4NICA

Crystal structure of klebsiella pneumoniae rsta bef3-activated n-terminal receiver domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
NKIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQWQGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional regulator RstA
publication title Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription regulator
total genus 38
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nicA00
4HNSA 4LDAA 2PUEA 1Z26A 4OBBA 1B00A 1YS7A 1JL3A 3CNBA 4KNYA 3CRNA 2AYXA 2PUCA 1ABEA 3NNNA 2BGGA 2DRIA 4RDCA 3F7NA 4LX8A 3O1JC 1NXVA 3N0WA 3KHTA 2F8SA 3EGCA 2IPLA 3H5WA 5TQ2A 2ID7A 1VRVA 2HQRA 3P9YA 3H6GA 4Z4GA 4XARA 5TPWA 5TQ2B 3HUTA 4LE2A 1DRKA 1EWVA 4YR7A 3FFTA 2QXYA 4RZSA 1DCFA 1ISSA 5TPWB 5JNRA 3MYYA 4KMRA 4G86A 4QICA 1M2FA 1OXKB 4FE7A 3TMYA 1WETA 1XWWA 4MLCA 3UKJA 4Z4HA 1S8NA 2NT4A 3GT7A 4L4UA 1DCKA 2FXIA 1GCAA 1VKRA 4EVRA 3QLUC 3HCWA 5CNKA 3FMVA 2E4ZA 3EAFA 3LUFA 5BRJA 5IX8A 2FN8A 3O1HB 6ABPA 1EWKA 3H75A 1PEAA 4H60A 5CNJA 4B09A 5DCLA 4ETNA 1CYEA 6CHYA 4H3HB 4MRMA 5B3JC 1SRRA 4OTZA 3CZCA 1FQWA 3KLOA 2L2QA 5IC5A 3CG0A 2MSLA 1JYFA 1M5TA 2LBPA 5JNUA 4OLBA 2J48A 2W42A 5TE9A 3LOPA 4YLEA 4JB2A 4ZMRA 5F64A 1HEYA 3ROTA 4LE1A 4RK7A 2FEPA 4W5RA 3RVPA 5EWMB 1Z25A 2V0NA 5CHYA 4ZJPA 2GI4A 2QSJA 5IEJA 2QU7A 4YCSA 5E3JA 2YHAA 5EWLA 3T6KA 2FQXA 2L17A 2CHFA 3BRSA 4JB0A 1CEYA 1TMYA 3KTOA 3SG0A 1QP4A 1JF8A 2FKAA 5EWLB 4N76A 2IDMA 2MYUA 3N0RA 1NXPA 1Z18A 1U2PA 4LE0A 4MS1A 1YK1A 3QLVA 1L5YA 1SD5A 1ZITA 3JS5A 5KWSA 4Z4IA 1BA2A 1K68A 3O2SB 1SXIA 3DZDA 4JA2A 4MS1B 4WXEA 3RVRA 3GWGA 4HNQA 1PUXA 2R4QA 4PE5B 3KSMA 4RWEA 4TLMB 5CNIA 4LZLA 5D2CA 1BDIA 1QQBA 2FMFA 1U8TA 2E4VA 3LUHA 2WRZA 3BILA 3GRCA 2JVKA 5C5CA 3DLHA 1JFTA 3URMA 4PICA 4TLLB 4MR7A 4NV3A 4EYOA 2H3HA 3MQ4A 4MR7B 1FFWA 3H6HA 4UHJA 3OLZA 3O1IC 1E6LA 3LUJA 4MQEA 1A04A 1Z2EA 2GWRA 1VPWA 1NXXA 4MQEB 5EWJA 3FFWA 3LUCA 3H5OA 3A0UA 1PHRA 1TM2A 4Z4FA 1XHFA 3BREA 4WT7A 1H9CA 5EWJB 1Z12A 3IP5A 1ABFA 5T7BA 4Q6BA 3RVQA 3RVNA 2MSWA 2E4WA 2LP4Y 2H0AA 3KYIB 3F6CA 4H3KB 3EQ2A 3SQNA 2PLNA 4ZPJA 2FSPA 4ML3A 1TVMA 3FDFA 1YK0A 3KKEA 3IDOA 2PUAA 2PUDA 1QP7A 4G0MA 2MYNA 4KZKA 4RV5A 3JVDA 1FFSA 4G0OA 1Z16A 3C3WA 2MYTA 2F8TA 1JFSA 5ED4A 2E4YA 3A0RB 3N6VA 1ZAYA 1Z15A 1D4ZA 2XDYA 4Z99A 1EAYA 3A10A 2GBPA 1ZHHA 1DZ3A 3RVOA 1BAPA 2PL9A 2JVJA 3C6QA 4HYEA 1GCGA 2QZJA 4N03A 4RSMA 3SNKA 3QLUA 4JAVC 4NCBA 1Z13A 1DC8A 4G0YA 2A9QA 4TMYA 5FBKA 3T8YA 5DLEA 4ETIA 2M98A 4YP9A 4L85A 4QPJC 3VNBA 4MYRA 3HS3A 4O1HA 2P4UA 3RVJA 5IULC 4EGSA 5B3JA 4KREA 3CKMA 3CTPA 3EULA 4JOQA 1DJMA 5DKFA 3KG2A 3BRQA 5IBQA 1P8AA 3HVRA 1AB6A 3RH0A 3EJWA 3ROFA 5HQJA 4LRQA 2QW1A 2OENG 3ILYA 4RXMA 3JVIA 1FSPA 1ISRA 4IMIB 4YWHA 5HKOA 5BQ3A 3H5TA 2JBAA 1QMPA 4RXUA 3HZHA 3IPAA 3UUGA 4YV7A 2ZAYA 2JBAB 2FW0A 5KC8A 2MSKA 1L5ZA 3OQMA 1MIHA 4PZ0A 3JPYA 3HDGA 1TLFA 3CZ5A 3M9WA 1DRJA 4IGAA 3IPCA 2R48A 4HNRA 4NCAA 1TJYA 3TO5A 4MRMB 4KK4A 4N47A 3BBLA 4S04A 3MMNA 5JS1A 1E2BA 2R47A 3CFYA 3N0XA 4WWHA 2FQYA 3OLWA 3RVLA 5DGCA 4G97A 2A9PA 1D1QA 1GUBA 4W5TA 1LBHA 4FE4A 4MQFA 3H1FA 1IIBA 4M88A 3O2QB 2JK1A 3QELA 4W5QA 1DC7A 1Y1LA 3HK2A 4MQFB 4DQDA 1SXHA 5PNTA 3UK0A 4IF4A 3QELB 4W5OA 2PL1A 4XASA 2FEWB 3LKVA 4S05A 1EHCA 2KYRA 1E6MA 1JDNA 5BRAA 5KC9A 1A2OA 2PJUA 3TD9A 5GOTA 3L6UA 2R25B 1EWTA 5TQ0A 2CWDA 3MF4A 4KQCA 1QO0D 2I6FA 4KFCA 3OM1A 3OQNA 5TQ0B 2NZUG 5TPZD 1LJLA 4RK4A 3Q9SA 5BR1A 1KGSA 1ZN2A 1PNTA 1A0OA 3CG4A 4EYKA 4OLAA 3Q15C 4LDZA 3KS9A 5FWXA 4JP1A 2IYNA 2CD7A 2FMIA 1APBA 2WWVD 3DGFC 1MVOA 3LUKA 3OO0A 2NUBA 3SY8A 3RVSA 1I3CA 3I09A 3OLYA 1NATA 5TQJA 3GBPA 3IP9A 3FFXA 4KK3A 2WY2D 1NXWA 2E4XA 5JNSA 4ETMA 4ZMSA 1JHZA 2WJAA 1USGA 4F3TA 4DN6A 5KQGA 3LUAA 2AYZA 3G1WA 4NQRA 4G0PA 3IP6A 3Q41A 3LFTA 1QKKA 2QR3A 4O1IA 2FVYA 5JS2A 4MR8A 4N41A 2B4AA 3E3MA 4YGXB 3C97A 4MR8B 4YRZA 1Z2DA 4Z9BA 1QQAA 5HSGA 1MB3A 4Z4EA 4N0PA 2LUOA 2PAFA 3D8UA 4G0QA 2PKXA 4G0ZA 5KQLA 3JY6A 1YTUA 5GQSA 4GPAA 2FTKE 2MYPA 4D74A 1JLKA 4RU1A 4Y9TA 1U04A 3OLXA 4KV7A 4RKRA 1D5WA 3QLVC 2IPMA 1NTRA 2JRLA 4Z4CA 5KQPA 4IMJB 7ABPA 4KPYA 1F4VA 1E6KA 5HM6A 4RY8A 1P6UA 1KMIY 1FFGA 2GX6A 5CNMA 5TPZA 1C4WA 2B1JA 4F12A 5T3YA 1USKA 4IILA 1PNRA 1JWLA 3I42A 3H5VA 3M9XA 2VUIB 2P9HA 1ZY2A 3A3KA 3Q7SA 3OLVA 1Z17A 3NHZA 1U0SY 3HXMA 3DBIA 4EVQA 5IUNC 4TN5A 1QPZA 1DBPA 3I45A 5KI6A 4E7OA 4WZZA 1ZDMA 1JH9A 2LIVA 4QYMA 3H5LA 1LBIA 4EUKA 2FLKA 3QLTA 4JASB 4Q6WA 3D02A 3M6MD 4Z9AA 4RY0A 3F73A 3S99A 3N53A 1USIA 1U2QA 1LJUA 3N75A 3O74A 4RKQA 1AB5A 1NXOA 2ZWMA 2QVCA 3MM4A 3T38A 3NNSA 4RK1A 3GA5A 5DTEA 4Q7EA 2L19A 2FEKA 3GBVA 3TX6A 4F8JA 4EYQA 2X7XA 4KVFA 1ZESA 2FN9A 1DP4A 1ZH4A 3C3MA 4OG2A 1KRWA 3W9SA 3JPWA 2PUBA 1P2FA 4W5NA 4MAAA 2FMHA 1QP0A 2VUHB 2HQOA 5ABPA 4P1ZA 2FQWA 1YMVA 1UDRA 4RK0A 2JB9A 3JTEA 3QEMA 4N0QA 3EQZA 4E7PA 1URPA 3QEKA 1RPJA 2OQRA 3O21A 3QEMB 1W9HA 1JDPA 3KCNA 1RXIA 4QYWA 2IOYA 2VK2A 3DGEC 3CLKA 2HJ9A 2L18A 1CHNA 3CU5A 1DBQA 3LUGA 3H5IA 2WB4A 3HSYA 4WUTA 1D1PA 3CS3A 2A9RA 2CHEA 4RK5A 1VLZA 3KYJB 1MAVA 4KQ9A 2YHBA 4O5AA 2HSGA 4MS4A 4OATA 2ID9A 3GL9A 1DG9A 1JFVA 1OXBB 3NHMA 4MS4B 2RJNA 4MPTA 3IP7A 3MIZA 4RXTA 2E4UA 4RK6A 2JVIA 2FLWA 3ILHA 2NT3A 3TB6A 1K66A 2IPAB 3KLNA 3O2JA 3MA0A 3H1EA 2A9OA 4MS3A 2VYCA 3C3KA 1C0EA 2GKGA 3HUUA 5EWMA 3RVMA 8ABPA 5JNVA 4MS3B 5JNTA 3I5AA 4XLTA 1GUDA 4MR9A 4P98A 1F51E 4MLDA 2RGYA 4F06A 3OMWA 2LPMA 3E61A 4F11A 1KRXA 4MR9B 1YIOA 4XXHA 2RDMA 3H1GA 2PUFA 1P6QA 5FWYA 5FWXB 4DADA 1J56A 2WMYA 2QVGA 5FBHA 5FWYB 1YS6A 4D6YA 4YS6A 2FMKA 1BDHA 4PEVA 5IUJC 3T95A 3EODA 3G85A 1GLGA 3L49A 3LUDA 3QX9A 1RZRD 2PUGA 3OQOA 1NXTA 1EFAA 2N9UA 2QV0A 3SAJA 1NY5A 4XAQA 1R8JA 5C5EA 3RQIA 5I4CA 2WJWA 4Z0NA 3SM9A 4EVSA 3K9CA 3Q7RA 3GYBA 3OM0A 1XHEA 1YVUA 4KRFA 3K4HA 3QK7A 2O20A 1JYEA 1DCMA 4NICA 2PE5A 3N8IA 1T34A 1M5UA 1ZGGA 1RXEA 1SXGA 4ZYLA 4IRXA 3QX8A 1ZVVA 3VNAA 9ABPA 3LKBA 4CBVA 4WXMA 4FB4A 4G0XA 1ZH2A 3NBMA 3GV0A 1NXSA 1QNLA 2TMYA 4UHKA 4PYRA 1PEYA 3OMXA 1QO0A 1RNLA 1MB0A 1DBWA 1BDJA 2IPNA 1LK0A 3R0JA 4YO7A 3RVKA 3HM9A 5KQMA 3F6PA 4XFKA 2JCGA 1BVHA 4EYGA 2NZVG 3O75A 1W25A 3HO1A 3HEBA 3KJXA 4EY3A 2IKSA 3FGZA 3HDVA 4GNRA 4MGEA 5IEBA 5JNWA 3B2NA 3LMKA 3Q7TA 4D6XA 2PMCA 1M2EA 3LTEA 3DLBA 3CHYA 2Q5CA 4RS3A 2HQBA 1JX6A 3HJFA 1ZGZA 1D2AA 2M1ZA 1RZRA 3OO1A 1YMUA 1JBEA 3EDCA 3HV2A 4RY9A 3NNDA 2RJOA 2HPHA 5IUKC
chains in the Genus database with same CATH superfamily
4I50F 4RM2A 5JSZB 3CWZA 1SOVA 2IP4A 3EASA 4UTNA 1M66A 2AMFA 3GLIB 1AZWA 3FTFA 3L7JA 3QVSA 3K4PA 4QKQA 2AC4A 5SZKB 3GU3A 3VGPA 2JI6A 1W0JA 3EIEA 4RDCA 4BATA 1QGED 4KQIA 1NW3A 3BMOA 4TWAA 3TNYA 1PZGA 5DOVA 3KHTA 3O8QB 3WO0A 1UFKA 4HL6A 1N2IA 4GLFA 4IZ6A 1M9NA 2Z2XA 2H18A 3L7CA 4J7CA 2X2PA 4QQFA 5TQ2B 1IFXA 3PUZA 1YBAA 3UJHA 1NN5A 2NW6A 3IPRA 5ADWA 4DWWA 3DOHA 4LHYA 1UPXA 4G86A 5LQSA 3FKJA 1WUYA 3IESA 3BWDD 4JB3A 3L3BA 1U2DA 4NC9A 4AJPA 4ALLA 5BQOA 4BKUA 4NTZA 4WECA 4S0XA 3QYJA 3AEQB 4EVRA 1WL8A 3HCWA 3QLUC 4ZT2A 2GXSA 2Y0PA 4BZWA 5GM1A 1L4FA 4LHSA 1B0UA 1YRLA 4Q34A 4K9KA 3EXEA 3I2FA 3DNPA 4FEGA 2C82A 5FLYA 3D3EA 4IX9A 3I6BA 1Y3IA 1BD4A 1GZVA 3IQDB 5LMCA 1T5OA 1SVNA 4IUCS 4YAOA 1I2ZA 3DLCA 2WJZB 2H1SA 4Q3CA 5EY5B 5A7GA 3VR2D 3G8YA 4A8TA 1OYYA 1SD1A 3M89A 2XNJA 4H3HB 3V2HA 5L51A 2O8DA 4LI3X 3IB3A 1RBMA 3FNRA 4JXKA 4OTZA 3CZ9A 1IHYA 1SZDA 3RUEA 3CUSA 5EUCA 4ZOCA 1VYVA 2P2GA 1L5KA 2QGNA 3IKJA 4AL4A 1CJUC 1VBMA 2E1PA 1MG0A 5T41A 5JNUA 4DMCA 1NV9A 2J48A 2RAVA 5M2QA 3U5ZB 3T3EA 2MU1A 1DBSA 2QRVA 3OX1A 4QQNA 3DLTA 5CHYA 3ZGXA 1QO7A 2GI4A 3IBTA 3P5BA 4XB1A 5HQ3A 3CWQA 1LW6E 2WWFA 1JVBA 2OVFA 1F0YA 4BJ5A 1GL3A 1X1EA 2W2QA 3K2IA 4JB0A 3WO1A 4ZN6A 3FCXA 4HFRA 1IUKA 4LRUA 2COUA 1L5VA 2ZKIA 2AG1A 3AXSA 3T7SA 2X2OA 1H4SA 4DEVA 3FYDA 2VQSA 2EP5A 4JUAA 1P1BA 3B5JA 5L3SA 1YDFA 3LW8A 3RSCA 3V9PA 3FDIA 4FTWA 5DLPA 4LXQA 1Z3IX 3BBPA 3ENNA 4TL9A 1HE3A 3QQ5A 1JLSA 2P67A 1OB2A 4II2A 3J7TA 2X6TA 4C7XA 2HPZA 5C5CA 4W9MC 3DLHA 2JIQA 4Y2YA 2QMUA 3JD1A 4Y2PA 3BMQB 4C3ZA 1YI0A 2OECA 3MERA 1BU8A 4BXOA 4KR0A 4HQ6A 3MOSA 4D79A 3AVWA 4MRVA 2AC2A 3O8OA 2OCDA 4QXQA 1B8PA 1L1QA 1OVGA 2ZYGA 1UXJA 1VXRA 5K2OA 1GRRA 2PX4A 1FTSA 4TXHA 3DUWA 5KIAA 1XMXA 2I66A 2HLNA 3F6EX 1A69A 2I6SA 4QPCA 2C57A 3A0UA 4C7OA 4WT7A 3BREA 3FZYA 3T7TA 5EWJB 1Z34A 4B2YA 4DQLA 1MRNA 2ILVA 2OFXA 1GZ4A 3HNPA 1F8UA 3EGEA 3PQ7A 1LDEA 3C16C 2X19A 1VI5A 4FHGA 2DAPA 2HK6A 3FPJA 5JJ5A 2IV2X 1UL1X 2JDIA 4S35A 2BEVA 4F8EA 3OCCA 3IRVA 1RP1A 5C1OA 5I51A 2CFRA 3Q3VA 1DQZA 1X9IA 1E0KA 2VDPB 3LBAA 5P21A 5H9WA 2C3UA 2PUDA 1KDTA 4UTPA 4N6GA 2O6LA 4L4YA 3L1UA 2H8KA 4NJMB 1Z16A 3UTDA 2HSEA 2AJ8A 2DY0A 3NAZA 3DW1X 1NW9B 1WUKS 1YXMA 4JL8A 3RVDA 4GQIA 2F3UA 4YP1A 3TINA 1QIEA 1HXHA 2NXJA 2R2AA 3MJDA 3UXHA 4C29A 1ECPA 2B4QA 3D4BA 1RLUA 4LSZA 2H4YA 4IY1A 5E95A 2HU5A 4YRIA 5C37A 4WY8A 2BISA 2IC5A 3RVOA 4NENB 4ITUA 1N3BA 2R86A 5H3CA 1Z38A 1MT3A 2ONCA 1G7CA 1UBCA 3N58A 1BN6A 3AUKA 1AT1A 1ZQ1A 2R00C 4L08A 4J0HA 2DBVO 5FUWA 4BBZA 4MULA 1KC3A 3L7AA 4AUMA 3X1DA 5A4IS 1UM9B 2HPAA 4EA8A 3CN9A 3E9EA 4CQMD 3F74A 4LZWA 1S3SA 2MMGA 1ZD4A 2IF0A 2IIPA 3QBJA 2JKYA 4JI1B 3WGVA 4DLWA 1RPAA 3RFFA 2Z6QA 1H2YA 1T0UA 1V8OA 4GM0A 4QT0A 2WPDA 3EWNA 3INRA 4HQNA 4BNDA 4ZCRA 1I7DA 4TT8A 5BN5A 1TNDA 1U0EA 2OZKA 1Q57A 1I6LA 3QKSA 1T6YA 3HM2A 4ZTZB 3SXUA 4JLAA 4L50A 3V9AA 4MHTA 1D2GA 3MRXA 4JBNA 4FSDA 1ZLYA 3OOSA 1BEZA 1ORRA 3WE7A 2D1FA 1SWWA 1XNGA 4B4VA 4R40A 1HYQA 3JQGA 1N5RA 3TXXA 2UAGA 4HYQA 3EVEA 3IPAA 1PDWA 3NASA 4G0WA 2ZZNA 4RGQA 4PIMA 3K96A 4HQ0A 5KCMA 4S1TA 1T9GR 2MSKA 2OHFA 1JEDA 1GPUA 3KOYA 3PLRA 2R8EA 1RFGE 5J2UB 2O3RA 4IGAA 1XJ0A 3BCSA 3WIDA 3IHLA 2I1WA 2Q49A 3PQ4A 2R1VB 2OQIA 4C2BA 3KQUA 4ZOEA 1C5KA 4L57A 5CB6A 3BF7A 4FHCA 2RGBA 2Y93A 1IVNA 1N6RA 1Y8AA 3R7SA 3DYBA 4Q16A 4TMVA 4GXRA 2VSNA 3RC1A 4Q3AA 2FZGA 4GOND 4TKLA 3PWSA 1M1NA 3ERCA 3ZJUA 3SFVA 1ZVKA 3N0XA 1E4EA 3OLWA 5BP7A 3ZZ0A 1RWPA 5EP1A 4EAAA 5K6TA 3CNQS 2FN7A 2ZOSA 4FE4A 4P7FA 4QYIB 2VXBA 5EGNA 3O2QB 2ZYTX 1DOAA 1GU7A 2I4MA 2ZJ4A 4BNTA 1HDZA 1IAVA 1MEOA 3ED5A 2QX7A 3HK2A 2HWKA 1IN6A 1TA0A 1OI7A 2ZE5A 5AD1A 3PB3A 3RU3A 4W5OA 3HU5A 2OCYC 4XASA 4S05A 2C99A 1WW2A 1AK1A 3CNLA 4D8VA 4TKVA 3OEWA 4C0KA 2EHDA 4LRWA 1CUGA 3G2LA 4V39A 4X7RA 3RSSA 4MAFA 3RIGA 3EIQA 3L6UA 4IIYA 4L0DA 4IHKA 1OASA 3SR3A 4CM1A 2PO7A 1O0BA 2Q46A 1QO0D 1FVHA 1MJ5A 4Q18A 5IK2A 5SY4A 4DIOA 2W6ID 5HK9A 4QXAA 2W2OA 4HJXA 2NV0A 2TYSB 4AULA 1H8EA 4WASA 3HUFA 4NE2A 3MT0A 4DLVA 5CU7A 3GJQA 1Q77A 4D8XA 1AUOA 1VKNA 1PCXA 2J0EA 3LWDA 1TFRA 2DQYA 2F8MA 3L1IA 3PGXA 3GH3A 2QTRA 3EGIA 4CL0A 2YIVX 2VRWA 5GPBA 1V8FA 1LW7A 3ASYA 3FETA 3K6RA 2ZDGA 4HBZA 1FDVA 3IUQA 4N5DA 3ZTTA 1V8BA 3WXBA 4RETA 1B8NA 3H4TA 2ZBFA 4MRRA 4GOXA 4EF6A 2IHVA 1OPXA 4COOA 2G0AA 2D1SA 3G59A 4NMXB 2Y1LA 2JIOA 5ALQA 3T99A 1G8FA 4C0AC 1USGA 1IM8A 1GPH1 2RGAA 1BEEA 1GKUB 1Y9EA 4UUMA 1BRMA 2JCVA 4X1KA 2XB6A 4JHLA 3Q41A 5BNIA 2FK7A 3ELWA 4M22A 5I47A 1HL7A 3R5JA 1IN8A 1M8JA 2G88A 2IDJA 5C3UA 3HY3A 2ZS8A 1G3QA 5JHHB 4BP8A 1FLDA 2ROQA 4QTTB 5LUAA 4XYGA 1K7XB 4MO2A 2LVBA 2OHGA 3H0CA 3V8QA 5HSGA 4H4EA 1IMOA 3HYCA 4H15A 4IXDA 4MW7A 1QLHA 3GGSA 2C0CA 3G2KA 3OQ6A 2JFHA 1E6CA 3DTNA 3RIEA 4QAJA 2JIPA 3RODA 2WIJA 4PNZA 3MSCA 1NKSA 2MIIA 4ENVA 3OJ0A 4F92B 4C4YA 4TX1A 1Y1RA 2ZRGA 2ZRIA 5AHKA 4B6GA 2QSYA 3ZK9A 3ORYA 5DJ5A 1PRYA 1UBJS 2CUZA 4I7EA 5BOSA 1NQXA 3B3FA 1VMIA 1K3UB 3DDCA 1NL3A 2BGLA 2HNBA 2JKVA 2Q2WA 3AOEA 4Y6QA 5IN4A 3LX5A 2I6TA 3LPLA 2ZBQA 3NPMA 1GR1A 3Q7EA 4EBBA 1ORVA 4YXWD 4RL6A 3ICCA 1I10A 3EDOA 1YV9A 1B14A 3HYNA 1K75A 3ZG6A 1JDVA 3QW2A 1GN9A 3U09A 3H9JA 1Y5RA 4JFAA 4JLUA 4QZVA 1I4WA 5A3QA 3EPJA 4AX8A 5E6UA 2XMRA 1WCIA 1GU0A 1SOUA 4G9GA 3IBSA 5EMNA 2J9FB 1PE0A 2Y0BA 5SYNA 4CXMA 3BXOA 1FDRA 3D7RA 3O74A 1DC5A 1NQ5A 3H2GA 1YHZA 5A3SA 3GJ5A 4H18A 4HNVA 5BW5A 1FK8A 2Q6KA 2O9JA 3WRXC 5REQA 3RSLA 5KX5B 2O0HA 2YWEA 1LPPA 3O8DA 2Q2QA 1GL9B 4V2UA 3OKPA 4ZGGA 3ZW7A 1SUIA 2B3TA 2FRVA 3R5HA 2FMHA 3DQZA 3CZAA 4EEXA 5ABPA 4QVKA 1JE0A 4AZ3B 3FGNA 1GT91 1HSZA 1UEJA 4LV8B 3A1TA 5KDOA 2ZBEA 3P0JA 5DHFA 4UBNA 4HSEA 4IJMA 5CA0A 4X66B 2WG0A 4G4GA 4L51A 2C4WA 3F1LA 4G2TA 1LI7A 4G63A 5EJ6A 1JDPA 1PUIA 3IBFA 5CXXA 3UBTA 3UUFA 1E89A 3DSRA 3ZLTA 4UZSA 4BVBA 3G3EA 4A15A 1E0AA 1BHSA 1LFDB 1NR5A 4KNVA 3K8QA 2FSVC 2H5LA 1T2VA 4O3FA 4CIXA 3EPLA 4KBYA 4J3FA 4FR0A 1T2EA 3IUBA 1HQCA 1KQ3A 2P5SA 5AHRA 1PVVA 2FXVA 4BO9A 3E9QA 3IGFA 3GEHA 1CVLA 5CXQA 3AT1A 3E70C 3AETB 4MVJE 4X6YA 6REQB 4DM3A 1NUAA 2XCUA 5C80A 2WABA 3AIIA 1SWVA 4MW5A 1E2MA 2NXNA 5EJ4A 3GLGA 2YHUA 3HJAA 5HQTA 2VZLA 4LJ6A 1UBEA 4MOWA 1Z06A 3PA8A 4HLUC 3QPDA 3D6MA 4HDKB 2ISCA 3HYTA 2OGSA 4ZAFA 1Q1EA 1P2BA 3BIWA 1M8KA 2PTHA 2FY8A 2QTGA 3WWZA 3ZX4A 3FPEA 1F6BA 2WFZA 2C2WA 3D7NA 1RAEA 4L5JA 5DK6A 3HKEB 3RANA 1KEZA 1SK8A 3BDAA 4QUAA 1CDEA 1OMOA 4BMDA 1PR2A 4MUMA 3PQ8A 5B2EA 5KBYA 2YASA 1I80A 3LUPA 2C2BA 2FOLA 1VLJA 1XD2A 2QRMA 3ZWKA 1ZHOA 4HZIA 4LJ4A 2P1RA 4HD8A 4F86A 3W5DA 2CXTA 2C8VA 3CUVA 1N0UA 1U9CA 1W36B 3OOYA 1CQWA 3PNVA 3ZGNA 1P0FA 3CYFA 5HPYB 1XAJA 2ZB8A 1OF1A 4JCOA 4OHBA 4HO1X 4WPGA 3L49A 3RBAA 3K6SA 1UMCB 3WGOA 4L8WB 2JJ2D 3DCIA 2PFGA 3GFSA 2P4EA 2N9UA 4QGBA 2PL3A 1NY5A 1ZM3A 3GQBA 1NR1A 1NP7A 4G84A 1ILWA 2R7LA 1RQ2A 2HMYB 3ZE2B 3OM0A 3A3NA 3LZCA 5BMVB 721PA 2PS1A 1GUAA 1XFDA 3V2GA 4B8WA 1IXZA 2G9NA 2ODWA 2PE5A 2DQ4A 3HZZA 2WD9A 3IQFA 2FH5B 5DTMA 3EVTA 2WYWA 1ORWA 3DV9A 3R0VA 4KPGA 3SX4A 1CLUA 1ORTA 2H4JA 3JAKA 3PJEA 3FJYA 2R751 5EYPA 2IU6A 4CUZA 3G7NA 3HYLA 3FZQA 2IYYA 4J0FA 1ZH2A 5MDHA 2I34A 3ET5A 1U3CA 2AOTA 3HLKA 4QRDA 1BKSB 3K1JA 1ONOA 4Q7LA 5BNFA 5KAMA 5DI9A 5FV7A 4X93A 3K32A 4BIMA 1M2WA 1U1IA 1E1NA 2R6JA 3IUEA 3UUWA 3OX4A 4DB2A 4OFXA 1UWCA 4LSMA 1E3MA 1YIAA 1UQTA 2OV4A 5CG2A 3AI2A 3VO2A 4OKSA 1OYWA 1P0MA 4QGGA 1PT9A 3B3AA 1W30A 3JWJA 4CQLA 5DM1A 5JSFA 2WHYA 4MAMA 1JHQA 1X13A 3WLQA 4RD6A 5AVXA 2YVQA 2P6RA 3PFHA 2WKPA 2RHGB 1EQAA 4CMIA 4FOOA 1TMKA 3IQWA 3U3MA 2ZJ6A 1FW8A 3PNOA 4XKJA 2GEBA 3UKOA 3DPIA 5JSZA 4JI7B 2JRCA 1O4WA 1DJQA 2Z09A 3GLIA 4TM8A 3OM9A 4U63A 2DT5A 2PUEA 4HNTA 3T7CA 2BI8A 2ZYSA 3QFFA 4M0UA 5FYQA 3CNBA 2DTEA 3RO7A 3SZOA 3CRNA 4BB0A 1CRWG 1E5VA 2AYXA 3C6XA 3VPSA 4ISBA 2WYUA 1EEXB 3O8QA 3GRKA 1EINA 2DRIA 3QHPA 3VH3A 3MAJA 3EF3A 4IV5A 1QCZA 1ZUHA 3WWCA 3B6KA 5LB2A 1EVZA 1LX7A 4DDWA 1NBWB 3B6ZA 5TQ2A 2FFBA 4ODIA 1UT8A 3EIUA 2YUTA 3F2IA 1QP8A 1DRKA 1WS6A 2YICA 1HNNA 3WYEA 1U4OA 3BWEA 3MILA 3ONFA 3ZDFA 1KXZA 2HJRA 3EOZA 5D00A 2W2NA 3AEQA 5DYWA 4BV9A 1C4XA 1DXHA 1FIUA 3UWKA 1MH1A 2AZMA 1NUHA 4MKZA 4QNMA 4K9MA 1VPTA 1E2JA 2Q5LA 3RDPA 5IAOA 5MGNA 1X8JA 3K05A 1KZ7B 1XF9A 1P17A 1ESZA 4RE6A 4GEGA 2QRQA 1GGFA 1Z2PX 3O1HB 2NSJA 2Z2YA 3AY0A 3H5RA 2P68A 1T0PA 4MP8A 3NYRA 5CNJA 1KKUA 1K86A 1GZ6A 1XRLA 4LKOA 2OLJA 3UMBA 2G7MC 4LTMA 3AKZA 1QORA 5G3ZA 4M0EA 5SY6A 3VMMA 1XRRA 1XCGB 1FYWA 5I45A 5I4IA 2XYGA 3NQ41 2HDHA 1U7ZA 2HO5A 1M5TA 1MOPA 1RC0A 3A06A 4P84A 1Y8CA 2V59A 1EXNA 1VCHA 2Q5QA 4FW9A 5D01A 3WGLA 4BFVA 2JAOA 5KS2A 2NADA 4IKEA 1FP2A 1S5PA 2ZBGA 1NKTA 1QFZA 2XCTB 4L9RA 4TKUB 3DTVD 4L5CA 3B89A 3VSBA 1CB7A 1R8SA 2O7QA 2PLRA 3OLQA 3G6WA 3KYCB 5CIWA 2GM3A 2ZJYA 1X3SA 3PE3A 1UBFA 2QQ5A 2HA3A 4KIJA 2R11A 3UJAA 5K51A 3W3AH 2Z8ZA 1QYXA 1N0HA 4LGYA 4CMEC 4N76A 2HZBA 1J1IA 3SYKA 1PR1A 2OV6A 1I33A 2PUTA 2ERXA 2YRWA 1Z18A 2DUWA 3H8VA 1EVJA 4F4HA 2JLUA 4EVIA 3N2YA 4UUPA 3HCAA 4FYXA 4WXEA 4G5RA 1QOZA 3Q9NA 5H68A 2QM3A 1E92A 5JY1A 2H9AA 1TYEB 2B83A 3GCGA 3PE6A 4WK0B 5DXJA 1VJCA 2R4QA 3NFYA 5TXGA 2QLFA 5BV1A 1VXOA 1VIAA 5H8WA 5KYYA 3LYLA 4XFJA 1KVRA 3QVWA 3BMQA 3VJLA 3L8ZA 2E4VA 1H3FA 4L02A 4M0MA 4EM6A 2NQ8A 4JKYA 4RTNA 4PX3A 4F38A 4EF4A 4NV3A 3I53A 5IYZB 4EW2A 2H3HA 2Q9UA 1KSHA 1JG6A 1JDJA 1U81A 3VPFA 2V7WA 3E9RA 4BASA 1TQ6A 1QE0A 3CO5A 4GICA 1VE9A 3BGDA 4I6JA 4PO8A 1M72A 1W5FA 5FRDA 3RFUA 3WNZA 3CZPA 5EWJA 3U9SA 3IP8A 5JSUA 5CDTA 4DA6A 4V0SA 2JHAA 3CEMA 2NXCA 1PJ3A 4LQLA 3ZS9A 4DLLA 2C4UA 4K9NA 5IANA 3PNYA 2H1VA 3KKPA 1LBTA 2YVLA 3MS7A 3R3XA 3N8HA 2CLMB 2JGDB 2XF8A 2SICE 3AERB 4CETA 3KYIB 1QV6A 3DFKA 2R6GA 8ABPA 4MPDA 1E3LA 2PLNA 2OXIA 4ML3A 4HVAA 3X1MA 3IMCA 1XXHE 3DAPA 3DL4A 4C1BA 3PR2B 1A9XB 3KOXA 4RTRA 1UFOA 1HTBA 1TM1E 3RASA 4LNAA 4KZKA 3KWJA 1QZZA 5EZYB 2VBFA 3P19A 3EDRA 1ADCA 1J06A 2MYTA 4YXFA 1NVMB 5AUOB 1EJ6A 2PL5A 4I8XA 2A1UB 4NENA 1S3IA 2QL5A 5EZSA 3COVA 4K7JA 3NU1A 1H42A 4QO7A 4RSMA 3SHOA 1C81A 2WF5A 3FKQA 4MYSA 4B87A 5HF5A 4ZZ2A 3A1SA 3Q40A 3IOMA 4QBGB 1FS4A 1C3OB 2BF4A 3GARA 3NVAA 1UM9A 3TCKA 3VPDA 5AM2A 4ZQCB 5IHPA 2G5TA 5DW0A 5IRCD 3GEBA 3GUCA 2RH8A 2FWPA 1I9CA 1ESNA 5EHGA 3RSOA 1MB2A 1NQUA 1ESCA 2GZRA 3U81A 5L7WA 3HWRA 4WKCA 2AMYA 3OI7A 3S6JA 1QDEA 3PC4A 3IEIA 5GM2A 5B3JA 2IWHA 3F67A 2H5JA 1LU9A 3K0CA 4I9UA 4MI9A 2BTOA 1QRRA 4P5EA 2YYAA 1IE3A 1RHQA 3BRQA 1WSBA 5JASA 1XDWA 4NARA 1CFZA 3B85A 3ZH2A 4D8TA 4Y2QA 5AW2A 3HDYA 3CF0A 5K0JA 3LSYA 2V4UA 1SVWA 1P2UA 4CDRA 3GP5A 3DDUA 3HU2A 2DUMA 3MWGA 4YN3A 4CCYB 1U8XX 3COZA 3HNRA 4EHHA 3FMIA 5TMEA 2BH2A 4OH1A 2NVWA 4NJOA 4OHOA 3NXSA 1A50B 4ZYZA 1PS9A 1DCTA 4LJYA 4UHDA 2C0PA 1YQQA 4OIMA 1TYZA 3R6TA 3WAJA 1B16A 1GA4A 5J2UA 1XZLA 3TRIA 4Y98A 1PBNA 2IBMA 4IV8A 1MIHA 2R1VA 4FQ8A 4UM7A 4M9RA 4MQUA 2FJ0A 5ERGB 3SE0A 2XRFA 4G1FA 4O4LF 1P5HA 3COSA 2Q3DA 1RZ3A 4OYYA 5E1MA 1JEEA 1QWSA 3TXYA 5KJFA 4TRRA 3IDZA 4JXJA 4OM7A 5JS6A 4GT1A 4HSGA 5DFAA 4II7A 1IZ0A 2O7NA 1KDPA 4U7PB 3PI6A 3ZVLA 2JLXA 3CFYA 2II6A 1UH5A 3G7UA 4KI0A 4QYIA 4EPXA 2PSFA 3F5SA 2EQBA 4HAIA 4JT2A 4MLPA 3H9CA 5BRAA 3DD5A 4LOIA 4N01A 2YY6A 4S1PA 1K3FA 4RYLA 1R3DA 3M0EA 4WRRA 5ITZB 1C7QA 2GAAA 4M60A 5D5HA 4OQLA 4WW0A 3HCCA 1BCRB 2FP4B 1EFKA 2OZPA 2ZB7A 2RAPA 4JSYA 4RZ3A 4QJ3A 1MX1A 3D6FA 1EHCA 2R6HA 3BL8A 3JD2A 1JHRA 3KUCA 4ROSA 4TN1A 4MITA 5CM9C 4WFJA 4E5PA 4DJDC 2AJLI 3GK3A 5LYJA 3RRYA 1QH8B 4BV3A 3O0TA 1D2EA 1NR7A 4RFSB 2OP0A 1GRNA 2NO7A 1JWAB 3NDJA 4N49A 3LCCA 1XELA 4QO8A 3R7WB 1ZRNA 2BKUA 1DC4A 2YJGA 1Q7RA 2VH2A 4Z3OA 1W59A 5TPZD 3E9ZA 3PCTA 1PNTA 2Z2KA 3I6MA 4WEQA 1RLJA 2VWPA 3D1VA 5L95A 3J81k 3QTLA 1Z7BA 3SKYA 1HZJA 3VHQA 3WX0A 4C2AA 1U99A 4KR3A 4R41A 2HBZA 2IYNA 5JRDS 1OSNA 2CD7A 1W581 3W3AD 5FA8A 3U7JA 5ECWA 1MVOA 1ZS9A 2O23A 4FOTA 4L6AA 4WKNA 4B8ZA 1Y5LA 3ROMA 3WIEA 4JENA 4Q0MA 3S8YA 5TQJA 1S01A 1PFGA 2XODA 3ANLA 2AZXA 3UB3A 4FWTA 4KE8A 3PRJA 1ATIA 4GRDA 1SUSA 4ACBA 5HUHA 4DMHA 2FPRA 3U49A 4ZMSA 1NVUQ 1XP5A 3MMXA 4AO6A 4F4IA 3RGWS 1RXVA 1SAYA 1FDOA 1F20A 3GRZA 2XGJA 3V4SA 5EZ6B 1OZAA 4EY4A 3FOAA 3BJZA 1NJGA 3IQIX 5GONB 3TZQA 1EP9A 5TNXA 4MVCA 2JGRA 2VZ9A 2OHHA 1NDQA 2HC9A 3VR4H 3AI3A 3MB8A 1KR5A 4N9WA 4OQNA 3NOOA 3IVCA 4IXWA 5IHXA 2ZUDA 2O8CB 3OPYB 4JUDX 4TVBA 4YGXB 4C78A 3TLYA 2GK7A 3K94A 4Z9BA 1SR8A 1JHUA 2ZK7A 2QTHA 4KB5A 2PT5A 5AKJA 2LUOA 1LQTA 2YS7A 2R85A 3OMLA 4L8FA 2ODPA 1U28A 1UUFA 1M1XB 2QAJA 3I4FA 4JJIA 4D74A 3B1XA 1CG6A 4RKFA 1UC5B 5DH9A 5ALUA 3L8FA 2OWDA 4KV7A 5EXDA 2ZITA 4DR5B 2I6QA 2EFDB 1NTRA 4S2EA 3QNWA 3SZMA 3O3NB 3REGA 2VT3A 4F1WA 4KPYA 3NTRA 2BZGA 3L4KA 4MA0A 4ZAWA 3L04A 1KMIY 5FJJA 1DKUA 4XGQA 3REQB 3OJFA 4INAA 5AVTA 4R2LA 4IP0A 4HN9A 4NZPA 1XGKA 4OREX 1RMTA 2P9BA 2EP8A 3G9XA 3LBYA 1Y9JA 4QOEA 3M7IA 4UQPA 3AL0C 3P9QA 1XALA 2J67A 4Q03A 3WWPA 4U7GA 1Z17A 1KVTA 5AKZA 4F85A 2QTVB 4FXOA 3WISA 4TN5A 3AVYA 2R5FA 3TJRA 4XDYA 5DYYA 1MH9A 2PH5A 2LIVA 2R62A 4MPRA 1Z37A 3NHFA 4NZMA 4BEBA 1RLOA 4INPA 1GQRA 4WDRA 4Q6WA 9MHTA 3HDJA 3CBQA 4RDHA 2OAQ1 3F73A 2J9FA 5AUPB 1P29A 4TZTA 5B7GA 4ROTA 2PPVA 1UF9A 1CYDA 1E59A 4HOYA 2R7KA 1JTEA 2PJDA 2JC3A 1ZIPA 1D5CA 3ROXA 4D9JA 2C2KA 3GFVA 5DTEA 3GA5A 4EHIA 3NTVA 4G9EA 1PK7A 3HCDA 4FFLA 1I24A 3GBVA 2QN7A 2WV9A 1NI3A 2V97A 3AKCA 4AZ3A 4AJ2A 3G8BA 3CPSA 1P2FA 2G6BA 9LDTA 1UZNA 3ASZA 4MAAA 3QOFA 4O0MA 3MWLA 3FVRA 3TSZA 2OO3A 3C39A 1UXKA 1OH7A 4BO1A 2RMKA 4C30A 4R1LA 2AOUA 1NJ1A 3JSAA 1PVOA 1TCCA 3MLAA 2VK2A 2V3WA 4DBVO 2L18A 2Q7XA 2PX3A 1L7VC 2TMKA 3MXOA 3PPWA 4JLOA 4P8RA 2PYZA 2H7YA 8AT1A 1Z6YA 1ZMXA 2N75A 1M6HA 3IXLA 1T8TA 3BWVA 4XR9A 4G1BA 5BPFA 5K0BA 4M98A 3D8NA 3W78A 3KQOA 1PWYE 3AETA 2NZ8A 4MUFA 6REQA 5AVVA 4DW8A 4JP2A 5LFAA 1KY4A 2WICA 2EJCA 4GHWA 2GRAA 2PD6A 3GT3A 5BXYA 3DEKA 3EWIA 1FUEA 3AONB 4HAOA 5HMLA 3PPIA 3B8HA 4C2TA 5DHQA 4MVJM 2EKPA 5FL3A 2WVJA 5ALXA 2AI3A 2Z5VA 3DXFA 4HDKA 2HY7A 3DMDA 4JMLA 3I6QA 2B4YA 2JVIA 3AHCA 5JAMA 1VYTA 1O03A 3AINA 4JYMA 5I7FA 4LRTB 4RHCA 5WRFA 2HPVA 2E82A 4DR3B 1NJFA 3HKEA 1U2ZA 3WIOA 3ETEA 3GRRA 4UZFA 2I67A 3H1EA 3M6AA 2XT6A 2EWMA 4ARIA 3D59A 5F51A 1V71A 3GLHB 2DULA 3W5CA 3GAAA 5EWMA 1R4MB 5AXCA 5EE1A 3VR3A 4DMLA 4ITVA 5A7HA 2GJSA 1PNQA 3EIWA 3NEPX 2JDID 4HEA1 5THXA 1T5TA 3X3HA 2XCRB 1OA1A 2OHXA 3EA4A 3OMWA 5CGQB 4F11A 4GI7A 2C9BA 2V0CA 1U1EA 4IH1A 1IXKA 5JADA 1EB9A 1OZ0A 1KVQA 2IODA 3A4VA 1A9ZA 1GZ7A 2CKDA 2DCUA 2CYBA 3H13A 4MV1A 3SF0A 3SIWA 1II9A 1U3DA 1P44A 4KN5A 2I7CA 3OZWA 4N82A 3U3XA 4B83A 4C7BA 4I3HA 4BLOA 2I1LA 1BDHA 4CI9A 1UMCA 3O38A 1NLMA 1ZI9A 3FKSA 2H2HA 1MO3A 4RA9B 3DD1A 1RZRD 1E61A 1YUMA 4TS4A 3GC6A 4HX2A 5F78A 4FONA 1SXJE 1TOAA 1UK8A 4P31A 3ZCSA 2NM0A 2AMVA 3L8MA 3GRYA 1PTJC 1WVMA 4OJQA 3TVYA 4OQQA 3DNFA 2Q45A 3H4VA 4RUKA 4QT4A 2DYKA 2L69A 5H70A 1HTTA 2HSDA 3UEOA 1MC5A 3STUA 4W1QA 3BYZA 1JYEA 1T8WA 3HUEA 2HMTA 4X00A 5ECDA 3V8MA 3STHA 1M7HA 3AHJA 3LP5A 1I1HA 3PKJA 4MV0A 5CVTA 3C3JA 3G9TA 5J5AA 1GPLA 3DWGA 3QX8A 1C3VA 2BT4A 4FX2A 1IY0A 4M37A 3IQHX 3B6JA 5CT4A 5CB0A 1N9GB 1Y80A 1LPNA 2W2LD 2E48A 1RWWA 3IVXA 5HBRA 5SYAA 1ODTC 3RROA 2Y3IA 3ICOA 1FZQA 1UAAA 3F4LA 3OMXA 5BT8A 3VR4D 2QF7A 3WGJA 5DM2A 3AR6A 1TXGA 3I9V1 1TC1A 3K9WA 2W70A 1YB7A 2NNWB 1GFWA 3S28A 5LMNB 4JT8A 4OJMX 1PJQA 1HG0A 2RD2A 3H04A 4ZT4A 2X9VA 2YW9A 4CUJA 5IM5A 2H7CA 1SC6A 2VNKA 4FWBA 2AW5A 4RA6B 1VLMA 2JATA 2CMDA 2XKJE 4DV4B 3O4RA 4QTYA 1RYFA 4UMDA 1G2OA 1KZGB 4M0KA 4TYWA 2HMWA 2AX4A 2V54A 3PJDA 2QR2A 2HX1A 2ZUFA 1B8OA 3ID6C 3T4EA 3T5AA 2E87A 4BVJA 1EVYA 1D3AA 4GQAA 4H6VA 1DKOA 1I2CA 3JXEA 5FTJA 1BMFA 3R4CA 4RENA 3S7TA 2RH5A 1Z26A 1RWQA 4A0RA 4EWLA 5IABA 3GJ6A 3THYB 1Q12A 2OEPA 5CAEB 4KNYA 4O2AB 5KTKA 3JQQA 3Q6IA 2AWOA 1BN7A 1ZC4A 2B2NA 4JT4A 1R6BX 1GSIA 4MDFA 1FFXB 4RKYA 1KSJA 3G0GA 3PNPA 5MN5A 3NJ4A 1P1RA 1KEKA 4Y2TA 2BFPA 2RK6A 3FHJA 4A6PA 1QIKA 5DASA 1VPDA 3GOQA 2RHTA 3QEJA 4RSRA 2X9NA 3FFTA 1N2HA 2CXHA 3NWPA 4IL5A 4M7RA 4G09A 5AKKA 1LVHA 5JSHA 3T9CA 1M2FA 4J6EA 3LY8A 1HE5A 2G83A 1LS1A 4MJ3A 3EQ6A 3Q1LA 5C7LO 5GJWC 1EXVA 2GDJA 1KOLA 2NGRA 4HLCA 5LZ7A 2NO6A 2QUIA 3K6JA 2W6PA 2CFSA 1SU6A 2PGOA 3C14C 5FYDA 4O4HF 2OOKA 4ZOBA 2JLRA 4I1OA 2CV0A 3U9LA 2EAUA 1NF9A 5ALJA 3VOTA 2JL1A 1KF0A 4NONA 4P86A 4RVFA 1LK7A 1GNSA 2YOHA 4IG9A 2RGXA 4B33A 4A10A 4C4SA 4N5IX 5LD2C 2NZYA 3KT8A 2F9FA 1G4HA 3PL1A 5KREA 4V24A 3M6FA 3M6XA 1U9ZA 3MTIA 4KRGA 2BR4A 2Q2NA 3AY6A 1KNXA 1IZ7A 1WBJB 2LBPA 1R8YA 2Y0DA 4R1PA 1KJZA 1QVAA 2QVZX 1SCDA 4I0WB 4TKUA 1FFAA 3LLUA 2IBSA 4U9UA 4HXGA 5EL0A 3KYCA 4MQMA 5HF6A 2WKRA 4JBGA 5KSYA 3QOXA 3ZJTA 4DR1B 5CVEA 4GL4A 4RLSA 3A04A 4PONA 1A82A 2JARA 4I1YA 4LBZA 4C4XA 4OHVA 8OHMA 1ZCAA 4LW8A 4RIEA 3HVJA 4U7HA 2GPSA 1NMYA 1Y4AE 2AQHA 1K5GA 1DMSA 1YBMA 1QXSA 1UPFA 2MYUA 2R1UA 1W0CA 3B2EA 3QLVA 1I0ZA 3KZMA 1E2IA 3V4RA 1A8PA 1K68A 5A62A 4WDQA 4PS1A 2O52A 4WBNF 2ZKLA 2R6AA 2V0GA 4EGFA 1ZVJA 1FNDA 1GTZA 1KEVA 2VF8A 3PGA1 5I7OA 1HDOA 1YZFA 3PEYA 1NE2A 1T9BA 2EGHA 4UCXA 1M8PA 1RD4A 1U8TA 2VTVA 3PFWO 3F98A 2WRZA 4HAXA 4K9DA 4BNIA 4BQOA 4RANA 4BEWA 3UAGA 4FOSA 4MCIA 2Q50A 2WSLA 2PDAA 3BVPA 2D1TA 4B7AA 4DIUA 1V5EA 4DMFA 3HCOA 4I9NA 1PN3A 1Y3FE 1SKUA 4UBLA 4BZXA 1ZGHA 1CPYA 1V5FA 2TS1A 1VDMA 5GP1A 4MQEB 1KAOA 2B4KA 2BFDA 4JBHA 3B7GA 2YN0A 3WG9A 2EGUA 1TEXA 2JGDA 3AERA 3BTUA 3L4BC 1BVRA 2YWJA 3PVCA 4LEIA 4Q12A 4BQSA 1LSUA 4IKPA 3RVNA 3K16A 1IM2A 5EA2A 1JW9B 4DE5A 3HU3A 2CLDX 2I71A 1V6SA 3EF1A 1FRNA 2XB2A 1ZSNA 4PLZA 2RAUA 4QU9A 4TYPA 4U2FA 4JUIA 2IIBA 1VYHA 4Q1EA 3B60A 1TA9A 4G0MA 2FNAA 3OY7A 3W2GA 5J3JA 2C78A 3V4ZA 4MGIR 1B74A 2A1UA 2JASA 3AI1A 3HABA 4XQCA 2C7RA 3KO8A 4ALIA 3A0RB 2ACWA 3DJFA 3RF6A 3S5JA 3OWHA 1QH1B 1AMUA 4U8HA 1ZHHA 1FDUA 2D8AA 3LQRA 4AUEA 5IJZA 4GI2A 1GPAA 4GBGA 4GXTA 4YP7A 1P4HA 1GCGA 2ARKA 3WNDA 4DV3B 2GPWA 2V45A 3EARA 3G5LA 3HJHA 3TSOA 1Z13A 4BTVA 1Z0KA 1DDIA 2H2GA 2XE7A 1M73E 3CLUC 2C7VA 4X5OA 5B7QA 4ZOAA 2JAQA 1DEAA 5IBCA 4HFNA 4F4FA 821PA 1SA0B 2R6ZA 4JEMA 2PRZA 4A16A 1ETHA 1XZIA 2ORYA 1A9SA 1CR1A 1QCYA 4H31A 2XCSB 2H5EA 1UP4A 2D06A 4MYDA 1AGRA 3G89A 4RCZA 3ZDYB 4PG8A 5DKFA 3IT1A 2WU0A 1OZFA 5IN5A 1J4AA 5JDIC 1J0CA 1KI4A 1MNQA 3OU6A 4B44A 4CCYA 3TK1A 2XUGA 3WB0A 3BHIA 5C1PA 5CDHA 1OX6A 4NHEA 1E7SA 2ZYWX 4ZFNA 2CDRA 4B6SA 2J46A 1YDWA 2A1TR 4WJLA 5JC8A 3TQFA 3W2EA 3T61A 3KPVA 3UUGA 1IHXA 1WULS 3PDCA 1IB0A 3ZLJA 4N6NA 3K9QO 2IVFA 3S2EA 3VMFA 3W2TA 1J8QA 1PW5A 1SBNE 1EDBA 2J3IA 2X6QA 3GO4A 3NP9A 2GARA 4OQDA 4I9GA 4ITRC 5D1HA 1BGVA 5JO9A 1EFVB 1WZ2A 5CB4B 1Y7PA 4YI5A 1B15A 1NF2A 4IGFA 4IIVA 2GYVA 4OVKA 3RBXA 1A2QA 1J0XO 1XJWA 3IE0A 4KK4A 4KTTE 3ICPA 1T6NA 4HS4A 4OX9Y 4YJHB 1FDSA 4R9NA 4YJ3F 1K6IA 4O02B 5JVDB 3ZU3A 4EDHA 5H9VA 2Y1KA 4CTOA 2E85A 1G9SA 4RJIA 2QL9A 1S2IA 4MINA 4KQ1A 2HNKA 2JI7A 4JSTA 5EI5A 5BNWA 3ABRB 1DC6A 1SCNE 1AE1A 1BCRA 2HNAA 2FP4A 2XTNA 3CQ9A 4G2NA 5A1JA 4RF2A 4YMUA 3PZBA 1Q3KA 1P6XA 2EBFX 1CZKA 1SXHA 2HIAA 4JVNA 5HJ5A 2XBMA 1KOGA 1HMYA 1YVDA 2IHZA 4TL6A 2O6HA 4KOEC 2PM8A 3EZGA 1W35A 2X41A 3RTCA 1AHNA 1QH8A 3E9MA 2PAAA 3P9ZA 4WOBA 1NT4A 4RFSA 1E6MA 3WLPA 5KYTA 3G9UA 2H85A 1PV2A 3C6MA 1A2OA 3I64A 4ID9A 3R7WA 2CF5A 5KTMA 2R25B 1EWTA 2SBTA 2ZRLA 1H2XA 2G77B 3WLNA 1Q1BA 3QIAA 2XGSA 3K6KA 4P5PA 4J8PA 4YRAA 1P33A 1H4QA 1T3LA 2C3OA 2XT0A 2Z08A 4H7HA 3BE4A 5K3CA 4B4DA 5I5EA 1TTQB 3P32A 3CONA 4X61A 1T1RA 5JZ9A 5EUQB 2OY0A 1DB3A 1ZK0A 3GLRA 5FWXA 1IN4A 1G3UA 2VQFB 1I4LD 3D7MA 1XI2A 5L6MB 3I04M 1ODFA 1YBVA 1M83A 5EESA 2NUBA 4FQ5A 5IJWA 4EMSA 4OI4A 1U63A 4WEOA 1YDMA 1DOZA 2HD4A 1M2GA 5T57A 2C83A 4E5VA 3HGMA 5JNSA 3FHOA 2OORC 2H3EA 2AFHB 2PZKA 3BD7A 2J1LA 5GONA 1GGMA 4IQ4A 4JLPA 1E7YA 3IFSA 2VJCA 2GEFA 4PO1A 2IUYA 3FTQA 3NV7A 3LFTA 3KX2A 1R10A 3AUYA 4KBGA 4D9HA 2P2SA 2O8CA 1AKNA 2CDNA 2FVYA 3GLVA 3OPYA 4NF2A 5DYIA 4DY6A 5DK4A 3BOSA 3D4OA 4OUDB 2W4MA 1VHWA 1W0KA 3H2ZA 4HHEA 4PAQA 1RBQA 4IZIA 3MRSA 5ALKA 4YRZA 4TQUS 2ZWAA 2WSSA 1DQYA 4XWWA 1GFIA 3J81A 1UJ2A 4UATA 3DZCA 1KERA 3ST7A 3TQOA 1KS9A 3T9EA 3HMKA 1QYCA 1NBHA 3NWBA 2FTKE 3HCRA 3QF7A 2FX3A 1BA3A 1QNFA 1CBUA 4UAJA 1PR0A 4XGRA 1GGEA 4FINA 4Z4CA 3GUHA 4OGLA 3REQA 3HXTA 1I30A 2V7BA 4HYTA 2VSQA 4M1WA 4LFBB 3LIPA 5C7OO 2P3SA 3DOFA 4IILA 5B6IA 5T8KA 3H83A 4EL5A 4QNRA 1A76A 1OGJA 2O2IA 5TEWA 4E1VA 2QTVA 5KWVA 1L7OA 4XM2A 1QHGA 3Q9LA 1QANA 1JT9A 2XUKA 4BX2A 1U1DA 2E5FA 3IVMA 4ER6A 2JCBA 4M7PA 3ON5A 3RUFA 2ENWA 3LYHA 3G6KA 3AEYA 4MV3A 5CW2A 3SQMA 4PM4A 4QJBA 1QIJA 4A73A 1KAQA 2OL4A 1NJ8A 3HKDB 3LVFO 1YU9A 4R3NA 3ZJ4A 4C6SA 3KSBC 2YQZA 4I19A 3JQ9A 2BRUA 1R64A 3W4IA 3FVWA 2WR8A 3CLHA 3IDSA 4ZAVA 2BE9A 4MP3A 4E6EA 1QCDA 1P9RA 1LJUA 4I50B 3I2GA 4W7HA 1U7DA 3MPOA 1U9IA 2QMEA 2XVMA 4DR4B 1X38A 3WJ7A 2OFWA 5FWDA 4L0MA 5E1BA 2P30A 1QHYA 3K0HA 1T5SA 3R40A 2D1YA 3VOBA 3UN1A 3L7IA 3T5TA 4EHAA 2VT7A 1GDTA 1AOXA 1YJAA 1YO6A 2LWIA 3JPWA 2AG0A 4HDQB 1L7EA 2EF1A 1K1EA 3AUFA 3ER9A 5EN4A 2V3CC 5DN9A 4J4TA 1FMLA 2Y68A 1TEZA 4N0QA 1JDSA 2PEYA 3U4IA 3DHNA 4AYXA 5CG1A 4BC0A 4J0QA 3NGLA 4NK5A 2QYHA 1EU1A 4JBIA 1O5OA 3KR9A 4IFEA 4AZTA 2P40A 1RXIA 5ELLA 2GHTA 2HCFA 3GI1A 3BE8A 5A2GA 5T3UA 4WLEA 3QBEA 2VK4A 5KVCA 2HJ9A 1OA0A 1Q2XA 1XNQB 1HV8A 1CULC 1PZHA 3WYFA 4ENTA 3N6XA 1D1PA 3QFCA 5EIFA 1G5IA 1Z6PA 1U0BB 1UMDB 2A59A 4F60A 3EC2A 1NV8A 1RIFA 2H48A 4NBKA 5L3RA 4RHEA 5AW8A 1H2HA 3WBFA 1GT6A 4GKBA 5BWNA 2W0SA 5EQJB 4DQ0A 4L2IB 1CP2A 1OXBB 3GJ3A 1FZTA 3H7AA 1E4OA 2YFHA 2FU5C 4TRMA 4P38A 4KAAA 4R1UA 5LB4A 4U7FA 2KB0A 3ZLBA 1ULSA 2QL7A 1QONA 3OSZA 3TM4A 4G4IA 1F3OA 4HK4A 3LHDA 4HR7A 1ZXXA 3GLHA 1L5GB 1X7YB 3O2JA 2ZUCA 2QP4A 1AA9A 1R4MA 1R27A 2CLCX 3I2IA 4GE3A 2I1VB 2VYCA 3A11A 3IPYA 4A0FA 4DNQA 4PAWA 5FX2A 3IKVA 3V1NA 4DJFC 1G8YA 2O3JA 3DBHB 5LDGA 1IJEA 1MW8X 1H4TA 2FW1A 4E2YA 4LSWA 3ZPXA 2XH8A 4I5DA 4MLDA 3T34A 4A91A 2OBMA 1ZXLA 1IJBA 2ZIWB 2AE1A 4XXHA 4LOAA 4OQXA 2RDMA 3HDTA 2VH1A 1P1HA 2HW8A 1TECE 1CRQA 2HF8A 2GPJA 4UC0A 4RA9A 1I13A 3G2OA 3EVGA 3E1KA 1Q3TA 2FMKA 3O03A 4AK9A 2UUCB 4PZLA 1O57A 3SQOA 1KAMA 4R5HA 3G85A 2ZETA 1VL1A 4R69A 3DE6X 2CCGA 4XPIA 1P2DA 5CFZA 2Z1NA 3I76A 2IEGA 2NLOA 1UBKS 5AW3A 1N25A 1MX5A 1TUEA 5AK3A 5JYDA 1Z6GA 2BP7B 1IBCA 2CXNA 3BJIC 3H1TA 4FSHA 5BRNA 4GPBA 3TR5A 4BO0A 1H0SA 3SS8A 2BDUA 1QTRA 1W48A 1PWXA 1WPQA 3T0IA 4B6FA 2GESA 1Z6ZA 2V58A 2ECFA 2IS2A 5C81A 3EB9A 1WAMA 2I8AA 3KSRA 3ROQA 1MJFA 4G0VA 2W58A 1N9GA 3K92A 3OPYI 5E1OA 1ZVVA 3WDLA 4CR6A 1CF4A 2GXQA 1DO0A 2H2IA 4C21A 5C8XA 2CCJA 3BSFA 5K8CA 3SOPA 4X41A 3ZHQA 2P5UA 3SF8A 3T5DA 2DSTA 4I4NA 1ISGA 1SBYA 1XVAA 5CBKA 1FRFS 1RNLA 4HXEB 3THXB 2WF9A 2V65A 4KXVA 1WD7A 2HRQA 1FU7A 3ZXIA 3STYA 3TH5A 3TD6A 1XT6A 4KEAA 4PRLA 4ETWA 3N86A 4DJAA 1CJVC 1QAQA 1W5TA 1Z62A 3OWXA 4FYJA 4RA6A 4AMUA 3FB1A 3ZU2A 4C7KA 3D54D 2FSUA 3PXEA 4FDUA 3CN7A 3Q7TA 1RXUA 4IDEA 1QHSA 2P9GA 1ZOIA 1F17A 1J42A 2VUUA 4JDPA 4PYKA 4Q9JA 4P4SB 4XVUA 3UMRA 2ZI5A 3PC2A 3DMTC 2ZXUA 1BU5A 1N7JA 3VH4A 3AP2A 3DBOB 1N1GA 3COJA 1KQPA 2J4FA 4WKGA 4BYGA 5TSDA 1T0JB 3DT8A 4CIAA 5CRIA 3OO1A 3FDJA 2OD2A 3OH8A 1ZGJA 2OKCA 3G5UA 3THYA 4KQKA 1XZ8A 2MSNA 3LCMA 3NKVA 5CGZA 2XT9A 3WDSA 3R23A 5CAEA 4CMHA 4A7PA 1Y98A 3CH4B 2QSZA 2BMEA 4N7MA 1EP1B 1FFXA 2OHJA 4YLGA 4RV4A 4ZYVA 3K5WA 1UT6A 4XGNA 1WXEA 2PK3A 3PICA 4L0CA 3S68A 4RHUA 5EXTA 4UQLA 1YZQA 4KGZA 4PHHA 4DL9A 2F8SA 3NIGB 5H3HA 3O73A 3CLVA 5BWOA 4XJXA 3H86A 3VNRA 1X94A 1XMQB 1R0XA 2X5NA 3VKUA 3QVGB 4NEGA 3Q8LA 4P54A 4P7GA 4DCMA 1YF3A 3HSSA 1GITA 1TDJA 1DCFA 5JNRA 2D1RA 5ER9A 3HEAA 4JT9A 3EYWA 3F4KA 3QI7A 1SKYB 3MLEA 3CZMA 4BJHB 1THZA 3CX4A 3JALB 3HLYA 3ASUA 4R9SA 3PF9A 5DP1A 3WIBA 4BJ1A 5HK8A 4CG1A 1DX9A 3BZBA 3QNUA 3TCXB 4BOYA 4BO6A 1KBOA 5I6DA 3FIJA 3NCHA 4ZVSA 3TIFA 1KAHA 1Z9BA 3SVZA 4CU5A 3E9NA 4F97A 2GBCA 4H60A 1D09A 3LC2O 2CJYA 2ZRAA 2XJ4A 4DSNA 1KFEB 3LRTA 4IVRA 4X7PA 3ZDCA 3AJDA 5L8VA 4KVAA 1G0NA 4I1RA 4XSGA 1E7MA 1MO5A 4QXRA 3Q7IA 4TKZA 1U0OC 5IMSA 3L8EA 1JLMA 1U3FA 4ZQEA 4LXHA 2V9ZA 3NEJA 2WUGA 1GUYA 4KODA 2PCJA 1XN4A 1WDTA 2W42A 2QRNA 2FE4A 1YB6A 4I3FA 1OBCA 4DB4A 2C5AA 3VNVA 2V8BA 4RH0A 5F64A 4R5MA 4L9AA 4F7WA 4W5RA 4HAYA 1ZW1A 2V0NA 1IOLA 3P9IA 3TW8B 3CE9A 1FTQA 3ZNPA 4BKOA 2H6EA 4DCPA 5HP4A 1KK2A 1SVIA 4S2UA 3GD7A 5E3JA 3ZCTA 2UUAB 1KZHA 1U7HA 1UJNA 5IARA 4AN0A 2FSGA 3GEGA 3FUCA 3F0TA 1SCQA 3KTOA 3NDPA 3SG0A 1E2NA 3UJNA 4F4UA 1IQRA 4WZBE 4X63A 4OQMA 1DUVG 1GAWA 4D4KA 2JAPA 1IB6A 5HS4A 1S7GA 1IC6A 3HH8A 2WJ3A 3A58B 5ALGA 2QTFA 2Q4DA 3EMVA 4DV7B 3WRYA 4X8MA 5M04A 2XSZA 1XB2A 3D0KA 4LZLA 5EHXA 2GUGA 1M6EX 4TL8A 4R71A 4KI7A 2HXSA 2OMEA 4ZDIA 5BURA 2DPYA 3OQ1A 1YZVA 4IGEA 4M1SA 4F3CA 2X9LA 1JFTA 2Z5FA 3ZDBA 4ZT5A 1IN5A 1P72A 4TLLB 5CDSA 4NBTA 1Z0UA 2YV4A 3ICEA 1NW7A 2OV2A 1U0TA 4MVJG 3H3XA 4MR7B 2A5YB 3ZH9B 4X44A 1AIPA 4IJKA 4UEOA 4MQEA 1B8UA 2D5LA 4ZD6A 2GWRA 5C4GB 3W4KA 2Y77A 2Y05A 1QIMA 3O8NA 1G5QA 3FE2A 4RPJA 1IBLB 1Z0JA 2VAMA 3FFWA 5LLSA 2BAGA 5JNVA 1YCDA 3IDFA 4ZHSA 2MT9A 3KNZA 2QKYA 4CN9A 3QVLA 3IOBA 3MG9A 5F5XA 1SFRA 2MSWA 1E3EA 5G0TA 1ZI6A 4E5YA 1R15A 4H3KB 1QHEA 3EQ2A 5ER6A 4MWGA 2UZ4A 4MWEA 2DBYA 1QF6A 5AI6A 3DR5A 3FOBA 2WSBA 1T8SA 2A3NA 2VP9A 3H3FA 3HR7A 4J9VA 3R7LA 1SOMA 2PUAA 3QWAA 2DBQA 4BO8A 3DMRA 4X3CA 5M7EA 4G0OA 1QH1A 2VJOA 3AKEA 3D6VA 3A32A 1JZQA 3D5QA 4NYMR 2CJPA 4B6JA 1RS0A 2F1JA 2GEVA 3AVOA 1KEEB 3CISA 3QKTA 5HDQA 2X23A 4MJ7A 3E82A 5J2TF 3ICQB 2KLBA 3SNKA 2R66A 3RC7A 4P4NA 1T1JA 1N1MA 2HL6A 2BE7A 2R4UA 3B5IA 3IUPA 1GL7A 2O50A 3JTMA 1SVUA 4WN9B 1SA0A 4BKPA 1XEWX 1MN6A 5D84A 1D7OA 2AJBA 1CUSA 2ZU0C 3CZ4A 1FFBA 4WLUA 4C4AA 4PG7A 1OTYA 1DBVO 5FOQA 1VHDA 2ORED 4L73A 4Y6LA 3W0LB 2ZVPX 4D8UA 3WQSB 2HEGA 4OA8A 4P3NA 1MTOA 1Z36A 4EGSA 4J16C 4NBUA 5M29A 1X39A 5JMTA 1QQTA 4GF5A 4G5OA 3LQ4A 2XWBF 4X1OA 2R6CA 4D4LA 1ZSVA 4DV5B 5C53B 1C3LA 2B2CA 4TV8B 4V0QA 4Y30A 1NSFA 1M1ZA 3EJWA 4B5LA 4D99A 4URFA 1IXSB 1RXSA 1X6VA 2K2QB 2C42A 1OTHA 3SQLA 3DQPA 5JNLA 2O2SA 2CFTA 2HT6A 4MCJA 2VNAA 3UWSA 1RCFA 2FYTA 1W36D 3N70A 1E1MA 5FKJA 1R2QA 4XJSA 5B3KA 3OHMA 4KDRA 4A4DA 4R4JA 4QU8A 3PQEA 2AN9A 4E03A 3JWGA 1CR4A 2AJCA 2ZUUA 3FYUB 3LF2A 3QUAA 2XQIA 3D5EA 4C7MA 5CB4A 5LNK1 2EIXA 4QRIA 4IBOA 3QPCA 4S12A 5FORA 2QLTA 4LNHA 5BYJA 4IJQA 3ZVNA 4NXMB 3OPNA 4OXYA 1OFUX 4Q4DA 4YJHA 3DE0X 4NDAA 5JR3A 3PD1A 4N47A 5JVDA 4ND3A 5B64A 1ZZGA 2R47A 3KQPA 4JQZA 3RK1A 2WFMA 3DEJA 1CP3A 1JJFA 2FQYA 1U5BA 1CD5A 4D3YA 1HNXB 4G97A 5B2ZA 1A2BA 5BVGB 4W5TA 4LZJA 3SSAA 1QF9A 4H17A 4OJTA 3BK7A 1HQKA 4NZ9A 3S0JA 4DHWA 2PIDA 2NWQA 3DWIA 3TE6A 3WMRA 3QUSA 5HRAA 4HEQA 1NQAO 1TW3A 3HFGA 1Y5NA 2JHGA 1S8OA 2Q29A 3CUWA 3OHPA 3E15A 4P2GA 4XVHA 4OMCA 1VLVA 5C2JB 1FYEA 4G1VA 3ANNA 5B37A 5KOYA 2GPAA 2Q3BA 2D3WA 3M5CA 1CVRA 1GKIA 5CURA 2OB2A 1YFJA 3RTGA 2YXNA 3GBSA 3T1YB 3AHDA 5CXUA 2HRRA 5BR1A 4WY2A 4O08A 3R8CA 4CMJA 3U7HB 3WWEA 1AVTA 3LBNA 2V7QA 3O3OB 1G42A 1Z0SA 4L72A 4R1SA 2HRBA 1RWVA 3KS9A 1NP6A 1P3JA 3NALA 1XTSA 4YBRA 5G4KB 1T2DA 4G8JA 4JLVA 1WP9A 2JI9A 3W2HA 1BMTA 3LUKA 2WWTA 2K2WA 4KXWA 1T5DX 3EHEA 4FGKA 4D98A 5BV2P 2GJKA 1J1ZA 1L4UA 3OPQA 2AFHA 1RIIA 4GX5A 4BU0A 1RYHA 3WK7A 2CZCA 4M99A 1EDEA 2E4XA 2X9GA 4TQAA 5CX1B 3SOZA 1Z0AA 5JJBA 2AC7A 2QTAA 1WJGA 4H1HA 4KKVA 1LSSA 1P4RA 2W22A 1V95A 3KPUA 4OBXA 4F3NA 1EHIA 1ZJWA 2BM1A 3SX2A 2QAGB 3E6AA 3T1VA 1TYBE 3O8BA 1L4EA 4JUCA 3RUDA 4EA6A 1OH8A 4WK2B 1YDGA 1MQ8B 1W8IA 4OUDA 2QLNA 4EO7A 3F8TA 3NRJA 3P71T 1EVKA 3TRJA 4V03A 3VDNB 3NVMB 1MF7A 4IDPA 1UXOA 3ETHA 3KWFA 3WGTA 1AHIA 1K89A 2ETVA 4I5GA 4NG4A 4PX5A 3U4AA 4N0PA 2WSIA 5AKGA 3L0YA 2WWYA 3ETNA 1HOXA 1NNUA 1BRTA 1VJ0A 2PKXA 3AYXB 3Q2KA 4HXYA 1QKJA 4M83A 4NH4A 1V0JA 5ALDA 4EL0A 2A30A 1GD1O 3R6LA 4DIKA 3W6ZA 3K4QA 4FLMA 3OHSX 4JLWA 3A4YA 3HI4A 2ZEJA 2VHZA 1I8TA 3SHWA 3IT3A 4QDUA 3V8VA 2EWVA 3AVUA 1C4WA 4AS2A 3R09A 4FGLA 3HXOA 2XV1A 1CIJA 4DAOA 4G8DA 4DREA 5K05A 1S1MA 4ERNA 3B38A 4L74A 3E81A 1P7VA 1CY8A 3Q7SA 3V7WA 4PN3A 4FYYA 4PVDA 4RBNA 3HKDA 5T6BA 4AX4A 4EVQA 3MJEA 3MD0A 2R7NA 3EYAA 3OEHD 3G49A 1CNFA 1ID1A 3H5LA 2EYQA 1LBIA 1FP4B 4I08A 2WT9A 2B35A 2FLKA 2PGXA 5IJXA 1WW3A 4Q37A 3D02A 2JJYA 5JYEA 1O0SA 3ONVA 2COKA 1E5TA 2J4DA 1TD9A 2Y8EA 4I50A 3WBBA 2JIZA 4EMUA 5D3ZA 4KE7A 1GNQA 2AN3A 1E9FA 3L4EA 4HVTA 4JUBA 4V0NA 5E7JA 5TGDA 4ANFA 4MUGA 3ED1A 1E0SA 1GGVA 2XE6A 1HT2E 1KYYA 3DKPA 5KNCA 2YC4C 2RBKA 2FEKA 2XEXA 3OY2A 1I3NA 4K86A 3CZRA 3M6IA 4ZTBA 3ZHTA 1XLWA 4FDVA 3AR3A 4E3WA 1DXYA 2OO5C 1TEHA 2KW5A 4IVPA 2ZBUA 1B41A 2DEUA 1B73A 4E7PA 4U2KA 3AB8A 3VX4A 2AWNA 421PA 4BNNA 2ZJOA 4WXPA 4A6DA 1M1YE 1BJTA 2C2HA 1JJ7A 1V7ZA 2G1UA 3O8CA 2AHRA 1L9KA 1DJOA 2IOYA 4NJEB 4Y9RA 1SC1A 4WN3A 5DLDA 2JFXA 1MGOA 3EISA 4O6VA 1YQTA 2WIGA 4UCFA 2UXBB 4KN9S 2QGFA 1UMDA 4WUTA 1FP1D 3IT0A 1LDBA 2I33A 2OV1A 1BH2A 3KEGA 2W93A 3OE1A 1T25A 4AJOA 1VOTA 4L27A 4L2IA 5EIBD 4CLXA 4EUEA 5JD5A 3R7AA 2PEZA 4UEWA 4UU7A 4FZ5A 4BMPB 621PA 1SQFA 3OIGA 3RK4A 5J4HA 2B7CA 2RJNA 5E1DA 4BV2A 3ZK8A 2WZDA 1E1KA 1LLDA 2C98A 1GGKA 2ZULA 4DEXA 4CEJB 4Z9XA 5GWXA 4Z51A 1UOEA 4LDNA 4CL2A 4XTCS 2D5CA 4NNOA 4TQGA 1X7YA 1BH6A 1H2AS 1HFWA 4IDNA 2GT1A 1PG5A 1C8BA 1YQEA 4LBVA 3UWMA 1HL3A 1X74A 4O2BB 2BHLA 4JBYA 4LF4B 4O3MA 4JVLA 4ZQIA 1TCAA 3DBHA 2W2MA 4LJSA 3C3KA 1C0EA 3RLIA 2R65A 3NFRA 3HJBA 4MW9A 5CH3A 1I3KA 1STOA 3OJXA 2RGYA 1P7WA 1ECLA 4LXGA 3S8MA 4HB0A 1YIOA 1Y7TA 1V6CA 2YH2A 2ZQ5A 4BKMA 4Q7QA 2ZS9A 2ZE7A 1ADBA 2DCMA 4K3UA 3TBHA 1A8QA 5DGIA 5CW1A 1SG6A 3P2IA 4YCLA 1EB8A 1TIKA 4NVRA 1ZNQO 2UDPA 3ZI7A 3RJTA 1D6NA 4X65B 1C1DB 1HLDA 2MHCA 4EENA 5AKEA 3ND7A 4OQPA 2OXRA 2V8OA 4PO9A 2X8JA 5A4DA 4XB2A 2ZRPA 2BP7A 4H1UA 2JAUA 2Y92A 5E4TA 3SAJA 3T12A 3W8NA 3TNFA 1RWOA 1VM6A 1WCV1 1ZGCA 2VDJA 3ETLA 3IE2A 3QVMA 3TLCA 5I4CA 3UAOA 3ENKA 3D0QA 4R05A 2OXCA 2Q3EA 1SM4A 1F48A 3WBJA 3RS8A 1VFPA 3F3MA 2G07A 1CQXA 1T34A 1FJGB 5DE3A 1SXGA 3MT7A 4CG3A 1RJ9B 3D0OA 3T15A 2ZAMA 1K88A 4PZ9A 1DAOA 1K0FA 5DWQA 3VNAA 1E2PA 4FI3F 1NLFA 2WTBA 4RX1A 3CWCA 2V3VA 1JMKC 3U62A 1ZG3A 2N0SA 3NBMA 3O7MA 1TYCA 2PS9A 4KQ2A 4UFNA 4C4RA 3OIWA 1GZSA 5IT9A 3THXA 5KJEA 4MDHA 1CUEA 4QULA 4IZHA 1JG3A 2ZTLA 1HLPA 4PYRA 4MIYA 4KPEC 1FFYA 2ZSBA 4QTUB 2LD4A 1FTNA 3EPKA 2QENA 3GLFE 4YAFA 3NT2A 4D3ZA 3ESBA 5KWEA 3VU3A 3FBWA 3BWBA 1N92A 4OXIA 4P4SA 4XOUA 1UFRA 1MORA 3N28A 4QSHA 1ZMBA 2HM7A 4NH0A 2ODAA 5LR6A 3DE4X 3TOXA 2W90A 3KKMA 1RWNA 2ZB3A 4ZYUA 2E89A 1ZRMA 2Z57A 3SJZA 1ESDA 1ZYUA 4FEAA 2EF0A 4B1FA 1L9XA 2M1ZA 4H2DA 4B6EA 4J3NA 2FHPA 3NNDA 1SHKA 1N7IA 3I9OA 3N0VA 5CJJA 2XYVA 4L3VA 1I32A 1WMSA 2P6MA 2ADMA 4XWTA 2WA1A 3A31A 3CZQA 1PZMA 3ZCPA 5IF3A 1TUBB 1J9EA 1KJQA 5I9MA 1OV4A 2V9CA 4FN4A 4QBFA 5B53A 1Q0TA 4ZEVA 4J76A 3MK31 1OTXA 3PTAA 4ZVPA 1A5SB 2Q5JA 2BM0A 2X0NA 1H2EA 4K9SA 5C1IA 1NLYA 5FBRB 3QVGA 1SULA 3KOMA 1NM5A 4GIBA 2X14A 4CYMA 2DQZA 1DKPA 4KXNA 5HR5A 1R0BA 4EJFA 1I3LA 1UJCA 3PZRA 2VQDA 5G1NA 5K4AA 1Q0UA 5B2FA 2YMPA 3MYYA 1TRKA 1XHLA 2AR0A 3JALA 4MV4A 1OXKB 1EUDA 1Z7GA 3T52A 1X3LA 2B30A 4OD0A 3UKJA 4ZRDA 4EHBA 3ESYA 4B79A 2OBXA 3BN3A 1W96A 1EE9A 3TZBA 3ZLVA 4YRSA 4ZJZA 4P7BA 1VG0B 1QGYA 2YN4A 4IIGA 2V4ZA 3SQXA 4YHBA 2QQEA 3GHYA 4LQ4A 2ZCUA 3JZFA 4G5GA 1DIOB 1QVRA 1ZL0A 2OLKA 4UTXA 2DHRA 3O95A 4L7QA 1IJKA 4EK9A 4ETNA 3N3BC 3HFRA 3ZWQA 3R2JA 4FFNA 2QY9A 4QATA 2B8EA 1PFKA 2J3MA 3CZCA 3HJNA 4RMGA 4UOEA 2GK3A 2KE5A 2L2QA 1Q20A 4PFJA 1ZJ4A 4MUHA 5CDFA 1QFJA 2F67A 2UVPB 4XEUA 2W37A 1G16A 1A72A 3F49S 4GR4A 5TE9A 1N7GA 3TW8A 3ZEIA 5FWAA 2QM0A 3LHKA 4ZREA 1XZDA 3INYA 3BE6A 3WLSA 2QMHA 2QUHA 3VUEA 5C7YA 2EIHA 2I8CA 3AXTA 1PJAA 1Q19A 1XZNA 2X2FA 2WSSD 3FSGA 3PIRA 4U1RA 1WU7A 4YJFB 5GV7A 4J0CA 4FYKA 1V11B 4ES6A 2JFGA 1SHUX 1JIUA 3FW1A 5A04A 1WOMA 5LZ5A 4P3XA 1NFRA 2ZUEA 1E1RA 1WQ3A 1OFTA 2F8LA 3RAGA 5JJLA 1C9MA 3MWDB 1BA2A 4BY9E 4FX5A 2GTHA 3DZDA 4GXQA 5D1NA 4M1EA 1XMOB 3DF7A 2FFQA 4LBYA 4JLJA 2RHHA 3COPA 2SCUB 2V96A 3OZTA 4MVXA 3SC6A 2A33A 3PUHA 2ZRKA 4JYBA 3UJPA 4LXUA 3WYDA 4BGVA 1DL5A 4C03A 1ZR2A 1A1SA 1LJ8A 3P4UA 1XD9A 3WNVA 1KEPA 5C8DA 3C8MA 4Z1MA 1KMHB 1JBQA 3UB2A 5K99A 4GKKB 4MR7A 2BGKA 2YHIB 3HB4X 3QLJA 4AJ4A 2QDXA 3EUAA 1AKUA 1TAHA 2WG1A 4PQFA 3FSEA 4ZAYA 3UV3A 3ZQUA 1LDNA 2QX6A 3CCCA 4DG5A 2WC1A 2C61A 4QLOA 3KEQA 1U6IA 3WNCA 1VPWA 4R2XA 3SQWA 3DOUA 1EXWA 3LHIA 1PHRA 2H7XA 5LMUB 1WLSA 4Y18A 5CPBA 2BFBB 2DFDA 1YI1A 4QEZA 5C4IA 2BEKA 4D45A 1UMBB 4B43A 2IYPA 4YDQA 3ZBTA 4LJ8A 2G5CA 4XYMA 5SZIA 4BVLA 1YI8A 1UFVA 4Y9UA 5EINA 5HKLA 3U7QB 3QWBA 2OXEA 3LRXA 2FW6A 2NSHA 1SELA 2BKVA 2C94A 1B43A 1PT7A 2CFIA 3CUEF 4LA4A 4Y6RA 1OH5A 1P39A 4EJ0A 5JO0A 2L42A 4RV5A 4Q9KA 4XWGA 3R8XA 3LOUA 2ZBDA 1U7XA 4UARA 4UUBA 2EBUA 1T36B 3C4VA 1WDWB 1FLAA 1ZOLA 4H7JA 1TZMA 1P1JA 2FFHA 2D4HA 3VAAA 5IKPA 1JFSA 4CODB 5EZQA 4F1JA 1D4ZA 2CXOA 1YULA 1II0A 4BBPA 4TXLA 1POXA 1BD3A 1GQFA 2Q4BA 4F5YA 1QM5A 4C3UA 3VYUB 2P8JA 5I7WA 1F4PA 4WN9A 3K72B 1KNQA 4HQKA 1ZJ6A 4PZCA 3DC2A 2MSCB 1NN3A 1RDFA 5F73A 2C9OA 3F8WA 5DCYA 1ACJA 4RCVA 2F3PA 4RPIA 3FZNA 3DEFA 3I61A 2EWWA 4MYRA 3QF4B 3ANXA 4ZALA 4FIZA 2GH1A 2CLOB 1UBMS 3RVJA 4AZ0B 5DXAA 4D4MA 2PWPA 5IULC 1BS2A 1ZCFA 1F0KA 3BMNB 3HQ4O 2ONZA 1LRKA 3CB2A 5KKCA 2FEXA 4FJ2A 1P31A 2GJ8A 2RGGA 4A8JC 4F8YA 2J4CA 1O95C 2QIOA 1GNLA 2B25A 5I4BA 4AY4A 4F5EA 1YDEA 1T2NA 4TV8A 5D51S 2V7VA 3QITA 3W5UA 4MIEA 2XNDA 3P2OA 3MW8A 4F93B 2RONA 2O2ZA 2AI1A 2HIHA 4A27A 5BWLA 3FLMA 3JZMA 2OENG 1GRQA 1YRWA 3ILYA 3KL2A 4LMRA 4G5XA 4RIIA 1ISRA 5JJCA 4LXYA 5DEOA 5LPNA 1IHDA 2YCLA 3UATA 5JROA 1WZCA 4LJ9A 5HKKA 3EGVA 1GQ2A 1I1QB 4RXUA 3UFBA 2BGWA 1RQXA 3NEYA 3FYUA 4K40A 3QVVA 1CF9A 1G4UR 2QTMA 2WK1A 3NWOA 4MJLA 2DFTA 5HVNA 2OCAA 2FCRA 3RLFA 4HDMB 4L78A 1Z68A 3EPHA 3TBFA 3E1GA 2VN8A 3GRVA 3ZXXA 4DCGA 3H97A 3ND9A 5JZMA 1WXXA 1AKQA 2PRYA 2C8KA 2J3QA 3BIOA 1DQPA 3EWSA 3O7WA 2H1WA 1Y4ZA 1V7QA 1QJCA 2CXRA 2JAXA 1F1BA 4D9FA 4TMZA 3PYMA 2BM8A 1Q6ZA 4K46A 4RC9A 5LA6B 1EK0A 3H05A 3GNSA 5BVGA 1RRMA 2FPIB 1JECA 1XMVA 4DUGA 1TQ2A 3RVLA 4NZZA 1X0XA 1JFLA 1QS0B 1GUBA 1CK4A 4MUBA 2JBWA 1EX6A 3KXPA 5EHZA 1QX4A 1IIBA 3LBHA 3ZV4A 2JGEA 4AYWA 3HP7A 2AF4C 1U0JA 2J07A 1WA5A 2R5WA 4F71A 2WTUA 4UHBA 1R0YA 3UK0A 5BQFA 2COEA 3ZQJA 3QELB 3M1LA 3W79A 5B5SA 1GSOA 3QVUA 4MW1A 3X1KA 3PUIA 1CQIB 1D4FA 1DV2A 4U4AA 1I7SB 3HA3A 2V7GA 3WWDA 4RW0A 3FBTA 121PA 1PIWA 3T5CA 5CTJA 4V0LA 4E5UA 5KC9A 3OU7A 3AY3A 1K8RA 2P7HA 1X2BA 2X15A 5EIHA 1EWRA 3ZTWA 1YS9A 3E4CA 4FD2A 2IYAA 4EKDA 5LDDC 5AYVA 5E9AA 4RKEA 4GXNA 1PFYA 2WWGA 4L75A 2AOWA 4PV7A 5G4KA 1CQPA 4LPSA 3QVTA 5IJAA 3IODA 4B34A 3OPXA 1E66A 3L07A 5GINE 5C9ZA 1ADFA 2OMKA 4JL5A 5JISA 4EG0A 3K70D 2JCXA 4JYPA 3I0ZA 4FHFA 4R83A 2PR7A 4CMBA 4QARA 1JZTA 1BHO1 1JXAA 2EJBA 4YJ2F 3SYLA 2NPFA 3AVQA 5DCUA 1UKBA 3I09A 5CX1A 1B8VA 1XJ5A 4QFDA 3FFXA 3Q87B 1Y1SA 1ZU4A 3K0BA 4KK3A 1VMAA 2WY2D 2CLKB 5IZCA 1Q95A 2CBGA 2IDZA 4JC5A 5C31A 2QAGA 4CMAA 3MUOA 4KITB 4FGWA 1J00A 2F90A 1YR8A 4Q9IA 5DP2A 1W49A 1WZEA 2IU4A 3PHJA 4EHDA 2WP0A 4AO8A 5A2QA 3OQPA 3A6PC 1RAIA 5FHRA 5CEFA 4L4XA 3HG7A 1OFHA 4A26A 5AKHA 2OZVA 4Y6OA 2VJMA 3JQBA 4IGKA 4CGYA <