4P58A 2O6LA 2OMEA 4LXQA 4HUQA 3WDMA 1V26A 3BSYA 4RTQA 3OFSA 1GTG1 4QARA 5K0JA 1YZGA 1G7SA 3HCFA 2GM5A 3HJTA 2QVXX 3I52A 3ILYA 3Q41A 4KLCA 4KUGA 4IXNA 5CTJA 4ZU3A 3ZWMA 3ZQJA 5B7NA 4FHCA 3TW8A 4JIGA 2F9FA 1H1DA 3D81A 4Q4HB 1I4EB 1PR1A 4WLOA 5A5EA 1D2GA 4JEUA 3EPHA 4BNWA 4OH7A 3OF2A 5CLHA 3TFOA 3K6RA 4XLTA 2RAVA 4X1YA 4NJMB 4OJTA 3SHFA 1NONA 4B81A 2E18A 2EV9A 4LRQA 5TX7A 1QORA 2HUPA 3BE8A 1M7BA 2QY6A 4PLCA 1JLRA 4FNGA 5A4JA 4IQ0A 5ALZA 4BKMA 3SWWA 3VNQA 5FHRA 5CA1F 5EKDA 3PNYA 4JBLA 3DBHB 2CLHB 3LBYA 1MF7A 2JDIA 1QBGA 4UBMA 4XX0B 5CD9A 2FN8A 2PNFA 4DW8A 3H42B 1M6WA 3HDGA 5GONB 1EUYA 4RZ2A 1E2QA 2VDPB 5FJJA 5ERYA 1SD5A 3D3JA 3E9NA 3FSJX 3S70A 4QU0A 2QLJA 5I45A 1JKMA 1Y4SA 1XMQB 3DNFA 1VCHA 3GDFA 4MEAA 3PD7A 3NT2A 4D1YA 5B4VA 3KVOA 4L3VA 1L4NA 2EQBA 3AB8A 3WHKA 1AY0A 4BNFA 3MB5A 4ALJA 3EZFA 1XEXB 1DIRA 4RESA 5LYYA 3RSFA 2APJA 1EBUA 2JPDA 4EF4A 3CN7A 3ROPA 1LV8A 1R8XA 2WTNA 2CMFA 1B26A 4MQFB 5GZ3A 2QE7A 2WSBA 3WLEA 4BNUA 1XU4A 3CSDA 1UBTS 4K3VA 3EA5A 1J8FA 1L3CA 2G40A 3DYVA 3FDZA 4IF4A 4JT4A 2XWQA 2W9XA 2I78A 3IO5A 3AKEA 2VSNA 2AG8A 3UMVA 4X1IA 2CGEA 5CW2A 2W8BB 1ZJWA 4OK6A 1AK9A 1QO9A 2HWXA 3CEMA 2BEVA 5J2TF 5KO2A 3VUEA 4JLBA 4DA8A 4DN6A 3QVGB 3ORQA 1VHTA 2GDJA 2X58A 3T3IA 2JATA 1GFZA 3DOIA 5B3AA 2HO4A 3AESA 1V3UA 1VLJA 2E4XA 3MWEA 2GTIA 2RGGA 3KJXA 1CE8B 1QYIA 2HHAA 5K0BA 1L4EA 4MCAA 1GA1A 2VF7A 2YY7A 4XCQA 4AWXA 4DG9A 3EZGA 4BLOA 1XCMA 4LJ8A 2F43A 2GB4A 2MJLA 4H31A 2DG2A 3G5AA 1THZA 1T5HX 3FVWA 1H66A 5KJFA 7REQB 4JU9A 4L5BA 1TEZA 3A2LA 5HGXA 3KOZA 4JLDA 4LGMA 4LK2A 1PV4A 1G4HA 2YJNA 3K0EA 1DC7A 5KNLA 4B1FA 2HJGA 2OQ2A 3E15A 4ER6A 1QRDA 2PA0A 3DP9A 4TUYA 3N07A 1L9XA 3C3XA 4O4HB 4GD3Q 1YAJA 1EBBA 4U8GA 1VPEA 2X0EA 3OPNA 3PVCA 1HV8A 1Y1RA 3QWHA 2XQGA 2Z5FA 1KQPA 3Q5EA 2IYAA 3IEPA 4FFSA 2NZYA 4ZXPA 4DJEC 2ERYA 4EHKA 1OW3B 1GRVA 1PWEA 2GZRA 2WUEA 3UBMA 4X7RA 3EB9A 3PVZA 2HBRA 3L04A 1EVEA 4PHFA 3W4IA 1SKMA 4IIGA 2I3DA 4MWTA 5HG0A 4UTPA 1LJLA 2YN0A 5FWNA 1E7MA 3MJTA 3TD9A 2F8LA 3TQFA 4EY8A 1CE8A 3PDCA 3EIEA 3KKMA 2JKZA 5A6VA 1U7PA 1GZUA 1GV0A 1WCIB 1X7YB 2YQ4A 5K0LA 1VECA 1P62B 1GSAA 2NV0A 4NBTA 4DG5A 3FLBA 1RBQA 3HJAA 4ZT7A 1VKNA 2GYUA 2X9QA 1II8B 4RC9A 1LBEA 4IFEA 4XWTA 2OC4A 3UJ9A 1KVUA 3B9RA 1II9A 2N9UA 5FCDA 1V6SA 1SR8A 2Q1WA 3OUZA 4TXHA 1MVNA 1P1CA 2AGVA 1U7UA 2IXAA 5F7ZA 3VX3A 4X64B 1X7HA 1SC3A 3W9SA 2OV4A 4XTRA 4G63A 5DNCA 2NP7A 3FYCA 3GJ4A 1JR4A 4LY0A 4JLWA 3RHZA 4BX9A 4D4MA 1EB8A 3QLVC 4PW0A 3RABA 1Y82A 1K5GA 1Z39A 1P1FA 3LHIA 3DL2A 3OSZA 3IC5A 4NEGA 5F64A 1F38A 1B1CA 3H13A 5EEGA 2WQ7A 2VR1A 4MRRA 4Q1AA 3QMWA 1EWVA 4I6JA 2GN9A 2E55A 4BHTA 4HVAA 1UQRA 4QYSA 2DUUA 4D4KA 5KSZA 1D9XA 3MG9A 1JYEA 2H5EA 3CB2A 5IDQA 4EF6A 1KH2A 1A4XA 2DX7A 3E4CA 2J30A 2NAPA 3TI9A 5DTRA 2C9CA 4JT9A 3D6MA 3HEBA 3NBYC 1MB4A 1IXKA 1RLOA 3B89A 5ES4B 2QQ5A 1M0TA 3VJMA 3AF1A 2CKMA 5I4BA 5JH7F 4YRLA 5KSYA 3ADBA 1J5EB 4R98A 3QLUC 4I5DA 3DC2A 3KT0A 2GNPA 5CH5A 4CEHB 4LTDA 3JQ7B 4X41A 3NLLA 3V4VB 1KMHA 3DWEX 3L84A 4QDKA 4CG0A 4I81A 2WJAA 3O47A 3U4AA 4DJTA 5AUNB 1CF4A 4EVQA 2IXTA 2WWTA 1NRJB 2RJ3A 3F9RA 4WTOA 1O1YA 4HDRB 3LPAA 5G4KA 3NBMA 1JLLA 3ZNQA 2BBSA 1TTHA 1E1LA 2NOAA 3WL3A 1PW5A 4RPCA 1WHSA 3CJQA 4JI5B 2Z9BA 4LXGA 1AA9A 4H7DA 4P92A 4RK4A 4UUBA 2W2XA 1NQVA 1R4MA 2PD3A 3F5SA 4INZA 4CTOA 2PZKA 1NRXA 2YRFA 5ECYA 4BX3A 4ETIA 1BYIA 1R9NA 2OCYC 3VVCA 3ZBTA 1PQUA 2NSDA 3ZJTA 3T54A 2QXUA 4B2LA 4WBNA 3RTGA 4H0CA 4EW1A 1LBSA 3CRQA 5SYAA 4PRKA 2R11A 2XLCA 2DLDA 4LY3A 2FZ4A 3ETHA 5MGNA 3JQ7A 3QVOA 3B78A 3M4ZA 1SULA 3PEEA 3GJ8A 4Q3LA 3P0EA 1YZVA 4HKTA 3HB0A 3ILVA 5H7XA 5CLFA 2MDTA 2CXQA 4Y7DA 3QEMB 4JBHA 4UM9B 3CH5A 2DQYA 1QLHA 5DSTA 4AJKA 4HDRA 4NCBA 1X15A 4PSAA 1E6CA 4RPIA 3ETEA 5ICCA 3W2GA 2HADA 3KL4A 4RA9B 2VWGA 4YJKA 4YDSA 3RTEA 3CRZA 5E3JA 3RVPA 2QUBA 3UMFA 3RU3A 4DLRA 2V9PA 7ADHA 1E7YA 3R3WA 3WL6A 1JAXA 3DAFA 1EM8A 1P7CA 3BX1A 3TPCA 3NDJA 4JLVA 3UK2A 4YRMA 1T4CA 1JR3D 4P7BA 5GMOA 4V0LA 4RFLA 2E85A 3L05A 4LYDA 3WKEA 3L06A 3LXRA 3U5ZB 3EGEA 3L7AA 5DHPA 3OEHD 3ZU2A 4AAYA 2V4UA 1M34B 3DMDA 4EATA 1QTQA 1BSVA 4NEHB 5KDDA 1A9RA 5F35A 2RSLA 2OYRA 1FNNA 2VK8A 5J1TB 3WTBA 4ECEA 2QM8A 3GMIA 2DLCX 1CC1S 2XA9A 1NY6A 1P4RA 1Z8NA 3DVLA 2J59A 5IMBA 4EKNB 4EZEA 5LBUA 2JIOA 1JKJA 1YMUA 1H8ED 2CE7A 4LWOA 2Z5VA 3T3EA 5AW4A 3UW3A 1Q77A 2W4MA 1GUAA 2X5NA 2D7JA 4IXMA 1Y5IA 4F3RA 2W2VA 3NBFA 2J9GA 4MVYA 5F23A 5ER6A 4R1MA 4MR7B 4TKVA 5DF1A 3MWDA 2X7JA 2GAAA 3FCOA 4UMEA 4WY5A 1ANKA 2PV0A 2FLWA 3MTQA 4YHHB 1P7VA 1N2CB 1ULTA 4C4XA 4LZPA 4JJFA 5GADl 2XB6A 3I04M 4BU1A 4HH1A 1U0TA 5G0TA 2ODPA 2WJ6A 1KO7A 2C5SA 1HR0B 3Q11A 1Q95A 3HB4X 4B3CA 1ODLA 3ICEA 1VTKA 4UFNA 4AYTA 1N6NA 3N8KA 2AMLA 5JSZB 5PGMA 1CUYA 4L8VA 5AM4A 4DLWA 2YRWA 5JRJA 3DLIA 3U3DA 3IVGA 2Y1GA 4UM7A 2D5IA 4CIWA 5KQPA 3EG5A 5CX1A 4M55A 3PCRB 2HV8A 1PR2A 2GBGA 1G19A 1Z28A 3ZTYA 3BCHA 2OVFA 4IZHA 5KNDH 1QBKC 2ZQZA 5FWAA 1BX3A 3LBAA 2XF2A 4NBSA 1Q1NA 5JQGB 5JI3E 3JQRA 1KJIA 3LYAA 1OZAA 4R8RA 4YH1A 1RYMA 1MKYA 2VDMB 3OQVA 5IXSA 5FNVF 3C4QA 3AM1A 3GJ7A 3ZDXB 3PQCA 1M7HA 1RBZA 3VTKA 4UEWA 1Q0UA 5AOAA 5K3BA 2FPIA 2WYUA 2QNRA 2X5KO 4CKEB 4RTKA 1S2NA 3WLPA 3KLMX 4U3JA 4Q3NA 4YAOA 1B4DA 3EARA 1XMIA 1B0UA 1U2GA 1R1DA 2VNIA 4FDUA 3JASA 3PYLA 4BO3A 2EFHB 1CY7A 3OLCX 3Q8MA 1B43A 3OZGA 4W5WA 4N5MA 4KK3A 3SSOA 2H18A 1JXOA 1GU0A 4RA6A 4CV1A 4IG9A 4ZYZA 4EVIA 5CM8B 3NBKA 3M0EA 4W1SA 2OPHA 1F2DA 1YR2A 2WHPB 2ZB4A 2LV8A 2H2WA 3OZ7A 5K2MA 3GA0A 1EH5A 3RSOA 3UK6A 3CZCA 2BSXA 2ZBQA 1R4ZA 2HDNB 4YRNA 4IO0A 2WT4A 1RKBA 4TWRA 3ZY4A 3NRCA 4UD6A 5FI1B 3OHSX 5AIAA 3BFKA 3PI6A 2YWEA 5ALNA 4ASUD 4TPKA 2EFGA 4ZOQI 1PZGA 4ARUA 3D54D 2JGLA 2D1QA 2OGTA 4DLXA 3COSA 5LFAA 1TJ4A 2MYUA 1PGPA 3JYOA 1QK5A 1U0HC 1ECLA 1LW7A 3N2GB 3EZYA 4PTLA 5J58A 1JQBA 4OL9A 4A8HA 2CY0A 3AI1A 1YL5A 1DG9A 5SZJA 1DXQA 3F8TA 3TSZA 1H42A 2VUTA 2YWFA 2Z2KA 3DJYA 3WWPA 4F2HA 4Y1FA 2JDID 5SICE 3LW8A 2W6IA 2V7VA 5EWLB 1AS0A 4B3BA 1F14A 1YOVB 4ZQFA 3ZS9A 3VPCA 1G5HA 5JU6A 3TLEA 3O8DA 3QWFA 3R20A 4EA9A 2FGJA 3HUUA 1GP2A 3WS7A 1PO7A 1P9WA 2QEQA 3WYEA 4D98A 5HKAA 3E2PA 1KRWA 4DLKA 1CX9B 1I9CA 3EIWA 3PC4A 1XD9A 3T1YB 3I32A 4CGZA 2GAOA 4QDXA 4WH0A 4ALIA 4WY2A 1U3FA 4R6XA 2BEUA 1AQUA 2ZWVA 4N39A 3V4PB 4C4PA 2B8TA 1ZUNB 1QIEA 2PDAA 3VUFA 5LWQA 2WR8A 4PNZA 4C0AC 1ZP6A 3FUUA 4BNHA 2ODEA 3RBAA 1PZFA 3O21A 2F1KA 1Q74A 4FNOA 2FFAA 3IT2A 5KNBH 3ZC3A 1D9ZA 1ISGA 2Z95A 4JYPA 4ZPJA 5FUXA 2VDJA 3O1IC 4Y1RB 1GPBA 2CJFA 4FOSA 1TZBA 4M9CA 2QGNA 3GN1A 2HA2A 4H6VA 5JVDB 1NASA 4LC0A 1YMVA 5IK2A 3ZH2A 1USVA 2CVZA 2E89A 2VAWA 1JLKA 5JXJA 2PGNA 2E4ZA 4FNAA 2OO5C 4JAVC 3PHLA 3U4DA 3I5UA 1LBQA 1S3GA 1L7PA 1SXJB 2HZBA 3JQBA 3Q7SA 3U4MA 3GLTA 2W2LA 3O74A 3OC0A 4UEJA 4CM5A 3H5VA 2G9QA 3O8OB 4TLLB 3BIFA 3WNBA 2QTWB 3BFJA 3TR0A 2WV9A 3NHYA 2X2OA 4DA6A 3NCHA 1ECPA 1QIDA 2Y0DA 3DOUA 4FN4A 3LHFA 2AFRA 3G2JA 3R5XA 5CURA 1ZNYA 4BZZA 3MWGA 5AH0A 2PBZA 2DR3A 1F4PA 3EPLA 4GOND 4HXGA 2R6ZA 4ND8B 4Y1GA 5DPMA 3NTVA 3T4UA 4IJKA 4X8MA 1U9IC 1CP3A 1JDBB 1NNI1 3MQ2A 4RJ2A 3O9VA 4H59A 1LLDA 5HBRA 3GQBB 3MS2A 3PI7A 3MCZA 4CKCB 2ZRNA 3ZBPA 3CISA 3PEVA 4D92A 5KCZA 2V7WA 4WJZA 3ROTA 3KWMA 4DPKA 2Y1LA 2IYFA 5CVTA 4B73A 4PWYA 2PKCA 5B2ZA 3B70A 4DMHA 1NYRA 1ZW1A 2H7XA 3WIOA 4LY9A 5KPDA 4UAGA 5BNIA 3ZIDA 1J1UA 1UT8A 3C3PA 4KVGA 4TX1A 5H59A 4XM2A 1TW3A 2YV4A 2H48A 3AUKA 1Z4PX 3ETDA 3TZQA 3ITKA 2NTYC 2ERCA 2PO5A 3C8UA 2ODNA 1I2CA 3PLAE 4FZ5A 4RY8A 1S3IA 3M1IA 4LRSB 1CLUA 3AL2A 4BCBA 3UJ6A 2G63A 3DVSX 3GQVA 2FP3A 3BREA 4KPUA 4X85A 1XYYA 2VG8A 4YRTA 4AQDA 1POXA 4Z4IA 4FSHA 3WVNA 1I0IA 3QNUA 5D51S 1WY5A 1VE5A 5C80A 3UK0A 1C41A 5FX2A 3PLNA 1XVTA 3EC1A 1IXSB 4KV7A 3I39X 1C30B 1OE0A 2IPMA 3AR4A 3BRWA 4PO8A 1IJEA 4GZ3A 2OXEA 1YTUA 1NNUA 2B5VA 1GKIA 5CM9C 5I47A 2ESRA 1L7XA 1CUEA 4MSUA 1AB6A 4DLSA 4X95A 1KOGA 1Z5VA 2VP2A 2W6OA 1B15A 5JJLA 3K1TA 1GGNA 2C4WA 3PZBA 2FMTA 2HQ1A 2YWCA 3R24A 1SCUA 2QAJA 3ZIUA 4P22A 4XQ9A 3KSRA 3HU2A 3K0HA 3WO0A 1DAKA 3W8FA 3GP5A 1CZRA 3OCYA 4OAPA 3V33A 2WQZA 3EIHA 3EZLA 3R0XA 1RAFA 2ATEA 2GCIA 2R85A 5L7WA 2B83A 1HQDA 3EMKA 2DBVO 4BJ5A 4BYGA 1GQSA 2VRCA 3TMAA 1E66A 1TM7E 4HTFA 2P1ZA 3F9IA 3PQ5A 2HJWA 3BK1A 5LB2A 1Y1SA 2I2WA 1J25A 2PZ8A 4KQMA 2AVNA 2IDMA 1U0RA 3F6PA 4IZ6A 4AWAA 4Q0MA 2PFSA 2WAYA 1E3DA 3IPXA 3H1PA 2QIOA 1WSBA 3RT7A 4CNQA 4BC0A 2AQHA 4O63O 3TLKA 1PNVA 4CU2A 4TROA 3IQEA 5A05A 1U02A 3JWIA 1F7VA 4MR9B 4DJDC 2LCQA 4ESEA 1YRHA 1CHDA 4F5YA 1ULHA 1L5FA 4WIAA 5BSVA 3KQPA 2PSDA 1KERA 1FFCA 1ZOOA 3EH2A 5JI2E 2I2DA 4CWAA 5EJGA 5BV0A 4UTZA 4Y2SA 4V2UA 5ESRA 2BMFA 2K6GA 3D6NB 4I1VA 4CQMB 4DM3A 1QWSA 3RAGA 4IGFA 3FHTA 2XDYA 2REOA 2NSYA 2Q4OA 3QE3A 2H0QA 1SXJE 4K9SA 1O9BA 1JIJA 3I9MA 4EEZA 3B3GA 4OQMA 1Z0JA 3K2QA 1DTWA 3MN1A 4FEYA 2AJCA 4NHEA 5AI0A 4AMGA 2ISCA 3LC0A 2IVZA 3I64A 1Y1KE 4QSMA 2PRKA 4BO1A 1UPUA 2C0CA 4OBXA 3H5TA 5BN4A 3HSYA 3ZWDA 4B3RB 1FTQA 1KIMA 1GXSA 1O8CA 1Z68A 2HM7A 2QTRA 4M87A 1NW3A 3SDBA 2E5FA 5C1PA 5C5CA 5CDHA 3IAUA 2ILTA 1MJGA 3U4QA 1ECFA 2VH2A 4EYKA 5BW5A 4MHSA 1KQNA 1DPFA 4OXIA 2IW1A 3WOHA 3HA3A 4M7PA 5DI3B 2GVZC 3NVDA 5AVTA 2ZIXA 4QWMA 3RUCA 1F5NA 1BRTA 1NOJA 2FLVA 2LGJA 4PAGA 1NXWA 3O93A 3RSGA 2PGXA 4YN3A 4RHFA 1L9KA 4DIOA 3HDVA 3H97A 3PWTA 4IUBS 4LRWA 4OXQA 2KHZA 1DAIA 1U0EA 3CZ4A 1VSVA 5CXSA 1JIKA 1H69A 1CS0B 3A4VA 3DMNA 3G2IA 4H60A 4IIVA 1TCUA 3LX6A 1FA9A 4MQMA 1SUSA 3GJ0A 4NULA 4MA0A 3A6GA 2BMJA 2QNIA 2NLOA 4K9MA 3D0RA 3OQNA 1GCOA 1KETA 2HRQA 2QX4A 3KJQA 1ZUNA 3WZLA 3SAJA 2EG9A 1QVAA 1VMDA 4PZUA 1ICIA 3OZSA 4YRZA 1YVUA 2B0JA 2XVAA 3LPMA 3IHLA 4IQFA 4BQOA 2CCJA 2E3JA 2RKWA 3BDVA 3QWBA 4RS4A 4N7BA 3BCSA 3SKVA 1NUAA 2J33A 4CT5A 1JMYA 1TZ2A 3INTA 2YS6A 4MKHA 6PFKA 3BS4A 1Z5WA 2CJXA 1F51E 2VTVA 3P4XA 4P32A 3OIGA 5KQRA 2QF7A 3MAJA 2O2SA 4UCQA 4Z9YA 2CE2X 3R0ZA 4BFWA 1M10A 2P6PA 3DKPA 4DVJA 3JQBC 4CMGA 4MDYA 3VPHA 3TZHA 3FJ1A 3HN6A 4M1TA 5CK5A 2HOQA 2FOXA 2JW5A 1BDMA 4KOAA 1L5GB 2PVCA 2HDWA 1YS9A 4LHVA 2VTBA 2QENA 5IBCA 4EGSA 2AE2A 2C2WA 3AEQB 4GO1A 4PIVA 3JVIA 1G21E 1QCCA 3CPSA 1VLZA 1TX4B 3PT5A 4LJ5A 4Q4HA 3ZPXA 4EI8A 1GTRA 3THWB 1NI3A 1G4AE 4CQLB 4CDGA 3DNPA 2A59A 4IH4A 3ZKWA 2D5BA 1P31A 1V11A 3HCCA 4B82A 4Q1CA 1G7CA 2WDPA 2BFCA 4F4JA 4P83A 2E0IA 2OL4A 4FR5A 3U0VA 1R16A 2GJKA 2J5RA 2O52A 3THRA 4BRSA 2C3UA 3DDNA 3MGCA 3VNSA 4AP5A 1ISPA 3EEIA 2J87A 2JZNA 5ENVA 2GA8A 3PGA1 4OQLA 2D1YA 3FX2A 3IGFA 1A72A 5CT8A 1H2WA 1NJSA 1ZD4A 3UHAA 2F48A 2X8AA 1EM8B 1Q1AA 2AA3A 2GAJA 3HB1A 4GOMD 4LISA 2WWXA 3RVSA 1RKQA 3T6KA 5KNCA 2RGAA 4JFRA 1UJNA 3CLRD 1CSEE 1J5PA 2B3TA 1B41A 3JCZA 3RS4A 4EOGA 3EVZA 3F3SA 3ZI7A 3O0DA 1NR7A 1JYFA 5JPDA 3KC2A 4OJKA 1GDHA 2R5NA 4NNPA 3SK0A 3W8NA 5BVHA 1T9BA 2AKAB 1A5BB 1L7NA 2IJGX 5FI0B 3VISA 4V02A 1RLIA 4B9AA 3PUZA 4QNMA 4RXTA 3WWYA 4ENSA 5KTMA 4NZPA 3GGGA 4D99A 5B6PA 1I2DA 3HLYA 4NOMA 1R5JA 2QL6A 3G79A 3QFSA 4FEGA 1DGQA 3FKQA 4IMJB 3LUHA 4MRSA 1WM1A 3AIIA 1EFRD 3F2VA 4UD2A 4XWAA 3KHKA 5FUWA 5HE9A 5BSTA 3UA4A 3W2EA 1E62A 4QTYA 4C5CA 1NF3A 3HB5X 4OP3A 2PJRA 1CT9A 1U7OA 2FP4B 3UOWA 2AFHA 5AKEA 5CIQA 4BNXA 1AMOA 1QHHA 2VEOA 2B4YA 5L9AA 5JSYA 1V39A 1G64A 5TMPA 5HK8A 4L76A 1D8AA 1RWQA 1PX2A 3GRRA 4DPMA 4A3SA 5ITZB 4LSMA 3D7KA 1SCBA 5JADA 3KL2A 3PWZA 3HWX1 1T8RA 4DCUA 3I34X 5JXWA 1IOVA 3MBIA 2G83A 1FU7A 4EJ6A 4O4LF 2PWPA 1E9FA 4A2PA 2YJGA 2Y99A 3IJPA 3LJKA 4RWEA 3NWPA 1YUBA 2ACWA 2PGLA 4PZ9A 1MEOA 1NFFA 4TRRA 2L42A 3U81A 1Z4QA 3EXAA 2QUKA 4S0ZA 5CX4A 4IY1A 1BQ4A 3QH4A 2C4UA 4FFMA 2ATVA 2J08A 4DUZB 2Z9CA 2IITA 5JS6A 1YVEI 1TYEB 3F97A 4JITA 1M34A 4WFJA 1FSFA 4HZUA 1HLFA 3EDOA 3PUXA 2ZE7A 4I2NA 2WBLC 4B7AA 2PWYA 7MHTA 3FH0A 4NMHA 3G0HA 1JHQA 5ADVA 3A4MA 4FN5A 4X66B 3UC5A 3OE7D 3AI2A 4WUTA 1C3EA 2XKAA 3T38A 3V4SA 5JSKA 2XWPA 3USES 4XRRA 3E0XA 2C42A 4J3JA 1TMYA 3RHFA 4OPMA 1WXXA 4R16A 2K4MA 4KU4A 2J0QA 4OX9B 2MSNA 1YS6A 4N1AA 3A6DA 1XEAA 2P27A 3LT1A 3OD1A 4ITVA 4AN0A 4F4CA 3UPUA 2PPLA 1M8PA 4YRSA 4YJHA 1J39A 1RZUA 1E7QA 5F9HA 4NQRA 4F12A 2Q62A 4AO6A 4DXHA 4WLFA 1V8PA 2BAGA 1ZKMA 4MWBA 1U7ZA 1BU8A 2L0XA 4Z7JA 2NVUA 3KP1A 4CLXA 1R4NB 1VLMA 2NNLD 1TZCA 1N0UA 1HEUA 3CUSA 3AQ4A 3P9XA 2QTTA 2FF5A 4QYIA 4C76A 4EGAA 4GMXA 4Y2JA 1W5FA 3E81A 3KE8A 5E2AA 1O89A 3RFTA 3GUZA 4ENPA 5FT9A 3GMSA 1YHYA 2FWPA 3GVCA 3FPCA 4CI0B 1H4QA 1KH1A 5BSFA 5AVZA 3N8GA 1UXOA 1KGSA 2LIPA 1BAPA 5IJZA 5EJEA 4LJRA 2XIQA 2NAFA 3DVAB 4QYTA 2AFIB 1PEAA 3SZLA 4I4LA 3P2JA 3M81A 4XIFA 1NW7A 2HO5A 4GM4A 2GASA 5IC6A 4RVDA 4DLLA 1NHGA 3NIFB 5ALHA 5KQMA 4RTOA 4K6KA 2NZUG 5E1DA 2JAPA 4FOTA 2CWWA 1G0OA 2IEBA 5ENDA 3KSBC 1FYVA 2G28A 4GICA 4LTNA 2XH8A 4PO1A 1ZM3A 1JT9A 3BQMB 3TMKA 4TM8A 1H3EA 5GP1A 3H1BA 4JHXA 1JTEA 1H93A 2HB6A 2WIKA 3VO2A 4UM5A 3BXPA 1E64A 4JYMA 2FE1A 3JQ8B 2FPSA 3ZD6A 2FPPA 4CEJA 4F6RA 1K0FA 1TVCA 3O73A 4H6PA 3L43A 2UYHA 4C0JA 3T7KA 1T0BA 1N5DA 2O1WA 1W59A 4GMDA 1FFWA 4QT0A 4WBXC 2ZI9A 5TARA 1VDMA 5TPWB 1FTNA 1ULAA 3K16A 2HIAA 3Q0EA 4N7MA 5BQPA 3RVRA 1NVXQ 4M0KA 4UKDA 5AKJA 3UQYS 3N87A 4DSTA 1JAHA 2PX4A 1Z6AA 2O2HA 3N2YA 3RROA 1WCYA 3R5TA 5LU9A 1BWSA 4HDMA 1TE2A 1EMDA 1GJRA 3BHIA 4L5CA 3LCMA 3PL5A 3TS1A 4I66A 5B3KA 1RAHA 1EK2A 3A25A 1RJ9A 3ESXA 1OV4A 4ZOAA 3VR5H 4GT1A 3QFTA 4DBLE 1GZSA 4K1XA 2QD4A 3UXMA 4ER0A 4B6OA 5C1BA 4U7HA 3E53A 2OK8A 4Q3EA 3UWPA 4EFLA 3W5VA 1M34E 1YACA 2XVXA 4LMAA 4U9UA 4JI1B 2BEVB 1ZC3A 5C4IA 2VVTA 3LWZA 1YJBA 3L4SO 1B6TA 1MD9A 1V45E 4OV6B 4PSDA 4RM2A 1EQUA 3O4IA 1ZEMA 3R6WA 4ZEMA 4FK8A 3FPSA 1E2FA 2PO7A 4INAA 5DX1A 1OB2A 2OVBA 3OBBA 3F5QA 3EWIA 4DDUA 1ECCA 1C7FA 2IPAB 3A11A 3DW3X 1O6GA 1JQDA 2J7PD 5CLQA 4F0JA 3LPNA 2TMKA 4IIYA 2P0EA 3L2OB 2QMUA 2IU4A 1XTRA 3Q12A 2Q1YA 2HF8A 3KEQA 4O2AA 4O4JA 2BEUB 1QNLA 3QPVA 3U6KA 5BW4A 1Y6QA 1ZRHA 3KPVA 4L16A 5J40A 5YASA 2BCJQ 2JBHA 1OXUA 1JFFA 3GU3A 1UM8A 4PLTA 3H5OA 1IHDA 4OGGA 1YUNA 1HO3A 1YNSA 1TCCA 1TUGA 4B3HA 3TEFA 2R96A 1VI5A 3NHFA 3MCVA 1N2OA 1M2VB 2JA1A 4TYWA 4R8MA 1I7QB 4I9HA 3ADDA 5JXIA 1UIRA 3I42A 4JLNA 4H27A 4XCXA 5LPNA 4GKVA 1L2TA 1NMZA 2HMUA 2VSQA 4J2TA 1W8IA 1G0NA 2O8FB 1GQFA 1BS2A 2VLBA 5DXJA 4JKIA 3UZUA 4ZZ3A 3V1TC 3GBVA 1M33A 4I8DA