4NICA

Crystal structure of klebsiella pneumoniae rsta bef3-activated n-terminal receiver domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
NKIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQWQGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords DNA-binding transcriptional regulator RstA
publication title Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 38
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nicA00
4RZSA 4Z4IA 2JVJA 3N53A 3BRSA 3NHMA 2CD7A 2QU7A 1DCMA 3RVRA 3MYYA 7ABPA 5FWYA 3HJFA 1TLFA 4F12A 2MSLA 1SXIA 2QSJA 1QNLA 3NNSA 1YMUA 4G0PA 4RU1A 4N0PA 3CG0A 4XXHA 1DJMA 4Q6BA 3RQIA 1NXWA 2QVCA 6CHYA 1KMIY 2HQBA 4MQEA 1YTUA 1P6QA 1FSPA 4ZYLA 2L19A 4EGSA 1ABFA 1YK0A 1ISSA 1PNTA 5FBKA 1OXKB 5HQJA 1FFWA 3SY8A 3KJXA 3NNNA 2MYUA 2LIVA 5FWYB 4NQRA 4RK1A 2RJOA 4MQFA 3JVDA 3FMVA 3ILYA 5D2CA 4ETMA 4IF4A 2P9HA 4MQEB 3NBMA 4EYGA 1EWKA 3I09A 3MIZA 2X7XA 2VUHB 4ZMSA 4G97A 4QYMA 4D6YA 2NZVG 3K4HA 2WWVD 5ABPA 4RY9A 3OLYA 4Z0NA 4RK5A 3TMYA 2PUFA 1A2OA 5EWLB 2VYCA 3C3KA 4Z9BA 4ML3A 4DN6A 3QK7A 5TE9A 1NATA 1GCAA 2A9RA 2LUOA 4O5AA 3HDGA 2R47A 3IP6A 2FVYA 3HO1A 3UK0A 2Q5CA 1S8NA 3VNAA 1MVOA 1JFVA 2B1JA 4KV7A 5JS2A 3QLUC 2HSGA 4JAVC 1NXVA 4MR7A 2QR3A 5TQ2A 5IC5A 2N9UA 5TQJA 4LE1A 4F11A 5BRAA 1JYFA 3DZDA 3Q7SA 4RXMA 4NICA 1Z2EA 4LDZA 1BVHA 3EQZA 3CZ5A 3M9WA 3S99A 2RGYA 3CKMA 4L4UA 4JB0A 3LUHA 4CBVA 5EWMA 1DRJA 1D4ZA 2IYNA 2WMYA 2PUCA 3CRNA 1JYEA 4O1HA 3OQNA 3G85A 1SXGA 4KZKA 3SAJA 4EYKA 5KQGA 3KYIB 3W9SA 5JS1A 3O2JA 1VLZA 1DRKA 4YGXB 3RVSA 3HZHA 4RKQA 1TVMA 1XHFA 2YHBA 1JFTA 1Z25A 4GPAA 1C0EA 3MA0A 2GKGA 3GRCA 1DCFA 1RZRA 2QZJA 1CEYA 3FFWA 2XDYA 5EWMB 1B00A 3BRQA 3H6GA 3OO0A 4N0QA 4ETIA 1ZAYA 1YK1A 3H1EA 2IPAB 4MS4A 4B09A 1ZGGA 3OLZA 5JNRA 4NCBA 4DADA 4YWHA 3D8UA 4Z4FA 4RXUA 1W25A 3JVIA 4LX8A 2FEWB 4WZZA 3C3MA 4S05A 3TO5A 1K66A 1DBWA 2HPHA 3N0RA 4W5NA 3URMA 1ZN2A 4IRXA 3QEMA 3LKVA 2O20A 3H1FA 2L18A 1E6KA 5TQ0B 3GT7A 2FQWA 4MR8A 2E4WA 1DCKA 4G86A 1P8AA 5KI6A 3H5TA 1SRRA 3GA5A 4RSMA 4RK4A 2ID7A 2P4UA 1QQBA 1DC8A 3QLVC 4MRMA 1E6MA 2CWDA 4TLMB 1NY5A 1PNRA 1F4VA 4N47A 2PL9A 2QVGA 2E4ZA 3HK2A 4L85A 1BDIA 4G0YA 4D74A 1KRXA 4EYOA 1GUBA 3GBPA 4XLTA 2KYRA 1D1PA 1T34A 4E7PA 3CLKA 4QICA 5JNWA 2PKXA 3HUUA 4FB4A 4RS3A 4G0XA 4XFKA 2QW1A 2PLNA 1Z26A 4ETNA 1QMPA 1U2PA 2MSWA 4KK3A 4EY3A 2NT4A 1DZ3A 3Q7TA 2PUGA 3LUKA 2JCGA 3JPWA 3LKBA 1GUDA 3H5VA 5CNJA 9ABPA 2GX6A 1QP0A 1CYEA 4OTZA 4RY0A 2IPMA 1U04A 1PHRA 2LBPA 4RKRA 2F8SA 3E3MA 3JTEA 1PEAA 3JPYA 3QEKA 3VNBA 2MYTA 4ZMRA 4G0MA 4OLAA 4PE5B 3CZCA 1ZHHA 3G1WA 2JB9A 2FN9A 4RK6A 3T6KA 4MYRA 1YS7A 4W5TA 4UHKA 4MR9A 1GLGA 1ABEA 3HVRA 1KGSA 5EWLA 2RDMA 3T95A 1DBQA 1VKRA 3KS9A 4HNRA 5TPZA 5IUJC 1F51E 3F73A 4PEVA 3HXMA 1MB3A 4MGEA 1JH9A 3E61A 4RWEA 2MYNA 5TPWB 3N6VA 1JHZA 2JBAB 4W5QA 3N8IA 4MR9B 4KREA 2J48A 5KQMA 4IMJB 2L2QA 4WUTA 1XHEA 5DTEA 3DGFC 3O1JC 4G0ZA 4PYRA 1Z2DA 2WB4A 3I5AA 2M1ZA 3MM4A 4H3HB 1DP4A 4NV3A 1L5ZA 3FFXA 2PUAA 4YO7A 1DC7A 1QP7A 5B3JA 2B4AA 4FE4A 1UDRA 3HV2A 4Q7EA 1ZGZA 1QQAA 1TM2A 4MS1A 2LPMA 1R8JA 3KKEA 1YVUA 1H9CA 1DG9A 1M5TA 3BREA 3LMKA 4D6XA 3OMWA 1E2BA 1U2QA 4GNRA 1KRWA 5KQPA 5JNVA 4YRZA 3Q9SA 2FMFA 3O75A 2H0AA 1JF8A 1QKKA 3OMXA 3N75A 5JNSA 1EFAA 2FLKA 4JOQA 4F06A 4Z4CA 3HM9A 1ISRA 3QLTA 3IP5A 4MS1B 3MMNA 3Q7RA 4YS6A 1JX6A 1QO0A 4Z4EA 1D2AA 2FTKE 2I6FA 2HQOA 3O2SB 2E4VA 3GBVA 4YV7A 5PNTA 2MYPA 3H5WA 3JY6A 3LOPA 2CHFA 4KNYA 4Z4GA 6ABPA 1JLKA 3DBIA 4IMIB 1M2FA 2PUBA 5TQ0A 3LUJA 1QO0D 2YHAA 3A10A 2FW0A 4KRFA 2JVKA 2E4XA 3SG0A 1M5UA 4WWHA 3CTPA 2ZWMA 3CHYA 1APBA 1JWLA 3D02A 2AYZA 1FQWA 3IPAA 1D1QA 3F6CA 1PUXA 1RZRD 3EAFA 1NXXA 3H5IA 5BQ3A 3O2QB 4M88A 4Y9TA 5FWXB 3HUTA 3GYBA 2ZAYA 4P98A 5IUNC 3TD9A 3R0JA 2CHEA 4HNSA 3HDVA 5I4CA 2AYXA 2GBPA 2RJNA 3RVPA 5HSGA 2JVIA 4RDCA 2QV0A 1JDPA 1ZESA 3A0RB 3ILHA 3MF4A 4MLCA 1D5WA 4Z9AA 1LJUA 3EODA 4EYQA 4N03A 2F8TA 3SQNA 3FFTA 3T8YA 4LE0A 4F8JA 1QP4A 4KMRA 3KSMA 2HQRA 4MS3A 5ED4A 3O1IC 4TMYA 1BA2A 1ZVVA 2WJAA 2OQRA 1YMVA 3GV0A 2FQXA 3EDCA 2A9QA 1RXEA 2PUEA 4Q6WA 3GWGA 3RH0A 3I42A 1AB6A 4PICA 2PAFA 3K9CA 4N41A 2VK2A 3HCWA 5C5CA 3MQ4A 4MS3B 4LDAA 3RVQA 3A3KA 4YR7A 1YS6A 2E4YA 2IPNA 5HKOA 4W5RA 5JNTA 1A04A 4EVRA 4KQCA 3FDFA 2L17A 1USGA 5C5EA 2FKAA 3A0UA 3KLOA 3HS3A 3LUFA 5KC9A 2PE5A 1DBPA 1J56A 2R25B 3IP9A 3N0XA 3QELB 5TPWA 1JBEA 2JBAA 3LTEA 2IPLA 1RNLA 4OBBA 3CS3A 4KVFA 1TMYA 4NCAA 3O74A 1USKA 5F64A 2DRIA 1A0OA 3OLXA 4TLLB 2PJUA 5B3JC 3KTOA 1Z12A 4RV5A 3H5LA 3RVJA 2R4QA 2FXIA 3LUCA 2BGGA 2FMIA 1IIBA 3H6HA 4FE7A 5CNIA 3EQ2A 5EWJA 3O21A 1EWTA 1I3CA 1ZH4A 1BAPA 4IILA 4XAQA 3OQOA 3OQMA 1JDNA 3C6QA 4WXMA 4HNQA 2PMCA 4JASB 5TPZD 1K68A 4H60A 2A9OA 1P6UA 5IX8A 5KC8A 4TN5A 4LZLA 4LRQA 5EWJB 2MSKA 1W9HA 1HEYA 5GOTA 2WJWA 5GQSA 3Q41A 4KK4A 1QPZA 3M9XA 3KHTA 2NUBA 4OG2A 5HM6A 3LFTA 3H1GA 3B2NA 3F7NA 3DGEC 1ZITA 1SD5A 5CNKA 5IEJA 1NXSA 3IP7A 3TX6A 4S04A 2FEPA 1YIOA 1EHCA 1Y1LA 4RXTA 2V0NA 5FBHA 2H3HA 2ID9A 5KWSA 2HJ9A 4QPJC 2JK1A 4MQFB 5CHYA 1NXTA 4MAAA 3BILA 4JA2A 2WY2D 4MPTA 3LUGA 3QX9A 5KQLA 1BDHA 3QX8A 1BDJA 5BRJA 4KQ9A 1EWVA 3SM9A 1GCGA 2FMHA 3KYJB 2IOYA 3HEBA 4OATA 3N0WA 3CNBA 3GL9A 1NXPA 3NNDA 3TB6A 1MAVA 4E7OA 3BBLA 1P2FA 2LP4Y 5IEBA 3ROFA 5IULC 5IUKC 2PUDA 5DLEA 5FWXA 3KLNA 1Z13A 4YP9A 3L49A 5E3JA 4H3KB 5CNMA 2FN8A 3KG2A 3NHZA 2R48A 1U8TA 1URPA 2IDMA 4MR7B 3OLWA 1RXIA 4KPYA 1LJLA 5TQ2B 4G0QA 3CFYA 3QLUA 4JB2A 3RVKA 3T38A 2IKSA 1MIHA 1SXHA 4XARA 2QXYA 4JP1A 1NTRA 4Z99A 3P9YA 4IGAA 4MLDA 4ZJPA 1Z15A 5BR1A 3RVNA 2W42A 1E6LA 2NT3A 2JRLA 2FMKA 1U0SY 8ABPA 1NXOA 2NZUG 2M98A 2GI4A 1JL3A 3ROTA 4O1IA 3OO1A 4EVQA 4W5OA 1CHNA 3FGZA 2E4UA 2WRZA 3JS5A 4UHJA 4RY8A 5DKFA 1ZH2A 1XWWA 1PEYA 2FSPA 1AB5A 3HSYA 3OLVA 4WXEA 3SNKA 4OLBA 1LBIA 4MS4B 5DGCA 3IPCA 3RVOA 2A9PA 2VUIB 4Z4HA 3OM1A 3C3WA 2FEKA 4G0OA 4QYWA 2FLWA 5T3YA 1ZDMA 1EAYA 3C97A 1Z18A 3F6PA 3LUAA 3OM0A 4PZ0A 3QELA 3H5OA 4XASA 3CU5A 4LE2A 3EGCA 4P1ZA 4DQDA 3DLHA 2FQYA 4YCSA 4RK0A 1L5YA 3DLBA 5DCLA 1OXBB 2TMYA 1C4WA 3QEMB 4ZPJA 3RVLA 3L6UA 3M6MD 3O1HB 1Z17A 1LBHA 4RK7A 4KFCA 4MR8B 4WT7A 1VRVA 4HYEA 3IDOA 3Q15C 1JFSA 1LK0A 3LUDA 1Z16A 4EVSA 1USIA 4YLEA 3EJWA 3RVMA 3UKJA 4N76A 2GWRA 3KCNA 4EUKA 1FFSA 4MRMB 5JNUA 5T7BA 1WETA 3H75A 1M2EA 3I45A 1VPWA 3EULA 5IBQA 4F3TA 1TJYA 2PL1A 3QLVA 1RPJA 2OENG 1ZY2A 3UUGA 3CG4A 1MB0A 1FFGA
chains in the Genus database with same CATH superfamily
3ZY3A 3EFEA 1IEXA 4MARA 3HB4X 4M49A 2HLHA 1GM5A 2ZT7A 5BSEA 1DCMA 2FEMA 4LI0A 3EVFA 1DTEA 4GWLA 1RU3A 1XO1A 5C2JB 5I7FA 1OGJA 1XAJA 2EFCB 3NNSA 4X1IB 4N0PA 5HVNA 1SHTX 1QRSA 1L4YA 4WZAA 1ENPA 5EMJA 4CKXA 2WHRA 4KPUA 4P32A 4UVGA 2IS6A 1EEHA 1T9ZA 2ZBDA 3MD9A 5A04A 4K9SA 4RKYA 3DJYA 4TLAA 2NZWA 3TNYA 2NPOA 5EJEA 1O95D 1Z6GA 2GYYA 2VP9A 5FBKA 1PNQA 4H16A 4U0KA 1NQWA 4FK8A 1RKBA 3RQSA 3V80A 1O58A 5JTTA 1A2QA 3KOYA 4O33A 5DHQA 1A4UA 1DU4A 1LPMA 4MV4A 5D87A 3V4LA 3HFSA 4FDTA 3DLPX 4ND6A 2YWJA 2DXIA 4P3OA 5CTJA 4JGBA 3OLCX 5ECDA 2FG6C 4UHCA 1Q92A 2BF7A 3CJQA 2IJGX 3NGMA 2HWUA 2O9JA 1PDWA 3BH0A 4P3PA 1DAIA 3MT9A 3TMYA 4UNQA 2QNRA 3N2GB 1NQOA 3D2AA 5TX7A 3VJRA 1SU7A 4JOSA 2VQDA 3R8XA 4E5SA 1GU1A 4ISCA 4U9IS 3ZHYA 1TD1A 1TQ4A 2CL7X 3KL2A 3K6KA 4FJ0A 1K5GA 4ND4A 4U1RA 1XD9A 2EHJA 3PBKA 1XEAA 4OOFA 3UZUA 3TEFA 3HO1A 3CEJA 2Z0MA 1PG2A 1W6UA 2FZLA 4R2XA 2WJZB 3QLUC 2I1LA 2QR3A 4YMSA 1B1CA 3SSOA 3ZV4A 2L42A 1FP6A 2DB3A 2WMOB 3FHOA 2DE0X 2YCBA 2JC3A 1EA7A 1P18A 2Y1OA 2H1FA 1OU4A 2PZLA 1KO7A 1N2HA 2YYZA 4PXYA 4Q4JB 4AQ7A 1C1XB 2PSSA 3KEOA 2FN3A 2JIMA 4LFAB 1VGQA 1EVEA 4RLFA 2SBTA 1QIHA 3PJRA 5BNZA 4EHAA 2PUWA 2A0WA 4C7KA 2LW7A 3UGKA 2D7JA 5KTPA 3CVJA 2A5JA 1SHKA 2PUCA 4C7OB 1XNGA 5EJ2A 3R9WA 1QTRA 1ZIYA 3DE0X 3UNXA 2ZIZA 3RVSA 4TGLA 3PFWO 5DU2A 3L8DA 4J75A 3ZU4A 3FM9A 4D6PA 4D4GA 3D7RA 1N2CA 3AKCA 1E0KA 3E1GA 2QJRA 2JFZA 2Q6IA 4Q9NA 3UKDA 4O2AF 3L6OO 4CRWB 1M5RA 3GRCA 4KVGA 1JLLA 3JQ7B 4HSGA 1PZHA 1M7HA 1BYIA 2QZJA 2LGJA 3I6ZA 3X2EA 1RR6A 4PZUA 4ZZ1A 3Q8LA 5BQOA 5CVVA 3H2GA 3RKSA 1Q3KA 3O3OB 3R44A 1AK2A 2H5JA 2IPAB 4M8LA 4L76A 2O14A 4DXHA 1SKYB 3TECE 1GXSB 4BLOA 4D0LB 1DO8A 5A2QA 4YIHA 3N8HA 2PBLA 4RADA 5LLDA 4OUDA 3EIQA 1A69A 1OXMA 2VS1A 4ICIA 2J7PA 1JEQB 4INOA 2BDUA 3WC4A 3ZHOA 1DBWA 1S2IA 2I6SA 3KJHA 4LG1A 2IXDA 4KXFB 2GPSA 3OZ7A 2Z2KA 3B1WA 4FBLA 1CJSA 1CNMA 4UTPA 2OGSA 3DR3A 3HCFA 4YRQA 3IDZA 4NOJA 2IOFA 4RY2A 5ICGA 4TN1A 1Z0DA 4G89A 3I12A 4D0NA 1Z4IA 4OIFA 1FZQA 2YIMA 3R9KA 1YR3A 4QJ4A 2QIPA 2ID7A 4GX2A 4IWNA 2AJBA 1VE1A 2WLTA 3LGAA 1FRNA 1S6YA 3RG2A 2BMWA 2RMKA 1JR3E 4URFA 3DDSA 2E4ZA 3ENNA 4L27A 1RBYA 2Q0QA 2Z9DA 3BWBA 2PH7A 1ZKMA 3WDMA 1C81A 2OV2A 3EPPA 2XMCA 3GAZA 4J7XA 1LK5A 5FWAA 1NVGA 4GKJB 1FFBA 2DWOA 3HUUA 4U5XA 3TLBA 3ZGLA 5JAZA 1RRMA 3PJEA 2F67A 2Y99A 4XFKA 1K8QA 2PLNA 4X1IA 2WIAA 1AE1A 5IMBA 1HR0B 2FPGB 4NNJA 1L2TA 5T8KC 4DM3A 3CVUA 4GI1A 1H6CA 2ZJ1A 5FEMA 4PQRA 1YL5A 1BN6A 1H0HA 2CLDX 2FUG1 2WKWA 3HXLA 4PAGA 1NZJA 4EGCB 5CDYA 1RCTE 3BE6A 3AYZB 1IZ9A 1F48A 1KOJA 4P4LA 3ANLA 3PNMA 4HQLA 3MBIA 4P82A 1PFKA 1KIMA 1ENOA 2ZB2A 3JTEA 4V38A 1Q84A 2ZTVA 3F46A 4DOMA 4XUEA 5IF9A 5DE3A 3WKEA 2MYTA 5JD4A 3WIDA 3A9CA 3Q9LA 2L69A 2RHJA 5BSUA 3D54D 4M98A 1OV6A 4M7OA 2ZM5A 3W4KA 2P40A 4O8CA 1UP7A 3ND6A 2F1JA 2J4FA 2IU0A 3PXGA 1HNNA 3COZA 1ZM2A 5SZJA 4DLPA 2X22A 2QI9F 2UYYA 2C2XA 2JFQA 3N2GA 1I1OA 4LZWA 3WWCA 5CH5A 5JISA 3LBAA 4V3CA 1K7EB 1O97C 1OX5A 2H4WA 2DWQA 2JD0A 3CBGA 4FCCA 1PLJA 4DDUA 1N1EA 5F35A 3C39A 5K7SA 4KSBA 4MGHA 3I53A 4PEVA 3HXMA 4MQLA 3R75A 4ZDIA 1Y89A 2DPXA 1J00A 2PIDA 2PT5A 2FJUA 3GPCA 2DGDA 5DNEA 3W06A 1KU0A 3A9TA 4K5QA 1Z45A 4R2JA 2GPBA 1LBSA 4DC1A 1SVNA 4KREA 1P9WA 4HB0A 4ZQBA 4NBSA 1JI0A 3E8MA 1G8KA 1E1RD 1UDCA 2AI2A 2HA6A 3DWEX 1PR2A 3MPUA 4Q4JA 1C1XA 3OKCA 4CCYB 1M1XB 2W6QA 3SQXA 2RFLA 3U3MA 3GLFE 1GN9A 1F2TB 1JKJA 1ZD8A 2JFYA 2XZPA 2ZUFA 4C7OA 3C1TA 5DGDA 3AK4A 1DRWA 1G5PA 5M7EA 2W0MA 1OX4A 1R9NA 5DX1A 5B30A 1DQPA 1LSSA 2D0IA 2I4MA 2QTNA 3F9CA 2AR9A 1CUBA 4CFSA 2I22A 2AWNA 1GWNA 3JQCA 2IHVA 1R0CA 5LWHA 1JF8A 5HG0A 1CUCA 3N75A 3V7FA 5JNSA 4KO3S 1RLTA 1TLLA 1YC2A 2P78A 1LZKA 3ESZA 1W85B 4H0CA 4LRTB 4M7WA 3UJBA 4YYEA 5LR6A 2YBEA 1T5SA 4J7CA 1GXSA 3SQDA 2D4HA 3OFND 1L1FA 1GGJA 1K7SN 4TKMA 4BATA 4KC0A 3WJ2A 2BL4A 4J0DA 1JEQA 2DTDA 3KPUA 1WLYA 1ZJ5A 1FVXA 1J90A 1EVJA 1MB4A 1LQUA 2P77A 2Y4NA 2XTAA 3AI2A 3E9MA 2B7CA 4L2IB 1PNOA 2B4RO 2FSGA 4MQUA 1QKIA 3W2TA 1J99A 1NA5A 1SUAA 2OUIA 3U4HA 1MW8X 1OU0A 2AV6A 3VJKA 1ZLYA 3NHFA 4ER5A 3TE7A 4ZDKA 4KRFA 1SM4A 4D4LA 3D4OA 3O5AA 3FRIA 1JA9A 1CFZA 1HQYE 1KPGA 1P60A 1RZ3A 2EGGA 2WF9A 3G0OA 4PG4A 4RBNA 3T4XA 3D02A 5KVVA 1L5WA 2NLOA 5JH7F 5J47A 2R1UA 1DOHA 4E14A 3FCCA 2AGVA 2GMWA 2VATA 1RZRD 2D6FA 5C5IA 3OCUA 4RO0A 2JGMA 2W0SA 1FDSA 4YRLA 1E1LA 4P0PB 4MEBA 3UJ8A 3E0XA 4CW7A 4TZ6A 4OAOA 2IY9A 4EQZA 1DB3A 3HCNA 5E2AA 1HDYA 2Q4BA 5AXDA 1VCIA 2LCQA 3D1JA 1ZXBA 1CDEA 3KEQA 1PBNA 3ZLTA 1ZWKA 2O0KA 3RIMA 5IM5A 3G5LA 2FPGA 1JJAA 1YI0A 4F3RA 2H59A 1LLUA 3HZOA 1D5WA 3RAJA 5F3DA 3SS8A 2H9IA 3IAS1 2V96A 1BWSA 4LE0A 4PZCA 4L4RA 1EE2A 3BDIA 1G6KA 1NX6A 5KTYA 2A59A 3Q9NA 4HNTA 2WJYA 4RW0A 2ZB7A 4U8GA 2WJ3A 2ORIA 4PX2A 2Q5OA 3I5MA 4HEA6 4MUYA 5A1TA 2G9VA 4PLYA 5H3CA 1OZ0A 4JENA 3Q87B 4KR0A 2E87A 1FFXB 3ONDA 3I42A 4GAEA 5FV7A 1MHTA 2DUMA 4N48A 2H16A 1O4WA 3AR4A 3R3HA 1RC8A 4J7AA 3EZYA 4A92A 1EZ4A 3VTZA 1T2EA 1SHUX 4LW8A 1DDOA 1ZPDA 4QREA 5JRZA 1A1SA 3Q88A 1UBMS 3O4HA 4W5RA 1A04A 1DTSA 1SUCA 3ESQA 3KVRA 4KQCA 4ZYWA 1DZIA 2RH4A 3I6IA 3O91A 5KSOA 3LUFA 3OOEA 1PR5A 4LOJA 4PVCA 3AEUB 5KC9A 3DEKA 4O02B 1PL0A 4M9SA 2BMDA 2VDPB 3GFGA 2BISA 3M6WA 2XTMA 2BPOA 2IPLA 1G3RA 1XLTA 3B5EA 4XYBA 2Z8ZA 1E98A 2QY6A 2FP4A 2N1MA 4B35A 4V02A 2XYHA 2XUDA 3KQLA 2R6FA 2ZBVA 3ACBA 4EKNB 4HFNA 2W11A 3FAZA 3Q11A 4LGMA 1QPGA 5EIBC 1A9PA 2XCUA 5FI0B 3GFPA 2HT1A 4RV5A 1PS0A 2R4QA 3GRUA 3JQEA 1IIBA 1OHHD 1T8WA 3H6HA 5EWJA 1F2TA 4FGKA 4UD2A 3H2KA 4YPOA 4B3SB 1U0BB 3GAMA 4LSWA 1LBQA 5HNKA 2C00A 1WCV1 4DE5A 1SVSA 2Z1DA 5C18A 3KBBA 4RTJA 1Y8QB 3OQMA 1AY0A 1QE5A 4RAOA 3DXZA 4BGUA 2AQHA 1C29B 4NATA 1NQAO 3P0RA 4AMUA 1FTNA 1GU0A 1H2XA 2OBYA 2AD1A 3OQ1A 1W5SA 1XZDA 2ZSEA 1JWBB 1DARA 4L9AA 2W2LA 2ZU0C 1CW2B 2JCYA 4G5OA 4U9HS 2QPAA 5IJAA 4DXDA 3EGOA 4UBOA 5DJ5A 5JJIA 1K0UA 2WJWA 1W85A 2HA7A 1XLWA 2J3MA 2JFPA 2ATEA 3RRYA 4ER3A 4EUNA 2C4NA 2REQB 3WQRA 3HXQA 1N1MA 1MOSA 3DSRA 4ID9A 4MPPA 4DIMA 1TYBE 4O2AB 3RSZA 4OXYA 3IOCA 1YIOA 4CF5A 1IBLB 5SY6A 4L78A 1Q7GA 4HQKA 4PZZA 1U63A 1MCZA 1NXQA 2BMFA 5BUQA 1E1QA 4L2IA 4EJ0A 5TF0A 2ZBRA 3PPWA 5K0FA 1VDZA 3FCYA 2BIFA 3OQPA 1SQSA 1JXQA 1U7PA 3FJ1A 2QX8A 2HU2A 5MDHA 4ITVA 3I9OA 3VJMA 1H94A 3ZDDA 2X8JB 2JAWA 3CX8A 1WPXA 3D3KA 3NV7A 5LQSA 4BN5A 2Q7DA 1SPBS 3LJKA 5IH3A 5IDWA 2JI7A 2YS6A 2GFIA 2AJLI 2Q5EA 4J0FA 3TVTA 4EQ6B 4D4MA 2GEBA 4MWOA 4PN7A 3K5HA 4V0RA 1VL5A 5AUQA 4ZCSA 5IEBA 4EY6A 1IU9A 1JB9A 5IUKC 2BGWA 4A5OA 1N3IA 1Z5VA 4CE6A 4PCLA 4H3KB 4XWAA 3U5ZB 2FPRA 3U60B 1OWPA 1ULSA 2GXSA 1R8XA 2XDAA 4RTSA 3BIOA 2E5FA 4Y30A 5K6AA 5KX5F 3DOHA 3T38A 4F0JA 1DHRA 2B34A 3ESRA 1BFKA 1MU0A 2XWQA 4ZVKA 3TLXA 3VI3B 1W75A 3AZQA 3V6MA 3GMTA 5B4VA 4KYUA 1WXXA 1AK1A 4JR1A 4L8GA 4PLTA 4EW1A 3LOQA 4A91A 4U00A 2ZDQA 4UFNA 1RJFA 3RUAA 1MZPA 3SD7A 4RVDA 3BXXA 3TIIA 5F21A 5A3VA 3B70A 5KTTA 5CFLA 2FPKA 1N57A 1FFXA 3TB4A 2WJIA 3SP1A 4PX5A 4ZYTA 1O1YA 4JMLA 2VP2A 1DLIA 1WNFA 1NNEA 1V1MB 4PHTA 3IYLW 4DLUA 5LXTA 3AMVA 5ITZB 3DKVA 2P35A 3T52A 2VUIB 1IK6A 5C46F 3FPBA 2XNDA 4WOCA 4DV7B 5A9TA 5IG2A 5IAEA 2R1TA 4FOSA 1JSCA 3UFXA 3H5OA 2Q4TA 4IWXA 4J1QA 5AKYA 3ZU5A 3KLMX 2VK8A 2HYDA 3SC3A 3ZK8A 3E3LA 1G20E 3QEMB 4TPKA 3TVYA 2Q2NA 4BVBA 5JCOA 3QTTA 4GM0A 3NQ41 1Q7EA 4W9RA 5BW8A 1H5NA 3PCTA 4R8SA 1QH9A 4TRNA 1ISMA 4HGYA 4MUIA 4GMGA 2J0QA 2HA0A 3UMGA 1ML3A 1JDZA 1QV6A 1T4CA 2RCYA 3W1EA 4YCLA 2BFCA 3A4IA 3AHDA 4TMXA 4YLEA 1JR2A 4J2OA 4G9BA 2YJ5A 1JB1A 2H11A 4NESA 1R8YA 1J1UA 5AH0A 2NPFA 3QLEA 5IBPA 4OGGA 3L4BC 1V1RB 2DFKB 3K6JA 1Y8QA 4RCZA 4E4YA 3ZYCA 4YQEA 1YGPA 2JVJA 3DP9A 3N05A 3O03A 3E2IA 5BN3A 2NVUB 2I2FA 2J3JA 3DD5A 2YZGA 4G36A 1DGQA 1QNLA 1ML4A 3M5DA 3F67A 2XMRA 4JT8A 1AKEA 1UJBA 2BI8A 1XQ1A 4MA0A 1K2VN 3RQIA 4D46A 4Z4QA 2J5XA 1DXYA 1TVEA 3LT5A 4ZI5A 3CLUC 2C9BA 2EX0A 2REQA 4QXRA 1GPLA 2AMJA 2Z04A 4RDXA 2V7XA 4O2AA 1PNTA 2CXOA 1OWNA 1YBMA 3C43A 1T2CA 3GELA 1VRCA 4OSOA 4QOHA 3LYHA 5FYDA 4PSVA 3CBQA 4Q19A 2R65A 4KR3A 1CIJA 1F5SA 1O08A 1C4KA 1J25A 3EIOA 1INLA 1DWQA 1OA1A 3Q2KA 2QP3A 3FI0A 3R74A 3GR6A 1NTOA 4O25A 4LYHA 4BNLA 1IDN1 1KQGA 2IGBA 4A10A 2MSNA 3JVDA 4NENB 5AKZA 2IEYA 1NAIA 4LZAA 1HM5A 4X6YA 2X8JA 4MA5A 3ZXIA 4BUJA 1QHNA 1HFKA 2IYUA 1U8ZA 2WWVD 3X1YA 4F9EA 4Z5XA 5KINB 4AG5A 3CW8X 2PX3A 2YJ3A 5KTNA 4V0MA 4E3ZA 1A2OA 3Q0EA 2VYCA 1ZD3A 2XHEA 3CUSA 5F5XA 3ULKA 2GEDA 1GQFA 2KQUA 2WTXA 5JDCA 2Q3EA 4X84A 2PQ0A 1KI9A 3DT9A 2BKLA 4OLFA 4Y6LA 3K8QA 3WR5A 5LBIA 4IVQA 5K0NA 1HEUA 1U8XX 2O3RA 1J5XA 2XJ4A 3L7MA 1J8MF 2Q5CA 3MBOA 5HUQA 5JH7B 4IP0A 5EP4A 5JAUA 4H4CA 5HKBA 4FU0A 4YRMA 1R66A 1HE3A 2W6IA 5LOVA 2BGKA 3GT3A 2X1LA 4GSLA 4S3MA 4UDNA 1UZNA 1VBMA 1OFUX 2O48X 1FEZA 2G3YA 1BDBA 3G0GA 4HX9A 4MDHA 5E1DA 5I9BA 3NBYC 1Y7LA 3DNPA 3SVTA 2OP0A 5JLAA 4WUVA 4F72A 4G5RA 4MVJD 4NV1A 4L4ZA 3TH5A 1U9IA 1Q1QA 3G85A 1LPNA 3OQBA 1RDFA 4KZKA 3VSCA 3KYIB 3DEFA 3EC1A 2QZ4A 1W30A 2EEZA 3CT4A 1H66A 1XHFA 1I9GA 2HIGA 3GDGA 3O73A 3R8CA 3WRYC 3DXYA 2C94A 2WKQA 3UQZA 4XGRA 3LPDA 3N2NA 1UXHA 4MCJA 1W5EA 1U7WA 3A6LA 1CR0A 1Q3TA 4FGLA 5EOVA 1FFDA 3VC3A 1WUKS 2X2EA 3A4LA 2ACWA 3CUYA 2ZSAA 3ME5A 4IIGA 1A98A 3RU9A 4MQ6A 3W1WA 1V1MA 4AO6A 3V4FA 1ZAYA 1XNRB 3H11B 2XWSA 5ITZA 1EM8B 2OBXA 1ZGGA 5K4HA 2BJWA 2G09A 3U5TA 1H4SA 2JH3A 4R8MA 3NLLA 5A4MS 1ZD1A 2ALJA 1EVZA 4X7PA 1U3DA 4ZT2A 3KVVA 3FVVA 4QGSA 5I4IA 1RI2A 3WRYA 1SXQA 3UJDA 4UM7A 4W5NA 1XZGA 1NN1A 1SHJA 3CF6R 3HDJA 2WUWE 4WERA 3CX7A 5I7AA 2ZJ3A 3QEMA 2HF9A 3Q6NA 2ZRPA 3LK7A 3P2IA 1KY3A 4NEGA 1MGOA 1VE6A 2QT1A 3NIDB 1WUTA 5TARA 4FFLA 1JT9A 1OYWA 1QQ7A 3L4EA 3NHRA 4RSMA 4KMMA 3TQQA 1K7YA 4WL0A 1Z74A 4UHDA 2QJWA 4JFAA 1BMFD 3WLLA 4YMVA 3VVMA 4W1QA 3NXKA 2PZJA 1F4VA 1V0JA 1KNQA 5DULA 1TM4E 5JROA 1LD3A 2HCFA 1IJFA 4GZ3A 5DEIA 1V1RA 1O0SA 2X13A 5HZKA 2WWGA 2EBWA 1AXGA 3NHAA 1KPHA 1QOZA 2ZRCA 4FYMA 4QOFA 1X1QA 1T34A 4YP6A 3IUJA 1E89A 5AFSA 4NKRA 2HA4A 3VAAA 5JNWA 2NVUA 5CT5A 1CZOA 1H1DA 1UXGA 2JCXA 4G0XA 5A5EA 2E89A 4NBVA 4ETNA 1Z6YA 1MDFA 3HLTA 2VZEA 2QD3A 1USWA 4GRDA 2IV7A 4XJXA 2O54A 1SURA 5HKKA 1PFGA 1BH2A 3GN1A 2GPYA 1NUUA 1KDTA 3D6UA 4DC0A 4DW8A 5DASA 3JPWA 3ITKA 3DFMA 1ZNXA 2GN9A 4IDAA 2P8JA 1HF3A 5CNJA 3PYXA 2CK3D 1M2GA 4LRXA 2VCHA 3IAHA 4NMHA 2JHAA 4OYLA 2OOKA 3U7RA 3QE9Y 2AZXA 3NHKA 2Y71A 4B3HA 1FVFA 2VWHA 1P7WA 3KELA 3GZNB 4O08A 3NW9A 1M1YE 2XV1A 4BN0A 3PHJA 2YKGA 1L7PA 1GKLA 3E0QA 5KWJA 4JJAA 1THTA 1RRKA 1AKTA 1QCZA 4NENA 3RRFA 2QZPA 3ZBTA 4URUR 2GD6A 3VUEA 4C0WA 1U6JA 5HPYB 1L4EA 3CNLA 5ALOA 4J6EA 3GFTA 5HA5A 1R5OA 3HVRA 1G16A 1P73A 1P4RA 2AKYA 2J3DA 2Q4RA 3AJ9A 1QH1B 2IF0A 2QYOA 1JJFA 1VKRA 2W22A 3BWMA 3BZUA 1T5IA 3IAAA 2XSZD 2Q2OA 3KQYA 4DCCA 2HYIC 4DLYA 2WSIA 3OQJA 3WBJA 2FSHA 2QZSA 2Q45A 1Z2CA 1E66A 3OCJA 5DCYA 1JH9A 5JH7A 3OQ6A 3EAGA 2VNKA 1C7FA 1XHEA 1OB2A 1YE3A 3ML1A 5DHTA 1LW6E 4PSUA 3KE9A 1ZVQA 4A82A 16PKA 3P5SA 2VDRB 2BDEA 1OH7A 1QLWA 3OSZA 1QGDA 2EWWA 2FWAA 2JNWA 3AL2A 3BZWA 3PUKA 2E48A 2I71A 4OY3A 3OMLA 3WDLA 4A8HA 4XLLA 3NIGB 5IPFA 2WA1A 3GLTA 1TM2A 4OKNA 3LYUA 4MS1A 1LBTA 2ROQA 5KX5B 2ECPA 2ZUEA 3KSZO 2OHGA 1W59A 4DMMA 4XE5A 4ERNA 4FGJA 4D6XA 2QTZA 2IELA 1B41A 5DV9A 2VP5A 5DMHA 1Z6ZA 4EGQA 2QTGA 3OI7A 4AYWA 2EKLA 2OKGA 3ND5A 4YUZA 4JOQA 4INJA 1CY7A 4WXHA 3H11A 2AG5A 3QA9A 3UWDA 4RZUA 3EVZA 3U7QB 1MRZA 1NKSA 2I6FA 3AJRA 2F59A 3TTWA 5FDFA 1U1CA 1SU8A 2B30A 3N87A 1CY1A 4L75A 4ROTA 4B44A 3IBYA 4HJXA 1G0OA 2FRDA 3JASB 1DKPA 3PT9A 4AJJA 1AU9A 1D8AA 2QV7A 4GBGA 4ZKEA 1DV1A 4R9SA 3RD5A 1DPGA 1ISIA 3ASUA 4QHYA 3D31A 4LTMA 5LQMA 3KSBC 4Z3DA 2IZ1A 1CCWA 3FCOA 1WXGA 3LW7A 3ROEA 4Z2YA 1KPIA 4IDPA 4JBNA 4LXXA 5CD1A 3L0PA 1M5UA 1FDUA 1AHPA 3KP1A 1HMYA 4KXYA 1T3HA 2ET6A 3DTTA 5EY5B 1K27A 1Z4JA 2W2MA 3EQ9A 2FZCA 3DE4X 2ETVA 1I4LD 3LIPA 3AHJA 1OT3A 2GOYA 3EIEA 4ZVMA 3A31A 4Y9TA 2FRVA 3QWAA 1TCAA 2VRNA 1DKRA 1G291 1I30A 2ZAYA 1UXOA 3H2ZA 3T9EA 4RM3A 4MITA 2ZYUX 4M1SA 4YP5A 3HA7A 3ZOZA 3AB7A 3FNRA 1TB4A 2C5EA 5F5LA 3WDSA 1UBLS 3RJZA 3W4JA 4BGEA 3NORA 4MA4A 2F3SA 3SX2A 5KCZA 2VTKA 3ZDZB 3BFKA 3MF4A 4CHGA 2ONYA 5I8WA 1QK4A 1XQ6A 4U3JB 1ODJA 4FEAA 1OAAA 2Z9BA 3B3AA 3HDYA 1CZRA 1H8EA 4TV8F 3U2QA 2Z8YM 5ED4A 1MC8A 1DUSA 3A6ZA 5EUQB 3V4RA 1H8HD 1YMVA 3PIIA 3GZNA 4ZN6A 4YLGA 2POCA 1IIRA 2IT1A 4YALA 1WEHA 5FUVA 4D02A 2Z8YA 3VPDA 4PNZA 4Q3NA 4RVUA 3W7AA 1UT5A 2FYTA 3P20A 4B47A 2V7EA 1ZN9A 4UHBA 3PU6A 2C5LA 2CMGA 3PDUA 4LJSA 1NLFA 1TK3A 2DQZA 2JGEA 4RPLA 4ZVSA 4AZ3B 2G70A 1JT2A 3NFYA 2GVZC 2DH6A 2F6RA 2G72A 3BCRA 4MINA 4XTRA 5DLQC 1UT8A 1QH1A 1XAGA 5GWXA 5TS2A 5I7WA 2R85A 1Z6XA 2NVWA 3DFUA 1L7OA 1EWQA 4GXRA 3IKJA 4DV5B 1TZBA 3ICQB 3Q6MA 1TIBA 5EKXA 4DR5B 3FMOB 5AVTA 1DBVO 1IEQA 5B3KA 2VP3A 3BXOA 1KDVA 1NIJA 4PCAA 1W7AA 2B4TO 2PBZA 4KRXA 4N82A 2DPYA 1R18A 3NXSA 3HCAA 1JPVA 5MGNA 2WHYA 5F64A 2QIOA 1JFLA 4TLLB 2JIOA 3MWFA 3CYFA 3GQBB 3UK6A 1OLOA 3C1AA 1MT3A 1UPXA 1K6XA 2VAVA 4PQFA 4CMBA 2ASEA 4DAOA 2FMIA 4LHZA 4OUKX 1YF3A 1LNSA 2H92A 1JWAB 3BF8A 4YX9A 4N18A 2FMUA 2PLAA 4K26A 1VKZA 4MKHA 3O21A 2GBCA 3PI6A 1S3SA 3BT7A 2HW8A 4QHTA 2BFNA 1WP9A 2QKYA 2ES4A 2H2WA 2GCNA 3R6DA 4M1TA 1WV1A 1ZN8A 2QP9X 3ROKA 2ZB8A 4B84A 3RBXA 2YVAA 1GNSA 2VF7A 3WSVA 1BGVA 1PT5A 5HX7A 3ZJVA 3P5BA 1M1NB 4MV9A 2I0FA 2AX4A 4IKOA 4IYRA 4CV0A 3FWPA 3G9QA 4EDHA 2PSFA 3EVEA 3KJIA 3I61A 3U7QA 1JSLA 2R6CA 3YASA 2WU1A 3DGEC 2UDPA 1SD5A 3Q3VA 1A9SA 4FP9A 2H65A 4IZIA 4AULA 2R8XA 5AW9A 2O1SA 2X4DA 1CETA 3JASA 4I4TA 1TEZA 4F3YA 1U3WA 2H3HA 2ZPUA 3C3CA 5B12A 2HHJA 4JBGA 4OPMA 2ZTLA 2QYHA 2FWBA 2JK1A 3T5TA 1BQ4A 1CK4A 2WFMA 5B1IA 3WRXC 1VPWA 4PS0A 2UUOA 2GUWA 4B8ZA 2WA2A 4O4LF 2BZGA 4TTRA 3AJAA 4R0VA 4NK4A 3ZHBA 1EWVA 1PJQA 1SJ9A 4AS2A 2HBYA 1GCGA 1FB5A 2FUG6 2R751 1SC3A 1MDBA 1NXPA 4HDMB 5D5QA 1SMKA 3A6HA 2ZAIA 4NBTA 1E3SA 2RAUA 4HNGA 2P8SA 4Q3DA 1N6NA 1D4AA 1H4TA 1E61A 2AE2A 2EG9A 2HSWA 2IQ5A 3B52X 3F3SA 4CMIA 2C8LA 1HYHA 4W7HA 5B2FA 2E5LB 3VC2A 3STYA 1YB5A 5HCUA 3I5XA 4J0JA 5FBWB 1ZLXA 2RHBA 2Q3LA 4E03A 3NHZA 1XJCA 5HUHA 4IJVA 1CQXA 4MYDA 3LI2A 2QHXA 4B0PA 3PEFA 2QD5A 4XA8A 5TQ2B 3CFYA 2G5PA 5TJHA 2ECFA 1H05A 3DD1A 4JVNA 1FVHA 4BNDB 2CCKA 2KBEA 4CM7A 2C3OA 1YL7A 2PVSA 4G8DA 4U3JA 3KFVA 1RS0A 3ONWA 3DL2A 4ZU6X 2TECE 4J16A 3H1BA 3K16A 3SQMA 2CNOA 4NFHA 3TCNA 5IFLA 2XUKA 3FJYA 3TR0A 3ZTWA 4DUGA 2M98A 3AP1A 2Q4DA 3WHLA 3TCKA 4D4IA 1U0NA 3WIEA 4YTEA 2Q9CA 3SSNA 1QBKC 3L0DA 3EG5A 1D0IA 3UH0A 2W6NA 4OMUA 1QORA 4UHEA 5K5EA 3G79A 4AZ3A 1U2DA 4ZARA 2JAQA 1EG2A 4JFRA 4AJ4A 3WLQA 4RNCA 1MH9A 1AT1A 4FR2A 3QVLA 4URHA 1WB4A 3A4YA 3ND8A 1N7GA 5HFAA 1ZNWA 2QQFA 4M8NE 3JD4A 4XCQA 1XNHA 4CG0A 2VTBB 4K7JA 2XMSA 3RIGA 4RV4A 5A5FA 2G63A 3EYWA 4XASA 1Z18A 1ZUIA 3HU5A 1G59A 3ROPA 3BD8A 5ALTA 1W1UA 3R41A 2BN4A 4S0XA 1P5RA 5DM70 3DLBA 1J2YA 4JUFA 2ZRKA 4WKGA 1ECJA 4GVXA 3FNHA 3O1HB 2QN7A 1YFKA 4WKPA 1TYDE 4MR8B 2WUDA 4HR7A 2HK8A 2PEZA 4WLVA 3HWSA 3DYVA 1UM9B 5G41A 3X0DA 2YXNA 2EU8A 2Q0SA 1Z33A 2BKXA 2D59A 2HCRA 4OYYA 2EZ4A 2QUIA 3GHYA 3ZJUA 1YQXA 4RYDA 4JXZA 2BD0A 1FX1A 1U5CA 3V7YA 2A7QA 1PL8A 1HDEA 1R50A 5A3JA 3GEMA 1XCGB 4IEEA 4NBWA 1E3QA 2I3DA 5DVZA 4Y2JA 4DNFA 5IBCA 1ZISA 1QU2A 5IAOA 1QJCA 2WYIA 1GY8A 4IUYA 3IILA 4UFOA 3W5BA 1TLFA 4BIIA 2VNSA 1M1NA 4V0KA 3RV3A 5DPMA 1C8BA 5DF1A 3NG1A 4LYDA 7GPBA 4I5IA 5L4NA 1KP9A 4BRWA 1IE3A 2KW5A 2NXNA 3PUVA 4GOND 4NULA 3VYSB 3S29A 3STWA 3MIIA 1KO8A 4YI5A 3PGA1 3DR5A 1UKYA 2CHVA 3PXBA 5BPHA 1KKMA 3C3JA 3J7TA 4ME6A 1X38A 1S2NA 1J97A 4F86A 3JZIA 3K2IA 3AIMA 3A37A 5DB4A 1YVDA 2QUAA 3TRKA 2NM0A 2DSNA 3AY3A 3MEQA 4J1TA 4B4KA 2O8FB 2FR8C 2QL5A 1NVMB 1N5KA 4P7JA 2ZJAA 4Z1OA 1B2RA 3PQ2A 2H4YA 3MJTA 4I1SA 4YCMA 1LDGA 1FTWA 3EIUA 2CXTA 3R7WB 4HDMA 5LUBA 2AZDA 5DGTA 1SQFA 2E21A 2XCQA 5JZSA 3K31A 1ZM7A 1FYDA 2FWNA 2BFBA 5LKRA 1GCAA 1YUBA 4KJXA 2NYAA 1Z39A 2C4TA 5FBRB 1OVMA 3F98A 2ZIEA 3BFVA 4L8VA 3ADBA 1FXSA 4YJHB 1N5LA 3W1VA 4ZIRB 2B1JA 1XCJA 3MGBA 3UICA 4PHGA 2H2GA 1UM8A 4LY0A 2HWWA 5TQ2A 4L4YA 4KDFA 4LKRA 5F7OA 2A7XA 1OC2A 4XB1A 2PWZA 1W35A 5H5JA 3CIOA 1Y1KE 1K5DA 4YT8A 4UXIA 1T0IA 3H9EO 4R1UA 2BGNA 5L7TA 1D0VA 4L4UA 1K98A 4HDKB 3A11A 2PA0A 3KKKA 2RK3A 2DHDA 3MWJA 3D0QA 4ZICA 4G0UA 1JGTA 3KK0A 1AUVA 5DM60 2J6HA 1EINA 3I01A 5H3LA 1KS9A 1TEVA 2R7KA 2CYAA 2PZBA 1OFUA 3KUUA 3OOWA 2ZOSA 3ZUGA 2XNJA 4WXPA 3LQ2A 1EWYA 4MDYA 4UBLA 1GZSA 1EU1A 1PD1A 1Z25A 2XE8A 2AHRA 4TV8B 2BGIA 3I1IA 4FONA 4ENSA 3A3OA 1M0EA 1RP1A 4HWGA 1M6EX 1UH5A 3JWPA 5TNXA 1Q1NA 5BUSA 1NVAA 1V1JA 4Y9SA 4MO9A 5EJIA 3F6SA 3G9TA 3RUDA 4TL7A 2Q3HA 4Q1FA 1E7QA 3S2YA 4CNBA 1Q5PA 2RGWA 2ZUCA 1ZS9A 5DOVA 1EFPA 4WVFA 3AP3A 2BM0A 2CZQA 3DXFA 2C98A 3TM4A 3EHDA 3V8EA 3M81A 2GBIA 4LDJA 10MHA 4LX8A 3GDFA 1VCHA 4HZGA 5AM3A 1QIKA 2GT1A 1XLUA 4KQ6A 1RQGA 1K66A 2CLFB 2PGJA 4DIEA 4LF8B 3V32A 2V03A 3LLUA 5DBFA 5FUMA 2RAPA 1W5FA 2FOIA 3EEYA 1JAYA 3LKVA 4OLHA 2VDNB 2ZYSA 1BSVA 3T7TA 4KCGA 4MR8A 4G25A 1JG7A 5HGXA 3TAHA 4FT4A 4ZI7F 2FPXA 2Y66A 1UM9A 4PHFA 2XODA 3NX4A 2QBYB 3H4MA 1JHMA 2W48A 2YBDA 3R7FA 3E9QA 2X8BA 3WLJA 3REFA 2LTAA 1B14A 2HRZA 3GD5A 3HK2A 3JSXA 3TNLA 3ZIUA 1O94A 3IVAA 1ZVJA 2I54A 3H5AA 2CLIB 5IWCA 1MX9A 1G4UR 4E7PA 1RRFA 4MZDA 3UCEA 1JPUA 1AN0A 1YBFA 4RS3A 2DFNA 1MMFB 3K0KA 4X6UA 3PEEA 3U13A 4ZFNA 2IXBA 1QF9A 1E3DA 1UOEA 1N1DA 4IQ4A 3WYCA 1OZAA 1U2PA 4CR6A 4U6NA 4LJ9A 4CL0A 1E79D 2OM2A 4JN6B 4RSRA 1GUDA 2ZWPA 1E5TA 4MUBA 1KJ9A 4OJKA 1XQYA 4ONEA 3OJLA 3UA4A 4U6SA 2BFAA 3ZXUB 3EZLA 1NPDA 4K6OA 4ND1A 5I9LA 3LT0A 1MRNA 2FEOA 1NUHA 2G5GX 2QQ0A 4JOCA 2XT0A 5DFAA 1C14A 1DNPA 4ZOEA 5E0OA 1JI3A 2QG4A 1FC0A 3QEKA 4BV8A 3OEED 4MQMA 1NL3A 2ZAGA 2ZJBA 3R6WA 4TVBA 3UV3A 2PH5A 2X5KO 1YRLA 2WM8A 4DSZA 4F2DA 2O8FA 2OXRA 3DM5A 2VYVA 3VU3A 1LUAA 1X9HA 1MJ5A 3BF7A 2ECQA 1E2DA 1G7RA 4UATA 3G7UA 1LVGA 1YQQA 1VJRA 4ZREA 5CLGA 1Z62A 3A3YA 5KNDH 4R1OA 4BASA 3PTAA 2OO5A 4HNRA 3UHFA 4O4LB 3WP0A 4B48A 3ST7A 5IUJC 4E88A 1M34E 2BGMA 2OR3A 4HB4A 2IV2X 4CIAA 2J4DA 3MCWA 5KTMA 2J9GA 1PV1A 1B6RA 5BURA 4B3RB 1AKUA 4IKPA 2QRMA 2MYNA 4LXIA 4ZOLA 5EKUA 3W77A 3WKDA 4ZIRA 3N8IA 2IIQA 4PLGA 5JV5A 3BHNA 2H4XA 2O8BB 2EARA 4G0ZA 1P7YA 3I5AA 1FFYA 5A0TA 3BRWD 1FX0B 1HQDA 2P3SA 4WNIA 3UBTA 2Y93A 2HSEA 4ZAWA 3AT1A 1VMEA 2D8MA 4OMFG 4NYJQ 5CVCA 1TD9A 1VB5A 5EZYF 3NYIA 1DIGA 4KH1A 4HDKA 4GMDA 1UAYA 3R77A 2F17A 3V33A 1ZC4A 4JI1B 4HT3B 5EKSA 2O2JA 4GP9A 4RPCA 3ZH9B 4DCJA 2C4WA 2F48A 4DEYA 4R41A 4WLFA 3V9AA 4R5HA 2NO5A 1E2BA 2X2FA 3OCCA 4PX9A 4GNRA 4ZT7A 3NAQA 1OFTA 4BV3A 1VMKA 5T5QA 1M33A 1J0CA 4YDRA 3FWKA 4TV8A 3Q9SA 5TDHA 2O4CA 4E32A 1CEQA 3MGGA 4MCHA 4Q01A 3RTDA 4A6EA 5K8LA 1DRUA 1TZCA 4D82A 3GJQA 1FBNA 5EIOA 3ZS8A 1X8XA 3SEQA 1TUBA 4I36A 3PDHA 3OE7A 4GOKA 3Q7RA 4E3WA 2R8ZA 4AUMA 5E6RB 3GCDA 3V1TC 3Q4GA 2JRCA 1XZQA 1KOGA 1PEKE 3VU0A 4K3UA 2PO5A 4L51A 1SCQA 1E32A 2BGRA 4J8PA 4UTXA 3ECSA 5HZHA 1RJGA 4CQMA 1JHAA 2CMHA 2VCEA 1Y81A 3M6IA 4N5IX 5K6RA 2QY9A 1KI4A 4Z51A 5LYJF 3AJDA 3RSHA 4GLJA 3ISVA 1KYIA 1VPTA 2ZKIA 2AX3A 4NMLA 3ABZA 4MIYA 3SG0A 3ZD8A 2QBYA 2CUKA 4YRKA 1Z8HA 2PLWA 4FC6A 4ZI3A 1GPMA 1RQPA 1L8AA 3QBJA 2WSMA 1E0JA 4LHWA 4J9UE 3SF8B 1PUXA 3EY9A 4MIOA 4FYJA 3EAFA 3IKLA 3H5IA 3N5CA 1IQRA 1X7GA 1FMLA 3OHSX 4OI2A 4XKJA 3WGLA 4FNAA 3GJ5A 4FLMA 4V39A 1J0EA 5EL0A 5CDTA 5GIPE 5DK4A 5FWXB 3S7ZA 5FR1A 1AUPA 2GPTA 1S7GA 4AFNA 3KR9A 3RFCA 3PPIA 1V6SA 2AFHE 3K35A 4KXNA 1YUMA 3DLIA 4LHVA 1K06A 4IQ8A 4AWXA 4AUNA 5DXAA 2WOOA 1BS1A 1YBVA 4FLEA 3RYIA 4DY6A 1UJ4A 2DQYA 2HY7A 3ZDAA 1SBQA 2X9NA 4A6PA 3I58A 3R20A 4N03A 3B8HA 1S02A 1E9VA 1VCOA 1XTVA 4NY1A 2HQRA 2HA2A 2PTHA 4L9WA 1SB8A 4K6KA 2FEAA 3L0BA 2H1HA 1MO2A 3VOTA 3CX3A 3JSAA 1RXVA 1N77A 4XM1A 3FF1A 5ERGB 1ZVVA 4G5QA 2CHUA 3D5EA 2VJKA 4CG3A 3U4GA 1ADJA 1P33A 2QRNA 3D6VA 2VHWA 4FYXA 4IDBA 4B71A 4ENQA 4Q03A 4UNPA 1YZKA 5M34A 3GJ4A 3HR7A 4P5PA 3D7LA 3B6EA 3VX4A 4ZYUA 3ZIAA 4OI1A 4KX3A 4FN5A 1WU8A 2VBFA 3SZLA 1KAQA 2D54A 3ZQUA 1CB7A 1CVIA 2I9KA 1UPUA 4E51A 1E4EB 1MV8A 3H8JA 5P21A 4NP6A 3JVUA 4P54A 5DOZA 5E4FA 5E38A 4QKQA 3DMTC 5IABA 4RHEA 4LF4B 3AXTA 1S1MA 2G06A 5DBGA 4LY3A 4O4LA 3WDKA 4DA4A 2ZI9A 3H1PA 1MAHA 2YFHA 3EW7A 5EVJA 3EWIA 4OREX 1THZA 1MEEA 4V2UA 2PE5A 5E6UB 1U3FA 2J0UB 4FI3F 3LBIA 2XBUA 3QE4A 5CLLA 5HKAA 2XUFA 2AK2A 2FHSA 3ZD9A 1HZZC 1FX0A 5F78A 3FCEA 3H9QA 3LWDA 4PHCA 5LZ8A 4M9RA 3RIHA 1HQKA 3TFQA 2VLBA 2OILA 3DMTA 4GMKA 3E3NA 1JKMA 3RK1A 5GMOA 1OI4A 5J23A 5I4CA 1K8YB 2OTCA 3CISA 5DIZA 4LAFA 5FYQA 3LUCA 4A5SA 4EI7A 7REQB 1RTKA 5E1MA 4XX1A 5HFNA 1C7IA 3C6BA 4BVAA 3GY0A 4NBKA 4C22A 5KUTA 2IBSA 1D07A 2ABWA 2ZRQA 3EDOA 3JQFC 3QSYA 1QHYA 2I65A 2QRPA 1HZZA 2VT3A 4J0HA 2EDCA 3KHUA 1R88A 3TS1A 3WGHA 4B3BA 4XZ3A 1EK2A 4X63A 3KC2A 4FDAA 1WBJB 1Z5PA 2ODEA 1HFJA 4E5DA 4Y67A 4KXXA 3EUWA 4E5PA 3KHTA 1GUYA 2F9FA 5K9ZA 1SVKA 3GLKA 3U1VA 5E6RA 3PJDA 4S1OA 4HFJA 4FCWA 1L4NA 2YV2A 3MJVA 4W82A 3FMIA 2OCAA 5FBHA 3R6LA 4EA9A 3N59A 2CEAA 2GASA 5DHPA 4E6PA 5AJYA 2M6LA 1EGQA 1MUUA 2D5IA 2PK3A 3KSDO 4MGZR 4MQFB 1I8TA 3ZLJA 1XMSA 1AQ6A 4EJFA 2PCLA 5D86A 4XSHA 3PWSA 4Z1MD 3QUSA 4B3GA 1I2BA 2AN4A 1I2CA 2FWMX 3KAPA 3O38A 1BDJA 3LH5A 3PENA 5K3EA 3S5UA 2M6RA 2CUNA 3AX6A 3S55A 2GHQA 2R7NA 3N0WA 5JEEA 2WT8A 2WIDA 4BMXA 1TO2E 4H08A 3QXCA 1FXUA 3VVCA 4XX0A 3JYQA 1YI8A 3M3PA 5DW0A 1KMQA 1RXUA 4BNIA 3QVUA 4C0SA 5FWXA 2NX2A 2HRDA 2EJUA 5CLHA 3B53X 1JU9A 4JBIA 4TTPA 4ZI7B 3L1VA 5KYYB 3TW4A 1XMQB 2P2YA 3OAAA 2WJJA 5C1IA 4G67A 1UOPA 2DHRA 4YR9A 1UP4A 1N2BA 2NSHA 3TVDA 1M2VA 2Q5FA 3KQQA 5JJKA 3MRVA 2XQVA 3HJUA 3IDAA 5GPBA 4KPEC 5EINA 1QE3A 3AKDA 3EUFA 4NEHB 1CR2A 2VJPA 3G0BA 4DBZA 1H2YA 4ZJPA 2V6IA 4AJEA 3CH5A 1H2AS 1E58A 4R54A 1G9TA 1E2GA 4IIXA 2IQIA 3Q1KA 1R0LA 4S1NA 1YS2X 1J5PA 3NHWA 4PGAA 4RD4A 1PJZA 3ODPA 4IYJA 2BYTA 1P2TA 1PWHA 1T9KA 3U17A 3UIEA 3I6QA 1CHNA 1H3NA 3HBJA 1CUDA 5BVGB 1XTJA 4RKEA 2JJ2A 3D8NA 1VHQA 4ZO4A 1A72A 4NDZA 1HK7A 3B38A 2D5BA 3N86A 4UU7A 3Q3HA 1AB5A 4K1LA 1K4YA 3JYHA 2F1HA 1J2UA 3EGDB 1M34B 2Y2UA 3DM9B 4CM9A 1RM5A 3PS9A 6AT1A 1JG2A 1GNPA 2WU3A 3CW9A 4BGDA 1PO7A 4M7RA 3OM1A 4HGQA 3C3WA 1XRSB 5BQPA 5HK8A 1XHLA 4XUCA 1IHDA 5E6UA 2YCLA 2J0UA 3OIGA 3OCZA 2WNHA 3VDMA 2FQYA 4BZZA 3AG6A 4JYAB 2YJZA 5EIFA 3RJTA 1G5TA 1GHTA 3AF2A 1LRJA 1VL1A 1TW2A 1KJQA 3D5TA 5DT2A 1JBQA 4GC5A 4LF9B 1JDTA 1ORRA 3OIUA 3TRHA 3KTDA 5LQJA 4H7DA 1TZKA 5K03A 4UEJA 7REQA 1RQNA 1EQUA 4IJUA 1PFWA 1PVOA 5DP1A 4FZRA 5H81A 1XV5A 3QLVA 2IWHA 3ZNNA 4U63A 4FDMA 4DWJA 3ZLVA 2ZSHA 3LFUA 4UBNA 1R0WA 3CG4A 2I99A 1R4AA 3QF4A 4WXYB 4NG5A 3U1TA 3G2HA 1NI4A 121PA 1HDOA 5EZYB 1O95A 3K9FC 4D25A 2JI4A 2G82A 2CNKA 4XM2A 1SCUB 1FNSA 2XTNA 2P5TB 4OJNA 1NYTA 3W8DA 2O5CA 2BJHA 3H8VA 4X93A 1UZMA 2I03A 4F91B 1BA3A 3HP1A 4KWCA 4WXRA 4QRHA 3MRSA 1A8PA 2HQBA 5A6SB 3Q5EA 5M5BA 2XYVA 3ZC3A 2VUSA 5T4BA 4LSMA 4KOEC 1N2XA 2P7IA 4QLOA 1UBJS 3J7AC 4OQEA 3BGVA 4YB8A 3B7PA 2X6TA 1XA0A 1YCGA 5JVDF 3L7BA 2LIVA 1VL0A 1Z8DA 3WBKA 2QN6A 2RJOA 1XEWX 3Q98A 1KSJA 4MQFA 2D5AA 4PSDA 1D1SA 2YXEA 4ARSA 1JIKA 5EIHA 2UXCB 1E9EA 5EERA 5TIIA 4CLDA 3GPLA 2AW5A 4BMYA 4BB0A 4C4SA 2DAPA 3R0QA 2XUJA 2XVXA 4QFCA 1KEUA 2BJVA 3MJDA 2ATIA 2PIAA 4MHOA 5ECWA 5HOEA 4NEQA 5LYJB 2ZYTX 2X4IA 3R0IA 4AB1A 1JXOA 1FTYA 3GGGA 2AFHB 3VDRA 1MQ9A 1SULA 1QF7A 2BGUA 4NLLA 3UK0A 2GEFA 4EFDA 5KYYA 2IYXA 1S8NA 3VNAA 2DF8A 4LXYA 3CMCO 4OKIA 5KDOA 2C84A 2VSXA 5U9CA 1GDHA 2COKA 2J07A 3WLNA 3EXIB 2H17A 1L5LA 3D6TB 1F1BA 3X1MA 1XA4A 4CM1A 5LQDA 4YHHB 3DZFA 4F4JA 2B61A 2NV6A 4WVLA 3I6BA 1KK3A 3CKMA 3IA7A 3V2GA 4BBJA 1PU2A 4YJFB 4EBBA 1WSWA 2W8ZA 4Q3OA 4BVKA 2JGLA 4AKIA 1ZIDA 2IYNA 3PSHA 1M2KA 4ZAGA 3CPEA 4NJEB 4O4JB 5JS1A 2B20A 13PKA 2DY0A 1UK8A 3T54A 1YDGA 4DR4B 4I4CA 2JGDB 4RANA 2OD2A 4PWYA 4UMDA 5AOCA 2VHTA 1DKUA 2PCJA 3KQVA 1XWIA 2Q0HA 5C4IA 4ESEA 2ZE6A 2PU5A 5CEFA 1KL7A 1DCFA 2RH5A 3AR2A 1JIJA 4II3A 5EXTA 3RRXA 1G17A 4EJSB 1FS5A 3PRYA 3PXAA 4XQGA 3IE2A 4FE3A 2O8NA 3EH2A 1LH0A 3GMIA 5CM2Z 5GP1A 3B3FA 3X3HA 5JQGF 4PS1A 2PLFA 2RHDA 2P5YA 4QYXA 4FSDA 3OJFA 4AZ0A 3JVIA 4MW7A 3TDKA 3A1NA 3Q3JB 2PMFA 2LNDA 3E53A 2BHNA 4F4CA 2QGNA 1JNYA 2C2GA 2R87A 2VF2A 2G1KA 4ILEA 2BFWA 521PA 3SDZA 5C8XA 1B0UA 2PT6A 4J91A 5U4QA 1ICEA 1QYVA 2A3RA 2YY6A 5GM1A 1PYGA 2YYSA 3UMRA 4OK3A 3VR0A 4DBLE 5TQ0B 3ZHRA 1F6BA 2Q8QA 2HPZA 3LLMA 1BWPA 1O4VA 4MKGA 3GFVA 3HP4A 3CTMA 1NYRA 1QFSA 2P4UA 3K0EA 2AUTA 3UB2A 3T5BA 3HBAA 3IE0A 4X9XA 1PR6A 4P3NA 4MVJF 3EWAA 3ITNA 3IEVA 4MWSA 1XZFA 1XQVA 1ZJYA 5CX4A 4F97A 2HCBA 3EH1A 3OEHA 4MICA 4UU0A 1DEOA 1EX1A 1JZQA 1YE5A 4FPXA 4XLTA 4G85A 4B45A 3VR6H 2F1IA 2F3RA 2BLLA 3B9RA 5EZYA 1DEHA 3A9RA 1U7TA 4Q24A 4Y18A 4IMRA 5IAJA 4ZA2A 2XT6A 3FI9A 2QW1A 2WIKA 4OSPA 4FFVA 3HGMA 3H1AA 3CH6A 4XB2A 3MN1A 4CT5A 4DDVA 4MW9A 1L8OA 5A6SA 1PFVA 1G6HA 2PUGA 3FIUA 2VPPA 2ZBGA 2HZBA 1FNBA 1M2JA 3C8HA 1D2NA 4OTZA 4L0MA 2A35A 3ODGA 4B87A 3DCJA 1LI7A 2G8NA 4RKRA 4W4TA 3K73O 1TA4A 3OP1A 4M53A 3H65A 4PYQA 5DTRA 2I4LA 5AWFC 4JGIA 1GIAA 1V3QE 2AC7A 3H04A 1FMFA 4IG9A 2RHRA 2UZAA 4IVNA 1U7UA 2O7RA 3AHFA 4KXQA 5HRUA 4NXNB 3VBCA 1CC1S 5IK2D 3ENZA 5LZ7A 1EBBA 2PBRA 1I51A 1N6IA 2WJ6A 3V3TA 2JJ1A 5CDSA 5A5GA 2PM8A 3R9XA 3AKEA 1FXWF 4ZO9A 1L5RA 1ICIA 3USCS 4YRDA 4AY2A 3AF0A 2C7PA 4CTOA 1QZTA 2WZDA 5HIJA 2VT7A 3L8CA 4DR2B 4P38A 3ZW9A 1N0WA 3OKPA 4Y1EA 2JGKA 2BAGA 3DB2A 3I2HA 2ESRA 3EA0A 3KKMA 1E1RA 3NHSA 4TXMA 3JARB 4GU5A 2ZT6A 3ZOKA 1VXRA 1I1NA 4WDRA 4Q9HA 3ZWCA 2YYAA 3SICE 5HFJA 2IYLD 1Y63A 4JQCA 3H2IA 3N6VA 4CIVA 4N9WA 4MR9B 2UVDA 1FJXA 5KQMA 1WCXA 2VDVE 2WKSA 3DUFB 4NS1A 4JCCA 2WWWA 1DWPA 4CLHA 2XKKA 3EXIA 2BGTA 3DH0A 1SO8A 1EUDB 1DP4A 5F76A 1AZWA 2ZRJA 1E1DA 4NV3A 1IN8A 1AQIA 2HTFA 4I8IA 4BVEA 4EEKA 1R8SA 2EHDA 3GEHA 3GLSA 3L1HA 2PKYX 1AF7A 1CP3A 1Z68A 4INAA 4QNNA 4EJSC 5A7GA 4YJFA 2P90A 2GM3A 2QN8A 3O7MA 5KOJB 1XL0A 3L18A 2NUPB 3OH8A 4NJEA 4O4JA 5DYIA 2VXCA 5ICSA 4D1YA 2JGDA 2BZSA 3O82A 1U2QA 3FDIA 4MI6A 4QOSA 4U2FA 2A1IA 3SKVA 2O7NA 3A27A 2EJBA 1A5ZA 1DC3A 3D7MA 4NI5A 1D1TA 3WS7A 4CPDA 5KNBH 3U7EB 4JK3A 1OE0A 3H97A 4EHLA 1OIVA 3OMXA 4GSKA 1R15A 3UFBA 1NSYA 2YW2A 4KX5A 5H80A 1JFRA 3HM9A 4HAVA 2P4SA 1NNI1 3CCCA 4K8OA 4RCVA 4UM9D 4UVIA 4QOEA 3RABA 3ZTYA 4EJSA 1KE1A 3KEGA 1D9XA 4BQIA 4S1PA 3CZQA 3MC1A 3ORSA 4FI3C 4R2LA 5HF6A 1Q0UA 3CXRA 4HMQA 5C34B 4LSGA 3C2QA 2VDKB 3ZDCA 2IHYA 3I8XA 2CLOB 1GSHA 2CHFA 3JY6A 4GP7A 1SY7A 4BFSA 4KNYA 1G3QA 1Z9BA 2WINI 4QJ5A 1Z6QA 1R5JA 3DO5A 2QORA 4HAIA 5A0VA 1J09A 3QPVA 4PXAA 3V1UA 3E22A 1UF9A 2FX2A 3K70D 5TQ0A 3D6JA 3NT5A 4OJMX 1ZBQA 3IHWA 2JVKA 3PFFA 3CTPA 1AQJA 4HH1A 1I4WA 1WO8A 3HB7A 4LXTA 5CYOA 5LD2C 1EUCB 1RKVA 1T0HB 2ZTMA 4UKDA 4EITA 2PSEA 2YJ6A 1BX1A 1E92A 1ZINA 2GKSA 2I76A 5BQ3A 1ZJWA 3QEAZ 1VOTA 1L3IA 1HKUA 5LB4A 4WFIA 1E7RA 2Z30A 2IGTA 4H27A 3LP6A 1RMQA 2YWXA 4HWKA 3SN6A 3EEOA 3AERB 1GGVA 4B6QA 3VR3A 1Y3HA 3FGOA 5GONF 2OV3A 5DBOA 5I7UA 3QVOA 2JI8A 1L4BA 2DWPA 2I2XB 2FFJA 1ZESA 1V4VA 3HYNA 4MLCA 3OWXA 3NV9A 3GLHE 3CLVA 2P9BA 1GQQA 2D5LA 2JGAA 3OKFA 4MQ5A 3T8YA 3VXKA 4N9QA 4EH1A 5IDQA 1EVQA 2CLCX 3PHHA 5LNK1 1SXJD 3G8BA 3KJZA 3LDAA 1TVCA 3MSXA 1P5JA 2W43A 4CG2A 5DNAA 1KDYA 3KOUA 3FPCA 4Y6SA 5K3OA 1ZW6A 2I5PO 1F9AA 4NC9A 3DLTA 3TOXA 5CFRA 2G83A 2PUEA 1XCPA 3PVCA 1WTCA 4MYSA 4AJPA 1XB2A 3AI3A 1PL7A 1NPYA 3HJBA 4S24A 4CMCA 4CM3A 1NVFA 2WFLB 2XLBA 1IEWA 1E2JA 3IXMA 4BNKA 4CDMA 3KTAB 1Z5ZA 1E1YA 1RJ9B 3N9IA 1SELA 4J0IA 4QUHA 3ZGOA 5JVDB 3LVQE 4BO2A 3IBCA 3OICA 1EGVB 3TYXA 4DA6A 1BMDA 3A1FA 3GJ7A 3EOBI 3PNLA 4NVRA 1SNYA 1Y4AE 1QLHA 4II2A 2GH1A 1SUSA 2A5GA 3G8AA 3ORHA 3IQDB 3BXPA 3PNBA 5HMMA 1NRIA 3CLTD 5IHXA 5LMZA 2R79A 1J56A 3LDGA 3M6UA 1EFHA 4XQ0A 5AVZA 2P62A 1OHHA 4GMHA 1NDUA 2C9ZA 4RD0A 4RJIA 4A23A 4EHNA 4MRVA 1RHQA 1RNLA 3N8NA 1V7QA 4PLVA 3WNZA 1C8KA 3DUFA 4NCAA 1JALA 1UMKA 3W2IA 1ZVKA 3FFAA 1Z4PX 2FR0A 3M33A 3OLXA 1HURA 1UXKA 3ZVMA 2V6BA 1HDIA 1DXHA 3L8MA 3QPAA 4HGOA 1O6BA 1QYIA 3S70A 4EG7A 2XKJE 1PTJC 1MD9A 4GQIA 3C8DA 4PLCA 2W93A 3K20A 4RLSA 2V6JA 3PD0A 2G9NA 3T34A 4PY2A 3VRHA 1ISFA 3N0TA 2OQVA 2H51A 5KOJA 2DJ5A 2WG1A 1JLHA 3TINA 1IATA 1JJBA 1HTBA 2NUPA 4GPIB 1BAPA 1BVYF 1WMAA 4DEVA 3CMMA 4RYLA 2QTVA 3PQEA 5FOSA 5THKA 1BXGA 1G3MA 1W73A 4LYEA 4XDZA 1N2JA 3IXQA 3AW9A 1GYQA 3EIWA 1P6UA 3TIVA 2A84A 2DKNA 3TQRA 3UXEA 3B85A 2XGMA 1W581 3HA3A 4YCCA 5JECA 1F7VA 1UDAA 2XOKD 4XDYA 5GQSA 1PTJA 2BFEB 1E3WB 1RIIA 2R60A 2ZR7A 3AO0B 3RS7A 3TXXA 1Z2OX 5DSTA 5HM6A 2JFUA 3KDAA 5IEJA 1QO9A 1U0OC 3R5SA 2W6PA 3WRVA 1DKQA 1Y1LA 2FU5C 4F2HA 5EQDA 5HP4A 4A16A 4I6GA 3FUWA 4GUDA 3UJHA 3BS4A 2F8LA 3F6BX 4JBHA 1P0FA 2Q1YA 3TSYA 3ZQ6A 4A0RA 4E2FA 4ZEVA 3SS7X 3D6NB 3PC4A 4AG6A 2JHCA 2JIRA 2P9CA 3PTLA 1CS4C 3LCRA 4LNHA 3P0IA 3V4VB 3GJSA 4M7PA 1BDHA 1A9XB 1EJ6A 2FE4A 3OOSA 1V71A 4TRJA 3SM9A 3ZWOA 2P2DA 2B2XA 3VPXA 2RK6A 1JA0A 1T4GA 2OP1A 1L5QA 3AF5A 4ETWA 1EUCA 5KQSA 1KEKA 5F7JA 1IPEA 4GRIA 4ZOAA 1WR8A 4E2YA 4BY9E 4Y2VA 1D2HA 1U7HA 6Q21A 4IVPA 1R6TA 5IANA 3WB0A 4XIJA 4CODB 5KNDD 4BYMA 4F2GA 2GCOB 4WBXC 1SZDA 1N34B 1Y9ZA 2B6HA 5E3JA 3SLRA 5CNMA 1P0PA 4FYKA 5H70A 1VPVA 3KG2A 3LL4A 4J6FA 5JD5A 1X1EA 2AZMA 1U8TA 4JCOA 5BV8A 4JJ4A 1TAUA 5DNDA 4B6EA 1NVUQ 3VSBA 1IXRC 5AJZA 3AHCA 3KPVA 3JYOA 2XA1A 3TR6A 5JPCA 2FFRA 4FMDF 3WBBA 1AS3A 3CO5A 2YVUA 4IDFA 5EJ5A 3MWDB 2VQFB 1WXFA 1U0LA 3VMFA 4OO3A 4DJDC 5KZMB 1HT3A 3NONA 2OD9A 2G80A 4HPJB 5KVCA 3NDPA 5BN4B 5K0LA 1LJ8A 1U0SY 4US1R 1G8SA 3LW8A 3W2EA 2QUJA 1WV0A 5GOZA 2VCYA 1SCAA 2DBZA 2O59A 1XEFA 1JL3A 2GZ3A 4MGIR 1VJ1A 1Q2XA 4EVQA 1YQEA 1RWPA 2PT9A 2IY8A 1F8FA 2RARA 5FBZA 1XRPA 1CJUC 4EHDA 1UT6A 2D62A 4B4OA 1RJ9A 2H9AA 1U81A 4FMPA 1Z4KA 4WCVA 4XVRA 5FA5A 3E23A 3V4ZA 4ZJYA 3OJEA 1TKBA 3VNQA 1DIHA 1WDWB 4WXEA 3R8FA 2YWGA 4L7VA 4MROA 1MHPA 3M70A 3GA7A 4CEJA 2C4UA 4FKBA 4OA8A 2CCGA 3FPEA 1L5VA 1VI2A 3HSSA 4LN1A 1O2DA 2O2HA 2YWEA 4MTLA 3BMOB 3I9LA 3K0CC 3C6YA 4W9NC 3TZHA 4P1ZA 3UENA 3VHXB 4IGEA 4AZSA 3OUTA 4Z9YA 4JLDA 3F71A 2PJDA 3HM2A 5DMXA 3DE3X 1ABBA 5IWAB 1OFIA 4F5EA 4AMBA 2P9JA 1Z17A 2JFHA 4IGKA 5KAPA 1ODIA 4E46A 4QNRA 1NAHA 3UMSA 1GPBA 3KL4A 1Z16A 4BQNA 2AOVA 2D1FA 3EJWA 5DYNA 2CLSA 3FHTA 3KWJA 1LFDB 4MRMB 5BOVA 3SLKA 3NJRA 1GZ5A 1ZA2A 2Q0XA 1XI2A 2H3EA 3CT6A 1XYVA 2SNIE 1JQ3A 1ZY2A 3HCOA 4IDCA 3V5NA 4AW9A 4WK0B 5HIIA 2X1MA 2V6FA 2WYHA 4KQXA 3MTGA 5IAAA 4TSFA 3D4PA 2YY7A 3VYUB 2J5RA 3E9DA 4CLRB 1J22A 5JMTA 4NOKA 3K9LA 1EVLA 2Y05A 1XZJA 3EFBA 4H7EA 5F2OA 3U4MA 4KR7A 1JSRA 2YFKA 1TOAA 4XXHA 2AEJA 3A1TA 1K3UB 3ADKA 1Q0QA 1E3WA 1P6QA 2XAAA 3AGPA 4ZPXA 2OFFA 1FSPA 3EDMA 4C20A 1YZGA 2CNWD 4ZZIA 1L4UA 1ZUHA 4YK7A 4CMEC 3SY8A 4TQUS 3U81A 4UCQA 1U4OA 3NNNA 1MABB 4G4SO 1VCMA 3LGXA 3TSCA 3DZHA 1R9GA 4GOMD 3RRZA 3REGA 3PUWA 2HJVA 1UPBA 2X5OA 3IP3A 3V1KA 1NE7A 1UMDA 3DE2X 3LY5A 5F3WB 4UBJA 2O1XA 4GOXA 1OBFO 3GJ0A 2NACA 4L3OA 1MIOA 4BB9A 2VSOA 1E69A 1A9XA 2YZ2A 1NP6A 4MIEA 4K9OA 1Z0IA 3OPYI 2EXXA 3I9KA 3QGMA 3E9EA 4XVHA 3BD7A 3OLYA 2G67A 2OCDA 1RM0A 3WTBA 1JDJA 1Y8CA 3HKEB 1SQGA 1FW8A 1EK5A 3LX5A 1NBEA 3U3JA 2VAWA 2DLCX 1E3LA 1NATA 1VMIA 1KJNA 1IMJA 2WAOA 3IBSA 5REQB 3F5QA 4DLSA 2GCOA 3C7DB 3I1JA 2UYCA 3QPDA 1HLGA 1L8LA 2FN4A 2Q27A 3GIWA 3P9QA 4JU8A 3T7IA 4MV3A 1P4SA 1G21E 5JS2A 2XWPA 2FW7A 2OT3B 5LMUB 4MVJA 4BLSA 1CDZA 3L1JA 4P33A 2VT2A 4QBHA 2C95A 2FE1A 3ISJA 3IQHX 3SYNA 2WAMA 4BX2A 4YXWD 2RHOA 1ADCA 4EL5A 2ZI6A 4PANA 4XDHA 3KZXA 3ZK9A 3ZWWA 1XD2B 4OEHA 1KNXA 4S35A 1K6MA 3EGWA 1E9FA 3RR2A 4MB0A 2GXAA 2IIVA 2QDKA 5DZSA 1LWOA 1VDMA 2WSSD 5FV4A 2B78A 4YPFA 2EIXA 1T8PA 3QA3E 5GONB 4BRZA 5BN4A 3KOXA 5K0GA 2AR0A 1NU8A 1Q0HA 4J1SA 5CT6A 1RD4A 3EF3A 4LKOA 4QFDA 3U0BA 4WOBA 3KYDB 1NZDA 4YGXB 2WU4A 3HVHA 4ENVA 5ICMA 5IS2A 2AN5A 1RABA 1CD5A 1Y6JA 1N5RA 2FEXA 2I3AA 4WX2B 3SVZA 3ESDA 5TQVA 2WQ7A 3RUEA 2WVGA 3QVMA 3V8MA 4IHKA 4YXFA 1TK9A 1ZP6A 1GPWB 1FTQA 2A30A 4LOIA 1JYSA 4ZCTA 1RXCA 5IXJA 1TGYA 2XDYA 4CV2A 1H23A 1WVMA 1Q0SA 1HA3A 3GFFA 3PX2A 3ET4A 3D2CA 1K9VF 2XIQA 2PR7A 1T10A 3NU1A 4NCBA 1J8FA 4YWHA 4UBIA 4BEWA 2PFGA 1CJCA 4ZV7A 1DAPA 3CLHA 4RXUA 4D9KA 5EQJB 1XXHE 2P6RA 2POQX 4H3VA 4BIMA 3C3MA 4S05A 1BMFA 3BMOA 4ZEXA 3VHXA 1RWXA 2HDNB 2X9LA 3OJOA 4IRXA 2DERA 1RMTA 3M34A 3L05A 1FBTA 3K1JA 1LEHA 1NBMD 4DA7A 1E6KA 1U2ZA 4W1PA 4UFPA 4H6PA 2GDJA 1KC1A 1BKDR 1QJ4A 5AICA 3FBTA 2R5NA 2ZYDA 5GV8A 5K0EA 3FTFA 3A3NA 1ZHOA 2PN1A 4UQLA 4MRMA 2CWDA 4QX6A 4UPDA 3AVWA 4BLVA 3ZWAA 3GLGA 2WF5A 3UJCA 1A76A 3FNFA 1UJ5A 1U8EA 3L93A 1PQPA 5IYZF 5LQKA 3PA8A 1Z36A 1KRXA 2P27A 2BEUA 1KO1A 2ZWAA 3TAUA 5CMLA 5SY9A 1DCTA 1D1PA 2CK3A 4R4JA 1XZPA 2CXUA 4QFMA 5COBA 2ENWA 1D2EA 1OFGA 1ODCA 1IC6A 1T91A 2LD4A 4FOTA 2C0QA 1OAOA 4M0EA 1NR5A 2BT4A 4UE2A 1SZCA 4HHEA 5G1NA 4L7QA 4QVIA 2X8AA 1ACJA 1P7ZA 1Z26A 1GVHA 3P2MA 2C1ZA 4MDEA 2EQ5A 2Q1XA 2LVBA 2WD7B 2WWIA 3IBFA 3PSAA 4RDIA 4QODA 3T3PB 1Z73A 2H4JA 1X8JA 4RHFA 4ECAA 4X20B 5EE5B 3OTOB 1OW3B 5AHOA 1U7XA 1UKZA 2HGSA 2Q07A 1ANKA 2WEKA 2XRZA 1PHRA 3O4VA 1T29A 2I7CA 5FFFA 1G38A 3IT1A 4ARVA 4KR2A 2I9PA 3TFOA 2CNNA 2PKWA 3U09A 5BY2A 3LSYA 3I2JA 1VYHA 3KEFA 4ATNA 3E5NA 2R2GA 2XSZA 3P26A 1HL3A 1LU9A 4G0MA 1N9KA 1KBQA 4PE5B 4AI6A 4ZVLA 1OBOA 2OCYC 3WLIA 4TYNA 2JGIA 1VYTA 1QHSA 1YS7A 4HGZA 1COWD 2IUEA 2F3QA 3FWYA 3SJCA 1F0PA 2N75A 2GSDA 2NZJA 3HKEA 4TVKA 3ZWBA 3MCTA 1SC4A 1SC1A 3Q72A 4WASA 4I55B 4P4NA 2FOLA 4RF4A 4IIVA 3IOYA 4QAQA 3ZE2B 1RZVA 3LX6A 3W05A 4CMAA 3NIFB 3SBDA 2ZZNA 4Y2PA 3FKSD 3RIXA 1G19A 3OCWA 4GOOD 3PQDA 3EXG1 5JSYA 3VDQA 2SECE 1KEZA 2NZ8A 2NIPA 4AN4A 1Y7TA 3U4AA 1KQOA 2XF8A 1P2VA 1VIMA 2CLMB 2NU7B 2Y1XA 3GRFA 4HTAA 4MYHA 1P9LA 4CGYA 3W5DA 4TTAA 2BFDB 1EA5A 5JATA 2CFSA 4KKVA 1XIVA 5D3MB 2QUBA 5CW2A 3DHWC 2EW1A 3GVIA 4WJKB 1F8YA 4RVSA 4Y2HA 3E6AA 1AKWA 1OMOA 2Q9AA 4BDTA 4D26A 1C3VA 3FXAA 4X44A 2ZRIA 5JSUA 2A92A 1T36B 4MI9A 3HV2A 1GKIA 3GZJA 1TYZA 1TLTA 4UNSA 5GONA 4DFDA 3OIDA 3DAYA 4MVXA 1IHUA 3NTQA 2QM7A 4LOLA 4NFSA 3I30X 4FMDB 3TBKA 1NY6A 3KYDA 1GO2A 5E9AA 3ZCUA 3OMWA 5BV0A 2ZVJA 1W4AA 3UPDA 3NUZA 1XPRA 1CEXA 2XWJI 1W4BA 1WHSA 2GLUA 2JIZD 3L6CA 1FFHA 1R27A 2GK7A 2C82A 1YQWA 2JAUA 3ENKA 3LXUX 5EYPA 5G0UA 2O8DA 4CDRA 2YV3A 1OROA 1SIBE 2GBFA 4JYBA 3X1KA 5FA8A 1FUIA 2IEAA 2VHJA 1T6NA 3W9UA 4CM8B 1DDIA 4QRIA 1UMCB 1UOQA 2WFAA 3DYIA 5ILQA 3VYWA 5KJ1A 2D2XA 2EKBA 3N70A 5DP2A 4YS6A 1Y4UA 3COWA 2WQZA 1MZVA 2CJXA 5EI5A 3KB6A 4ZAZA 4M0MA 1RE1A 4GIBA 4YV7A 1LPAB 2BWJA 5AOAA 2QPLA 4HMPA 5CCEA 2OAQ1 1XZBA 2MMGA 2OLKA 1JKFA 1GCIA 2Q5HA 2QD4A 2IW1A 1FLNA 2QQGA 4QYSA 4P9NA 3BMXA 1KETA 1YJ5A 4Q7JB 2IYPA 3AEKB 3NMUF 3IRUA 1J24A 2VEDA 3RKRA 2B5VA 5CBPB 3FIJA 1BX0A 5JBNA 1UBUS 1JTEA 1RYEA 4HAUA 1X13A 2BCEA 2XLCA 3RF7A 4FHFA 1GTRA 2W2OA 2VDOB 3LDFA 1R16A 4OFBA 5LVAA 1Q6ZA 1ZUNB 2EIHA 2EWVA 2RCNA 2Z2XA 2WWXA 3P0FA 1R0YA 1D1QA 5AW7A 4HAXA 2ZB4A 1KZ4A 1MH1A 1GAEO 3X2SA 5BSHA 4LDQA 5DYTA 5H8WA 5DX0A 4DTIA 1O54A 1MOZA 3DOOA 1SG9A 4RDHA 3WK6A 5F23A 5J4KA 3BCUA 4XWOA 3IURA 2O1WA 1AIPA 2ORVA 5K0JA 4M0UA 1MTOA 5AKHA 3OZUA 5HW0A 3EOZA 1G2PA 3HO6A 2BHSA 3EXG2 1MXFA 5BSWA