4IGIA

Crystal structure of the collagen vi alpha3 n5 domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
197
structure length
197
Chain Sequence
EKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagen alpha3(VI)
publication title A structure of a collagen VI VWA domain displays N and C termini at opposite sides of the protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 72
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4igiA00
3K71B 4HQLA 4PN7A 1DZIA 3E2MA 3PPXA 3FCSB 3TW0A 4Z7NB 5KYUB 1QC5A 1IDOA 1AOXA 1M2VB 1T0PA 4A0QA 4C2BA 5KYXA 5KYYA 4F1KA 4JDUA 4CNBA 2NVOA 5E6RA 1FNSA 1XUOA 4CN8A 5KYWA 1CK4A 2ODPA 4WJKB 4C2AA 1M1UA 4UM8B 4BJ3A 3GXBA 2NUTA 3N2NA 3VI3B 2ICAA 1U0NA 1ZOOA 3BQNB 4NENB 1RTKA 4MMYB 3EFOB 1IJBA 2VC2B 4F1JA 3PPVA 3EG9A 2WINI 4IHKA 4UM9B 4C29A 3HXQA 1SHUX 1LFAA 3PPWA 1N3YA 3M6FA 3NIDB 5E6UB 5HJ2A 1XDGA 1OAKA 1RRKA 4WK0B 4M76B 1ATZA 3EOAI 3FCUB 1RD4A 1ZOPA 1MQ9A 4HQFA 3V4PB 2ODQA 1CQPA 1JEQB 2VDOB 2VDQB 1SHTX 2O7NA 1MQAA 1Q0PA 2VDNB 2XGGA 3NIFB 3QA3E 2NUPB 5LN1A 3K6SB 1DGQA 1MF7A 4FX5A 1QCYA 2IUEA 3RAGA 1M10A 5KYUA 1JEYB 1M2VA 5BV8A 1SQ0A 1PD0A 2QTVA 1BHQ1 3EH1A 3K72B 5KYWB 1AO3A 1MJNA 3T3PB 1BHO1 1RS0A 1U8CB 2XWJI 1IJKA 1MHPA 5E6SB 3F78A 4Z7OB 1M1XB 3IJEB 2X5NA 4XW2A 3ZDYB 4IGIA 5KYNA 4NENA 3EGDB 3ZQKA 5HGJA 3EGXB 2I91A 3EFOA 2M32A 4Z7QB 5ES4B 1L5GB 1AUQA 1JV2B 2VDLB 3BQMB 4DMUB 3PPYA 4MMZB 4G1EB 4NEHB 1FE8A 1QC5B 2I6QA 3TCXB 4IXDA 5E6UA 3EOBI 4WK4B 1JLMA 5KYXB 5KYYB 3ZE1B 3ZE0B 4WK2B 5E6RB 4CN9A 3HI6A 3ZDXB 1U0OC 1JEQA 1UEXC 3BN3A 2NUTB 2I6SA 4G1MB 3VI4B 2NUPA 3K6SA 2B2XA 1N9ZA 2VDRB 3IBSA 1JEYA 1PD1A 1M2OA 1PCXA 1NA5A 4UM9D 3EG9B 5HDBB 4MMXB 3NIGB 1YVRA 4HQKA 3ZE2B 1IDN1 3EH2A 2VDKB 3TXAA 2ADFA 5E6SA 3ZDZB 1ZONA 1PT6A 4HQNA 3TVYA 1TYEB 3F74A 1XDDA 1MQ8B 4O02B 2VDPB 2XWBF 3HXOA 1V7PC 3Q3GE 1T6BY 2WW8A 3EGDA 4WFQA 4HQOA 3V4VB 3EGXA 1YVPA 2VDMB 3T3MB
chains in the Genus database with same CATH superfamily
5JW6A 5BQ3A 3T7KA 3GRYA 1CDOA 1JAYA 3LLVA 2Z2YA 2X8JA 4QFMA 1J8MF 1IEVA 2Q62A 2YNMC 1TIBA 3HBAA 3OMWA 3OURA 4JBXA 3VGPA 5LLTA 4BNIA 4X6LA 4DZTA 2NZXA 4HNGA 1U1GA 4JLNA 2QHXA 1YI0A 5KVQA 2WFMA 4H7EA 1HX7A 4YEDA 3TGPA 3H5LA 421PA 1E1QD 1TQ6A 3W9YA 3CUSA 4JKYA 3C6YA 4MV1A 5MGNA 3IIMA 1D4ZA 2QORA 1ESDA 3BWVA 5ED0A 1CDEA 2NV2B 5LP1A 4KQHA 3U6KA 1SQFA 2QX8A 4RGBA 4Y2YA 1E2QA 1XMVA 3B36A 2WINI 1OYVA 1G63A 3CCCA 3OUUA 4YO7A 2BGGA 3E2IA 1C29B 1GPWB 1YZTA 1Z5PA 2VHJA 4NR0A 3RSGA 3Q8MA 4L5JA 1R0ZA 1DT5A 1E77A 4DCOA 1LY1A 2W2VA 3KAQA 3KYIB 3MMPA 4E15A 1BW9A 4YMUA 2NUAA 4AICA 1HFWA 1DELA 3U3ZA 1QYCA 1VE1A 4WIAA 3K9QO 1YC2A 2IVZA 2P11A 5GGXA 4B8YA 3QFSA 5HQTA 2FEKA 4HDOB 3IULA 4NJMB 4GNRA 4K6KA 3LWBA 4IYRA 1Z0SA 4ZAVA 2B98A 4EJSC 4G5HA 5FUVA 2B2NA 2BFDA 4OAPA 1E5DA 1R0CA 1YRYE 2ZI3A 2EJWA 3L0OA 2XADA 4PSKA 1OVMA 3CVOA 1W5EA 1QHNA 3Q40A 4E5VA 3OQHA 2MMGA 3BREA 3CH5A 4OQNA 1QRDA 4P92A 1KYIA 3NG1A 4HDQB 4Z9AA 5AVOA 1ST3A 3K1ZA 2VYFA 1W4LA 4ZK6A 3AVXA 4D9JA 3SX2A 1GPYA 1NUQA 4ITRC 4KVZA 3H3FA 5TMBA 3F46A 3CVXA 4QNRA 3MM4A 4QYMA 4LIPD 3UJAA 4G41A 3W7VA 4A23A 2D5AA 4DBLE 3GN1A 1Z6TA 3NYRA 4MICA 3MS7A 5CH5A 5FA8A 1ODSA 2IITA 3WQSB 4GKAA 4O29A 2ZSHA 3QMMA 4EW3A 4CQJA 2PZJA 4LCJA 2JLCA 1AUVA 1U3TA 3CRRA 3IV7A 1W0JD 4RJIA 3RNOA 3C8ZA 4EKGA 1XK7A 3IYLW 4RK1A 2NTEA 1WETA 4DCSA 3LU1A 5B2EA 4D9MA 1KTIA 3UMSA 2H7XA 3T4UA 2CK3D 3DBLB 3HVKA 4CV3A 5J4KA 2OVBA 3KBOA 4E2WA 2PS1A 1M6WA 3KB2A 4IJMA 2P6RA 3F3MA 1MO4A 4QLAA 4EENA 1EBUA 4D4HA 1L7VC 5FDFA 5G41A 4LZLA 1FMCA 3VX4A 1Z0IA 2H2IA 4N0MA 1VA4A 1GAWA 3UFXA 3J81A 4CM9D 3V1YA 5KNDA 1KNQA 3KJHA 3F74A 5JXWA 1MQ8B 2DLDA 5LQMA 1HDZA 2O8FB 3IP7A 4HR7A 2C95A 2PUTA 3DEKA 3H99A 4K3UA 1XZNA 2VT6A 2P77A 2I1QA 4JXZA 1HF3A 3L4BA 5DBHX 4BZWA 3VC2A 2CXTA 3AGQA 4MYTA 3LHSA 2YOFA 3GGPA 1IQ0A 2PX0A 1KJJA 2C3PA 4MRAA 3KYDA 5KVSA 4MRMA 3QI7A 4GRDA 4CM3A 5KUTA 2B7LA 3N6RA 5CT6A 5B1SA 3VM6A 4P53A 1AKUA 5BSRA 4B6OA 5JISA 3OA2A 3KXKA 4X1OA 1EJBA 4P38A 3I3SR 4ZEMA 2B1QA 1EZZA 4YRSA 3T9BA 1FSFA 3GRRA 3JYNA 4LVOA 1R00A 4PHHA 1PG0A 1X7GA 1US8B 2D1FA 1AB5A 3H11B 2JHGA 1JAIA 3IC5A 4M54A 3FF1A 2QNBA 2H7VA 1CUYA 1YA8A 2H4XA 4FYVA 3S55A 4XPZA 2I76A 2I9PA 3EZGA 3F6CA 3LW7A 4XLZA 3SYLA 3FUVA 4ACAA 4BV2A 2JIZD 2ZIXB 3IEKA 2AOUB 5B3AA 1U2SA 2F7SA 3IP9A 4J94A 4F71A 2GD6A 3PPWA 5THKA 1LNSA 2CSUA 1TX4B 2H2HA 4BQNA 4HHEA 3GU3A 1B6RA 2D13A 1DC7A 2QM7A 4JU9A 2G40A 3KR2A 3GLQA 3O4VA 5EMKA 3ITEA 3L6DA 5JBNA 2ZSEA 3N39C 4NK4A 1YB4A 4U2DA 4G1BA 2H0AA 3C0KA 1IHXA 3KWFA 4IJUA 3O38A 2HK9A 1Z2EA 4Y98A 3HQ4O 1E20A 5COBA 4DSUA 4W8OA 4IH9A 4O1HA 1R4NB 3OJLA 3VNBA 3PNYA 4CYMA 2H2DA 1RS0A 1XCOA 4QJ5A 5DCWA 2Q8PA 5C3MA 3OJ0A 1H6BA 1YTLA 2D0PB 1L8XA 4LVNA 3CKKA 1KHTA 1U3DA 3FXAA 3BJIC 5CTAA 4PRYA 1VGVA 3PXUA 4KRYA 4WVLA 3TF5A 4UUBA 3OETA 3OP4A 2OYRA 3DCNA 1GNLA 4AJKA 2PXCA 4KPEC 3SS8A 4M98A 4MVWA 5G3YA 2IYXA 2VDLB 1YRBA 2ZM6B 1RU3A 2PWPA 3P9XA 3WHLA 1ZAYA 3OCCA 4JB2A 3F9RA 1I7PA 1ZUIA 1W30A 5F3DA 1M34A 2J0QA 3MQ2A 3USCS 2XHEA 1WIWA 2XVYA 1X15A 4ZT3A 3V1LA 4O2RA 1YUBA 4BV9A 5EJGA 1TM5E 5HEKA 3L18A 1Y89A 3X1KA 3O47A 1BEZA 1Q57A 3SYNA 4BQOA 2E4UA 4DQXA 5LZ4A 3HB5X 1CUHA 2EATA 1HI9A 2FDXA 4S35A 2FPIB 1UPTA 2Q5EA 4FSXA 4J76A 4ZVKA 2HCJB 2GM3A 4HAZA 3RV4A 1OZGA 2I67A 4KP7A 1DCKA 721PA 4TUYF 3OFKA 2PMEA 4GPAA 5KX5A 1EDBA 1DKRA 2JIQA 5H82A 1O95D 2Q4EA 3N8GA 1FFAA 3K9NA 4FE3A 1BU8A 3PF8A 2B0JA 4C1BA 2IYRA 2ZRGA 3UT5A 4HSGA 4YNBA 4QOGA 1GQSA 3BDVA 3C6XA 1WU7A 3IQXA 1HEYA 1N1DA 3W4KA 3JD1A 3DEHA 4TVSA 1FZQA 5EE5B 1N2IA 4U7PB 1AJEA 2C9YA 3L6CA 5AIBA 1J70A 2ZR9A 3AILA 3GUUA 2DFNA 4V3CA 4R1NA 1OBCA 1GVNB 1XZ8A 2IZ5A 1VYHA 2Q1TA 5L3SB 1I7QB 5DTQA 3RJ9A 2VI5A 4KEAA 1TUEA 4RJTA 1R0XA 1TK2A 2QPLA 3N53A 3RD5A 1SKBA 3I1IA 2VK4A 4XI9A 5KZMB 2PYIA 4Q9IA 1KZGB 3FTDA 5DSXA 4G23A 4B7AA 1FX0B 5BQXA 2BM8A 3BHNA 2H4ZA 4HL6A 2NQTA 1DXYA 3RS5A 4YRIA 3LPLA 1YBFA 4CETA 2FDCA 1YS7A 5AXAA 1P72A 3WB0A 2R5NA 2PKQP 4CU5A 4RD2A 3CN7A 1GNVA 3O2SB 1PR0A 5GOZA 3GFPA 3Q10A 4WLNA 5CGQB 4YMWA 3ZIAA 2C58A 1O6CA 1SIWA 5I7AA 1PNQA 1KI1A 1QHHA 4Z54A 9ATCA 4KW7A 3LPAA 3UGJA 5IBCA 3UQZA 1TIKA 3AHFA 1JL3A 1GCAA 4HPWA 3S2ZA 1VJCA 5L8VA 2I7TA 4C2UA 4GOJA 1USVA 4WK0B 3N8KA 2XE8A 1G20E 1E4YA 1ZA1A 3TTWA 1PJ8A 1E3MA 2RIPA 1DZ3A 3AF2A 3OZGA 4DLNA 1HG0A 4MVJE 1DC8A 4QUAA 4B2IA 3UHJA 1KVQA 3HXPA 4M1OA 5HYVA 2IV2X 5CIWA 1KAQA 2LZ0A 4XA8A 1M2VA 3IA7A 2Q5OA 4F11A 1OFUX 4BVHA 1P3DA 1PDWA 4K8RB 4QBFA 4ND3A 2IFTA 1ZNWA 3LC1O 1SPXA 3AVPA 1N6OA 4ZVVA 4D9NA 5AI0A 1KDPA 3DNFA 1FTWA 1DKQA 3L1UA 3DEFA 5LU8A 4PG7A 1Z5VA 3JQCA 5EERA 3LYLA 3AUXA 4LTNA 4S2EA 4PNZA 1NJ2A 3OQVA 3ILHA 4JMPA 1KFKB 4ARSA 1MU0A 2JGRA 1BGVA 3SEAA 3TSCA 1U2PA 1EFRD 1W44A 4ONEA 2A33A 3T54A 3RVMA 3SYRA 5KOHA 1QPBA 1P3JA 2NZUG 3ZXSA 4RY0A 1BMDA 3E4CA 1UOEA 4WDQA 1CS4C 1TZCA 1Y9JA 2E21A 4TQ9A 4XGKA 4BOYA 1E2EA 3IO3A 2Q3JA 1SULA 2G0AA 3U7FB 1EVIA 1LCIA 4MCHA 1TTPB 3KEFA 3GVHA 1MEEA 3AUSA 1M8PA 3GEPA 1RZUA 3B2QA 5EEGA 3VYWA 4FM9A 3AXTA 4YV0A 1XMPA 3S2EA 1TW3A 4JJZA 4WVFA 4V24A 4M0MA 4OXYA 2EGUA 4PS0A 3NCTA 4TXNA 1DAPA 1LX7A 3G2NA 2X86A 4J7CA 4JELA 4BNYA 4QPZA 3UK7A 2CBXA 1PCXA 3K5PA 4MRPA 1BX3A 3CIFA 3U6BA 4ALNA 4OHYA 1QFMA 3VTAA 2DQYA 3MFYA 3ZV6A 1ZIOA 5IAOA 1ZK1A 2XQGA 1CZNA 1TLTA 2XYRA 3A1VA 3IE0A 2GEBA 2GK6A 1TCCA 3K2BA 1AY0A 3OEYA 3PFFA 4NMWA 3SLRA 1KC3A 1XL1A 4BNTA 2M6SA 1B2LA 4QASA 1QS0B 1NNLA 2JLVA 2CXQA 4G4JA 2X4IA 5IT5A 2VDMB 3NTLA 3O8DA 1G8GA 1Y8QA 1PP4A 2RONA 3LNCA 4KPGA 3HFJA 1U0RA 3RUDA 5FR2A 2H9YA 3NHMA 3A7DA 3TW0A 2YFHA 3ZOKA 5KYUB 3FPSA 1AOXA 1EWYA 3LC2O 3TPZA 3KQNA 4A0SA 3N70A 2YIVX 1RAFA 2PGJA 4DQKA 2IZ6A 1S7GA 1YONA 2PKEA 4R5HA 1ML3A 1N7HA 4RLQA 4GXTA 1I7NA 4EVSA 5C31A 1APBA 1EX1A 1YMUA 3NB0A 2XCSB 1MXHA 4YP1A 3H7IA 3UB2A 4OSOA 4QVIA 3S0JA 1IVYA 1YUMA 4V1CB 4XJVA 1NVEA 2JLSA 4OQLA 4EUFA 1QZ3A 4HX9A 1DTSA 3T5TA 2Z1MA 2FZLA 2KLBA 2Y0DA 2BGIA 3HLYA 1EFVA 3AJEA 2B69A 1MOQA 3G79A 4G0YA 1PV4A 2WSYB 4F9GA 4ER0A 5JZSA 4PLVA 3GA7A 1FDWA 1Z6ZA 2VRCD 3AB8A 2AVDA 1OWNA 3LAWA 4KLZA 1V96A 2H0QA 1I1NA 1RBQA 2Q46A 1ETUA 3HABA 5HK9A 5DEOA 2GZRA 3A4NA 3C70A 1UKEA 3DZKA 4O2AB 1JU9A 3ZWYA 2IPOA 2VJKA 4O8CA 3NVKI 3DT6A 1WZIA 5B3LA 1G41A 2V65A 4QE3A 5EN4A 1GCUA 1HO3A 4RXTA 4MKHA 1YCHA 4BNVA 1BDIA 3KJFA 4O63O 3DDWA 3O8QA 4F45A 2XCQA 3KEMA 4JBLA 4MUGA 1VSQA 3FIJA 3AI2A 4MR9B 2C9DA 4ETWA 2XNDD 3CUWA 2J0SA 1H2RS 3JALA 1TM2A 2YHIA 3LK6A 1RABA 4D98A 5DYGA 4HN9A 1GUDA 4CR8A 3E1KA 1K6EA 5M04A 1EHYA 3VO8A 3X1MA 5K8LA 2VRBA 4P0TA 4PBRA 2WQZA 2ZAMA 3UXEA 2ZB8A 4QULA 1A4UA 2CFSA 3CF6R 5A05A 4Z2YA 2OK7A 3IP8A 1XZLA 3OEEA 4EF5A 4UM5A 4ENPA 3FTEA 1UMBB 3AV0B 3VKGA 5AW5A 5IRCD 1H1LA 1VG0B 1RRPA 3LBAA 4HD8A 2JL1A 3X2SA 3MBIA 1Q1GA 2PZEA 1CUBA 2NSYA 2PR7A 4TMWA 1L5HA 3WGZA 3WX0A 3ZHOA 1JTFA 4JP8A 4DLPA 3DS8A 4WY5A 1RQNA 1GRCA 4L5CA 1KJQA 2HRBA 3OO0A 4H0FA 1NUUA 3M4ZA 1A04A 1C80A 3OM1A 5JC8A 2Y71A 1JEYA 5EIFA 1EUDA 4P6VF 2PA0A 4EFDA 3INRA 3ZW9A 1PL8A 2WHRA 1LQUA 3LX6A 3GLFA 4S24A 2H4JA 4WD3A 2VXOA 2JCSA 2HUPA 1PDVA 1PQPA 1PUJA 1GCIA 3N2ZB 4XR4A 4YV2A 5JC1A 2CV0A 2AHRA 5DK4A 2E9SA 4TYQA 3L1JA 4R1OA 4MPDA 5AUOB 4X9XA 5FO0A 4I3GA 2J0UB 1II9A 1KJWA 1VI6A 4D25A 4K46A 3G17A 3AEYA 4MUYA 4M88A 3SCZA 4A91A 4YMGA 3AL2A 2ZYGA 3E9CA 2IQ5A 3ETCA 1F0PA 5C7IO 2L42A 1FS4A 4XKJA 2PZBA 2C3MA 5I8WA 3UJ6A 1XCBA 1BVYF 5DPMA 3ISJA 2H48A 3MLBA 3PLRA 1M8KA 1ACJA 4K5QA 4U3JA 1OW3B 3H3JA 4FYKA 1SCUB 2VQDA 1AGXA 2R1TB 4II2A 2FPWA 4N03A 3RUPA 2ZSAA 4DLUA 4CNBA 3MT0A 2W93A 2OHVA 1JFFB 5T7BA 5A4MS 1NJ5A 1EH5A 1Q1QA 2YY5A 4ENTA 4J75A 1DPFA 4GPBA 2MSWA 1IN6A 1U0BB 3MA0A 4ZMBA 3EE6A 4RCYA 3TOZA 2UVDA 4WY2A 1CY6A 1HUQA 4ZT5A 1GARA 2Y2UA 1N4DA 1SQ5A 2FZEA 2WTEA 4HNRA 1B41A 1P4AA 3AFNA 3Q5DA 4PQEA 1VL1A 2QRLA 2ZUVA 5SYMA 3TSZA 3ZXIA 5IT0A 2AJLI 3OOEA 2EP5A 2PFGA 1GOTA 1VKNA 2RC6A 2HF8A 2ADOA 2HJVA 3FGNA 4RHTA 4RF4A 4XE5A 1JE0A 3TQHA 4CL8A 4UTPA 1F2VA 2Q1YA 1B15A 3CWQA 4YUYA 3IDQA 3LZ6A 2CHEA 2UV8A 1TNDA 5KIAA 2IYVA 1Q74A 3TUZC 3RC1A 2PH7A 3SNHA 4LNUB 2B5WA 3FVQA 1RI4A 1G1MA 2JC3A 4K88A 1Z5UA 3I9V6 3Q3IA 5DJ5A 4X0EA 1KQNA 2FFAA 3U4HA 4I5FA 3VPXA 3ZBQA 2G1PA 1HLDA 2O52A 4L3VA 3WO1A 1JIQA 2Z2ZA 3GQBA 1LTHR 3IA2A 5T57A 4KKVA 2WB4A 1V3VA 4LGYA 2GBPA 4JB0A 3OE4A 3T3EA 1KBOA 4A27A 1U99A 5CDHA 1WNFA 1Y42X 2V9CA 2P3OA 3AY7A 2G9NA 1VE5A 2W8ZA 4YRLA 4CHTA 5C7YA 2AZTA 2AV6A 4HYYA 1CZRA 1U6JA 2D5CA 2GN1A 4EDHA 3B7GA 2OKCA 1GPJA 3IEMA 3MOIA 1I13A 3K30A 4JC8A 5IEJA 5KYKA 3AWIA 4FPXA 3D0QA 1VLQA 1H94A 4FHEA 4MGHA 5JXGA 4BVEA 1HT0A 5C51B 3RK4A 1NMYA 2R2AA 1HURA 2VHUA 3QUAA 3S8MA 3P9SA 2NO5A 3T5PA 2Z3WA 1DFHA 2XB4A 3PUYA 4LZJA 5GWXA 5BN4A 5AVWA 5JJBA 2ZRLA 4HBGA 4L75A 3TW8A 2VJAA 3IMEA 3KZMA 2XT9A 3EVFA 2ZG6A 4MI6A 1TK9A 3D81A 2GEJA 4DN6A 2WILA 1GV1A 3K16A 5BPFA 1VJ1A 2P9EA 1NQAO 3FTPA 4BECA 1QKIA 1C9JA 5NLLA 3WE7A 5KTTA 4P3PA 4CKEA 1RHQA 3MK31 3REQA 2WTUA 1M2OA 3UMFA 5KKNB 2NAFA 2H59A 1ATIA 4J0IA 3W3AA 5CB4F 4DTCA 3C6BA 2WWHA 3M6MD 2ZSIA 2H8KA 3L82B 3K05A 4AJ9A 1RZRD 2YV3A 1BCRB 1Q3HA 1UC4B 2WV7A 2ES4A 3V6LA 4BTEA 5CTJA 4EY7A 5HF6A 4K9KA 3OM9A 5C2JB 1E3SA 4QG7A 1CG6A 2DT8A 3K8OE 1AUXA 3IVRA 1NLUA 1UDRA 3GJSA 3K1AA 3P96A 5DF1A 3EXIB 5B3JA 1G19A 2CMKA 4B3XA 1G4UR 2UVQA 3UV3A 4L0MA 1ECJA 1XE3A 5EJ7A 2VF7A 1XNQB 3DHYA 1RC1A 4GSKA 4YRPA 1PSWA 3FOAA 1UT5A 3S1LA 3GUHA 3ZY6A 4AI6A 1TMOA 5L51A 3PE3A 1UAYA 2JK1A 3AR8A 3W8FA 4B3GA 3WLOA 2IV3A 3LFHA 2JI8A 4R81A 4B6PA 2X13A 4YDRA 3H8JA 4P08A 2XZDA 2ZI5A 2ZUBA 3KK0A 3OFJA 4GSYA 3TL6A 3OHSX 4DUGA 1PJQA 1T2EA 5F73A 2XBUA 2NPIA 3BG5A 4PU0A 4LQDA 2OY0A 2GPTA 1DFGA 3EZLA 1NY6A 5SYNA 1H05A 2PS9A 1P7ZA 4BMOB 4AAYA 1FDRA 2ORYA 3HEMA 5EC8A 1YA6A 2WM2A 1N33B 1TCAA 1E1CB 2OMKA 2H1OA 3SWWA 1A0OA 3PQ5A 3F5DA 2B5OA 4TZTA 4KTVE 4EAAA 1QR2A 1SXQA 3DFKA 1HORA 3QI2A 4REMA 2V9ZA 4N5IX 2QBYA 2AWNA 2QLLA 4M2LA 2XE4A 4OHKA 5HF5A 5LLSA 3UGQA 3UWDA 3AUFA 3FGOA 1VMIA 4I9HA 4JGGA 4N3NA 4O33A 1CTQA 3VSCA 2PL9A 4FD2A 2H6EA 4MS3A 4RD1A 4M8LA 3AR7A 3HCOA 2OFFA 4ESOA 3V1MA 5EKSA 1P1JA 1EMDA 1SBHA 4NZMA 3NIFB 4KMRA 2W0MA 1MOZA 5KC9A 1QCYA 2JJQA 4UHBA 3AQ4A 3FHJA 4WXYB 5JQWA 4QAQA 3WGLA 4Z9XA 3G2QA 2H51A 3GD5A 1S1MA 4RTLA 3F1LA 3F7MA 3RODA 3NBMA 2NP7A 2QVYX 1UJBA 1BQEA 3DVRX 4COKA 5G0VA 3IVGA 2Z2XA 1O9BA 1Z7BA 5CYPA 1PS8A 4XFDA 3VQTA 4JLUA 3HJTA 4TSKA 1NQVA 3E3LA 4UMEA 3ESZA 2CLHB 4WCFC 4D80A 2C4VA 1NYTA 3DXZA 2NTVA 4MKZA 5JYEA 4TKMA 4E2YA 4BPBA 5EYPB 4AMVA 4R2JA 5BYKA 1R4MA 4G56A 5BYAA 1RRVA 4KQ6A 3LF2A 5DGHA 1T8SA 2CFCA 1T10A 3PGJA 1EFKA 2QE6A 5DW3A 1A4XA 2EKQA 4TTQA 5DM1A 1FW8A 1X77A 4QARA 2BOVA 1WA5A 4X6XA 5BR4A 5IDWA 2EZ9A 4JDPA 4ZTZB 1Z47A 1VB5A 2D8AA 3G3EA 4YDSA 3W8RA 3K9FC 3DAOA 4AURA 1J97A 1QV9A 2PGXA 3VPHA 5K6AA 5IZCA 1KKMA 3ODPA 4LF7B 3S44A 1DO2A 1GR1A 2XZTA 2NU7B 3CLKA 4KH0A 4WA7A 3I2GA 1VL0A 1T5OA 5ALPA 2OBBA 1SQ6A 1E3TA 3LWZA 3DHNA 3I1JA 2G28A 3R9IA 2CVFA 3L7MA 4E5MA 1AT1A 1V5EA 3LVBA 2Q0SA 2UDPA 4IDOA 2CDBA 4L28A 4RVUA 4ZIRB 4MUHA 1CXZA 2QD4A 2WF9A 2X8LA 4K2AA 4L4XA 4C7OB 4C06A 2PKWA 4LXGA 1K7EB 2GN8A 2V03A 3PHCA 4DEXA 5CLIA 1DOZA 4XSHA 4PEVA 1GDDA 5E3HA 5K8IA 1MPXA 1EM8A 1LVUA 1UT6A 5G0SA 2ZUUA 2CEAA 3A3OA 2BPOA 3FPJA 4NV0A 3UENA 2RHBA 3EYWA 4AKHA 2PGIA 4HPJB 4M8SA 3KUCA 1RRFA 4ALLA 4JYPA 4IEIA 4XCQA 2FQXA 5L7YA 3I6YA 4E51A 3KR9A 3EQ9A 3O4IA 2CMGA 1OB2A 3R9XB 3N74A 1VSUA 2X8BA 1ISGA 3W2TA 2OHGA 4GBGA 4J1QA 4FBLA 1UFOA 3HMQA 4LMPA 4S3MA 4F5YA 3QMWA 2Z30A 1T0JB 4H7HA 2GDJA 2PGAA 3TOCA 5C4MA 4CCYB 5C35A 3QEAZ 1NNEA 2IH4A 4LSGA 1IUOA 2GBLC 1XF9A 4P3YA 1LLFA 3I0ZA 1NNUA 2WNHA 1XU7A 2XOKD 4BJ3A 3LQRA 4BO7A 1HDXA 1XWIA 1GU0A 2WK1A 4ZZIA 1SCBA 1UFVA 1GADO 1DEHA 3H2SA 4G3XA 4NZZA 2BCGY 2GK7A 3ILVA 2VKTA 3NDBB 3PDUA 4MDHA 4P32A 1YGPA 5D86A 2P3LA 3N8NA 2PSJA 4KODA 1TEZA 1JI3A 2A5LA 2HWYA 2WVGA 3M5PA 1YR6A 5HQ3A 5HA5A 3PFBA 3NZEA 4NIMA 2JCYA 3Q6NA 4Q3BA 1YBAA 3HCRA 3OKCA 4CFYA 2ZRMA 3IELA 5D84A 2O14A 1DBVO 2C9ZA 2G5GX 4QVKA 4UDXX 1YZYA 3H1FA 3ENVA 5I5GA 2DWQA 3DP7A 5MF6A 3AEUA 5BWMA 2XCUA 4P4SB 5BN1A 3V4PB 1CUEA 3QBDA 1JHXA 1JEQB 2VDOB 5LQDA 2FWNA 1TM3E 4GMHA 3OC0A 4CLDA 4D45A 3ASUA 1TJ5A 1Z0ZA 4QFBA 1A9ZA 2PUBA 2H2WA 2YMQA 4KLCA 4MGZR 5CXXA 1PX0A 1TM1E 3H8SA 4AZ0A 4BNJA 2QI9F 4M1YA 4X00A 3USES 1DCMA 1TU0A 3H5RA 3W1VA 4XCXA 5AESA 4RMGA 5KYWB 2OESA 3T5DA 1N2OA 1L3CA 1NRWA 2NX2A 5JBQA 2PT9A 4AUMA 2P7HA 5EQJB 1NQWA 3UT0A 4D81A 3MBOA 4QWMA 2X5XA 2DUWA 1L7NA 1RACA 4YJGB 1CLEA 4Q3NA 4QPJC 2RH9B 1HZZC 5D8DA 1ZVKA 4ZCTA 5HPYB 4ZOCA 2CXSA 3NJ4A 3LHFA 4GW3A 4K6MA 1EVKA 3LS2A 2JGDA 2CVPA 1W8IA 2W2KB 3UKJA 4ZT2A 1X8KA 3ACCA 4Z99A 3IP1A 3VHLB 2JLAA 1YVDA 3G8DA 4R69A 4A0FA 4Q4AB 3DLAA 5JALA 3FWKA 1RWQA 5FBWB 4F93B 5B1YA 1YCDA 2VYQA 3D2LA 2J6CA 2OCLA 4NL4H 4KRFA 3HB4X 4P8RA 4R1SA 4MI9A 3WL4A 3KOOA 3ONFA 4D02A 5AUPB 5KTKA 3C3CA 1ZXLA 3GO4A 3VR1A 3GAZA 3CW2A 1CE8B 1M7HA 2A1UA 4B6EA 2A94A 3EOZA 2F43A 4E5DA 3F47A 1NULA 2JGIA 3JASB 1OIVA 1UXGA 3CW9A 4GU5A 4YRKA 4ZEVA 2EBFX 2ZWMA 2G6BA 3NRJA 1E2PA 1W5AA 3RRMA 3ZHCA 4L15A 4QRDA 4BVAA 5C52B 4XQ0A 3C1UA 3HRHA 4M0DA 4OJQA 1NVGA 2XA2A 4Y7CA 5LYYA 1G2PA 4YJ3A 1U8EA 3WB9A 3GXOA 4MXDA 2F64A 3BHJA 1H8HD 3L79A 3ZWXA 3RABA 2PBRA 3T3MB 3QVUA 1W0KA 2NU6B 1PYGA 1LS1A 2R6R1 4R9NA 1A72A 4BUZA 3I2YX 4MW5A 2ZXUA 4CM7A 1M2KA 3MAGA 3ZBPA 5JT1A 1JPJA 3LO8A 1N7GA 1IRXA 2J1LA 3D8SA 3ZV3A 1ODLA 1QE3A 1Z5ZA 3VZPA 4DJ5X 4YHBA 2HMYB 3L46A 3PNMA 4D97A 5T4FA 1IVNA 3VU9B 3BIFA 1QGOA 3GPLA 6Q21A 3CEAA 5LWQA 1D04A 1Q7CA 2CY0A 1C7FA 3KO8A 3OLXA 4M89A 5TIIA 3M6XA 2I1VB 3WLLA 1M6NA 2D4HA 3DHEA 4D0NA 1CQJB 2AL7A 4D42A 1VPVA 4EAQA 3O4JA 4ZHQB 2GLXA 4YGXB 1PWYE 1QBGA 3G2MA 4Q9HA 2A78A 2EFDB 4GT1A 1QE0A 1FNBA 3SOPA 4F1JA 5JQGF 2O8CA 3KEQA 5DGIA 3ZVLA 5MFZA 1HFJA 2GF2A 3WK7A 2VP6A 3I04A 1M74A 2GBGA 3QBEA 3PWTA 4KFTA 4WLUA 4C4ZA 4LE2A 3T5AA 4U0JA 3JQ8B 4XH9B 3PQ3A 3GMTA 4W5JA 5JSUA 4G5OA 4ZQCB 5IDQA 5CBKA 3UQYS 5CLGA 4LY3A 4GZ5A 2GGSA 3TVTA 3F8SA 1UC5B 1MAVA 2RHTA 3SJZA 4DNXA 1VJDA 2PRIA 1X0VA 1LK7A 3H2KA 3TMKA 3LG2A 1LDYA 1FUIA 1PR1A 4ZDJA 1NJ8A 1IWBB 1OGJA 3DQZA 3ZGXA 1IAVA 1NG9A 1Z75A 4CODB 2JFNA 4WAUA 9LDBA 4FDAA 3GJ7A 1X19A 1VOTA 5FUYA 1ONOA 4GMKA 1JYFA 1IG0A 2DFTA 1TUGA 2XV1A 3GJ4A 1DLIA 4Y9RA 2P6UA 4QU9A 4C05A 3OE5A 1QHGA 4U6NA 3OBBA 1FVOA 3NP9A 2MMCA 1QYXA 1B73A 2IUYA 2R6ZA 3FY4A 5LP6F 1O9GA 4QLBA 4W1RA 4DV5B 1QQBA 4OGGA 1LJUA 3NFRA 1LPBB 2G9QA 3HN2A 1EX7A 4MNTA 4BFCA 2ZRDA 1E7WA 2RHDA 1N2XA 2CUNA 3GFGA 5CA0B 4X84A 2JIBA 1B0UA 4LZOA 3VVBA 3RSZA 4EQ6B 2HC9A 4P84A 2X3FA 4NDAA 3WHIA 4PLHA 5T8KA 1QOQB 4N6NA 2KI5A 3WA6A 1UM9A 5JCPA 1QP7A 1HPLA 4ZODA 1I14A 1JZQA 1PNOA 4OXQA 1J42A 2JH9A 3GT3A 3SYTA 3FW1A 4B31A 2ZB7A 5I5EA 1IUKA 3QVLA 4Y2UA 4BWFB 2XDWA 5A3VA 3VFDA 4RYDA 3HXMA 2QSZA 4IGKA 4C3ZA 4DMLA 1WCIA 3FKJA 2JFUA 1N25A 1ZBQA 3DLBA 5T67A 2PY6A 2OD7A 4UDYX 4I9GA 1SCAA 2ZRNA 3KT0A 2F1IA 2NNLD 3SFVA 3DYIA 4XFJA 4EJMA 1Q92A 3CC8A 4XVQA 5K3EA 3EHDA 2DE0X 1GUZA 4G1CA 4KV7A 3TX6A 4IQGA 3EF1A 4N39A 1EHIA 2C00A 3NT5A 3MWLA 1KOJA 2QLTA 2WA1A 2XLBA 5EXTA 1QTQA 1WX1A 2HWUA 2KSQA 3ADDA 4IEEA 3PC2A 1FDTA 1CJVC 1FF9A 1NVXQ 1YDGA 2AB0A 5DN6A 3M9LA 3HKBA 4EHBA 3MTGA 1Y1TA 4IDHA 3KQUA 3MFQA 4LOAA 4Q6BA 1U0JA 3ZNOA 1LPNA 4PV7A 5C4IA 3WISA 2JJ1D 3BFPA 1UDWA 2QA5A 2YZ2A 2VHEA 5FT9A 1GG8A 3VJMA 2OVFA 3SPXA 3A1EA 4A6XA 4K87A 4KO1S 5BUQA 5JD4A 1T9KA 1TAQA 4FYWA 4C20A 3CZRA 3PE6A 1YI1A 4AG5A 5MN5A 2IGTA 3CVUA 2A5GA 4HNUA 1YJCA 2PDAA 2R8XA 2B8JA 4IFBA 4MVJG 4P5EA 4DLTA 1KQFA 1JAXA 1IY1A 2HA0A 2NXJA 2X19A 3HUFA 3CG4A 4GL4A 5I6DA 1L1FA 4Q3KA 3OQJA 2BBTA 1BE0A 3DYBA 1J8FA 3RLFA 3ZGLA 2IGBA 1QV6A 2GNAA 2ZSUA 4FYMA 4DIBA 5KQRA 1F5SA 1BXGA 2WIGA 3QOXA 3SZ3A 4KR6A 1W19A 1RQRA 2H52A 4JFRA 5CEEA 1XZMA 5J1TB 3VR2D 1S01A 1IM5A 1XVTA 3F96A 3LGSA 2BKAA 4X20B 1Q1NA 5E8JA 4A10A 2Y4OA 1MMFB 3NTVA 5G1OA 2ZAYA 1GL9B 2A1TR 2QRPA 3NASA 4RK6A 1PJ3A 3LUPA 3V2IA 2VSFA 2Q1SA 3RC8A 5IYZF 1T91A 5DWVA 1QO9A 3KPWA 4J90A 3PUVA 4Q1FA 3TGLA 1BDJA 1XXHE 3F5SA 4LJKA 4E6PA 4EUSA 4JCOA 4O4HA 2R751 2NVUB 1WXIA 1UUFA 1K6MA 4TWIA 3ERCA 3O1IC 1MO6A 1DDIA 1KEPA 1BE6A 3PHLA 2J85A 4IY1A 3UMBA 4CCAA 4CEIA 1JFLA 4ZQGA 3GRAA 5DVZA 4CVNA 3UHFA 2O1SA 3D7LA 4NZNA 4G8CA 3RVSA 4DAOA 3O84A 3R41A 1EWVA 3I5AA 1NQUA 3M6VA 2AXEA 3O8NA 1BOOA 1JLSA 1JT9A 3IDZA 1UR5A 4QHSA 4X97A 5ICFA 2QU8A 4RD3A 3RRJA 1C7QA 1CETA 2IYWA 4YJ2B 4DM7A 4L76A 4JOQA 5LMCA 5SZJA 2AMVA 4BAGA 4DDUA 4UEOA 2QAGA 3L4KA 1BDBA 1EP3B 1F7VA 2BVNA 4HPXB 3UTDA 1WUTA 2GM5A 5DHUA 3H83A 4WZAA 4Z4IA 2CWDA 2G0NA 2QJFA 4P4GA 1W36D 2DG2A 5EIXA 1WF6A 1W6RA 2V5VA 2FUCA 3OJXA 3O7MA 4AZ3B 1SBNE 3DWGA 3I6IA 4RL4A 2BC9A 3OC6A 4TTAA 5JYCA 4AKGA 5DN9A 5JJKA 2G1KA 3H42B 5EP3A 3W4JA 4XEHA 4B3HA 4CKCA 1Z18A 5D00A 4C6TA 1H5NA 3ZWVA 2Q6OA 1I5OA 3AJ9A 4KTTE 4E14A 4PIVA 4TKVB 1O0BA 1Y3DE 2JGMA 3LJKA 1KYXA 3LSYA 2QLBA 3O1LA 3E3MA 4ZQBA 3T61A 1TZKA 3COWA 3BMOB 4NCIA 3HG7A 2MT9A 3AETA 2ASVA 2HHCA 2Z8ZA 2WUDA 2CE7A 4O02B 4ZOLB 4GWLA 3TQTA 4AJHA 4UCWA 2FEAA 5KQMA 3GRZA 4MB6A 1DQRA 3GFQA 1O94A 4RF3A 4L74A 2YXPX 3JAWB 4LYGA 5B53A 4QA9A 2WLTA 2Z2KA 1EWKA 2F4NA 3AU9A 4Y0NA 2NU9A 4FN4A 4J0EA 3S99A 2HU2A 4OYHA 1CQIA 3F6PA 4FQ5A 4FC6A 3DR5A 3I92A 2FN8A 1HWYA 3K9HA 2QAIA 5I48A 4C2AA 2L19A 3PJRA 2DH6A 3DULA 2NZ2A 4M0CA 1MORA 2UAGA 1VL2A 2F8LA 3ITDA 4MTLA 4REQB 1FFWA 1KI9A 4I4CA 4BY9E 3R5HA 1Q91A 3NXKA 4GZMA 1BA2A 3TDMA 1JWAB 2R6GA 4BKQA 5E1BA 4AWXA 2ZUSA 3D4LA 4MVCA 4RU1A 2G1AA 4C7BA 4QQFA 2NACA 3C3KA 1YE8A 1QZUA 1YQUA 3PU6A 1LSJA 4NAHA 4NNJA 4C7MA 3CVVA 4J03A 1JHQA 3D4BA 1H2HA 3JSAA 3W78A 2AKEA 4Y1FA 1NTRA 4EBBA 2RSLA 5HSGA 1KR5A 2WJAA 4IOLA 3QFCA 1ORVA 1SIOA 2YZNA 5M2QA 4QDJA 4EW6A 1ATZA 3IE2A 4LZAA 4MUMA 3SHQA 1RCFA 2GAOA 1XQYA 3FMPB 5I9NA 4ZCRA 1A8IA 3SEQA 3QE0A 3LPMA 1JEEA 3M81A 2WWXA 3NH9A 2HDHA 4Q9JA 4JL5A 1QB7A 2B34A 3BERA 2B8WA 3C1TA 3IAFA 5CU7A 4ESVA 3TSWA 4FE7A 2R7AA 3G9TA 4QUGA 4FCWA 4IJVA 4X63A 3CVJA 2IDZA 1T6ZA 2BZ1A 4QPDA 1S96A 3HSKA 5K0GA 4YJHB 1FSGA 1SCJA 1YV9A 3MWEB 4KQXA 1GZUA 1UODA 1C9DB 4H3HB 5DLYA 5DMXA 5ANRB 2ONJA 2A0XA 3TVDA 1K4KA 3AW8A 1WKCA 4KC0A 5C37A 1E0JA 1IN4A 1G6OA 3QSGA 1X2EA 1EP2B 3EIWA 3GOQA 3PZBA 1SKUA 1U2RA 3WLPA 4A2QA 4O4LA 2HWXA 1W36C 1UOQA 4NOMA 2VTKA 3LI2A 1MAUA 3Q3EA 4OJTA 5AOBA 2EFYA 3ZQKA 3MIZA 4C4XA 1DKOA 1NI4A 4FKBA 1JPUA 3SIWA 3FB4A 2DWOA 4JP1A 3V4FA 4CZ2A 1CEQA 5I9LA 3M3PA 1GT6A 3BMCB 4D9HA 2O8VA 1EAYA 3CUEF 3RYIB 3NS7A 1SGWA 1JQ5A 2CNDA 2B21A 2IC5A 1FSPA 2CNOA 3U37A 5FAXA 5TS3A 1XD2B 4UFNA 5BORA 1YDWA 3VHQA 2IH5A 4ZAWA 3B1FA 3SDSA 4CJXA 5A9SB 2I6GA 2YN4A 4RAOA 5T5QA 3T12A 3AR6A 3CRQA 4F96A 2X9LA 3SM3A 3W2IA 1HE5A 2OWDA 2V8OA 2ZJ7A 1RQPA 4FB5A 3EFHA 3I3OA 1XQVA 4DV1B 4GNKA 5E9JA 1OASA 4AJ4A 3PKJA 1GTZA 1YJ8A 2FMHA 4R9RA 4IEFB 5TPWB 3B7PA 2G08A 2WJJA 4LSZA 4XJSA 1Q50A 2RD2A 5EMMA 3AY3A 4KAAA 4R2WA 4RDHA 3G82C 1VMDA 2LPMA 1PT8A 2J9XB 2NUBA 1KZ1A 4GE0A 3OBIA 4UBKA 1V5GA 3WLNA 3ZWBA 1CNFA 3HK2A 3B1YA 4IRXA 3TVYA 1G291 1AQIA 3NM6B 3WMGA 3EQ8A 2C07A 3H13A 4N5NA 1Z0JA 4UQOA 2XUOA 2X0JA 2R48A 1HQYE 1I3CA 4YCBA 1V2HE 2J7PD 3K0AB 1HV8A 4PQFA 3SHOA 1IHPA 1GTVA 3COPA 2QD1A 2WFLA 3BMNB 4TRMA 1GD1O 3DVSX 3O1JC 4Q39A 3QX9A 5KU7A 3P2EA 5IWAB 2K7FA 1L5KA 4HTFA 6LDHA 4C4TA 1KJ8A 1JJAA 3L05A 3OAAD 2LKCA 2OZKA 2Q45A 3MILA 3RK0A 4DJJA 4WJKB 5A62A 3EARA 2V1XA 4X1KB 3OPYA 3VH2A 1NUAA 4PSVA 5JLJA 2SCUA 2HPAA 3PYMA 5BW8A 5C8YF 4RTMA 4CEJA 4Q1EA 1R6TA 3UA4A 1DOHA 2P3QA 2X6RA 4PX2A 1OH8A 5EXXA 3HKEA 5K3AA 1NC3A 3UKOA 2IHJA 1K5DA 4DDWA 2VDUE 1D6MA 4P36A 5JJLA 5E7IA 1Q84A 1S4MA 3GEBA 1CJSA 3E27A 4RZSA 4TLEA 1E92A 5K2OA 2W2QA 2YOHA 5K7SA 4U0KA 3MOGA 4I9NA 1L8LA 4AW9A 4Q4CA 3U4GA 2XRMA 5LYJF 3AP2A 3A0RB 3CNNA 1GGJA 1ZL0A 4NS4A 4ZCIA 1NHGA 5IANA 2VR1A 4B48A 2P41A 1UPUA 3DZ8A 4CKZA 5FUWA 1JFRA 2X3YA 4RDCA 5DXFA 5EJ6A 2X5JO 4LDNA 2H7YA 2WDPA 1FY2A 1JZTA 3PICA 4CT5A 4FONA 3NWOA 2OHIA 2GF0A 3OQ1A 1U1EA 2YL2A 3EX7C 5HILA 5K0EA 1QWSA 3BFJA 1AZLA 3MMXA 2A57A 3LE8A 4J8PA 3X1WA 5J2TA 2WJGA 2AR9A 1QF6A 1EZ4A 1WZUA 3LZCA 2C9OA 3ZOZA 1XTTA 3W5HA 3ICVA 1GWNA 1U3WA 2YS7A 3AM4A 2FA9A 3BB4A 1CUSA 4MGYR 4NENA 4WXEA 3EGXB 1OFVA 3IALA 3TTSA 2RAUA 3DBHA 5A3RA 9LDTA 1P6UA 1E2IA 2FJUA 3Q7TA 4YMSA 4UMDA 1PRYA 2OMEA 2PZ8A 3F5MA 3ONNA 2D3WA 4OLHA 3T7SA 1W88A 3DHWC 3R5FA 5DGXA 3O8LA 4YAFA 3T3DA 3TL3A 4AXXA 1MFZA 2V98A 4ZANA 2O50A 1WUIS 3K8QA 1JPVA 4DDHA 1AQLA 1VTKA 3BXGA 2IBSA 2IV7A 4Q19A 4G65A 2VTVA 3GH3A 2J30A 2PUGA 1Z37A 4BNFA 4COOA 4DREA 1PFVA 5BN5B 1I6MA 1RP1A 1I3LA 1M6VA 2GCOA 1AZWA 1UKVY 3FBGA 4JR1A 4RLHA 1TYAE 2VYNA 2BUBA 1L5SA 3H5NA 2KWIA 3C8HA 3FX2A 2FFQA 3IQIX 4J07A 1Z7GA 4UVHA 4G67A 2RGBA 2YWXA 1BEUB 2NSJA 1E8NA 2VDWB 5CNKA 2I4IA 5AQEA 4CR7A 1VXRA 2P2LA 1Y5RA 4RV5A 4QSHA 2YASA 4D26A 3HP4A 4G63A 2XDAA 4QL3A 5THXA 3JWHA 2MCFA 3TLKA 5J4YA 2WJZB 2WM8A 2REQA 1FRQA 3G59A 4I1OA 1XRQA 2QTFA 4FYIA 1XZCA 4XGRA 4YJKA 1U4OA 2FY8A 3U4DA 1JR2A 2FPGB 4OUDA 4ZJYA 1Q7BA 4HNHA 4MO2A 1A69A 1Z34A 4PIMA 1BJRE 3CUKA 5M7EA 5AK4A 4IDFA 1RAGA 4X93A 5IAKA 2FSPA 3E58A 2Q1XA 1J33A 1GZ6A 2C8JA 3GPCA 3H1EA 3V3KA 1YI8A 1GA4A 4JI6B 3CLVA 4X6UA 5AK5A 3SXJA 3COVA 4XARA 3NHKA 4XWKA 2EKDA 1J9GA 3E6AA 2C8LA 4EL5A 2POCA 1LDGA 3QELB 4GLFA 5BMVF 1GZDA 2HYIC 1K63A 3CMCO 3UJCA 3JPYA 4EA8A 1FUYB 4EI7A 1IN8A 5HIJA 3KR1A 4UKDA 2LIVA 4GI1A 4INOA 5FLEX 4OP2A 5C32A 4FMDF 2SKCA 1P5ZB 4LHYA 2BKVA 1WUHS 3R0IA 4Q3DA 3AFGA 3AVYA 3H1AA 4BGUA 3M33A 4KREA 4JJAA 5IZ4A 2Y1CA 1T5HX 5I9BA 4JP3A 2IOHA 1ZUNB 3L7CA 5HR5A 1FBNA 4PLTA 3JY6A 4BV3A 3F2IA 4PGGA 1FVHA 4RO0A 3T1QA 5A1JA 2GARA 3ZV4A 3MMNA 1UC9A 1EQ2A 4KQEA 1N5OX 2VWPA 4C6SA 5FP0A 2HT6A 2XCOA 1RPNA 1GL7A 2GK3A 4TTRA 5FLKA 3RRNA 3TKLA 4LHVA 5I7FA 4TUYA 1YQGA 3V32A 1MZPA 1CUWA 1BFDA 2CUTA 4RVNA 3EWSA 2PH1A 3RRYA 3PC7A 3HWWA 4MJ7A 1W4ZA 5H9VA 2PLNA 1UP6A 1TAGA 1G7SA 2WJ6A 4FOPA 2GAIA 5DE3A 1NJFA 1N2ZA 1YDHA 2G70A 1HEIA 2A0FA 5ENZA 1AHHA 1BD3A 2BBSA 3A1TA 3AGPA 3I28A 3TAUA 2X1HA 3RARA 4F6LA 2GZ2A 3EY4A 1GGFA 4JENA 2CYCA 1A97A 3WZ2A 1N78A 4QG3A 1QO0A 5F23A 1K68A 2FUKA 4DIUA 3MWJA 1QAQA 1XRJA 1RHMA 2WVJA 4R8MA 3D64A 2AUMA 4RL6A 5C1DA 1HY3A 2EXXA 2Y05A 3JQ9C 5I7OA 1GCGA 1WXHA 5H0IA 1CRPA 1E64A 3J81k 2P2GA 2QUZA 3AOEA 4INJA 4HDRA 2ZI7A 2ZSJA 3K4HA 3NUGA 3QKRA 4FHDA 2WOOA 3KOMA 3LFTA 1S2NA 1N32B 2NYVA 1YR2A 4OYYA 4XWTA 2G9RA 2I6SA 1FXSA 2Y0BA 2GBIA 1P2VA 1BOFA 3SGLA 1V7CA 1AA9A 2A7XA 3KV1A 2QS9A 4YAEA 4B7ZA 1LLUA 1J8YF 3E8XA 1NU8A 1T8RA 3BTOA 2ZGVA 4BFZA 4X45A 5FWNA 4W6QA 3ASVA 5BWCA 4EX6A 1EFLA 2Q6TA 2ZITA 4QM7A 1UAGA 4MMXB 5TR9A 1H2BA 4JYAB 4Y2GA 3K4QA 1KIAA 2YWEA 2ZWVA 1CSEE 1OYOA 1Z4JA 2JAQA 3O8BA 2IDMA 4FOTA 4L78A 4JC0A 4OQFA 4AB1A 5JS6A 3H9JA 4M36A 4TKZA 3TRIA 2DYKA 2OHXA 3KZOA 3K31A 2LGJA 1KFBB 2BTQB 4A8JB 2NXEA 2ADMA 3MGBA 3WIVA 1X86B 2ZWPA 2ZYHA 1KO5A 4OHOA 1YQQA 3MXTA 3S27A 3X2FA 1NE7A 2AN5A 3PE4A 3V55A 4DXHA 3P1JA 1E1MA 1ZR2A 1C9EA 3DM5A 4NYJR 1CVIA 2QZSA 4G1VA 3JYPA 2AA3A 2CNNA 1H2YA 3TLZA 3CPSA 1JHYA 2UYYA 3DGEC 3GZTB 5AW9A 4ENSA 4GC5A 1K3TA 3I4FA 3H84A 4L4UA 2IXBA 4XEUA 3FDJA 3VPDA 3DDCA 1PTJC 4BEWA 4U63A 5DM0A 2WF6A 1MO3A 3V7UA 3PENA 4HEQA 3EUAA 2ISSD 3EAGA 2IYSA 3LCRA 2QSJA 2QX4A 2XF2A 1G21A 2VBIA 4K81B 1A2KC 1YIAA 4Q9NA 3SXUB 2GEUA 1ZPDA 3CUTA 2PJZA 3CZQA 5C8VA 2DCUA 3FCXA 1GP2A 3Q2OA 2DR2A 2O8NA 2X7HA 3UM9A 4B8ZA 3I01A 4XB6B 1ZR4A 3T7EA 4JVLA 3PZRA 2PZLA 2A3NA 4DBVO 3T3HA 4DRZA 3BRQA 4S1NA 1PWZA 1BZYA 3AR3A 3KSDO 4P35A 5DM60 7REQB 1E4EB 1EXVA 3LXRA 1PJSA 2OCYC 1JW9B 1TKBA 3FR8A 3NEPX 3KOYA 5FULA 1PFWA 5CFLA 4YASA 4I0WB 1N8NA 1WDKA 1XDUA 1WHSB 1C3OB 1IC6A 2Q3LA 3B82A 3EVTA 3LBHA 4HLQB 2FETA 1SU6A 2YMPA 4IX1A 4K9LA 4M1EA 2HGSA 4DC0A 2DRIA 2P9YA 2WKPA 3N2EA 4I1UA 4A8HA 2IUEA 4A0GA 1TTTA 3BCHA 4Z86A 1S8FA 3T6KA 4IG9A 2R79A 3PB3A 1IPEA 3WYGA 2ZRPA 3KRTA 1IZYA 3UANA 1XNRB 1A9OA 2VAPA 5DYTA 3UF0A 2VT3A 3QVTA 4LF9B 4DLBA 2B8TA 2H2AA 3AUJB 4K9DA 5CCDA 4HVLA 2YHAA 1U98A 4TQUS 1I2DA 3M1LA 3IJEB 1NQTA 4D8UA 5KYNA 3GRUA 3E61A 3ANXA 3BSYA 3HR7A 4O4JB 3K70D 4FT4A 2IYOA 3JQQA 5DHAA 1RWNA 5IKXA 4A8TA 1UZNA 5DO9A 3ZQ4A 4EGJA 3JQRA 4TMTA 1T9CA 3S70A 2VPTA 2JJ2A 3CNHA 3IOYA 2O6HA 3R5KA 1KXJA 5IXYA 4X8HA 1ZUD1 5DFAA 4EH1A 1OKKA 1JIJA 1JTEA 1QH1B 3K0CA 1NLYA 3LUKA 3HO8A 3MJTA 4L27A 1EZ1A 1XQWA 1ZHFA 3AYZB 5CH8A 5EAIA 4OHMA 4YWJA 4ER5A 5B7PA 3T1YB 1SG0A 2L0XA 2JGJA 4GYJA 5GV7A 3DZDA 2C4MA 3WSVA 1XVVA 5E9AA 3OIDA 2BMFA 1EA7A 4IQ4A 4RELA 5KOJB 3A6KA 1BDMA 1OFTA 4PYRA 3N07A 3U9TA 1SA0A 1VLVA 4P86A 2DUMA 1ZXBA 2C03A 2VOJA 5JPDA 4BXOA 1UWKA 1Y6GA 3ROKA 1CUDA 4QLOA 1TUBA 4OD0A 3CXUA 1JSLA 2YWFA 2WHYA 4H1UA 2J0EA 3WA7A 3HCFA 2NOAA 2BGUA 1BVUA 4US0R 2WSLA 3LQQA 5H3LA 3OMLA 2GVZC 3KZKA 5DGTA 4BS9A 2VPZA 3BE5A 1X2BA 2QG4A 4DWWA 2B9VA 2W48A 3IXQA 3PQ8A 3VKHA 1K86A 4RK4A 1PR6A 1AQ6A 3K9LA 1YIOA 2NSHA 4XDGA 2WYHA 1H1TA 1UWCA 3W6OA 2JLUA 2GS9A 1JI0A 4BNDB 1YKSA 2GHQA 1PZFA 3TLGA 3UCFA 5IU6A 4YRNA 5LVAA 4BJ5A 4PG8A 1V5FA 1YZVA 2V7UA 3GAFA 4WOJA 1AQNA 3LQ2A 1R4AA 3PUZA 4HJRA 5FPYA 2A4MA 2IYPA 2YJGA 5AVRA 4MGEA 2PZGA 1HK7A 5I45A 1T3HA 4PBSA 3JQAA 1UJMA 4HSEA 3OZSA 4ADSG 2FSVA 3CNLA 3K6RA 1UJNA 3B70A 4PONA 1RLJA 4LFCB 1S4QA 4UNNA 3LDGA 5ALGA 5CIYA 2V1UA 2P0EA 2CCKA 5SY4A 2F00A 3QKUA 1SM4A 3A3YA 3TQRA 1KF0A 5BOSA 1OAKA 5FIUA 4D4LA 3EF3A 3FNQA 3FYUA 1TM7E 3RFVA 1UJCA 4K1XA 4FWTA 3U16A 3U62A 4Q01A 5G3ZA 1USIA 5L3QA 4LWOA 3IEVA 5E2IA 2ZI9A 1KH1A 5TF4A 3D6FA 1QQAA 3O03A 9MHTA 1TMGE 4UBJA 5C1BA 1DS6A 4PNHA 4B1FA 5L9AA 5CHYA 3K70C 4ABTA 2QX9A 4DA8A 2FPMA 3N8DA 5HIKA 1CB7A 1Q7TA 4DEYA 1W48A 3UB4A 3DLHA 1RPAA 4R9SA 1RM5A 4RSHA 3R7NA 5BR7A 3PYXA 621PA 3DW1X 4G0MA 4TMVA 3WGOA 1SU4A 4ZCPA 4AWBA 5AJHA 4XVRA 4E46A 5FQNA 4H6WA 2YJZA 4BWGA 3ZZMA 1FRVA 4CG0A 4MR8A 1CDDA 3G0IA 5EP1A 4JNKA 4LZPA 2C9BA 3ZCVA 1F8FA 1C1YA 2ATCA 2OCXA 4Q7MB 4BDTA 3DDSA 2P4UA 3L93A 5H59A 3TYXA 2JK0A 1Z5WA 3A05A 1Z6GA 3EC1A 1XZHA 2HO5A 3NOOA 4LE1A 3TBKA 1R6DA 4CKBB 5FPKA 2PX4A 1RFGE 2ONZA 4FT2A 1NSFA 1SVMA 3WFJA 5JDIA 4CMHA 1UPAA 5I4CA 3OTWA 2XOXA 4NVRA 4JI2B 3IDSA 5MGBA 1ZBDA 1RDFA 1R8XA 4OMUA 2NAPA 1QVRA 2CV2A 1BVHA 1IZZA 4L8VA 3KD3A 3DTVB 1C0EA 2P2SA 3AOGA 4MX8A 2Z6AA 1BE1A 2BM9A 2V6MA 3E81A 2XYHA 4IX9A 1FDSA 4A92A 1E7QA 1T36A 1C0KA 5EMHA 4ZV7A 2DEUA 4HZUA 1Y37A 2W7TA 4OF4A 4ZI3A 4PRLA 2O7SA 3H2JA 5L4LA 3LIIA 4NCAA 4M1TA 1ONSA 4TV8B 8ATCA 1IONA 3HM2A 4KQ1A 3S2FA 4Y3UA 3DCYA 3ZHSA 2R00A 3PQFA 1KRWA 2ZTHA 4I50F 2GBCA 2BH2A 1SCIA 1SVOA 3AUTA 3EISA 2QRUA 4FFLA 1M73E 4QJIA 5AKZA 5K3DA 7MHTA 4R8SA 1KEZA 1E2KA 2YC4C 2WPNA 4JT4A 1J2UA 2I6XA 3IQDB 3QVJA 4MAMA 3DL7A 1DKNA 1WMFA 3GZNA 3I9V1 5KCMA 3VR6A 1CUVA 3E82A 1I0LA 1OIXA 4BFLA 3DL4A 4CT0A 4EJSB 4JBIA 4ARCA 1V8ZA 3N2KA 1NVVR 3ZLJA 4ND5A 4RPIA 5K6TA 2COUA 4J1NA 4NOLA 1DFIA 4X85A 5GONF 1V7QA 2HA6A 4MARA 3EA0A 4R98A 2CUKA 5YASA 1GPAA 2IP4A 3D8BA 4RKEA 3SJBA 4EHFA 3NTUA 4I36A 4AZTA 1QIKA 4A0HA 1C9KA 2O2IA 4GE3A 2XCIA 2FLVA 3D43A 1MV8A 3DOCA 1J39A 1AZTA 1KVUA 4RKQA 1TC2A 1EFCA 5CT8A 1L1QA 3O26A 1L4FA 5KPJA 2FWMX 4J1TA 3ZDDA 5GV8A 5M29A 3QWFA 3LM8A 4PLZA 5C7LO 3R8FA 4A1OA 4S1OA 1XD8A 4IZHA 1XLUA 3JD0A 3PQ2A 3EMVA 3KPVA 4EX7A 4F84A 2JIMA 4AZVA 2N75A 1JR3E 3TAXA 3WXMA 1R3DA 1RXIA 2V4ZA 3UW1A 5H3HA 3HBMA 3W5JA 4ID9A 2UYGA 3PRHA 3WGTA 1XDGA 2GPYA 4HB0A 2JBWA 3H2HA 2JEZA 3DJYA 1U7ZA 3T52A 2Z4RA 4B80A 4L8WB 4NG5A 4L6IA 3ISTA 4XOUA 1L4GA 4HLDA 4KFCA 2RBEA 4ZI7B 1DTWB 4DY6A 1M7GA 2B4AA 2FEMA 4RZUA 2LBPA 2PRYA 2IUTA 3ONWA 4YC7A 4R7GA 3X1ZA 3DVAB 3KSRA 2I4LA 3F6YA 4YN3A 3EIOA 1AVTA 1HM5A 3LVRE 2O1WA 3K0BA 5CFPA 3DFUA 2DHEA 3ETLA 3CTMA 1NF2A 5CB4A 1ZJWA 1G20A 2WD7B 3QZUA 13PKA 1F14A 1JHZA 1ZD5A 4I9FA 1XYVA 3M8KA 4RK0A 1KIFA 2IK8A 3STTA 5FLYA 1OWPA 5CNJA 2IF0A 1DU4A 2VUIB 4QHYA 1Z88A 1GQYA 1V5WA 1VFNA 4FZVA 4MVJA 1Y3FE 3K6JA 3HA5A 4ZKEA 2MSNA 3S40A 1HDGO 2PUVA 2WP0A 3TZBA 2GHIA 5C8XA 2BKEA 1YULA 5FNVB 1DT3A 5KMGB 4KITB 2C0QA 3RTAA 2OPHA 5TJ9A 1WY5A 1SY7A 3OSZA 4EPWA 1AUQA 1NZDA 1Y34E 2FYTA 3NUQA 1PWEA 4RJ2A 2FZGA 4CU2A 1F06A 1ZESA 1L5YA 2ZAGA 3ZWMA 1WEHA 4UTNA 3KQSA 2E5WA 4EP1A 4BO2A 2HRDA 2QY6A 1WHTA 2EEPA 2Y9PB 3SZUA 4CQLA 4AJNA 1N9KA 3KG2A 5D3MB 1U0OC 4KFUA 4U7WA 4ARBA 4F92B 3QXSA 5IAAA 5K6AC 2BEKA 3PXGA 3Q8LA 1Q12A 3C6MA 4MJLA 1CJKC 4OQ4A 2IT1A 1XG5A 1BWRA 1HKUA 2E6UX 2OQVA 2BFBB 2JKVA 2XOEA 1GQFA 1DBPA 3R5TA 1PD1A 4ZAGA 4RHEA 4B0PA 2H31A 4E2FA 5TRTA 2X2PA 1E63A 1Q0ZA 2W8BB 5FBVB 5IBQA 2ZEJA 3TCKA 4F7DA 4NBUA 3H6HA 3T7TA 1CUFA 2I7XA 5AKGA 3AEKB 4EY8A 1G0NA 1T1SA 1F38A 4LV8B 3GVCA 5AW2A 1KOGA 3HHEA 4DM3A 3ZIUA 4AJEA 2XRZA 3OTHA 3L0BA 5TPZD 5LSAA 2R6FA 4J0FA 1DCFA 4FHZA 1IOVA 3E0XA 2BRUC 5EKTA 4XVCA 2Y1GA 3A9WA 2H1HA 1E6EA 2XWPA 1Y33E 5EUCA 5FBQB 1QRSA 3COZA 4B3RB 1GXSA 4OMFG 4B5KA 2MIIA 4BB5A 3F4LA 1FS5A 5HF8A 1P1BA 3DT9A 3WDLA 3SD7A 5C5DA 3HNOA 1U63A 5DBGA 3RAJA 1I9CA 3BFVA 3BRCA 1EESA 4KO8A 4ZU1X 2J46A 1YA4A 1XFAA 2Q29A 2HCRA 1OFHA 4NMLA 5BYBA 4PGAA 3VZRA 1MLDA 1EB9A 3HJGA 4OHZA 5K3FA 2R0QC 1NN3A 3JARB 4DB4A 1G38A 1P81A 1XQXA 4ZDWA 4F9EA 5BURA 3WHKA 1H42A 1QGYA 4PG6A 3TS1A 3D4NA 4YV7A 1PNTA 5ALDA 5G4KB 1C14A 1U1IA 1DX4A 2BEJA 2XUPA 4PCAA 5JADA 4GMXA 2FJ0A 1X39A 5IJ9A 3O4GA 2GYWA 3IHKA 2I62A 3R76A 5DHQA 2JD2A 4DCPA 1N36B 3F4BA 1AV6A 1RBYA 1B93A 2QMYA 2HMUA 2GJSA 1NR7A 5LBIA 1W1WA 4YWHA 1ZN8A 3EIUA 4GYYA 4HH4A 1Q44A 1FTGA 2FRDA 3CONA 3HNPA 1C1XA 4EO4A 1JDNA 4TWJA 1R6AA 2RI1A 1E89A 2C2WA 2IKSA 4WRRA 4F4IA 4MW2A 1XKXA 2WYIA 5EJ4A 1JIVA 4J4HA 4Y6SA 3BB3A 3VH1A 2QXTA 5KS2A 1DQPA 1A7AA 1T15A 3BYZA 2FMTA 1NUHA 3DBLA 1GCOA 3OP1A 4AP5A 2HMSA 4EGAA 1QDEA 4BMNA 1Z26A 4XSVA 5AYVA 4EKYA 5CA1B 3TAHA 4B9EA 1DXHA 4Y1GA 1ECBA 2AG0A 4UOEA 2Z58A 2YRFA 1HDCA 3CR7A 3DMPA 4BNKA 3OWHA 2FOXA 2CNBA 2QL5A 3LBFA 2RGUA 2B36A 1ZO8A 5LNK6 4UPEA 1TVEA 4DIFA 3R7WB 3E9NA 1QNFA 1U0TA 2ONCA 1ZP6A 1RTTA 3C41J 1FSSA 3OF2A 4H35A 2YUIA 1KMHA 1NE2A 1NG1A 4XM0A 3DKIA 3MAJA 4KKXB 1DRJA 4FGLA 4HXEB 1VJ5A 4EF6A 3L8YA 5ALFA 1ZL2A 4FCTA 4WLOA 1M72A 2OCDA 2RH5A 2O3JA 2YJNA 2XTZA 2ZI6A 1GPDG 4G8DA 2NIPA 1QC5B 4KOAA 5C8YB 1TVKB 3WK8A 3IQWA 4JC5A 4U9HS 1R0RE 1MP0A 1KK3A 2C3OA 4RHUA 4UULA 3ZK8A 2Q3FA 4IIEA 4D9GA 2CNWA 5KBYA 4KZKA 2I1LA 1S8OA 1TMYA 2EARA 3F67A 3DPIA 3QU9A 4E12A 2R5FA 3UJPA 1GN9A 2XMBA 4CL2A 5JNVA 3HXTA 2D7JA 2LKDA 5K6RA 4DHWA 3EDQA 2O2SA 1VBNA 3WO0A 4QPCA 3MG9A 1MA3A 5FI1B 3W6NA 1YS9A 1XC7A 2C5EA 2WFAA 1L4UA 1UZUA 2VF2A 2FZVA 4UBLA 5B57C 1ORWA 2BGRA 3JYOA 3I0NA 2UZ0A 5AI6A 3GW8A 1CZKA 3GJ5A 3NJRA 4MA0A 4D46A 3NJ8A 3PXEA 4ZPJA 2CDRA 2ZIXA 2AOUA 1PW7A 4MP3A 4WBNF 1RYEA 2H54A 4YFVA 1CZHA 3GT7A 4RVDA 3WWDA 4YXFA 1U81A 3LKZA 2C7OA 4BUJA 1A8QA 1XF1A 5E3IA 3K0HA 3ZQ6A 1DQNA 1R12A 1RAHA 3EJ6A 5ITWA 4IDBA 1YB5A 2ZM5A 1Z9BA 1QFXA 4XB1A 3V5NA 4HNSA 4U2BA 2PGOA 2MU1A 1YBHA 3H05A 5JAQA 2QT0A 2PD3A 4QYSA 1K7SN 3RSCA 4HNAB 2IPLA 3LXUX 2FEOA 4WLEA 1C30B 4R68A 3BJMA 3RO7A 1GL6A 2QGNA 4LQCA 2FTKE 3EDMA 3B1KA 3K1TA 3IQEA 1IBSA 1IZ9A 1N57A 2W42A 3K4PA 1FW6A 1P7WA 3GEIA 3IBYA 5EKXA 3R2JA 4NV1A 2F1JA 1TQDA 3M1IA 4UJ3A 1MG0A 5ALVA 1E2DA 1X9GA 1PVDA 1YUNA 3RASA 1IEWA 2CHUA 1R0SA 1X9HA 1ZIDA 2NU8B 1N6PA 1UT8A 4Q00A 1M2NA 1KP9A 3TEMA 4A5OA 2CXNA 2XECA 4KYIB 4LXUA 5I9IA 1TFRA 5DBOA 5E6UB 1ABFA 2FP4B 1M8FA 4JKOA 4PNPA 4CPDA 5A02A 2Z5GA 8ABPA 1V43A 4OQMA 2WIBA 4JUBA 1CC1S 1T8YA 3H75A 2WZDA 1IIRA 5F2OA 2ID7A 4RABA 3T0FA 1PFGA 1WUYA 3FNFA 2VDNB 4G2NA 1UFKA 2JW5A 3ET5A 4HAUA 4HRVA 4N9QA 1MF7A 1QUFA 4CLXA 4MPRA 2OUIA 2IXDA 2C57A 3BTUA 5FUBA 2PUEA 1IYZA 4LX8A 3TE7A 5BV8A 2D4AA 2GXAA 4RMJA 2WIJA 1U94A 2ZJOA 4GKVA 2EAUA 3W6ZA 1MJNA 5KDDA 2SNIE 1SVLA 3OX1A 1LEHA 2J09A 4OKIA 1U8UA 1ZICA 2XVXA 3I45A 4M9RA 1Q0RA 4RV4A 4WSOA 3H5TA 3R6WA 5E6SB 3TLAA 4I19A 3TD9A 3N2GA 3AQIA 3IE1A 1H4QA 2AW3A 4D96A 4LOKA 4NNPA 4CEHB 3HJRA 4I4IA 5KNBA 1P19A 5JVDF 2G17A 3COYA 4H15A 2V45A 2YN2A 3PWZA 1ML4A 2OCKA 4V0ME 1KJ9A 2VK1A 1H66A 1MB2A 1T4MA 1NW9B 2P79A 1BMTA 2DECA 1BA3A 1D7AA 3GAAA 2BJWA 5ADWA 3H86A 1QP0A 4IHJB 2H3EA 2CL6X 4HADA 3AEZA 2XXJA 2VK2A 4TKUA 2WLSA 4XCVA 5T8KC 4YBRA 1CYDA 5AT1A 2GTPA 3ROXA 2YJ3A 2XTMA 4DR3B 2O2HA 1NN5A 1T2DA 1ZCBA 3RWOA 1ENZA 3FNIA 4MWOA 3NBYC 3AKEA 4MIEA 1IXKA 3H0EA 5CX1B 3PX2A 1L7OA 4TMXA 4R83A 2FP3A 2W6NA 2BFOA 1T9GS 3F6EX 2WWYA 4MLCA 1DQSA 2YJ4A 4Z9YA 1Z73A 3EBLA 1B0ZA 1X0XA 2VHTA 2BR4A 2EW2A 4C7XA 5FJIA 4E22A 3RUAA 2NXWA 4P3NA 5AKEA 4CV1A 1ZGGA 4FMCB 2HLDA 2WC1A 3NATA 1T5DX 2ZE7A 1WLYA 5JQGA 1NVBA 2W71A 1KEKA 2PXXA 2Y67A 3IT3A 2FNAA 2YYYA 3JPWA 4LAFA 1QKJA 2FF5A 1IMOA 2P1DA 3FSJX 4KWTA 4YAJA 4YT2A 5LMNB 3OFNA 4C89A 4L22A 2E4YA 4Y6OA 4OX9B 1DOAA 4Y2TA 2V0GA 1RRCA 1H2EA 3MJFA 4P4TA 4YA6A 1YRAA 1V16B 1CEYA 1XWFA 1GZHB 2TECE 3QEMA 5HP4A 1JHVA 3FWYA 3HO1A 1JR6A 1FU8A 3WGNA 4YCMA 1QF7A 3QKIA 5AKIA 5BO5A 1VRVA 3UVEA 3I32A 2D6FA 1XCJA 4MB0A 1HQKA 1QH8A 2C5SA 1DEOA 1XEFA 5GJBA 4D44A 1Z8HA 3SQOA 4CM8A 1NUTA 3FUXA 3HU2A 2Y6UA 4GPEA 3VDRA 3N6XA 4F6CA 5A5DA 3QTLA 2FMKA 5G4LA 3LCJA 3O95A 2REOA 4N0PA 3AR5A 3FSGA 2KPOA 3AVVA 2AEMA 2Q5FA 2PZKA 5EHNA 1J7KA 1YACA 2W9XA 4DIKA 5C5EA 1UPBA 5BQPA 3JZIA 5ELMA 1O94D 2GPWA 2H1RA 3AVQA 3R44A 2R6AA 3KALA 5AJWA 5TV2A 1IPFA 3VAZA 4KZPA 4EW2A 1KEUA 5A4DA 1V3TA 4C0KA 1VDZA 2H8GA 4M86A 1M1NA 4NLLA 3AW9A 1J09A 2DPGA 2ET6A 1QG4A 3BB1A 1U2DA 3M6FA 4URWR 1ZCZA 2V7BA 2B6NA 2VZ9A 1C7EA 1L3BA 4NFHA 4MIOA 1KFJB 1L7EA 3GLIA 3AIOA 5K4AA 4DNOA 1SD2A 2CJWB 4HVCA 3QLVC 4PC6A 4TXHA 4OH1A 1ECCA 3LRTA 3TRJA 4TYWA 5TX7A 5IP5A 4L2IA 2PAAA 1FNDA 2I33A 2W2TA 3OFVA 4ETIA 2H06A 5D5QA 1KIMA 3H0CA 3O82A 5EKUA 1DUVG 1U90A 2X9QA 4HB3A 2IUUA 2YKGA 1WBBA 4MQBA 5EZYB 5KTNA 4MQLA 4Z4HA 1O5OA 3NBQA 2HU8A 4OIFA 3KYBA 3K6KA 5I7SA 3RYHB 1ADJA 4MHSA 5AOCA 2QPTA 2V59A 3IB6A 1Y4AE 4OK5A 3FPKA 2XUJA 1ZIPA 1RXSA 2ZYIA 3GUCA 4X5OA 3W9UA 5JXIA 1Y8AA 2RHMA 4BQRA 3RSSA 1ZC4A 3ZD7A 2E37A 5T64A 1WPRA 3LUCA 4DC9A 3DGFC 7ADHA 2J5XA 3WLSA 4PZAA 1G5TA 1MJGA 4V2UA 2QVBA 5BRAA 3BXHA 1K6XA 3G1UA 2PWBA 1J2YA 2BE9A 3MW8A 3O3MB 3OJEA 1SRRA 1TADA 2QAGC 4QO8A 1U5BB 5ETJA 3LUDA 4HH1A 3RCBA 4B3JA 1JF8A 2RHWA 1VKHA 1T43A 1KDYA 4N5HX 4MV4A 2R1ZA 4MPJA 5CDGA 2UKDA 1FLDA 2WU8A 3SVZA 3A6FA 3VHXA 1KO7A 3ZGZA 4XX0A 4M0LA 2Z5FA 1C4XA 2XUAA 4UHFA 4WN3A 4YI3A 4ARAA 2ZIVB 1PJTA 5HX7A 3KQHA 5E7QA 4G0NA 5J47A 3E9QA 2XB9A 4HXFB 1RXUA 1KZYC 2O2EA 3C6ZA 3L0IB 3NWBA 4TL7A 3CLSC 3KQWA 4ZEXA 4CI0B 4V1CA 5KNDH 1YAJA 4I9UA 1MVLA 1OLOA 2OC9A 3RYFB 4EM6A 3IO5A 1RPJA 3FETA 3FPHA 4M9ZA 1U6KA 3S1AB 4E94A 2ZDGA 3GPIA 2AG6A 3QG5A 3HWSA 4LCEA 4PLWA 1FMJA 1L5FA 1XJ5A 2YVLA 5F76A 3D5QA 3SIRA 3TGWA 3T9EA 1X1TA 4G0PA 4TN5A 1T1IA 5AJXA 3FOWA 1V4NA 3CU5A 3SHWA 1WM1A 2PMDA 1P4RA 2XAUA 3R3SA 2C7BA 5DYNA 1G5FA 4MS4A 5HQJA 3SYMA 5IYZA 2CLFB 1VSTA 1O94C 1PR5A 3NKLA 1PBNA 2ODBA 3G7SA 4KJXA 1WNTA 4O2AA 3RIGA 1SIBE 3TW6A 1DIRA 4B4KA 4BVFA 4Z3KA 5IM4F 2A86A 4JL6A 5FOSA 4NBNA 4MUBA 2II6A 1WP9A 4HDNB 1BWPA 1IEQA 1RJGA 1CK4A 2PKXA 3U49A 4E08A 5CDSA 5D1HA 2R97A 2M9MA 3TZQA 4KN6A 3S2SA 3RHFA 4F9FA 5ISMA 3OZIA 2RHRA 2PVPA 1UKZA 1SG6A 3GWZA 1UQUA 1K98A 3CG0A 4JR2A 4MR9A 3TLMA 3IIEA 1KJYA 1DG9A 3W5DA 1BEEA 1RXCA 1MGPA 4HX5A 4O0LA 1QYWA 4KDRA 4OA8A 4XVHA 1D9XA 3GT4A 3ON5A 3VKWA 1OHHA 1T9DA 1ZFNA 2JGLA 2G63A 4P1ZA 2OZEA 4AS3A 1E1LA 1A82A 4NP6A 3M89A 2Q07A 2IL1A 3B51X 2Q2WA 2FW7A 5F2NA 4P5PA 3T1OA 4TMFA 1YFLA 1N0HA 4CM5A 2GRUA 4G07A 2WYWA 5KSYA 4IDQA 4OGLA 3ZKWB 5JXHA 3SHFA 5JI2E 1ZS9A 3DBVO 1DAKA 4GKKB 1P44A 3OQPA 5DT9A 1EDZA 1RXVA 4KR0A 2WWRA 2WJHA 1I5RA 3DHVA 3FZEA 3LYAA 1Z25A 1DAOA 2GPAA 1AURA 2Q7DA 1V39A 5AW4A 2SECE 1ZVQA 3IPXA 2GD1O 3U39A 4IIBA 4AJOA 1I6KA 1N6NA 1S3SA 3ED1A 3FFXA 1KPGA 1R37A 3O73A 2CFRA 1ECFA 2YVKA 4H4DA 5FHRA 3WTCA 5DNEA 4C1NA 4YAIA 1F3OA 2ZIEA 4W1QA 5KSPA 2O57A 2ZDHA 4J6FA 5BN3B 2EL9A 1F6BA 2JFWA 3CLUD 1NWHA 4YRZA 2V0CA 3V6MA 2Y92A 2VRNA 3U4AA 4NABA 3DE6X 1QR6A 3DTYA 2ROQA 4NX2A 3CPHA 1CDZA 4D4IA 4P81A 4FU0A 4Z9BA 1NZJA 5A3JA 4KXVA 4H4CA 3EVEA 4NEQA 5L3VA 3NP7A 2ZB4A 3D8UA 2C98A 3IOEA 3C3EA 3K0EA 3KZ1E 1G7TA 4A6PA 1E1QA 4PPQA 1DBWA 1ZW6A 2IU6A 4RACA 4LDJA 3E1GA 3RAEC 3R6LA 1KBZA 1Z06A 1KSFX 3CZMA 3LOUA 1V3QE 3EAQA 1MX9A 2H1LA 3I8SA 1SCUA 2Y1FA 2FEPA 1ZI9A 1LUAA 2DFPA 3MGCA 4X6YA 1YS2X 4RS4A 3PWKA 1JG1A 1RMTA 5CW1A 1UXIA 1BRTA 2CDAA 3AUYA 1K0UA 3ED5A 4R16A 3TMAA 4OH7A 1P9WA 2ERCA 5KWSA 1F8GA 1UXHA 3DAYA 2JGNA 4HFNA 3B6MA 5DKFA 3AY6A 2RB4A 4GGPA 4ILEA 1ZD1A 3KDPA 1QRRA 2BHNA 1RI5A 3F49S 1KSJA 3R7LA 1NURA 1Y82A 4HQKA 4LJ4A 3VJKA 2ZUCA 1W581 5JBIA 5IDYA 1QG2A 2K5UA 2X4LA 3EZ2A 5FCDA 3RC3A 4RJJA 4C0WA 5A5FA 2H2GA 1QZXA 1GO2A 4PYIA 4RS3A 5TB5A 5KX5F 4LCBA 2IEGA 2B0CA 4KX3A 4RC9A 3WZLA 4DNQA 2CUZA 4ZZ0A 2QYSA 1SCQA 4W7HA 1GYPA 1UBMS 4NYIQ 5LM3A 3D0KA 3TE6A 3MTJA 1I2AA 2H4HA 2ZYVX 5FFMA 5TT0A 1DMRA 1VKOA 2OZLB 1NBME 1JFTA 1Z56C 1Y7IA 2I80A 2YOGA 5KYYA 3CSSA 2VYND 5AR1A 4Q1CA 1Z4QA 1E5XA 1L5LA 3SIXA 4AKSA 3BA1A 1FNSA 2F3RA 5CXQA 1SC3A 4NQZA 3QY0A 4IV5A 4YYEA 4E09A 1XZBA 4XPIB 4MRSA 3Q1KA 2BMJA 5LIRA 1TOAA 4M9UA 4OU4A 2RBKA 3ZGVA 2FGKA 4AF6A 5T41A 3ABRB 3IRVA 4BMXA 5KDOA 4KPYA 4DAEA 4KO2S 4DT1A 2ETVA 4JGBA 1NMSA 1VBKA 3HUDA 1OWLA 2Y0PA 2QVXX 1MUUA 3IEIA 1AXEA 5AJYA 4QOFA 5FI5A 1FNMA 3KE8A 3OIWA 4ZVRA 1M5RA 4P58A 3HPQA 4MUNA 2DR3A 3ZLBA 8ADHA 4QTTB 4Y9UA 3I37X 3I73A 3LQ4A 3CRZA 4MW7A 4C3OB 2X23A 3A2KA 3QLUA 4KPUB 2IYNA 3KJXA 4HQFA 4M8IA 1K7XB 4I5DA 4B17A 4LC0A 2HJWA 2C7RA 1LC3A 2B6HA 3CLUC 3SBOA 3O83A 3GJQA 1XHLA 3CY6A 4M1MA 4BO4A 2XKBA 3GYBA 4X60A 1P5JA 4CQMB 3PGMA 3LLSA 2XX3A 4JJ7A 1G9SA 5JNLA 4XVUA 4CM9A 2GCEA 2OCIA 3A4IA 4EUEA 1IZ0A 2B1RA 4PGHA 2GYVA 5MN4A 2RJNA 4ZTUB 3K2IA 4M1WA 1WMAA 4C4AA 4RTQA 3AERB 4L7QA 2R8RA 1Z4OA 3HR8A 4MZDA 2Y4NA 3B6EA 4U8GA 4FI3C 2O1XA 3GLGA 2R68A 1E3WB 1JKMA 3A7EA 1JDVA 2QR3A 3OQBA 5TARA 4C5AA 4GM0A 3EJWA 2IOFA 4B3CA 1ZK3A 1AGNA 5ALMA 1GPNA 4D8VA 4IDDA 1E3LA 4ZICA 4J7AA 4KUGA 3R0JA 4BBPA 1M75A 1SBIA 3WSTA 5D51S 3I72A 4IIJA 3JRXA 2BSAA 5C81A 3KTAB 4PCLA 4L8LA 3FYCA 3Q7SA 4G1EB 2LW7A 2EL7A 1U8TA 2HLHA 3EA4A 3TCXB 2PBZA 1Y7PA 4OBWA 3RS0A 4MLPA 3EK2A 2JHAA 3CLTC 2OAGA 3H04A 4AM8A 3H5VA 5HUJA 1A96A 1RE0A 5JNUA 1Q5PA 3WWEA 2JIZA 4Y2HA 3O74A 3ZBTA 5AI9A 5EA2A 5CFRA 2O7QA 1M6YA 3SSNA 5A2QA 4Y2JA 4IV8A 1MENA 1JXOA 2NYRA 3GLTA 3KJNA 1J22A 4E2ZA 4F0JA 1ZRMA 3H2BA 5EESA 3WR5A 5JJ5A 2G07A 2E48A 1NA5A 5I4BA 2OCBA 1E1CA 2XUIA 3QW4B 1DJPA 1TKCA 1YDEA 3IMFA 4N4AA 2UYHA 3GJZA 3ACDA 1QVVA 3I9FA 5JRJA 4HWGA 1NNSA 1AM4D 1MC5A 3EWNA 5ICCA 3P2MA 4LJLA 3R6GA 1P9RA 1WMSA 2QJTA 2OFOA 4Q7EA 2QZJA 5GJCA 1ZK2A 2E85A 5LYJA 4YR7A 1WTCA 1Z5NA 3WWOA 2QRVA 3N7TA 4R0NA 4A16A 3B9PA 5HCIA 3RYCA 2A5YB 2DTDA 1SNYA 5E3JA 2QGFA 2F1HA 3G13A 4RQUA 4O3MA 4IL5A 4OXIA 4Z7NB 5HUHA 1GY8A 3C97A 5JUWA 1N6HA 2D74A 1ZW1A 1VPEA 4BQQA 2GPBA 4K86A 1E3EA 2GR9A 4OO3A 4UE6A 3ZD9A 5E6RA 4CMEC 1C9MA 1N2CB 4KH1A 3ORSA 5ARBA 1NF3A 4YRDA 3MOSA 1EE2A 4OAOA 4FMPA 2PUWA 4UATA 3ZCSA 3IUYA 3PJEA 1EFHA 3O3OB 2JAHA 1J2JA 1VKZA 3H16A 2NWQA 5K3OA 3T1HB 5EZ5A 3O8OB 1PQ4A 3BTVA 1GFZA 4B3BA 1ZXXA 2IDKA 1XLVA 5BSMA 3A6DA 3P5SA 2Q2NA 5CT5A 1QGUA 2BGMA 1E5QA 2PU5A 4YYZA 3HXQA 4Z4QA 4K9OA 1A7JA 3S2GA 1YZNA 1PAUA 4B73A 3PR3A 1WVMA 3N59A 2JZOA 4W99A 4H31A 4AUKA 3H0KA 4WXRA 4YJFA 5TQ0B 1KP2A 1QJ4A 1RHJA 2XDYA 2QLJA 1I0ZA 1CF4A 4ZVPA 2Z04A 3QTBA 1I24A 4AXBA 5CH3A 5HIAA 2B4KA 3OU7A 1O95A 3E8MA 1J99A 2GN4A 2JVJA 1MO2A 3IV9A 3OIFA 1ANKA 1A95A 1RYBA 2XWSA 2VPWA 3VBCA 4DQLA 2HR1A 2EG9A 5BNTA 1OGYA 2TYSB 4XTCS 2DQKA 4IVQA 3FYDA 1M6HA 4FFBB 5D87A 4D99A 2CL5A 3QEJA 1JMVA 3LY8