2D00A

Subunit f of v-type atpase/synthase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
MVPVRMAVIADPETAQGFRLAGLEGYGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVERLMRGRDLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a central stalk subunit F of prokaryotic V-type ATPase/synthase from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords V-type ATP synthase subunit F
total genus 32
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2d00A01
5KNBH 3VR6H 2QAIA 4IX9A 2I4RA 4RNDB 3AONB 2OV6A 3W3AH 5KNCH 5KNDH 3VR4H 2D00A 3VR5H
chains in the Genus database with same CATH superfamily
3PDCA 1KXZA 1HQKA 1DXQA 1G20B 2P0YA 2Q3DA 2ZYUX 3HE3A 2QSYA 3JVVA 2Y77A 4K9OA 2CDAA 5DTEA 3QKTA 4FGLA 5CM8B 4NXMB 3FTEA 4EFDA 3G2JA 2BE9A 3HR7A 4D3FA 4HQFA 4QGFA 7MHTA 1TGVA 3AINA 4N7JA 4E22A 1HQDA 1LTHR 1W19A 2ZUFA 4R1OA 4D5EA 5CLJA 3HGQA 5LWQA 1YB1A 4GIBA 3U9TA 1ZD9A 1ISGA 2GO7A 5DYYA 1GG9A 2ZJ8A 4HVAA 2Y1OA 3EEIA 3DEYX 3IP3A 3NIGB 5D5PA 4EG6A 5AVZA 2ZT5A 4RF4A 4YT4A 1EFKA 4LWZA 2ASVA 1VG9B 1A2OA 4W9MC 1P4GA 1L3BA 1RP1A 4FD3A 3DW3X 5IF9A 4YO7A 2W2PA 5JO9A 4QKQA 3KQWA 4DDTA 5EMHA 1WEKA 2PZAA 2BUBA 2DLDA 2IYSA 1SKYB 3PX3A 4ZKEA 5C9ZA 4NE7A 2QTVA 3AR2A 1D2EA 4R01A 2RKWA 1PVDA 4HP8A 4AS2A 4EX6A 5LQKA 3KS9A 4I99A 3IA2A 3ABZA 1EVZA 5HZKA 2IUTA 3ROFA 3ZIUA 5JSFA 2A59A 5B3KA 4ZHQF 1VPDA 3DP9A 4PZEA 1C29B 2ERXA 3B9QA 3EA4A 3MMZA 5G0VA 1PBTA 3U80A 5F2NA 4AIIA 3THYA 1G1MA 1ACMA 2JAHA 2O6HA 3IMEA 4C04A 1L6RA 3HRHA 5D51S 3WDSA 1SC3A 3QXCA 1OA0A 2W70A 4KCGA 3RSGA 1ZK2A 2PE5A 3AL0C 1FYDA 2ZBRA 3A6KA 4OQPA 1O4WA 3LVBA 3NRJA 4G0NA 1GZ3A 2AMJA 2H5IA 5ENVA 5CBKA 5AVVA 1DHTA 1SG6A 1XKTA 5GAJA 2DP4E 4YMHA 1ZHOA 1ZUNA 1NNLA 1DIGA 1IB6A 1KVTA 1XZQA 1JDUA 1YS1X 2I4NA 3I1FA 4IFBA 2GEJA 4UMEA 4JQYA 3SDSA 5U9CA 5B7GA 2VEOA 2Q6TA 3P19A 3NKFA 5LIPA 3G59A 2Y92A 2W6JA 1Z45A 1AURA 2GJSA 3E58A 3FDIA 1GQFA 4K9PA 4KPUA 1RWVA 4QBFA 5CNJA 4F1KA 5LVAA 3A25A 3GLFA 1P2SA 5ALWA 4ENPA 1AMNA 4WUVA 2WWGA 3R5HA 3N8KA 3E9RA 4Z0HO 5SV2A 4UXJA 2P1RA 3HKBA 1QQAA 4G4IA 3QUSA 4NEHB 4EY6A 2APJA 2O2IA 5JQGA 5IVPA 5DZSA 1L4FA 1R9GA 1TA0A 1RM4A 2I4TA 2VJDA 2ZDHA 3OEEA 2BFCA 4YRJA 3U3KA 4B35A 5LLTA 2V7QD 1N7JA 1E1QD 1Q6YA 2OHIA 4TM8A 4U9HS 4JODA 1PG5A 3ANLA 3OZCA 4D9NA 1JTVA 3IDSA 2D1QA 1SRRA 4DJ5X 4JI3B 4A0GA 4H18A 2CKDA 4PO3X 3PPIA 3INGA 4OM8A 4NYMR 2PTGA 5J43A 4MEJA 1F8GA 3L0OA 2CVHA 1UQUA 3K0CC 2OHJA 2RAUA 4OXKA 1W88A 2AJDA 4I3FA 3REQA 2ORED 5IHPA 3ANTA 4K03A 3LQQA 3MERA 4ANFA 4BCCA 5LMZA 1J00A 5BSEA 3CG0A 3HVHA 5JG7A 4KO8A 1F8UA 4EDFA 1K8RA 1SBCA 3LQFA 3NWPA 4DJJA 1LK0A 1ZOSA 3QLVA 1BHSA 1YWGO 3C3YA 4B2YA 4GOMD 4HUJA 2V03A 2O50A 3MTGA 4QBHA 2DXIA 1SHTX 2QL9A 3OX1A 1VRCA 2UAGA 4GX0A 2ANCA 2GK7A 5BOSB 2WFZA 1FW8A 2ZJZA 1EP9A 5I7RA 5BO5A 4KNWA 5JQGB 1MC4A 1OI2A 4JGIA 2SKEA 4R8LA 1Q6ZA 4QJ3A 2Q5QA 1V4VA 3KZ1E 3K2QA 4S04A 1LNSA 1XX6A 2BIFA 3L7MA 5NLLA 4M6WB 5ED4A 3R23A 5FI3A 3PT5A 4RFVA 1F2VA 4QXPA 1XQ9A 2MSCB 4GLLA 4TT3D 4M1ZA 4HDOB 4MWGA 1PFGA 2VWGA 1A9PA 4H17A 4Z53A 4G5OA 1AN0A 1QHEA 4IQGA 2JJ1A 1V1RA 4QTXA 3MINB 5B1DA 4EUEA 3B5JA 1KMNA 4V38A 4CCWA 3E6AA 4KE7A 3BTOA 1ZM3A 3JX9A 5HGJA 4CLXA 4F5YA 1YXMA 1X13A 3I2HA 2IPLA 3KPWA 2JEYA 2JKZA 3HC7A 4MRSA 4X00A 5DYWA 4GX1A 3GLIB 1XQWA 2WJJA 1P2GA 1WU7A 3HBAA 4UOQA 3JQBA 4R6XA 2ONJA 3BWXA 3O4RA 3FIJA 4X1YA 3B7PA 4YIKA 3ZE1B 2B61A 4ERNA 3HABA 1Z07A 2HPVA 4FYHA 3IODA 3X1XA 2GGSA 3FPAA 1J6UA 4PINA 3K9LA 1NQVA 1CG6A 4NCAA 3CRZA 2H1CA 2Y4NA 5MN4A 5C81A 1I5OA 1A0OA 2DECA 4QDXA 3V1MA 1KI4A 3VU3A 1E7QA 1K8QA 4P86A 4WRRA 5LJLA 4MPRA 1QRDA 4Q1AA 1BNCA 5HRUA 4D79A 3R0IA 1MNAA 3QKSA 4UXIA 3G0IA 4ZK6A 2P62A 2YYSA 4RK4A 2NU7A 1WS6A 3ETLA 3MJVA 1RYNA 4FE3A 5AJHA 2X0DA 2HTEA 1VLHA 3HJUA 2YKGA 1X1EA 2C8KA 4FFOA 4AJHA 1T1GA 2C2ZA 3EVTA 3JY6A 4V0QA 1BOOA 2PGIA 4LDJA 1MG5A 2CHUA 4YONB 3WDKA 2X42A 3JWHA 1R6DA 1K0UA 3QBTA 3SEZA 1RPNA 4O4IF 3AHFA 3HFGA 3PGA1 4M88A 4XGIA 3GEEA 4LCEA 4A9AA 7REQA 1ZM2A 4NSNA 2RKOA 3OSUA 3R6LA 1L4UA 4CQJA 1U5BB 2IV7A 4XIYA 3VOSA 2BFFA 3KZOA 5TRTA 3HYTA 4A2QA 4G1CA 4U7WA 1AN9A 4IXMA 3P0RA 4P4GA 4J1SA 4HATA 4B85A 2PQMA 5JAUA 2CUTA 5JD6A 1P2DA 3CEHA 3EVDA 3OZDA 3OZ7A 3EIHA 4MW7A 3U31A 4AFNA 1O94A 4MVJD 3ECAA 4WUTA 1ZR4A 1E5VA 4XX0B 2OC4A 4X1YB 4MUAA 4W63A 2FTKE 1XTJA 2Z3ZA 3AR7A 3BFJA 2GD1O 5J2TA 2HX1A 1P4HA 4OP1A 3UWPA 4LZAA 4JHXA 3VUEA 3O9ZA 5BR1A 4MO9A 4B4VA 1TLFA 4KWHA 1J0XO 3ESAA 1MG0A 1U2EA 2F9FA 4R2IA 1ZLXA 1KMIY 1KFEB 1O57A 3BVPA 4ZZ2A 1W25A 1A1VA 4NOLA 1TAUA 1DJNA 2HMWA 2GOYA 1DAOA 2NU7B 1IWBB 4JROA 1AO3A 1KJZA 1R6XA 1Y48E 3Q3VA 3WNBA 4ZMRA 4EF5A 1SU8A 5FR1A 3VGPA 1JKFA 4Z9AA 4I8XA 2XCLA 3SF8A 3ODPA 5IDQA 4O5OA 2ZI3A 5KWIA 3WRYC 1JDVA 4TTJA 2MYTA 4DWWA 1ORHA 4FTWA 2I1QA 3GLKA 2JDIA 4TKMA 2FCAA 4C4ZA 3HBNA 3ND8A 1FNSA 3IXLA 3VR3D 1VA4A 3WXBA 4BLUA 3VM6A 1E2DA 3RIMA 1KOJA 4AZ0B 4GQBA 5IXSA 5TEWA 2NXEA 3PXGA 4DANA 1Q7TA 1M0SA 3MT7A 4IDAA 3BZUA 5FTNA 3LGAA 3FPJA 4JEIA 1U2ZA 3LT4A 4J29A 4GXTA 2P2YA 3UGQA 4KVZA 4X91A 4B7CA 1JF8A 1T9KA 3OQ6A 4JC8A 4D0GA 3KJXA 3TW6A 1PK9A 2CLCX 3DJFA 1S0UA 4Q1FA 3KFVA 3FZYA 2UYCA 3O38A 3K0EA 1R0SA 3RFUA 1CUBA 1Z8FA 1E1NA 2GBPA 1ICEA 3U16A 4Q4CA 4TS9A 3O75A 4BB9A 2EWVA 4KXFB 4JH0A 2I2BA 4KBGA 1G42A 3LCMA 1R8XA 3AEYA 3D3WA 3WGHA 2GPJA 4O4LB 1OF1A 3JCZA 1HZZA 5A4JA 2HMTA 4UPEA 3KQQA 3KHKA 1BEUB 3LP6A 4JDPA 3T7IA 4ZYLA 4LHEA 3A6PC 1EZZA 4P7JA 5BSVA 2YFKA 5CT8A 2X76A 2QQ0A 2W00A 2PUWA 1U4OA 1U8EA 4QXOA 2IUFA 2QDKA 2Q2NA 2O0HA 4KW7A 1K27A 1Z06A 1E3WA 3IR5A 4F6CA 4R8RA 3OLCX 3GGSA 4PHFA 2IYWA 3BWMA 1JSXA 4Z51A 5JNTA 2QUJA 2ZRFA 3DOEA 3RYCA 3IV9A 4ZD6A 4K88A 2QTRA 4X61A 1UBNA 2YBDA 3KR1A 4ALNA 1I3KA 1XZPA 2UYGA 4RMHA 4IF6A 3KQOA 5U4QA 2JFPA 2XVMA 4RY0A 1MZVA 4HYQA 4HL6A 2NZVG 3S2YA 4BLSA 3RGGA 1SVWA 3G0HA 3WMXA 3H2JA 4N3BA 2ZSAA 5LB4A 2ANBA 2BEKA 3F74A 1AKQA 3EQZA 3H4TA 2PD6A 1I13A 2J3DA 1VG1A 1JDPA 1PU2A 3IKLA 3JYOA 1RYYA 3BH7A 4RKEA 4YCBA 2NZYA 3V1KA 3OKPA 2VG8A 3MUOA 2YV4A 2R6ZA 2C96A 2I87A 2RGYA 4QDTA 2OFFA 3I4CA 1JZQA 3H9JA 3A06A 3EGOA 3L1UA 3M6VA 4J0KA 4MINA 3TLKA 1UXHA 3QX3A 3VNUA 3OKAA 4BP8A 4I1YA 2LD4A 4PZZA 1KC3A 1QGDA 4I4CA 3QW4B 3OSZA 2WHPA 1RHKA 4CKWA 1QX3A 2JGJA 3I4LA 3HDTA 2V6FA 4C78A 3B6MA 4ZQFA 2PUHA 5ERXA 3TWOA 3ZCVA 4BFVA 1S2MA 2D7CA 2FMKA 2R7AA 4J16A 3MWEB 3WIOA 2A5GA 2BFWA 4YHHB 2QLFA 5DHQA 3BKWA 1XUOA 1EE1A 4D0SA 1Z47A 1P6QA 2EW2A 4XYLA 4R9SA 4GGPA 3RARA 1TPYA 1ZMTA 1TQDA 1X39A 4QXRA 1ZM9A 3R3HA 4K9RA 4LWQA 4ESVA 2ZWIA 4U4AA 4NULA 3WSTA 5AJXA 5HPYB 4TQUS 5EMNA 2VSXA 4GPAA 3QKUA 1GZUA 4J6FA 2P2LA 3KQVA 4QT4A 3RFTA 2OL4A 4ER0A 2VQFB 3SQWA 2E48A 1FDVA 4CUZA 4CN9A 3F96A 3FE2A 3QWBA 4NP6A 4X6LA 3RHFA 2QRPA 1H3FA 2VWHA 3EIOA 1JKJB 1KKUA 2IYFA 1PKXA 4D98A 4C4AA 3OOSA 3E9YA 5HHTA 1K5HA 2C99A 3FM9A 5E1DA 1KEVA 3L4BA 3LX5A 3RTBA 4AJLA 4MVJI 4FS3A 4J76A 2FW6A 4NEQA 3L6UA 2C7PA 5JCJD 4WXHA 1G55A 1GXSB 2FPUA 2CJFA 3Q0IA 1JIIA 3M4JA 1NMZA 4ND2A 5I7FA 1QH0A 2AFIA 1DPFA 2G5CA 4HRYA 4TLBA 4UQPA 1KAMA 5AT1A 3PSHA 2FFJA 1PUJA 3UUEA 4GE3A 4UBMA 2CJXA 4H08A 2HDWA 1Y3IA 1W0CA 1KI3A 1H65A 1ZIXA 3JYPA 4L4ZA 2D5CA 2J46A 1U2SA 1HTBA 2OHGA 1T34A 1WZIA 3F6YA 2G83A 1J25A 2P65A 4R4JA 4WACA 3RE1A 1QRAA 3T0GA 2FWRA 3TKLA 4JY7A 5J47A 2XQIA 2ZREA 4ISCA 5CDUA 1FQWA 2BMWA 3IAM6 3UKJA 4NS1A 5AXCA 5JDCC 2H31A 1TYDE 3U7RA 2GR9A 3JWIA 2NYRA 2QLMA 3DXZA 3FLAA 2QJFA 4X1KB 4XQ9A 4BNJA 4BECA 2X0KA 3H83A 1C8KA 3GZTB 4M55A 3Q88A 3AHHA 5BSFA 2QE7A 3DZGA 3KU4A 1RWKA 2WTMA 4CF3A 3U4MA 1TT5B 4LHXA 1RRKA 1FFCA 3JD4A 4YJ2F 1QOZA 1U2GA 2Z5FA 1AZTA 5DGIA 4C7MA 1SR8A 3RKUA 2V96A 4PANA 3PL1A 3DYIA 2X7XA 4A8JC 4EM6A 1R4MA 4HQNA 2FSHA 2QX9A 4PRYA 1CUHA 1N6NA 4TMKA 1HDIA 3HY4A 5KIAA 2GBFA 4UU8A 4F0JA 5IEJA 4PPYA 4R8VA 4DAOA 4J4BA 1TOAA 2WUEA 5E2IA 2Q3MA 1NFRA 2OAGA 1Z4LA 1RVV1 2P69A 2XAUA 3T35A 2C0CA 3GP3A 3TLZA 2AD1A 5LA6B 4F45A 1JR6A 1CVLA 3BB1A 2RHOA 3SF0A 1VKHA 1I3LA 3INYA 4YQZA 4AY6A 1IATA 4A6PA 1EAMA 1UJ2A 3DL2A 3E7PA 1SU7A 4EY5A 5LKAA 3QSYA 2QRGA 3CKKA 1L1FA 1EPUA 2ENUA 3MPUA 5ALGA 2X9NA 4KUEA 2QT9A 3RTCA 1MB9A 3EXHB 3FLMA 2IU0A 3TW8A 1F51E 3OJXA 4N76A 3LWBA 5KQMA 4GRIA 2Z2YA 3H2ZA 2YJGA 1J9ZA 3B5IA 1WY7A 2J9YB 5JRZA 2E89A 5EEHA 4H6WA 3WYAA 1P1RA 2RGCA 3LBNA 4TTRA 3BWYA 3IUQA 2QF7A 1N57A 3FHCB 3IKVA 1Z5UA 1NAIA 2PUJA 2XNJA 1M34A 2BEJA 3L4BC 3RWOA 4Q9JA 4BZWA 2OT3B 3OTGA 4MR7A 3UJ3X 4AXBA 1JHPA 1C14A 3G1TA 3UPDA 1XALA 3ZE7A 1TZMA 2FQXA 3F98A 4BKOA 3FGOA 4D4MA 2OXRA 4ZQBA 1WP4A 3MTQA 4MUGA 4QQFA 5E38A 5I9MA 1K6EA 2INGX 4JLMA 3GMTA 4Y2JA 4XWGA 5F2KA 2IX9A 1MABA 2XMZA 4YQEA 2A92A 2YDYA 3FYUC 2EZUA 2EFHB 4O8CA 3V46A 1OFUA 2YZMA 5IJZA 1RMYA 3THXA 1M2NA 3SFTA 4B9EA 3F97A 4X65B 4OQYA 1E6LA 3DVAB 3HP7A 4RTNA 1RQGA 3ZJ5A 3T7RA 1O8BA 2BM8A 3I9OA 4BP9A 2QMEA 1XZFA 3W5AA 2H54A 4IWNA 4OQDA 2ST1A 4I81A 3UHJA 3W9SA 2JLYA 1JSCA 3A3KA 2PGAA 3KJNA 3KP1A 3WWDA 4Z86A 1RHJA 3HCFA 2VNKA 3IEKA 2PH5A 3I8OA 5BWCA 4PG4A 1TO6A 4V39A 3G8DA 2BKAA 3ZVLA 4BNGA 4N39A 1TECE 1SC9A 4F38A 3H7IA 1GTL1 1ATZA 2QRVB 3VU8A 3UYLA 1WNTA 1UIMA 4FHEA 4BGDA 2P9GA 1EFUA 4S3MA 3AHCA 1TUBA 5KMGB 1KRWA 5TF0A 2PXHA 1BWRA 2SHKA 2DLNA 3FVVA 4TKUB 3VR3A 1YUBA 2A1UA 1QIEA 4QRHA 3UJBA 2PVSA 2BSQA 5ALHA 3LZDA 4Y1RB 2OG1A 3ORRA 2UZ1B 1Z6PA 3OAAA 3BQNB 4QQKA 1NJ5A 3VZCA 2Z9DA 5B3AA 2XCTB 3DZ8A 4KREA 2N42A 1GGVA 3I6MA 4EABA 1UJ6A 4QARA 1AS3A 4IJWA 2VSNA 2QZZA 1N8NA 4YJGA 3S28A 4MV9A 3B5EA 4G4GA 3SXPA 3EUAA 4X1IA 3TRHA 4AMZA 4C14A 4H7FA 1ST2A 1XO1A 4LQDA 5KHAA 1XN4A 5KQLA 4ZXFA 1W5SA 1E4OA 3P71T 4YMSA 2Y3IA 3ETEA 2FPPB 1KERA 4HWKA 3LQ4A 4KIFA 1QORA 3RI3A 1PQPA 3CUYA 3H87A 1Z13A 2OCPA 4MVJH 1C9NA 1UPFA 2EU8A 2JVJA 5DN9A 2OAEA 1ZMRA 2GZ1A 3D0QA 5AI0A 1DAMA 3TLXA 4X1OA 2HRDA 3BH0A 5JXJA 5M5BA 3K96A 1EG7A 4DSTA 3BB4A 4YLEA 2HSGA 5FNVA 2JNWA 3C7CB 3DO8A 1KI6A 4U6NA 3G0DA 1ZM7A 3IE2A 2IRWA 2MYNA 3NS7A 2WV7A 3L6RA 2QT0A 4G1UC 4LRUA 1ABEA 2A0WA 2WUDA 3D8TA 3N6VA 4INZA 4LVOA 2PMEA 2J0VA 4B6EA 3KQHA 4WXPA 5JROA 2D6FA 1ZCAA 3E5NA 2W2LD 1CV2A 5KTMA 1BXRB 4QJ5A 4XR4A 1WXXA 4YP6A 3DDSA 3X1MA 1CF9A 3IKJA 4PAOA 4XSVA 3SYRA 1ODFA 2RK3A 4A27A 5FI0B 1SQ6A 5BW5A 3OJCA 1NZFA 2X1MA 5FI1B 1T9GR 3IILA 5GIOE 3ZEAA 1TA9A 4RA6A 1E2GA 2WHYA 2YXBA 2XB6A 1II9A 4MIOA 1CQIA 5AJZA 3VC2A 3T5TA 2QENA 3OWHA 4NCIA 4OJYA 2CW5A 2GN6A 2LWIA 3K9GA 4ZODA 3SS7X 1RP7A 3PFNA 5JZ9A 3OX2A 1E0JA 1QZTA 2PLWA 3K9WA 1V25A 2PL1A 4I55F 1QHNA 2PL3A 3GA7A 4BDTA 1AVTA 3EG9A 3DBRA 1Z35A 4XWYA 1WULS 1NRJB 3FLBA 6REQA 2R86A 1J24A 3CNQS 1SD5A 3P9KA 3OBBA 3T1OA 1IUKA 3A1TA 5KQRA 2DT8A 2VSFA 4HGPA 3P9CA 4RAQA 1VL8A 4A1OA 3EQ9A 3D7LA 4AJOA 4BQNA 4C0QC 2V6BA 4YLYA 2P6RA 3IUEA 2ZIGA 1J7KA 1NJ6A 1B15A 4XGRA 3I1JA 1SKMA 1DL5A 4YAUA 1C1YA 1FFDA 4OQLA 3WHKA 3Q0EA 4YWJA 3ZD8A 2F3SA 4E03A 3IQDB 1LTKA 3B1ZA 4JFAA 1NSFA 3B2EA 4GR9A 3NUZA 4NBVA 4UAUA 5G3ZA 4KZKA 3TJMA 3PC8C 1AKUA 4ZT5A 3OHSX 1QFMA 1T4CA 4OP2A 1MHPA 4PPGA 4LOKA 2HZBA 1FTQA 1XF1A 4HGZA 5E7JA 5BUCA 3IDZA 3OQJA 5FO1A 2YRXA 3DTYA 4UVHA 3AR9A 4BVEA 5JC1A 4GI7A 4LCBA 5EWLB 3UUFA 3N2GA 3RJ9A 4JLPA 3VGJA 5AW7A 2MJLA 5EKTA 1ZC3A 5IM4F 3D6FA 2P9BA 4R83A 2W22A 1PFWA 3MXOA 4RSGA 3BJIC 1MAVA 1E1CA 4YYZA 4MRVA 2I2WA 5H59A 5BQ5A 1U9JA 3N87A 2JLZA 2GEDA 2Z6UA 4O2BA 4KFRA 2ZAOA 3AP3A 4MR9B 1NXWA 3PXEA 3GJYA 5AHWA 1N34B 4QOFA 3KQYA 5TPZD 3WB9A 1T0BA 4AJEA 4LV5B 5K8VA 1E79A 5MDHA 4OAQA 5AOCA 2W8ZA 2AG1A 3RM3A 2B78A 5JYDA 2VTBA 2C98A 4GVLA 5GY7A 1D04A 3DHVA 2X2PA 2P3LA 5THKA 4YPOA 1P5HA 1SXJD 3B1YA 4XUDA 4E21A 2WT9A 4QYWA 4HDSA 2V5AA 4MRMA 4OQQA 5HUHA 1A04A 2EKDA 2PZJA 3TO5A 3KC2A 3C0KA 1DARA 1T43A 2C4TA 2QV7A 4IJ5A 4BVFA 2A5JA 2Q62A 3CF6R 4HRAA 1UFQA 2R8PA 3N2LA 1Y7PA 1XQXA 3ZZMA 3SZGA 3EXEA 4EELA 4GBJA 4LY3A 2V9CA 5E4FA 1ORIA 2GEBA 3HI4A 4O33A 4R2KA 4PRKA 2AB0A 2D1YA 3GQBA 1TLTA 1EDOA 1W85B 3QU5A 1XB2A 3W4JA 4ZZ1A 1X92A 3TZKA 3E61A 4IH9A 1ZRHA 1ODLA 1RYFA 3FYUB 4TWBA 1OZGA 3RAFC 4ND5A 1ORTA 1VP3A 2RIPA 4O1HA 3KCQA 4Y8VA 3ZHTA 4AZTA 1O94D 3GBPA 4MVJA 5FPSA 1C1XB 1BX3A 1IHPA 2PBZA 5FQOA 4CKBA 2J4CA 1SCAA 2O8EB 4Q93A 3RODA 3HBMA 5C5IA 1R9JA 2DETA 1EJBA 4KYTA 3A4TA 1J0DA 1GUYA 3G13A 1V5WA 4G24A 5TE9A 1KYWA 3PUKA 4K26A 1SFRA 3PPYA 4KACA 3UJPA 1ZITA 2YCLA 4HQRA 3HKEB 3GJQA 4HGYA 1KO4A 4GX5A 3ZQKA 4P80A 2VF4X 2HXYA 4C3VA 3IXMA 1R00A 3W77A 3U7FB 3HUTA 1T3GA 3AETB 1XQ6A 1N2CA 5DRTA 4MUNA 2HJ9A 3A2KA 2D13A 2BZ0A 4NBTA 3LUCA 3PTZA 4RD2A 1P81A 1Z75A 2TSYB 1FP6A 4CE6A 4LUCA 3WI7A 1KEEB 3EGDB 3K1AB 5DHUA 5EIAA 2IYNA 3RSQA 5GGYA 5ECGC 3RVKA 1TQ8A 1Z0DA 4JC0A 1RS0A 4L5CA 4WASA 1GG5A 3EGCA 5DM2A 3ZDQA 3GARA 2HYDA 1FSGA 4XFJA 4AB1A 3ICCA 3DEFA 4UNNA 1SIOA 3AOGA 5KCZA 1L2TA 3BWEA 1E2KA 3WRVA 4EKDA 1EVQA 2BGRA 3UUGA 2WTAA 4WFJA 1IMOA 1JR3A 4ZC8A 5L3QB 1KAHA 2ID9A 4J9VA 4J2TA 2CXSA 4CQMD 3E7FA 1TCCA 5MHTA 1IN4A 1S4QA 13PKA 2GZMA 1VOTA 3OZUA 1XTVA 3P9SA 4B3JA 2Q3LA 5CH3A 4I5IA 5J5AA 1XDUA 2ZJ6A 5GPBA 1IL0A 2VOJA 4NU6A 4ZCPA 1GY8A 3N7UA 4HEHA 4LYGA 1XTSA 3ZKWB 4MW6A 4OSPA 1V7QA 1RXEA 1F6DA 3VUFA 2NTVA 1XWFA 2HBYA 2W6QA 2HQRA 4WLUA 4BBZA 2AX4A 1O0SA 4R41A 3PK0A 3SC2B 3NAZA 4E4YA 2FWMX 2A9PA 2F7SA 2G9QA 3FUXA 4TT3A 4B09A 3AETA 1XNGA 5A05A 4UTZA 2XDQA 2BKXA 2Q45A 3K2EA 4QGAA 4EY4A 2IELA 1RRVA 3U6KA 3DOIA 2XW6A 3VAAA 1OLXB 3FYDA 1AKNA 1J20A 4Q7KA 2PUVA 4LNUB 4TTTS 5EZQA 2OZLB 3I04M 1QF9A 1SZPA 2WMOB 4URWR 2E5FA 3V4OA 1QVWA 3NC1C 1U3DA 2Y0PA 4Z4FA 3ODGA 1FJXA 1P9RA 4DR6B 4EB8A 3T1YB 3BICA 1XELA 3OURA 1HWYA 4I1IA 1IMJA 2VR1A 2XMGA 4LYJA 3RRYA 4QNMA 2NUAB 3LH5A 4JJFA 3F8WA 4G41A 5I9NA 3PFCA 4DEYA 1WZEA 1WY5A 2LRHA 3QEAZ 1IBKB 4KI0A 1YBMA 3NHLA 3H2HA 2C07A 3DBLA 3UNXA 4YRDA 3UWMA 5LQDA 3RD5A 3VKGA 1L5VA 1CZLA 2H1HA 2DU8A 2QWXA 3IPRA 4GOLD 1PJAA 1QIDA 1VLQA 2ODWA 2G0TA 4MGEA 3ZKWA 2E4XA 2GD0A 3T7DA 5EIEA 1PYGA 2NM0A 4FYXA 3A8TA 1HT0A 2DKOA 1YDGA 1Q17A 3HVIA 1QYVA 2Q4DA 3C48A 1JHAA 4DGSA 3DXFA 1J8VA 2BGTA 1PX0A 5DV9A 4BUJA 2D2FA 5TT1A 2XMRA 2Z3WA 4GKKB 1GGFA 3PYLA 4JU9A 4TYNA 4XTRA 5EZYF 4BE7B 1EWRA 4TZ6A 1DQPA 1VDMA 3ECSA 2HV8A 2J9FA 5ARCA 1OAAA 4CT4B 1HE5A 4NV3A 4URZR 2IC5A 3TAXA 4WXMA 3DPSA 1J49A 1DWUA 1GA6A 2XUQA 3GDFA 3L0CA 3MS2A 4RKRA 1KSFX 5I45A 1CY6A 2ZYVX 4NABA 3DZDA 2D5IA 3N74A 3D7MA 4HGOA 5E6SB 5MFPA 2E9SA 4WIAA 1N2HA 421PA 1PR1A 3I37X 4OJMX 2YWHA 3QPCA 5TS3A 3WP1B 4EJSC 2IUEA 2VWQA 2FOLA 1SC1A 3SJBA 4RTJA 1OWPA 3UVEA 4ZVMA 2OA0A 1YONA 1LDEA 1OA1A 2O2SA 1P4AA 3D3NA 5TARA 1K9SA 1DWQA 4CEJA 3MWKA 1PWZA 2D1SA 1RCTE 3PC3A 1JFFB 1K89A 1SVUA 2UZ0A 2HA5A 3H5AA 1SAYA 1TGYA 4MKRA 5K1ZA 4BRWA 4L5BA 3FMOB 2ZIWB 3ZLVA 3RF7A 5A5FA 1R37A 1TC2A 1I3CA 2ZK7A 3EVZA 2VRBA 3AIIA 5KVVA 1OBCA 3ZDCA 3MCAA 2C9YA 1M6NA 3IVAA 1UOQA 5CVEA 3KZVA 1TM2A 5JAHA 3L4KA 1U2GC 1YAHA 2E0IA 1MAUA 1MC1A 4Q3NA 2AR9A 4OQZA 1JKJA 1FJGB 2JDID 2IEZA 1Y3AA 2PYZA 3A1CA 3SM9A 4RA9B 3UHFA 3IEVA 1YE3A 1MO2A 1NUAA 5KVCA 4RMGA 1SCIA 1MV8A 4BNDB 1GSAA 5C1BA 1V2HE 2A9QA 4HF7A 5EIBD 3RYIB 2R8BA 4LHVA 2PIAA 3T7EA 1GTG1 1T2AA 1ETHA 3IUSA 3OT5A 3DULA 4EZEA 1PK7A 3BAZA 4MQUA 3PB3A 2JS7A 3U3ZA 4EKEA 4BO1A 2Z30A 4M1EA 1FBNA 3CV3A 2Y93A 1U7ZA 2BE7A 5AW4A 2QMUA 3AB8A 1TIKA 1YFZA 3WK7A 1NVWQ 1RI3A 3A1VA 4FYJA 4FXPA 4PS1A 3EWAA 5H80A 2H06A 2JRLA 4EATA 1RXYA 1UBSB 1NVTA 5T7BA 4CU2A 1D9ZA 4U2EA 5L4NA 2PBFA 3GRFA 1ITZA 7GPBA 1A7JA 4NJMB 1B0ZA 3SGLA 3I2GA 1RNLA 5AVWA 4K9LA 3RUHA 4IMIB 2CNWD 2OQRA 2OMKA 5JALA 3NU1A 1G18A 5CLQA 2H7CA 1MLDA 3NBAA 3NNDA 3AY6A 3ZH2A 3WZMA 2UUCB 2I54A 3B6KA 4Q12A 1NT2A 4MCJA 3T3DA 2QUHA 5F4ZA 3CF4A 3NORA 3SI7A 1XP5A 3CLUD 2Q4BA 3Q87B 5FAXA 3WO1A 4BFXA 1BX1A 3EA5A 3QBEA 5IULC 1V5IA 3EMVA 4MS1A 5HMMA 3Q6MA 1ND5A 4HX5A 2X8AA 4L50A 5E6RB 1N9GB 1OWMA 1GPBA 3A05A 3T4PA 4RA9A 3DMRA 4EFMA 1G3RA 2ZATA 2HU5A 4MV1A 2VH2A 4J3NA 3ZUGA 5LP6A 1NRXA 3FPBA 1E2PA 1RC0A 3N7TA 1HDEA 2REBA 2QQGA 4B0PA 1BXKA 1HZZC 5BVHA 5HJEA 3NXSA 3HB1A 5FULA 2G36A 1WDTA 1L5NA 3CLRC 2XT9A 3VX4A 2PX4A 5TIIA 5BV8A 1LBQA 5E9WA 4WY5A 3GAMA 5K3EA 1ZH2A 1JKIA 3X44A 4KN6A 4MCHA 1VECA 3CWQA 4OHCA 3AVVA 1K2VN 3BUSA 3DMNA 1MT0A 4E3WA 4X92A 3M34A 2E6KA 5BWBA 2OP1A 4C88A 4PN7A 4IIUA 4LJ5A 4MW0A 5IN5A 3C6QA 1LCIA 4K6MA 4AO7A 4LZOA 2W8BB 3Q98A 1H2FA 4A1FA 4MYDA 1GPH1 4ZQHA 3TVYA 2AD5A 3TLEA 3KEMA 3DL7A 4CIYA 1NTRA 2IWHA 4KQEA 2PSEA 1CR2A 1NUUA 1BFKA 1QIGA 1ZGCA 2PYIA 2VFAA 2ZFUA 1WUIS 3OIVA 1RIFA 1KMCA 3ESYA 3MSCA 5HIIA 1E5XA 1JQBA 4CUKA 2VLIA 4H0CA 3JQ7B 1SCKA 3EC7A 2WZBA 1QH1A 2DWOA 5AW2A 3W2GA 4YXWD 4W6ZA 1P0PA 3WO0A 1ZOIA 1N6OA 4XUCA 3DKIA 1PVOA 2JKYA 1CNMA 3VJLA 4WY2A 4CR8A 1AXRA 1UXOA 4LYYA 5D3KA 5IASA 4PLVA 4NMLA 1BW9B 4ZOLA 5HE9A 2QP9X 4YV0A 5BV2P 1PKEA 2GDZA 2Z4TA 2I8AA 3UW1A 5LZ7A 3TFQA 2VP6A 4HJXA 3KKZA 3RVLA 3HU5A 2V6MA 2VDLB 3L0YA 2VJMA 3UHAA 1OE0A 1RPJA 3UATA 3HP1A 1TB4A 3VZPA 3I6ZA 3SE0A 4LY6A 3I61A 2MOKA 4C7BA 4WKPA 1II8B 2R44A 8AT1A 4TVOA 1V11A 1GGHA 1XEWY 4FMBB 4Z1MA 4TLDA 2DPYA 3TOCA 2WDZA 3HO8A 2X9QA 5T3UA 2P7IA 3VMFA 3RRJA 1E96A 1K63A 2VPXA 3M4ZA 2YC2C 5BV0A 5G1PA 4D3DA 3TRDA 1CPYA 4R2HA 3SZLA 1I4LD 1TYCA 2OCIA 4BB5A 4F3TA 2YQ5A 2IYZA 5EVJA 1JR3D 4Q21A 1FQJA 1A9SA 3ELUA 3EDCA 5DEIA 1N1MA 3PI7A 4WJLA 2XWSA 5BSKA 5ALIA 1K98A 2QTBA 3ETHA 4UVEA 1JQAA 4RFSA 4KVAA 1ZQ9A 2IYEA 5C31A 3HTXA 4F84A 3N39C 2H8KA 3O4IA 4N8DA 4Q19A 3OY2A 1OAOA 3GLUA 5ELMA 5I7AA 4YAKA 1ZNZA 1ECPA 4F96A 2EWWA 1I3OA 5CFNA 1VL1A 2FEWB 1I80A 1TMOA 2QVGA 3CRNA 1EZ1A 2AXPA 3QKSB 4ISBA 4P3XA 5EERA 5EZYB 5SZKB 3A6LA 3IHLA 3R3XA 1DIRA 1KZ1A 1WVIA 1CJCA 3TD6A 2TMDA 3I09A 5JBNA 3L8YA 5LLDA 1XCBA 2J3QA 1KVQA 1Y0BA 2Z9BA 3L7JA 1NFQA 4RLQA 2H0AA 2EP7A 2YFHA 3W04A 3HWWA 1T13A 4CZ2A 2CN1A 5C0OE 1DKUA 2BKUA 5AKGA 4LQLA 1W9HA 1DMSA 4ER3A 1YR1A 1B0AA 1V8BA 3PSAA 3H9EO 4PLHA 5TVKA 4AX8A 1K75A 1IUNA 1U5CA 3WIDA 2B25A 2Q6IA 4NDZA 2EKLA 3V5NA 1LA2A 1HT2E 3OCZA 4L07A 1JSLA 1VKNA 4LSGA 3SX0A 5JECA 3TSCA 1Q84A 1P7WA 1UBGA 1UBUS 2VBCA 3STYA 1DHRA 4Z49A 2ZTVA 2J08A 3EDRA 2NP7A 4UCQA 3E15A 1UWCA 5A4IS 4B3SB 1Z5OA 1X3LA 2D8MA 3LBAA 1T5TA 3Q3CA 3OPMA 1THMA 1UF9A 2A5YB 1T26A 3KALA 2ODNA 1BXGA 4KU4A 3DTNA 4GVPA 4MRRA 4YCDA 5CEJA 3ZWQA 3A2MA 4JKIA 2IWRA 2OZPA 5B30A 2QP3A 2RCYA 2NUPA 1P2TA 3RWBA 2OXFA 3ZWBA 4BV8A 1GR1A 2JHGA 2WB2A 2ZRQA 2VDNB 1DOZA 1T5DX 3CYFA 1BGWA 1B1CA 1Y8ZA 3LM8A 2WC1A 2FZVA 1YO6A 5LQCA 2VPTA 2ZXEA 4I4TA 4QPJC 2HHLA 1BDBA 5KEIA 3DZBA 1ZH0A 3D8HA 3FUCA 1JR4A 3N8HA 3OM1A 4J7AA 3GK3A 5IANA 1BCRB 2QVLA 4XDHA 2Q0QA 4AMVA 3FMPB 4C87A 2OXEA 3HUEA 2VK2A 2V3CC 2RGXA 1I1QB 4GNKA 1VMAA 3NNSA 4CCYA 2QAIA 2FZ4A 1X7XB 5CFMA 4FYPA 1CJUC 2RGBA 4MQ5A 2VZ8A 1Z4OA 4C0HA 5JNUA 5LQUA 1E79D 3D3JA 3TEJA 1KU6A 4ZZ3A 2FZ5A 4Q1DA 2I4RA 4JCOA 3ZDZB 1WMEA 3CLHA 3NX4A 5LP6C 3Q7QA 3COJA 3HJAA 4LE2A 1PFUA 3QOFA 3ZHQA 1N0UA 3TMAA 2YYAA 2OVBA 4OM7A 3U19A 1YQTA 3U9LA 1CE8A 1HR0B 5HQ3B 2O8CA 4TSFD 1VKZA 4PR3A 4D1YA 3IOYA 3PIIA 5K0FA 1O6FA 3KYCB 5THXA 4ZMBA 4Y6RA 3U3DA 3ZW8A 5TMDA 3DD1A 3P4XA 2A14A 1CIVA 2QI9C 3R3SA 4JL5A 4N4AA 4NPHA 3KHSA 2WY2D 1OH7A 3DWEX 3CPHA 1XDBA 4PGMA 3WXMA 4B3TB 2O2GA 1DCKA 2WSBA 1RJFA 4DZRA 3MJEA 2CJPA 1RQNA 1GR0A 5BSMA 3TTVA 3LO8A 4O2RA 1VIMA 3L92A 2XRZA 2D0PB 1UBKS 2PSDA 3GAAA 3K2BA 1HDGO 4K8RB 3C5WP 4DZTA 3BRCA 5ITZB 1I4DD 2QM0A 4A6XA 5K0TA 2ZPTX 4LXIA 2OO5A 4U2CA 5A6SB 2IYVA 3JD1A 1JMVA 4XR9A 1E8MA 5FJIA 5G02A 5AI5A 1B6SA 3LVFO 1W88B 1VKRA 2JK1A 3IFSA 1DQSA 3LBYA 2X9GA 1UBOS 1WMBA 2OZKA 5KKAA 5D5HA 1XZBA 1FXWA 4PZ0A 2PLRA 1QJCA 3QVWA 3VPSA 5AJYA 4BV3A 3CY6A 4Y2QA 2ATXA 1Y1LA 4E32A 4DSZA 1H2RS 1P9LA 1MO5A 1U9YA 2A7QA 3K0AA 2YXDA 4C6SA 2F1OA 4BLTA 1GUFA 4ND6A 4TN5A 5E4TA 1FFXA 1KAGA 1P6UA 1Z29A 2D0IA 3WBKA 1LTQA 1IK6A 3TW0A 3NGLA 4QJIA 2ZM5A 1EM6A 1X1RA 2LKDA 3F9CA 1YBHA 1IG0A 3ABIA 4G8CA 1E66A 5EI5A 4JBGA 2CLOB 5PGMA 4N9QA 3CZCA 2QMHA 1O96B 4RZQA 1F4LA 2CD7A 3WA7A 2M1ZA 1RWWA 4MPTA 4ZU3A 1SCNE 3C8HA 3DQQA 5ER9A 4DXHA 1Q1EA 5B6PA 1ZJZA 4D45A 3R9XB 3GGCA 4CQLA 4Z4IA 3VTZA 2NNWB 2F8MA 3JAKA 3MW8A 4HDNB 3ESCA 3WL4A 3DC7A 2G5GX 5HKKA 2PGXA 4X6XA 3AF2A 1GZ5A 1GRQA 2NVUA 3E9QA 3TZHA 3EH1A 4L5JA 1Y5LA 2WUGA 4L6IA 3OF3A 4TX1A 1PNQA 2GKOA 4OY3A 3DWIA 4RJLA 1LPSA 3DJYA 2EBFX 1PWHA 4B6RA 2MSKA 3BE8A 2PANA 4NENA 4DKJA 2HB6A 2OC9A 3FI0A 4RJIA 2XXAB 2QT1A 5C1IA 2HA2A 4EAQA 3S29A 3QK7A 1YL7A 4P9NA 2B1GA 2FSVC 3MBOA 3W6ZA 1EFPA 1XFAA 1CJKC 2I99A 4WZAE 1CEYA 1FCJA 1OGIA 2QZSA 4PGHA 3Q0TA 2BTEA 5CYOA 4KQ6A 4UTNA 1K8XB 1WWKA 2XD4A 1K6MA 4CM8A 3M3PA 3KAJA 2X5XA 3QNUA 3FTCA 3N5CA 1I5RA 1WCIA 4W8GA 3NYQA 1MH9A 2W43A 1P5FA 1WL8A 1UBCA 3EULA 1R66A 3GZNB 1WG8A 3PPWA 3AY0A 4KHPB 3I6BA 1KPGA 1ZGHA 2PS9A 1R2QA 3PQ4A 4X20A 5G0TA 3UEOA 3ESZA 1T5BA 1U0FA 4R40A 3D59A 1L4NA 4NL4H 2JGKA 3I28A 2CLIB 4YFVA 4OV6B 3EUEA 3RS4A 4QJ4A 3QNMA 2ECOA 4G0WA 2JBHA 1V16A 1EVYA 4RHFA 1W47A 5L53A 4KQJA 1YI8A 4B80A 4D56A 1ISHA 2WYVA 3ELWA 3FSEA 1HDXA 5L3SB 4JLKA 3BT7A 1XC7A 3M5DA 4DDWA 2XCSB 1U98A 3NANA 1H42A 2NADA 1KR2A 3EZNA 3KQLA 2RGNA 3TR6A 2PG3A 3FPFA 4DGQA 5JPIA 3EVCA 2GZ2A 3QPWA 1FU7A 3VH2A 5FWNA 1L7NA 1VJRA 3AHEA 5DU2A 3I9V1 4I55B 1P0QA 2ACWA 2P78A 3A1FA 4XLZA 1UBTS 3U81A 1VGRA 1LI4A 4F60A 1W0KA 2AV6A 3HCNA 2F64A 3ORFA 4PCAA 3DV9A 1U31A 3EUWA 3JZAA 1GQQA 3QFRA 3M33A 3OTIA 2H4XA 4A2PA 3E9MA 3O4VA 3ZV5A 4QM7A 2FUCA 3P9ZA 3LCVB 4I36A 5F51A 5FBKA 2L2QA 4DLNA 1N3LA 2CLSA 3CX4A 4PC3A 4WNIA 2WJ6A 3QITA 1A98A 1X86B 4M1MA 1ZKDA 4UDXX 4F71A 1NMSA 3AUUA 1CEEA 2B69A 3TW4A 3WHIA 5CRIA 1Z16A 1W36B 4ML3A 2OOKA 4YRCA 2CZCA 2W2MA 1BMFA 2AEJA 1GNRA 2C20A 2R85A 5TPZA 5HYVA 1J23A 3DBIA 4K05A 3D31A 1A5SB 1Y1TA 3H5OA 3KVOA 4XIGS 4XM1A 3STWA 1FMFA 1UBMS 3ISJA 5FUXA 4I3GA 2B8WA 4HWGA 3HNOA 4I50B 1LC3A 4QTYA 3D2BA 3GT7A 1TAGA 4W1QA 4MVWA 2AW3A 1GFZA 2RSLA 4X7PA 3X2FA 1PEYA 5CB6A 4R31A 1RYHA 3N9IA 2P2NA 3CCFA 1ZAYA 2PEYA 3EB9A 2QU8A 1CQXA 4LG1A 4LSZA 4MYRA 1D5WA 4GMHA 1V71A 5FYDA 4RK1A 3W9BA 1N5LA 1MQ9A 2GJAA 3IO5A 1EIWA 4LGCA 2I5PO 3QLEA 4H16A 4PX2A 1KWGA 3L7YA 1UWVA 1H3EA 1TCUA 2H7XA 3G5LA 4HQ0A 3ZWMA 4G8DA 5FLKA 3PUVA 4U2KA 3ICVA 3NHRA 3I9FA 4IFEA 2ZUUA 1EEXB 2NACA 3DE4X 4DYDA 1FLNA 3HJGA 4X9XA 3QZUA 3CC8A 1WKBA 2C3YA 2FW8A 3GMDA 4MJ3A 3FOFC 4KWCA 1DUIA 4MKFA 4FUTA 4JLOA 5FWXA 1P5JA 4L3VA 5AVSA 2FEKA 3O93A 3FFAA 1Q91A 4ZAVA 2ILTA 3AF3A 4MXDA 2W6MA 5K99A 3U39A 4BIIA 4UBJA 3S0JA 3ELBA 2I3GA 4MVJP 2J5RA 3ZHRA 3HLTA 4OGGA 1XD2A 3COYA 4CM9A 2CVQA 2PRKA 4KUHA 4PCUA 3NBZC 1TJNA 1ID1A 1NJ8A 4TV8B 3GOQA 3KOOA 4ZT6A 2YMQA 2NN3C 2QX8A 1D3AA 3E23A 3OF5A 2JLUA 3NHPA 1VE3A 3W2IA 2GLXA 1Z0KA 2NO7A 1XAHA 4RCZA 1SN7A 5EIFA 2R8EA 2NQ8A 3N53A 3QLUA 1NC1A 2XA9A 3MIZA 2JLSA 4NBUA 3HYNA 5AI4A 4C3ZA 1HQYE 4IJQA 2H1IA 1ISSA 2J1LA 5EWJA 3V4ZA 3M6IA 4ODIA 3L9XA 1NX6A 2F90A 2VPPA 3KWLA 3M6FA 4U8GA 3RUIA 4FWTA 1OYWA 2DH6A 1P5ZB 3FHLA 3OUTA 4WKOA 3S8MA 3CH7A 3ZVKA 3VR2A 1XDWA 3BMOB 2F4VB 4UM5A 3R7WA 5AH0A 3HB5X 2G40A 4I9UA 3PUHA 4PLTA 4YPVA 1GVHA 4J94A 5LN1A 1VSUA 5CT9A 4HFRA 3KAPA 1IONA 4RVHA 1J0EA 1WDLA 1X9IA 4OXXA 4Q4JA 3STHA 5BPHA 4BN4A 4D9MA 2DCUA 1C3EA 4GPTA 1NVMB 1VE1A 1QRUA 3QU4A 1CTQA 3ITEA 4G4JA 5DISB 2XECA 3DOUA 4S35A 3KV3O 4YRMA 3QBVA 3IEMA 1RKBA 1B8UA 1SD1A 2JGDA 2PNFA 2LGJA 3NRBA 4AUKA 2YMLA 2ZM6B 3L06A 4HKTA 2QZJA 5JEDA 2VPQA 1IN8A 1O6ZA 4HLNA 2C4UA 1UAGA 4DAEA 1ZS9A 2JRCA 2JBWA 5D84A 4UMDA 2F48A 1OOEA 3INTA 3OX3A 4BZPA 1CB7A 1CUCA 3DWGA 2BMEA 4XD7D 1NFFA 2A0UA 1A96A 4UKDA 3FIUA 5KC8A 4UCWA 3B1WA 4BMPB 4WE3A 3HKDB 3TSOA 4Q5IA 5JLAA 2IQ5A 1LQUA 3W5HA 1F9AA 3EZ2A 3ZUPA 4D9IA 4F46A 3FFXA 4RO0A 4RM2A 4XA8A 5IK2A 1UP4A 4BCDA 3EVNA 4X8MA 1V96A 4NATA 2PM8A 4AF6A 3OWOA 3PQ6A 3Q4GA 1E9CA 3MWGA 2Q0XA 4RE5A 1NNEA 5TXGA 4CNBA 2ZBVA 4Y6QA 5IUJC 2B6HA 1E4EA 1I32A 1I4TD 3AHIA 3I52A 2XMDA 3TTTA 1P75A 3ZLBA 1YA8A 4E7OA 1TU4A 3PNYA 3C39A 1QAMA 2AEMA 3ETGA 3UKOA 2RG7A 3FWYA 1A2KC 2BFBB 4MPDA 3NEPX 3MMSA 3DUWA 1YI1A 1RR6A 1LY1A 1CR1A 3F6RA 5JI2E 2DG2A 3NDJA 4Q66C 3ILXA 4CQNA 4JC5A 3UMMA 2BM1A 4M9RA 2WKRA 4R3UC 2YJNA 4ZCIA 1N9ZA 1TEZA 4QLAA 4RABA 2PLAA 4J8PA 1BRMA 1E7RA 4H1HA 3EARA 1KRHA 3N6XA 2C7OA 3FCOA 2RGUA 2NX2A 1Z39A 1YZLA 1XTBA 3D4PA 4JIMA 3T9FA 4G26A 3CLTC 5TC4A 4LJYA 2YWDA 1U90A 3NH9A 2JAWA 1TJPB 1Z6TA 3QWHA 4G5YA 3CRVA 4MHOA 2D8AA 4XDYA 4AICA 5KSZA 4M1WA 5K8IA 1ES9A 3H5VA 1NVDA 2BR4A 2GK3A 2P35A 3OCXA 5DGHA 4OBBA 3CW2A 3JWGA 5AKHA 5L40A 2WSIA 1ENYA 2HD4A 1HX7A 5SZIA 1CY2A 1W6RA 1Q0SA 4C7XA 1N7GA 4HLUC 1I36A 1FS4A 1E1YA 1K4YA 1TF2A 2HSDA 4R7ZA 1THGA 3S99A 3B2QA 4A91A 1Y9JA 4LJRA 4OKSA 2NUBA 3SAJA 4XVUA 1BU5A 4W9NC 4DUPA 5C4IA 2UXCB 4G07A 1NAHA 1TI7A 3EPKA 2FFQA 3ZGVA 1U7UA 3WDLA 4JLNA 2QBYA 3UGTA 1N5IA 5YASA 2FETA 3DMTC 1QGYA 3LPNA 2ZI9A 1G9XA 3IBCA 2QNIA 1D1SA 1VKOA 1VJ5A 1PJLA 1AKWA 1HY3A 2BMDA 4YAEA 2OXTA 2V7UA 1FLDA 4DADA 2HF2A 2Q41A 4EG0A 2AE2A 2EKPA 2POCA 4ARVA 3E9DA 5LBUA 4FM9A 2Q99A 3R7DA 1DTWB 3SEFA 5JFGA 1B2RA 3N3BC 2UVPB 3GJSA 3JVDA 2PMKA 1N8TA 4RPGA 4A73A 3Q3IA 2A2ZA 1K08A 4C4YA 4XGQA 2F3UA 1Z4NA 1WDMA 1U0HC 5AO9A 4D57A 1TAQA 1OBOA 2J0EA 3MCUA 1VPTA 2PV7A 1COWA 4PTLA 5AI9A 1GZ6A 3Q40A 4ACAA 2QTLA 2IJGX 3WGQA 1Q3HA 2R5WA 4JKYA 3T99A 2EP5A 3JD3A 3EX7C 4FZVA 1ENZA 3GPDG 5B36A 4F1WA 4B3GA 3AR4A 1ODJA 1HEYA 3Q11A 5CTJA 5FQNA 3UPUA 4LE1A 3U3RA 1UT8A 2AA3A 3DKVA 1V9SA 3QY0A 4KN9S 5DOVA 1AO0A 2C57A 3KWMA 2VJOA 4JJGA 1YCHA 3QVMA 3T5BA 2P1DA 3K70B 3KLMX 3AVUA 1UJMA 3HJTA 4LBZA 4EKYA 8LDHA 3PXCX 3QYJA 2O0LA 2O1SA 2ZU0C 4AYWA 4F1JA 1YKGA 3T3IA 5KYTA 1P1IA 2JI8A 2O2ZA 4ECEA 3VC1A 2PO5A 5F52A 1X1AA 2O3QA 3W79A 2AN3A 3WFJA 1HOTA 3NOOA 1MTZA 3EG5A 1QCCA 1O7JA 4I5GA 2RGEA 5EZYA 5LXTF 5CVTA 2FSUA 5DT9A 5HKLA 4A8HA 4F97A 5TJ9A 3QPUA 4I1OA 4PC2A 4QLBA 1IEQA 1OWOA 1A72A 1VIAA 4RV4A 4DQKA 3SBEA 3DR3A 1MV5A 1ZA1A 4R2JA 3WKCA 5JH7A 3FJYA 1UBRS 2AFVA 3BZBA 2XADA 1NBAA 3HZOA 4UHBA 3ZX5A 2RGRA 4XRRA 3GI1A 4RMNA 1H2HA 3KO8A 1T35A 2CL6X 4IF4A 1K3UB 1H2EA 3MQFA 3LT0A 3RIEA 3TMYA 2AR0A 2JFVA 2JZNA 2FWPA 3GL9A 4I7EA 4S1OA 4XCXA 4N0DA 3ZVNA 4V3BA 3D1JA 3CNBA 1FXUA 1GCUA 2NLOA 3CSSA 3FUWA 2IUYA 5JD5A 4XEUA 5KHLB 3H9QA 2ZTMA 3HB4X 1DT3A 3VI3B 5KMGA 1JA9A 1DTEA 4PXSA 1QUEA 5DM4A 5IBQA 1M2GA 1N6IA 4M1TA 5DNWA 5KX5A 2MU1A 1EYZA 2VIIA 3UBTA 2O5CA 1P2VA 1ZX1A 2Z2JA 1EUZA 3DNFA 3BHIA 3FR7A 3KU1A 3JV7A 3FWZA 3ED5A 1VMKA 2G67A 2UZ1A 3JALA 2QM8A 1IRIA 1OXXK 4PZUA 4UD6A 5EJ9A 1D5CA 2JAUA 5CURA 1XTPA 4FSXA 1Q7RA 2X7JA 1FU4A 1UC8A 1DSSG 1TFUA 3G88A 1AKRA 1Q15A 4CIBA 2M98A 1HT1E 2GBLC 3IX7A 2B4QA 1AT1A 1AKYA 2BP7B 1T3TA 2V4UA 2W9XA 4YLGA 4ZOCA 2AZXA 4F9TA 3PXUA 1YQ9A 4CI0B 3D5TA 1JWAB 3TTWA 3LYHA 1Z7BA 3AEQA 2IDJA 1LRJA 1UMCB 2QL6A 4FEAA 4DLAA 1T8PA 6AT1A 1UDXA 3A31A 4OD0A 4BB0A 3A4YA 3M6MD 4UFOA 3T3PB 1DBWA 1U3UA 4I50A 1DLJA 1G7SA 2FPMA 3NP9A 5J23A 4K8OA 4N5DA 4HB2A 5IPFA 5KHOC 3T41A 4X7MA 2LDXA 1IZYA 1IQRA 2D3WA 3ILYA 4IG4A 2QPOA 4CDNA 2BFFB 4YRTA 5DNAA 5TF4A 1KH2A 1T0JB 4Y9RA 5KYWB 3JQ8A 8GPBA 4QBIA 1IHXA 1UZAA 1Q22A 1JEYB 3RBAA 4XGKA 1XZMA 1EFVB 3NBMA 4M9QA 3JQAB 5J4YA 3LUJA 2HXGA 1JV2B 2V3WA 3FJ1A 4AMGA 1H2YA 1JG3A 1MN6A 3Q9SA 4IHAA 4N5IX 4UUQA 4BTLA 2YWXA 3G8YA 1Y3CE 4NJOA 4P4SA 3SDBA 2JLQA 4TZ0A 2FPRA 5BV1A 5CB4F 2ZUVA 3KVYA 1PT6A 2P1ZA 3F3YA 4YJ2A 4TTAA 5L7TA 1A88A 1MFPA 1WKCA 3ENZA 3SY8A 4Z1MD 1G8SA 1VM6A 2AMFA 3KTDA 2LZ0A 1G8KA 3R77A 4GZ3A 4M86A 2PRIA 3OP1A 1DVRA 1CEQA 1VPLA 2EFCB 4L4XA 3OECA 4WOJA 4IV5A 4Q3KA 1C30B 2YXEA 4NDNE 4QPZA 4KO2S 4PBRA 4E2FA 1E9AA 2ZAIA 1RT9A 1IJBA 5EZ5A 2RH5A 4EBFA 2GILA 3PNVA 4YAWA 4F3CA 1EE2A 4RK7A 4AJ1A 1T24A 2AXEA 3SNHA 2XGOA 5GONA 3G85A 3VO8A 1YACA 1ZUNB 5FPTA 4PFJA 2ONZA 5H4GA 2BTQA 1UC4B 2O20A 4JOCA 4KX5A 1FVOA 4WAUA 3DD5A 5D2CA 1JPUA 1DOAA 1ZN2A 2EIHA 3H8JA 3K0AB 4NEGA 4KPUB 4TM7A 4TT8A 4RX1A 1PTJC 2P4EA 1X15A 2FSSA 4A8JB 1MEEA 3LT1A 3O4JA 3QJ5A 4LHZA 3WRXA 3DAHA 1RWPA 2NYVA 2XYRA 5B4UA 3D3EA 3V8EA 4LW8A 3ZY5A 3SSNA 1FDOA 3C3CA 3Q7IA 5KINB 4YY3B 3HYRA 1N77A 2JLRA 2IH2A 3HB7A 4XUEA 2E3JA 2AG8A 1NKVA 3C7TA 2FY8A 1HE1C 1SCUB 1YZFA 3PR2B 3R7WB 9ATCA 1DB3A 4C6HA 3EC1A 4UTPA 1TRHA 2B4TO 1MJGA 3F3KA 3GZJA 4R98A 1XZNA 1X8JA 1JP7A 1AD2A 2HZ7A 5A7HA 5JBQA 2PUCA 4LJ6A 3P26A 2I6GA 5JSYA 4D3ZA 4DG5A 2I6FA 5D1HA 7ADHA 5MN5A 3RVNA 1A97A 1XMIA 3FOZA 3S27A 3JAMA 4IGAA 3HCOA 1NBHA 2XXJA 5HFNA 4DRYA 2V8OA 1Q7CA 5HK9A 2IIPA 5JC8A 1I6KA 3WL7A 5A3RA 4RQTA 2JGEA 1YZQA 2HDNB 1L5OA 1CF2O 3EDYA 1DDOA 1M2KA 1OKKA 3A3OA 3KFXA 2IUUA 4GWKA 2J0SA 3KEGA 3IERA 4L3OA 5IJ0B 3DB1A 3DTVB 3C74A 1A5TA 5EWMB 5HWSA 1RBYA 3UJAA 5LIRA 4DV4B 2C5FA 5FL3A 3C41J 5JCZA 2H48A 3MAAC 2WWXA 4MJXA 3TPFA 4Y9TA 3E2PA 4F2PA 4L72A 5CBPA 1R12A 1EFHA 3B3QA 4IZIA 3UMFA 1WE2A 2WKPA 4BVHA 1X14A 3RYFA 4WL0A 2JFOA 4FN5A 5AI8A 4LQ4A 1P72A 4RH0A 5GV7A 2I80A 3PQ3A 4EKGA 3F71A 4KFSA 1HYQA 2DBRA 3AR5A 2ZSFA 5JRDS 3KKOA 2P6OA 3V3KA 4CODB 1V6SA 2WJVA 3DNMA 1XCMA 3QXHA 2HPHA 2GD6A 4MKHA 4L9AA 3ZOKA 4RKFA 3LUAA 3K0CA 2GK4A 1AGRA 4MA0A 4LY0A 2P4QA 2EL7A 3M9WA 4Q7LA 1PG2A 1L5LA 3TSZA 1ZD4A 4B7UA 2O6LA 4AP6A 4BEVA 1N2XA 3EEYA 2GPAA 1J99A 3KAKA 3W78A 5CLFA 1UZLA 3G0CA 1KETA 3L6OO 4UHJA 4Z9XA 1X9HA 1OIWA 4P5DA 3QOYA 4C3OB 2DWCA 4HOYA 3K8QA 1YB7A 2F17A 3JQGB 1DQYA 1M2FA 5DN6D 3TN7A 5K8UA 2I22A 7YASA 4IX9A 2OPHA 3NFRA 1YZTA 4NBLA 1U8FO 1FDRA 2A84A 2CHFA 2K2WA 5A62A 2DHDA 3B78A 5GM1A 1OREA 5KQSA 5C37A 3Q7RA 1AKVA 3JS5A 3ZWWA 4DMMA 3AC0A 3LBFA 3WGMA 3QEJA 2JHCA 2FVYA 4OQEA 3S2GA 3V00A 1Z62A 2WAOA 3AUSA 4NCKA 4QA9A 5DK6A 1BEZA 2VDKB 2F1HA 4OOFA 4LRXA 1CZOA 5E3JA 4OSOA 1Z7GA 4RVCA 3AJAA 3G2NA 1R10A 2WAAA 4KDEA 4OSEA 2VJCA 3TUIC 4E1AA 2M32A 1NNUA 4Y0AA 4JEMA 2WHQA 1W73A 1X0XA 2O7SA 1ONSA 3HCCA 3ZLTA 3LX6A 1U2QA 3OESA 3OU7A 4JSRA 4NY1A 3EIWA 2B34A 3HCAA 3KVVA 2FEPA 4H35A 1WBDA 1M5RA 2CCGA 2NV6A 1XMPA 3D6NB 3O0DA 2ZSKA 3HCWA 5ECWA 3ANMA 3J80A 1S3SA 2QLJA 4OXYA 4EUSA 3I2YX 3F5DA 3SEAA 3WHPA 1Q11A 1UXGA 3QVXA 1M6HA 1E6CA 3ZH9B 1T15A 5J2UA 1Q0HA 3TNJA 4ZDWA 4FHDA 1Z4JA 3PDWA 4M9XA 4QUEA 5DGDA 4DKXA 4EHAA 4EJ2A 3FAZA 4G5GA 4QAJA 3IHTA 3TUZC 3NZEA 3BWVA 2ZAYA 5A0VA 1KOFA 1XJCA 5GZ1A 2W48A 3LK7A 1F8FA 5KNCH 3VPCA 3CLKA 1JIJA 2C2HA 4I5EA 1CC1S 4TS1A 3ZZ0A 4BXOB 4IMPA 3BD6A 5C1OA 1TU3A 4HDKB 3V7WA 5DP2A 1RM3A 2GLUA 1EWYA 4FT2A 2B4AA 2OGZA 3D7KA 3Q2KA 2EQAA 1IN7A 2WOOA 4M60A 5JMTA 2ODTX 3E35A 1ZKMA 4M8LA 5J2TB 1SKUA 2ESRA 3LHDA 3KSRA 1AHIA 2IEBA 3C3JA 4I4NA 1GCOA 4TL8A 3LY7A 5BNIA 3NTQA 1X1TA 4QPPA 1KL7A 1QIHA 1U0OC 5CDFA 1SH7A 4J0JA 5REQB 5IP5A 1T4MA 2DBZA 2G9ZA 4M46A 4U6QA 4OJTA 5F3DA 3UJ8A 2X0NA 2A3RA 3ZHSA 1PJCA 2X15A 3JQ7A 5KVAA 1QP7A 3I04A 1NJSA 2QKYA 1MD9A 3A0RB 2A0FA 3N0XA 4C21A 4IP0A 2YY5A 4EYGA 3O91A 4TRJA 3TNFA 3T5PA 5ALRA 3VR1A 2AYYA 5K4HA 4KTVE 2ZQYA 4OJKA 5EXTA 3IR6A 2X41A 4IZ6A 5KI6A 2HF7A 3E7WA 4BNZA 1WB4A 1ML4A 1E6WA 4HYYA 1KK3A 1I14A 1KJIA 4MVJE 4P2BA 5J2UB 4F2WA 4QVIA 1LZKA 2A78A 2IHUA 5IJWA 2QD3A 3BFVA 3P0EA 3Q3GE 1E2IA 2GYUA 2RJNA 3QI7A 5LA6A 3T61A 1DG1G 1LFAA 2GJ8A 3C87A 1T2EA 5DYIA 3SIRA 2H00A 3SIXA 4ZQEA 1JR2A 1M2VA 2AC2A 1TQ2A 1N3BA 2B7LA 2W6NA 3HACA 2PWZA 1K6IA 2X2EA 3ND9A 4AF7A 4RDIA 5CFPA 2B2CA 4N18A 4WCFB 2XGSA 3WIEA 1YFKA 1FX0A 4WNAB 3ACDA 4D8UA 1UEIA 5EXSA 3GIDA 1A95A 2A35A 5K9ZA 2Q1WA 4JYBA 4Y9UA 5SICE 5BNTA 4OQMA 3I3SR 4IS3A 2V7BA 5EKSA 3A9SA 3OQPA 2J4DA 1XL0A 5JSQA 2YZ2A 1BN7A 4LWPA 5KX5B 2DY1A 4N3NA 4BZZA 4M99A 1NKTA 1GEGA 2EG9A 1E6UA 4V0SA 3ZDRA 4ZU1X 3VDNB 2UYHA 4U5XA 4EPWA 2E85A 3RQIA 4XQEA 1W4CA 4GDMA 2FPWA 3FG9A 3PNPA 1Y4UA 3RF6A 1DG9A 1N2OA 4M7RA 4XJXA 1EK1A 2WJ4A 1QIKA 3SMQA 4KKVA 2ZXFA 3F78A 1EHCA 3QVJA 4EL0A 2OV2A 4UE3S 3DDHA 2V54A 2LNDA 2ZB2A 5CU7A 3TZCA 1O89A 3OZWA 2IZ7A 6PFKA 3A2NA 3K15A 5I4IA 4TSRA 3GOHA 3PRJA 4OBXA 3CVXA 2XGMA 5JSUA 2G3YA 2IEYA 2IEIA 3I01M 3LY8A 2IXDA 3OJFA 2DMRA 3IPXA 1EI9A 1X87A 1QK3A 2HV9A 1Y8RA 1EFDN 3OMWA 1FL9A 4YJHA 3IPCA 3TQTA 2VXBA 1DKQA 1GILA 2R11A 4FC6A 4BGIA 3W0LB 4DV1B 1QYRA 1Q12A 5FFNA 2FLWA 3OT4A 3RKSA 2CCKA 2EFDB 4N40A 4LXUA 2IF2A 4RHXA 3B6IA 2PXCA 1RXSA 4C2TA 1WUHS 1NF2A 2O0MA 4AJJA 1UKCA 4ZYZA 4BX0A 4Z8YA 2EFYA 1QO9A 1SVKA 1NN3A 4WA7A 1RRMA 3DSRA 2DB3A 2B8NA 4KGZA 1YDHA 5DDIP 4FW8A 3ZJVA 3ZLUA 3DE6X 5CDHA 2WHPB 5FTWA 4NICA 1USGA 2EGUA 4RYLA 2J7KA 3OPQA 4K46A 4OXQA 2J7PA 3E3MA 5BN3B 3UWKA 1P9NA 2O5RA 3C6KA 1G5TA 1WA5A 3A1NA 4QC2A 2DUJA 1MT3A 1H4VB 4MW4A 3QPVA 1ZOLA 4F3RA 1CJTC 2JD0A 4PIPA 2X86A 2PKYX 2PBRA 2ZGVA 5AJWA 2I4LA 2R8OA 2ZJ4A 4UHHA 3QEOA 1PEAA 3WTCA 1C9MA 4Y6GB 3IAS6 5ALFA 1HETA 3ROEA 3TQQA 2AG6A 4M49A 4CM3A 4LC0A 1A8UA 5A4MS 1NVUQ 2Q2VA 4FYWA 4X41A 1Y34E 3IIEA 1N5OX 3TEMA 2L42A 1TO2E 1WEHA 3IBSA 3K31A 1P6XA 3KT6A 4I08A 3KPYA 4KVFA 4PTZA 4MJLA 1YD7A 2IZ5A 1JHMA 2QYSA 3KZMA 1FUKA 2QM3A 2ERYA 2CMGA 3E8XA 3PVZA 3DLTA 4RMIA 1TZ2A 4B6OA 4BFTA 4DLXA 1H5NA 3PC2A 3RRZA 3SD7A 5ABPA 3FLEA 2HK7A 4P5PA 2GM3A 2W6ZA 1JDBC 1YJAA 2FHPA 1VRWA 4WQMA 1WDKA 3DEKA 2RH9B 2BZGA 1LV8A 1QQ6A 3BAFA 1WX1A 3E3OA 3BULA 1NUPA 4R1QA 2AFIB 4XARA 3BFKA 3BPSA 3R1IA 5DLQC 2KS6A 5CVDA 3OCWA 5BW8A 1AJEA 3E9ZA 4JZYA 4RDXA 2LV8A 3M89A 3PQCA 4RJ2A 2D54A 2OCKA 4MR8B 4CT5A 5IDWA 1P45A 4U7PB 5DXAA 3VU9B 5LQJA 4KNVA 4MVXA 1I3NA 4CT0A 3R0ZA 1WXEA 2FWBA 3CWCA 2E18A 2VHWA 4CLOB 2FZKA 1A8SA 1R8SA 4G5FA 1JNYA 3AY3A 2DWUA 1NXQA 4MRAA 3ZXYA 2D1FA 4F4IA 3OOJA 1L4HA 3TYXA 5FUWA 2XF2A 3M0EA 5K8CA 2DERA 3ZE8A 3GVPA 2GPSA 3L6DA 4Z4CA 3GLIA 3MAGA 1VFPA 3E27A 1C3LA 1SZDA 4RADA 2HQOA 5CYFA 4YCCA 1YZ3A 3VR4A 1EFRD 3GLFB 4JXKA 2YHIB 4CCAA 3QVLA 1FFXB 1Z7WA 3DOCA 1EB9A 4HUQB 2IP4A 4Q4LA 4N6NA 1X94A 2ZAMA 4ZVNA 3FWNA 2NV0A 3JZMA 2VCEA 3A1SA 1U2DC 3PS9A 3R4CA 3EZ9A 2N1BA 2Z56A 4M3NA 1I2AA 2FMHA 3M83A 4E11A 1L8QA 3EBLA 5TQ2B 4BFSA 5IFKA 2XGJA 2UXDB 2XUGA 3FBWA 5DLPA 1UEXC 4FP9A 1F2TB 3GRZA 2V45A 3AIMA 2JGNA 3E53A 1B2LA 2A94A 4XLTA 4FJ0A 2H5LA 2XB9A 1O8CA 1ZAKA 2NSHA 3A3NA 4NZZA 4QHTA 1B74A 5CLGA 5FYQA 2Q3EA 3K1ZA 3ON5A 3OLXA 3AV0B 1J21A 4W99A 5ILOA 5HTOA 4IUYA 3ONWA 1NYLA 5T64A 4ITVA 1Q95A 4DLKA 4I6JA 1PGNA 1JN0A 2BFEB 3UT6A 2HM7A 4P53A 1XN1A 2QUIA 3W06A 4O5AA 2ODBA 2PRZA 1UC9A 1QDEA 4KPYA 3WLNA 4EECA 4HD8A 4DRXB 1FE8A 4DUZB 2IL1A 5J4VA 1AXGA 2A9JA 1EFAA 1Y5MA 2I1VB 4E1VA 4QAQA 3SLRA 3WQQA 4KPEC 2QW0X 3R09A 2DTDA 5CIYA 5TMEA 4YAOA 1IVYA 1ONBA 4QEZA 2A9RA 2B36A 5SY9A 4KXUA 2VNHA 3RV4A 4P38A 1X7GA 3C6YA 5EESA 2QLBA 2C61A 3R5SA 4FNOA 3UTDA 4EQ6B 5AQ1A 4OYHA 2TMGA 1YDWA 4BE9A 3AVXA 1DFGA 1ZLYA 4M0UA 4YXFA 2R00A 3H1GA 1WHSB 5K0CA 1KGSA 1QPZA 2XYPA 4FVTA 2Z3VA 3CWZA 1YZHA 3JYNA 3MB5A 3DG9A 2OYCA 4Z0NA 1FMTA 1IC6A 1RLIA 1RMQA 3BDAA 4NH0A 5BN1A 3TAHA 2XBMA 1C0LA 5G0WA 5B3LA 5C2JB 1P4SA 3K20A 1Z63A 2BP7A 3ZHBA 2W6PA 2DSTA 2QG4A 3IKMB 3AFHA 2V97A 3GLHA 2FK8A 2R7MA 3KKNA 4ZICA 1AQNA 1LK7A 1T36B 1QCDA 3K4PA 2GMWA 1E7YA 1UJBA 3WNVA 4UUBA 5D01A 4TXLA 4GLJA 2FQYA 3REGA 1GZDA 1V8DA 1NV9A 4K28A 2E4YA 4BB6A 2O0JA 3NC0C 4I50F 3RS7A 4AX4A 3CZ4A 1HLDA 2CK3D 1M1NB 4ZVUA 3IVCA 1AHNA 4P4UA 4Q4HB 4WN3A 3UAOA 1VIYA 4UZFA 4QEKA 4GXRA 4EYKA 2OD7A 3BEOA 3MTAA 3Q3JB 4JUFA 2UUOA 1TL7C 1XTZA 4AULA 2H65A 3K0KA 2R1TA 2C7VA 1MXFA 2QI9F 2WIJA 2Y67A 4GL4A 4ASUA 1XKXA 1C7JA 1FMJA 2YWEA 2AN4A 4X3CA 2BJVA 4QHYA 4YN3A 4DV5B 4OB8A 4NZYA 1KYIA 2B20A 3DEHA 2ZOSA 1W2WB 1TX4B 4S2EA 3ZY6A 2BOVA 3RSZA 1COWD 3PUJA 1FDWA 3NEAA 3QFHA 4N0PA 2QTCA 4G0ZA 2BISA 2QZPA 2H9AA 1J8MF 1QBKC 2QR2A 2YTZA 4OQXA 3LZCA 4RANA 3BE4A 5E6UB 1OU0A 2H29A 2V7QA 2YX1A 1ZL0A 4CR7A 6Q21A 5EMJA 1G3IA 3REFA 2OLJA 3AMVA 3GFVA 1XCOA 4MMXB 2QJOA 3GPIA 3R5KA 3IR7A 4MV8A 3TKAA 3SVTA 1R3DA 3ORQA 3ULKA 1AK9A 1GJRA 2P9HA 4RE6A 1KS2A 3X43A 1FYEA 4M7OA 1T0HB 4PE5B 3T5CA 4QM6A 4HWPA 2JLVA 4LRYA 1RAAA 3TQFA 2JFBA 3E1SA 4JCCA 1YJ5A 2ODAA 4LVUA 3KDAA 1SVLA 4K87A 4OQFA 4HX9A 1EVKA 4J07A 1LKZA 5H02A 1APBA 1CS4C 1OFIA 2PVPA 1AS2A 1PJTA 2ZWPA 2P9ZA 3QJYA 3VYSB 4ARZB 1JH8A 3U4DA 4EMTA 1ECFA 3DZHA 2W2KB 3D6VA 4LXHA 4IQ0A 3QPBA 3SBOA 2FKNA 3UB3A 1QRRA 4FX5A 3LWZA 2HSJA 5GONF 3C1UA 2P77A 2R8RA 1UT5A 2VF2A 1NKSA 2FRXA 5HGXA 1VCHA 5HS6A 1ZD3A 2CLEB 3F46A 4ND3A 2WWYA 3I62A 3L7AA 2NSJA 5D3MB 1ZISA 2EGGA 1M67A 2AXNA 1U3FA 2JD1A 4LTMA 3CXRA 4TSKA 1EGVB 2OQ2A 2VDVE 3OFSA 3I6YA 4CPDA 1KP2A 2BI7A 2PMDA 4JVNA 3S3TA 5BNZA 4PC6A 5JPCA 3C3KA 4X66B 1WCWA 4XSHA 1XL1A 3AHDA 1PGPA 1PZXA 1YQUA 1VJDA 4HNAB 3DDCA 3IT0A 3LVRE 2ILVA 2OORC 3DPIA 1L4GA 1HFEL 4RULA 2G06A 1RKQA 2Q8PA 4CWAA 2JEZA 3FCAA 3L2OB 1YQEA 1D4AA 4H3SA 4H27A 4HZUA 3UT0A 4DWOA 1ZSYA 4OHKA 4RPJA 2XE8A 3KR2A 5EINA 4L28A 3W8FA 1EDBA 1KGDA 3WGZA 1KVRA 5JFOA 4RBNA 1QFJA 2QD1A 3GBVA 5H7XA 5BUQA 2HYIC 4TVSA 3TIFA 3C6ZA 3PIRA 3IPAA 1TF7A 1R0ZA 2CUZA 5IYZA 4DA9A 3RIYA 3AJRA 4BNUA 2EIXA 2WV9A 3VNVA 1WSDA 1HQCA 1I7LA 1SXJC 2FPKA 4D9GA 1XCJA 1JLSA 4W6QA 1R4NB 3IAEA 1HYEA 3THOA 2HEIA 1N2BA 4R8KA 2Q5EA 3ND6A 2FWJA 2P8JA 5AVRA 4BU0A 3ZBQA 4B76A 1DXOA 1G3UA 5BR7A 3P32A 4KV9A 3I73A 1GYPA 5EZ6B 3NOXA 2JIOA 4HDNA 5T8KC 1YU9A 2CSXA 1Y4SA 4EG5A 1VMDA 1W1WA 2IODA 3EDMA 3FB4A 1GXSA 2QRNA 4PYRA 3HK2A 3CVYA 3QVKA 5CITA 4V1CI 1G6HA 3FTQA 3DT8A 3R40A 4HX2A 1Z0ZA 2AYXA 2I3ZA 4L0CA 5F3RA 3AEXA 2VHEA 1A9ZA 4DCNA 1KKLA 2XUFA 5HJ2A 4BX9A 1O0CA 2NT4A 2D06A 1KFJB 4UU0A 4E5SA 1W0KD 1SWVA 1H4SA 1G8MA 4R81A 5U1PA 1GT91 1OC4A 1AHPA 1BQEA 1VG0B 3HSSA 4KFCA 2JZOA 3DTTA 3KXDA 3JVUA 1DUVG 3R3UA 3EASA 1TKBA 4YGXB 1RAEA 4DCSA 4BOYA 4B79A 2QYHA 2CJWB 3C3XA 4NK5A 4RZIA 1GNVA 4ZV7A 4CDMA 4CM8B 1PWXA 1U1DA 1E3IA 2VPZA 3HU2A 4DM4A 4FZRA 4JMPA 5JNVA 4K86A 3FMGA 1G5IA 4ENQA 4L5AA 3R6WA 1EGQA 5H81A 2NSYA 5HBGA 3V55A 4E30A 2O3UA 3IP5A 2P9CA 3UMCA 3WS7A 1TW3A 3BHNA 1DC3A 4GPBA 3GQBB 3DWFA 1BDHA 1J22A 4PRZA 4I1RA 5EGSA 2MSNA 4I19A 4ZARA 4YRKA 1GP2A 1UDCA 2OV8A 1QHHA 4GGMX 3H3XA 1UC5B 1NR7A 4CKXA 1YJCA 3M5WA 1MJNA 3ND5A 1Z6XA 3F49S 3TLAA 4MA5A 1YQGA 3U17A 4DY6A 5HIJA 1A5AB 3ZJTA 3ADDA 1M0WA 1E5LA 3V1UA 5L3SA 5EMKA 3QP9A 1PW7A 1XA0A 4R5HA 3ZU5A 1KQGA 5ITWA 4IWYA 2H57A 2P8SA 3JXEA 3OEYA 3RV3A 2XLCA 1GFIA 3FDXA 2QRLA 3P2YA 5I7OA 4N47A 1QU3A 4Q47A 2ZB3A 3AUTA 1OHHD 1RRFA 4XFDA 5IKMA 1RYDA 5JDCA 3MCWA 4UHEA 4WBNA 4NNPA 5BYKA 3PRKE 3CRQA 1LPOA 4FONA 4J43A 5DWDA 4JIGA 721PA 5F23A 4D8TA 4OL0A 3ZVMA 3RJ5A 5HCUA 3HB0A 4Q4DA 2XOKD 2QBYB 1NLUA 1P80A 1M34B 4QE3A 5ALJA 3T52A 2YOFA 5FD8A 2AYZA 3PWZA 1OB5A 4LZZA 2CT8A 2BSXA 2ZR8A 4X24A 3JWEA 2R6JA 1WU8A 2I33A 1K06A 4N0EA 4EO9A 3AT1A 1YDMA 3IOBA 4YP7A 4QOHA 4DMUB 5ESDA 2HHCA 1YIDA 4RIGA 1QE0A 2KMLA 2NO1A 2H1RA 1E2NA 3N6RA 3IV6A 4UASA 3WBFA 1L9KA 3ROZA 3FHTA 4UHCA 4EBBA 1MP0A 4ZIRB 4B81A 3IAXA 2CXTA 3OA0A 4ZDKA 1N2CE 1HRKA 4KBFA 3H99A 1LVHA 1KA9H 2K5UA 5CA0B 5ADHA 2O52A 1QHIA 2DC1A 1WXIA 1WXWA 1JHUA 1WAMA 4DMGA 2JLXA 2R0QC 4Z9BA 3UK0A 1E62A 2BHTA 1XK6A 621PA 3KUDA 1A9TA 1FMLA 1I0ZA 3I58A 1S2LA 3SK0A 3QLUC 4BQRA 2BBOA 4MX8A 4DQVA 4WLEA 4EHFA 1H6DA 4M0CA 2DFKB 1QE5A 3N2ZB 2WTEA 3WGYA 1D8AA 3WWOA 4BE4A 1E3MA 1A77A 2PGOA 2ORYA 4D97A 4BNWA 4F91B 1QTQA 2NG1A 5JSKA 2WJWA 1CK4A 3U1TA 3JR7A 4CTKA 1DC4A 4M0FA 6ABPA 4AQ7A 1EXWA 3FBTA 4QFMA 4B3BA 1OLXA 1USIA 1VB5A 2F3TA 2QUAA 1SRQA 1M6VA 3BTVA 3DHNA 4O29A 2B0CA 2BD0A 1DJLA 5GOZA 4BC0A 4DR2B 5E4JA 4O4IB 5E9AA 4ZJYA 4Y1RA 4WT7A 2FQ1A 4JVLA 1NW9B 3AYZB 1YUNA 5JU6A 1SQSA 1LUAA 3T6KA 1JHYA 1XD2B 2H7YA 4ASUD 1S1MA 2EZ4A 1SC4A 3GD7A 3IUBA 3QELB 2X9VA 4JBIA 1GLNA 2WYOA 3A9RA 4PC7A 4PTYA 4E46A 3R0JA 2CXXA 4JELA 3OJLA 3HY3A 2EYUA 3CNEA 1BS2A 3I01A 3V80A 4HPXB 4XEHA 3DCJA 1Z2NX 3NMUF 3N05A 4LNHA 4RD3A 1ZWKA 3GFTA 3QH4A 1GG2A 3GH1A 4M1SA 1A4RA 4BQEA 3BD7A 5JAPA 2NYAA 2GDJA 2GN8A 2HIAA 4B7ZA 5ICSA 3IVGA 4UEJA 5ALKA 2BPOA 4S1TA 1JKMA 1RAHA 4ZI3A 1TA4A 4OOEA 4NG4A 4P34A 2Q9AA 2P6NA 2BGWA 3TW8B 3H84A 1USUA 2XZDA 3HO1A 4KPFC 5J4LA 4AY2A 1V48A 4IX1A 1E9BA 1BYUA 1IJEA 2R7KA 1W581 2WVGA 4IPTA 4JLBA 5JOQA 2OBBA 3Q8MA 3I6QA 3C45A 1C7IA 3F5MA 4B2IA 3VZBA 1N92A 2IHYA 4L51A 1JDSA 4IGKA 4LDRA 5TQ0A 3H9CA 4A0FA 2VA9A 4DV6B 2R48A 2PD3A 4IHJB 1FFWA 2A8YA 2VXOA 4LGMA 4MMYB 1H2AS 1KFCB 3LWNA 5DBIA 2BDUA 2IS6A 4G85A 4NAVA 4CKCB 1FSFA 1M8PA 2QD4A 3ASZA 4BP3A 1WPGA 4UBLA 1JH9A 1V3UA 3D8UA 1IZZA 3ZY4A 1XAJA 5DSZA 1ISMA 2C4HA 2O8BA 3QV2A 4G01B 1F48A 3L1VA 2O19A 4A36A 4EGFA 2AZDA 4V0KA 1BA2A 5DT2A 3B38A 2BWJA 4KZPA 4M8KA 1KZGB 3AEQB 3DVAA 5IK2D 3UENA 3OCUA 4ZCMA 2UZAA 1GDTA 4BZQA 1IIRA 1LGYA 2QAGB 2VBGA 3DMPA 4TOIA 2EX4A 1VHQA 3QI2A 2EDCA 4RDHA 1FU8A 2IOQA 5LZ5A 4DJAA 4Q9KA 3E1KA 3E2IA 5ALMA 3AVOA 1YS6A 1XMVA 2ORWA 3G6KA 1G41A 4WHMA 4KSYA 5ADVA 1DRVA 4J3JA 2PQ2A 4D99A 4PZAA 4D42A 1Y1KE 5BN5B 4AKEA 4DQXA 4O2BF 1USVA 3KTAA 3EUFA 4GP9A 4HBGA 4WTOA 1Z68A 3KYBA 1IY8A 4IXTA 4MQ6A 4UEQA 5TQJA 2F1KA 2VQ6A 1I1NA 5K3DA 1TCBA 1XA3A 1YVUA 1L5ZA 3TD9A 1TUBB 4C08A 4I4LA 4PG6A 2GTPA 5IARA 4O2AF 3O5AA 5IC6A 1YRHA 4WOBA 1NF3A 2ZVQX 2GJKA 5B7PA 1EVLA 2AQIA 4IHJA 4WV3A 3ABOB 3ZXXA 2Y1FA 4YJ2B 1NVBA 3DC2A 5AW3A 3BL6A 1I7DA 2GK6A 4DIOA 1Q0QA 1T4CB 1MIOB 3B3AA 1GZ4A 2JFXA 4KWEA 3CLUC 4LMBA 1R8JA 4I2NA 3V7FA 4TUYF 2Z8YM 1F20A 2VT2A 2W4IA 1F5NA 1WV1A 3WK6A 4EB6B 1T8RA 2H63A 5KNCA 4G67A 3NHBA 2DKFA 1A2QA 1RAGA 3KOUA 3QKRB 2RHWA 2I66A 4QDJA 4ZO8A 3VVCA 4WBXC 2B83A 4G1MB 4HI0E 5HW0A 3DBHB 2M6SA 4CV1A 1KVUA 1YR2A 1C9JA 2Y1EA 3BRSA 4GW3A 1YB5A 5INTA 1YIOA 1HG0A 1GOTA 1X7XA 2WZCA 4ZVVA 4BO5A 3WLJA 4N41A 2BTQB 1VDZA 3N2NA 4U7JA 5K3BA 4PXYA 4DDMA 3NHMA 2P41A 3E4CA 4MSUA 4N3CA 4PV7A 5CM9C 3CJTA 1RE1A 3I39X 1P19A 1T91A 5ALSA 4D4KA 4EG1A 3QYAA 4E5MA 2FAXA 3KB2A 3SFZA 2XODA 1P18A 4OU5A 1D0IA 2BUAA 1ZL2A 3T0FA 4YIHA 4ZGGA 4AUNA 2AOXA 4WZBE 4R2MA 4E08A 1M1UA 3SZMA 4M1OA 3KTOA 4L78A 1GCGA 4RTQA 4Z7NB 1BSVA 1EMDA