4IGIA

Crystal structure of the collagen vi alpha3 n5 domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
197
structure length
197
Chain Sequence
EKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Collagen alpha3(VI)
publication title A structure of a collagen VI VWA domain displays N and C termini at opposite sides of the protein
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2012-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4igiA00
1AO3A 3BQNB 3IJEB 1XUOA 1L5GB 4WK0B 4IGIA 3ZE1B 3V4VB 5E6UA 1JEQB 4PN7A 4C29A 5KYWA 5KYWB 2QTVA 1IDOA 5KYXA 1M2OA 1U0OC 2VDPB 5HJ2A 1CK4A 3PPWA 4CN8A 3ZDZB 2VDOB 2VDKB 4JDUA 1SHUX 3EFOB 3ZQKA 4MMYB 1T6BY 5KYUB 4A0QA 1OAKA 2IUEA 4HQNA 2I6SA 2NUTA 4UM9B 4NENA 4HQOA 4F1JA 1ZOOA 5E6RB 1TYEB 1M2VA 3N2NA 1FNSA 1QCYA 2ICAA 3QA3E 4IHKA 3V4PB 5ES4B 1MQ8B 4Z7NB 1JLMA 4IXDA 4Z7OB 2I91A 2XWJI 5E6UB 3HXQA 2VDNB 1PD1A 3F74A 4NEHB 2I6QA 3ZE0B 1YVRA 3EGXA 3E2MA 4WK2B 5E6SA 2VC2B 4G1EB 5KYXB 1PCXA 1U8CB 3EG9A 5LN1A 1V7PC 1UEXC 3HXOA 3EGDA 1IJBA 2X5NA 3PPVA 1JEYA 4CNBA 1BHQ1 3K72B 3K6SA 1ZONA 3NIGB 1QC5A 3TCXB 2NUTB 1M10A 3IBSA 1YVPA 4NENB 4G1MB 3FCUB 3PPYA 3NIFB 2NUPA 1M2VB 3Q3GE 3FCSB 1RTKA 3BN3A 4MMXB 1SHTX 1N3YA 4C2AA 5KYYB 1RS0A 3M6FA 2XWBF 4HQFA 3RAGA 1CQPA 1M1UA 4HQLA 2VDQB 2ODQA 5HDBB 5HGJA 3ZE2B 5KYNA 3EGXB 4MMZB 3BQMB 5E6SB 1LFAA 1JV2B 1ZOPA 1MJNA 2O7NA 5BV8A 3EG9B 1AUQA 2NVOA 3EGDB 4F1KA 3TVYA 4Z7QB 1RD4A 3T3PB 1ATZA 1JEYB 2VDRB 3EOAI 1IJKA 3HI6A 5KYYA 3F78A 3K6SB 2ADFA 1QC5B 1MF7A 1SQ0A 4FX5A 4CN9A 1NA5A 1JEQA 4XW2A 1T0PA 4O02B 3EH2A 3ZDYB 2NUPB 2ODPA 2XGGA 1AOXA 1U0NA 3K71B 4DMUB 1FE8A 2WINI 3TXAA 4BJ3A 3PPXA 1BHO1 1DZIA 2M32A 4M76B 1RRKA 4WFQA 1MQ9A 2WW8A 4WK4B 1DGQA 3EH1A 3EFOA 2B2XA 1MQAA 1XDGA 1PD0A 2VDLB 5KYUA 4HQKA 3T3MB 3VI4B 4WJKB 1PT6A 3NIDB 2VDMB 4C2BA 1XDDA 3EOBI 4UM8B 5E6RA 3ZDXB 1IDN1 1MHPA 1Q0PA 3GXBA 3VI3B 1M1XB 4UM9D 3TW0A 1N9ZA
chains in the Genus database with same CATH superfamily
4TLAA 1XL0A 1G2PA 1DJMA 3I2YX 3IFSA 5ICCA 1OILA 2FWPA 4UE2A 3RS3A 1R6UA 3I1FA 4PQRA 3PJRA 1RQGA 4MARA 4YRQA 5I9SA 1HURA 3O2QB 1RQNA 4YMSA 4PYRA 4W5JA 3HI4A 4L8GA 4PYJA 221PA 3LC0A 5F7JA 1R4NA 1V7QA 2I6UA 3FFBA 2VDKB 3QM1A 2C3PA 5DH9A 4XDGA 3C24A 4ZALA 3HXPA 4GZMA 3DZKA 4KWTA 1GRNA 1ZMRA 3AVVA 1Q15A 2AQHA 2H5EA 2NZWA 2YMMA 1K8RA 1OAKA 1UODA 1FFGA 4PGHA 3OTGA 1BDHA 3LLVA 3RODA 5FPTA 4X97A 4BZPA 4OATA 4A0FA 2IS4A 5I7WA 2WRZA 5L3SA 4Q4LA 4KQ1A 3WQQA 1IQUA 1KMHB 4UDXX 2G9NA 4FYWA 4J1TA 4DCOA 4ZV4A 3X1DA 1FLNA 4KR3A 1SY7A 5JJBA 4BQOA 5F52A 3U1VA 1CRPA 2N9UA 1YB4A 4N0EA 4UDOA 4A16A 1KXZA 2NSLA 3D4LA 1BMFA 2FY8A 3P94A 2W6JD 5DHPA 5E6SA 4BWYA 3PHHA 1V5EA 1MJGA 2GRAA 3W2IA 4TWJA 4EF5A 3RYHA 1IB0A 1ODLA 5GM2A 1XZLA 2J08A 5DCWA 2QBYA 3GFRA 3GMDA 2V7VA 4DQXA 3D1JA 3PQEA 3PGJA 3GP5A 3I2HA 5HW0A 4DW8A 2VJPA 3H3XA 2JZNA 5DX1A 5D51S 5E4FA 3CC8A 2V0GA 4IFIA 2YV3A 1RPNA 1X2BA 3EIQA 1E77A 3IEMA 3MQFA 2NP6A 2C4KA 1WPGA 4JC0A 2QIPA 2WV7A 4ESVA 2G9QA 2PMDA 2HJVA 2Q2OA 4LY3A 4PGGA 5G02A 3LQKA 1Z7EA 2AL7A 4MW5A 5ALYA 1XEFA 4WXPA 2C4MA 4AY3A 4RDHA 3QMPA 1Z82A 1BWQA 3C6YA 4HLCA 1NV9A 3G9QA 3BTVA 4S2EA 2JIOA 1NVVR 2AR7A 2CMKA 3E22A 1GVNB 2O7NA 4JH0A 4RZHA 3RUCA 3UMYA 2VAPA 5HF9A 3C6MA 5CCEA 1G9XA 1ORTA 2FGKA 1EKXA 3EOAI 4B9AA 1IN4A 2PFKA 4P3XA 1SU6A 3GRZA 4JB8A 4DIKA 4GLJA 4H1VA 4MIYA 3CRNA 2CDBA 3NCTA 2QL6A 1ZI9A 1JEQA 4JITA 3KE8A 4CW7A 3NV9A 3KWLA 1UPTA 4OB7A 3MIIA 5CUQA 1PR6A 1JHOA 5J2UF 3SSAA 2ZBEA 4G8JA 2AXNA 4IGFA 4OK6A 3TMKA 3V7NA 4C3VA 1C50A 2X13A 4X6XA 4JL6A 4RY9A 4UBMA 1S3GA 3WYFA 2OPHA 3GUZA 1M8FA 3UJ9A 5A5DA 4CEJB 1E66A 1FB5A 2BP7B 2FJPA 2IHTA 1Z75A 2J33A 1QUFA 4MWZA 3VUFA 4BO7A 4TUYF 3TCNA 3FPEA 5J1SB 4C0SA 4IP0A 3LCJA 4QHTA 1NOIA 2GXSA 3LX5A 4X8HA 1FUUA 4Y98A 1UDCA 3I09A 3ZNOA 1X13A 2H1OA 4NXNB 3WTBA 3E1GA 4N5HX 1M6VB 3TQTA 1RP7A 1BGXT 4UE3S 3MBIA 2YHUA 3GRVA 2CDCA 3G5UA 4PZ0A 4LXTA 1JSRA 1E79A 4QECA 3LTNC 1C14A 4A0HA 2H0RA 2TMKA 3AETB 3KVNA 1KOJA 2P2DA 4K81B 5DHUA 2BR3A 2JAWA 4QU0A 5C51B 2XGMA 3STXA 1BGWA 1X3SA 2P6NA 2INGX 4QXOA 3PQ8A 4PICA 1TDJA 4R1TA 4CM3A 2FWJA 4J90A 5FWNA 3S81A 3MD0A 1Y5RA 1NQAO 3K9NA 3M6IA 3KR9A 4LZAA 4L5AA 5J43A 1J56A 1DAOA 1ZLYA 1ABBA 4FD2A 3G8CA 2WJZB 4MKGA 3SICE 5JT1A 4IIBA 2QU8A 4OXXA 3O8BA 3AK4A 3DMNA 4MEAA 3B3AA 1XZMA 2QMEA 3Q72A 3NM4A 3IKJA 1RLOA 3BZUA 3OQPA 2JLYA 2KYRA 2RONA 4JC8A 2OGSA 5DM0A 1AXRA 2DPMA 2GNPA 3C41J 1RLJA 2VKQA 3AHJA 1W19A 4LF4B 5DHAA 2XWJI 2XWPA 5FFMA 3HP7A 1RWNA 1M34B 4QSHA 2H2DA 4QPNA 1VOTA 3MW8A 3UKOA 2VCEA 2W6PA 1Z38A 4PTZA 4ZOLA 3QPBA 1U7DA 2XXBA 3UUFA 4H7KA 3A6PC 1E63A 2RFLA 4FCTA 4GQBA 1N6OA 5E9WA 3SX4A 3TTXA 3N0RA 4CNBA 1NQOA 3HK2A 2MYUA 1WXIA 1YMVA 2AZDA 4DIOA 1IWPB 3AF1A 1GUYA 1WAMA 3TL2A 3WAGA 2PZFA 5H0IA 5LQNA 2ORYA 4I2VA 4YA6A 5A4IS 3UAOA 1ZLXA 2D3WA 3EPKA 4WNAB 1NFFA 2PK3A 2GBLC 3EW9A 3AP1A 2ZTHA 1EFCA 1MB4A 2WFLB 4XDHA 2ZR8A 5HGJA 1Q84A 1QHHB 4EAQA 4GKJB 1ID1A 3DMFA 4O5AA 1ZH8A 2K2WA 4LJ9A 1GNRA 1IHDA 4TM8A 5D00A 4Z8YA 5KX5B 4YCNA 1B0PA 2CE2X 1KMQA 3R3XA 3WKEA 3ZGOA 4XYEA 1GPYA 3IP5A 1XVVA 3KYDB 1RAEA 2DJIA 2QX8A 3OI7A 2FQWA 2AFIE 3GHHA 4HFMA 4DG5A 3PNLA 3S7TA 4AS2A 3ITDA 1ZD8A 4NHOA 1P5HA 1I4OA 1BTOA 3C8HA 1VCHA 2HXSA 2WJPA 2X42A 1UH5A 3MBKA 3OFND 4BEWA 1C7IA 1NA5A 1Q14A 1XDUA 4JLAA 4QWWA 4JC5A 2AOUA 1HRKA 1GNLA 1JDBC 2BFPA 2P8JA 2C82A 5DBEX 5C31A 1J0AA 2BFAA 1V4VA 5F2OA 1IXSB 3DDZX 2OYSA 3BA1A 2IOYA 1TUGA 2QRKA 4Y1FA 1U4SA 5AUQA 3G2QA 1FFDA 2YW9A 4A1FA 3PUJA 4WLNA 2GEFA 4CCAA 4GUAA 4EYGA 3T9BA 1K8ZB 3C48A 4IRXA 2ZJ0A 3OJOA 3DR3A 3EUAA 2ZBFA 4MTCA 4X90A 1YAHA 2XNDA 5DISB 2ZAMA 2XZOA 3NIDB 1KI6B 2GAFA 1TYCA 3E5HA 3EGVA 4JEMA 4QQFA 4JLMA 1EJ2A 2GPWA 3B36A 4EGJA 3CF0A 4ZYLA 1W5SA 2QY6A 3JZIA 5DM4A 1CFJA 3O2JA 5K4HA 2XE7A 1A9RA 1YR1A 4IBOA 2IHZA 3D2LA 5IJ9A 4U02A 3ESRA 3S7ZA 3UJ3X 3KR2A 1N7JA 4CQMA 3NVDA 4A15A 1GZ6A 1Q77A 3LKVA 4UVIA 3GA0A 1J8MF 2IZOA 1Y33E 4C7XA 4DC9A 4EK9A 4RD4A 4B2LA 5BWOA 1WLYA 3H2JA 4DNOA 4OX9B 4CKZA 1ZA1A 1XCJA 2GHRA 1S6YA 3EXEB 2LKDA 4ZYZA 2GHQA 1ZMXA 1CUUA 2PL9A 4NBRA 3VHXA 1DAIA 1XZPA 1Z4MA 2F00A 1HSZA 3GD5A 2PSFA 3EODA 3WGZA 2OVFA 4YRTA 3A1UA 2GPSA 2HSJA 1FTGA 3ESBA 2C20A 2W2QA 3PXEA 5IZCC 4QGSA 3E3MA 2XOKA 3WXBA 2LE0A 4TKUA 4E1AA 2QJOA 3GLHB 4YONB 4Z4GA 4ADSG 1TC2A 1WOMA 4ZVLA 5TIIA 1HDZA 3RYTC 4JV5B 1Z0KA 3Q7TA 3SYNA 4KMOA 1P4AA 3L5KA 4UVDA 3EWIA 5FBZA 2CEKA 4EH1A 2G88A 2OUKA 5ETJA 1MG0A 2IELA 4HAUA 2NTNA 3GJ5A 2O7VA 3LLSA 2E89A 2PKYX 2OUIA 2VPXA 3NC1C 3OPMA 4LZLA 5BR7A 5I4KA 5LLDA 4HUJA 3SZ3A 2VJNA 4FBGA 2IW1A 1RLMA 2CHEA 2V96A 5THQA 4UNNA 3KZMA 5DI3A 4DYHA 3EA4A 1TIKA 5DMXA 4AJOA 1NG9A 3E2IA 5HA5A 3PP8A 3AUYA 1YO6A 1W4RA 1OTYA 3UT5A 1L7DA 1USIA 1KBOA 3FRJA 2X0KA 4MQLA 3K70D 3FCUB 3MMPA 3NIFB 2NTJA 1H8ED 2AT1A 2ZJ7A 3W7VA 1HLDA 3ZD8A 1QLWA 3CNOA 1T91A 2AXEA 5AOVA 5CB0A 3BL6A 1S5PA 3QFHA 1RMQA 2J0VA 3NAQA 2NXJA 3M6FA 2J4FA 4G1FA 3V55A 2OM2A 4N0QA 4F60A 3ZHZA 4AG5A 1GFSA 2AEEA 3H2ZA 4B3SB 1E9DA 3VU3A 4Z4QA 2ZR9A 1NTOA 3EGXB 3BFKA 5BSWA 4O5OA 3K1JA 4XI9A 1SGWA 1BRTA 4Q1EA 2VJLA 3MOSA 3JAMA 4DQVA 1TPYA 1UFQA 3MS4A 2NVOA 1C9DB 3BK7A 4BHTA 4A8JB 1E4EB 2QTBA 3BGOS 5A03A 4Y9UA 1UBLS 3C7DB 3EPHA 4DCSA 2IH5A 2YWCA 3PDIA 4MS4B 5GM1A 3M1AA 2IP2A 2Q8NA 2ZE8A 1MW9X 2HO4A 3AP3A 4LDZA 1W4ZA 3AFOA 4OBXA 5L45A 5IP5A 1E2BA 1JIQA 2AUMA 1JIIA 2BFWA 4PO3X 1NBIA 4KBGA 3RUPA 4PZEA 1QG4A 3ZU4A 3H4MA 4OSPA 2FRDA 3IEUA 4KXFB 4RL4A 5CURA 2EGGA 1T2NA 2M32A 1EVJA 1CVLA 1W25A 4UFNA 3TRKA 4PPQA 5JAOA 3NHWA 5EJ5A 3KSRA 2XYGA 5JMWA 1Z3CA 1SELA 2QN2A 5CVDA 2FQQA 1JR2A 3K9QO 1QFZA 1YR8A 3N2GB 4O8CA 1YB6A 2DPYA 3SBXA 1PRYA 3A2LA 2E0IA 1P3Y1 1CULC 5EKXA 1QFMA 2I8CA 3MWDB 4BB6A 1B8NA 3OFSA 4N6OA 1N9ZA 1W581 2RGCA 2VQ3A 3H4TA 4WXMA 1GO2A 1HL3A 1T9HA 4MV0A 4LUCA 4H3KB 4KOAA 4ZYUA 1W5EA 1JJVA 2ZRGA 3A1FA 3L2OB 4IX9A 4LRTB 3QPAA 4EY4A 4D41A 1NJSA 3LK6A 3X0DA 3U3JA 4NK4A 1ECJA 1OA1A 3BORA 3OO1A 2W8BA 4GOKA 2CGEA 4IYRA 3K5IA 4CIVA 4KNYA 3HN6A 1P2UA 3CCBA 4X1OA 2F8LA 1EFVA 2X76A 3OJCA 3ZHSA 1SUCA 5KJFA 1IVSA 4L9RA 2BH9A 2FUKA 2H2IA 3T1VA 3VPCA 2P1DA 1NXOA 3RVPA 5JECA 4KE6A 4C0BA 1ZP6A 2QUHA 3MT8A 4E21A 2D1YA 2XMDA 2WWXA 4OHFA 4D5EA 3ER6A 1ZJYA 1UBNA 3KJEA 3SFVA 3IKVA 4U6NA 3W1WA 3WL4A 4D5GA 4H1TA 4EGCB 4OAQA 4P0PB 4GKBA 1HDGO 1A97A 1CQIB 3LX8A 3LGSA 4I5DA 2BUBA 1I9GA 5F4ZA 2I91A 1W4AA 1F8YA 1HO3A 4V0MA 2XVAA 1KGDA 2Y68A 3QIAA 3SZUA 1YVRA 3LL4A 4LYEA 5JVDB 4CMJA 1J0CA 1TIBA 1EFUA 1VMKA 3AI1A 4FHFA 2R6DA 1MAUA 3BTSA 1VL6A 4K40A 1Q21A 2Z6VA 5M04A 1QRDA 1L7EA 4OBWA 3DZDA 1DDOA 3UB3A 2HLDA 1RWPA 3OAAA 4QRHA 2HRZA 4DT1A 3EPRA 4ALLA 2B7LA 4DSTA 1OLUA 2GWHA 2R68A 1M10A 2ST1A 4OAPA 3P19A 2WI8A 4BBPA 5F98A 5DTMA 2GBLA 3CUYA 1AKQA 2QDXA 3K96A 4QHYA 4CT5A 4A8PA 4DIUA 1X7WB 2BSQA 2O8BB 5AYVA 2KE5A 4F71A 1BH2A 2CLSA 1L4NA 3K1TA 5EZYF 1EXVA 3I53A 1FRNA 4Y2PA 2YV2A 4QXPA 1MEEA 3EVFA 1CEEA 3JD2A 1SIUA 4L9AA 4Q12A 3A2NA 5J4KA 3DEZA 1ND5A 2NZ8A 3SQDA 4F6LA 2WWGA 5U4QA 4LK2A 4U2KA 3AL2A 1E5VA 4UAGA 1DWUA 1Y1KE 3JAKA 4LYFA 3VDMA 3B1ZA 1EQUA 3NKFA 3NPMA 5ECYA 1X0VA 2DUWA 2FW1A 1D2CA 2WLSA 4GE3A 5KCMA 5KYVA 3O75A 5LKRA 3PEWA 1KPGA 3IILA 2XYHA 5KSPA 3AOGA 3LOPA 2QM0A 1SQ0A 3HEBA 4GBJA 4RV9A 4EPWA 2Z8YA 4LDRA 4Z3KA 4ZOQI 1EX9A 1FRZA 4J4TA 3ZZTA 2FFJA 3L7IA 4JP8A 1JQJC 1GSAA 2PQMA 2UZ4A 4FKBA 1N2EA 1NR7A 1W85A 2XCIA 4A1OA 2O2ZA 4Q16A 3MUEA 1YDFA 4OI0A 1UBKS 1WDMA 2DQKA 4JGIA 1QIKA 2OVBA 3B9RA 4RIIA 3SZMA 5HM8A 4JLVA 1AKNA 2IEYA 3VR5A 3HUEA 5DT2A 3FKQA 5C37A 3Q0EA 4KHPB 4NS1A 2PIDA 3R6DA 1BOFA 1WUHS 4JUIA 1RKQA 4U2GA 5ES3A 1ZOSA 3R3SA 2A14A 3HMQA 3VM6A 4UFPA 2WVJA 2VP3A 4KMMA 2C58A 2WPNA 3UAWA 5K3DA 5KJEA 3ZY2A 3HKEB 2WT8A 1NUUA 1UJ2A 5LA6A 1MAAA 3IE2A 3B1FA 2J32A 4YV0A 3LFUA 1N0WA 1VYTA 2AD5A 3RVOA 3QZUA 2OFPA 5FQNA 4C29A 4AP6A 4EUFA 4IDPA 5EZSA 4CL3A 1WCWA 1XNHA 1U28C 2J46A 3G3EA 3LK7A 4GMHA 4R6XA 4E03A 4Z2AA 1QANA 4BNGA 1RPJA 3SQOA 3GT4A 4C78A 1A9PA 3X3HA 1S2IA 1O95D 5LQCA 2HSDA 3O3OB 2O5EA 1G7SA 2PLWA 2P0EA 4GM1A 3K2EA 3N0WA 4EYKA 3OSZA 5L95A 4KR6A 2X40A 1GNVA 1W8IA 5A6VA 2WWHA 5CCXA 2EARA 5TE9A 2WBLC 2FX2A 4XCQA 4KAXA 1C9YA 2QL7A 2EDCA 1W5TA 3R76A 3U4DA 4HZIA 3WRYC 1Z0JA 4JR1A 4EI8A 4KREA 3ZK8A 4N40A 2FOIA 2JHGA 1HYBA 2OCPA 5GGYA 4D80A 3REOA 2WU0A 3DQZA 3VZPA 3A6FA 3RFVA 2DTEA 1XQ9A 5JG7A 4FOTA 3QKSA 3HCPA 2ZEJA 3TZQA 1FYXA 1IU9A 2AK2A 3DDCA 3IB3A 4QASA 1GSHA 2AW5A 3P45A 4G97A 4RPLA 4EIWA 2IIBA 3RRFA 1INLA 4M0FA 2Q41A 4MUIA 5I3ZA 1OFGA 2QTVB 2WUEA 1VLLA 3C3JA 1MKYA 1U0SY 4RTSA 3B70A 1JG3A 1H5UA 3CURA 3ZGYA 1TYAE 4X7RA 5REQA 4B1FA 1J49A 2AN5A 4YAFA 1K08A 3JVEA 3JY6A 2HR1A 2HQSA 4FFLA 1SBNE 1Q83A 3GG2A 4ZTZB 2B25A 2VAVA 4K03A 4KFUA 4XKJA 4IMPA 2DR2A 4G0WA 5TJHA 4DMGA 1Y98A 3BT7A 1N32B 3AJ9A 1Z0AA 4B33A 4DLSA 3IP7A 1K5GA 1U98A 1U0EA 3TLZA 2XSZA 4GWLA 5AI4A 5FI1B 2AJCA 3H9QA 4TKZA 3R9IA 5CT5A 3HEMA 2ECFA 1U2ZA 3UC5A 4F4IA 4PTLA 1CQZA 1L5VA 1XNQB 2PL5A 4I4NA 3TTWA 2X8JB 4R05A 4V02A 1V4BA 4EW3A 2JKVA 2P9GA 3FUUA 4V0RA 4D9NA 1A5BB 2IPMA 1YS6A 3DHWC 2QE6A 2FFAA 5CLHA 1BD3A 3ZXSA 1FXWF 4OMDA 1XYYA 2ET6A 4HDNA 2J6IA 2QN1A 3Q2KA 4CF5A 1KMIY 2VHVA 3KT6A 5DPMA 1L8XA 3NGMA 3UFBA 5L53A 3R7WA 2A9RA 2I65A 4OLFA 4M3NA 3UTDA 3PL1A 3TR6A 3WQRA 5INTA 3A1VA 4PZUA 1Q0TA 4FFBA 1JQ5A 4IVNA 2ACKA 1RLIA 2QD2A 3SNKA 4EB0A 2BMAA 2GNAA 2A3RA 1L5NA 2C2BA 3C16C 4JYAB 4G24A 3U4MA 1FX0B 3NRCA 2GESA 3RC7A 1QHNA 1J7KA 3BREA 2ZRKA 3KEQA 1CWUA 2CXTA 3JRWA 4JLUA 4GKVA 1ADFA 4E51A 3LXUX 4TXMA 2JGDA 3WGLA 2R8XA 4BNVA 3GWZA 3HPQA 4EHBA 1KQOA 3D5QA 4IGAA 4WOCA 3HA2A 1XDDA 4FMCB 4M9SA 5KOJB 1Z3IX 4OHOA 4QICA 1LBSA 3S1AA 5KI6A 2C8LA 3LUHA 3DKVA 4L75A 4U9IS 2RGNC 1DJNA 1CUEA 2PR7A 2Q4OA 3A1TA 2I4IA 3K30A 3NBUA 4O4JF 1KY3A 3B3QA 2NU9B 3EZYA 1MT3A 2CDAA 3LJKA 1ZNWA 4EVRA 5FBVB 1TZBA 3D6TB 3U3DA 2DEUA 1HKHA 2HHAA 4HNAA 2CXUA 2YIDA 3DNMA 2GCOA 4FNAA 1YJCA 3JATA 1S7GA 2VSYA 1WA5A 5GQSA 5K7SA 3EEOA 4NG5A 5IVHA 1U5AA 1TF7A 2CFOA 3LPAA 1I5OA 3F5DA 1GNSA 1T2UA 3RSZA 4C7KA 4EJSC 2NOAA 4TLDA 2AHOA 1L1EA 4PC1A 5JOQA 1G3IA 2F9MA 2RBGA 3EBLA 4I5EA 4L7QA 4ZC8A 3TDNA 4KWHA 2EX4A 4WX2B 4HLDA 1L8LA 2X77A 3GMTA 3I30X 1BN7A 1ODIA 2CXHA 3ANNA 4GPEA 4NS4A 4XJTA 4Z3DA 4DG9A 3DHVA 2EBHX 2BUCA 3VJLA 2B3DA 2WF6A 4KQWA 4MVWA 1TFUA 4EHDA 5C2JB 2I4LA 2AG0A 4Q47A 4YBZA 4HGYA 5D5HA 1N5OX 4Q9DA 1U0BB 3C6ZA 4DCVA 1FUIA 2EATA 3LIIA 1UDBA 3BWXA 3TRDA 1W0JA 3F7TA 1Y8AA 1B76A 2AG1A 2HWWA 4WA8A 1V3QE 4NDNE 3GFOA 1WMDA 4XRGA 4PNZA 4X62B 1LNQA 1SOUA 1O89A 3PWKA 4Z7JA 4XSHA 1JSCA 3F49S 4D25A 5CVEA 4R2WA 2AHRA 4GLFA 5FOXA 3NCHA 1D03A 3OKAA 1I4LD 1ZICA 4AY4A 4CG3A 1BJTA 1V95A 1NVTA 3FTNA 5LOVA 2Q99A 4EUEA 2ZQ5A 4L08A 2JAHA 3KTOA 2XRMA 4JGBA 3AC0A 1PN3A 2YYZA 1E69A 1QH0A 3ZVLA 4CMEA 3CUKA 4FTWA 1JHRA 1ZK4A 2X86A 1Y42X 3MAJA 4X44A 5DTRA 1VJTA 4JIMA 4MJ3A 1DJQA 2A5DA 3PG5A 3OIFA 4YB8A 3RRMA 1E32A 1T8SA 2XNJA 4D99A 1W9HA 1HF3A 3GROA 4X00A 1P81A 1YUNA 1BKSB 3LQ2A 3PICA 4KN9S 4BXOB 2BBWA 2D5AA 3PRJA 3RSLA 1X80B 3D1LA 4IHJA 4RVDA 2IYXA 1IY0A 3QEMB 1OXXK 4Q34A 2GZMA 3E8XA 3U4IA 1CUAA 2QP4A 3FMGA 2QX9A 3RJ5A 5BR1A 1EAMA 1UMCA 1HYQA 1X8JA 1EP2B 4O02B 3EVCA 2OOKA 3L7MA 5I9BA 2PMWB 3L4BC 4D9FA 3LC7O 2G7MC 2Q45A 4W9NC 3ZWDA 3AVTA 4P3YA 5BPFA 2G08A 3U7RA 4L16A 5BWCA 3AF6A 1L4MA 1QS0B 2HBZA 4C43A 3NHAA 1H94A 1N0UA 3T41A 1DXQA 2I6FA 3F97A 3CVWA 1FSGA 3VJMA 5J59A 2WJ6A 4RWZA 1VJGA 4DR1B 5KYUA 4EPVA 2I87A 5AM1A 3WC4A 3HGQA 1D9ZA 3SVLA 2C83A 1PWYE 1T3GA 2OT3B 1Y9JA 4K1XA 4Z9XA 1JEJA 2WMDA 3BMXA 1B14A 4JJAA 4C5BA 4YRCA 4GGPA 1G8SA 2C3OA 2QVBA 3PXDA 3OZCA 4NARA 4XXHA 3O26A 5DWVA 3TBKA 3HXTA 2FA9A 2D4HA 4UUQA 2EG9A 1ZS9A 3MJVA 4ISCA 1AGNA 4N49A 4ZEWA 5K4GA 1XLTC 4QOIA 1QK3A 1EFKA 2JW5A 2OTCA 3FDJA 4LJ5A 1BXKA 1KQ3A 2LD4A 2PA0A 4WH0A 2P4UA 1Z17A 4IZIA 1R12A 1WXFA 4L8FA 3MEQA 4LHEA 1V6CA 1JMYA 1MAHA 1YCHA 2GM3A 3QVMA 1PJCA 2XODA 4QOGA 2H2AA 2QUBA 3K0AA 2W8ZA 2WG2A 2GZDA 2VRCA 3FWNA 4NH0A 1G7CA 2FV8A 3PE3A 2GDJA 2OG1A 2K2QB 2QD4A 5SY9A 4GYYA 3E4CA 5H8WA 1Y6FA 1VRCA 4UXHA 1J8FA 1LDNA 2A9FA 4BO6A 5CBPB 4PC2A 1FRQA 1C0PA 1IG0A 3OX4A 4DAOA 2YZ2A 4F9TA 5JJIA 1LSSA 1W4LA 5K3CA 3U7EB 2W22A 2H51A 4B81A 2A1TS 1ZVKA 4CLRB 2EWWA 5SZHB 4TTJA 2IU4A 2P2YA 3GFGA 1ZU5A 4FFVA 1KK0A 1KSFX 3DL4A 1NLZA 3LP5A 4BBJA 3RT1A 2A1UA 3CRMA 3NH9A 3T3DA 3FLMA 4L02A 3U7JA 3SMQA 4H59A 1M83A 2WF8A 1KP2A 2BLLA 5EIWA 2OENG 2X4LA 4EG3A 1EA7A 2NUAB 1SEPA 1Y82A 4BMCA 4JQOA 1GVHA 2Q6OA 5E3IA 1JILA 1PGOA 1ELOA 3RV3A 1TM2A 1EUCB 3EYAA 3PXBA 4KQFA 1OI3A 4AFNA 3E23A 4WKBA 5TEVA 1G55A 5DYYA 1CHNA 3IT3A 3GGCA 2NUPA 1FUKA 3W8NA 1KK1A 1WOYA 1ZJ4A 1H0SA 4DGQA 2B94A 3QXXA 1MOSA 3BRQA 1U8AA 1PL7A 1BE0A 3LIPA 4I1YA 2MINA 2LCFA 2Y0CA 3PL5A 4UU0A 3TLJA 4RK7A 1LJLA 2DPLA 3QVGA 3MJDA 2I78A 1ML4A 4BZQA 1KYVA 3DD5A 3I1IA 4KIUA 1TZCA 3GEGA 2H0AA 2VHCA 1MJNA 4OF4A 2FUG1 4RIEA 5JE8A 2Q3DA 3CJTA 3T5AA 3V1YA 1L3BA 4L2IB 2Y2UA 1Y3HA 4M6WB 4RD6A 3BS4A 1P77A 1UP6A 4AG6A 2JAUA 2WPDD 4ZCPA 4NJOA 2VN8A 5LBUA 3OWXA 3IAS6 2GK6A 5COQA 2J41A 2VQFB 1CY6A 3TF5A 1HTTA 2D00A 3KZVA 2XKKA 4HO1X 1JR3E 4Y30A 1LA2A 4DRYA 5FNVA 2J7PA 2ROQA 1FE8A 5AFSA 5HRUA 1SCDA 5T7BA 2ZATA 3DH0A 1ODCA 2PSEA 5IT0A 3KCQA 2X5KO 4TYQA 1Y7HA 5JTTA 2CKDA 3A70A 3ZWNA 4EFMA 4U7DA 2IC5A 4R1MA 1WZ2A 3D8SA 3WA6A 4N76A 1R0ZA 4EGAA 3HR7A 2B8NA 3GHYA 2DE0X 4D81A 2AFHE 3OQIB 3GCZA 4UCXA 1MIOA 2BHLA 4FHGA 5FD8A 3BSSA 3R7FA 4Z9FA 1E9CA 2P2GA 2WUVA 3HUTA 4KVAA 1SC1A 1XHLA 3OCWA 3NOVA 5KTPA 1JF8A 3CM0A 3FBWA 1CYEA 2VL7A 5I7FA 1UC5B 2VPQA 3DDNA 4H60A 1CYDA 4XPIA 5I3CA 4GMDA 3CF6R 1UR5A 5EUQB 1U7OA 1P91A 3H2KA 4AUKA 1QAOA 2G1AA 2G1UA 3A3OA 4BJ1A 1T5BA 4DEYA 1WMSA 1MDBA 3KTDA 2CNBA 3P96A 4XD7D 4TVBA 3SG0A 1EBUA 2OD9A 1FNDA 2VSFA 2D7DA 2BM9A 4LEIA 4N03A 4ASUA 2MU1A 2CZQA 4J3NA 1DC3A 3U3XA 5F33A 3JWEA 2DR3A 3ADPA 3KV3O 4AS3A 1KH3A 5A0FA 4DN6A 3F8WA 2P6RA 3LFTA 2BV3A 4JSTA 4ZCIA 4O4IA 3U7FB 2F8SA 4C9BA 4Q9HA 3PYLA 1SUSA 1A5SB 3C3WA 4PRKA 3PUKA 2IV7A 1F2VA 1Z5ZA 1JZSA 1HG0A 4AF8A 2AFIA 3B3FA 4Q6WA 4CKBB 5KVVA 2JFVA 3TSZA 4CMHA 1FXUA 1OOEA 2Q50A 3R23A 3A25A 1SCQA 3M4XA 1NQTA 3KHTA 3NRBA 5EMKA 2ZCJA 1AKUA 4NNJA 4UEKA 5LDDC 4UVEA 1NPTO 3COYA 3A04A 3KDSE 1GG2A 5HG0A 1XZNA 3WISA 4JUBA 3SVTA 1UKCA 2I4NA 1EVZA 2J6CA 4LCEA 3PT9A 4D43A 4OO3A 3TZHA 4OK5A 3OJEA 4B73A 3BMCB 1ZUWA 5TB5A 4X8OA 3FPGA 1ZSNA 4EJ6A 2JD2A 2YZMA 3UUWA 1RE0A 1HI9A 4M0KA 4MVJF 1Z4IA 4ARUA 4JXXA 1RHJA 4NENB 1CU1A 2UUAB 2C3YA 1YXMA 3JQFA 3G2OA 5BN3B 1QHGA 4KIGA 3W90A 4HEHA 2BEUA 2AWNA 4MCJA 4D96A 1RS0A 4YT8A 1AK2A 3PNMA 1OX5A 5CT4A 2XZLA 3AXSA 4TWBA 5AR1A 3HJFA 4EY5A 1RYDA 3X1JA 2IU3A 3DAGA 5HFJA 3FPSA 4AX4A 3MTJA 3EQ8A 3NEYA 4UPVA 5IMBA 1U2SA 3V4ZA 4ALIA 2JK0A 2IH4A 2D59A 2DFKB 2B1RA 2W2NA 4EHAA 4LYYA 2J85A 3ROMA 2HMWA 5T67A 1IUKA 3TFOA 1FTSA 4CDMA 4NG4A 2XVMA 1NE7A 1RJGA 2PJZA 1TLTA 3PTLA 1UZUA 4URFA 1ZHHA 3SF8A 4ENTA 3L92A 3QWBA 3ONEA 4UAVA 1QRAA 5EJ4A 3P9SA 3G0DA 1N4AA 1R66A 4RELA 5BUZA 4RHTA 1NJ6A 1C4WA 1PS8A 2VJYA 3B6IA 3C45A 3D31A 3S68A 4UDYX 3SSOA 4HXYA 4I50B 3GG9A 3IYLW 2BE9A 5G53C 3LLCA 4PWZA 5CB4F 3PQ6A 1VMIA 4D9GA 2AS0A 3HJRA 4RBNA 4PPYA 2MJLA 5JNWA 3DM9B 3TTTA 1NAHA 2NZXA 4C3UA 4HDSB 3NTQA 4C22A 1GDTA 5GZ3A 4HQKA 1PR9A 2J5BA 4JI4B 3OX2A 4AD8A 4DV3B 4KBFA 3EDMA 4HXEB 3W5SA 1VDMA 1ZL2A 1G63A 3R75A 1Z6XA 1BJKA 3L05A 3D7LA 3OCCA 2BFBA 2JHAA 5A5VA 4DCJA 4ZP1A 1XLTA 2JS7A 3S1SA 3UV3A 5BQPA 1EIWA 2WWIA 3JD3A 4Q1BA 3I9V1 5HIJA 3O7WA 2C3MA 2WWRA 3TJMA 2NYUA 1ZH6A 3ZV7A 1M7BA 1C8VB 4NNOA 2JFOA 1XVAA 2JF0A 1VHJA 5JRJA 5AW5A 1DKRA 3VC3A 4ZJYA 2JI6A 4Z0TA 3VKGA 3OICA 4UULA 4WVFA 1V3VA 1YKFA 5EA2A 1O94C 2WNIA 3V2IA 4WBNA 3GK3A 2RGYA 3ELUA 3FR8A 4RPJA 3DBRB 2QN9A 2WJJA 1XRRA 3WFJA 4WLVA 2WA1A 1KL7A 3IESA 3U16A 2R8EA 2A5GA 2CD7A 1EX7A 4BS9A 1UDAA 4B3RB 3AEXA 3DHYA 3AX6A 1GU7A 4NEGA 1N5IA 3NIBA 3LCRA 3UWOA 3OHSX 5B7GA 1GRQA 4NFHA 5AVOA 1NXPA 2O4CA 1Y8RB 3GN1A 5H80A 2YRWA 1US8A 4D9CA 4Z1OA 1D6JA 4JASB 5DJ5A 3MCUA 3SHTA 5C7LO 4TN1A 3ZQ4A 1YDGA 5LU8A 4LXHA 2OCBA 3SX2A 2C4UA 1A4XA 3TJZA 2QLBA 4EABA 2H06A 1TXGA 4RXMA 2A88A 2H2WA 4MGYR 1J39A 3KZOA 3NT4A 4JLSA 1J6UA 1TU0A 2V1XA 4DJFC 5CEEA 1N78A 4PONA 4K8RB 5CLQA 1KR2A 1NMEA 2ETVA 2HFJA 3FJ1A 2WIJA 3K6RA 1I5EA 3KQKA 3WO1A 1SIOA 4K0RA 2AC2A 2GEDA 2YL2A 3H04A 5CCBA 2P69A 4NBTA 1G5HA 1L7RA 3DKIA 1DAKA 1H6DA 4BNKA 2I1VB 5ALVA 3IMFA 3FPCA 4GI5A 1DUVG 1Q1AA 2BLNA 4GVLA 4GPIB 2COUA 1HWYA 3BQMB 4QQRA 3CRVA 1U0HC 2XWQA 1NX6A 1JI0A 3OPYA 3OECA 1J1ZA 4P98A 1T0HB 4G9GA 4TV9A 4YAKA 4Y0VA 5BURA 2GEJA 2QUKA 4P3OA 1JFTA 1GARA 2IXDA 4CWAA 1GG9A 2HK7A 3HL0A 4AMGA 2Y1FA 3L7YA 4C05A 4F6RB 5I5EA 4LNUA 2IDKA 2JL1A 3JD0A 1UBRS 3FETA 5AVSA 1K0UA 1MX9A 4I2NA 4BUZA 1W46A 2F1JA 4RDCA 3HJBA 4CF3A 2G4LA 4OB8A 2B37A 2J5KA 3VR6H 4CQLB 4Z9BA 3IUJA 1JJ7A 2EERA 4XJSA 1EG7A 3MA0A 3Q7QA 3K6KA 3SQNA 4PQYA 2FN9A 3IQFA 2J07A 3BIXA 1Q91A 3G9UA 2XNHA 2ZRAA 4R1NA 1T5OA 5H4GA 2W6CX 1QDLB 4PFJA 4R3WA 1ZVJA 2C84A 2VHYA 3UO8B 3HUFA 3IRVA 4HDCA 4U7TB 1E2EA 4HGOA 4MP8A 5GGXA 3UY4A 1G5IA 1W36C 1EHCA 1JKJB 3CX7A 4B3FX 3VNVA 1VQ1A 3NX4A 4HEQA 4P84A 4EPXA 1P31A 1WXEA 3DVAB 7YASA 5SYAA 4CKCA 4OYLA 1FFCA 4R31A 4UU1A 2O07A 1SXIA 1XDWA 1O96A 5IDYA 5TPWA 2EX0A 3TBHA 2IHYA 1A4IA 4IIHA 1WCYA 5A1TA 4FN4A 2QRNA 4W7HA 5J4HA 1DZ3A 3PXUA 3SQXA 2FPUA 2YV4A 3ICOA 5BSUA 4C4PA 3V4RA 4HNRA 4IHQA 1KYYA 1OR8A 3F90A 3OY7A 3OQVA 4L3VA 4OB6A 3V8RA 4XQGA 3V4FA 3WRYA 1I4EB 1VLVA 2PD6A 4O8ZA 3BOSA 3CZRA 5LZ8A 2IYRA 1E0SA 4EI7A 2J8ZA 3COPA 1A2QA 4UNIA 1XA4A 4YMWA 5KSZA 4QOJA 2ZQZA 2VRBA 3H16A 3I4FA 4KH1A 1A8SA 5ALDA 4BNIA 4RZ3A 3KHUA 1TK3A 2XKAA 1W88B 4IM7A 4UHHA 1ZX1A 2ZSFA 4A0QA 4A8JC 3JALA 4A27A 4D9EA 2C4TA 4HQOA 4ITUA 2HHJA 2JJ1A 5H3CA 4PC6A 5JAPA 2CL7X 1XR3A 5K0SA 3GQBA 5JXIA 1P7VA 5FOTA 2XUKA 2WAOA 4EQZA 5EXPA 1YCGA 3LUJA 4LK3A 3D6AA 4EWLA 3MMXA 3E5RA 4F06A 3K2BA 4YRSA 3R44A 1WY7A 2CXNA 2J6HA 4Z7OB 2B4RO 1OXBB 1IULA 2H7CA 1KI9A 2YWXA 1JDNA 2ZI9A 4YALA 4AJ4A 2R97A 1KI8A 1QNLA 2HCJB 3D81A 1D0VA 3E81A 3VMMA 1SXGA 2DQ4A 4LIPD 4IV8A 4RV5A 1Z39A 2VA8A 2YJZA 3AM5A 2C77A 3EB9A 3TUZC 3WRXC 4QBFA 4H17A 4C1BA 2RK6A 2PXCA 1H5QA 3MINA 1DWPA 2QJWA 3R0XA 4LY0A 5LXTF 3X1WA 3OBIA 4HGNA 4IJUA 4QAQA 2WM2A 2HWUA 2FMKA 4UNRA 5DBGA 1JVSA 4ERNA 2V3WA 4YPOA 4G1BA 1RC8A 1CRZA 1Z2CA 3T5GA 3TLEA 4IOLA 3LO8A 3LT5A 4L22A 3EIHA 1WZEA 2VHZA 4AJKA 1E3TA 3U6KA 4JK3A 3LSTA 5AKYA 5E3HA 5KU1A 1DG3A 1QRUA 3AR9A 2VDQB 2BC9A 2CLHB 3KFLA 3FBGA 2GOYA 4FEGA 2IWHA 4DBVO 2HPAA 1EK2A 3A6ZA 3L7KA 2QZJA 2CBZA 3PBKA 3BKXA 2WY2D 4XD2A 1JTEA 3WOVA 4DNFA 4LNAA 1YONA 4LBVA 2VPZA 4UD6A 3NATA 2I0FA 4JVMA 5B36A 3B60A 2QM7A 2X2EA 1WMFA 2XMQA 3Q8WA 5JZMA 2H5IA 3U17A 4OU4A 1UAAA 1MO2A 2YKGA 2VDRB 1V16A 4F85A 2ACVA 4RK4A 1D2GA 3VRHA 2HA6A 5IH7A 2GKGA 3I61A 2NUBA 2Y0DA 1I3KA 4YWJA 3L7BA 4NPCA 5EKSA 3FPAA 1C1XA 3N8GA 1S3FA 1SUPA 5KTKA 3UFXB 5HKOA 5M5BA 1YBAA 1QE3A 3CW2A 1T26A 4ZEXA 3V42A 3WQHA 3EXFA 2OL4A 3BE5A 2NPOA 3N2EA 2ORVA 4F3YA 4DOMA 1GCAA 3HA5A 4W1QA 3CCCA 1L1FA 1K3UB 5JC1A 1G6Q1 1NMSA 3L0DA 4NWIA 4FQ7A 1WF6A 4OHPA 2W6QA 3S29A 2EXXA 3IXQA 1ZNZA 1DMRA 4XQ9A 5GOZA 3T9DA 5BT8A 1GU1A 4BNXA 5TLSA 2VDLB 4TT3A 4IIJF 1KVSA 3FN4A 4AXBA 4ZI7F 1T8YA 2Q8PA 2J9FB 1KZ6A 4AJLA 1R15A 2P75A 3MJTA 3G89A 3W2FA 4UJ5A 1YZNA 5CLIA 3W2TA 3ZW9A 3QYAA 4PX3A 2G77B 2HQ1A 3EC1A 4HAOA 2C94A 5HE9A 4PAGA 2FJUA 2ZJ4A 1TO6A 3Q40A 3DQQA 2EKLA 2DQYA 1BVRA 2WA2A 4LOAA 3FZYA 3I92A 5ERGB 3V7WA 2IZ1A 1O94A 1Z88A 1IVYA 2OP1A 3RPEA 3A28A 5TF0A 1CB0A 1LFDB 1RI1A 1T2FA 1T4MA 4YS6A 3PFFA 3V7FA 3IP6A 3E1SA 2FEWB 1EU1A 1HDCA 3FNEA 2ZYUX 2YRFA 5L3VA 1KJ8A 2R84A 5JCXA 4UMDA 1N3LA 2D0OB 1NI4A 4YRIA 1XYVA 1YL5A 1QV6A 1FFYA 4ARSA 4WZBE 1VL2A 2XB9A 4DRXA 4HVLA 1V3TA 4E46A 5IDXA 1A4UA 1PTKA 2OEPA 2FLWA 1M33A 5AVQA 1WDWB 2R00C 3H0EA 4PAQA 1YJQA 2IS6A 1XX6A 4QEZA 3BICA 4X92A 3GX1A 4S24A 2QXYA 2PY6A 4E70A 3SQWA 4HEA1 4C7OA 1HDIA 3GLTA 3G2PA 4WACA 3SXUB 1DFIA 4KI0A 4QTZA 4RMGA 4HB3A 1E6WA 5JASA 2O2IA 2V54A 1D1SA 1KZ4A 1Q0UA 2XDYA 4PZLA 1WCIA 2VYCA 4GZLA 1ILEA 1NXQA 1VE7A 2PGIA 1UMBB 5BN4A 1LF0A 5F35A 2I66A 3UJ8A 2YQ4A 1F38A 1A9OA 1CUJA 1G8KA 3BB3A 4P54A 3A27A 3J81A 1P2SA 1E2NA 1VB5A 2OHFA 2WTMA 3P32A 4FFNA 1FFWA 1HZZC 2NUTB 2SKCA 3AVOA 3VR4D 2NZUG 4L5CA 3ZZ1A 1QVAA 1M8PA 4YQZA 1VMAA 3A7DA 2C4NA 2BGGA 4WW0A 4MYUA 3SZGA 4GQIA 2VWGA 1NUSA 5AHRA 4X6LA 3PQFA 4KNVA 4PYIA 3KTAA 1YR3A 2NN3C 1FVFA 4YAJA 3D4OA 4J2OA 3UMGA 1OXKB 3SKXA 2Z9BA 2YVUA 2QROA 5CB8A 4LS3A 2ZI4A 1DRWA 1Y1PA 3DOUA 1NW3A 2Y0PA 2Q0HA 1AZTA 3OMLA 5BW4A 1R74A 2YCLA 1V47A 1AQLA 4O2BF 4B6JA 5L8VA 2F6RA 1DVRA 2GF0A 5FUXA 3OQ1A 3E5NA 4MB6A 3K0SA 1FJGB 1QO9A 3HKDA 2H7XA 4GZ6A 4V3CA 2NO7A 3KZKA 3BZBA 3DF9A 1FFEA 1EDOA 5HFAA 1P17A 4EO7A 1E1LA 2C2YA 4PLWA 1LS6A 3L77A 4BJ6A 1I1OA 2PUJA 2YHSA 4ZAZA 4V38A 5LL6P 1Q92A 4Z4EA 1C1DB 2KBEA 4QG3A 8ABPA 2FPMA 3M9LA 1Z6TA 2V3VA 4L8YA 4YT4A 1JKXA 3JD1A 5DV9A 4YJ3F 2X4IA 3F3MA 2ZVJA 2W0MA 3STTA 2I4OA 5DX8A 3AEQB 4KXNA 4HVAA 1T43A 3VYWA 2C99A 2CY0A 3L9XA 3RU2A 5LQSA 1NBWB 2FZLA 3GJYA 3PXAA 4BV2A 2AH5A 1E3MA 4WJLA 3RSOA 4D8YA 3IEVA 4HADA 4UMFA 1CV2A 4KUEA 3NWOA 4X54A 4Q3LA 2Y1CA 4K6MA 3TIXB 2JGLA 3KUKA 1NUTA 3QTBA 3FZGA 1SU8A 3CB2A 4I4TB 2Q6KA 1DEHA 1P1RA 1KFBB 1FDUA 5CA1B 4CKWA 3LHFA 1YVEI 1D7OA 5IT5A 2H4FA 3ASYA 3CNNA 1NN5A 2O0JA 4PLGA 4F91B 3P9IA 5KNBA 2XYQA 5ADUS 3KTFA 4WUVA 2X8WA 4I8DA 3RIXA 1D3AA 1N9GA 2IYTA 2V7UA 1YVUA 3QKRA 4F3CA 4MV9A 5BN5B 2GRJA 4ZHQA 1H5NA 5KNCH 1GEEA 4FGUA 2GF9A 1A8IA 2BN4A 4C4RA 1C7ZA 3RVSA 4PPFA 3N2NA 2RGAA 4OHWA 5AJXA 1KDVA 2P9BA 1P6QA 4IHKA 2JVIA 4V03A 2NV6A 3S5JA 1AMOA 1MQ8B 1ABFA 4CFSA 4MUBA 4QQ8A 4H7HA 4E2WA 4AY6A 2WSLA 1TAQA 1XCBA 1A8UA 3ES9A 1PJBA 2BZGA 1THTA 3M2PA 5BYJA 3RWOA 3IEXA 3R3HA 2X6RA 3KSAC 2C9CA 3S4YA 4RQBA 3L8GA 2V5AA 4KX5A 1ZGZA 3EGDA 4RXTA 3AG6A 4YAUA 4X94A 1E7MA 4CLEA 2JH3A 1KF0A 1DQNA 2YHIA 3KZXA 3R5JA 3UMJA 1E2QA 1C9KA 2Z4TA 4WXYB 2UZIR 5IJZA 4QVIA 3DMYA 1BNCA 3VX3A 1DKLA 4HZUB 4UUOA 4IIEA 5DGHA 3FJYA 1N2GA 3DT6A 3DVLA 5C8YB 4RH3A 4DUZB 3N8KA 3L5OA 4GR9A 3QU4A 2Z5LA 2ZYWX 2W11A 2NT3A 1D4OA 4LZNA 3WYGA 3G2LA 4I1PA 3EQ6A 1WZIA 4ENSA 4MRAA 4OAOA 3AT1A 5FPHA 4RVCA 2Q21A 2ZWVA 3IDAA 3I5MA 1C3EA 2IRWA 1E1CA 2H92A 1N6IA 3AQ4A 3QWAA 4FXOA 1YZHA 1YR9A 2B8JA 1ZC3A 3R9KA 4EENA 2YRXA 2JI9A 3SBDA 1A27A 4MVJI 3FGZA 1IBRA 1Y9ZA 3JQAA 1Q57A 3H97A 4CF6A 1BO6A 5TDHA 1T3LA 1XZHA 1J9GA 2ZRQA 4POAA 2JGNA 3QVSA 1HA3A 2DQSA 4PO1A 4FE4A 1XZJA 3V1MA 4BQSA 1K4YA 3G6WA 4RYDA 4UPDA 1YZVA 3T7SA 5ILQA 1K1EA 4D4KA 3RUFA 4RM3A 1EDEA 2C9OA 1ZD4A 1A98A 4U2DA 1AK1A 4CLDA 2W2KA 3O47A 3ONWA 3BXOA 3O4GA 3KYCA 2OZLA 4Y2VA 1UKEA 1HMYA 4G5XA 1QM5A 3KP1A 5AW2A 4LGCA 3QUTA 3UWMA 1S8AA 3ZZMA 3VA7A 2J0SA 1WHTA 1BHSA 2BHTA 2CLEB 2OCGA 2PTGA 4ATNA 3KQNA 4WKNA 4QHSA 4C2BA 4ZZ1A 3SJAA 1WV1A 4EG7A 5FL3A 2N1BA 2H9IA 1M1ZA 3FLBA 4U3JB 3UW3A 1LLDA 2AG5A 1XUOA 4LPKA 1I6KA 3JAWA 1GR0A 1ZINA 3Q0TA 3U9SA 2GVDC 5KQPA 4L0CA 5COAA 1QP4A 3AYXB 3ZCQA 5JRZA 1M2GA 3ZDAA 4WXRA 2J3JA 3HFGA 4PRYA 3UGTA 2X0FA 3V2GA 4CJXA 1E9BA 1Z0DA 2EKDA 1UK8A 3OHPA 3IA2A 4G3XA 4YMUA 2RGXA 3MMNA 4Q4HA 2FWBA 2RH4A 2X7HA 1H2RS 3FJOA 1E9EA 3GJTA 3Q9LA 2QKYA 3VPXA 1Z26A 3MJHA 1YD7A 2ATXA 1W1WA 4FU0A 3IMCA 4CIDA 3IUNA 4W5NA 3L8YA 1KI2A 2P78A 2Q4DA 5DM1A 1SQGA 3GLGB 1M66A 3ELBA 2V97A 4IF4A 4I19A 5DMHA 5CYGA 2Z95A 2I2DA 1ISSA 2MT9A 4JDPA 1C80A 1FNSA 3MWLA 4GOJA 1X7HA 1JDTA 5BVHA 4HH3C 3T9CA 1OZHA 2C7GA 3F4BA 4IDEA 5CK4A 3F6YA 4MQ4A 4HNVA 4AU1A 2QGFA 5IBPA 4GR4A 3Q3CA 5EMHA 3KKQA 1WVMA 2CV2A 1H6BA 1SCKA 2VTVA 4V2IA 4JI7B 5JATA 1X1SA 1WMBA 1KFCB 2FSPA 2HEIA 3HZOA 5C7YA 1JR3A 2ZAGA 3EZGA 2R1VA 3FMIA 1X7DA 2R2AA 4RSMA 5CJJA 5EC8A 3ONFA 5DNAA 5EP4A 2O8DB 3T1QA 2ISQA 2ZSIA 3X1XA 3K6SA 3L18A 3U4QA 2GTHA 2RHBA 2ZUUA 1GCUA 3GFSA 2ZU0C 3I5UA 3NNSA 4XVHA 2QTMA 3WNBA 4BAZA 3OEEA 4QDTA 4INOA 5IYZA 2P4SA 3O8RA 5C34B 2P91A 1USKA 1JPUA 2AFHA 2BSAA 1F5SA 1EDZA 1KI4A 3Q3GE 2XEDA 4X20A 1E1NA 3OZBA 4Y2QA 2DLDA 5FJIA 2L69A 2Z83A 2FSIA 3WQBA 5C8DA 2VNHA 2AZXA 2HMSA 3E7WA 3VR1A 3A06A 3CT4A 1SO8A 2VSQA 3S2ZA 3V8PA 3I45A 3VMFA 1QGED 3OVMA 2HSEA 1VP9A 4OHMA 2PBZA 2QSJA 1E1QA 1QB7A 3WDKA 5FAXA 4AJIA 5IABA 2O7SA 1FTQA 3GH3A 1O6GA 2R7NA 1FBNA 3LPCA 3NTRA 1WP4A 3O1HB 2XA2A 3DUFB 3I0MA 4DIMA 4CTOA 4EKIA 1HLPA 3K0EA 1RLTA 4MK4A 4NYJQ 2XB6A 1JDVA 4P4SB 1QO0A 2QAGB 1TAHA 2GN1A 4EL0A 1QH9A 3AYZB 3ONVA 5D5QA 4FBMA 4GLBA 1PT7A 3GRPA 4MUFA 3O91A 5I7VA 4BRSA 2H1RA 2X0JA 1XQXA 3NASA 4JA2A 2JFXA 4YJ2A 3TW8A 4N7RA 3REFA 5GAJA 2WILA 3TCKA 1XZDA 1NJ5A 1OX4A 3PYMA 4RIFA 2E3JA 2HMTA 1L8AA 2FW8A 4K9LA 4KXWA 1T5TA 2GM5A 2IU0A 3WP0A 4DFDA 3OM9A 1H1DA 4XWOA 4P82A 2FMHA 2R8YA 3PE6A 2GNOA 3P20A 1CUGA 2OV1A 3H0KA 3KQQA 3VKHA 4G5YA 1M2NA 3SXPA 5EMNA 4OHZA 2I29A 5DTEA 4W5WA 5EXTA 1AZSC 1SU7A 4U6SA 3KUDA 3V80A 1ZIYA 1YDHA 4DILA 1FCJA 5KMGA 2YWBA 1NN3A 2WMOB 3MHPA 3O2SB 2EFCB 3BMOA 1PZFA 2WAXA 5EL0A 3W4JA 1LI7A 5KVSA 3LFHA 1JFVA 2KWIA 3K9BA 3MGAA 4Q9JA 1N75A 4HLUC 1TPZA 5EMJA 1DTWB 3A6GA 4WN9A 4DDWA 4I55B 1GPBA 4WLFA 3VPFA 1NQXA 4ZZ0A 5JD6A 2FZKA 5BORA 1NYRA 3ORSA 3LCMA 1XAHA 1ZNYA 3HU5A 4AICA 5L4NA 3KB6A 4QOEA 4MRNA 3LUGA 2CHFA 2O20A 3DZJA 3HKCB 1PW5A 4HMOA 2QVXX 2JRCA 3QE0A 5E7MA 1GA4A 1J2JA 1NW5A 4C3ZA 4JODA 1R37A 1TA4A 1U0OC 3DWIA 4DA7A 1L7VC 5EYPA 1Y7PA 4MWSA 3RAPR 5ITWA 1A3CA 4EY7A 3AERB 3IHWA 2CLOB 1M5RA 1ZGJA 2LDXA 2RHDA 2ZUTA 1O94D 2X4GA 4PPNA 3HGTA 3ZBTA 3TOSA 3H2HA 3SM3A 1FP4B 1UPAA 5JC8A 5LU9A 1W59A 1N77A 3UJCA 4KYIB 3REQA 5EHXA 4OHUA 1OB2A 4FBLA 1JHMA 4IKOA 4ND8A 5DYNA 1OKKA 1SIWA 4LDPA 1PF7E 3JPWA 5I4IA 2VTBB 3UQZA 1HNWB 3RC1A 1CQJA 1SU4A 1AMUA 5G0VA 3PFGA 1DQYA 1YQ9A 4C0AC 1AKTA 2ZBQA 4PCLA 3ADDA 2XRYA 1M6HA 1C2TA 1XKTA 2FEOA 4EBFA 1XE3A 4FFPA 2NV0A 5K6RA 1J23A 1Z15A 4AUEA 1G60A 1BVYF 1Q1NA 3IIIA 4TXNA 4G4GA 4F46A 4GD3Q 2AI2A 4BO1A 2PCJA 1II8B 2UVPA 1L4FA 2KM1A 4MPPA 5CAEA 3DBHA 2PJDA 4QNRA 2DETA 2HPZA 3QUSA 4RA9A 1OFTA 3R20A 4O4HA 4BLVA 3RBAA 1M0EA 4AO6A 4FGZA 1MOQA 4RS3A 2Z08A 5IW8A 3A3YA 1QLHA 1U8FO 1LQUA 2X58A 3KOUA 4WZAB 1SD1A 2JK1A 3K8YA 4CUJA 3FDIA 1XMOB 1EUYA 5CW1A 2QTLA 2AC4A 3GJ8A 3WNQA 5LSAA 3JS5A 3P9PA 2BFOA 5B58T 5DWDA 1H2XA 5LQAA 2CWWA 2HMVA 3JVUA 4C0KA 1VE1A 4TV8A 2FP4A 3T9EA 5FOUA 1DS6A 4HHEA 5BMVB 2QTZA 2WSBA 3ETGA 1IFXA 3EUFA 3PHGA 3PI6A 3QE3A 3E7PA 1UT6A 4L85A 4RMIA 4AJPA 4UTNA 1BROA 4UQLA 1XTPA 2BMWA 5GV7A 3VTKA 4Z7QB 4Y9DA 1E20A 3SOZA 4DL9A 2WTUA 3P9ZA 2XXAB 2PUFA 4DA4A 4R2IA 4G86A 1IXYA 4ON9A 3NYQA 3B2NA 5HEKA 1K2WA 2EFGA 3P27A 1Y7TA 4FX5A 4PPGA 4XQCA 1EVKA 4R5HA 4DAEA 1Y1RA 5EMMA 3TIFA 4QNNA 3SNHA 3ZDYB 4DMFA 4LJ8A 2YBDA 1RCFA 1YTLA 3OZFA 3CZQA 5DZSA 1C7EA 2QXTA 4YUVA 3CH6A 4HDMA 5C4GB 4HWSA 4MI9A 4KQEA 4DQLA 1ENYA 4GECA 3GA5A 3LBYA 4LQCA 1SC9A 2WSYB 4N9QA 4TZKA 1YASA 4WEOA 4EFLA 5BR4A 4WECA 3EBPA 2UUBB 3U62A 2A94A 3BAFA 1GXSA 5CVTA 4H7FA 4QM6A 3CN7A 4DVGA 1YKSA 3IP8A 5D85A 2SCUB 2DH5A 4YRJA 4ER3A 2WKSA 1Z2PX 4IO1A 1CR6A 3GGOA 4KQIA 1E5XA 1XTVA 2ILTA 2JD1A 4Q48A 4ZO6A 3RS8A 5LP6B 1K7EB 5BVGB 4YROA 3VH2A 4QOSA 3PLAE 4KPYA 3UAVA 1RNLA 2G1JA 5KWJA 1N5LA 1QORA 2ZYRA 3GVXA 4FWBA 3WGVA 1WHSB 1GPUA 1GA6A 1GEGA 2XH8A 3DLBA 2BM8A 5CT9A 4ZWNA 2OC4A 3VYVA 1I7LA 2YN2A 1W8DA 4JFAA 1DSSG 2D2XA 4WXEA 5A6SB 4TTVA 2IHKA 4B6GA 1ZKMA 5FO0A 1U9ZA 5K0JA 5KNBD 3KKKA 5YASA 2VQ6A 3OP1A 5ESXA 4CE6A 5JISA 2QVLA 1PSDA 5JH7B 2C1XA 4NEQA 1TU3A 2W2XA 1ZM2A 2CUTA 4YPFA 3T3IA 2P65A 3P8ZA 3MJ4A 3IT0A 4U9HS 2F48A 5HHTA 3W2HA 1R5OA 2NVBA 2V65A 5DM2A 5FBLB 1H65A 2ZSJA 3CO0S 3S2UA 1M54A 3QF4A 1TCVA 2BZ0A 3GO4A 5CG2A 2JKZA 1JLMA 4RIGA 4E2XA 2ZUVA 3O8QA 4L6AA 1M0WA 2ZKIA 5HFNA 1A8HA 4GC5A 2PT9A 4WKPA 1IYZA 4M7PA 1AHNA 1HQKA 1TTQB 4AWXA 5K1ZA 1LX6A 1UBGA 4J43A 4LHSA 3WK5A 1C7QA 4JLDA 3A4YA 2XNCA 4WLEA 2WHPA 3A9WA 3CR3C 3QXHA 4JNKA 4JEUA 4QUKA 4XUCA 3G1WA 3EG9A 1NF9A 2C2ZA 1IXRC 2FUCA 3FUWA 4JVNA 3IJRA 1UM9B 4YIHA 3IR5A 1KR5A 5SICE 1Z56C 3A1EA 4TSFA 4RWEA 2QMUA 3DAYA 2EJWA 5DE3A 2DX7A 4Q4AA 3P0JA 2GBGA 4P5PA 2ARKA 3A6JA 4P93A 5GZ6A 4ERXA 5BYKA 3O93A 1QTRA 3JYLA 1DG9A 1N5MA 4A03A 1TCCA 4HBGA 4KACA 5U9CA 2F64A 4AS1A 1VTKA 1RTKA 4RMNA 2IV2X 1TLFA 1Q0QA 3WHIA 1X19A 4RVOA 3GGPA 4OIMA 5BOSB 1RVV1 2GHIA 4IXTA 2ZUWA 1PE0A 2QNBA 3PEYA 2P8SA 3ZDDA 5LXTB 1L3IA 3KSUA 3WJ1A 1Q19A 5GIPE 1D1PA 5ALUA 4US1R 1VM6A 4NSNA 1G42A 3DTTA 2B98A 5B58C 1CCWA 1TNDA 2B1JA 4FLMA 3KJFA 3H1TA 1U2DC 1P0MA 1KEPA 5JLAA 5IT4A 1QK4A 2H5JA 1RDFA 2NTVA 2PBLA 1RWVA 2VATA 2Y1OA 5D7NA 1NP3A 4ZEOA 1ADGA 1CLEA 3R8XA 2C92A 4D56A 4F2PA 4EKDA 1S7CA 3MYRA 1DIOB 2XTNA 3EH2A 3IJ5A 2GZAA 3D0RA 3DE1X 4FW9A 3CKKA 4TS1A 2DLNA 4XIGS 5JYBA 1S8OA 4RKWA 1GG8A 3SSMA 1WF3A 4GI2A 1VJDA 3TXAA 4NC9A 1O0SA 3DEJA 4JYPA 3UWPA 1U04A 2I9KA 1KRWA 2JIRA 3SLGA 4Z4IA 5C8VA 1N2JA 2X3YA 3IB6A 3RU7A 5JMOA 1ST2A 1PNTA 2O14A 4HLUA 2ZRJA 3Q7IA 2C4VA 1PLKA 2EKQA 2RK4A 2FR0A 1TJNA 2ENUA 2HD4A 2IEBA 1XEXB 4N9WA 3X2EA 2BAGA 1E5TA 2JLAA 4H7JA 3V3KA 1E1RA 3ZWOA 2PKRA 2WDZA 5EMLA 4M1ZA 4BNYA 4G4SO 3THXA 1FU8A 1CJUC 2AMVA 4L50A 1M7HA 3BMNB 3QMVA 4MIEA 3UJ7A 4KN5A 4QT4A 1M8GA 5T4EA 4PRZA 4FJ2A 4QPZA 1CIPA 1SUBA 1E6MA 1X9GA 2BFCB 2O3SA 3K0CC 5KQLA 1EGQA 4H7EA 5HKKA 2ZB8A 1H0KA 2W4IA 1WU8A 2QN3A 3TBFA 1VE3A 3H11A 4MVJH 4B47A 4G09A 1EBFA 4KVZA 3L1UA 4MS1B 2QYHA 3TR0A 4NIMA 5AVVA 2DBVO 3H2IA 3FTDA 2PUTA 3M6LA 4EZEA 2AI3A 1LZLA 2DWQA 2PUWA 4RKEA 3UPDA 4H0NA 4BPRA 3DO5A 3JSXA 3SIWA 1KYIA 1U9JA 2C88A 4DQ0A 4GR5A 3QVJA 5LBIA 1M9NA 1N5KA 1NBME 3HLKA 5HKBA 3H5IA 1O4VA 3KKOA 1GT6A 4KO2S 1UQUA 5CDSA 2VHXA 4EJ2A 4HSGA 1YMUA 2QTFA 2Z4SA 1KFEB 1T3TA 5A3QA 1GL7A 2BFDA 1Z5WA 4LWOA 3ZLBA 1JG4A 3DYVA 4P1ZA 1F2TA 3D3EA 5SZIA 1T6XA 3S27A 3U80A 5H59A 3UMVA 3ZU3A 4YV1A 3IXMA 1NG1A 3E2MA 3I42A 1AN9A 3OZDA 4BVAA 5EVJA 4P22A 4QU9A 1SD5A 1KTVA 1PJRA 5G4KB 5AW9A 3WYNA 1QPGA 3RDPA 4JBYA 4D44A 2WE7A 4WERA 1J97A 2XA9A 1IJBA 1GDDA 5D2CA 1BCSB 4YCBA 4YQYA 3ICEA 1EWVA 2ECKA 3KJGA 3OPYI 4URYR 1TZJA 2LGJA 3KXKA 1JR3D 3B9PA 1T0JB 2CW5A 3E0QA 5B3LA 1UZLA 1QC5A 2C42A 3PZBA 3D4BA 2QN6A 2ONJA 1P1IA 2QRVA 1QFXA 4LE0A 3C70A 4LFCB 3LWDA 3G5AA 2PZKA 5K2OA 5A4KA 3ZK9A 1G4HA 2V45A 4L0QA 4JEHA 3AFIA 4HWPA 2DZDA 5F1KA 3OEED 1N3YA 2GCIA 2WNSA 3ESXA 1KAOA 4B8YA 2XHEA 3PEVA 4R1OA 1QYDA 3VVBA 4EDHA 1CDEA 4FWIB 1LI5A 4JQSA 1ZGAA 1GYQA 1XWFA 2DPHA 2O4UX 4JZKA 4LOLA 1V8ZA 4DIFA 1K0FA 2WTAA 4D45A 2BOVA 2FX3A 1QXSA 2XCLA 7AT1A 1QVVA 3QP9A 3UHPA 2Q2VA 3A32A 2E5FA 1GAQA 3LKDA 4PY2A 5FR2A 4AX8A 5G3ZA 3ZKAA 1KI3A 1LX7A 1GLGA 2QRUA 1V5GA 4MA5A 1HDXA 3HI6A 4E5KA 1S1CA 3DXXA 3F5FA 5F3RA 1H1TA 3WLLA 4KR7A 1KJIA 3I4CA 2ZREA 5AMXA 1ZZGA 4B5KA 5TGTA 5BQ5A 5BRNA 4GMXA 1JWLA 2AA3A 1T6YA 2BEWA 2IOFK 2WHXA 1Y4UA 4FOSA 4RTNA 2IYYA 4MPRA 4WZBA 4ZC1A 4FFDA 1SD2A 2BL4A 2HV8A 3GGJA 3O73A 3PE4A 3TPZA 2R751 4BEJA 1BHO1 1T10A 3MERA 2QMOA 2V7QA 1EFAA 4HATA 4KWEA 5K3SA 3WGKA 2OO3A 4RF5A 2PZMA 5AM5A 4Y3UA 1OXUA 3E9NA 4AXXA 2CDNA 2CUNA 4FXPA 2ATVA 1T9CA 3ZZ0A 2R1TA 1AUPA 1A95A 1WCXA 1QYXA 4KXYA 3P26A 1KYXA 1MB3A 4ZKEA 1DBRA 4NE9A 1SUWA 3AR4A 3FHCB 4W1SA 2PSSA 5EEHA 3W05A 1WQ4A 2OAP1 3AZQA 2P3SA 3FGOA 3IUSA 1GKYA 4DR6B 3ESYA 2PPVA 4M7WA 1IN7A 3GUCA 3BIWA 4OH1A 1I14A 1LTKA 4A23A 4AO8A 4HUQB 5CMLA 1P1CA 2QI9C 4F8YA 4YJ3B 4ILKA 4QVKA 2JNWA 3ENNA 1XDSA 4LRXA 1E1KA 1N2BA 1UJ5A 1VE9A 3TW4A 1JHQA 1SWWA 2GPJA 2W2LA 3BULA 4HK4A 5FL7A 3P2OA 2Y8EA 2EW8A 4R0VA 4LSWA 2J48A 2QORA 3HDVA 1CJKC 1N2CE 2GJ9A 4EQ6A 4IH4A 3K9LA 1YBFA 3D7KA 5AKKA 3Q5EA 3Q7PA 4IMJB 4YUXA 3ETDA 4XIYA 4IZOA 3C3KA 3HDGA 3GAAA 5IU6A 2DFLA 1UZNA 4N0MA 1DOHA 1W0CA 3DTVB 1SKQA 3E58A 5DX0A 4BWVA 4CZ2A 3OBBA 4RH1A 4R9UC 1V8BA 3H19A 3EGWA 4JL8A 3OKFA 4C7MA 5K0NA 1E1MA 4RX1A 1C4XA 5A7HA 4KQJA 3VOSA 6PFKA 1MDFA 3C0KA 3O38A 3DSRA 3WYAA 3HSYA 5DBOA 4EGFA 2CVHA 1CUCA 1KETA 1ZGBA 2A5JA 1XT6A 3KXDA 1MJGM 1D4FA 4A9AA 4X1IA 5TQVA 1NVFA 4YP1A 3IIEA 5DGXA 4HAVA 4CKEB 2I6GA 2WJIA 4ZCMA 1IRIA 4OQPA 2AN4A 2AJTA 2QEQA 3LOQA 5JDCC 2PX8A 3QHAA 1Q1QA 1TRHA 3DBVO 4FFWA 2JFWA 5EUBA 4EX7A 5C32A 3B85A 3I62A 4WT7A 2IYZA 3DE0X 2AX4A 2AYXA 3MSXA 1NQUA 4RPCA 3AZPA 3QX8A 3S0JA 4CQLA 3N6RA 1SURA 3UA4A 1V1MA 2TRSB 4WA7A 3DYBA 2XB8A 1WNFA 3GLIB 3O5AA 5IRCD 5CFMA 1DV2A 1WPQA 3QEOA 3AB7A 4Y1RB 4BAGA 4CGZA 1YB7A 4YMTA 3KQYA 3LY7A 3VSEA 3LXRA 3HCFA 3IA7A 4C4AA 5JBNA 10MHA 5IAEA 2QTWB 1QGOA 2YJ5A 3FOWA 3F9RA 3GLQA 5GONF 4PHFA 3WGYA 3P97A 1B73A 5C1IA 2A84A 1O9BA 9LDTA 3RRYA 5IC5A 2LXNA 2KLBA 2XTJA 3W7BA 1I0LA 3ADCA 4MV8A 3NBKA 4MVJP 4IJWA 5ENDA 4CHGA 5J3JA 3OUZA 1GTMA 1B8VA 3IAUA 3ETCA 4X1KB 2FFRA 4QIHA 3ABOB 1UZMA 3T12A 3G82C 4IXNA 1ZN9A 3QG5A 5KNCD 5JAQA 4RY8A 1XCPA 5CT6A 1Y5MA 1IEWA 3H65A 3V4OA 4O2AB 3BGSA 3W6OA 4EP1A 1I6MA 4DR3B 1ECCA 2CVFA 2C31A 4B7AA 2VQEB 1GZ5A 3WRWA 5IHPA 3QNWA 4BWGA 2WKWA 4DR2B 1HTBA 2W4QA 5EIBC 3KT8A 2YS6A 4UCFA 3NTXA 3CRZA 4KQGA 3WADA 5FLYA 2ABWA 4Z1MA 3SBEA 5CB6A 5IHXA 2O8FA 2ZRBA 4E1BA 1IY2A 4QAJA 4NFSA 3OU7A 4OK3A 3RF6A 4MZXA 3HR8A 3WTCA 2ADOA 2ZR0A 4AMUA 2Q6IA 3KALA 1H05A 2VYQA 4UM9D 3T06B 3ZBQA 1AIPA 2R44A 1PFKA 1UBTS 2ZK7A 3QUCA 3NEAA 3ED1A 1MAVA 1ZIDA 3ZCSA 2EAUA 4K86A 4HYTA 4CIAA 4GXTA 1OD6A 4MQEB 2XQKA 3C7TA 2ZRLA 4WJZA 1N6NA 3SKVA 4EO9A 2YJTD 1RT9A 4N3BA 2PN1A 2NNWB 1DLIA 2VR1A 5CYPA 1A7KA 1TC1A 2XF2A 4REQA 4DSZA 2ZETA 1KDOA 1UQTA 4E07A 1SHUX 1Z2NX 2MSNA 2VRWA 2QF7A 2BHRA 3N2KA 5I9LA 3GCWA 1DXOA 1B8PA 1P45A 4Q4DA 4JBIA 4XGIA 2O2JA 5E4JA 4DARA 4RDXA 2PX2A 4TRRA 1DCTA 1JQDA 4FFMA 3Q9UA 1LC0A 1KIAA 1M75A 1YQGA 2E55A 2G9RA 3RSSA 1AKRA 4MWCA 3ZH9B 2FI1A 3EDRA 3IODA 4TRMA 2CFCA 5D01A 2QV7A 5G1OA 2WJHA 1O97C 2CB0A 4JJ8A 5JNTA 1C3OB 1GPAA 4RK6A 1PKEA 5F5XA 2B1GA 4KXXA 3V1NA 4C7JA 3QSGA 3SPXA 2A30A 1RZRA 1XN4A 1EVLA 1EFPB 2WHYA 3ZCUA 4YI5A 3RASA 4F3NA 3HYSA 4KNWA 1XZCA 1ZH0A 2DFDA 2DHDA 5FBHA 3U26A 4I6JA 5C8XA 4IDFA 5KTMA 1VJRA 1U7HA 5CITA 3EOZA 1F2UA 2ZT6A 4BO0A 3NDRA 3UAGA 1X86B 1PW7A 3FMOB 1Y1LA 3AHGA 2P7IA 3V8VA 3Q8LA 1ML3A 3M6MD 2EFEB 1ZGCA 1RAGA 1SHZA 2GA9A 3FYHA 4HQRA 4TSFD 4DUGD 2C9MA 1ORIA 1Z37A 4C14A 2RI6A 4DV1B 5LYJF 2W83A 2B4YA 1X92A 4DEVA 4DM7A 3ZWBA 3S99A 4HNQA 2DWOA 1FX1A 3GRCA 3LYLA 1QKKA 5ALEA 2HRCA 5KNLA 4POOA 1MO5A 1NXTA 2W7TA 3B20A 3MTGA 4DABA 1GM5A 3LSYA 1FIUA 5JZ9A 3GA7A 2ZIXB 4R3NA 5BUQA 1ZUHA 821PA 1RD4A 2BGTA 2ATCA 2VH5R 1ZEJA 3SFZA 1JEYB 1MVLA 2FPPB 4H77A 5BQXA 3FCEA 1YQWA 4IL5A 1P2VA 1SAYA 1YRHA 2RGWA 4JR2A 5CDHA 4TYYA 1BC5A 5JALA 4RFLA 4DNPA 2C5SA 2P1ZA 2F8MA 1YDEA 4JYBA 4FQ8A 5C5IA 5HXAA 2IW3A 3LECA 4PANA 3ZBPA 3BIOA 3F4KA 1OAAA 4YJGB 3MWEB 3A1SA 4K8OA 4NX2A 2E4XA 3SZRA 3I72A 4YGXB 2ZIEA 5K8IA 3OE5A 1RXWA 2VSNA 3I0NA 4G0QA 3UB4A 3NH6A 1F48A 1IMJA 2CYAA 2D54A 2PZEA 4NMLA 4XYMA 4QULA 3QJGA 1XOIA 4XVQA 3UK6A 1R8SA 5SYNA 2YUTA 1NBAA 3B5JA 4EB6A 3JQGA 5IULC 4E3WA 1VPDA 3WHPA 5U4XA 3B1XA 4NJMA 1T9AA 1OROA 2VT2A 2FUNB 3R41A 4AWBA 1OC4A 5KYYB 1XRJA 1WUTA 3DDHA 1XL1A 1D5WA 4ZT7A 3IQDB 1RRFA 1DU4A 2BMFA 5ICEA 1ACJA 2V6BA 1FDTA 3K9WA 2O1XA 1JFFB 1WM1A 4YQEA 3MRXA 3CEAA 1XZQA 4PVCA 4RVHA 3H5AA 4TKMA 2YY5A 3RSFA 1ULSA 5J2TB 4KRYA 3WG9A 3WIBA 3CUEF 2XCUA 2FB9A 4OM7A 2FP3A 4YLGA 1RW4A 2Q9CA 3WKCA 3O8CA 2Q28A 1D2RA 4JMLA 4BNTA 2KBFA 3CTPA 3UICA 3DLHA 3PCRB 1OSNA 2VP2A 4BIMA 4DCTA 3TOZA 4E6EA 1GZUA 2V8OA 3EFOB 2QN7A 4E5MA 1F0KA 2Q5LA 4FGSA 4XWKA 3DV2A 3LAWA 3HTXA 4ROSA 4ODIA 3SU8A 3IPCA 1E18A 2G09A 4COOA 4RLHA 5CBKA 5EZQA 1E7QA 1XWIA 5CH3A 3P9CA 4K6CA 4CEHB 1MENA 4IINA 4M8SA 1YHNA 5TPZA 1XKLA 2VPIA 1A5ZA 1PDWA 1TM1E 1Z18A 2QT1A 4RY2A 3WLSA 1FS5A 1N7IA 3U7HB 3ENQA 1E94E 4A0GA 3D2AA 5EPOA 4A92A 3H84A 4BN4A 4E2ZA 5FX2A 1TD9A 3WWPA 2IEDA 3LG2A 2QD3A 2QRQA 3SK0A 4PIVA 3AUUA 1L5FA 1FFHA 3K4PA 3WB2A 3KPVA 1PJ8A 3ZKWA 4EI9A 4MJXA 3WKDA 1R4NB 3GVHA 2P5UA 4IXMA 4BVLA 4PIPA 4TQ9A 4KAJA 1IBLB 2X5NA 1HE3A 3CPHA 1DUIA 1QHYA 2FVYA 1XXHE 2NVUA 2PMKA 3DGEC 3K72B 5M3BA 4MDEA 2QP9X 1NOJA 3NFYA 3GWGA 3R40A 2A0XA 2ZSBA 1DEOA 4G5QA 5EINA 1FUYB 2JFYA 4YAGA 3G2KA 1POWA 3NJRA 5DI9A 2R25B 5A5EA 4H6PA 1ZWKA 3LA6A 5GVRA 3ZCVA 4QXQA 1M2EA 3WGUA 5L3SB 5KWIA 1OC2A 3EIWA 1BXRA 4TN5A 2DULA 2X9GA 1XSEA 3A4NA 3PCXA 4QLOA 5JCZA 1PZEA 1TUEA 1VLJA 1W2HA 3A3KA 2C5LA 4K9SA 1CZNA 4BCDA 1EWKA 4AJHA 5ER6A 3GRFA 1LF5A 1M2WA 1ORWA 1RJDA 3LHIA 1Z8DA 2P2ZA 3JQBA 4KFRA 3OQHA 5HUQA 1HMPA 1T1GA 2VPPA 2CEAA 5E6SB 8ATCA 3OHMA 5A04A 3HB0A 1M6WA 3LTEA 2ZRPA 5WRFA 1RFLA 5HOEA 5BV8A 1Y1SA 3RYHB 3ZX5A 5CEFA 1ISGA 1VECA 3O0TA 3OE1A 4ZZ3A 5F77A 1F0YA 2FJ0A 2VJBA 4OU5A 4RIHA 1RKVA 3T3PB 4BVHA 2QBYB 2C2KA 2SKDA 1AQ6A 1G20B 4YMHA 1T3SA 1OT3A 5MN5A 3VTFA 4DF3A 2R6ZA 2OGUA 2FKNA 4HN2A 2AJ8A 4TTPA 2AOWA 1W0KA 4QNMA 1T0PA 4LDAA 5AK3A 1OFUA 3UK2A 3AOEC 2CYCA 3G5LA 3ZGVA 1AOXA 2QOEA 2XQVA 4QWMA 5HNKA 3WJ7A 2B5WA 1FK8A 5AESA 3EAQA 1XJ0A 3EAFA 4DLUA 3ND9A 2CLKB 1G17A 3RI3A 5EXSA 1UIRA 4YPVA 4X3PA 1JS1X 1PKXA 4FB4A 1G0OA 5FWAA 3N58A 1WE2A 3VKWA 4B6RA 3UPTA 1I7DA 3ER9A 4G5RA 3TXYA 4TPKA 2ZYSA 2AX3A 5EIXA 3E22B 3SX0A 2PZAA 5ALMA 3MJFA 3UGJA 2XVXA 3RTBA 2ZXUA 4O1HA 1L5OA 3HO8A 2F1IA 2Q3EA 3RUDA 1DBIA 2HTFA 2ZCVA 1HFKA 1L3CA 3DMRA 4BKQA 1EK6A 3D02A 4I46A 3JQ8A 2X9QA 3IPAA 1H0RA 3GY0A 3G2HA 1JEQB 1S96A 5D3ZA 2UZAA 2F8TA 1TQ6A 1JHPA 4MTLA 1DP4A 3FPLA 3NHFA 1FMFA 4INPA 1GPLA 2V55B 3F6SA 2ZBVA 2CDRA 3EXG1 5K3FA 4P86A 3H1EA 1AX9A 3T3HA 1RRGA 2LIVA 4Q9NA 3ZR4B 1U7TA 3G8AA 4RTOA 4N41A 1KPIA 1I8TA 3BB1A 3SKYA 2QG4A 2BBOA 3G1TA 1NXVA 2YDXA 4ARAA 5CFZA 4HWTA 3C14C 5HOQA 4GYJA 3PI7A 5AOAA 2HF2A 2MYPA 1C9JA 3JQDA 4RZSA 3T52A 1WQ3A 2IOQA 2WD7A 1XJWA 4MUAA 4OFZA 4CT0A 2F62A 3V4LA 3P9XA 1F9EA 1SCJA 1VYHA 1P5JA 3KYIB 3DE2X 3E27A 4JELA 1A4RA 1NVAA 2CXSA 2PLRA 1N3IA 3R6LA 4ZU3A 2WWYA 5B1DA 4F5WA 5I51A 3VU1A 2YYSA 3KG2A 4E4RA 1H9CA 1KAQA 4ZEMA 2SNIE 1U3CA 2RC6A 5CD9A 2WABA 3DGFC 4UBIA 3ICWA 4TTAA 3CRQA 1DO8A 2D0PB 3UWSA 3CF4G 3RS7A 1VSVA 1Q5PA 1N1EA 2C5AA 4OXRA 4QYMA 4D3YA 3TKAA 3GMIA 3PQCA 4U5XA 1R3UA 4YRFA 3BC1A 1RM0A 1Y1TA 1RFGE 2NM0A 4TRJA 1E9SA 4U1RA 3SR0A 1QRSA 1G19A 3PKIA 3ZE6A 1M74A 3B48A 4LYGA 4TXJA 4RESA 2RKOA 5JWHA 4HJXA 1OWMA 3ZHVA 3WR5A 1RU3A 1GA1A 3FA2A 3K8ZA 3ZTWA 4CF7A 3MMZA 2XCSB 3EY9A 1R8XA 3UC9A 3SC2A 1V0JA 2VP6A 4HRXA 2GJ8A 1DBPA 1QYWA 1V8FA 3Q2IA 1U1DA 4ZFNA 1RZUA 1WP9A 1XJCA 1XZEA 4B09A 1Y6RA 4V1CI 2HIMA 4CG2A 2ONYA 4YN3A 2QTGA 2PH5A 4R0NA 3PCTA 4ZOLB 1UXOA 1ZR2A 3IQIX 1XEWY 2DERA 5J4YA 2ZJ1A 1ZD5A 2I1LA 1TT7A 3R6WA 2XQJA 4YRNA 3TYXA 1J90A 4TMYA 2A4MA 3ZTTA 1XVUA 8ADHA 4FC7A 4BC0A 4PZZA 1CLUA 1W35A 2FN4A 5FTMA 2HK9A 4Y2YA 4TQAA 2PH1A 1U1IA 2LIPA 2F3TA 3KT0A 2XOXA 4OP1A 2VUTA 3VX4A 2B8TA 1OCEA 3L6OO 3QSYA 2IHJA 3ND7A 4JAVC 2JPDA 1SIBE 3GUHA 4LMRA 3LVRE 1ACMA 2OG2A 3OPQA 4MWBA 3ED5A 2JGJA 3GFFA 3D9QX 2JGAA 4JENA 1DV1A 4OMFG 2XYVA 3WY9A 1F17A 2R2GA 2XT0A 4D0RA 3RWMB 2GJAA 1GPWB 2I3AA 2QENA 3CWCA 4PC3A 4S0ZA 1UPUA 5K45A 4KZPA 2RG1A 4AT1A 1L5HA 1D2EA 1P5FA 1ZR4A 3CQ9A 1NLUA 3HB9A 2RJ3A 4X1YB 1B23P 1WD7A 3JARA 2HA7A 3EZ7A 4J1SA 1E6UA 1U2EA 2F1HA 4PINA 4CLHA 2CJXA 2NO5A 4S3MA 3FTPA 1LD3A 1IIRA 1G21E 2A9KA 1XCMA 1C0IA 1VC2A 2DTDA 3JQ7B 3QNMA 3EFHA 4M8IA 5D7BA 5KVQA 3F5MA 1ISHA 3N7UA 4OQ4A 1XTUA 2DBQA 4LJ4A 3IAM1 3KDAA 1U9YA 2ONZA 3IMGA 2AOUB 1YRLA 1RWOA 4BN0A 5JYDA 3ONDA 3T0IA 2BELA 6ABPA 3RV4A 3T7JA 4D4JA 5JPIA 5E7JA 1QIGA 4RD1A 5DGDA 5ALIA 3X2FA 3DCIA 2O0LA 3RNLA 1BEEA 2AG6A 5AVKA 5B1HA 1DXYA 1E98A 1FFAA 5BQOA 4F3TA 1A9YA 3EZ9A 3IE0A 4ZEVA 4MS3A 3HO1A 5IN4A 3MWJA 2QTCA 1CERA 2M6RA 2NYAA 3JD4A 5DYTA 1J8DA 4ZCSA 1JG7A 4BKRA 2CCJA 4UUMA 3VKFA 1ZNQO 5JSQA 3EE6A 4ZN6A