2D00A

Subunit f of v-type atpase/synthase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
MVPVRMAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a central stalk subunit F of prokaryotic V-type ATPase/synthase from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords V-type ATP synthase subunit F
total genus 32
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2d00A01
2QAIA 2I4RA 4RNDB 4IX9A 3VR6H 3W3AH 5KNCH 5KNBH 2D00A 3AONB 2OV6A 5KNDH 3VR5H 3VR4H
chains in the Genus database with same CATH superfamily
1VCHA 4OHOA 1F0PA 2ORWA 4RDXA 2DMRA 5D3MA 1AO3A 5BNFA 3ZQ6A 3AONB 3FCCA 1M6VB 1HDEA 1IDN1 2F00A 1XMIA 4DLBA 1EFKA 4MLCA 4YCAA 5D1HA 1HLPA 4HGNA 4BYMA 3DE5X 5JJBA 3OHSX 9LDTA 1FDRA 4ZAYA 2I9PA 3PHGA 4GF5A 1U0FA 4EI2A 1WDWB 4MW7A 1RPTA 2WTEA 3LUAA 1YOVA 2BE7A 5FB3A 4UUOA 3FWKA 3EZ2A 1N0IA 3MOSA 2AF3C 1L5QA 3LPLA 1RWPA 4R2IA 4DSAA 4HXGA 3IMEA 5CA1F 2B5OA 4DA6A 4F9EA 1CX9B 2RCYA 4US1R 3PEEA 2WQ7A 1EM8B 3UEOA 1OILA 1NFFA 4PICA 1KAGA 3AUKA 1I3CA 5LMUB 1F5NA 1LPPA 2Q2VA 4FR0A 5DGXA 1YTLA 5JAZA 3GCXA 3ZE1B 1YV9A 3JARA 4KO2S 5CXQA 1WSDA 5KWJA 3N3AC 3EIOA 2B98A 4AFNA 3K0KA 1KJ8A 5G4KB 2WYOA 5U1PA 3D6AA 1WKCA 5TF0A 4DCTA 3OAAA 4HATA 1N33B 2D8AA 1YR1A 2E5FA 2OCYC 2OD7A 4OKSA 4NMXB 4TLDA 4EY4A 3IFSA 4W5QA 2C5FA 2VJMB 1EAMA 1E7RA 4TKZA 5JD6A 1U2DA 1XNGA 1PVOA 2OP0A 4LVCA 4PTZA 3FVQA 1E3LA 1DINA 1MEJA 1PJAA 2Y1KA 3HPRA 5AIAA 5EKSA 3ZJ5A 3HNPA 2VAXA 2VP4A 2C98A 3G49A 3Q7RA 1ZCZA 1PNTA 1USUA 2R6ZA 3GRYA 3NC1C 2O2YA 2X6RA 3ETGA 1J1ZA 2IYVA 4NR0A 4RPIA 1O08A 3VH3A 3ZWQA 5LNK6 2ZIGA 3NUGA 4V0KA 4PFJA 1ZD8A 2HHHB 2C78A 1EK5A 3LT4A 4KXNA 2BI8A 4KX5A 5G0WA 4ALIA 4Y0AA 4TRMA 1YJXA 3R8CA 3JD2A 2HWXA 2QRVB 3FDXA 1DLJA 3T5GA 3WGLA 1DEAA 2CXHA 2F43A 4KQMA 1JIJA 5CW1A 1SXPA 1V6AA 3OZTA 2KLHA 2R85A 1M6NA 4LJLA 3EVFA 1ZUIA 4TWBA 3GQVA 2HREA 4W6ZA 1PD1A 3KPYA 5K20A 2A3RA 4KBGA 2X3UA 4Y6OA 5IKEA 5TARA 2PWBA 3GCWA 1UDWA 2CJWA 2J30A 3AEZA 2I87A 5E95A 4JLMA 5FTMA 4I6EA 5CFRA 2HD4A 4AX4A 4XWKA 1SBZA 3BMQA 3GJXC 3T54A 4BJ3A 4MVJI 4V2IA 2AXNA 3V2GA 3B8EA 3N0VA 3MTGA 3SY8A 1WNFA 2V9ZA 3B2QA 3QBEA 5CXUA 3BSYA 2OXTA 5FWNA 1RYZA 4INJA 3ZCTA 3FYUC 4IEFB 4LJ8A 3VGJA 5BYJA 2GCOA 4UARA 3ORYA 2XB6A 3LBHA 2A1UA 4H1TA 4IDGA 1TEZA 4HLUC 2ONZA 2R8RA 5FPTA 1NIJA 4IIUA 2HXYA 3K0CA 2AUTA 1NUUA 2KX7A 4RE6A 3TVTA 1YU6A 3VSCA 3WXMA 3ZV7A 2I8LA 3EXG1 3KTAB 2J46A 4EUFA 1ONPA 1WB6A 3PUXA 1I9GA 4Y2VA 4G4JA 4FMCB 2A5DA 2DBQA 2WZDA 2B4YA 4WZ6A 4YECA 4EG5A 5HZGA 1WP4A 4RFLA 4L6IA 3WZMA 1LTHR 4OPMA 4F86A 2P0EA 3O3CA 5EL0A 4J16A 3VR2A 4Y3UA 4AMYA 1U5CA 3Q3HA 3TPCA 1VOTA 3KVRA 2J32A 2IU0A 1IJBA 4MITA 5HJ2A 5ILQA 3EIHA 1JHVA 1OFHA 3CWCA 3EMDA 1VI5A 3IBSA 4MLZA 3WKDA 3D3NA 1PV4A 5E6RB 1HEUA 5K8IA 1PFWA 4GXQA 1KVRA 1VPTA 3MGKA 1KC3A 4R6XA 2DR3A 2VJLA 6PFKA 2P9QA 3NH9A 1TW2A 1L4GA 1VIYA 4U7PB 2BGTA 2OXEA 5TT0A 3RR2A 2IP2A 4CTKA 3ADDA 4LJ7A 3HU1A 3NQ41 1H2RS 4YUVA 3WGOA 4AWXA 3ZBUA 1L6RA 3O8BA 4CF4A 2IEBA 3QPBA 4OB7A 4DR3B 1VMAA 3FYDA 4Q3CA 2QIPA 3GW8A 3VZSA 3GLIA 4HMOA 5TGZA 3OZBA 1ODCA 4EL0A 3T7CA 1X2BA 1C80A 1GY8A 1XMSA 2VA8A 4N4AA 3IEVA 3WK9A 1EFTA 4OFXA 4BWFB 4NH4A 1C3VA 2QRPA 3D4IA 2XUQA 3W5DA 1AXRA 3EIFA 4CL3A 1IY8A 2B3TA 4KSBA 4BC1A 1C3OB 1LSOA 1TK3A 1CS0A 3NT5A 2AVDA 3JAWB 3RH0A 2B8NA 4QIHA 4CQLB 5DIZA 2XVMA 3A6EA 3CISA 3HY4A 3OX1A 3Q12A 3KQHA 1N4AA 3I42A 5DMHA 3WGTA 4EITA 2MR5A 4KDFA 3PEVA 4MV5A 4OGLA 4P33A 4JLBA 3I1FA 2B8TA 1YJAA 3JQBC 4IFIA 3F8SA 5TMPA 4OI0A 1TF5A 1X1CA 2IX9A 4LY6A 2OFFA 3IRVA 4NV3A 5AOCA 3BFPA 2I4OA 1B42A 1PWZA 1TEXA 1CZNA 3KWJA 4FYWA 5GZ3A 3BHJA 3MELA 4HGRA 2ZDHA 5FUBA 1QDEA 1M8KA 4P6VF 1JVNA 1IOWA 1C9JA 2NXEA 4C7XA 5IKPA 2PVSA 1FVFA 4YH1A 1ZUNB 4ND7A 4C88A 2FQXA 2ZJ5A 2HBYA 1P3Y1 4DAOA 1CY8A 2GHTA 2ARKA 1CIVA 4PHCA 1KP2A 4RY8A 5F4BA 3SEQA 5JWRA 4RK4A 4PANA 1W25A 3LO5A 5BVGB 3CY6A 1XFAA 5BV0A 4DCJA 1JG3A 1K5DA 1U1CA 4PZPA 2O3UA 4EUSA 5LA6B 3JWHA 4F9FA 4GLLA 3HEBA 4QPPA 4ZT5A 2Q41A 3B52X 4URXR 1E94E 1LDMA 1P1JA 3ABOB 2RGXA 1EH5A 4IMIB 1DAHA 1M2OB 1SCDA 2GZHA 3G9TA 2VP0A 5HM8A 4V02A 4PTLA 3FRIA 1M2WA 4ZARA 2R8PA 5SY9A 3ZWOA 3AL0C 3FAZA 4LSZA 2JW5A 1XRSB 3EEYA 2Q3FA 1JGTA 1IEQA 2XITA 4AXXA 4FB4A 2HU8A 4KXQA 3ZQJA 4GI1A 2AE2A 3L04A 3CH7A 1YRWA 2A1IA 4IY1A 2VJQA 3KJZA 9LDBA 2QAGC 4HXEB 2EERA 3PUJA 1C8BA 3S5JA 1T5IA 3K15A 2CUZA 3T5BA 1N2SA 4D5EA 8AT1A 1EEHA 5J2UF 3H16A 4ZEMA 1QBGA 1CB7A 1NC1A 1RYDA 5D7NA 1E1YA 5U4QA 1U4OA 2O1XA 4FZ5A 4OKNA 4R8SA 4TWRA 5LOVB 4F4FA 2J3EA 2II6A 5KAMA 2R9VA 1KBZA 1OFIA 3HRIA 1DV1A 4IIEA 4JA0A 4JDPA 5WRFA 2YR0A 1NM5C 2DFLA 3KQMA 4XEHA 5CAEA 3D1LA 3O38A 3OOWA 4ZI7B 1LI7A 5LFAA 1N8NA 3KVVA 3RTAA 1E6CA 1NN0A 2XX3A 4IIJF 4F84A 4Z6KA 4AF6A 3KEFA 4DM3A 2H92A 1Z35A 2ZYGA 3A9VA 4LDJA 4UHDA 1XMOB 1CDZA 3WLEA 2BM1A 3DDWA 3ADKA 3DZBA 5F73A 1DIAA 1Z4JA 1NU6A 3BD9A 3CO0S 2FPRA 1VSBA 3HWRA 4HR7A 3RTEA 3MWLA 1SK8A 4ECAA 5C32A 1PYGA 4FM9A 4IJMA 4LF6B 1I51A 2D3WA 4COKA 3RYFA 3H5NA 3I6BA 5E7QA 5EHQA 4RHFA 2IW1A 2A9QA 1OI4A 2MIIA 3SR3A 1CRZA 4A6PA 5JJKA 4HDKB 3KELA 4QATA 4AF7A 3U16A 1EDEA 1ANKA 3ZWXA 1X1RA 1BX3A 4WXHA 3C5WP 4JC0A 4EGSA 1UM9B 2FQWA 3NHBA 2QX6A 1C9YA 5KNDH 3PL5A 1M83A 3O0TA 4W1SA 1C4OA 2CVPA 2Y1WA 3CU5A 1H1LB 4D0LB 2ORYA 4U39A 2W2VA 4ER0A 3GPLA 1E8DA 3MT7A 4PX5A 4XUCA 1RWMA 1CUSA 2J3HA 1DTEA 5LP1A 2YMMA 1CUEA 4JP2A 1UAAA 3EXIA 3I6IA 2IOQA 4ARVA 5EIXA 3QU9A 2WICA 5E1DA 1JHYA 2NSLA 3AKCA 3QVLA 4RVUA 1ML3A 5AK6A 5FLKA 3L0ZA 2QJFA 2AMFA 4I1PA 4PFKA 1LH0A 4HV4A 3GLHE 1WBDA 1R9MA 4M7WA 2WVGA 1NVTA 1XLTC 3UT5B 4RNCA 3TIIA 3WYDA 4DY4A 2PPLA 2QTMA 1MORA 1OWLA 1QPGA 1ZM4A 2NXJA 2ZWVA 3N7UA 1OC4A 1U7XA 1UDBA 4Z4GA 4D1YA 5IP5A 5JC1A 1KJIA 2O8EA 1YZLA 5E9AA 2Q6OA 5BSWA 1OYVA 5TLSA 1R4ZA 4QM7A 1XR3A 3CB2A 1DEKA 2ZTLA 1KI8A 1SKQA 3JQ9A 4IGEA 2IEAA 2C5GA 1XKTA 2J7KA 2NXCA 2JARA 3JD3A 4I5GA 1I36A 1R4AA 5IC4A 4GR9A 2JLXA 2W43A 4PTYA 2YICA 2WQ6A 3B20A 2VF8A 2OORA 3B70A 3TW4A 1A4RA 2CLKB 3F3KA 1KY5A 4LJRA 1YNOA 1V1RA 2WYIA 1L5HA 3QXHA 1YQ9A 1ZI6A 1FRNA 3OZIA 4KYVA 2IUSA 2G9RA 3UQYS 4AS3A 3KC2A 4Z53A 1L4HA 3MWEB 5I8WA 4Q4AA 3KUUA 1D6JA 3N0WA 5DGDA 4Z3DA 2PX2A 5CYGA 3SWWA 4PGMA 4CF7A 1S9HA 1CR1A 2PH5A 4OK6A 4R40A 4LA4A 3CR7A 1G9XA 3W5CA 3NPAA 2QPLA 4E5UA 1N34B 1M2JA 2Y05A 1KK2A 3WX0A 3ZHYA 4XYLA 4LGCA 2WD7B 5BMVA 4FSDA 2B34A 3S81A 3SAJA 1D9XA 2APJA 2JGIA 2CXXA 2XQGA 3E9RA 3IAXA 3SBXA 2NTVA 5BOSB 1HX7A 4QXMA 3TOCA 4J2OA 4JBWA 4P81A 1ST3A 3T06B 3TXXA 5AK3A 3UMCA 4UDOA 4WDQA 1E79A 1OOEA 4HDKA 1SIOA 2VHEA 2BKLA 3A2MA 5ALZA 2ZSBA 1QGYA 1VP9A 5EJ2A 3TOSA 3MQ4A 1QWSA 3IKMB 1WM1A 3U7RA 1H2YA 1NNEA 3AI1A 1WP9A 1RWOA 3CVJA 3T3OA 1RZVA 3ROZA 3F6YA 1B6RA 1GITA 5HJ7A 2WU1A 3CF0A 3VO9A 3KDAA 3KSDO 5G0UA 5JS2A 2X4LA 1JW9B 2I62A 4BBJA 4KZKA 2BF4A 5BQXA 4WT7A 5JEDA 3P7MA 2D4HA 4XR4A 5AOBA 1H66A 2QUIA 3CONA 4FWBA 4ZPXA 2LE0A 1M33A 1ORHA 2GSWA 3G2MA 3KPJA 4MWDA 5K3BA 4A73A 4PXYA 4HUJA 5DN9A 4ZYVA 4QBFA 3QSYA 1A5TA 1FYEA 2L2QA 2AD5A 3ONNA 1A95A 1HDOA 1FLNA 3H7AA 1XCPA 5TXGA 4JB2A 3UHJA 5KOHB 3Q88A 5D3MB 2I4LA 1HLDA 2ASVA 4RDCA 4BFXA 3PR2B 4ZIRB 1OFUX 1UEIA 4ZO7A 5JMOA 1B76A 3EQ9A 2YBDA 4LXIA 4NARA 4KPGA 1L4BA 1XYVA 3D8BA 4JZYA 5CA0A 2HT1A 4IYJA 3ZCSA 3E6AA 2NAFA 3HO1A 1HDYA 1XZ8A 1O6FA 2Q5JA 3H0KA 1A8SA 2V6FA 3V8QA 1Z7EA 3AW8A 3WBFA 3AG5A 3L1UA 1RIFA 1SKAA 2PGLA 4MB2A 4YRFA 3FMFA 3DZGA 1OI3A 3W6NA 6CHYA 5LXTB 2G3YA 2FFBA 4GLJA 2FR8C 2XAAA 2XE7A 4RTOA 3O4FA 1XDWA 4DR5B 1RADA 3SZUA 1FOEB 4HNRA 3W04A 4D8VA 5ITWA 1KQPA 2P40A 3R6GA 4DQ0A 1CJTC 3EGXA 4EKNB 3KFXA 5FBWB 2CSUA 3E1KA 2HMWA 2D13A 2REQB 5BW8A 5AR1A 3KUXA 1DKLA 2A0UA 3E8XA 3TNDA 5HW0A 5AESA 1IMJA 2HPZA 3HZZA 4N6NA 3EVNA 4CT0A 3R3HA 2I3AA 4P5EA 2FFHA 5BN3B 5ADWA 2XQVA 4S24A 3L6EA 3SZOA 5GOZA 2P78A 4UNQA 1M72A 4FU0A 2AMLA 4P7FA 1PW7A 1MNQA 3O47A 2ZRGA 1H3NA 1X94A 1XD2A 2EJUA 3EZ6A 2NQ8A 2OGUA 4XE5A 2XCRB 3KU4A 3RO7A 4PZYA 1XJWA 2HT6A 5BPFA 1L3CA 2D7JA 5JDCC 2CFCA 2NU6B 5LBTA 1DEHA 4Q0MA 4UHCA 3RT7A 1PG0A 3D3WB 1ECCA 1KZ9A 3AR9A 2OWEA 4MIKA 4EMBA 4J6EA 1XWWA 1R8JA 3F46A 4MDHA 4E5NA 2P9YA 2XCLA 3HUUA 2P4UA 3TRFA 5LLSA 3TWOA 2OHJA 3HSSA 4WERA 2SCUB 1C7IA 1FF9A 3Q10A 3W06A 2PRJA 1RWWA 2JVKA 2FWAA 1T8TA 2J9FB 2TYSB 3DEIA 2I2CA 3Q85A 4H2DA 4MK4A 2ZITA 1AKUA 3GC6A 3LF1A 1YT5A 5G0VA 4F92B 3W9BA 3HM9A 5FWXA 2R1TA 1FDTA 2O0KA 3OZGA 3LUBA 2FSVA 2ZWMA 4G4GA 3EJWA 2I3BA 3EZLA 4TKUB 1GQSA 4Z7QB 3IT2A 5CCDA 2RHRA 2C99A 5P8WA 3EPLA 4WCVA 4GKJB 3B89A 5DBFA 2E9SA 2H7XA 1DQNA 2JBAA 3G88A 2FSIA 1N5DA 4IV0A 3UHAA 1AQ6A 1X7WB 1L8LA 3W5JA 3ZHVA 2PSEA 1GYRA 1NRIA 3T1HB 2OOKA 3OLZA 2YVAA 5BUSA 1CE8B 4N39A 3ND9A 1G291 5AHOA 4DCMA 1GP2A 4HQKA 1FFEA 4NQZA 3FOWA 1A9ZA 3VYRB 1IOVA 4Z9AA 4K0RA 3AU9A 5FWXB 4B4OA 3GEPA 1HYQA 1UKEA 2HHCA 4M76B 3L93A 1XO1A 2HW8A 2ZQ5A 1B3BA 2AOUA 2WF5A 1NSYA 5F21A 5THQA 2P2DA 2EATA 2IUTA 1FFCA 1UBUS 3RYTC 1R50A 3K31A 1LPNA 1C4WA 5D8DA 3ORRA 3LMKA 3IEMA 4R1NA 4CM1A 1F06A 3MT0A 4WZAA 3TGWA 1ZRHA 1E6EA 2A35A 3AX6A 1PG5A 4PSVA 2YVUA 4XARA 4XX0B 4YHBA 3SP1A 2VPXA 4Q3OA 4YCSA 4DV0B 1L7DA 1JAHA 2XH8A 2IOHA 3G0BA 4U63A 1NUQA 4YWHA 4DSTA 3R9WA 1XROA 1L4LA 4RFVA 3R9XB 4KX3A 1WUJS 3JR3A 5AJHA 2ZUFA 1Z25A 5IUJC 1TVEA 4WLEA 4FILA 4DC0A 1M2KA 1ULTA 4O1MA 3E15A 4EKDA 4BLQA 1SQ5A 3SE7A 4X6YA 3CNLA 3AHHA 1KFJB 1NHGA 1Z9BA 4RVSA 1SXJE 1UODA 1V3VA 4U7WA 5CB8A 3NXKA 2QD2A 2DJ5A 2P9FA 1SWWA 2GWRA 3AXSA 3DFIA 1YB1A 3GJYA 4L15A 3RF6A 3EFOB 3V7NA 2BE9A 2X9NA 1LVHA 2C77A 1XL0A 3PCTA 1XL1A 2ZAGA 3HS3A 4OX9Y 2R1UA 2OFWA 3M49A 4ALKA 1X1TA 4F4HA 1LDGA 1V8DA 3ZBTA 2Z2IA 3T5PA 3W1VA 4O63O 2PD6A 3CWZA 3I30X 1KYQA 4IIXA 2F8TA 1CD5A 1KWGA 2HCRA 3PPVA 2P0YA 3A6ZA 3ZWVA 2Q6TA 2VXCA 4KR9A 4DTIA 5BSFA 3BMOB 3ZHQA 5FPKA 3SVTA 1P9NA 2BC9A 1JKMA 1R5BA 5HPYB 2QZPA 4QOFA 3CLRD 4BP3A 2W6JD 2X76A 4Q5IA 1CWUA 1I1QB 1BS1A 4PO8A 4RF4A 4S1TA 4YA6A 4YGYA 4BVAA 3D81A 2CSXA 1KS2A 5ETJA 2IOFK 1B7GO 1GTSA 1WVMA 4D6XA 3GB9A 2XBUA 2H8KA 3BVPA 4PHGA 4GQAA 2R0QC 5I01A 1VQ1A 4KWTA 3DDZX 4JBGA 3WGHA 4YUAA 1YQEA 4DIEA 4GDFA 5IDWA 4DM7A 3C3YA 4KBFA 5E2AA 4MPPA 1RQXA 3KQPA 1G1AA 1AV7A 1MT0A 2HMAA 2IYLD 3GELA 4YO8A 4R0VA 1F4VA 4HX9A 4W7IA 2VUHB 2W6QA 2PGOA 4UNNA 3RJTA 1APBA 4NSNA 4EZEA 4FFBA 3QJGA 5J4LA 2H5EA 4RKEA 4TYQA 5BR8B 1CYEA 1CNMA 4B76A 1Q57A 3HBMA 1JEEA 4KOAA 3KLOA 4Y2TA 3L1IA 2CGEA 1KH1A 4U4AA 1WLSA 4ZMBA 3IB3A 2EEPA 1X0VA 2X5XA 3LV8A 3KOWA 4HNAB 5B55A 2ZIWB 4B82A 1P73A 2RGNA 1RNLA 1X7WA 2DWOA 4X1KA 5F1KA 2J5BA 4YMHA 2X1MA 4L8WB 1FW8A 2G9ZA 4IIHA 2YKGA 4AN1A 1EP3B 3DE1X 3CUVA 4JK3A 2R7NA 3HVIA 4QO8A 4A7PA 4GYYA 4HUQB 3O4GA 1PYDA 4QX6A 2IIPA 2X6QA 3O91A 2D00A 3QU7A 4AMUA 1SBQA 4N5LA 5C8ZA 4JUCA 5K0BA 5KQGA 5EXTA 5HFAA 1K3TA 2NPIA 3LX8A 4YHHB 3FKSD 3QM1A 1SY7A 3WFIA 1K75A 4YP9A 2AZXA 3UGKA 1MX3A 1DKNA 1T8PA 1TA9A 1D1TA 2ZE5A 3AIMA 4KHZA 4UUPA 4WXEA 1N5IA 2FSFA 3UTDA 1UBTS 5TVKA 4DXHA 2AIRA 2YIJA 2Q29A 1PDVA 3LPAA 4MNTA 2HADA 4XJSA 3UXMA 3WKBA 4F96A 2V7GA 3L8HA 3VU8A 3CC8A 4R1TA 4PNEA 1BD3A 4JJKA 2NU7A 4AKGA 1LBEA 3T7KA 3WLLA 5FUMA 1OLUB 2HDNB 4LEIA 1PSWA 2N9UA 1N5JA 2IL1A 3KJXA 4GOMD 2VRCA 3ZDYB 4Q37A 4Z1MA 1OIWA 2EXXA 3C98A 3LYHA 4GOJA 3THOA 3ZU5A 3ER8A 4XJVA 5THXA 2AA3A 2DQ4A 2GEBA 1XCJA 3C5HA 3EIXA 3SXUA 5CFQA 2IEZA 3NTLA 3TRIA 2B36A 3RRFA 4JYZA 1XLWA 3MMPA 2G1UA 4ID9A 4MTLA 1Z0DA 3B7PA 1T5HX 1KI6A 1U28A 5LIPA 1CB0A 1GFZA 3RIYA 2YWDA 3WGNA 1R66A 3U7GA 4IJ5A 4R2MA 3A4VA 5EVJA 2QZJA 3T7TA 5IPFA 1J7JA 3ANXA 4DCSA 3W78A 2QLBA 4MQEA 4PLCA 4RAOA 1KOJA 1XMQB 3FLEA 3TCXB 2FRDA 1SHKA 1NWHA 5AVQA 5I5EA 1KK1A 2B7LA 3CJRA 1XNJA 3H2IA 5DM60 1MMFB 1ZXBA 3ET5A 1QQTA 3PBKA 4QBHA 1VPDA 1NBWB 3VR5A 1PE0A 1C30A 1X7ZA 2I3ZA 3HCOA 4NICA 3I2IA 4GUAA 4XJTA 1XZKA 5F5LA 1GFIA 3T9CA 4J9VA 4RSHA 4LV5B 2I2XB 3FNQA 2H1FA 2OKCA 3U48A 4B6OA 1B0UA 1R12A 4RVDA 5FBLB 3WK5A 3BL5A 2REBA 3GGPA 1U1FA 2Y1LA 3HCNA 5TX7A 3QEMB 4Y8VA 4H7JA 5IT0A 4L8VA 2IUEA 1RFGE 3DCNA 3RI3A 3IVCA 4JB0A 4WRRA 1EVIA 3EDQA 5H70A 3F5MA 2AGVA 1E0DA 1TF7A 4HNQA 1B93A 3K6RA 4CYMA 4BNDB 2VZEA 3RK0A 4HGZA 3NM6B 3NTQA 2EKBA 5DOVA 4JI3B 5EIBD 2EFCB 2FEWB 2QRMA 3BREA 3RRNA 1ISJA 1SNYA 1U8AA 4LISA 5JBNA 3JX9A 1ODSA 2PYIA 4WCDA 3D3QA 1SOMA 4JEHA 4RQTA 5LBUA 1TRKA 4ZAFA 5DX8A 2QENA 5LQDA 1PT9A 1VDMA 2GDJA 1YBFA 4LBYA 1H0SA 4TV8F 4YJ2F 3ICVA 2O2ZA 4WQMA 2AS0A 1PAUA 4IICA 4HQNA 1TD1A 1RMQA 4JP3A 5L53A 2UVDA 4RD1A 1OXUA 4JUAA 2RK6A 3BWVA 3EQ7A 4G5XA 5KYXB 1VYVA 2XNSA 2AMYA 2HJGA 1BE0A 3G8BA 4MUFA 4QJ5A 5LDGA 1G17A 1JDBB 3EZNA 4KQCA 5GVRA 4KSCA 1FDWA 4G81A 1P44A 1RVV1 2WJIA 3CG4A 4Z7OB 1N9GA 1UIMA 4BLWA 2XYPA 1X8JA 3MAAC 2ZBRA 1HT0A 4JT9A 4D74A 4BFVA 2WRZA 3MCUA 1ZKDA 2DKNA 4HUTA 2OHHA 5K6TA 1XZMA 1Y5MA 1N3BA 2ZI3A 4HAOA 3U81A 3R7BA 5EFZA 3QVKA 2H2HA 1VLLA 2ZIXA 4RSRA 3RADC 3L43A 3QA9A 2AW5A 3ODPA 4GSKA 1WWKA 3T9EA 3CV3A 2NUAA 2Z6QA 3BRWA 3FI9A 1PIWA 1Q7GA 1T5BA 3NHMA 4UDXX 3E22B 1PSZA 3GFFA 3E4CA 3ZJ4A 1KJJA 3NATA 4ENVA 1F2TA 4K7JA 3TTTA 1QTRA 1FIUA 1JQKA 2J7PA 3ASYA 4UD6A 2P9ZA 4P84A 4YRTA 5IN4A 3CR8A 3KYCA 3GVIA 4S04A 1SN7A 4DOMA 3D0KA 4E33A 1AZTA 3WXBA 1LKZA 3ED5A 3PNKA 5D51S 1GCIA 1GPJA 1RAGA 2IP4A 3NWBA 4Q9AA 3ST7A 5K4GA 3KSBC 1GZUA 1O95C 1QHSA 1WZUA 1N6HA 3Q2KA 4DB2A 1C4KA 4MQMA 2HIAA 3UJ9A 4BFSA 3N6RA 3PUWA 4KUHA 3SLKA 3TD2A 3R0QA 4DBLC 5AVSA 1KEEB 3K30A 2IHBA 4OYLA 1N6OA 4D9JA 2V7QD 4XWTA 2UUAB 2Q3EA 3SFTA 4W9NC 5KX5B 4CKBA 1R8SA 4A8PA 1I13A 1PO7A 2WZCA 2W93A 1JEYB 1KQNA 3T94A 3F97A 4KITB 3DULA 3O26A 2VZ8A 2AZDA 3K16A 1MO4A 1RVDA 2HWKA 3CBGA 2PO7A 3G6WA 1DSSG 2IS2A 2Y0CA 4YPVA 3ESAA 4YK7A 5JH7A 5EXXA 1HV8A 1AQYA 2Q6IA 2QN1A 3AILA 2BVNA 3MJDA 4KJXA 4P1ZA 5T41A 4TYMA 2XQFA 1KEWA 4NNPA 4YN3A 3TSYA 4KWEA 1Z83A 1HMPA 3FVRA 3BJIC 3DD1A 2J3QA 2OBXA 3GNLA 3NUQA 2PQ0A 3DW3X 3FUVA 3IX7A 1GCUA 3GLSA 4F60A 1T4CB 5JY1A 2JS7A 2NYRA 3Q9LA 3Q8WA 1P9OA 1ZN7A 3NFYA 1U0OC 1EWKA 3WYBA 1S3SA 4CL8A 5DGHA 3A0UA 2V74B 2VHXA 3LLSA 2CXSA 2EFHB 2IY7A 2ZJ7A 3UB4A 2QDXA 1YDEA 1NW3A 1ODJA 2WWFA 3MRSA 1TA0A 2IVFA 2XGGA 2CUNA 3QVJA 3GUVA 2H06A 1QRAA 1YB4A 2HJWA 1WXWA 2ZGVA 3R5TA 4FHEA 4LJ9A 3V1NA 1ILEA 2ONJA 3KG2A 1B6SA 1VCOA 2I7TA 5DYWA 5EZYA 3ULKA 3Q9UA 2JLQA 5FA8A 4X84A 4II7A 2OGZA 1LBSA 1AHNA 1B1AA 3SBDA 1ZONA 3PXAA 1B43A 3Q1KA 4JY7A 4YGXB 1CFJA 1S2GA 3A32A 1X1SA 1UJ2A 2ZVDA 2O6LA 3F5SA 4BCDA 4OIFA 1HY3A 1I7DA 5KCMA 3ZTTA 1KFKB 4LK2A 1DCMA 4UEKA 1Z5VA 2C1XA 2WHPA 3DLTA 4EHFA 1BE8A 2O0HA 1A04A 1I9CA 3EGEA 6REQA 2VT3A 4TTTS 3MLEA 1E5TA 4D3ZA 4F12A 3HBNA 1IWOA 2QQEA 1DJLA 4FYYA 4M55A 4LGMA 3G8AA 2E4ZA 3TR6A 4LE2A 4HL6A 4L16A 2BP7B 1WZEA 2QNRA 2O9JA 2XA2A 3OZRA 4N82A 3W5VA 1L0BA 3NOQA 2PNFA 1U0LA 3VR0A 1G7TA 2VNHA 1OXSC 3EVZA 1KE1A 3KL4A 4F71A 3VVBA 2VH2A 3TW0A 2JD2A 1ZITA 5EE3A 5C4IA 4C9BA 3KYBA 4IM7A 4W8OA 1N77A 1D8TA 4GZ5A 3UWKA 2HGSA 4R71A 4K6HA 4AMGA 2QRZA 2R1VB 3BB1A 1US8B 1G38A 2ZUEA 1P7CA 1EU1A 1SQ6A 3LLUA 4CTNA 1QHXA 4TSFA 4ZCLA 1SK9A 2IPNA 3GG9A 3OCUA 1XTKA 2Z5VA 1IY0A 4LXGA 2CJWB 2P9EA 5DM0A 4ZRNA 1L9XA 2GN1A 1ZGCA 3BYZA 3QF7A 1K98A 4Q02A 3MYRA 4GR4A 4I9UA 4MS4B 1BA3A 1RCTE 4PR0A 5HGJA 3MS2A 1GZ5A 1YONA 5SYMA 2CB0A 1M66A 1SCIA 1ZMXA 5CIQA 3V9AA 5KQSA 4JU8A 5C35A 2QTFA 4TWIA 3RYCB 1F2DA 1CQIA 2A92A 2I5PO 2I78A 1XCBA 4V0ME 3VNBA 4G0NA 1FXUA 1LQTA 1QYIA 2XTNA 2FW8A 1BW9B 3P0IA 4Z2YA 4PPGA 4IJKA 3ZCUA 1J2EA 1N5KA 5KNCA 1T9AA 4DA8A 4R31A 3ZH2A 3HMKA 3ZDBA 3U3KA 1SUCA 3KKZA 2HFKA 4CUZA 1NKVA 1E6UA 3K9WA 4RE5A 1E59A 4US2R 5CB4F 1RS0A 2PMWB 3D9QX 3OX3A 2G17A 4Z4FA 1IN5A 1EK1A 4Z7NB 1RYMA 3TQIA 1W96A 1LZLA 3FGPA 3M4YA 4JITA 1FQWA 2HJRA 2EZ8A 2DERA 3GT0A 3QJYA 1XXHB 3QFTA 2FMXA 3AF5A 1EFVB 3F8WA 2P9CA 1N5LA 2B2NA 1KXZA 2BR4A 1I0ZA 5JRJA 5F3WB 1GU1A 3M6MD 2P0AA 1MIHA 1XJQA 2XLCA 1NJ5A 5K0LA 1NVXQ 4QU9A 3X2SA 3A9WA 4MUYA 4B85A 4MKGA 3MWKA 4ERXA 2HTEA 2J3IA 4QUEA 5LVAA 4GRAA 2QTVB 2ZBEA 2GXUA 2QZSA 2QN3A 2G9VA 2B1RA 3C6BA 5AI0A 4K3UA 2BMDA 2OLEA 3E53A 5KNLA 4E94A 2GCIA 2PR2A 1X92A 4O4HF 2RAPA 3NAMA 5CCBA 4TLBA 4N1AA 3VKUA 2J5XA 5EE5B 3A1VA 4E2FA 4YAGA 3IE1A 2XECA 3IB6A 4YR7A 2H2IA 2ACKA 2DE0X 5IJ0B 4JR1A 3SXPA 1SVKA 1U2DC 1QQAA 4WXRA 4F1KA 1TO2E 3R3XA 2H2FA 1ZC4A 4MYTA 3M82A 3GUCA 4E7OA 4G5SA 3PB3A 3IKLA 1L8OA 1CETA 1M6EX 2WFLA 5K7SA 3KPWA 4NNJA 3D3WA 3FY4A 4RAQA 3BMCB 4UHJA 3BD7A 1EK6A 4QL3A 4X45A 3P26A 4WXPA 4PLTA 3EVDA 2LCQA 1I14A 3FVTA 3ZUPA 3FN4A 4DDUA 2XCTB 2ZE8A 1NI4A 2TMGA 2VO1A 5B6PA 1CJKC 4XFDA 1XQ6A 3B48A 1UMKA 4UAJA 2GN0A 4I1SA 2VH1A 3ZI0A 1KDYA 1XRPA 3A31A 3VOBA 4EY7A 1ULAA 4J0DA 3CSDA 3FPBA 3ISVA 3QLJA 1P1FA 1MC8A 1UBJS 3CZPA 3FMPB 1OV6A 2ZJBA 3LQFA 4FMDB 4TN5A 4U2GA 3GPBA 3KYIB 2XE8A 3DZCA 3FUWA 1P7ZA 4O4HA 1E98A 1O3YA 4I66A 3TJMA 4EVQA 4NZZA 1Z4PX 3UCEA 4AY5A 2B7BA 2H54A 3MQFA 5F35A 2AVNA 1LBTA 1T10A 1QCDA 2WHYA 3BD8A 3RASA 1IUOA 2CXRA 4E5VA 1BDHA 3MWGA 1E4YA 2FCAA 4PBRA 1VGRA 3IHLA 3GZNA 3RJ5A 3STYA 3G9QA 4BVGA 1T2UA 4GXNA 4L5CA 4BCCA 5MDHA 4MKXA 2NLOA 4G25A 4CDMA 2HDOA 3JVIA 5AVKA 1B1CA 3ZHBA 2P1ZA 5SZJA 3AESB 3FDJA 4RGBA 2GK3A 2ORVA 3DOUA 3RFFA 3V8BA 5A5FA 2HWWA 4MPDA 4OXIA 3IBGA 2EFYA 2J4FA 4U1RA 1NE2A 2OYSA 3A26A 2OY0A 4L5AA 1M1YB 1OFGA 2CF6A 2L19A 4MQ5A 4BVKA 1F48A 1OIVA 2ETXA 4P2BA 1XAGA 3UGQA 1N2ZA 3FJ1A 1U3VA 2ZREA 3X0DA 3VNVA 2YWBA 4MVJE 1YWGO 4XEUA 3NDJA 5J2TF 4P32A 4E14A 2NU7B 3UAGA 4R5MA 5KNBA 4EB0A 4CG1A 1FFYA 1KPHA 1W9MA 2JFYA 3IUQA 2VNJA 4RHEA 2QSZA 2PD4A 2VEDA 1VMDA 5FI1B 1C5KA 2VHQA 4DR4B 3STXA 1UMCB 4OHFA 1QPZA 4QU0A 3I09A 5DP1A 3OFND 3Q41A 4CCYB 1LFAA 2YXBA 3W6ZA 3HB1A 3L6CA 4PCLA 4F85A 4OXNA 2E4UA 4KQ2A 3O1IC 2H3HA 1E2NA 4HP8A 2YZGA 4XYBA 4HNTA 3A1DA 1QC5A 1Z2CA 4MRNA 4ODIA 1X7XB 1JEJA 1E2PA 3B7WA 1O5OA 2AFHB 5FBRB 1NDHA 2O5EA 1ZM7A 3MJVA 4JWKA 3A58B 2CMKA 1IAQA 2QW0X 3OE4A 4MVJD 4XFKA 1BA2A 3ZVKA 3CNQS 4AZWA 2OV6A 3ZGZA 3HJUA 1XJ0A 4F3KA 1HEYA 3GNSA 4F4CA 1JALA 1MDFA 1N9KA 1ZIDA 3PGA1 1GFWA 1NUSA 1R0CA 3KALA 4LJAA 1Q15A 2DT5A 5I9LA 3AFHA 2GPTA 2MYPA 5FA6A 3S2EA 2QRGA 3KE9A 2WIKA 3QKWA 2O54A 4JT8A 3VTAA 4WZZA 1KZ4A 5A4AA 3O95A 4AO6A 4M0FA 1PNQA 4WMLA 2WWRA 3UH0A 5LQJA 3RSZA 1AHIA 1U0JA 5B1YA 3PT9A 3OP4A 2O4UX 3DFUA 3QFSA 2QX8A 2YRWA 1UMDB 4W9RA 4LX0A 3RTDA 2PUHA 1EGAA 1K9SA 2BFEB 1TUBA 1ECLA 3DWEX 4DV5B 1XDZA 1UC9A 1SUFA 3QWIA 3RVQA 3CA8A 2AE1A 2HK9A 4J0JA 1G3RA 2D1SA 2ETVA 3A3KA 4B2LA 2F3UA 4URVR 2OSBA 3KR0A 1YA8A 2PX4A 1KO5A 4IHJA 2JB9A 4YV1A 2ZT6A 1SXIA 3QPDA 3U4CA 1OROA 1AK2A 3LCCA 1D9ZA 3TSOA 2V4MA 2MDTA 5HXAA 3REOA 1OCEA 1T0HB 3LPCA 2CLOB 1XYGA 1OXTA 4CKBB 3WMRA 5AHXA 1G3MA 2V58A 1WUKS 4FJ0A 1JR3A 1L8XA 1JSLA 2I6QA 4UVIA 4WZAE 1AB6A 3DG9A 4QSHA 4OOFA 5BUCA 2FKNA 4ZMRA 1L3IA 3FBGA 3U37A 5KYUA 3ZU4A 3L1HA 4AU1A 3GBVA 2Z98A 1SVMA 3AFOA 3UCFA 1A9TA 3IDOA 4PIMA 3WLFA 3L6UA 2XVXA 4B3CA 5CDUA 2HMYB 2ZT8A 3GXOA 5DRTA 1YZTA 1QH8B 4V0MA 1Y3HA 4D02A 4ZOBA 2YH2A 1GLVA 1W1UA 2CYBA 2FEAA 5J58A 4R9NA 5LQNA 1OI2A 2IJGX 2ZSAA 2DR2A 5AJXA 2PY6A 1TK9A 1QPBA 3E84A 1YCFA 5T5QA 3T95A 1F12A 2X7XA 3DE0X 3E4DA 2ZTUA 4KI0A 2OZEA 1UXGA 1XDDA 4KU4A 4DVGA 2XODA 2QTWB 4KEAA 2LDXA 3SC2A 3R5XA 2ZSDA 1J8VA 1XFDA 2YY5A 3G89A 1CZHA 3C8UA 1U0BB 5BV7A 1D2MA 1YH3A 3MJRA 2P2NA 3D4BA 3LOUA 3VHXB 1SCJA 4L9RA 4QG3A 2H5LA 1MB3A 1CHDA 5J2TA 4DMUB 5SY4A 2PIDA 1ZD5A 1YFZA 1YS9A 3KLPX 4X97A 1Z4QA 3P32A 5AXDA 4Z0TA 3WIDA 1NZFA 2IXBA 1ZEJA 3LL7A 1NP3A 2FHPA 1VA4A 3DAYA 4ZD6A 1L1FA 2DTDA 1KSJA 1U0TA 2OGSA 1QV7A 3GZJA 4GVPA 1VE9A 3NWPA 1I7PA 3D7MA 4REQA 1BCSA 1HWYA 3FPCA 2OV3A 5ALUA 4LHYA 1PZXA 1Q3KA 4RVCA 3UPTA 3N53A 4C5CA 1W4AA 3BWDD 5I9TA 2R6AA 3BWXA 3Q15C 2O8BB 5D5PA 2WWVD 3DUFB 1QVZA 4C4XA 1BMTA 2YFKA 2EX1A 3DVQX 4E3WA 3C8DA 5JZ9A 1FA9A 4FE3A 3AEQB 2FUG6 1JSRA 5TPZA 5BXYA 4IXWA 1C3XA 3JVVA 2EHJA 1FMTA 4NULA 5EJIA 3VRHA 5HSGA 1E96A 4HS4A 4UEJA 3FPLA 1G64A 4EHKA 3HBJA 1VL0A 1OTXA 5KDLA 1QONA 2WI8A 1L3BA 2QROA 1XZQA 3EGWA 2BM8A 1YJBA 4EYGA 4XM1A 3R3ZA 4KGDA 3ZWMA 3V42A 2AFVA 2VUUA 5AVOA 5KHAA 2IUUA 4G8JA 1YFLA 4ZVPA 2QT9A 1GM5A 4OP2A 3GL9A 5A7GA 1XVTA 1WJGA 1G9TA 1OGYA 1Z6QA 2ZUWA 5A05A 4LYEA 1M0TA 3FOZA 1DCFA 4LQCA 3AKZA 3CEHA 4PRKA 2YQ5A 5FPPA 1QQBA 3AOEA 4DLWA 1KMCA 4WVFA 1DOHA 1R16A 3I8XA 2RIRA 2QMUA 4BS9A 1J25A 1NFQA 2N1BA 1NBEA 1MAUA 4Z9BA 2A5LA 2QN9A 4JQZA 4TQUS 4N49A 5AJUA 4DUGD 3OE7A 2C3OA 2NU6A 3N74A 3PRHA 2MSEB 1Q14A 1R0XA 1RXYA 5I4BA 1A97A 4QXQA 3T52A 1AKQA 1W36B 3UA3A 5EJ4A 4DABA 1J8YF 1OHHA 1TM7E 1U5BA 5IBCA 2RJ3A 2BEVB 3PC6A 5A9TA 1AUOA 1ZK1A 3T3GA 4CKWB 3FG9A 1DJNA 2JI8A 1AUPA 1KH3A 1QO7A 1RRPA 3USZA 4ZREA 4ZCIA 4GEGA 3F6EX 4YBZA 1SRRA 4P83A 3A4YA 1U80A 4WASA 2Y1XA 4ALLA 1FFHA 5KC9A 4ND6A 2GDZA 4XX0A 5DH9A 1XQVA 4K9KA 2R3SA 1NG1A 3FGNA 1A8IA 3X3HA 2BZGA 1ZQ9A 3L6DA 1GZ4A 4LXQA 5F7JA 3EHDA 2R6HA 4OMDA 2GH1A 1KORA 2O1SA 1YIOA 1F9AA 3PUVA 3B38A 2IDJA 3P9QA 2NMVA 1KP9A 2W2LD 4RABA 4KXVA 5JH7F 4Y1GA 1DPGA 1K8YB 2HLPA 3P94A 2EX0A 3ECCA 2QSUA 3QLUA 4PBTA 3SVZA 4EJ2A 1F8UA 3MTIA 1KTVA 2UVPA 4GKKB 1VCNA 1CUGA 2GO7A 3FNHA 1BH6A 5E1BA 1IVNA 3CM0A 3SIWA 3VC7A 2EZTA 1V47A 4HQ0A 2IEGA 1TAHA 1WB5A 3C7KA 4LZOA 4UTZA 2HV9A 1PR2A 3JVEA 3LW8A 3BH7A 4DARA 2GZMA 1Z38A 3EVCA 4DKXA 1DAIA 1V16A 2AK3A 2Q3CA 4FDLA 4BP9A 3PQ4A 4NFYA 3DTVA 3A2LA 4X1KB 4EW3A 3D2CA 1FPMA 4HBGA 3VJLA 1PDWA 3VNQA 3EPJA 1OH6A 3X1DA 3KZKA 4FIZA 1A4XA 2VCHA 3H5VA 4L74A 4M0MA 2G4LA 2PCJA 3VC2A 1SBHA 2P3SA 3EMKA 4OVKA 1QP4A 3KZ1E 1KEPA 1FUIA 5AW4A 4OJQA 1DRJA 2F6RA 2FE4A 3I1JA 5AM4A 2P69A 5BRNA 1BMFD 2Z4TA 3HM2A 3TMYA 4BO6A 4HUQA 4D96A 4J0FA 1F38A 2GBLC 2W8BA 1X2EA 3BJEA 4UUMA 3W2FA 1UPUA 4F21A 2WWGA 4FONA 3CNHA 4Q3AA 1KMIY 5J2UA 1XMPA 1YR9A 1NXXA 2ASEA 2LTAA 1N1DA 1E8NA 3BEDA 3FUCA 3C39A 3NX4A 1E6KA 2HNKA 4ZZ1A 1II8A 4KTVE 2LIVA 2REOA 3HJHA 3I1IA 2F17A 3UW3A 1XZNA 1ZW6A 3BSSA 4JMPA 5ENZA 3NIBA 2YXDA 1ZM2A 3OQIB 4DREA 1GADO 2Q4BA 4CMCA 8LDHA 1KYZA 3OSZA 4MZDA 5IFLA 3Q0TA 2JGDA 2WIBA 4OUDB 4J29A 1HRKA 2H18A 4RXUA 4CKEA 3FYSA 4V0LA 5IKOA 5THKA 1WU7A 1ETUA 2H4XA 2HF9A 4TV8A 3ZZNA 4ZO8A 4RHCA 2CHEA 4UPVA 5B7GA 1V3UA 4J2HA 1PR3A 2OLKA 3DE6X 5E6SA 5IULC 2J6HA 5IJ0A 2GYWA 4KXMA 1G16A 4ZGWA 1ZNXA 2OC9A 4O2AB 5TMEA 3RKSA 4DUPA 4IJQA 2TMDA 2O5CA 3W3AD 1DT5A 2RHGB 4LOAA 4DSZA 1T1IA 1S2MA 1ZJ5A 1CCWA 5FBZA 2EL7A 5FPHA 3RBVA 2BMJA 2VQ3A 2FUKA 4GSLA 4JJ6A 3ZXSA 3BE4A 2F3RA 1DG3A 3U40A 1KHHA 2VRWA 1Z0AA 3F1LA 3HI4A 1T36A 1VLHA 4YP5A 1UBCA 2OFOA 4MCHA 3RTGA 4LXYA 5CDFE 3ZDRA 1GAWA 4YRKA 3NJ4A 3R4VA 1SULA 2EBHX 1FNBA 3QX7A 1HI9A 1Q0PA 2ZSIA 1DBSA 2IPMA 4ZZ2A 2C4KA 3KQLA 3ENWA 4FJ1A 4WGFA 1LLQA 4OQDA 4S2EA 5HJ5A 3BCRA 5BN5B 3OC6A 2R00C 1W36C 4FFNA 4JHXA 4EBBA 1XNQB 5DI3A 2WNIA 3EDYA 4QVGA 4YNBA 3COWA 3W2EA 2GRJA 2W6PA 4Q3KA 4ZU3A 1JKFA 4OQPA 1L1QA 5CB4B 4DVJA 4ENUA 2DM6A 1O8BA 1G8GA 1Z06A 1LUAA 4IVNA 4NHEA 4M6WA 3KR1A 3NBYC 2JAQA 2HIHA 4Y6RA 4ANFA 5JSZA 3IQDB 2IA5A 2NVUB 5I7RA 2O3JA 4XLTA 1BHO1 2WAYA 5L7TA 1GG5A 1WCV1 2Q1SA 2Y71A 1QIIA 1HT1E 2ISSD 1BQEA 2KPOA 4AJIA 3L7NA 1KK3A 4N9WA 4A0HA 4QBKA 1AN9A 3DXYA 1LGYA 4IHJB 2E5LB 1N9GB 2VP6A 2XWQA 3GFBA 3NKFA 4I9GA 5KYUB 4JV5B 4JP1A 1RRGA 2OV8A 4RJTA 1PT8A 4NAVA 4RNDB 2ZSEA 3G13A 2AD1A 2Q4OA 2Q8PA 1X3LA 4MS1B 5F52A 4OAPA 4BGIA 1HDCA 1OXKB 1AZSC 1IB0A 3ZGXA 3D31A 1R0YA 4AWBA 2ZUBA 3WLIA 4D56A 4EB8A 1E1KA 2R1VA 4FVTA 3G68A 4O8ZA 3TINA 2C9OA 3Q3IA 4ZHQA 1UQUA 2O19A 1EA7A 3EGOA 5E4TA 4BJ6A 3U19A 2G67A 5IZ4A 4MKHA 4ARAA 4UTXA 4KN6A 4TT8A 4P0TA 3M6UA 4R8MA 3DL0A 5CYFA 1HNZB 5DEOA 2VYVD 4D44A 1KH2A 3DAHA 4XB2A 3AOEC 4DLRA 3ZE2B 2I34A 3CPSA 3GLFE 5HIJA 1BU5A 3U3MA 4KFCA 5JXGA 3TB6A 3FH0A 2YFHA 3KVYA 4TLEA 5COBA 3T7AA 3VR4H 4C2BA 3LT2A 1RQ7A 2OEPA 3MGCA 5F7ZA 1PL8A 5KNCH 2UUCB 1OBCA 2ZUCA 1Q2UA 2PL5A 1K7CA 2OBBA 2BKXA 2RGDA 1C9DB 1IIBA 2IE8A 4BLSA 5ALRA 4BVFA 4HVLA 5H68A 2G80A 5J4YA 1P7YA 2P67A 2ZJAA 4DIKA 4WFJA 4A2PA 2ZXEA 2YYSA 4WNIA 3MJ4A 1N2HA 3NIFB 3CGGA 3KTAA 3NWEA 1ZR2A 4Y2RA 3OQ6A 4GYKA 3JAKB 2EFGA 2YNMA 5EQJB 2OVFA 3MK31 3DB1A 3TK1A 1QIEA 3TQSA 3KRTA 3AB8A 2EJTA 5CNJA 2Q1XA 3LXRA 3RRZA 5F9HA 1O95D 4NATA 4XDGA 2JCYA 3GJ0A 4YUXA 1AHPA 3NHPA 5JTUA 2GM4A 1BGWA 2PA0A 1H85A 2BFDB 3F5FA 1YAHA 3BXXA 1ZWKA 3E3LA 4J0EA 2PEZA 1U9IC 3OIUA 4UBKA 1XQ1A 2PX8A 5IZCA 4IDCA 2ODWA 1MEOA 1O7JA 2Q4RA 2XZPA 3PPWA 4P4SA 4YLYA 2CHFA 4J43A 1QLJA 1GA4A 5FJIA 2XCQA 5FWYB 3K72B 1AS0A 2X4IA 4Y6SA 5CG2A 2IU6A 3SC3A 4OB6A 4Q3LA 4C43A 3UUGA 1PFQA 4MVJG 3UJ6A 3N3BC 1DRUA 2Q3DA 1UZNA 1WPRA 1J49A 4GGPA 4LNUA 4YRMA 3IQEA 1H8EA 2Z08A 1YIAA 3GA5A 3N07A 5TE9A 3GOQA 3URKA 2EP7A 3TJZA 4NBVA 4MUAA 3DZKA 3V2UA 1N2CB 2WUEA 1K8XB 2PS1A 4Q4HB 5LXTA 1LRKA 4G09A 3K4HA 2RDMA 4XD2A 3VSBA 4DDWA 2X7JA 1C1XA 2GMWA 5DWDA 3UV7A 1BTOA 2PUTA 3BUSA 3DLPX 3CF4A 1PFVA 4QECA 3UXYA 4HEHA 4A0RA 3GX1A 4JSRA 4ZRMA 4CEIA 4WKOA 3QIVA 3IDZA 3IE0A 2VRBA 1SOVA 1TQ6A 2HA3A 1E7YA 2PGIA 2Z4RA 4QREA 3C5EA 5TEWA 4UHBA 3N2EA 5EWJB 4F3YA 5EIEA 5HOEA 5JECA 1QORA 4NENA 1RMYA 5JCXA 3ZLJA 1MB2A 3G2PA 2C9CA 2VKTA 2C84A 4XM0A 3PTAA 2FDCA 2R2AA 2ZB4A 2GR9A 4K9PA 1JVBA 2D54A 4H3SA 3RHSA 4ND4A 1JR3D 1EB9A 2WZBA 2FCRA 4BLVA 2JL1A 2ZJYA 3A3OA 4G84A 4LHSA 1K5GA 1Z4NA 1KSGA 1MTZA 1AY0A 1U7UA 3TGLA 4I8DA 4NU0A 5EIWA 3VAZA 4ES6A 4BB9A 2YVLA 3PLRA 1GKUB 4JC8A 4BYGA 1QDUA 4ZDJA 5L3VA 4KUEA 2ABWA 4P3NA 2CCJA 2CNLA 3K5HA 3QEAZ 2DTEA 3EBPA 2BEKA 3HDYA 3UHFA 4JI0B 1XPUA 2G82A 2ECPA 2ZRAA 2OLJA 2UAGA 3KAKA 2Q7XA 4JVNA 2GVDC 1YOBA 4J1NA 4K6CA 4KRGA 5AJYA 5TSDA 5LZ9A 4C76A 4RJ2A 4S1VA 3BIOA 3DMPA 4I7EA 4MHOA 1Y7LA 4I1RA 5GONF 2CCKA 3OUUA 4X9XA 4B5LA 5CFLA 3KJEA 3PC2A 5EJGA 4GO1A 4KFTA 4B8YA 3IDQA 4D7AA 3F4KA 4C6SA 1S2LA 3VR4D 1QOQB 3PIIA 2AMJA 4FYHA 2PTHA 3C70A 3OH8A 3DLBA 5DTMA 1DQPA 2A0FA 3F47A 2XUFA 4B3SB 4LF9B 2DP4E 2W37A 1CXZA 4JLJA 4RIEA 5DSZA 3WISA 2EV9A 4EI8A 4RIIA 1QO9A 3JSAA 4PO1A 2Y0DA 2DCUA 2BZ1A 3C6MA 2B2CA 2JJ8A 3M6IA 1A69A 2D7CA 4OFWA 3GEDA 4QUAA 3VYWA 1MUUA 3O2QB 4WL0A 2COKA 4TRRA 4UAGA 2JFUA 5GZ6A 1LRLA 5AXCA 4HQRA 1ADFA 4ZOLB 3AIOA 4FZJA 3VPSA 2Y4NA 2BZ0A 4UHKA 3NLLA 4UZSA 1SBYA 5HKKA 1PZGA 2OHVA 2FWBA 1Z2NX 2UZAA 5C4GB 1JSXA 3JSXA 4CIXA 5BNTA 3F98A 1OT5A 4IH1A 4J0HA 1TFUA 4JYBA 4D8UA 4BXOA 3BXFA 2CBGA 3ZKAA 2AI1A 3SYMA 3SS9X 1GT91 1XA0A 3MJTA 3UFXB 3BMNB 5CDFA 5IFKA 1IRIA 3ESCA 1Q74A 1RJEA 1J1UA 3JQAA 3FJOA 2QR3A 5JEEA 4OGGA 1V5IA 2YBEA 4Z54A 4B3GA 1FB5A 1QCYA 1U3DA 3CF2A 2X58A 2AN1A 2FX2A 3ACDA 3BCHA 3FAKA 3OT1B 3TZKA 4B40A 2OQVA 4BNUA 5IJ9B 2PT7A 4CM8A 1SC1A 3MB8A 1NBAA 1W9HA 4GYWA 1A7KA 2QTZA 2WM2A 1T25A 3IAS6 2PZLA 5DHFA 3B1ZA 5KWVA 1Z5ZA 1MJGA 1ZK3A 4M49A 3D3EA 5K8CA 3TLMA 1TE2A 1TNDA 3PE3A 4HAZA 1L7VC 5AW5A 1TTQB 1SU7A 2W6JA 1MP0A 3D6TB 3EFHA 4A0FA 2D2IA 3DE3X 4GMGA 1RJGA 1SO8A 1XMVA 3DYIA 5H5JA 3TI9A 3FMVA 4RLHA 5LP6B 3CZRA 4QBTA 5JBQA 1UT5A 3AW9A 4QUIA 1JLRA 4DV3B 4HXYA 2FQQA 4QDZA 3X1YA 5DNVA 4MQEB 2DETA 3UOWA 5BSHA 4MLPA 3CTMA 2AKEA 5LYYA 2F9LA 1OX6A 5BWBA 5IG2A 2OXCA 4BVJA 5FOWA 3W79A 5FA5A 3WDSA 3ELUA 3SQDA 4WN9A 5CD1A 3L02A 2P9TA 3BXEA 5D86A 3WGIA 1N3LA 2JEZA 2QLMA 3GD5A 3GGJA 3W2HA 5CK4A 4M1OA 4YAWA 1K92A 3TSAA 1ZG3A 4ZEXA 4O0LA 1E2DA 4X00A 3V8PA 4QDTA 4RY9A 5BWLA 1JXQA 1NLFA 4L07A 4DWJA 3QVGA 4EFMA 2CYCA 5CVEA 3S2IA 4KGXA 4B79A 5HOQA 1OJ7A 2VYCA 1FSZA 4I1VA 4MB6A 3RUIA 3EUWA 3E70C 2BM9A 2PQ2A 1WOMA 2WU8A 1M75A 4OB8A 1TF2A 5IBRA 1J2UA 5ALTA 3M1YA 4FEAA 4D41A 4D45A 5CVJA 1RKBA 1CEEA 1YS6A 4M8LA 1IZ8A 1Z08A 5ECDA 1D2RA 3TZ6A 2I6TA 3T12A 1L5ZA 3CUWA 3EPPA 3GN2A 3C4QA 3UNXA 3WVNA 4D3DA 2P2CA 3LCRA 2QMOA 3AVYA 3I9V1 4RK7A 5K8VA 2IWRA 2KHZA 2F2TA 2I99A 4BEBA 4YS6A 1XDUA 1XU7A 2GI4A 3P2JA 2XB9A 3IULA 2ODEA 1FDOA 3DV9A 3VI3B 2I6SA 3EIWA 4G9GA 3AVQA 1N5MA 5BR1A 3K5WA 4L5IA 1XTIA 1TM5E 2G7MC 3DONA 4B31A 3FHJA 4MP6A 2PX6A 4RSGA 2WYVA 2HF7A 4OJMX 3S44A 1WQ1R 2OUKA 4B8ZA 5A2GA 1V4VA 2D5IA 1Z6ZA 4OATA 4I50F 4YXWD 1V26A 2BFCB 3OD5A 1EHIA 2C8VA 1QTIA 1YHYA 2WWIA 2DWUA 5ALSA 4HN9A 3UAWA 4D8WA 2OZPA 4GX5A 2ID4A 4WLNA 2C2MA 4Z49A 2PLWA 3M4XA 4FDMA 2X4GA 4JOBA 2IZZA 4EA6A 3OBIA 1V1MA 1L5VA 3H5WA 3TZBA 1KI9A 1J33A 3HA7A 4IW3B 2ZUVA 4Q01A 5D3KA 2GVZC 1CUJA 3GVCA 2ODBA 4UBOA 3AFGA 1RQLA 1U7HA 5ER6A 4V1CB 3U09A 3WP0A 1X42A 1JIUA 3HWX1 1L5FA 4N03A 3RS4A 4BU0A 3R77A 3SS8A 4HRVA 3JQEA 4RV5A 2BGLA 2NT3A 3PKZA 3H2HA 4UMVA 3AVTA 2ZSUA 4G36A 4WKPA 2BRUA 1ACMA 1LB1B 4QEZA 4WK2B 5C0OE 4HFNA 1MQ9A 3NV9A 2QTTA 2VC2B 1SOUA 3Q8XB 4B81A 5ALFA 3R9KA 3MAGA 1JHOA 1L7NA 3LBNA 4RF3A 1EG7A 1X39A 1EFPB 3WBKA 4H6VA 3L8GA 3A6KA 1DO2A 1G4UR 4KH1A 2J09A 3EZFA 3P2MA 4QLOA 2ZATA 4BZZA 5DISB 1DL5A 2BGGA 1W34A 4K9DA 1L7QA 2R7MA 4N6GA 1E0SA 3I4FA 3WE7A 4BNXA 4UOZA 3D8UA 2OUIA 2AWOA 3MTBA 4MIYA 4M0CA 3I5XA 1I6KA 3VGPA 3QHAA 4XIIA 3DVSX 4WCFC 4IDQA 1ZXXA 3G9ZA 2HDHA 4LVOA 3MILA 5AKKA 5SICE 5L4LA 4DC9A 2GJKA 4L4ZA 4RXTA 1T43A 4HEA6 5KOYA 4CNQA 1G20B 2QUJA 1P8JA 5DCUA 4P5DA 5KREA 1KO8A 1O58A 4UDYX 2Q0SA 5BSGA 2DPYA 3FBTA 3GHHA 4AICA 3NBQA 1UK6A 3UBMA 2W6IA 5F5XA 2XKJE 2O0JA 3BULA 3IIKA 3EF3A 2PANA 3KOUA 3C7TA 2CLSA 1X80B 3AT1A 3N7TA 2Z43A 3OE7D 2WJWA 2XEDA 3MMXA 3QITA 4KGVA 4UXIA 2YOGA 4UVHA 4ZT2A 2Q0XA 5FD8A 3U7IA 4ETWA 5FLYA 1GR1A 1Y6GA 2H2GA 2V98A 1ZD1A 4HLNA 4QRHA 5ALKA 3AEUA 3JQCA 3O7MA 5C37A 2YL2A 2YQZA 5DIFA 4PVDA 4YTEA 1ISPA 4IHKA 2EZ9A 2YJZA 1AKRA 4FZRA 4OY3A 4PLPA 4F04A 2PL1A 4DT1B 4GWKA 3O4IA 4PLHA 2DJIA 3NZEA 1B8PA 1ZAYA 1U5BB 2GPAA 1Z0IA 4I1UA 4WCFB 1E60A 4HDSA 4CM5A 3KKMA 4DRYA 4R98A 4CF5A 3IPLA 4BLPA 1AM4D 1YZKA 3LCMA 5JCZA 3PD7A 4UREA 1RXEA 1TQ4A 3BTVA 4L9WA 3L18A 2R6R1 3RWMB 1QV9A 2WIDA 3WSTA 4A03A 5M04A 1VZ3A 2IIVA 2O07A 1KMMA 2GBPA 2Z2ZA 1TGVA 2NXWA 3JQ9C 4EB3A 2HR1A 2CLDX 1ISGA 1QF7A 3FCXA 3KS9A 1OVMA 3VR6D 2A5GA 221PA 2OM2A 1ENPA 2IH2A 3C5VA 2Z58A 1G8HA 3ADCA 4HPJB 2PKXA 1LPMA 4YRRA 3EWAA 1ECJA 1RZ3A 2B37A 3NWJA 1WXXA 2CK3D 2GFHA 1I1NA 2HK7A 1UJ5A 3NWOA 4I55A 3EXHA 4OH1A 1LNQA 4CGYA 4EKIA 2XV1A 1XCOA 3CLSD 4URUR 1NY5A 3QLVC 2PG3A 3SYLA 3HP1A 4F2WA 4C4ZA 4ZCMA 1H65A 1S96A 2O7QA 4G67A 1P39A 1ID1A 2EZUA 3KU1A 5FL7A 4J0CA 4YONB 1SVSA 3UUFA 4ZV4A 3OFJA 2H17A 5CB6A 4D8TA 2W2XA 3VZBA 2JLWA 1S8OA 3DDNA 2OHIA 3QMWA 4FR2A 2ODQA 1HKHA 2G71A 3EZ7A 4L27A 4LDRA 4XFJA 4DEXA 1JAIA 4QXRA 4C7VA 4K5QA 1EFUA 3Q8KA 4N5NA 3LOQA 3EG9A 3CLUC 4YUWA 1ZUHA 2VA9A 1NYLA 1DX9A 1JJAA 1R15A 3VDMA 2GAFA 3HY3A 2FB9A 4FKMA 5AKYA 4B7AA 3QKRA 4EPVA 3STHA 3BTOA 1A9YA 1JFSA 1BMQA 4IJUA 1RQNA 1ZL0A 1UFKA 4GZ3A 1YRYE 2B2XA 3EXEB 4GPZA 1G4HA 3L5KA 4BO0A 2E6UX 5ADVA 1AT1A 1NOJA 4EFNA 2R44A 4CETA 3OSUA 1G5IA 5LNK1 1P2SA 1KETA 5TDHA 1P3DA 1W88A 3DL4A 1P62B 2ZT7A 1G21B 3N6VA 4JB3A 3H86A 1Y4UA 4QFBA 4JROA 5LCXA 5E4YA 5AW8A 2FQYA 2Z56A 4PSDA 3TRHA 4GPAA 2FKAA 1SCUA 3GLRA 3KQWA 3K9QO 4A2CA 1QJ4A 1NZDA 1V48A 5JG7A 1WDLA 4LY9A 4TL8A 1G6KA 2CJFA 1OH8A 3E9MA 5TQ2B 2Q6LA 2UVQA 4IDBA 1YZFA 2YCBA 1U1EA 2CLFB 4EKYA 1GRQA 1RC8A 2CVQA 2G9NA 4N7RA 4EOGA 1T5LA 3DV0B 2VT2A 1NM5A 4JMLA 2PYZA 2WT4A 3QVOA 3SEAA 2B9EA 3LWBA 4HAUA 4RKFA 1N32B 3K4PA 2HWUA 3QBTA 2CWWA 2HBZA 1QZUA 2REQA 3IVGA 1FX0B 8MHTA 4KO8A 3DVAA 4YJ2B 2XCSB 4FLFA 1FFXB 2YWHA 4HYQA 2RSLA 5JAOA 4EARA 1Q3HA 3D7NA 2OYRA 1HT3A 2KJQA 2LR0A 2ZBDA 4H4EA 5K8TA 4CR8A 5CFPA 2JRLA 1KRHA 1B8OA 3AR2A 1CVRA 3OZUA 4GPD1 2QI9F 5DWVA 1LX6A 4EGQA 1SQSA 4Q7QA 5IVKA 1SUIA 3L0SA 4GFDA 1JHQA 2H7YA 2NYVA 3C3JA 2BTQB 3MLBA 4LYDA 4OLHA 3HYNA 5AJTA 1Q7CA 2MINB 3EEQA 4RKYA 4TVSA 2PUAA 4RANA 3ZW9A 1QRTA 3E8SA 3EZGA 3RFTA 1GA1A 3AQ4A 4X1IB 2X40A 2Y0EA 4J4TA 1RRVA 2I33A 3WY9A 5F4ZA 5CHYA 3E48A 2XMZA 1A77A 1SG9A 2XMBA 3GJSA 1SURA 4MEBA 5JJCA 3H4VA 2ZYDA 2H1WA 3NDIA 3UK6A 5HIAA 4AP5A 1GTZA 5AKJA 1OMOA 2CVHA 1W4LA 3BXGA 2CXOA 3PUKA 3O92A 3DMRA 3HO8A 3RK1A 2P75A 4NG4A 2XRMA 5KOHA 5EP3A 2R7KA 3OTQA 1MR3F 2PDAA 1E1NA 5AUOB 1CK4A 3R0IA 2WG1A 3BCSA 3G8CA 1JFTA 1C7FA 1ZLXA 1SQ0A 1BDJA 3FYCA 1BDIA 1BC5A 4IWNA 1ZH8A 4JDUA 1OWPA 3GD7A 2VDJA 3MINA 1YOVB 2E4WA 4Y0NA 3MS4A 4BEWA 5ED4A 5K05A 1RM3A 2JHGA 5JVDA 2NV2B 3QEKA 2G83A 5DTIA 4MINA 2X77A 3WQQA 4YP6A 2YZ2A 2W4MA 2D74A 4ZTZB 4GMKA 2FFRA 5D85A 1SVIA 1C1DA 1G2QA 2ZB3A 3D8SA 2OZLB 3G0DA 3MM4A 2OCXA 2R4UA 4GX0A 3VSEA 3D4NA 4B6EA 3W8RA 2PS3A 2VLBA 5B1EA 1ZY2A 3IV6A 4M1EA 4MB0A 1PW5A 3R0VA 3I9LA 4Q7JB 2AV6A 1UPBA 2XQIA 3GK3A 2XZTA 1PD0A 2QXYA 4N0DA 2CXQA 3T1QA 3TR0A 5JY6A 2NSDA 1TQDA 4L4XA 4U2BA 3M7IA 4UPDA 4FGZA 3VPXA 4F0JA 3VPDA 2EQ5A 3ITDA 3SHVA 3SKYA 3U56A 2NU8B 2Y1GA 3DBHA 2GYYA 5I4IA 1I30A 2ZRNA 3LHDA 4L22A 1ACLA 1PLJA 3OJWA 4TMWA 1ZMRA 3DM5A 4HY3A 5ECWA 4ZZIA 2C5HA 3QE4A 2JFZA 1BXZA 4PYLA 2JH9A 3BF8A 1K3UB 2VAPA 2ZZMA 2C03A 5I7WA 3GARA 3F4LA 2CFRA 3ZD6A 1VSTA 3QP9A 4FS3A 5JISA 2ZPAA 4PO9A 4D99A 4BASA 4W5RA 1U8TA 2LCFA 3QXGA 5L3RA 5IAJA 3DR3A 4CZ2A 1CFZA 4V2UA 1QCZA 1O4VA 1Q2XA 2G8NA 4JAVC 4D92A 4DCGA 4Z1MD 5CMLA 5KHLB 2HIGA 3PEWA 3IPCA 1Z45A 1KR2A 2W2MA 2ZJZA 3F3YA 3FX2A 5JSHA 4LV8B 2WILA 3NHSA 4EP1A 2ZI5A 5CDYA 1U2PA 3L0YA 4EO4A 4X93A 4BGUA 1MOSA 2IYRA 4BMSA 4TSRA 3KLNA 3V3TA 5KWSA 4F8YA 4L6AA 1AKYA 2OXIA 1SELA 1PCXA 2QV0A 1PJTA 5EJ8A 4D0GA 4ICIA 4WBNF 5HDBB 2A30A 3FKSA 4N5HX 1PWEA 5H8WA 3OO1A 3RYHB 2IW3A 3LTEA 4DN6A 4OO3A 4LE0A 2QRQA 2GNOA 2OAEA 2Q9BA 3OQIA 5BY2A 2QOEA 3GZNB 4L4YA 2HMUA 3OKPA 3ILYA 1P1BA 2BMVA 3FCAA 4WEQA 1OA0A 2COEA 2FJUA 3W3AA 3DEFA 3I8SA 3RC8A 3L9WA 4IZIA 4EATA 4U7HA 1JX6A 1QYCA 1JKXA 2XUGA 3PQDA 4RTSA 4ROSA 1I2AA 5CJJA 4E4RA 1U8FO 2GAAA 1H9AA 1IZ7A 1FTSA 4C87A 3OOEA 3WTCA 2XHEA 2ZBVA 4DUYB 1K88A 1HA3A 2BUBA 1AF7A 2XDAA 3AY7A 4B3IA 4YUYA 5LZ4A 3L5OA 4ZYLA 1YJ8A 3GVXA 2X86A 4HRXA 2JGKA 5K99A 1A5AB 1WUIS 1COWD 4W5OA 2P2ZA 5EYPA 1K27A 1DAFA 2FPWA 1G3UA 1M3SA 4G5YA 5DOZA 4Z4HA 2HQRA 2DFDA 4HH4A 4DQVA 1IQUA 5KTOA 3B5IA 3VVCA 1Y3DE 3JS5A 3LU1A 2IYZA 4M1TA 3WRWA 4DFDA 2QORA 3ZDDA 4E6PA 2GM3A 1COZA 2ZR0A 5KU7A 1YQTA 1W36D 4AD8A 3CH4B 3GDHA 5HTKA 2C94A 3PDCA 5IAEA 5JLAA 5KQMA 5I48A 3GGDA 5E9QA 2V0GA 1P74A 1MVLA 2ANCA 1YL5A 4FCCA 1E9BA 2QRHA 3ROEA 5F9FA 4WTOA 5FF9A 1JXMA 3UJDA 3FOFC 4BQEA 1YC5A 3ZQKA 3A6DA 1RM0A 1K6JA 4N3CA 5E2BA 3IEKA 5GONA 1EMDA 4OQFA 2ODTX 1ISMA 1YI1A 4UBLA 3EIUA 1HC7A 4HGOA 4R16A 3O74A 5AVJA 2VQFB 5BNZA 1PT7A 1X7YA 4NFHA 4W1PA 5CA1A 1AKNA 1SCBA 3HBFA 2NSYA 4MX8A 4D6PA 2XSZD 4AG5A 4IVRA 5LOVF 1HLGA 3P9PA 1ZSYA 1MQAA 1MV8A 1U0NA 4PAGA 3C14C 3WNBA 4CEHB 3IP7A 5HK8A 2H00A 2A0XA 3PXDA 5CBKA 1KY2A 5M3BA 1DC4A 3BK1A 3CUYA 4TLMB 2ENUA 3TR5A 3CVUA 3U44B 5GJBA 4ZI5A 2BW0A 4X54A 3LFHA 5TPWA 2C2OA 3BDAA 1G8SA 4DT1A 1TM1E 2X8WA 3AUUA 2GJAA 3OY7A 1ORTA 1QOPB 3LW7A 4JYMA 1FP2A 3O75A 3JWJA 5MFPA 1CRQA 5ALXA 1MXFA 5DNAA 3L7CA 3UKJA 5C8VA 1KU6A 1NF8A 3PYMA 4L76A 4Q18A 1EI9A 5HHTA 3QOWA 1MAAA 3KO8A 4IOKA 4B35A 4TSFD 4BMVA 4OCZA 5EHGA 3FJYA 2PGAA 3H83A 3SBEA 5CLGA 1R0BA 2YX1A 4JI6B 1SXQA 4KH0A 1L7PA 3UMBA 4OQEA 1PQ4A 2WU3A 1ZNYA 1A2OA 3ISJA 4H17A 3OP1A 2OCKA 3SX4A 4AS2A 1DELA 2BEUA 2VDPB 4L0MA 3IUBA 1KP3A 1O87A 3MN1A 2VR1A 2FPOA 5HILA 1JDPA 3T1TA 2C83A 3E7FA 4B09A 2FP4B 2VVTA 3PJDA 4BC0A 3VUFA 2Z09A 4KXFB 4UCXA 1C4XA 1PDOA 2WF8A 2JAWA 1DQZA 5EJEA 4ZVLA 5KVCA 1R6DA 3P19A 1JE1A 3Q9NA 1S2IA 1X1EA 3T8YA 1ZOOA 2ZS8A 4Y6LA 2YV4A 1E9VA 2ZEJA 2IHYA 1GEEA 1SVLA 5HKAA 3DL2A 3QYJA 1NHWA 1M2EA 1YKSA 2YHIB 3AU8A 1GD1O 3CNNA 1Y3CE 2HRBA 4OLJA 4BLRA 2UZ1A 2VRNA 3GP3A 2M6KA 5KVVA 3WK6A 2JLVA 2IEYA 1TJYA 1TTPB 1JMYA 1WD7A 4O4JA 3JAWA 4FLMA 1C2YA 5DLEA 4CLOA 4I9HA 2OKGA 1UJ6A 3VSDA 4JXZA 4PQGA 4R8RA 4X1OA 4RHUA 2HLNA 3HKCB 1ODKA 4IH4A 4CR6A 1NVEA 4TN1A 4JP5A 3B5JA 3NIDB 1CBUA 2VBGA 3LPNA 4MWSA 3L7YA 3WIUA 1OE0A 3W8FA 4Z51A 3OI7A 5BMVB 4YAUA 1QU2A 1VG9B 1GQYA 4R69A 4MVXA 1DMRA 1PF7E 5JE8A 1B16A 5K4AA 3SU8A 3FPSA 1HFKA 3K2IA 4ZU1X 4QYSA 1NXTA 2R87A 3WK7A 4OBWA 3THYA 5EXDA 2BH9A 3ENKA 1XAHA 2IKQA 3R23A 1P31A 4L7QA 4R54A 1RWQA 1KFEB 1XWFA 3OHPA 3WGKA 4C0QC 1R6AA 1N8TA 1T0PA 3A1UA 1SQFA 4X1YB 5ENVA 4W5WA 4Y9UA 2IV3A 3NAQA 5JCOC 3IEUA 2X23A 1PQWA 2ACWA 4YJGA 4RIGA 4MWTA 5IUNC 3HVJA 2ECKA 3INNA 1LRJA 5F3DA 4B73A 4CMKA 4U2KA 1KMHB 2BBWA 3DNFA 4AM8A 3QXXA 3R74A 5TGTA 1QGUB 4FJ2A 1IWPB 4UFOA 1EG2A 2H1LA 4A92A 1N3IA 3BICA 4GPEA 3WKAA 3R3WA 1Y8RB 3KT8A 1OX5A 1TJ4A 3ETHA 1MLDA 3ZLTA 1T3GA 3B9QA 5IBPA 1G1MA 2O1WA 3QVXA 4H15A 3IH5A 5HNKA 1YVDA 3DBOB 5ARCA 2B25A 5FQNA 5KYYB 2GTHA 4MRPA 1R4MA 3MT8A 3QWHA 1J70A 1G18A 1ZU4A 3I28A 3I6MA 4FR5A 4KVGA 3UO8B 4BCBA 4EPTA 1JPJA 4AQ7A 1N25A 1VSVA 3RRXA 4MGIR 3VZCA 1XIVA 2AYZA 1HE8B 3QQPA 4GUDA 4L0QA 5E0OA 1VE1A 4C7OA 2AUMA 5ALHA 1GKIA 4QPJC 3E03A 3HXLA 3SNHA 1IVYA 1CUYA 1W85A 1DX6A 2QP9X 3B36A 3PEFA 4FZ3A 3RSQA 3AVVA 4NBWA 1Q91A 3IELA 1C9NA 4ZDIA 1DBPA 1OGIA 2A94A 2PZAA 2BI7A 5JO0A 3LUCA 3TBFA 3ETJA 4LV6A 2G77B 1Z4MA 1WXGA 3JQGB 1UK8A 1H9BA 2QPOA 5DXAA 5AVTA 1TCBA 2P79A 1WA5A 5BSMA 3PNPA 5JZOA 1JPVA 1ZS9A 5KAPA 4QHYA 1KEEA 1FP4A 1JFFA 1JH8A 5JNLA 1EQUA 4LYHA 4DW8A 4C4SA 3D0OA 4ILKA 4J7UA 4KYTA 4RIFA 3UWSA 2PSDA 3DBLA 4WZBB 5TF4A 3VO2A 1QHFA 4HYYA 5DYTA 2IKSA 2QLFA 4Z7JA 2GZAA 4WJZA 4C7OB 1IXKA 2CDNA 3RVKA 4YC7A 2Q0QA 3UFXA 1ID8A 1JHRA 1Q7BA 1QE5A 2BFEA 2C2XA 4YUZA 3HDHA 1HZZA 2FEOA 2ZK7A 4LJYA 1NR7A 2DBVO 2WFZA 1NBIA 4XWOA 1K7SN 4PQYA 5FFMA 3TLGB 3PRJA 5IJZA 1IY2A 3QHQA 1IWBB 2RAFA 5D84A 3P1JA 2W4QA 3TF5A 1OAAA 2FUEA 1WX1A 1YDFA 3NOXA 4MYSA 1VSQA 1KEVA 2ZIAA 1YZNA 2D5CA 4H7HA 4HK4A 4AKTA 3U7HB 1ZI9A 2CDRA 3WNVA 3F74A 1WB4A 3HCEA 3HJCA 2ZETA 3A9SA 2V3CC 1T1GA 3SZMA 1JA1A 1DHTA 2JNWA 3JWIA 4PZAA 4B6SA 2PKQP 4RMNA 2GT1A 1XZEA 1JR6A 2C4WA 2MSDB 1JJVA 1SEVA 5CT5A 5TY0A 4B3XA 1QG2A 4OMFG 5K3FA 1DTWA 1U1IA 3BIFA 3KEGA 2HB6A 4HLUA 3P5BA 3F6RA 1GPBA 1QR2A 3WIBA 2J9FA 4E1VA 2EJVA 3GMTA 4RDHA 3V8VA 5G4LA 2PH7A 1T4CA 1Y6FA 4BNFA 1Y9JA 3ZE9A 1B6TA 1E79D 4BUJA 3KR2A 3FTFA 4PNZA 4Z2AA 1BGXT 1P0FA 2HRRA 3DHVA 1ZESA 2PT6A 3A2NA 4GS5A 1YZYA 3PGLA 4YT8A 1U3TA 9MHTA 4P9NA 2CNNA 3OCZA 4KV7A 3L4BA 4GX2A 3Q6MA 2JI6A 2GA9A 3OWOA 2YHIA 1G8PA 1YCDA 3C8ZA 2NO6A 4GSYA 1Z6AA 3HWSA 5FBQB 3SEFA 3ZOZA 2JFNA 3SS7X 3LWNA 1O6BA 4DNOA 4JLKA 3OFNA 3GT3A 3U3RA 1Q16A 2JFBA 4XWAA 1L7BA 4Z0NA 3NYIA 3MJHA 2A9OA 4B33A 4KKVA 1G5HA 2E4AA 4IKPA 3ETCA 3VKFA 4ESHA 5ARDA 1YMQA 2R4QA 1WDTA 2QSJA 3EDRA 3IJ5A 2VQ6A 3DAPA 4WKCA 2H7CA 3NHFA 1LCIA 4OA5A 1JJ7A 1A82A 3A8TA 4AZ0A 3NI2A 4L8YA 4BDSA 5B4TA 1VKJA 1XAIA 1YAJA 4UUAA 4CVNA 2H07A 3M5DA 5A6VA 1KWKA 5C52B 2IS4A 4NBKA 4NZOA 4PG4A 1SUAA 5CVTA 1KGSA 5HDQA 1ZGHA 4DMFA 1YBMA 1TMOA 1E1QA 2QYOA 3RVDA 3T3HA 5A9SB 2WTNA 5GMOA 4KE9A 2GN8A 4L57A 1ZU5A 4MW1A 2AI2A 4DJ5X 4DNQA 1K8RA 4WDRA 2IYNA 1M8JA 1S02A 3IDFA 1MO6A 1NYTA 2A9RA 3AHIA 1PJLA 3IHTA 2QU8A 3I52A 4FW9A 4TTPA 5ITZA 2YY7A 1GUAA 2F7SA 5DHPA 5LKRA 1Y4ZA 3NYRA 1FP4B 2WJ3A 3FWPA 2NTYC 2GEFA 3GPDG 1Z3CA 2GPNA 5FWYA 1ZQ1A 5KTMA 2DQKA 3TG2A 1J7KA 4KP7A 5ALGA 3UH1A 2IPAB 1W4ZA 4JD5A 3O21A 2YV3A 3AO0B 3A04A 4CL2A 1GDTA 1KOLA 3EGCA 2VQSA 3CLRC 1DX4A 3L4SO 2Q3BA 2GYUA 2J9ZB 3OPNA 2XMSA 1ZISA 4LJ6A 1EGMB 1ESEA 3DWIA 1B6GA 5FOVA 2C1EA 4Y0VA 5GJCA 3SVLA 1X74A 3M1IA 1H1DA 3K94A 1YQGA 3Q2OA 4MPJA 1KYYA 1L7EA 1U2SA 3JAKA 3PLNA 1V37A 1LDYA 4HRAA 4KVAA 1P5RA 1XK7A 2ILTA 3L8MA 3RARA 4QGAA 1G55A 1WMDA 1ONNA 4GU5A 4M88A 5GY7A 5C7OO 3VTKA 3QE2A 4Q48A 3R9IA 1GZVA 3JRWA 1GAQA 1K0FA 1DG1G 1JBKA 3DLAA 4N8SA 3OEED 4LJ5A 1GUFA 4YCDA 2UZ4A 4ML3A 4MKZA 2AOTB 4G1CA 1C7JA 3PE6A 4IXMA 2WP0A 3MSCA 3G23A 2L82A 4FHGA 1Y1PA 1Y7IA 5BWMA 3UVEA 4JJIA 1Q44A 1MW9X 2QV7A 3DWFA 4L8FA 3QMVA 4QZVA 1B8VA 2CJYA 2OO3A 5KSPA 1JU4A 3CZ9A 1OQAA 2ZUUA 1MAWA 4IUDS 1UBRS 4NNOA 4G1BA 3CX8A 3DZJA 3OETA 3AUXA 2P6OA 3DC2A 4LWPA 4HSGA 4WNYA 4B4KA 2WDZA 2V7UA 3P9NA 5A4KA 2HA7A 3G0HA 2YIVX 1BXKA 4O8CA 5EJ7A 3GLGA 4NZMA 1W8DA 1Z74A 5EG5A 1T5SA 1ZOPA 3QQ5A 1IHYA 1EX6A 1Q0ZA 4QXOA 4YAFA 4D4LA 2HRZA 5FPQA 4HH0A 5KTSA 4QYIA 4B3RB 1FYDA 3SDSA 2CT8A 3TQQA 2JKZA 2NTEA 1HGXA 2XAUA 5HX7A 5DXFA 5LZ8A 1RW4A 5D5QA 4ESVA 5T6MA 1MJNA 2PFKA 1A8PA 2OD9A 3LUGA 4OBEA 4YRJA 5FFNA 3G9XA 5L9AA 1BIFA 3WMFA 1IONA 1WDMA 2EF1A 5DT9A 4JOSA 3LVFO 3QPWA 3H5IA 2VAWA 4GLOA 4V24A 5HMLA 5D2CA 3QE3A 3SC4A 1FTYA 3P2OA 4QUKA 5DYIA 3W8EA 3FZGA 3KOXA 4XTRA 3QPCA 4AIRA 5EE9A 4F3RA 3GLHA 2GD6A 4NESA 3QKTA 5T8KA 5FORA 1FS4A 1K0UA 4CJXA 3WZLA 4G26A 5IK2D 3MTQA 3HL4A 3HU2A 4PGAA 3U2QA 4M9XA 5K0CA 3N0XA 3OEHD 4P0QB 2Y1FA 1QVVA 3A7DA 2ZRDA 4QGHA 4KODA 2ZBPA 4X7MA 5IK2A 4NWIA 5C46F 3MUFA 5K9ZA 2K5UA 4Y2SA 1DFIA 1E3WA 2ZRKA 5CURA 1MTOA 2FN3A 3R0JA 2XOEA 3U39A 1NAHA 3R7WA 5FEUA 1QX4A 4ASUD 5I9BA 3LGXA 3KD2A 5IMSA 1PBNA 3EQZA 1A3CA 1BRTA 3RJ9A 2ID8A 4DLZA 3M5WA 3WYNA 4A6XA 2HF2A 4EENA 3MRXA 1GA6A 4MPRA 1ADYA 2AYYA 4MWZA 3S55A 2YCLA 3FDIA 4X3PA 3UAZA 1K63A 4QWMA 4W5HA 1AN0A 5H82A 1UOQA 4AP9A 3IVAA 3ORSA 3GLFA 1BS9A 1G9SA 3ZD9A 1XZJA 5B3AA 1WZ2A 1N3YA 4DDVA 1NVAA 2GF9A 4II3A 2N47A 2NZXA 3QFRA 3FYTA 4LX8A 2R66A 3CNBA 4O6VA 3VO8A 5JADA 4FNOA 3ZDCA 4DNPA 2B94A 2QR2A 2FPXA 4QT0A 2GAOA 2H08A 2BWJA 2ZS9A 5CU7A 3DBHB 4B47A 5KSZA 4ZVNA 5JD3A 5JV5A 5JZVA 1BAPA 4RCVA 4UUBA 2ADMA 4HX5A 3E3NA 1MA3A 3HWWA 2A88A 1RTKA 1SUSA 1LI4A 3B1JA 3OCCA 3M4NA 3R20A 4LAFA 2OVBA 4WGGA 4X1YA 2LD4A 4BMYA 1X1DA 5LLDA 4S05A 2O8CB 4W6QA 1HOXA 3UKDA 4ZK2A 4MICA 3JARB 1BYUA 1D2NA 4GPTA 1KQFA 3UT0A 3U4AA 1M5RA 4O2LA 3AEQA 1BZYA 1KHTA 2ZANA 2XDQA 2RC6A 2EL9A 4I99A 5EUCA 5FAXA 3ZI7A 5L45A 2D0OB 2H51A 3N05A 3BFJA 4RCYA 1P2UA 1DJQA 4E70A 1T9DA 1GV0A 1THTA 2VK8A 4AUNA 3ZKWA 2QTAA 2QUZA 2VG8A 1GL6A 3EVTA 4ZYWA 1D7OA 2F62A 3DDCA 4F6RA 4MRMB 4B6RA 1X9IA 1EUCB 3EZYA 1MF7A 2I29A