4JNCA

Soluble epoxide hydrolase complexed with a carboxamide inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
312
structure length
312
Chain Sequence
b'GSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional epoxide hydrolase 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Discovery of 1-(1,3,5-triazin-2-yl)piperidine-4-carboxamides as inhibitors of soluble epoxide hydrolase.
pubmed doi rcsb
total genus 111
structure length 312
sequence length 312
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jncA00
4AO8A 5ALTA 2BGNA 3D0KA 3STTA 4XWGA 5DYTA 3MUNA 2X8BA 3D5EA 4L3WA 2PBLA 4Y2JA 5HFNA 3AIKA 1MAHA 1J06A 4G9EA 4G4IA 5A71A 1XQVA 1TCBA 2OCIA 2RGUA 3AILA 3D2BA 2PSEA 1BU8A 2G4LA 4DMCA 3O4IA 2C0PA 1R88A 1KU6A 2PU7A 1UFOA 4UHCA 2PUJA 5HQ3A 4PO3X 2XQFA 2HU8A 3WL6A 5LZ9A 5BWCA 5AP9A 5ALOA 4J0JA 2HL6A 1ZI6A 1DWPA 4X7BA 4QZVA 1RWQA 3EQ9A 2GZRA 4C6HA 4G8DA 2ES4A 3VXKA 4JNCA 2WTNA 4LXGA 4M0EA 5JATA 4Q34A 4D9JA 3WKCA 5T4HA 4H7FA 3OOSA 1SFRA 2XQKA 1H2XA 2VT7A 2OCLA 3FNBA 1A88A 4EB0A 1ZIYA 1QTRA 3EF3A 1YB6A 3PUIA 1X70A 2E3JA 3AJAA 1GKLA 1BCRA 3TEJA 4C4ZA 1SCQA 1EX9A 2BUBA 4F5ZA 2XMBA 4FFVA 1ZD5A 1G66A 3FSGA 3C6BA 1CUCA 1VJ5A 2EDAA 4WFJA 4QWWA 5LKAA 1AX9A 3STUA 4G4JA 3MVEA 1R4ZA 4P08A 4OD0A 1W76A 4HRYA 4Y2RA 2GBIA 3H18A 3DQZA 4J0DA 1TAHA 4B9EA 3C43A 1W1IA 2WHRA 4UBNA 1DTEA 2VJBA 3WK7A 1EB9A 5DYWA 2OGSA 1U65A 1XKLA 2V96A 4H77A 1VE7A 1ODSA 5JZ9A 2PSHA 2RI6A 1PV1A 1W4LA 4WDRA 4HXFB 3RARA 1YS1X 4KAJA 4JYPA 3O95A 4TPKA 4FKBA 3M3DA 2WFLB 1MO2A 4WJLA 3I2GA 5AKGA 3G9TA 4Y2XA 3I2FA 1XZGA 4FWBA 2H7XA 4GECA 2HFKA 4EZIA 5D6OA 1DWOA 1UKBA 3S2ZA 3F97A 3N2ZB 3OC0A 1TRHA 4BZZA 2CZQA 3JWEA 3LLCA 1QIKA 1MJ5A 1YA4A 1T4MA 1XZDA 1OILA 4DNQA 3WK5A 4GXNA 5AM2A 1VA4A 3DEAA 4N5IX 3FCXA 1IUNA 4G5XA 5K3FB 2XDWA 2QUBA 5AI5A 4OU5A 3H2JA 2ZSHA 4C88A 2VAVA 2HU5A 5EI5A 1XFDA 3O4GA 4ZGBA 4HZGA 4OB8A 5ISMA 4LYDA 1YA8A 3GBSA 2W22A 4WCVA 3WWCA 4BZWA 5FPQA 2OG1A 5FXMA 1CR6A 3ZPXA 4CIBA 5AKZA 5HK8A 2ONCA 4FMPA 5AHXA 3UUFA 3HJUA 3G0BA 1FSSA 1EHYA 3IULA 5ALXA 3RLIA 2QOEA 3OM8A 1LBTA 4TGLA 1ACJA 4ZREA 4H18A 1EDBA 3EQ8A 3HRHA 3DYIA 3WKDA 4Y7DA 2H7CA 3I28A 1YS2X 2DQYA 4QE3A 4BE4A 1XZBA 2BJHA 5HQ3B 1YASA 4L0CA 4U2EA 3FVTA 1CUVA 4LHEA 3O9VA 3R3WA 4FOLA 5CH3A 2G63A 4RNCA 1QIFA 1E89A 2WQZA 2CMFA 1AUOA 3AZOA 4RPCA 1HKHA 1QGED 5HK9A 2I78A 5AKIA 1FFEA 1CUSA 3YASA 1ZOIA 4DNFA 5D3KA 3E1GA 5AKLA 2OQVA 1IZ8A 4FBMA 1E66A 4UHBA 3KWFA 3DKRA 4BTVA 5SYMA 2RIPA 1XQXA 2WIJA 3CCBA 4X97A 1U2EA 1R1DA 4K5QA 5ALHA 2JEYA 4QA9A 4A23A 5FV4A 3H2HA 1GQSA 1EXWA 4MQLA 3G9UA 7YASA 4CI9A 1CUFA 5SYNA 5ALJA 4FLEA 2Y2UA 1N5MA 1G5FA 1Q83A 1LLFA 1ETHA 3FYTA 1JU4A 4MXDA 1H2WA 3I6MA 4K6GA 4OSEA 5HFAA 5KREA 3KSRA 2EDCA 2WG2A 1SCKA 5CT6A 3I2IA 2JGKA 2PVSA 1OCEA 2V98A 5CRIA 3EBLA 4KE9A 5C7YA 4MWTA 4EY6A 3GELA 3H1AA 2JGIA 5CXUA 2QJRA 1K4YA 3KXPA 1CUDA 4XIIA 5AM1A 3AINA 4DMFA 2WILA 3OTQA 5CH5A 5CXXA 2QMQA 3R40A 4UBMA 3F96A 1DWQA 1YR2A 3R3YA 2PM8A 2D0DA 1FFAA 1CUEA 3TRDA 1QLWA 2BGRA 4XJVA 1XZLA 4KRYA 2OPHA 1ZD3A 5HF9A 4UHEA 4RE5A 1BE0A 2V97A 4H7KA 4Q1VA 2QVBA 4V2IA 1GZ7A 5DWDA 5I8PA 5ESRA 1ODCA 5AKXA 4QDXA 3DS8A 2I3DA 1C7IA 5A7GA 4NVRA 1Q0RA 4IO0A 5JAUA 1RYYA 3WJ2A 2HHAA 5JANA 2Y6VA 3I2HA 5CW2A 4WFKA 1TIBA 3TJMA 2GYUA 1AGYA 1ZGCA 3DNMA 1R9NA 2WFZA 3QVMA 3IBTA 5EHZA 4L72A 3O4JA 3GROA 4BATA 1GPKA 3R41A 3OURA 1XRPA 4GI1A 4CCYA 1QZ3A 2GBGA 3C6ZA 5JARA 4J0HA 1QIDA 2HFJA 3BWXA 3NUZA 4LKOA 4ITVA 5KWIA 5ALMA 2JGMA 3NGMA 3F9CA 2HADA 2ZYRA 2BKLA 3U0VA 1H2YA 1HPLA 3IIIA 5AOAA 4B81A 3WKBA 5K3EA 3ZV7A 4GW3A 1GPNA 3V1KA 5BWBA 5ALQA 5AK3A 4BTLA 2GZSA 1WB5A 5AKYA 4DTCA 5AO9A 3IUNA 3HABA 3C5VA 1B41A 4B9AA 1FFDA 1AKNA 1E3QA 1N8SA 3GA7A 2XUHA 2ZJ7A 1I6WA 4CFSA 2XUKA 4BP8A 3C8DA 2JEZA 4U2CA 4N8EA 4PW0A 2RHTA 4IH1A 1TQHA 1ZD2P 2BUCA 3BJMA 1LPNA 2WHPB 5ALIA 1P0PA 2CEKA 4UPDA 4PF1A 3VJLA 2XUIA 4HXEB 1D07A 3CCCA 4FLMA 2O2HA 1LPAB 1YAJA 4ZI5A 5C8ZA 1QE3A 1L7QA 2X76A 2PSFA 5CURA 2VJAA 1X2BA 4E15A 1PJAA 1Y37A 5F4ZA 1XZHA 4BVKA 4C4XA 1XLVA 5AOBA 5E2IA 1EK2A 5T4FA 3WLAA 5ALGA 4Q3KA 3U1TA 4CCWA 4DMKA 2GBFA 4H0CA 2WUFA 4AN1A 1WOMA 1MTZA 3WIBA 2WUDA 2C5FA 3VJMA 4P9NA 5CBKA 1F6WA 3DL7A 4X92A 2RHWA 1XKTA 1XZAA 2WKWA 3BF7A 1H23A 6YASA 3ZI7A 1HDEA 5LLSA 1TCAA 1A8UA 5FDFA 2XLCA 1BRTA 3NWOA 4H7IA 3F67A 3VKFA 3QYJA 4UHHA 4DSZA 3PI6A 4U2BA 3HI4A 3ILSA 1W52X 4FDMA 5LZ8A 4AZ0A 1EH5A 5EIHA 1MNQA 5ALNA 1HQDA 2DSNA 2JGFA 4C4YA 4EA6A 3IUMA 2QUAA 4CIAA 2ROQA 5LZ2A 1S8OA 3IA2A 5AICA 1O6FA 3DL4A 4IHAA 2AJCA 4Z49A 2P8SA 2BCEA 4X94A 4CG3A 1LZKA 3A70A 5ALZA 2CB9A 3D7RA 2OXEA 1TKRA 4OB6A 1L7AA 4W1PA 2GYWA 4GWLA 3WYDA 2Z3WA 5JADA 4DIUA 2XUFA 4UBIA 4IH4A 5AJHA 2ZJ6A 4H7DA 2HU7A 4BBZA 1C4XA 1QIGA 2YYSA 3WWOA 1UZAA 3A2MA 3G0IA 1CUAA 3O4HA 5EHNA 5K3AA 1MT3A 1WPRA 5FPPA 5K3BA 4EUSA 1XZIA 4AMYA 1EVQA 3C8HA 4WFIA 1QFMA 3QM1A 4BRZA 3W9UA 2Z5GA 1MX1A 2XQIA 1UK7A 1JFRA 4X93A 5E4TA 5FUMA 1JMYA 1MX5A 4EY8A 2O7RA 1CUHA 5HKAA 5JIBA 2AJBA 2YXPX 4UHDA 5JALA 2C0QA 1ORVA 2VF2A 2Z8ZA 4QEKA 4I4CA 1IUOA 3NOXA 2XMSA 1FFBA 4PQEA 3FBWA 1ZICA 4FLFA 5HF8A 5I9IA 3I1YA 5JASA 3BIXA 4AMZA 2G5PA 3E4DA 3G02A 2QZPA 5JYCA 3IUJA 2QKYA 3FYUB 3BL8A 4QDUA 4I19A 4OUKX 4LYEA 3LP5A 3CXUA 5DNVA 4BVJA 2OCKA 1ODTC 4EHBA 3AZQA 5EIEA 3BXPA 2O2GA 3GZJA 2CJPA 3D59A 5J3JA 1ZD4A 3G7NA 1C7JA 1MU0A 2QXTA 2D5LA 5D3ZA 1ORWA 4BC1A 5E4YA 4QDOA 4Q3LA 3BF8A 2CBGA 2CKMA 1UWCA 3ZWQA 3G0DA 1HBJA 3V1NA 3R3ZA 5CT9A 4BB0A 5ALWA 4B7ZA 4BCDA 4X6UA 1F8UA 1G4HA 4KE8A 1MN6A 5HZGA 2WU4A 2WIKA 2XUOA 5LP1A 1VOTA 1CPYA 1UOOA 3KD2A 1JI3A 1LPOA 4ZV9A 4PV7A 3ICWA 2WM2A 5IVKA 1XRRA 1Y7IA 1ACLA 4BP9A 1XZJA 4C89A 3ANSA 1CLEA 2ZYSA 3R3XA 1X2EA 3LCRA 2DCMA 1XRMA 3L1IA 2PX6A 1WPXA 1YSCA 2OGZA 2XUQA 4QDTA 5DNWA 3B12A 1WHSA 2HRQA 4B6GA 2C4HA 3D3NA 3SX4A 1E8NA 5A7FA 3FLBA 4Q05A 1DU4A 1GQRA 5BOVA 4Y2TA 2VJCA 5AKHA 1CIJA 1K5PA 3P2MA 2VT6A 2Y6UA 2B61A 3ICVA 1QFSA 1IZ7A 3GFFA 4YPVA 1BS9A 1XRQA 2HA7A 1L7RA 2O2IA 5AK6A 3FYUC 3WK4A 3BJRA 3RKSA 1GT6A 2OGTA 2PSJA 5T4EA 3OG9A 5CT8A 5LYYA 2XMCA 1M33A 3EIOA 1E8DA 1Q84A 4MYDA 1MAAA 3D2CA 4WY5A 4PNZA 4W1SA 3WK9A 4AO6A 2XI4A 3DCNA 4F0JA 1XZMA 3QPAA 1UK9A 4H7EA 3IDAA 1J07A 3SK0A 4Q3OA 3G0CA 4JH0A 4QWMA 5K3CA 2B4KA 4UFNA 1CQWA 3HEAA 3D2AA 3G8YA 4X91A 2ZVDA 4E46A 1XQYA 4ROTA 2HA2A 5K3FA 3ESBA 5K5EA 1CUIA 2EEPA 3PDCA 2JF0A 3W2TA 1F0NA 4B0OA 2VQ6A 2DR0A 4UUQA 2HDWA 5ALRA 5CT4A 3WI7A 2ACEA 2VAXA 4FHZA 3WL5A 1CUYA 1XRNA 3BE8A 1BN7A 4X6XA 5C8XA 1Y7HA 2XT0A 5LZ7A 4Y2YA 3WYNA 3R3UA 1XLUA 1ZJ5A 2WJ3A 1UK8A 4DYHA 2QXUA 5DJ5A 2OAEA 4GEGA 4EBBA 2Y1KA 1ZJ4A 4AX4A 5DTIA 1GPLA 1R3DA 1JKMA 4HRXA 4X3CA 5FLKA 4B0PA 5CTAA 5T4BA 1H22A 2O7VA 1MX9A 3F8SA 5IH7A 4BDTA 3HLKA 4G1FA 4Q82A 2PPLA 3WKAA 3CN9A 1QO7A 3G0GA 1DINA 1LZLA 3QBJA 1XRLA 3T52A 2BFNA 2QR5A 2QM0A 1RP1A 4Y2UA 5A6VA 4UBOA 2FJPA 5IKXA 4WY8A 4C87A 1G42A 2WIDA 5AK5A 3ESCA 4X71A 4A16A 4FBLA 2LIPA 4PSDA 2BUAA 4BCBA 2X5XA 4H7HA 2C7BA 3Q8WA 3QPCA 3VVMA 1CVLA 1ISPA 1WCYA 5CMLA 4UFOA 3I2JA 3X3HA 4J0GA 3FLAA 1CUUA 1WM1A 4BDSA 1QJ4A 1ZI9A 4BVLA 2PL5A 1LPSA 3QITA 3STWA 4KR0A 3I1IA 2VA9A 2AJLI 5JZSA 3R0VA 3ED1A 3V48A 2QT9A 2DFPA 2WJ6A 4KAFA 3ZLUA 4YK7A 2XQGA 2XMRA 4FNMA 2H7YA 2PKYX 3MUOA 4OYLA 3IVMA 3KOOA 3WK6A 4C01A 3B3QA 4KYVA 3WL7A 3STXA 1THTA 1LPMA 1KEZA 4MJ3A 1VZ2A 4Y2PA 3BIWA 3VISA 3DOIA 1JMKC 1OXMA 3S8YA 1QIEA 4RGYA 3DJYA 4KRXA 3C45A 1K8QA 5AIAA 4NZZA 4Y2VA 1CUZA 1EINA 2GBCA 3C87A 5ALLA 1FFCA 2WG0A 4GHWA 2IX9A 3RM3A 3IURA 5AKEA 1EB8A 1MPXA 2XMQA 3HSSA 1SC9A 5ALVA 4S0XA 2DQZA 1CQZA 4BRSA 4A5SA 4PSUA 3C70A 3FCYA 1BEEA 1VKHA 4JEIA 5FRDA 4BAGA 2R11A 5IVDA 2HA6A 1Q0ZA 1CUXA 2Q0XA 5AI6A 5DTJA 1USWA 4OU4A 2YASA 1CUWA 4LXIA 2WFMA 3V1MA 3QMMA 3C6YA 3DKKA 3VVLA 3KWJA 5LKRA 2G5TA 2HM7A 3G9ZA 1XQWA 1QTIA 5EFZA 4B84A 2IIVA 4J3JA 2FJ0A 4OB7A 5ALDA 4X6YA 2C58A 1CUBA 5LZ4A 4AB1A 4UFPA 4GDMA 5AM3A 2JGJA 1O6GA 3FVRA 2C5GA 1WHTA 1P0QA 4ZRDA 1CEXA 2QTBA 2WUEA 1JJBA 3ESDA 1UKAA 3A6ZA 4E14A 4UBKA 4J0CA 2WHQA 1NX9A 1CUJA 1XZEA 5JAHA 1BN6A 1UKCA 4AXBA 1XZCA 1ZI8A 2VSQA 5JD6A 2Y2VA 3FWHA 4EY5A 2PU5A 4KE6A 1IVYA 4FNGA 1A8SA 2VATA 1UXOA 2ECFA 1DX4A 3DDUA 1DQZA 4G9GA 5AM5A 4MEBA 4OCZA 2ACKA 1VZ3A 3SWWA 3T4UA 3C5WP 3DD5A 3H17A 4MQMA 1GXSA 2JGEA 3A2NA 4Y2QA 2WIGA 4DGQA 1LPBB 5KBYA 1QONA 4DNPA 2CUTA 1NU8A 3G9XA 3L1JA 4BE9A 1EDEA 1CRLA 1QIMA 1PFQA 4OPMA 3JYHA 1R50A 1DT3A 3PE6A 3V9AA 4EY7A 1XZFA 5HKBA 1TCCA 1LGYA 1W75A 4KEAA 3UUEA 1QOZA 4HS9A 4QLAA 3PFCA 1FJ2A 3HYSA 2XQJA 3IB3A 5EHXA 1AQLA 5ALUA 1XROA 1TK3A 2R8BA 4K6KA 3B5EA 1E5TA 1SOMA 4IH9A 4UBLA 2AJDA 3STVA 3H04A 4HVTA 5HF6A 3AUKA 3GUUA 4MEAA 4W1RA 5AI9A 2XUPA 3LS2A 2DHDA 1QIHA 1K6EA 1CFJA 3L1HA 1F0PA 2XUDA 2OLEA 2RONA 3O0DA 3DYVA 3F98A 3BDIA 4HAIA 4MYSA 5AOCA 5JAPA 3AIMA 2PUHA 2WTMA 4M0MA 4N8DA 4INZA 2GYVA 2B20A 4WDQA 4H7JA 3WMRA 2DHCA 5FKJA 1LPPA 1U8EA 4ARBA 2OQIA 1JT2A 4O08A 5AH0A 2WU3A 2IITA 4E11A 3VJKA 4FTWA 1XLWA 2W6CX 1AURA 3RK4A 2ZYIA 3WQHA 5FOQA 3FAKA 4TVKA 4ZWNA 4G4GA 4QLOA 3TGLA 2J4CA 1JJIA 2WJ4A 1A8QA 5ALEA 2JIDA 3QMVA 1QIIA 3WL8A 3PICA 1UOQA 2XUAA 5EIAA 4Y9SA 5AM0A 2HA0A 3QZUA 2VEOA 5AI4A 4ZXFA 2RAUA 3JW8A 5ALFA 2ZYHA 4BYMA 3V1LA 4X85A 5DLPA 2HRRA 5AKKA 2J4FA 1DQYA 3EQ7A 1SCIA 1VXOA 5C8VA 3LIPA 3PUHA 3QH4A 2WHPA 1N5RA 5AI8A 3STYA 3CN7A 1MNAA 5LZ5A 2WLSA 5HCUA 2XMGA 4LXHA 4N8SA 3H19A 4AZ3A 3SC2A 4B85A 5FP0A 4DNOA 3W04A 1EDDA 3MGAA 3K6KA 3OPMA 3M83A 3QMWA 4GLBA 3WWPA 4W9RA 3DOHA 5EHQA 4F60A 3HC7A 2V9ZA 4IQ4A 1BCSA 4KAAA 4UHFA 5JD4A 3HACA 3WZMA 1W6RA 4U2GA 5ALSA 4G8BA 1AZWA 2XE4A 5YASA 4N5HX 3ZLVA 2OCGA 2PSDA 5A2GA 2HA4A 4Y2SA 5IVIA 2OAGA 2FX5A 3UMJA 3W9BA 5JZBA 3A2LA 2B9VA 1J2EA 1UT6A 2I3ZA 2HA3A 4M0FA 5CH8A 2JBWA 1NU6A 2FUKA 4CCYB 3W06A 1DX6A 3WA7A 3I6YA 2UZ0A 4CG2A 3PF8A 2XUGA 4YASA 1UOPA 5BV7A 4BAZA 2WUGA 3PF9A 2XUJA 4J0IA 2ORYA 3E0XA 2I03A 4W1QA 4FFWA 3H0CA 3QPDA 1AC5A 3WZLA 4K2AA 4J7AA 1K63A 5D7BA 5AKJA 4DSAA 3BDVA 5AM4A 5JD5A 3I6ZA 1HL7A 2J3QA 5AI0A 2XMZA 3FLEA 3KDAA 4KE7A 5A62A 2XLBA 1EK1A 2VJDA 2K2QB 4YX9A 2WIFA 4PSCA 3FOBA 4LIPD 5KWJA 4ETWA 1Z68A 2NW6A 4KJXA 2XB6A 2J3DA 1LBSA 1JJFA 2JGLA 3IUQA 3WA6A 1P0IA 3M81A 1IUPA 1CUGA 4F21A 4DM7A 2H9YA 2ZSIA 2HIHA 3K2IA 3FYUA 4H35A 3WKEA 5E4JA 2WG1A 3O9MA 2AXEA 1JU3A 3I2KA 1AMNA 1QO9A 4B80A 1GGVA 3C6XA 4XX1A 3E3AA 4AN0A 1IMJA 4B82A 3PFBA 5ALKA 3FSGD 3K9BA 4JYMA 3HZOA 3H2IA 4NMWA 3AFIA 5AIBA 4U2FA 3M82A 1YB7A 2BAGA 1QIJA 5I7UA 1J1IA 5EGNA 1P0MA 5JAOA 1R9MA 1KU0A 1N1MA 4P93A 2DHEA 4EY4A 3Q0TA 1DT5A 5ALYA 4HXGA 2WSLA 4QNNA 4I3FA 5H3HA 3ZLTA 4J0KA 1VLQA 1VXRA 1WB4A 1GKKA 4MWSA 4B83A 2WFLA 4RE6A 5HF5A 3DLTA 1VA5A 4DLNA 1YAHA 4JUIA 4X90A 3AIOA 1ZIXA 4BC0A 1EI9A 4KACA 4AO7A 5DYYA 1ZGBA 3ESAA 3H2KA 1E8MA 3WWDA 2XMDA 5AK4A 5ALPA 1WB6A 4L9AA 5DNUA 4P92A 5K3DA 4U2DA 2H1IA 4CG1A 1YCDA 2QJWA 3AZPA 3D4LA 5IVHA 2Z8XA 1B6GA 3W05A 4X00A 1VE6A 3WWEA 2VTVA 1LNSA 2HA5A 4K6HA 4HTAA 4UBJA 1A7UA 5A7HA 4W63A 4X95A 1T2NA 4G8CA 3WK8A 1EVEA 3R3VA 1EA5A 1XZKA 4AQDA 1U4NA 5LIPA 4BCCA 1H2ZA 3LIIA 3N0TA 4DMHA 4GBGA 3WIOA 4J03A 3H1BA 2YH2A 3WJ1A 2QS9A 1BEZA 1HLGA 3H2GA 2ZJFA 4OYYA 5CT5A 4XVCA 4ZV7A 2Z3ZA 1BROA 1UK6A 5C81A 3ANTA 2QRUA 4QDZA 4BAUA 3HXKA 1CV2A 4NS4A 4ARAA 1THGA 2AJ8A 3VDXA
chains in the Genus database with same CATH superfamily
2JH3A 1YZKA 1QXSA 1PR9A 4AO8A 4BV2A 4YQEA 4RF5A 1SIUA 1L3CA 4PNPA 1SIBE 5EJIA 1L5HB 3KLNA 4CKWB 3SQWA 2BYTA 5L3QB 2OORA 3CUUA 4MYHA 4NV0A 1YQEA 1V5GA 4YCAA 2FG7C 5BNTA 4BXOB 1LA2A 1P5HA 4DQXA 4AXXA 1NQAO 3C5CA 4EECA 2PQ6A 4R2HA 1BD4A 5IKMA 2XXAB 2EF1A 2ZI9A 1DKRA 3CUTA 5DYIA 4BNDB 3D5EA 1X1BA 2XPCA 2YDYA 3HQ4O 3KOUA 1HLPA 3DONA 4HZUA 4AICA 5HFNA 3SSNA 5A04A 3INRA 3P27A 2GMWA 2DUUA 3AUUA 4WN9B 1VL0A 1YTUA 1QANA 3C3JA 2IZ1A 1Q15A 1P5ZB 2FW0A 4N4AA 3GPCA 4WFQA 1SVIA 1UM9A 3ABIA 1CNMA 1F7UA 5CIQA 8ATCA 1XYGA 3H3FA 3FIJA 2WVAA 3INNA 3WMGA 1SCUA 1T5TA 1H5QA 2GBPA 2IPNA 2RGUA 3CMCO 3D2BA 5I47A 1DL5A 4HDMA 2BN4A 2G4LA 1X7GA 2JKYA 4GMGA 3QLVC 3FJOA 5DISB 4DMCA 1TYEB 1HNZB 2FMTA 2V7XA 5I4BA 4C7BA 3GLRA 2VQSA 1P74A 1P2FA 2PUJA 3RG2A 3R6LA 1ETUA 1ZQ1A 1V8ZA 5KJCA 5A9TA 2OQRA 2CDRA 1ZMRA 4IUDS 5BWCA 2IXGA 5AP9A 1FSZA 3MELA 1CR0A 3W6ZA 2HL6A 1PG0A 4FI3C 2PJUA 3VC3A 2YJ6A 3FFWA 4QRIA 4TRNA 4RJTA 1PSZA 3K09C 4LZOA 4MWOA 5G1PA 1NI4B 3ZKAA 1NV9A 5EJ6A 121PA 1SELA 2X2PA 4NH0A 3X1DA 1U0JA 1VSVA 1OB5A 2I29A 4J1TC 2RB5A 3UJBA 4C6HA 1KIFA 1L5GB 4G8DA 5KCZA 3M3HA 3OO1A 4HDOB 2GKOA 4LDJA 3SC2B 3V7WA 4JWTA 2QN1A 1A2BA 2P9CA 4RO0A 3PKJA 2IPMA 4W4TA 4XPZA 1E96A 1S02A 2AFRA 1SZDA 4RESA 3I5UA 3LUGA 5JS7A 2WTNA 2I2BA 2J5XA 1QHHB 2VPYA 4NNOA 5LP6B 2VQFB 2A30A 2WKRA 5AVYA 2Y0EA 1CDEA 4Q34A 3AL2A 1SXJD 2B8NA 1CRPA 4YBZA 1Y82A 3PX3A 4WXYB 4CBVA 2O8BB 3EDOA 3MGBA 2WJAA 3IBFA 4H7FA 3PDHA 4MUMA 3HDTA 4PCVA 4XUGB 1SFRA 3DDSA 3RIYA 1H2XA 2HEIA 2VT7A 4MUGA 3FNBA 2YINC 2F1JA 3FTCA 1MV8A 2GXUA 5CB6A 1KJIA 1ZIYA 2H0AA 4RK1A 9LDTA 2J46A 3CU5A 1C5KA 1LSOA 3OVMA 4Y8VA 3HPQA 1C7FA 1YB6A 1EXNA 2LXNA 1AGXA 3I52A 5BYBA 3OKPA 4N41A 1GRCA 3AJAA 1UDBA 3AETA 1BCRA 1JYSA 2X4LA 4TN1A 1SCQA 5JLAA 3QKUA 3SZRA 3UN1A 2JL1A 4F5ZA 3IODA 3GLFB 4JITA 5FORA 2XMBA 2JJ1A 3TLBA 4FFVA 1FQJA 1N1DA 1G66A 1AKMA 1ZD5A 3FSGA 4KVFA 1CUCA 2B0JA 3FG9A 4OHKA 1Q3TA 1NONA 1TVKB 3BGVA 1DRUA 1Q0LA 2D5AA 3PNMA 1G16A 5TPZD 4G4JA 4P08A 3EX7C 4PIVA 4K6OA 4OD0A 4LOHA 1PLKA 5I5EA 4AYWA 2PPVA 1LX7A 1KR2A 2RGXA 5CVUA 1VHJA 1YHNA 3F0TA 1MORA 1VPVA 1W7AA 3JCZA 2G09A 4RV4A 1YZGA 3EVDA 4A1FA 4IDEA 2Z95A 4ROSA 1RFGE 1BJTA 3NDPA 1G5PA 4IWNA 4CUKA 1FMFA 3JRNA 3H6HA 1DTEA 3HBMA 4YJGA 3WK7A 5DYWA 4R31A 2UZIR 2L17A 4FCCA 3PA6A 3BM5A 2OGSA 4X1KB 2IOQA 4CR6A 2SBTA 4DYDA 1KKUA 2GLXA 3BMQA 2AWNA 3CEHA 1P7ZA 3JPWA 3OLVA 4ZYUA 1B1AA 1QHYA 5IEBA 3KKPA 3H9GA 1LSJA 5GIPE 4NTZA 4FSXA 4ER7A 1NFFA 3IDOA 5FQNA 4E13A 1ZUHA 3GMTA 2P2GA 1LBQA 3HRIA 4YWJA 2RI6A 5LQKA 1ID8A 3ZTYA 5EJAA 3V8PA 3LECA 1KYYA 3REOA 1RAIA 3ORFA 1DJPA 1ZJYA 1M8JA 1KJQA 2VOEA 4WDRA 3GUZA 1GRQA 1E3DA 2Z56A 2HCRA 1EZ4A 3LM8A 4M49A 1PUXA 1YS1X 1WW2A 4MKZA 4EPWA 3EIHA 3O38A 3LW7A 3Q6IA 4F4IA 1T5OA 3QE4A 4TTPA 4UM9D 1Y7LA 3ROKA 4JYPA 3RRXA 1POXA 5FB3A 2IXAA 3O95A 3ZUGA 4B4OA 1GU1A 5K51A 1DZIA 3KYDB 2R62A 3N8GA 4JS0A 1AV7A 2ZSKA 4P4TA 3ZTTA 2WFLB 1X7YA 2QE7A 2JW5A 3TQRA 5HDQA 1BXGA 4WJLA 4MDEA 1QSGA 5BW5A 1FS5A 2X3UA 2AI3A 1XZGA 3D6MA 4BLUA 2QGZA 4F9TA 1LWNA 2XZPA 3ZWMA 3R3SA 2G07A 4WA7A 1S2LA 3TQSA 1G60A 2GAAA 1N6RA 2F64A 2OZEA 3D0QA 3NETA 5DYGA 2ZJBA 1PS0A 1WVGA 5D6OA 2WP0A 1G3UA 4B3FX 2ANCA 4OK5A 1E64A 3F97A 2FEAA 3FUVA 2GOYA 4O25A 3W79A 3MWGA 3CS3A 3MJRA 4IZIA 1N2BA 3JWEA 5I7AA 4JLJA 1VIMA 4DCMA 3FDFA 1GPAA 4RADA 4J8PA 5KVQA 1YA4A 3JWPA 5GWXA 4JP5A 1T4MA 1XGKA 3ECSA 4MW7A 3KAKA 4CL2A 2FQ1A 1X38A 3SQNA 2OC9A 2NZJA 4DSUA 3PDJA 4DUGA 2VT2A 1G0OA 2XT9A 5LD2B 1NVGA 4GXNA 3S29A 5IABA 1NW7A 1VA4A 5KOHA 3S81A 1NLUA 1UC5B 4U9UA 1MA3A 5HZKA 4FFSA 4IQ8A 2BMFA 3J7TA 1J2JA 4N5IX 3ZWYA 4QFBA 3KJEA 1WE2A 3MNFA 2ZWOA 3MC1A 2X86A 1GTZA 2ZRQA 2BRUC 2DSTA 1J00A 2EU8A 3EDMA 4L16A 5BQPA 5K3FB 5BVHA 3M4ZA 3T4PA 1VJDA 2D4AA 3KALA 4LXYA 4I9HA 3MAGA 1VP9A 2JVKA 3H2JA 2ZSHA 3GCWA 3RJMA 4IIJF 5FBRB 1JLSA 4ZVQA 4C04A 4C9BA 1V6CA 2JLUA 1PBNA 4JB2A 4AMVA 3C4VA 4C0XA 5CB8A 1HT2E 5C80A 4BQFA 3FOCA 1Z2AA 1DV1A 3PCXA 2J33A 3O4GA 1PFYA 5EQJB 5F2KA 3V2HA 5M2QA 4KO8A 1SKMA 3GBSA 3WNBA 3N2KA 4MB0A 2PGXA 4JZYA 4ZEMA 4UHKA 4E3ZA 4RY9A 2XRZA 1UBJS 4FX2A 3KPYA 3OJCA 4C5CA 4IVNA 2AS0A 4KBGA 4JUAA 3KYJB 4LE0A 4WACA 4E6PA 3OBBA 4LYFA 1VRWA 1R9GA 3GDGA 3RS4A 3UK7A 2OG1A 4MARA 5FXMA 3C6QA 3TUZC 2RE8A 4R8LA 1T43A 1E1NA 2CB0A 4CIBA 1DIGA 2BJVA 4A0QA 1NQ5A 4YJDA 5HK8A 4RTSA 1ZNZA 5KHOC 3N3AC 1MENA 4UCXA 5AHXA 3U7QA 3IDZA 3HJUA 1NC3A 1P6UA 1M72A 3EPLA 3UVEA 2MYNA 3CZRA 3FMVA 5F78A 1V3VA 3L2OB 1SOWA 2XE6A 4TL7A 4OQEA 4PO9A 1KI3A 4YTEA 3RC1A 2O8DA 2JHFA 4RVFA 4NDZA 1TMYA 3P9PA 4RMIA 2D5BA 5K9ZA 1FVHA 2J9YB 3NKVA 1B7GO 1T1IA 2WNIA 1ACJA 4BVEA 4B17A 1QKIA 5B1HA 1V7CA 4KO1S 3CXRA 4BFLA 3EQ8A 3WGJA 3AP2A 2OBMA 5T64A 2R84A 4L3VA 4DWOA 1Z8HA 5F51A 3ICEA 2OWDA 1Z4NA 1PD0A 3SN6A 2FZKA 2W8BA 1KQPA 4CQMA 3WOVA 4BJ1A 3DV9A 4HQLA 4QE3A 4UMFA 4PZ9A 3VNUA 4PLGA 3CPHA 2FZ5A 3SVTA 1WP4A 4QLBA 4ZI7F 1TT7A 4ZOLB 4QO8A 3AOEC 2AMJA 4ILEA 1XDUA 1YASA 2OV4A 2OZKA 4YJGB 5JG7A 3V97A 4HVCA 1PL6A 5D87A 1V6SA 4NCHA 2CMDA 3WFIA 1NQVA 4EH1A 1GPWB 1UDWA 1UWLA 1VMEA 2F62A 1EGAA 2EXXA 3A26A 3BXXA 1YQXA 2LWIA 4DBLC 2OD7A 3X43A 4FIDA 3O9VA 2X0RA 4J7CA 2ZOSA 1O5TA 2ST1A 4FOLA 2V0GA 5CH3A 3I42A 4FYPA 2G63A 4HNGA 1YRLA 2NU7B 4QPPA 2VDKB 1ZK1A 4MCAA 4X9XA 2ICAA 3JYPA 2E85A 4YP9A 3CKMA 1SD1A 4DR3B 4OQMA 2WSSA 1Z0JA 2Z8YM 3L93A 2RH4A 1YMVA 4R7GA 3EF0A 4FR5A 4M0CA 5KYYA 4LOJA 5AVTA 2CXNA 5JNVA 1CYDA 4P86A 3BE5A 2NUPB 2EJWA 3RVQA 3V4RA 4REOA 1Z07A 5HK9A 2H63A 5G2OA 4X1OA 2RHCA 2I78A 4LE1A 5FWDA 2R8YA 1NKTA 5HEKA 2A0FA 3D1LA 5AXCA 2F59A 1EEXB 2G6TA 1LFDB 3BSFA 3DAFA 3QVKA 4R3NA 4P53A 3AEUB 3ESRA 2WSSD 1QGAA 3EULA 1CC1S 4KDFA 4QQ8A 4WNIA 4OXXA 1NW9B 1PE0A 3BRSA 5A3JA 4DNFA 2JAWA 2P6UA 3E1GA 4K8RB 5AKLA 2Y76A 5H16A 1R0CA 4KQ9A 1G6Q1 3FCCA 2QJFA 3KSBC 1CS4C 3QQ5A 1HG1A 1E66A 2AEEA 5CD9A 3G2PA 3KWFA 1OT5A 1VG9B 4PYOA 2CHQA 1Q12A 2VSFA 3ELWA 3FCEA 1WF3A 3IQXA 2Q7OE 4Q9JA 2C59A 1ZVMA 1NLZA 1R1DA 5EGSA 1VBMA 3PNBA 5KOIA 4J29A 3VSCA 4XD7D 1NVDA 3O8OA 4MK4A 5CD1A 4LPKA 4JV5B 5CCDA 3WLRA 4Q1EA 1GQSA 3B36A 5JDCC 4MQLA 4WASA 3G9UA 4RKRA 3BWDD 3RF6A 3T3GA 4CQLA 5C2JB 1EIZA 2D2EA 4YR7A 3E7FA 1G2PA 3S1SA 3Q8KA 2Y2UA 5T3YA 3PJGA 2AEFA 1EIWA 3G6WA 1JXMA 2GAJA 4Q7KA 2Q27A 3KFLA 2QQFA 3ZQUA 3V3KA 3BFJA 4WCDA 2PUCA 4LF7B 1Z7EA 3DNFA 3RGWS 1ETHA 1LXCA 3HXTA 2RB4A 3O8QB 4M6WA 5BN4A 1JHVA 4MS4B 3U3KA 4ONEA 4I6EA 3ZQJA 4N7BA 1QCYA 4K6GA 1ZXLA 4ND8A 5GPBA 3T9CA 4CR8A 4OSEA 4QODA 4DBZA 2C57A 2E1PA 2A1IA 4BBPA 1CIVA 3CLVA 1J9GA 2C4UA 3ZIUA 1YZHA 4M7RA 4Y9DA 3RYFB 3BGSA 1GGHA 2EDCA 4RM3A 3OICA 2DFNA 3G1TA 1HE1C 3IIKA 2QXYA 1XN4A 5EMKA 3P1JA 4CEHA 4KSBA 3SI7A 4CN9A 1GQ2A 4DPKA 3OPYI 2PVSA 1KAQA 1OCEA 1RYDA 2AYZA 1SXJC 3W2GA 3LTNC 3CVXA 3WBFA 4J90A 2C2GA 1LTKA 3E8SA 1PT6A 3A0UA 4KQ6A 4GLJA 4OV6B 3N9IA 5CVCA 1B6RA 2OSVA 3CWCA 4QECA 3MW8A 4D0NA 1VPWA 4UVGA 4M7WA 5LJLA 4JI1B 3WDSA 4MWTA 5E6RA 1W30A 2JIMA 3HWSA 4TZTA 5CFZA 2JGIA 2WT9A 5CXUA 3C8UA 4CODB 1JKJB 2FR8A 4M1OA 1R4NB 4WNAB 5C1PA 2J3HA 4ZOEA 2PUVA 3UIEA 2COKA 3NEYA 5AM1A 4NJEA 3AINA 2WILA 2CXHA 4MHOA 4ZICA 5DM0A 2J0QA 1WU8A 5FBQB 4AUKA 3W0LB 4XQCA 1RMTA 2ODTX 2QMQA 1SKUA 1YQ9A 3V5NA 1D4OA 5C8DA 3EDRA 2KPOA 3F96A 4C43A 1EVLA 3FUUA 1IB6A 1FFAA 2F43B 3E84A 4G5QA 1KE1A 3QUTA 3HK2A 4GVXA 1TM3E 3WIEA 5IUKC 3KX2A 2AOVA 2XRFA 3GCZA 4I1VA 4RD3A 5E38A 3TH5A 1PQYA 3GLGB 5FNVA 4DZRA 1PQWA 1UZMA 3QI2A 4YDRA 5HKOA 5JZMA 5A0FA 3OPNA 2HN9A 3V32A 1DTSA 4UHEA 3QE0A 5CX4A 1X13A 1BE0A 4NK5A 2OILA 4PLVA 4EB3A 2DPYA 2Z4SA 4LWOA 2DT5A 5IJAA 5MFZA 1GZ7A 1T5SA 1M73E 2AFIA 3DG9A 3GB9A 5DWDA 3TLXA 4ERXA 5K8TA 1WBDA 4PQGA 4TXHA 1FFYA 5IKOA 1W59A 1FTWA 1Y6RA 4G01B 4FDLA 5AKXA 1N2EA 1DPFA 4QDXA 3HYNA 1PSDA 1C7IA 1CF9A 4NVRA 2I9KA 1N2ZA 1GZ3A 4FINA 4P98A 3FPJA 1EWKA 2GCNA 3JAWA 4R2KA 1A9ZA 3AB7A 3MWEA 2OA0A 4B45A 4IO0A 2JHAA 5JAUA 2QZ9A 1NAIA 2B2XA 1IDN1 2C84A 3RPEA 5JANA 4Q4DA 1U5BA 2ZE7A 5JCOA 3P20A 4X41A 2PKCA 4C3OB 2PBRA 2BMVA 2CDCA 2PXXA 1V9SA 3AJ9A 3GEBA 1UEIA 4UMDA 3WQBA 4F8EA 2ZQ5A 1Z08A 2JLCA 3ONVA 2GYUA 1U0LA 1AUQA 2GN6A 3FSJX 3L8EA 3QF4A 1YGPA 1K8RA 3IBTA 5EHZA 1R9NA 2WFZA 4IAOA 2NYVA 4GKJB 1YBHA 4KFTA 2JS7A 2P3LA 1NYRA 1J6UA 1LJLA 1THZA 2PT9A 3KE8A 3NAZA 3LBFA 3UANA 5ECDA 3EXIA 3B6KA 2FCAA 3COYA 3KR9A 3PSAA 4KB5A 1G4UR 4OP1A 5LYJF 4CKEA 1JN0A 3P9CA 5EE3A 4ZAWA 1V37A 4GKAA 1QS0B 2OZLB 2Q4TA 5BO5A 1EFCA 4QG7A 4TRMA 1IPEA 3W4JA 3JQCA 1RTTA 3L3BA 1QIDA 2GXSA 2FR0A 3IQDB 5EE1A 4ZQEA 5A0TA 1PJBA 4GL2A 2FN3A 3NUZA 4LKOA 5KWIA 5ALMA 4MVJD 2NXCA 3JVEA 5DW3A 4CEJB 4TMWA 1XDGA 5LQRA 3O8QA 3KCQA 3GLQA 5KYGA 4HWRA 4R51A 4TL9A 2ZYRA 1NWCA 2J07A 2ZUWA 1SVKA 3CZMA 3K6RA 1NG1A 4A8TA 2BKLA 4YCJA 5AVVA 1HPLA 3MTJA 4G5FA 4Q21A 4DVGA 3GGCA 5JO0A 1J2UA 2G7MC 2B1QA 4LRWA 3ZV7A 1A9QA 1W4RA 2GEFA 4MINA 4B81A 3N6VA 1GPNA 3OCXA 4U6QA 4XVQA 3EAFA 3UO8B 4YBRA 2QPLA 4KV7A 5BWBA 1YQTA 2KQUA 1XU4A 3EJ6A 1IB0A 2Q3FA 5JBIA 4BTLA 4BEVA 2HMUA 3ANYB 4PRLA 3F5DA 2AJTA 3JYNA 1LDMA 3OQBA 3OOYA 5KMGA 5K0GA 4NEQA 3K73O 2QD4A 1OXVA 3EQ2A 2ZBQA 3MLBA 4JB3A 3U39A 3WLQA 3RUCA 3IUNA 5CB0A 3HABA 1OI2A 1U0TA 3C5VA 3SE7A 1L9XA 3ZHOA 4B9AA 1J0BA 5LL6P 4CFZA 4K40A 1EWVA 4H17A 1AKNA 3WYBA 4DLSA 2QL5A 2GEJA 4CMEA 2BFDA 5KO2A 2V65A 3CZ4A 1ZMTA 3OEYA 2LVBA 3V9PA 5C5EA 2QTHA 1AKTA 1IEQA 2FGJA 1KVTA 2H4JA 3ZE6A 4DG5A 4BECA 1I6WA 2K6GA 4YUWA 3P71T 1DIAA 1SUDA 1VCOA 2ISQA 1GAWA 2VJKA 3LMKA 4IZHA 3HYRA 2OENG 4DA8A 3CLSD 4ZDKA 1RBYA 2HMWA 3QEMA 3W3AA 4N76A 2Q1TA 1BQ4A 2WDPA 4Y6PA 2PO7A 2JEZA 1XCOA 5AVRA 2AQKA 2ZIFA 4U2CA 4N8EA 2ZB4A 1AVTA 4M8LA 2VTKA 3WC4A 3G82C 4OHPA 3NO4A 4ZQCB 2RHTA 3B1JA 2VHEA 3NPAA 3CH5A 4IDNA 3RHZA 3TZQA 3RRBA 1OMOA 4AZWA 1TQHA 4QYMA 3MT9A 3TD6A 2HUPA 2ODAA 1TAQA 2BH9A 2HPVA 4YUXA 1DBQA 1W5AA 1PS9A 3O93A 4M1YA 5ALIA 1DQRA 2CEKA 2R47A 4UPDA 1W48A 1WUKS 2TYSB 4ZVLA 2HF9A 4BMSA 3FX2A 4OMDA 3VPHA 3SKYA 3BBLA 3BD8A 4HGQA 1H0SA 2Q8QA 2JLAA 2BISA 3P4YA 4EELA 5D2CA 5ICGA 3KSAC 3WLKX 1W0CA 6Q21A 3WIVA 2XDQA 1TC1A 4YQZA 5BSUA 4AY2A 2IZ7A 1ADJA 4ZI5A 3H9BA 3B3GA 3MBIA 3RAPR 3P0JA 4XD2A 5C8ZA 3SQXA 1QE3A 4WK6A 3F4KA 3WHPA 4J2OA 1F2DA 2CLFB 4KGZA 2HQ1A 1A71A 2PSFA 3HUTA 3I04M 5CURA 3AI3A 2VJAA 3TX6A 3UGQA 1X2BA 1G64A 1QYWA 4YALA 3GQVA 3O2JA 5BP7A 1YR8A 1AUXA 1PJAA 1SM4A 4Q19A 4RQUA 3FKQA 1Y37A 1HT0A 3VKVA 4CU2A 3SCZA 1EM6A 5F4ZA 3IQGX 3MOGA 4JQOA 2EHJA 2PD4A 4PTZA 4XWKA 1A8PA 1Q7CA 2JFYA 5DLDA 3OTWA 2FMFA 5CA0F 5K0BA 1JLLB 1XLVA 2DETA 2GUWA 3DM5A 3HN7A 4W8OA 2PZGA 1EK2A 3OE7A 1N2CE 4OXNA 1FYEA 3WLAA 3PXDA 2M6KA 4Q3KA 5D8DA 4CCWA 4DMKA 2DCUA 2JI8A 1FBNA 2BMEA 2GBFA 1V16B 1U9CA 2LE0A 2TMGA 1O6ZA 2WUFA 3CNOA 3NBXX 4CNBA 1UMDA 5F9HA 5IX8A 2V7UA 2HPZA 1G2QA 3IALA 4CTKA 5FNVF 4YN3A 2WUDA 1PHPA 4O4HF 1AT1A 4URVR 3RU7A 4XEHA 3F2IA 4PC7A 2AD1A 1INLA 2JNWA 3H1GA 3M6UA 1T2VA 3P5BA 5IXYA 5CBKA 3ANXA 3WL3A 1F6WA 4I50A 3F3MA 4FKMA 5DBEX 1I33A 3NYQA 4Q1FA 4BV3A 1W29A 1PW5A 3A6LA 1LC0A 1MQAA 3EXIB 3K4QA 1RVV1 4X92A 1PW7A 1U3WA 5BQ3A 4U8HA 3AESB 3BF7A 1H23A 4FOSA 2BEUB 3NDRA 3OKFA 3PDIA 2X19A 1V11B 1Q2UA 2F1IA 4REQA 3OETA 3H5NA 5T8KA 1TEZA 2EKQA 1TCAA 1A8UA 2DBVO 3IOBA 2CC2A 3E5RA 2XNSA 3DC7A 4JSYA 4MB2A 2LP4Y 3KJIA 3GCDA 2GXQA 4A5OA 1EFPB 2VDOB 1KS2A 2ERYA 2PWZA 2QZ4A 1VHLA 4LDAA 1J1UA 4JJAA 1NY6A 3HI4A 3ILSA 1TMOA 1W52X 4A2CA 4EO9A 5AESA 1DJNA 3CR8A 2BWJA 3Q5EA 4P3KA 2WKSA 1XX6A 2WYHA 2Q41A 5I9NA 1Y4DE 1MNQA 1YO6A 5TNXA 1HQDA 2JGFA 1FZQA 4MDYA 5DCYA 3ZOKA 4ACBA 2V5VA 5JOQA 8MHTA 4HWOA 1N6NA 1C9JA 2HDHA 2C4TA 1EYZA 2H1OA 4XM1A 4KMRA 1XAIA 2BI4A 3IHKA 5BSRA 5A5VA 1XJQA 1XVTA 3GPDG 1J8VA 4NCIA 4CU5A 1XHFA 5KOJA 3G7UA 3OUZA 3CB4A 6GPBA 3JS5A 3ONNA 3RJZA 1FW6A 1RJDA 1I1NA 2QTVB 2V8OA 3GRUA 4QDJA 4C7KA 4HGPA 2DWCA 4I8DA 3T1YB 3JQ8B 2P8SA 4BNWA 4ZGGA 5EMMA 3IPLA 3U6KA 5GZ6A 4QYSA 1N8KA 2REQA 2ZWVA 3FKSD 3GLTA 4YO8A 3RF7A 2DKOA 4PLPA 4NG4A 3OQJA 4GU5A 1RFLA 3FNRA 2Y1LA 2KBEA 2W6OA 3DXFA 2O1SA 3MWLA 4G5GA 4OMUA 4ZMSA 5ABPA 1SN7A 5JXJA 4N01A 1PNQA 3K5IA 2BEJA 5JHHB 1K3UB 2M98A 1JE0A 3ELYA 3QLUA 4WKPA 3U5ZB 3IP1A 4ZEXA 3U09A 4IVPA 3K0EA 1OH6A 1SHJA 2PH5A 3HCPA 3NM5A 3QX9A 4L8YA 2QSJA 4WN9A 1JKXA 4LGVA 3CSDA 3TTVA 4DBLE 2RGDA 2O3RA 2OB1A 3G2MA 1A9TA 4HATA 4RZUA 5H9VA 3DBRB 3KPJA 4GYJA 4OFZA 3AV3A 4UBIA 4H7DA 1T0HB 1TTQB 1I5OA 1WBJB 1O95A 1QIGA 2D00A 4B09A 1KJZA 3MCTA 5A4KA 3O0TA 4OK6A 2PGOA 2Q3HA 4RPKA 4HV4A 2XCTB 2GVDC 3GJYA 5C34B 3EMKA 1NGSA 4Z0HO 4DLBA 1L5ZA 1RE1A 2IDKA 4EYKA 3KR2A 3ZDAA 1WPRA 3BEOA 3PXBA 4EUSA 3T1HB 4AMYA 2R9VA 3AF2A 4KIGA 1TA0A 1PKXA 1XMPA 4MS4A 3C8HA 4RJJA 3L84A 1QFMA 3R23A 3CW2A 4AJLA 1MDFA 3ITEA 4IVRA 5DMHA 1UT5A 5K0LA 1ZCZA 3JYOA 4HTFA 4Z3OA 3NHRA 4JCCA 3F47A 3MJCA 1XTTA 1PT7A 2VNIA 3BK7A 2EW1A 3LI2A 4W9MC 4JI3B 2YYZA 4MPPA 3MCZA 1KARA 1OZHA 3H84A 1NF9A 2AN4A 1CHNA 5AW1A 1UP6A 2HRZA 4DWVA 3QW2A 5HKAA 4Q6BA 3O5AA 3GLUA 3PHHA 1BD3A 3UM9A 2WAXA 2EZTA 1ODJA 1ORVA 1PUJA 4XB2A 1QK5A 1X19A 3BKXA 3V7UA 1RLMA 3DE2X 3GFPA 1IAQA 4DADA 3HEMA 2W11A 2XMSA 3FPFA 4V1CI 5HJ7A 1PJTA 5DPMA 1O4WA 1DAKA 1C9YA 2QTWB 3HZHA 1GTSA 3A3KA 1ZH6A 3BIXA 4A10A 4WNCA 3H5VA 3BK2A 3OJOA 7GPBA 3VZCA 5HGXA 5J4LA 1QLHA 4QUBA 4JBHA 3L4BA 3C3BA 3ZHBA 1BE1A 1L5NA 1NW6A 1EE2A 2A78A 2B25A 4G0WA 4HJXA 2DBQA 3EMVA 1JDJA 2QKYA 1R00A 2OOSA 2MINB 3H6KA 4KO3S 1S8AA 4PRYA 4RH1A 4B71A 3D7MA 2EWWA 2IY8A 3VU9B 5B2EA 5HIMA 4E3WA 4KQEA 4FWTA 3TIIA 4B74A 2X6QA 3LCMA 4OUKX 2IPLA 1E2IA 2ODBA 1Z75A 3CXUA 3U4AA 1K9VF 4Z0NA 1B74A 2A33A 1SXJE 5DNVA 2QL9A 1XEXA 3LHSA 4X66B 1KK0A 4EZBA 1XHEA 3D7SA 5EWLA 1KETA 2C8KA 5K3SA 1B76A 2CJPA 3IEPA 1EP2B 4Y6SA 5FHQA 1F14A 2OYSA 3G49A 1MABA 4OM7A 4RVOA 2LD4A 1JTEA 3VOBA 3H6GA 5G40A 2YNMC 4V24A 1ZCBA 2D5LA 4D6YA 1ZA2A 3OMLA 1ISHA 2DHQA 2ECPA 1F60A 2WJWA 3B5JA 3IX7A 3OPYB 4KK3A 5D3ZA 2V3VA 3SMVA 4IIJA 4Z7JA 1A5TA 3LHIA 1S5PA 4MGZR 3D54D 5FOXA 1E2QA 4CKCA 1BKDR 4KW7A 4CL8A 2Q2NA 1SGWA 2I6XA 3ZJVA 4RV9A 1SMKA 2H57A 4Q3LA 1IY1A 1WW3A 3L06A 3R0JA 3USES 4A8JC 1U0BB 3PRJA 2CKMA 2J0UA 1EFPA 1UWCA 2HR1A 2H54A 3IP7A 1W88A 3FZGA 3PB3A 2YWFA 4NBVA 5T41A 4BZQA 1VI2A 3QUBA 1SKYE 1RYZA 5LA6B 5EZYF 4OQDA 3R3ZA 5CT9A 3V4ZA 3RK1A 1IBSA 1SHLA 3FWKA 1T9DA 1UM8A 4WH0A 2P62A 5DZSA 1F9AA 2KLHA 5H5JA 4BCDA 2IHKA 3OZ7A 4ESEA 2YBEA 1ZSYA 5FL3A 1R37A 3GJSA 4IMJB 3LYUA 1QRAA 1XDDA 3K31A 1XQ9A 2RGCA 5EP4A 1VE5A 2XCUA 2WKPA 4HC4A 2PZBA 3K05A 1QYVA 5K0FA 3HKEA 1VYTA 2ZJ5A 1SUPA 2WIKA 1VKRA 2IYPA 2XUOA 4K6MA 2VHTA 8ADHA 3D6AA 1NVBA 2GZ3A 4CWAA 2N3ZA 2BFBA 4QBGB 2J0SA 1JXQA 3LA6A 2A58A 4P83A 1DEKA 4CNQA 4KYTA 1U7DA 1ZM3A 1CPYA 3LUFA 1N2IA 5G0TA 4D4MA 3JARA 2H48A 3CNQS 1JI3A 3JQAD 4JJ8A 3SZMA 6PFKA 1LPOA 3CLSC 1Z4IA 4OBBA 4ZV9A 1EK0A 3ICWA 1X7YB 3HB5X 2E87A 4ZI7B 1FIUA 5IVKA 4MQFA 1BOOA 4XEUA 3UT6A 3DAHA 3L7LA 1VG1A 4MUAA 4M1KA 4OL9A 5CYGA 2AF4C 3R9XB 3ZHCA 3IJRA 3LA8A 4FBGA 4KXNA 1SCDA 5CNMA 1CY1A 2JZOA 3OZBA 2HMYB 2J0VA 2TMDA 4UNIA 1R0XA 4YMHA 3VUFA 5CDFE 1U7HA 1K5DA 3LZ6A 3TPCA 1H2HA 3KSMA 4D3XA 2DCMA 4W5QA 2XKJE 1KMNA 1GPYA 3H42B 2AR0A 4I1RA 3O7MA 3B3AA 1JDVA 4LCBA 3Q15C 1JDTA 2KX7A 4XCVA 3D64A 2J9RA 1DARA 4I8XA 1RD4A 2BE7A 1SPXA 3UPTA 1PZHA 4RZXA 3GFBA 4HY3A 3WNVA 3HPRA 1ST2A 2IS1A 1SKQA 2AOUB 2ZTLA 4GWKA 2R7MA 4Z0PA 1E6EA 2VYQA 4CDRA 4MGHA 1LRKA 4NFLA 1OTXA 5CFLA 4J76A 1H6DA 5K6AA 4RAOA 5DNWA 2D5CA 3CLTD 2J4DA 4LTNA 1H2EA 4OM8A 4OQYA 3N59A 4QJ4A 1K7CA 1I32A 4IDOA 2OT3B 5EXTA 2PD6A 3KKLA 1CQJB 3DZIA 4E09A 1C4OA 1HYQA 1GD1O 1RDFA 3IXMA 4CLOA 3Q10A 1M1YA 4UOQA 3DJFA 2GEKA 4L57A 3D3NA 3OKCA 4B3DA 5ULLA 3I73A 1I80A 2CV2A 5JS1A 1E8NA 1G18A 4PWYA 3EXFA 4B6OA 2ZUVA 1XVVA 2CXQA 3G1WA 2FF5A 3QV1A 1I94B 2VJCA 3ETGA 3R6DA 5AKHA 4HAZA 3ENKA 2WSYB 5AJWA 3G89A 4UM7A 2VLIA 4BMOB 1C8LA 2FJUA 4CV1A 3ICVA 4JY7A 3WHLA 1QFSA 1UP7A 2E18A 4MKXA 4R3WA 3SJZA 1U2DC 4JLBA 4MS1B 1JU9A 1LD3A 2A3RA 2QPAA 2HA7A 3NVAA 4O3FA 4OFBA 5ICFA 5KNDA 4LYYA 4K6FA 3BE6A 1JVNA 1KK3A 1Z0UA 5AK6A 4JQCA 5GVRA 1GSIA 4I5FA 4J43A 3L41A 3IOCA 5L4LA 1ZM2A 3BHNA 1N9GA 1D1TA 3SJBA 5JYBA 4KYIB 4YI3A 5KJ6A 2XMCA 1OXSC 2JZNA 3QHAA 4LHZA 4RLQA 1PSWA 1UH5A 2WF7A 4J4TA 3RIGA 4G37A 1YCHA 4WL0A 1Y42X 1DQNA 4RV5A 3BWEA 4IGEA 5F77A 1JLLA 1I3NA 1T9GS 2PWAA 1B3RA 3D2CA 2QW0X 4G6ZA 3TG2A 4B3SB 4PNZA 1ULBA 4MICA 1EX1A 4W1SA 3HA3A 5TMEA 3IFSA 4DRXB 1OYOA 3WK9A 1OAKA 2NXWA 2GHTA 2ZCVA 3R5FA 3TOXA 5B6JA 1I10A 3UCXA 3VHXA 1JYFA 1W4ZA 5SY9A 4KBFA 1LI5A 2FCRA 1XZMA 4ISBA 5DW0A 1ZVKA 3S3TA 1H2BA 3W3AD 1LK5A 3DZJA 3FSRA 3LQKA 4JP8A 4F8YA 4H7EA 1FU7A 5FFMA 3IDAA 5BV8A 4X3OA 1GNSA 1T6ZA 5IZCA 1F4LA 2HIMA 5CITA 4Q3OA 4PGMA 3G0CA 2Z2JA 3TL2A 4JH0A 3ON5A 4XM0A 1GVNB 3HCCA 4XH9B 3VKUA 3AM4A 3F78A 4FE4A 3A4LA 2HV9A 4E1BA 4UFNA 1W5BA 2IIBA 3R5KA 5CDTA 2HW8A 3MOSA 1SXIA 3B7GA 3IIEA 4DA9A 1R10A 1RWXA 1X0XA 4N0QA 3V34A 3AUXA 1ZC4A 5IHPA 1WHSB 4X91A 2Z98A 4CQMB 3UJPA 1XQYA 4ROTA 1S2IA 2J9GA 2NG1A 4F12A 4CIVA 3NT2A 3PQ8A 2QW1A 1R0WA 1U4OA 3ESBA 2LKDA 3HJCA 3MILA 3NR2A 2G5CA 4OKSA 5K5EA 3SYKA 3M5WA 4ETNA 2JF0A 4YACA 3HXMA 3ZNPA 5LMNB 4B0OA 1OH7A 3K16A 4N5DA 2DR0A 3REFA 1VL8A 4I99A 3AGQA 4LGMA 4UUQA 4F1KA 2WBLC 4OQLA 2Z09A 5B6PA 3QIAA 2FUEA 3IQIX 1J21A 3GLFA 3RSLA 1YKFA 3ZCUA 2ACEA 4AF6A 4HHEA 4E21A 3KEOA 3IAM1 2PEYA 5FWXA 1AHNA 1LF0A 2Q2QA 4QXPA 3BE8A 2ILTA 1F5NA 2CL5A 1IIRA 1BN7A 2JFWA 3PCTA 3RG8A 1QF6A 5H4GA 3AHGA 3FCUB 1QBGA 2UV8A 4PBTA 4Y2YA 1X6VA 3GRFA 3R3UA 4HDNB 4ND6A 4P4NA 1FXWF 2D1QA 4N0EA 5CFOA 2PL3A 3EGVA 3H7IA 2WJ3A 1Z8NA 3H0KA 2B4TO 5KC8A 1E0KA 1EFVA 1E4YA 3WGZA 4YMIA 2IX3A 2PFKA 3A9TA 1I5RA 1JRLA 1WZCA 2F67A 2Y0BA 3AF3A 2PT5A 2WTBA 3RTGA 3ZVLA 1Q7EA 1I3MA 2Y1KA 4JI7B 3OU6A 5TQ0A 2HK6A 1F06A 1ZJ4A 2NZWA 1VJCA 5DDIP 4AX4A 2NADA 4TTTS 3NJ4A 3U44A 1M54A 1ZJWA 4BASA 1HDGO 1GPLA 3GLKA 4HRXA 3IUBA 2ATCA 2ZSBA 3WLIA 2A4KA 3NVKI 3B48A 4YONB 2O7VA 1WSDA 1RYMA 4K81B 3QTLA 1FB5A 1AO0A 5K0JA 4A1OA 4INJA 2Z04A 1F0KA 2HREA 2HNBA 2Q9AA 2A5LA 4LC1A 4BLSA 4D79A 2YKGA 2IVZA 5JD3A 2YWCA 3DD1A 3HLKA 4B7XA 2ZS8A 6CHYA 1Q0TA 3TZBA 4DIOA 4WBSA 2JFXA 5A3RA 3OLQA 4LSGA 2ZTUA 5JH7F 4QQNA 2JFPA 3M5PA 5JSUA 2VC2B 2GYYA 2HDOA 3L0DA 4DJJA 4Z5XA 1DINA 1LX6A 4B4KA 3I58A 1Z6PA 5JJIA 2DWQA 3AVUA 1UC9A 4WSOA 1V11A 2CZCA 2O07A 2R8ZA 2VH2A 1I51A 3ZWWA 2XSZD 1JZQA 1QG6A 1D4ZA 3ORSA 3T94A 1ZUIA 4DJ5X 4OGGA 3R7LA 1FCJA 4UM5A 4EARA 5HWSA 2IY9A 4CXMA 1T4BA 1BXZA 3ZWPA 4W5HA 2PV7A 5HA5A 3LKBA 3H9QA 1WDLA 5LQDA 1GTVA 1RJEA 1K7XB 1M75A 1ZNQO 3ZV4A 1VGVA 4IEFB 4C3VA 5JYDA 1EXVA 1FDIA 2SKCA 3QOXA 4AU1A 5A3QA 2IELA 5IYZB 2MSCB 3JZMA 3LAWA 2HMVA 1RCTE 4FBLA 3OJFA 4M9SA 4XJTA 2V4ZA 4D3DA 1FDTA 1LDEA 2C77A 2ZP1A 2JFGA 2BUAA 4K6CA 4XJSA 1OW3B 2NO6A 3HM2A 5GONB 2X5XA 1KDOA 4Q4HA 3QK7A 1EK5A 2GAFA 1JR4A 3QEJA 4H7HA 3FPKA 2ZJ2A 2C7BA 3IDQA 3N2NA 2NZ8A 3Q8WA 2IOFK 2VDRB 3QPCA 4G56A 4GM1A 4UARA 3ZBPA 4EI7A 2FPPA 3ZJUA 1CVLA 2CY0A 2VH5R 3KDPA 3RC7A 1UC4B 6NULA 4TYYA 4ENQA 1XTJA 3ZEAA 3TLZA 3I92A 3WRWA 3ZE7A 3LCUA 3QHQA 3X3HA 4E5VA 3FLAA 5GOZA 1CZHA 1BG6A 3EVTA 2IPXA 1HZZA 4TVOA 1TAGA 1JAHA 1QE5A 2B1GA 1WIWA 1IL0A 1FL9A 2AZMA 3E8XA 4D80A 1ICEA 4EHNA 1H0HA 4JD5A 4S0ZA 1QJ4A 5EUCA 3HKBA 1ZI9A 2CKDA 1GOTA 3TZHA 3PUWA 4BDSA 3O3CA 4C0KA 3SEZA 4LGYA 1MTOA 1RACA 2FKNA 2VHXA 3O31A 3OJEA 4MI3A 5G53C 3KETA 1Z26A 3UK6A 1J0XO 2ZUSA 3NOOA 3Q9SA 4EJ0A 3IIJA 3OQNA 4PBRA 3RRZA 1VHTA 3UHJA 2BY4A 2EX1A 2ZTSA 3AHDA 2VPIA 2P2SA 1Q19A 4KUHA 1IK6A 1FNCA 4RD6A 2YWXA 4C29A 4MQEB 3WLTA 3E81A 1EDOA 1B8NA 1G7RA 2IU6A 3HUDA 3U4GA 4C21A 3ZLBA 1QRTA 2NP7A 2EBUA 2XQGA 4R7ZA 2PBFA 2XMRA 2J31A 4AQ7A 3F4LA 2X3YA 2VP9A 1QOPB 3PUXA 1HDOA 2Q2WA 4IXTA 2Z9DA 5J5CA 3ZWXA 1QV9A 2VYVD 3JR7A 4F38A 1X8JA 4KQ2A 2Q5OA 2Z5FA 2QAJA 4XTRA 2XOXA 3ZH9B 3GW8A 1OYVA 4C01A 3OIUA 3ADOA 3PP8A 3E23A 4GKVA 4PYMA 3D6TB 3DBHA 3S0JA 3T06B 5LVAA 1LPMA 4GI2A 5J2UF 2Z6QA 1EHCA 1N3LA 1VZ2A 2H2DA 2X8JA 4UVDA 4NAUA 4PNHA 1OXMA 3S8YA 1QIEA 1P2VA 2QUZA 2RGYA 4XVRA 5J43A 1P31A 1UAYA 4LY0A 3WMFA 3TLMA 3A6KA 4NZZA 2H2FA 4Y2VA 1TZKA 1YUNA 2A14A 2V45A 3L9WA 2GBCA 4I81A 4I4LA 5DBHX 1ORTA 4LJ8A 2R6FA 1QGUA 3SM9A 3WMEA 3QFHA 3UV7A 3DDZX 3VHQA 2DZDA 2AOWA 2Y67A 2FAXA 3I0ZA 2AR9A 2IBMA 4UE6A 2QZJA 2WWYA 1J49A 1WF6A 3KP1A 2XECA 4MGYR 1BW9B 4CM4A 3SKXA 1JXAA 1XMSA 4O4HB 3LC0A 3QXHA 4JHXA 3ZCXA 5B7PA 1T36B 4NCKA 4GMDA 1AM4D 3OAAA 2FEXA 3S8MA 4IEIA 4CT4B 5HSGA 1ORDA 2A1UA 5L3SB 4CGZA 3I62A 2XNDA 3HSSA 1ITZA 1M6VB 1NIPA 1TUEA 1E1QA 1SC9A 1Y3AA 4YJ2A 4HKTA 3K35A 4Q4AB 3VR3D 1Z0KA 3K6SB 2XZLA 5ALVA 4N65A 4AJ2A 4EZEA 1FMCA 2C94A 4M8SA 1JB9A 1G8SA 2VIIA 4FJ1A 2C9ZA 1Z34A 2AWOA 3CHYA 3O8DA 2MSEB 1CQZA 3CX3A 2R8PA 4MVJP 4BRSA 4DABA 4ZIRA 2YXBA 4A5SA 3WS7A 1Y80A 1MW9X 1GRRA 3H11A 1CQIB 3C70A 4G24A 4RIGA 5KYNA 1VKHA 1E2DA 2OHVA 5FRDA 4BAGA 4C0BA 5IVDA 2OWEA 4QUGA 1QKJA 1W96A 2GA9A 1KFCB 2Q0XA 3U0BA 4G0YA 2MSDB 1K8YB 3VDMA 3AI1A 1RTKA 3BHMA 1OV4A 3EJWA 3HJBA 2JLVA 2XNHA 2JGNA 2OUIA 5GONA 4TWBA 1CD5A 2HM7A 4EMSA 4QGSA 4KWCA 3A6DA 3JXEA 4NIMA 4XGIA 4DILA 2RDMA 1YZNA 3DMTC 3EG5A 2YMPA 3IQZA 2IIVA 3RSSA 4KXFB 1L6RA 3D1VA 5KYYB 4F04A 5ALDA 4X6YA 5TF4A 2JFBA 2WINI 2GF9A 3G8CA 1L1QA 1Y8RA 3UHAA 2VQEB 5ICCA 2Q6VA 1R6AA 5LDGA 1EJ6A 4JA2A 2J0UB 4TLEA 2W0SA 1RJWA 4FGJA 1XT6A 3V55A 4OHCA 4WLVA 1UPAA 3SR3A 4C0QC 4UFPA 4Z4HA 5EOVA 3VH4A 1MUUA 1MCZA 2COEA 2GRJA 4AS1A 5SICE 5CDGA 1WHTA 2QTRA 1JQ5A 2WT4A 4BHTA 5HW0A 1MF7A 1P0QA 1U8FO 2IS6A 1T8SA 1MW8X 4EUNA 3NTLA 1CEXA 3ESDA 1CE8A 4O2BB 2H4HA 4B3GA 2B6HA 2N46A 2GX6A 4J0CA 5ESWA 1NMZA 2C3UA 1K4KA 4BKRA 1CUJA 1XZEA 2CWDA 2PMKA 2P1ZA 3UFBA 1GA1A 3R0ZA 1Z0SA 2HX1A 2ON6A 7ADHA 1JPUA 2HSZA 4LISA 1OLSA 2QL7A 5BQFA 3BJZA 1XELA 2Z4TA 4P33A 3P2JA 2FEWB 3V8VA 4BXOA 3D9QX 2EFCB 1GZ4A 1GDDA 1NF2A 2CLKB 4JBNA 2IU3A 2WWFA 4NPCA 1TVCA 4TMFA 5FL7A 3T1QA 4A6DA 1JHPA 4HAXA 3DF7A 1NFRA 2F1RA 2WF8A 3WO1A 4EY5A 1NUSA 2GN8A 3UATA 2IUSA 5B7QA 1QV6A 3SS7X 3ASUA 3PPXA 1M1YE 1Z6AA 1A9OA 4GVLA 3GUHA 1IVYA 1DEXA 3VMMA 3BXOA 4X1YA 3IL2A 4OHUA 2UKDA 1R2QA 3FYCA 3NHBA 3JWJA 3O8OB 4ZAFA 3STHA 1DX4A 1LI7A 1UJ2A 3DDUA 3F2VA 2RKWA 3TL6A 1X8XA 2A57A 4KX3A 2PH1A 5AM5A 2PMBA 4Q9IA 1NASA 3NDIA 1TYZA 2ACKA 4AJOA 2AXNA 4R8MA 4Q9NA 5JSKA 1PWZA 1QYXA 1SC6A 5H02A 1A9YA 3MJFA 3NCHA 1GN8A 3OOWA 5K8IA 3A32A 3IUEA 4E2YA 1OH8A 2O0HA 1JXOA 3UMSA 2BFFB 3LRPA 3X2FA 2FW9A 2ZUDA 1AHHA 3HNRA 3IAM6 3W7BA 4EJSC 3MSXA 3KT8A 3WFZA 4UUOA 2C5AA 1VG8A 3E3OA 3BXFA 5ENZA 3FOEC 2J3MA 2TMYA 4IRXA 2O48X 1R8JA 4BZPA 3OFJA 3EPKA 1T6YA 1J20A 2R7LA 4RTJA 5AHOA 3C7KA 3CA8A 3TCKA 1AHPA 4AS3A 2AN5A 1ABEA 2HV8A 2W7TA 3QPUA 4G2NA 3L04A 1QIMA 1PFQA 3UFXB 4HB0A 1QVZA 3L05A 4QTXA 1R50A 3KQMA 3GPLA 5BYAA 1NP3A 1TCCA 1HWYA 1ZEJA 3G5AA 1KEVA 3QVSA 4J7UA 4N82A 4YJ3A 5BN4B 1L4GA 3RFFA 1V0JA 1KEWA 2GPSA 2GPTA 2W2NA 4FZJA 1R5BA 4QOHA 3UUEA 3LBNA 3S2EA 1T0PA 3NYWA 4I4TB 1AUPA 4GZ5A 2FQXA 1CTQA 3ILHA 3PFCA 5GMOA 2WVGA 5K01A 2P67A 2CGEA 2R6R1 3FCSB 3BCUA 3ELUA 1FJ2A 1C0PA 5EP2A 2X0KA 3VYVA 3HYSA 1MB0A 2QTCA 2XQJA 5MFPA 5CDSA 3TZCA 1AOXA 2FEMA 1XROA 5ALUA 1KZ1A 1E4VA 1EVJA 3EUAA 1NXSA 4K6KA 4OI0A 4G81A 3F71A 3LXRA 3TVTA 1GVHA 2LR0A 3CFYA 5HJ5A 3FCOA 5JDIA 3KUUA 4IG4A 2A0KA 1R0BA 2R1ZA 5FTNA 3VBCA 3CO5A 4A4DA 4OEHA 4RORA 1GQQA 3L7YA 3STVA 4Y6GB 2ATIA 1T0IA 3B6JA 4N1AA 1MHPA 1F1JA 1KMCA 1O89A 2BFEB 2GSDA 3E2IA 3ENNA 2VS1A 1XYVA 1Z3IX 1CSEE 2F2TA 4G23A 4GD3Q 3LL7A 4X20B 5HQJA 1CKEA 1U9JA 4RQTA 5HMLA 2D1RA 5BRNA 2B1JA 3THYB 1Z25A 2O7SA 5K20A 5BR8B 3KQHA 2DHDA 3VC2A 4TXNA 1QIHA 3C2QA 1CFJA 4DDUA 3A6PC 1QQTA 1G19A 4JLKA 3N5KA 2XOEA 3GO4A 2OLEA 2G8LA 2RONA 3NKFA 1GFZA 2JB9A 1JHDA 2H0QA 3F98A 4XUDA 3QIVA 1J2TA 1ZINA 1I7DA 2P9TA 2EX0A 2Z1DA 3AIMA 2UUAB 3HL4A 4GPAA 1OBCA 2WTMA 3V8NA 4A0RA 4M0MA 4JSRA 3IA7A 2ATVA 2QL6A 5BYJA 3W9SA 4ZVNA 3T5DA 4INZA 4XWYA 4CKEB 2FPOA 1V2GA 7AT1A 4WDQA 3WMRA 3L01A 1P1CA 3O3OB 5CGQB 5JEDA 1HDIA 1YVPA 4KBYA 1E0AA 2HMSA 3MMPA 3ZY4A 4XLLA 4YLGA 1U8EA 4ARBA 5TS3A 4XD7A 1GFSA 1SEVA 1RI2A 1G38A 1U99A 3ND7A 4DEVA 4PRKA 2HMAA 1DELA 2NVOA 2ONZA 1E3WB 4OQ4A 3A36A 2OE2A 3E2MA 2OGWA 4ND4A 3L7BA 2IITA 2PXHA 4XDHA 1EFHA 3DVRX 1C3LA 2ORVA 1N5KA 3T9FA 1PJ3A 4FTWA 5ITVA 1HK7A 1XLWA 1TTPB 1AURA 4F5EA 4G97A 1U2GC 2L19A 3Q2OA 4A9AA 1E2EA 5FOQA 2ZRNA 4LDNA 4BNNA 4BX8A 3OEHD 4ZN6A 3QX8A 2E4XA 4URHA 3R6WA 1KAMA 1YFZA 3VR4D 2I2XB 3GLHE 3H2ZA 4POOA 4HK4A 2FF7A 1JJIA 5BVHB 5DCLA 3KJGA 4BEWA 5TVGA 4Y2GA 2ZYAA 2WWRA 4M9QA 3HB0A 2C7OA 3OU7A 5C3UA 3F7MA 1UBUS 2YWGA 3EMDA 4G1EB 4N3GA 2VBFA 1A8QA 4D45A 1YIDA 2JIDA 2QLLA 5ALEA 5EJMA 4DN6A 1JFSA 1GNLA 1GU7A 3OHMA 3OX3A 5EXDA 4O59O 2ZREA 3IKLA 4FR2A 3WL8A 2AFIB 3KNZA 2SICE 2ZT8A 1WULS 3UCFA 4HI0E 4PN3A 3DDCA 4OJYA 4Y9SA 4URWR 1U3FA 5EIAA 3I9JA 1VJTA 1ZK0A 1T91A 2BBWA 1VBKA 2ODPA 2VEOA 3HCFA 4HDRA 4OAPA 4PAWA 5AI4A 2PX3A 5E0KB 3AYXB 1O7JA 2ZBUA 4DAEA 2BBSA 3PQ5A 5ALFA 4BYMA 1XMJA 3GFGA 1TLTA 1ZXBA 1GY8A 2GRAA 4K1LA 5DLPA 2BHSA 1DQYA 1T3GA 2JRCA 5HXAA 2RK3A 3GUCA 2IQ5A 4OXYA 2KMLA 2XKBA 3GEIA 5A03A 3PC8C 3ZJYA 3G59A 4M0UA 5DXJA 1VXOA 1Z5WA 4D82A 3HDYA 4EI8A 1ZGJA 2IY7A 4JKIA 3RQSA 4P7BA 1X7WB 2XA1A 4I1UA 5IMBA 4OHOA 4MW2A 3MWKA 3FNQA 2BFEA 1HX7A 5CCBA 1P19A 3TBFA 4PN7A 4YRAA 3LIPA 5JVDF 5A9SB 4Q4LA 1E0JA 1NDQA 2WHPA 3M7IA 3H16A 3WLSA 4B7CA 4DNXA 3D2LA 1TM5E 2O0KA 2WYWA 1MNAA 4RVSA 1FMJA 3BN3A 3M49A 4TKMA 3KQTA 4DZTA 1YOVA 2ZE6A 1QU3A 2QR3A 5HCUA 3UAXA 1QFYA 2UYQA 5B30A 4DIDA 3DLPX 4QUDA 4HFMA 1DO0A 4HGZA 2NXEA 1KXZA 3UJ8A 4YNBA 1C2TA 2J85A 3FE2A 3GJ3A 4NFYA 1TUGA 3NWBA 2AXQA 4ND1A 1KR5A 2ZW9A 3HH8A 3WV5A 5EIXA 4DNOA 3AB8A 1EDDA 3HJTA 4H08A 4DV1B 1CYEA 4AZ0B 3OTGA 3SZLA 2Q3JA 3QX3A 3K6KA 2X9QA 2Q5FA 5FUYA 1USKA 3M83A 3QMWA 1CS0A 2W6QA 2PDAA 4W9RA 5EIOA 5TF0A 2PTHA 3HFSA 2DBYA 3GC6A 4F2WA 1W19A 3RK0A 1LLCA 5ADHA 3ZDRA 2GETA 3Q8LA 2VXYA 1S7GA 3MUFA 1AGPA 1K27A 2A7QA 3HC7A 4XM2A 4BX0A 1ZD1A 3CNNA 5EZSA 3E7PA 4QFMA 5FTJA 2QV0A 2HTEA 3MMXA 3WB1A 5CDUA 1MDBA 1WVMA 2ABWA 3JD3A 3M34A 1EG2A 2C9BA 5DTMA 5K09A 2IH5A 3OF3A 2WOOA 3QE2A 3WZMA 2NUBA 3GRPA 2DXIA 4IIGA 3K4PA 3E61A 1JEQA 3BIFA 5K6TA 2R1TB 4UEJA 4G36A 3T5PA 1X1CA 3II6X 1ZUD1 2FQWA 2OC4A 3ESXA 4N5HX 1F8YA 4TRRA 3JASB 4XVHA 4HQRA 2HKIA 2ZYGA 2P90A 3UWOA 1T9BA 3QJYA 1V4VA 3AEYA 3WRYA 1U8TA 4B73A 5I8ZA 3L7DA 4LV6A 3K5PA 2IV7A 5FV7A 5BRAA 3VI3B 2ZJ1A 2YFQA 3FGZA 4ZT4A 3HKCB 3ISTA 2ZR9A 3KEQA 2FQYA 1NTOA 2EERA 3Q3HA 4RS4A 1IZ9A 4URUR 5P8WA 5C1DA 5IVIA 2O0LA 4BKUA 2OAGA 4IJVA 2AN3A 1E94E 1V8BA 1ZIOA 3V8RA 5JH7B 3CLRD 4YJHA 2C29D 3HU5A 3UMJA 1A4RA 1WJGA 1Y8QA 1N2CB 1V48A 2FP3A 2VA8A 1L7XA 3IOMA 3Q3VA 1RLTA 4HFJA 3A2LA 3FDZA 2H1CA 5JZBA 2DG2A 3VZDA 3G3EA 1IBKB 5JRJA 1HTWA 1QFZA 5KDOA 1SXHA 3TBKA 1T25A 4EKYA 1RQNA 1Z83A 2CJWB 1A82A 5DGDA 2NUAB 3VR2A 4DDVA 3DEFA 5FPYA 1HKUA 3W06A 1KEEA 1DX6A 1J8DA 3I6YA 5L3SA 3UXHA 3SF0A 3PRYA 2WC1A 5EJGA 3NZEA 2O8BA 3SHQA 5FBLB 1G4AE 4YASA 2IWHA 1P2BA 1MOZA 1UOPA 2WAYA 2OM6A 3GH1A 3WXMA 1EUZA 4Z6KA 1NN0A 1GNTA 2WUGA 3AEQB 4D3ZA 5BV7A 3QKSB 3O82A 1CEEA 5TC4A 2XUJA 4J0IA 1Y5IA 2LDXA 2FLKA 2WM8A 5KTRA 5TT0A 2C9MA 2VEDA 2Q0HA 1QRDA 3A6HA 5ICEA 4D43A 4O5AA 1O77A 5NULA 1Y4AE 3PI7A 3WYGA 1XPUA 1KZYC 1PQ4A 2FFJA 1UKZA 4CEIB 4MV7A 2AMVA 3CVOA 3BDVA 3TK1A 3K71B 5JD5A 3PGMA 3ETNA 3R0IA 5HMMA 1Y1TA 1OFIA 1U7WA 4NBNA 2RHMA 2NT4A 1Z62A 1NURA 2J3QA 2XMZA 3FLEA 4GKBA 2XX3A 1N7JA 4I0WB 4KE7A 1SOUA 4TSKA 4E08A 4AMBA 3AUTA 4NNJA 4PSCA 3SBDA 3ZKWA 1KJ8A 2WUWE 4ETWA 5LDHA 3COZA 1BMFA 1KFKB 2CNKA 2CK3A 2JGDB 3H9UA 3RIXA 2PWBA 3IBYA 1YZQA 5ECWA 2ZBEA 1HEUA 1DS6A 1OE0A 4O2AB 5D1HA 5AJYA 3B1WA 2O06A 4PHCA 1CS0B 4C2AA 2VWHA 1CJKC 2J3DA 2ZSEA 4TS9A 3QWIA 1LBSA 2O0MA 4IUBS 4JN6B 3L4KA 2GASA 5LP6C 1XDZA 4NDNE 3WA6A 2QY9A 3FHTA 4TS3A 3JQ9C 3JQBA 3KZNA 4ACAA 4RKYA 1IUPA 4D6XA 2QRPA 3PPVA 1CUGA 4P4GA 4OXKA 4AWXA 2XBLA 3ONWA 3TPFA 4DM7A 4N7MA 4I46A 1UR5A 3N74A 3VSEA 3ZK7A 5GADl 1ZCAA 2PZKA 1CWUA 5HS6A 2ZSIA 5J4VA 3HKDB 1E9CA 1G8FA 3K2IA 1J42A 2W6NA 3LYHA 2G76A 3T7CA 2J6BA 3CM0A 1CNEA 4EOGA 5FBZA 1C3OB 4KK4A 3O1HB 3IMGA 3PQFA 3P9SA 1FJGB 1W2GA 5E4JA 1VGRA 2V7VA 3IRUA 4P7FA 4B5LA 5JXIA 5I3CA 3BMCA 4YJ2B 1RLOA 4LHYA 2D74A 3E9CA 5AW7A 4L2IA 4B80A 4IL5A 4C6SA 4E2WA 4XX1A 3ZGOA 3SIRA 5JC1A 5HZHA 1IMJA 3FDJA 4XLZA 3PFBA 3NTQA 4Z9YA 1EVYA 1MC8A 1U1FA 5CEFA 2B7BA 1T4CA 4HP8A 1AA9A 2P9HA 2ZS9A 1FP4A 2V7BA 1TF7A 1LEHA 1K7YA 2PY6A 3VR2D 2GD0A 4C7XA 4Z7OB 1FVFA 5KNCD 3HKCA 1K3TA 4PO8A 3H7AA 3GLSA 1E2UA 1BCSB 1TQ6A 4U2FA 1W1WA 3M82A 4FGWA 2JA2A 4HQFA 2R6JA 1YB7A 3M5DA 2H08A 2BGKA 4Z2YA 5DHUA 4C0LA 3U2QA 5IW8A 5D1NA 5D3MA 4R98A 1RRCA 5JAOA 1R9MA 2Z1NA 3BFXA 3H9CA 4ZXPA 4V3CA 5DSZA 5CA1A 4HDCA 3ZNOA 2EQBA 4KQJA 4NECA 4TMVA 5BVGA 1SXJA 4OQZA 1FU8A 2EBWA 5EVJA 4OHRA 4DS3A 4BVFA 2L69A 3NNSA 5ALYA 2WSLA 1M2HA 1X1RA 3NT4A 4GBED 4REQB 4ZC1A 1L4NA 5J40A 4B33A 1C3XA 5FAKA 1KO8A 4JDPA 1OU0A 1E5DA 5H3HA 3UQYS 2E5WA 2PMDA 3P9KA 4PC1A 3SSOA 4J0KA 1ZZEA 1RXVA 1ECPA 1VLQA 1RRFA 2VK2A 4MYTA 5IKEA 5K8CA 3WOHA 2QMOA 4BV8A 3HVJA 3D3WA 5JXWA 2YV1A 4GSKA 4QXMA 4I6JA 3PHGA 2WFLA 3TZKA 2Q5CA 1MLDA 1M7HA 4RLFA 1A2KC 3KTAA 4P4UA 3BRWA 3DH0A 2XJ4A 4KH1A 1SVWA 2ZRMA 1T2UA 4QUAA 4S05A 1EFRA 1KE2A 4MUEA 4DLNA 1TM1E 3IEMA 2JLRA 5ERYA 1KY3A 2AFHE 3G1UA 4ARZA 1DRKA 1C4WA 4WECA 1RNLA 4QPJC 3ODPA 4QGBA 4N6OA 2FLWA 3LT5A 4X90A 1BX3A 1ZIXA 2JASA 3INGA 4P81A 2XMPA 3MJDA 4F4UA 2GZMA 5BOSB 3PTLA 3DCJA 1EI9A 3OFVA 3TAUA 2O8FB 3TW0A 4US1R 5EG5A 3V7FA 3QEKA 1YVEI 4AO7A 3CH6A 2P2LA 4QQRA 3H2KA 4WMLA 1E8MA 1PAUA 3SC4A 1XEXB 4RSRA 3ROTA 2JBHA 1HO3A 2HK8A 4NK4A 3AL3A 4MCJA 4NZPA 4ZAZA 1Q1EA 4DF3A 1GCGA 2W6JA 4L9AA 4QM6A 2IWRA 4IKEA 3C15C 4KXVA 4WK0B 4LE2A 4W7SA 4EGQA 4V1CB 1SUAA 3MPUA 4OGFA 3QUQA 5C5DA 1E9SA 1YCDA 2VN8A 3FJ1A 3Q7TA 4MYUA 4CM5A 1XWIA 3KWMA 1JKIA 3D8UA 4LMAA 5IAEA 1AS0A 1ZN7A 1Z0AA 2AIRA 3IUYA 1GM5A 2Q6IA 4EP1A 4PVCA 1SULA 3NP9A 4PE5B 3T3HA 4DT1A 3WWEA 1VE6A 2VTVA 1LNSA 1X7HA 2HA5A 3H1FA 1XD2B 4HR7A 4NONA 2HUNA 4YP0A 4UBJA 1V4NA 5B53A 1N3IA 3HU2A 3K15A 1O5OA 4X95A 4LSMA 3ZBTA 4WUVA 3DV2A 3SXJA 1RE0A 2EIHA 4H1HA 4C14A 1G98A 4F3NA 3DMGA 2WKQA 2FWPA 3DP9A 2UXDB 4JBXA 4RXUA 4DW8A 2P5TB 2ZQYA 4EY3A 1P61B 4L3OA 1RKBA 1J22A 2H00A 4EL5A 1JTFA