4JNCA

Soluble epoxide hydrolase complexed with a carboxamide inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
312
structure length
312
Chain Sequence
GSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional epoxide hydrolase 2
publication title Discovery of 1-(1,3,5-triazin-2-yl)piperidine-4-carboxamides as inhibitors of soluble epoxide hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 111
structure length 312
sequence length 312
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jncA00
1A8SA 4J3JA 2JF0A 4IQ4A 1FSSA 2HA6A 2R8BA 5CT6A 3GFFA 4AXBA 3H2JA 3F96A 5C8ZA 3F98A 4C89A 1CUJA 3A2MA 2PPLA 1YCDA 4Y2SA 5HF9A 3G0BA 1MAAA 4M0MA 4WDRA 3HEAA 3FBWA 1ZD3A 2CBGA 3WK6A 5T4HA 3R41A 1J2EA 1CRLA 2XT0A 2C7BA 4G9EA 1F8UA 3QPAA 1XQVA 1YB6A 4Y7DA 1MO2A 4H35A 3WL8A 1J06A 3PFBA 1XLWA 3O4GA 2BCEA 5AKZA 1EINA 2Y6UA 3VXKA 5HFAA 2HU5A 3V1KA 4KAFA 4KRYA 5JIBA 5AO9A 3HJUA 3B3QA 1QIDA 4Y2UA 3IBTA 5EHQA 1ZD2P 4M0EA 5A2GA 4B7ZA 5JAHA 1DWOA 3H1AA 3WJ2A 3IUQA 1EB8A 1JMYA 4GWLA 4X6XA 3O4IA 4Y2TA 3IIIA 3KOOA 4P92A 2PUHA 1ZJ5A 3Q0TA 3I6YA 4P08A 4UBIA 4L9AA 2QR5A 4W1RA 1KEZA 2I3ZA 4ZREA 1K63A 4UBLA 4KE6A 3C8DA 2HA0A 3FCXA 5IKXA 2OCLA 1EH5A 2QJWA 3G9UA 1WOMA 3DL4A 1ZI8A 1TRHA 3WIBA 1USWA 3PF9A 5AIAA 4WFIA 1JU3A 1HBJA 2DQZA 2O7VA 3CCCA 1OXMA 5JYCA 2C58A 2ZYIA 5F4ZA 5EIEA 3TEJA 3AIOA 1ZJ4A 2WSLA 5K3AA 2HA2A 1CUBA 1VE7A 2W22A 1EXWA 3V1NA 1A8UA 3ZV7A 3I2GA 1CUHA 4G8BA 1ORVA 1UOPA 5YASA 4BE4A 1ZD5A 5D3ZA 3ICWA 5C8VA 2HDWA 5HF6A 2VT6A 3IB3A 4B0OA 4MQLA 4DGQA 4U2EA 1XZHA 4AMZA 2DCMA 1XZBA 4B9AA 5BV7A 1CUXA 1C7IA 5AIBA 1SOMA 5ALNA 2PU5A 3WWCA 3LIIA 1KU0A 5HF8A 1NU6A 1BRTA 4IO0A 4J0HA 3CN9A 3WKCA 3G0DA 2VJBA 3F8SA 5LYYA 2G5TA 5CT9A 3WZLA 5ESRA 3S8YA 4WY8A 4ZXFA 1E3QA 4KR0A 3HC7A 1HPLA 3CCBA 3DCNA 4QDTA 5A7HA 5DWDA 1E8DA 2W6CX 3K2IA 3EQ7A 4FFVA 2AJLI 5AK4A 4FOLA 1N5RA 4IH9A 1UOOA 5ALFA 2OCIA 1MT3A 1WB4A 3GZJA 3BDIA 2XUIA 1K5PA 4HRYA 2QUAA 4GW3A 3R3UA 4GDMA 3DJYA 2JEZA 5D7BA 1YS2X 2HIHA 4BZZA 1DX6A 4F0JA 4L0CA 3WA7A 4JH0A 3V48A 1IUOA 4DTCA 5AKJA 1XZFA 1Y7IA 1VA4A 4J03A 1VE6A 1TCAA 2WKWA 2WHQA 5JADA 4EHBA 1NX9A 3M82A 1GPNA 1R88A 3L1IA 2PU7A 2B9VA 1L7AA 5JZ9A 4G4GA 1IUPA 1ZD4A 2DHDA 4Q05A 1TK3A 4QWWA 1UK9A 1UKCA 1LBSA 4WJLA 4X92A 4A5SA 2QVBA 4B81A 4H7JA 2HL6A 1X70A 1DX4A 4WY5A 3B12A 4UHFA 4BC0A 3DLTA 2XQKA 5LZ2A 3WKBA 2FJPA 4G1FA 4DSAA 3WK7A 1JMKC 3GBSA 5ALWA 4AB1A 5IH7A 2QXUA 5DTIA 3QZUA 4N8DA 1EK1A 4KJXA 5LLSA 5AOBA 2IIVA 3DDUA 1QTIA 3LCRA 1M33A 3H2IA 1DQZA 2PKYX 2HA7A 3AZOA 1XQYA 1QIJA 3EQ8A 5DJ5A 5AM1A 3C87A 1WPRA 2G5PA 4Y2JA 5HKAA 2OAGA 4UHHA 4K6GA 2V96A 1HQDA 3C43A 2XUGA 3DQZA 4OCZA 2C5GA 1U65A 4TGLA 3C5WP 2J3DA 3TRDA 4C4YA 2QM0A 3STYA 1H2XA 4P9NA 4ZRDA 1TIBA 4QDOA 4X6YA 5A71A 3S2ZA 1LPNA 1YR2A 3BDVA 1QTRA 4FMPA 5I7UA 4BC1A 3DD5A 3IDAA 3W05A 3O95A 1LPAB 3OG9A 1ZI6A 4UBNA 4BTLA 1RYYA 3G02A 3IVMA 1UK6A 2XMRA 1CUDA 3JW8A 3ANTA 1QGED 3F97A 4B6GA 1N1MA 3KWJA 2WIKA 1WHTA 2WFMA 4H0CA 1EVEA 5CT5A 3ESAA 1XRNA 3P2MA 3WMRA 4M0FA 1GGVA 1VXRA 2QZPA 3IULA 5AKKA 1CPYA 4DMKA 2I3DA 1X2EA 4OUKX 3RM3A 3BL8A 1EDBA 3D3NA 1W75A 4C4XA 4FFWA 1MTZA 3EBLA 2DSNA 1UK7A 1O6FA 3RARA 2BUBA 1A88A 4AMYA 5IVIA 4G4JA 4BZWA 3DNMA 4XWGA 2ZYHA 2RHTA 1A8QA 2JGLA 4ZV9A 3WK8A 5HK9A 4B80A 4LKOA 3OOSA 1LPMA 4KE7A 4J0GA 1XZKA 2VQ6A 7YASA 5AK5A 2OCKA 3AFIA 2WJ3A 1QLWA 4PSCA 1SCIA 1AUOA 5EHXA 1MAHA 4H7KA 5DNWA 4IH1A 4C88A 3WQHA 3ANSA 2YASA 5ALYA 1XLVA 3PUHA 3WWPA 2BUAA 5LZ9A 3ZI7A 3HACA 2OAEA 1P0PA 3DKKA 3QMWA 2GZSA 4YK7A 5T4EA 4FNMA 3MVEA 1CIJA 4UHDA 3CN7A 5AHXA 5EFZA 3FYTA 3KXPA 1ACJA 4HVTA 4N5HX 5ALVA 3V9AA 5FOQA 5AM0A 5FRDA 4ZGBA 1HL7A 1Q0RA 3I6ZA 5LKAA 2QOEA 1QOZA 4LYDA 2WHPA 1ZGBA 4Q3LA 2LIPA 1QO9A 3WYDA 1XQXA 4HTAA 1MX1A 4H7DA 3N0TA 1UOQA 1BS9A 5ALIA 3IUMA 4XX1A 5I9IA 3I6MA 3VJKA 4C01A 1VKHA 4CG3A 2Z5GA 1P0MA 5ALSA 3U0VA 1ZIYA 2DQYA 5AKYA 5E4JA 4LHEA 2OGTA 4NMWA 1Y37A 1LGYA 2WIGA 1CQWA 1R9MA 2WUEA 3JYHA 1ZGCA 4U2BA 4HXGA 3DKRA 4BAUA 5BWCA 5AJHA 4FLFA 4YX9A 4MWSA 3GA7A 3SK0A 2AXEA 2RHWA 4UPDA 4CCYA 3NGMA 3L1HA 3F9CA 2HU7A 3C6ZA 4FLMA 5EHZA 1TCCA 1LZKA 4L72A 3D2CA 5LZ5A 2WUDA 3Q8WA 4FDMA 1F6WA 5AI4A 1ACLA 1JJIA 5ALUA 3D7RA 3H1BA 4GBGA 4KAJA 4UHEA 3C6BA 5AKGA 4X3CA 1XROA 3MGAA 4OU4A 1ODSA 2AJ8A 4DNOA 5ALMA 1BE0A 3WWDA 2B4KA 5ALTA 4DM7A 1MX9A 1SFRA 5HZGA 4X85A 4ZI5A 1CUYA 1Z68A 3X3HA 4H7FA 1R9NA 3ZWQA 4UBMA 3M83A 1WM1A 4Y2VA 5CT8A 2WIFA 1ETHA 5KWJA 4Y2PA 3PFCA 1N8SA 1UXOA 4U2DA 3IUNA 3W04A 3ILSA 2RONA 2CJPA 5ALZA 3NUZA 3G8YA 3QYJA 4K5QA 4H18A 5E4YA 1G42A 2GZRA 4OB8A 4Y2QA 5LP1A 1XQWA 4EY7A 5ALKA 1JKMA 3D2BA 2DHEA 2BJHA 2HHAA 4FKBA 2PX6A 4W1PA 2X76A 1NU8A 3IUJA 4RPCA 4J0CA 4U2CA 4EY8A 1CUSA 2VF2A 4L3WA 3A6ZA 2IX9A 1THTA 2QS9A 4BBZA 4MYDA 4OYYA 3QMMA 3PDCA 1DWQA 2FUKA 1DT3A 1QONA 3HABA 4KACA 1UT6A 3W9UA 1DT5A 1XKLA 3WL5A 3TGLA 2V9ZA 2G63A 2WU4A 4DNFA 4JUIA 1WHSA 3H2GA 3VVMA 2IITA 4S0XA 5ALLA 3VISA 2GYVA 2DHCA 5AM5A 2XUJA 2D5LA 4MYSA 1ORWA 3E1GA 1LPPA 2AJCA 4G8CA 1KU6A 1H2WA 2WHPB 2AJDA 1Q84A 5C8XA 1LNSA 5AK6A 2JGKA 3K6KA 5JARA 4X90A 4MEAA 4K6HA 3DOHA 3LP5A 5AKHA 5SYNA 4NZZA 3W06A 4H7HA 3HSSA 4NVRA 4E11A 4J0IA 1XZMA 4NS4A 4FBMA 4BCBA 5ALDA 4RGYA 5CBKA 3C8HA 3W2TA 1BCRA 3ZLVA 2WJ4A 5A7GA 3G0GA 5JAPA 3M81A 5FKJA 1SCKA 4BP8A 1CEXA 1GKKA 3ESBA 3UMJA 4DNPA 4PW0A 3BF8A 2XQJA 2WIJA 2XUAA 2YYSA 4B9EA 2GBCA 3AUKA 3WKAA 2WTNA 2XUDA 4OSEA 4CCYB 2QKYA 2GBGA 2J4FA 3FLAA 4XIIA 1VOTA 2PSHA 1UKAA 2QRUA 3R0VA 1G66A 1K6EA 4J0KA 4I3FA 3WI7A 1CUEA 4PO3X 1OCEA 3ZPXA 3MUNA 4HXFB 4DMCA 1ZICA 3PICA 3QVMA 1YS1X 3FLBA 1EB9A 4UBKA 5EIHA 4X91A 3HZOA 5K3CA 2XE4A 5JALA 3QITA 4AZ0A 4TPKA 2ZSIA 2ZJ6A 1BCSA 3YASA 3H0CA 4J0JA 3WKDA 3PF8A 2H7XA 5DNVA 1CUVA 1CV2A 3QBJA 3SWWA 2EEPA 4BDTA 4WFJA 4MXDA 3BE8A 1W76A 2NW6A 3LIPA 3M3DA 3O4HA 2OCGA 1VA5A 3TJMA 3WJ1A 2R11A 4E46A 3HXKA 4A16A 2JGEA 3AIKA 5FDFA 4H7IA 1JU4A 4F60A 3AZPA 1BU8A 1QIMA 5D3KA 3NWOA 1G5FA 1J1IA 5HCUA 4MEBA 4FBLA 4X93A 3K9BA 4BE9A 4AO8A 4BAZA 1K8QA 3I2HA 3QPCA 3KWFA 1YA8A 3U1TA 2ZSHA 4BTVA 1CUAA 3F67A 4LIPD 2JIDA 2YXPX 2Q0XA 3WWOA 3ZLTA 2VATA 2XMSA 4BB0A 4F5ZA 3D5EA 1GQRA 5FPPA 5FLKA 2ONCA 4WFKA 3BJRA 2DR0A 3RLIA 4I19A 3A2NA 3STVA 1JI3A 5ALQA 5LKRA 5ALOA 1QO7A 3WK4A 2WILA 4BDSA 5AICA 2RI6A 1FJ2A 4OYLA 3R3VA 3AJAA 3H19A 2ROQA 5JANA 4WDQA 5D6OA 4DNQA 5J3JA 5JATA 1IVYA 1XRRA 5LZ7A 3O9VA 1R1DA 1N5MA 3MUOA 4N8SA 5AM3A 1MU0A 3I2FA 1XZDA 1EVQA 4GECA 2V98A 2PL5A 4FTWA 1XFDA 2QTBA 1YASA 4Y2RA 1VLQA 5DYWA 2VJDA 4AX4A 3O0DA 2ACKA 4GEGA 2XUQA 4V2IA 2OXEA 4G5XA 5FPQA 2Y2UA 2CEKA 2OQVA 3WK5A 3V1LA 4DSZA 5K3FA 1AX9A 3AILA 1SC9A 2Y6VA 2X5XA 2XDWA 4AN0A 1TKRA 1CUWA 2I03A 1YA4A 5ISMA 2PBLA 2GBFA 4D9JA 4EA6A 1GT6A 2QMQA 4X7BA 2RAUA 3D2AA 3IA2A 5ALGA 1HDEA 1UWCA 4H77A 4QLAA 5HK8A 4ARBA 4HAIA 5FV4A 4QE3A 3BIXA 2WFLA 1AKNA 1UK8A 4CFSA 1H2YA 1XRPA 5JD6A 5AKLA 2CB9A 2VTVA 2QXTA 3ED1A 1FFAA 1XZCA 1VJ5A 1TCBA 2XQGA 4U2GA 1XRMA 4H7EA 1AC5A 2VA9A 5H3HA 3AIMA 4K6KA 1RWQA 3C45A 4RE5A 2BGRA 5JZSA 5A62A 3OTQA 1XZIA 1A7UA 3L1JA 4BP9A 3CXUA 4Q3KA 3FWHA 5DYTA 2C0QA 2X8BA 3I1YA 2WJ6A 4GLBA 4BRZA 2G4LA 4QZVA 1ODCA 3EQ9A 1ISPA 1G4HA 2WTMA 3D0KA 2JGIA 3UUFA 3V1MA 5FUMA 4YPVA 2XLCA 1CR6A 3T4UA 2UZ0A 3O9MA 1GPLA 1YB7A 2OQIA 5JAUA 5AOCA 2Z3WA 1U8EA 3G9ZA 2ACEA 4UHCA 2GBIA 1ODTC 5CTAA 3BJMA 4CCWA 5C7YA 3PUIA 1DU4A 1XZLA 2PSJA 3KDAA 1XRQA 4QDXA 2H1IA 5ALRA 4EY4A 4INZA 2JGMA 4PSDA 1QIFA 2Y1KA 2QT9A 3ICVA 4OPMA 1BEEA 2ZJFA 1F0NA 1W52X 4PQEA 4QEKA 2CMFA 3I2JA 4ZV7A 1Q83A 2WQZA 1EI9A 1YSCA 3I2KA 1LZLA 4Z49A 4BYMA 4A23A 3FOBA 4MWTA 4C6HA 4TVKA 3HRHA 5AI6A 2HA4A 5HQ3A 4WCVA 1U2EA 5HFNA 4EZIA 3IURA 5SYMA 5LIPA 5AM4A 4W1SA 4ITVA 4ROTA 3WYNA 4PF1A 1MNQA 2PSDA 4BATA 1XRLA 3OM8A 1QIIA 3ZLUA 1AURA 3C70A 3ESDA 5AP9A 2OG1A 3R3WA 4MQMA 1UZAA 4KE8A 3OC0A 4QWMA 4G8DA 3DEAA 3SC2A 2PVSA 2YH2A 3VJLA 1OILA 3STWA 5JD4A 2CKMA 1AZWA 1QFMA 3WL6A 4LXGA 4FHZA 3STTA 4EB0A 1XZGA 2WUGA 5ALPA 1PJAA 5JAOA 5CXUA 2HU8A 2BUCA 2GYUA 3R40A 5A6VA 5HKBA 3NOXA 2O2HA 3DL7A 3QM1A 4J7AA 2VT7A 5IVHA 3LLCA 3AZQA 2ES4A 4JNCA 4BAGA 1ZI9A 4CIBA 4EUSA 1E8NA 5K3FB 3G7NA 1QJ4A 2HFJA 1EDDA 4EY5A 1ZIXA 3QH4A 4IHAA 4KAAA 2O7RA 1BROA 4HZGA 4AO7A 1DINA 2CUTA 4XVCA 1MPXA 5KBYA 1O6GA 4C4ZA 4E15A 1J07A 1RP1A 1CUIA 3C6YA 5CURA 3FVTA 3VJMA 2Z8ZA 4BVLA 4P93A 4UFOA 1XZEA 3WL7A 5DTJA 2WFLB 5CMLA 2XMGA 3DYVA 3EF3A 1DQYA 1B41A 4UFNA 2XMQA 1QE3A 4CIAA 4FLEA 5AI9A 3H17A 5E2IA 4BRSA 3A70A 1L7QA 4Y2XA 4EBBA 4W9RA 2VJAA 1BEZA 3OURA 1WPXA 3H18A 4HXEB 4PV7A 3PI6A 5IVDA 1C7JA 3VKFA 1X2BA 4RE6A 4UBOA 3C6XA 1QFSA 2WHRA 1QIEA 3C5VA 3BIWA 3QMVA 2HRRA 4KRXA 3HI4A 1QIHA 2PUJA 3G0CA 2PSFA 2C0PA 1FFBA 1C4XA 4UBJA 1IMJA 1JFRA 2ZVDA 1LLFA 1QIKA 4MJ3A 1WB6A 2BGNA 1CFJA 2Z8XA 4LYEA 1R4ZA 1YAJA 3GROA 1EA5A 3HLKA 3FYUA 3WKEA 1Q0ZA 3G9XA 4U2FA 2XMZA 1MNAA 4X95A 2BKLA 5HF5A 4AO6A 4RNCA 5BOVA 3H2KA 5A7FA 2VAXA 2Y2VA 4UFPA 3WA6A 1MN6A 2H7YA 1DTEA 5KREA 3G0IA 1Y7HA 3SX4A 5LZ8A 4BCCA 2VEOA 2XUHA 1JJFA 2WU3A 5CW2A 2O2IA 3B5EA 1I6WA 1IZ7A 3VDXA 1VZ2A 3WZMA 3R3ZA 5HQ3B 4JEIA 5ALHA 4G9GA 4DMHA 2OGZA 2JGFA 4W1QA 3BXPA 4GHWA 1YAHA 3DS8A 3FAKA 1THGA 4O08A 1CUGA 4X71A 4CI9A 5AI5A 1CUZA 1W6RA 4BVJA 1BN7A 4Q34A 1EX9A 3BF7A 5CH8A 5K3DA 1WB5A 2CZQA 1FFDA 4CG1A 5CXXA 3E3AA 2BFNA 3STUA 1GXSA 1T4MA 2RIPA 2QJRA 2H9YA 1WCYA 2EDCA 1DWPA 5CT4A 2XI4A 1GPKA 2C4HA 5AM2A 5AK3A 3W9BA 1TQHA 2J4CA 5AOAA 5AKIA 2DFPA 5AKXA 3ESCA 2HRQA 3WK9A 1LBTA 1CVLA 3STXA 1EDEA 1U4NA 2P8SA 2XMDA 3G9TA 4HRXA 1P0IA 4DMFA 5AH0A 4B0PA 3DYIA 5EHNA 4UUQA 1JJBA 5AKEA 4Q1VA 4AZ3A 1CLEA 1FFCA 2XUFA 2WUFA 4GI1A 1PV1A 1H2ZA 4QLOA 2O2GA 2VJCA 1L7RA 2K2QB 2OPHA 5DLPA 5ALXA 2XMCA 4PSUA 1H23A 4G4IA 1T2NA 1GQSA 5T4BA 3WWEA 3LS2A 4QDUA 5IVKA 1EHYA 5CH5A 3JWEA 2OLEA 4Q82A 1S8OA 5DNUA 4UHBA 3PE6A 3FYUC 3T52A 3H04A 4OU5A 1AQLA 5KWIA 2E3JA 3KSRA 3FSGA 4N5IX 4B84A 3I28A 2HM7A 2Z3ZA 5AI0A 3I1IA 2RGUA 2WM2A 1SCQA 1XLUA 1VZ3A 3QPDA 1XZJA 2OGSA 5K3BA 1R3DA 1ZOIA 4OB6A 2JEYA 1IZ8A 1FFEA 1H22A 4GXNA 2FX5A 3R3XA 5EGNA 3KD2A 4N8EA 1HKHA 5T4FA 3I2IA 2QUBA 1UKBA 3VVLA 4JYPA 5K5EA 1CUFA 2XLBA 5DYYA 1MJ5A 4X94A 2HA5A 2WLSA 1E5TA 5K3EA 4Y9SA 1GZ7A 5E4TA 2V97A 4FWBA 2JBWA 5LZ4A 2VSQA 3FYUB 4F21A 4DYHA 1E8MA 4BCDA 3FSGD 4Q3OA 3AINA 4KE9A 2ZYSA 2XUOA 1LPOA 3FVRA 5EIAA 4E14A 4C87A 2VAVA 2GYWA 3GUUA 4AN1A 1QZ3A 1W4LA 1W1IA 3E0XA 4B83A 1MX5A 2H7CA 2XQFA 3O4JA 2C5FA 2WFZA 5EI5A 4LXHA 5JZBA 2EDAA 1K4YA 2XQIA 4OB7A 2WG1A 1R50A 1P0QA 3EIOA 5JASA 1AGYA 3WLAA 4OD0A 4QA9A 1UFOA 3N2ZB 4KEAA 1LPBB 4DIUA 2I78A 3D59A 4PNZA 1HLGA 2D0DA 4JYMA 5FP0A 2BAGA 1E89A 1F0PA 2HFKA 1XZAA 2AJBA 1IUNA 3RKSA 3GELA 1CQZA 4B82A 3A2LA 2FJ0A 5FXMA 1PFQA 2ECFA 4FNGA 2HA3A 4J0DA 4YASA 4ARAA 3R3YA 1XKTA 3OPMA 3D4LA 1QIGA 4W63A 4K2AA 2XUKA 5C81A 3WIOA 2PM8A 4B85A 3DOIA 4X6UA 2ZYRA 3FLEA 4QDZA 3FNBA 4IH4A 5I8PA 3FCYA 2B20A 4X97A 4BVKA 3UUEA 2WG0A 3BWXA 2XMBA 2ORYA 4ZWNA 4DLNA 1GKLA 1LPSA 2B61A 4X00A 3E4DA 1CUUA 5JD5A 2HADA 4ETWA 5CRIA 2WIDA 4XJVA 1JT2A 4I4CA 4KYVA 4CG2A 4Y2YA 4HS9A 3RK4A 5ALEA 5BWBA 1EK2A 3HYSA 2XB6A 1VXOA 2J3QA 4AQDA 4QNNA 5AI8A 1E66A 2ZJ7A 5CH3A 5ALJA 4LXIA 1AMNA 2WG2A 1BN6A 1TAHA 1CUCA 3H2HA 2PSEA 4EY6A 1D07A 2JGJA 6YASA 1B6GA 2XUPA
chains in the Genus database with same CATH superfamily
3IP3A 4QSHA 1Z83A 1C7QA 1F12A 3MXTA 4CLDA 3MJCA 5L95A 1WX1A 3NIGB 4MR8B 5A9TA 2BEVA 4I4TF 3WGJA 5L8VA 4UXHA 1NR5A 3PFHA 4F4JA 3RJMA 2NUAA 4Y6QA 1FSSA 1RLUA 3PGVA 2R8BA 5CT6A 1AHNA 4WT7A 3T5DA 3VUEA 3MBKA 3P9NA 1YMVA 1DRWA 3HVIA 2Q6VA 3IT3A 4Q01A 3F96A 3FHJA 5FI1B 3BXXA 3VTZA 1Z5WA 3V8VA 4MS4B 4FNOA 4DA0A 2HRCA 1D03A 1NTOA 1RCFA 3MTBA 4KO2S 4AZSA 3A37A 5K8TA 2ENUA 1KQFA 1UDXA 3ZE8A 3I5MA 3QEOA 4GR5A 4EFKA 4YMWA 4WDRA 1A96A 3P94A 3IT0A 3FRIA 3FBWA 1ZD3A 3F7TA 4XYLA 5A02A 2A30A 3E84A 1J2EA 2JA2A 1Z22A 1P8AA 1G6KA 1L5LA 1D2RA 2XT0A 4JOQA 4EGCB 4JJKA 2EFHB 1W5TA 3EZXA 5JAIA 1FW6A 3C1TA 1F8UA 5LQSA 1S2OA 4AULA 2GD1O 3QPAA 4S12A 4L22A 4LZAA 1ZWLA 2GEBA 3WWYA 1LQUA 4MI3A 4H35A 4LBZA 2GHIA 3QFRA 3WL8A 5JBQA 1W2WB 3UWDA 1W6UA 3USZA 1P1IA 1ADFA 1Z8HA 1YVPA 1SY7A 1S8FA 4P98A 4ARZA 5AVSA 1E4VA 3SDBA 1XLWA 4IIUA 4LXXA 4QDKA 1AZSC 1XTBA 2BCEA 1ZOSA 3F0TA 4PG7A 4OK6A 5HFAA 2B2NA 3EUEA 1JFSA 3E3NA 2DYKA 1UWLA 1GUFA 4ZQCB 3ESXA 5JJIA 1NVKA 1PZXA 2JIZA 5CD9A 3PYXA 4C4SA 4DDUA 4NU8X 2OKCA 1V4NA 4KK4A 5FOXA 1B43A 5E3JA 2QW1A 2RIRA 1FFSA 1QIDA 4V0QA 1NBOA 3O73A 1E9RA 5ESXA 3QF4A 3VH4A 5B6PA 5B1HA 1SXJE 2WU8A 4Y2UA 1T35A 5K09A 2QN3A 1W0JD 2B7LA 3BMQA 3UQYS 1AU9A 3L6RA 4HEHA 2IH4A 4I1OA 5A2GA 1XDUA 1N6KA 1JG6A 4CEHB 5HCNA 4CQLB 5AFSA 3WXMA 3MCZA 1IQUA 1P5FA 1MABB 2JJ2D 2M98A 1Q7CA 1FOEB 1YXMA 2MINB 2Y93A 3KQVA 1XSEA 3AH8A 3S70A 3IHTA 1OLUA 1DKRA 2BGKA 1PDWA 4U63A 4Y2TA 1K4KA 5AYVA 4EQ6A 4TM8A 4DJTA 3W5IA 5C1BA 3L8GA 2O20A 4TZ6A 1TUGA 4NZ9A 4UBIA 5J23A 1OX6A 1HTWA 2TYSB 5CNIA 3G88A 3SQMA 1UBUS 2Q6KA 4L9AA 4IP0A 4QFMA 2GK6A 1YRWA 1KEZA 4MKIA 4KPGA 4ZREA 5E1MA 5GP1A 3ZUGA 2I91A 3IEVA 1UJMA 2HKIA 1UXHA 1EDOA 4GAEA 3MILA 3W5BA 1XIVA 4KE6A 4LY6A 3C8DA 4RK5A 2HA0A 2HXYA 3IMFA 1Z0KA 3RSZA 5D1NA 1C9MA 3ETEA 4U6QA 3ZY3A 3E7DA 4E33A 4A8PA 3HWRA 4HNTA 3G9UA 1X39A 1MRZA 3GZTB 4YT5A 2Z09A 4RD3A 4NOLA 1RPJA 2RC6A 5AIAA 4YRSA 1G4AE 4IIJA 4N82A 4Y30A 3S2EA 3ZR4B 4Z1MD 1AKVA 2ZBVA 3DEFA 3QKTA 1B6TA 2HIGA 3ZD7A 2GRJA 1HBJA 1HT0A 1KP2A 2DQZA 2REOA 4V0MA 1KYYA 1GUAA 4CDGA 4EELA 4EVSA 5LFAA 2E48A 4D0RA 5JYCA 2CKDA 3DC7A 4LMBA 2W2NA 3F5FA 3R7WB 4WBNB 3CLTC 1P9NA 4KUEA 5B2ZA 4N12A 3L6DA 4HT3B 1KO7A 3AF4A 1ENYA 3BSYA 2NV6A 3KLOA 3AIOA 1I0LA 1ZJ4A 2CL6X 4OGFA 1VP3A 2WSLA 2B3TA 1OBFO 4UUPA 3M1YA 1IY0A 4R9NA 3IQWA 3Q7QA 1K6MA 2HA2A 1CUBA 5FPHA 1VE7A 3H84A 1M6NA 2C98A 2GVNA 1QYCA 1Y81A 3LUKA 1MOPA 4FZJA 1ABFA 4LBVA 2XNCA 4CLRB 4LNUB 3FUWA 4XSHA 2C8LA 5HPYB 4L7QA 2VHZA 5JWHA 3T3MB 5DISB 4XGRA 1QH9A 4BE4A 4KXWA 2C7OA 5D3ZA 2HDWA 2IWHA 4WFQA 4IDHA 2WYUA 4PLYA 1SZPA 1THMA 1SB9A 2Q3CA 3RLFA 1JV2B 4IVPA 3AT1A 4DWVA 4HGOA 1T15A 3HUFA 1H4QA 3OZAA 4LFBB 1W4AA 1XP8A 3M4ZA 1QRSA 1EX7A 4OMFG 3TG2A 1FBNA 2P91A 3EDRA 5KO2A 2PH1A 4DGQA 1EFHA 4JI4B 1EFUA 5LCXA 1XZHA 2Y71A 3R5HA 1SBTA 1XZBA 1YZLA 5JDCC 4AMZA 3EXG2 3FPGA 1GJRA 2J9GA 3CGGA 4ER7A 4ABYA 2Q4RA 2BFEA 2CUNA 4FFLA 1TK9A 1WBJB 4IIBA 4A8JC 2YY6A 1PZFA 2PKCA 4GGMX 4CGYA 5AXDA 3P20A 2D1YA 3WFIA 4NAVA 1R8JA 1V5FA 2IUFA 2YVAA 5IFKA 3L8FA 2BF4A 1WMEA 3M5WA 2P0YA 3AOEA 4FN5A 4YP1A 2ZBEA 3BRCA 4DXHA 1BG6A 4H9GA 4J0HA 3CN9A 4N3NA 5G0VA 1UMDB 3KEOA 3CW9A 3G0DA 2A8YA 1SC1A 1ECPA 5JYBA 4S1TA 1GM5A 3F8SA 3M6VA 4MRSA 3D02A 3TMAA 4KQ2A 3TTTA 1M6EX 3BDAA 5CT9A 3VSEA 3MJSA 2JJ1D 1H85A 2NSLA 3C2QA 1GHTA 4KR0A 5KPJA 3J81A 1SG6A 3DLBA 2VZEA 4WJZA 1WDMA 3HC7A 2FN7A 3DCNA 4RAQA 5EY5B 1E8DA 3KLNA 2JLVA 2EX4A 3O8OA 2FWIA 1QRRA 5D3MB 5GQSA 4EPVA 3G2NA 5KQGA 1U2SA 4CGZA 5MN4A 4FFVA 3DEZA 4YV7A 4V03A 1GPMA 2PX8A 1G7CA 3DZJA 4IH9A 1QZXA 1ISHA 4XSGA 1PR6A 4NK4A 4XFJA 5EXDA 5BMVB 4DIMA 1EJ0A 1H6AA 2OR3A 3OF3A 1VSUA 3IB6A 1GPYA 2P4UA 1MT3A 3IKTA 4E5KA 4H3HB 1XJCA 3Q8XB 4IR7A 4K46A 1IQ0A 1ONOA 2PS0A 1K5PA 2XUIA 3EVZA 3CWZA 2C7GA 3SEZA 1ND5A 3A1EA 3PK0A 4QRDA 1F51E 1ZU5A 1BS2A 4OXRA 3LUDA 5K3SA 3RJTA 5I45A 4OXYA 4UM8B 2BEVB 1RVDA 4ZYWA 4D6PA 2NUAB 4D44A 1MMFB 2POQX 3TFQA 1H6BA 5FTJA 1FA9A 1P2DA 1LDMA 3GWGA 4JH0A 3ID6C 1TKAA 3IEPA 3LQYA 3GPIA 5K2MA 1F38A 2VP4A 3V48A 5AKJA 1BJTA 5E7JA 4E12A 2GM5A 1VA4A 2VDJA 1ISJA 1VE6A 4NHOA 1OI4A 3RSCA 4CF6A 3ACCA 4M9CA 1ATZA 1T6ZA 4FHGA 4TMVA 4U9UA 1F5NA 4RSRA 3UZUA 2V0CA 2XVAA 2ZWVA 4A27A 3K5PA 5BORA 3CVWA 1I4OA 3BN3A 3GBVA 4JC4A 3R77A 1R88A 2FV8A 3TNLA 4YHHB 3FOZA 4BNHA 2B9VA 2JLUA 2G1JA 3NO4A 5E1DA 2SKDA 2HR1A 4FOPA 4M1MA 3TPCA 3CPJB 5IHPA 1A9SA 2DH5A 2FEWB 4IOMA 2P7IA 2ZIZA 3EISA 1NW4A 3E7PA 4GYWA 5FUYA 3T34A 4E7PA 4ZZ1A 3NLLA 4OK5A 1IUPA 1TF2A 3MGGA 3GGDA 2DHDA 2UZ1A 1V47A 3FOAA 1I6KA 1E6CA 1KYTA 1G5RA 4Q05A 3NDIA 3TVTA 1JE1A 4JA0A 4ARZB 3U61B 4O63O 2XB9A 2YUIA 3DVQX 2MYUA 4P7GA 4BYGA 3F2IA 3H4VA 2BZSA 3M4NA 5FOSA 1U3WA 2ATVA 3OETA 1LBSA 3K20A 4HTFA 4ID3A 4E08A 2F8TA 4EJ0A 5G4KB 3W2HA 2JFVA 4B81A 4H7JA 2JFQA 2Z2YA 3GUHA 3IV9A 2M1ZA 1JR6A 1ZHHA 3GPCA 1DKMA 4B3GA 3T5BA 1TZCA 4WY5A 4LJAA 5JFOA 1VB3A 3VU0A 2ETXA 2V54A 3TUIC 3DLTA 1NNI1 3QF4B 1V96A 1YBHA 3QXHA 3G2LA 2XNHA 2EX0A 1LRJA 2OSBA 3OQJA 3GGSA 1O03A 3BMQB 1KQPA 1MR3F 2H1HA 3UQZA 3GO4A 3H2BA 5COAA 5IT0A 3ST7A 2PZ8A 4RYDA 4BFSA 1Y80A 3A1CA 4PPGA 3EVNA 3GBSA 1XJWA 4G1EB 4C7BA 4UHJA 5EJ9A 5K6TA 3TAXA 3T1YB 4ITRC 2X8JA 3CS3A 1VL2A 3OZGA 1NVVQ 2ZI4A 3ICPA 1IG0A 3ANMA 5IDVA 3QZUA 1OLUB 3ZJYA 2ZZKA 4AG3A 5EIWA 5HSGA 3AJEA 1WU7A 5DRTA 4EQ6B 4YRKA 5ADVA 1F5SA 1QQ6A 4AKTA 3BHIA 5M2QA 3ZCVA 4KLRA 4OKSA 4B8YA 4B6FA 4YP9A 4J94A 1T9AA 2C5BA 1YMUA 4L7VA 4MVJI 5IYZF 2J7PD 3M4XA 4R1TA 4WLEA 5G1NA 4C7OA 3AR4A 5L3SA 4P54A 1XWFA 1ZL2A 3ROPA 3MTGA 2HK8A 5D86A 2WA1A 3AZOA 1QIJA 1YS7A 3K1YA 4CKXA 4DCVA 4IXTA 1NJ5A 2G0NA 4LMPA 4ZOAA 1FZTA 2G5PA 3PGJA 2O5RA 2R66A 3EEBA 1GU7A 2RCNA 3NQ41 1RBYA 5D84A 4GICA 4JBLA 5FOWA 1JA1A 1Z7EA 5DW3A 4S1PA 5BNWA 5K8UA 4M49A 1ZM2A 3GCZA 3S5JA 2EYUA 2Q6OA 2R1VA 4BWYA 4Z51A 3OFJA 3HLYA 3SFZA 1OB2A 1DC4A 2FFAA 4P2BA 3OZIA 4LE0A 4CI0B 1BXRA 3C43A 3BKWA 4P3OA 1NF3A 4IIJB 2PVPA 4I6GA 1R0CA 2ZSUA 1OTHA 1WVGA 2ORWA 2RB5A 1K7XB 1ZD1A 2LXNA 3TRFA 4KLCA 4DUGD 2ATXA 4YAKA 2GEJA 1YQQA 1T6BY 1GRRA 4IX9A 4JLOA 4COOA 1JEAA 1KJJA 1LC3A 1BRMA 3U48A 1M76A 3A6HA 1QDLB 3RVBA 4A0HA 4UNNA 1FTQA 1IB0A 1RLJA 3EGOA 2H3EA 5JG7A 3STYA 4C4YA 1FNCA 4DY4A 5JXWA 4ER0A 3OT1A 1COWD 3EAGA 4NNPA 3TR5A 3UENA 4HB2A 3DDSA 4NJMA 3WFJA 1YCGA 4YAWA 4JDUA 4BECA 1PVVA 2C78A 3RWBA 5BPHA 3CLUD 3ROXA 1NKVA 3EZNA 5C80A 1IWBB 2B35A 4QGBA 3ZZUA 1JVNA 2VLIA 2XVXA 3B5JA 3KWLA 4IZHA 5A71A 4ZRNA 4YT8A 3OMLA 1QTRA 1XVUA 4NCBA 4G1VA 1PSDA 1ZN7A 2MYNA 4K6OA 3AVYA 3QU5A 1XTJA 4ECAA 2HT1A 3LPAA 1V11A 1CYEA 2ZSDA 4WLNA 4NZMA 1ZJYA 1TW3A 2H1OA 4ARUA 1XL0A 1T9ZA 2H85A 4G97A 4TN1A 3LCVB 4FFDA 2AX4A 5J63A 1Q1BA 3PUJA 1OREA 4ZVNA 2MR6A 3PWSA 3P4YA 1Y9AA 5BUZA 5CBPA 1T5HX 1UK6A 2OEPA 1XA0A 3IAS1 1KO8A 3JW8A 3WYAA 3WRXC 4EG6A 1AE1A 3OZ7A 3K30A 4Q9KA 1ZVMA 2J3EA 2ICAA 3EDYA 4JJ8A 1XMQB 3C15C 1UEXC 2H59A 4FZRA 1GTL1 1MQ9A 2BFEB 2XA2A 3DSRA 3KWJA 2PKXA 4AWBA 2HAEA 2NQ8A 3ZD6A 2Y3IA 3VR6H 2FN9A 1GP2A 2YVUA 1SCDA 4C3VA 1SVKA 5HXAA 3QY9A 1DDGA 3I9V6 4KYUA 2EOAA 1GGVA 2GEFA 4M0FA 4GPZA 1NRIA 3C6KA 1P2SA 4HEA1 1K88A 1BVHA 2HWWA 1Z25A 1R8YA 4E94A 3B1JA 2BI8A 5AKKA 2ASEA 3ZZMA 4DIKA 1ULAA 3AJ8A 4GX5A 4MMYB 5CDFE 5IT4A 4CTNA 4NJOA 4ER3A 1JDTA 2X5NA 2PBFA 3RSHA 4ZQGA 3WBKA 5IZCA 4F45A 1URPA 2I2AA 3RM3A 3L4BA 4YR9A 2I4RA 1FUIA 3A26A 1ST2A 2HNBA 4RD4A 4Z4GA 3IDSA 4Q3AA 1RYBA 1BYIA 4GBED 4B4WA 5CEJA 4TKMA 3Q8KA 4XIGS 4LSGA 3L7LA 5FOVA 2PRKA 3R7LA 1WUIS 3W77A 4D0SA 2Q2WA 3KLBA 3O91A 3B6IA 2JFHA 3UJDA 1HO3A 1I13A 1EBFA 1Z0DA 1TMOA 1Q2XA 4FXPA 1UK7A 4K9OA 4KQFA 3RIMA 3ZDQA 3O8OB 2V58A 1O6FA 4B6PA 1A88A 4P0PB 2V7BA 4IJMA 4NKRA 5IVIA 4MVJF 2A9FA 4IY1A 4PIVA 3UK2A 2WHYA 2F48A 2VNSA 2E1RA 4BGDA 2NQ2C 2ZYHA 5E7QA 2QRGA 1XDWA 3IQXA 4B7CA 2X9LA 4ZV9A 5CA1A 5AVYA 4WNCA 3JQFC 1OR8A 3BH6A 3ACBA 5H4HA 1H6CA 2MSLA 3WK8A 2HWYA 2P1ZA 4FFRA 3ETHA 2ZRQA 3EVBA 4JBIA 3PS9A 4HYYA 3IJRA 4M76B 4Z4CA 3WGYA 1VLLA 3I92A 4O2AF 1M2HA 2IS4A 2RD2A 1LPMA 4J0GA 1UXIA 4KE7A 4IXDA 3UWKA 2JGRA 4OIMA 3EHEA 4GGOA 5CK4A 2OCKA 3AFIA 3DMFA 4Q4AA 4QULA 2R60A 2WJ3A 4QFCA 3DVLA 1O08A 1E7YA 1X0XA 3CQ9A 3E3OA 5DYNA 5L4NA 1I4EB 3JD4A 1SCIA 2GXSA 4AMGA 1FLVA 4ENSA 4LTNA 3E7FA 4MUFA 2ZJ5A 1H4VB 1MAHA 3BXGA 3CKLA 3LT5A 2V45A 4PCAA 1GNPA 3WGLA 4EHIA 4XM2A 1E0AA 1UZNA 3EA0A 1JH8A 1BMDA 1UFRA 3CLUC 3HVKA 4DY6A 5ALYA 4D9EA 2M6LA 5JCOC 2FZVA 2P6PA 4XUDA 4G0VA 3TNDA 4UATA 1BXZA 5K3OA 3FPJA 2B36A 2OAEA 1P6UA 4DV7B 3HN2A 1P0PA 3CH7A 2XNDA 2QP9X 2HPAA 3B6EA 1DFGA 5CFPA 1OQAA 1NMZA 1BTOA 1M0WA 1VYUA 2Q3JA 3VR6A 3WG9A 3LX5A 3WMXA 1ODJA 2YJNA 4WBXC 5KU7A 2GZSA 4J0FA 4YK7A 3ZLJA 4Y8VA 1I9GA 3U81A 1DUIA 3ZHQA 4WACA 1UADA 1KBQA 1CQJA 4EA9A 1TIPA 2RBGA 5GJVC 2ZWOA 1NUTA 3FMGA 1L7EA 1LSUA 4HDNA 2PWYA 1P17A 3CN7A 1K75A 1NJ6A 1ULBA 3FYTA 4YRCA 4YJGA 4XDYA 5GV8A 1E2FA 3K9HA 4HTFB 2O5EA 3PNQA 3ZIUA 1LBEA 1H3FA 1B23P 5LUAA 2AQHA 4U3JA 5ALVA 3EFEA 3DMYA 3K0CA 3R5TA 3VKGA 2F8SA 4NH4A 3KSUA 5DHFA 4PYKA 3VVCA 1H8ED 1M2JA 3U7FB 3ZVKA 3ZBTA 2AMJA 3PC8A 5JFGA 1O5OA 3CF4G 3W79A 4F5DA 4M1EA 3CW8X 3F5QA 1E64A 2DBZA 3LGSA 2V5UA 4HGPA 4LVUA 3TZEA 1I30A 1I3KA 1KYWA 4K87A 3SHVA 2D7CA 1P2VA 3C3PA 4IHKA 4GEKA 4MRPA 3AKCA 4OYHA 3ZV6A 1QNFA 2QOEA 3LQQA 3S4YA 3QEMA 1HORA 2GILA 3WS7A 3A9WA 3LW7A 1E2GA 1P9RA 2W4QA 2ZRPA 1IRXA 5AHRA 1YFKA 4TQGA 2BEWA 4PE5B 3W4KA 1NX6A 2IDMA 4BO0A 4QQKA 5LQDA 1YUNA 1QO9A 3H6HA 1Z6PA 1O5IA 4HDMA 3HCFA 2DPXA 2OT3B 5T7BA 1QP0A 1BQ3A 1I6MA 3FJOA 4X1KB 2X8JB 4C43A 4H7DA 3N0TA 2CXNA 3K73O 2FSVA 4YLGA 3AI7A 4ZOLF 5ALIA 4OJNA 2NPFA 2HB6A 4IJUA 1GAXA 1UIRA 3IUMA 4HYEA 3DMRA 2B1GA 2ZJ4A 3ITNA 4G24A 2ZBQA 5JJCA 1PJZA 3I6MA 3VJKA 5EJEA 4HWOA 1J39A 1SPBS 4XR9A 4H3SA 1P61B 4KXYA 5C7IO 5L3SB 2WHXA 5EMLA 4Y6OA 3THXA 4O3MA 1KMIY 3C4JA 4KNWA 2RGXA 2XRYA 1KEVA 1ZFNA 2YWFA 5AKYA 1ESNA 1QYVA 1PD1A 1MO4A 3TRKA 1T25A 3F9IA 4IJQA 4TSFD 2V6MA 4LHEA 2C1EA 4PZ9A 1KA9H 3LBHA 4NMWA 3ZX5A 1Y37A 4YRNA 1CQWA 2XYQA 1R9MA 5BSWA 4S04A 2R1VB 2EJBA 3JYHA 3ZJ4A 4FYIA 3CE9A 1BXRB 3DDZX 1SZJG 1LBIA 1SKYB 3BIJA 1GCGA 4JLDA 3T12A 1C80A 3A6KA 4J7CA 4ME6A 5BWCA 1N6IA 1T2DA 1A27A 1Z4QA 3DC2A 3SK0A 3UN1A 5DIZA 3V8PA 4I1UA 5LDGA 3FTEA 4UPDA 4E5SA 4RZ3A 3K16A 1DRVA 5AVKA 5HM8A 1FYWA 3F9CA 1P31A 3PGXA 4P33A 1P4HA 3NHKA 3OT1B 4R9UC 1IHDA 3O83A 3SBXA 2R4QA 4I8DA 1WMAA 3C6ZA 4FBGA 1DX9A 4NJMB 3W2FA 3ZHXA 2BBWA 3KPUA 4B3IA 1VJ0A 4JVOA 5EHZA 3TL6A 4L72A 3O7WA 2PANA 4FP9A 2VBIA 1UINA 1MEJA 4MUNA 5KC8A 4WLUA 1PQYA 4B33A 2RKWA 5JS1A 1OE0A 4H4EA 4E5MA 1NQTA 3D2CA 3MNFA 3DZCA 4PPQA 5DCUA 4Q7MB 4JP2A 4N0PA 2OZKA 1D6MA 3DVSX 1QV9A 2QF7A 3VQTA 3ZJUA 5KI6A 4EHNA 1L0BA 1R5JA 3DR3A 3Q8WA 5KTPA 5AW4A 2VHYA 2CNBA 4GMXA 1M8PA 3OM9A 1KZ6A 3PQFA 3WGOA 3RADC 1F6WA 2FHPA 4NBVA 1Y34E 2VPWA 2MSDB 3BK1A 1E94E 3D7RA 9ABPA 4GBGA 2YQ4A 2P62A 4MMZB 2HI0A 2MJLA 2PZLA 4BRWA 2V7WA 4G56A 2I3BA 1RI4A 3PFNA 1RCTE 1U0JA 4JR0A 3U3MA 5CBPB 2OHFA 3VR5H 4L3VA 1XROA 2C4TA 1NI3A 2B37A 1KVRA 2NACA 4KPEC 3H1TA 2OUKA 3DZIA 1FPQA 2AJ8A 4DNOA 2W83A 5ALMA 1L5YA 1MB4A 1J1UA 3WWDA 5HKOA 2KB0A 3B1ZA 2PUGA 4DM7A 1SFRA 3COVA 4IICA 1CR4A 3PXXA 4P8RA 3OM1A 4KQKA 2D2EA 2SCUA 4U6NA 3VR2A 4GO1A 1EGAA 2PGDA 1T26A 3EVTA 5BV2P 3WO1A 1WXEA 3MOSA 2V9PA 1YL7A 4G84A 1RTTA 3RAPR 2XDQB 4UU7A 3D0QA 1SNYA 3OCCA 4EPXA 2IOYA 1DTWA 2QLMA 4II2A 6Q21A 1G38A 3DBRA 4BNKA 2OLJA 5GIPE 1KJNA 3JR3A 2WIFA 1EFTA 1Z7BA 2BKEA 4AZWA 4CR7A 3WYEA 2QMOA 3GA5A 1EQUA 3PGMA 1KSHA 2VRWA 1A04A 1GSHA 1XAJA 1UDRA 3E82A 1L5ZA 4MW7A 2UZAA 1R5NA 1VJCA 2Q0QA 3ZU5A 5HTOA 1CTQA 3ILSA 3TLJA 3DT9A 2PO7A 2B2XA 3R7AA 4KUGA 5AVTA 3HP4A 2OXCA 1USGA 4L4XA 3UFXA 3Q7EA 3L6EA 3JQQA 4BIMA 2C82A 2ZJBA 5CHYA 5DXAA 1OH6A 4CM9A 1Q6YA 1PZGA 3PA8A 2XT9A 1GNSA 2GZRA 4OB8A 1UBJS 1GZ4A 2EJCA 1Z34A 1Y9ZA 3IMGA 2QW8A 3G8DA 5IH3A 1ONSA 5CA1B 4PWZA 3ZIAA 1MG0A 5D2CA 4B7UA 2ZUUA 2G4CA 2AD1A 4NBUA 3HCPA 4YRQA 3RJZA 2DQSA 2LDBA 2BJHA 2ZK7A 4Y9UA 5EE5B 1B6SA 4AJ9A 4YYZA 3QU9A 4R9RA 1ECBA 2P0EA 2NO9A 3PQ8A 3EWAA 1U80A 2G1AA 4ZK6A 2PX6A 4YPOA 4NQRA 3T9EA 2WJJA 1DTSA 2X15A 1GAEO 4J0CA 1XPOA 2XOEA 3NYWA 1CUSA 2VF2A 2YNMA 5B57C 2R79A 1J21A 4Q4AB 5I6DA 5JDIC 3UJHA 4JLNA 1XZ8A 2XTAA 3ASUA 2QRLA 1PU2A 1ISIA 4YUWA 5KAMA 1PQPA 3GWZA 4X61A 3RU3A 1QZTA 5BN4A 4RTLA 1PV4A 1QP4A 1SZDA 3FWYA 4GZ3A 2I1WA 3MXOA 2CXRA 3PC7A 1CJBA 5EXEA 3VR5A 4OYYA 1Q0TA 3O6VA 3M6FA 3PFFA 4L51A 4UPEA 2IXTA 5ERGB 3QE4A 1KAEA 2HJSA 1U6JA 3CGWA 3UK6A 5SZKB 2XXAA 3C97A 4UKDA 1B0AA 5EIOA 4CV2A 4KACA 1DG9A 2OO5C 3DL0A 3T0IA 1UT6A 4TT3A 2D1FA 1E7RA 4AJJA 4LF4B 1DT5A 2BMAA 1EVIA 4N49A 1NVWQ 4U0JA 1L5NA 1W0KA 1E1RA 3E23A 2QTVA 3KEGA 2V9ZA 1HFWA 1JE0A 1CQJB 2V7QA 4RETA 4A0QA 1C8LA 3DQQA 2OUIA 5AXBA 1PFKA 1RYEA 2P41A 4HDNB 4A6XA 2HQOA 4JUIA 4ZP1A 4LC1A 2ZB4A 4FDLA 5DBFA 5K2OA 2ECKA 4YJGB 4MW1A 5ALLA 3VISA 3ZKWA 1QX3A 1UF9A 2Z95A 1RKUA 3PRYA 3CNEA 2DHCA 3PWTA 1WVMA 3ZI0A 4DEXA 1F1BA 4LV6A 4U3JB 2BJVA 2FZ5A 3IX7A 1JHRA 3BTVA 4OREX 2VHXA 2OYRA 3KXKA 4MI6A 4KFUA 1YUMA 1XMSA 4I2NA 1WQ3A 4KWHA 1Z4MA 1PI3A 3HUTA 2HZBA 4QUHA 2I99A 4ROSA 5ENDA 3FYHA 4C3OB 1KEKA 1M75A 1PGOA 5B64A 2R7KA 4XQGA 4G6ZA 2AJCA 4PC2A 4HDSA 4ZAGA 4BO8A 3KQOA 1OLXA 1YZFA 3AO0B 2Q5IA 4L6AA 4MQ4A 1SXJA 4BNZA 3LAWA 3QEMB 1AQUA 2VXOA 2Z9BA 4IV0A 1H2WA 3DBIA 1TU3A 1Y9DA 3NT4A 3O93A 2BEWB 3CNBA 5DGHA 4K1XA 3H5RA 4JU8A 5G0SA 1YJXA 2ODAA 1SVMA 1XZPA 2WJIA 3F7NA 2JGKA 4PSKA 4U02A 4UMFA 3L7MA 1WLYA 3GUZA 4HDMB 4MEAA 1E6KA 1T8PA 2QVZX 4CM5A 3L7YA 3UJ3X 3IUEA 1U4OA 5GWXA 3ZK9A 1W30A 1NDQA 5FF9A 5DTMA 4R3UC 2AZXA 3NBAA 2VQSA 3JZAA 3KHUA 1XNHA 3QVLA 4IWNA 2Q4OA 2OGUA 3FNFA 1U0TA 4TXJA 3DEJA 3MWEB 1YR1A 4RTKA 2PZGA 4O4LF 3OO1A 4AJEA 3H9JA 1EEXB 1TTQB 3TRJA 4J0IA 4UAVA 2PUFA 1ID8A 1BH6A 1QS0B 2GN0A 4BCBA 5ALDA 4UZEA 4II3A 3NALA 3C8HA 3THXB 3IALA 3JQAD 1M2VA 1ZL0A 4I9UA 4B46A 4L07A 1PDVA 3WLIA 1IZYA 4JX9A 4R9SA 1RWPA 3MFQA 3Q6NA 3ZLVA 2JVKA 2B6HA 1RZVA 1MAUA 2Y4NA 1TAQA 4J49A 1FNDA 3HRKA 3R3SA 4ZZ2A 3WISA 4KYIB 4LHXA 2VHVA 3E5NA 3OCZA 4FFSA 3UF0A 4DR3B 2H4ZA 2WJAA 1F17A 2IODA 3KD3A 5DBIA 5B3JC 5JAPA 3B8EA 4Q1EA 1GQOA 5D87A 3PX2A 3U2QA 3M5CA 1RLOA 2IIQA 1GKKA 3T54A 2QSJA 3PHBE 5GJBA 1L8XA 2XNJA 3I39X 3TG8A 2V7GA 2ZIAA 4PS1A 2CL0X 4QXPA 3BF8A 4NBNA 1S8NA 4WK6A 1H3NA 4YCAA 2Z04A 4ZI7F 2WIJA 3NKFA 3QE3A 3TAUA 3WY9A 2ANBA 1ZC3A 3I8SA 3CB2A 4XARA 2OFFA 4B6SA 2VBGA 3EF1A 1TAGA 3AUKA 5ERYA 3WKAA 3O90A 1R66A 2J9XB 1BDBA 1JDUA 3GDFA 4IZIA 1VBMA 3I04A 3KZKA 4EO9A 1QX4A 3SNKA 4D0NA 4R5MA 1GZDA 4FPXA 4KN5A 3KJHA 4MV4A 3ADCA 1XPRA 1RABA 2GBGA 1OWMA 4QAJA 5F33A 4KYTA 1XLTC 2VTDA 4GOLD 2YZ2A 3L6BA 4ODIA 4EIWA 4LF5B 1UKAA 2Q5JA 1WBBA 1ZVQA 2X41A 1K6EA 4J0KA 3LKBA 1M67A 5KOYA 4AUKA 2DUNA 4C6RA 2D1RA 1N2XA 2DF8A 1NONA 3VU9A 2WNSA 3H7IA 4B3FX 4EHLA 4HXFB 1OXSC 4YLEA 4I3HA 3E9YA 4DMCA 2C8JA 1FP4A 3KSMA 3P19A 4YS6A 3ZVMA 4AS3A 3GT7A 4LJ6A 5BWMA 2W2VA 1J5PA 1EB9A 1QH0A 1MJGA 2AWNA 2EZ4A 3AUXA 4YBRA 4E30A 4OSOA 4BFTA 4UNRA 1YQXA 4YCSA 6AT1A 2BM9A 2IUYA 3HO8A 4X91A 1IHUA 2YRFA 2GKSA 2B4AA 4DG8A 5THQA 1UBSB 3RSOA 2XE4A 1M3SA 3GHHA 1Z18A 1WCXA 4TV9F 2CVQA 1MIHA 4AZ0A 1M6VA 4R05A 2C4VA 3LX4A 1PD0A 4G85A 5TGZA 3V4PB 4D4LA 4ZT3A 4JBNA 3O4RA 1BCSA 1WQ1R 3YASA 1GG8A 3WKDA 4UUBA 3U6KA 2X2FA 1NVGA 4HD8A 4GIBA 4QOIA 4XFDA 1HX7A 1V7ZA 4MYRA 1SQSA 4ZMBA 2SCUB 3W8EA 1ECLA 2PFSA 2ZBRA 4Q16A 4C0KA 2BIFA 3BZUA 1CUVA 1IJKA 1DOZA 1LRKA 2NO6A 2PFGA 3GB9A 4L8FA 3UJCA 1ISRA 4GLLA 4DA4A 2CVFA 2FG7C 2ZXFA 2D5CA 3WB0A 4BDTA 1DTWB 1P4AA 1G3MA 3CWCA 3DBRB 2XGJA 3L8ZA 3V6MA 1R4NA 2YN0A 1K3TA 1Z2EA 3NASA 3UJPA 2JLCA 3BE8A 3P45A 3RGWS 5A3RA 1DAGA 1GZSA 3U60B 2NW6A 2ZRGA 4RPLA 1XCBA 1MDFA 4R6WA 2OWDA 1G9SA 3NRJA 1Z8FA 2XJ4A 2VA8A 4CR6A 3E9DA 5DRYA 1PS0A 2R11A 2H48A 1VRVA 2QLTA 4LDRA 5TF0A 3SFTA 3TINA 3UMRA 1W87A 5K8LA 2NNWB 1Z17A 1CDOA 1WCV1 3DFFA 4GLOA 3H4MA 3BQMB 4NYJQ 3UFXB 3E5RA 1APBA 3L0BA 4I4NA 4D9KA 4LF6B 5F98A 4RY8A 2X3UA 3AZPA 3S68A 1Q1QA 1QIMA 1DKNA 1YRAA 2ACWA 3HGTA 1G5FA 1ELOA 1NT2A 3IP9A 3OOJA 4OHKA 4UEQA 3UMFA 5KOJA 4GKJB 1NV9A 3DVRX 1HSOA 4CUKA 2ILVA 4EMSA 5HCUA 3QBVA 4MEBA 4X93A 1IOLA 2DT5A 4FUQA 5TGTA 3MZ0A 1KI7A 1NW3A 3NHSA 2IU4A 3DV0A 4BAZA 3QVWA 1K8QA 2W5UA 2PNJA 1ZUD1 4H16A 3RRNA 2P6MA 1OTXA 2DWOA 2WV9A 4LF8B 1H9CA 4BBAA 1A7JA 2GAAA 4J1TA 1X6VA 2LE0A 2BKVA 2GPNA 4JJGA 1YRLA 1HDOA 2AYZA 1FMLA 2IKSA 3WB9A 4EO7A 1IUKA 3RC2A 4YRIA 4KP7A 4W5QA 2JIDA 4OK3A 3TL2A 4B17A 5JOQA 3ZS9A 2CV2A 2E5LB 4LCBA 2Q0XA 3E2IA 1IY1A 3R6WA 2VNAA 1B42A 1FDTA 4MINA 5IJAA 2A0YA 2VATA 3ZLTA 1N0IA 3A4TA 2H07A 3N2KA 3ZE7A 5BN4B 4GVLA 1CDDA 4BEWA 1NVBA 1XX6A 3CEMA 4NXNB 5FLKA 2VQEB 3OHMA 1MVLA 1PKEA 2D2XA 4I19A 1E3SA 4RPGA 2ZIXA 1JI3A 4DMMA 4EPYA 3L0IB 4CTOA 4YV0A 2BMWA 4PPYA 5KNCH 5FLXA 1ECJA 4BDSA 2XXAB 2O8DA 5AICA 2AA3A 3LXUX 1E79A 3P2JA 5AJZA 3UOWA 1KH3A 2IU3A 2H18A 1U7DA 2M1XA 3HHPA 2HPVA 3R3VA 4OYLA 3AJAA 3H19A 5ELXA 3NETA 2QPOA 2R4UA 3E2MA 4Q1FA 5JANA 1Z5UA 2VHJA 3SHTA 2CJFA 2QTVB 3DEKA 4L8WB 4L8YA 5D6NA 1L4BA 4WDQA 3O8LA 3H7AA 3R4CA 4WQMA 5D6OA 4YMTA 1HK7A 4JLAA 2ADMA 1D04A 3QUQA 2ZRMA 4V0RA 2X0FA 1RM4A 2PUWA 4KVGA 1T4DA 4O5OA 4XYMA 3GK3A 4LCJA 3CG4A 3ZKWB 1IN4A 4EKGA 1AMOA 3O9VA 4M89A 1MUUA 3GJZA 4Z5XA 1SBYA 2ADFA 1N5MA 2OMKA 5AM3A 2PBZA 3L4EA 1YR6A 4LZWA 4UM5A 1GAWA 1EVQA 2G4VA 2N75A 1QAMA 2V98A 2PL5A 2J0EA 5CDUA 3CUYA 3NGLA 5A4IS 4EATA 2AZMA 3OQNA 4WNYA 1D4OA 3B89A 5C31A 4RHEA 4C0BA 4R1NA 4JOBA 1Y33E 5DYWA 4PX9A 3FCSB 4HDSB 3O0DA 2FGKA 1OLXB 2ACKA 4IDGA 1SXJB 5JO0A 1XVIA 2JKYA 1D6JA 1GTJ1 4QOHA 4A03A 2BI7A 1AUVA 2OXEA 1ZK2A 1DUVG 2B4YA 1KR5A 4H4DA 4ZMSA 3ESRA 4YMSA 2OHOA 2Y1CA 4H31A 2DETA 4OAOA 1NUQA 3GZNA 4W6QA 2R8OA 4QYXA 3GG9A 4JLWA 3GP5A 5HMMA 4L5CA 3RT7A 1PYDA 2Q3FA 3AILA 3QPUA 4RUKA 2OORA 4MHOA 1QP7A 3OAAD 1Q12A 1K92A 2AFIE 4GG1A 4MGKR 1M6YA 1UR5A 1F4VA 1C1YA 2PRZA 1W59A 3ND7A 1GLNA 3OOEA 1IBLB 2O6HA 5F5XA 4JXXA 3EMBA 4AU1A 4C9BA 1AQNA 1X19A 3QNUA 1VECA 2AS0A 1WULS 4CFYA 1EP2B 5SZIA 4FE7A 4EYOA 3LOPA 1E3DA 1MT0A 1I5EA 2OCPA 4UUMA 3IMKA 1M2VB 1ZIDA 3PNYA 4V0SA 3A9RA 1YQWA 5PNTA 4KGVA 4GMFA 7REQA 3A28A 1JL3A 3Q7TA 4X5OA 2IGBA 4BFWA 1RPAA 3ZDBA 1XFAA 4IEFB 3V1TC 1ZH6A 4G23A 3WDSA 5KNCA 4W5JA 1LV8A 3HU1A 3OEWA 1YQDA 2CD9A 2DOKA 4NEGA 4NK5A 4XPIA 3BIXA 1K2WA 2DMRA 2XHZA 2WFLA 4JU9A 4OJMX 4XB6B 5C1DA 3JY6A 1R0WA 5HW0A 2XQVA 2E21A 1ZDMA 3S2IA 3GVIA 4R69A 2D0OB 2DFKB 3V4RA 4QXMA 4AKIA 2ZTSA 4CFSA 5FR2A 1Q19A 2QG4A 1QWOA 1S0UA 4LCEA 2BZ1A 3QKWA 5CXQA 1RXIA 1YVRA 5AKLA 4PRKA 4ZOEA 1OX4A 3U49A 5SY6A 3P2YA 4LBWA 3LWBA 2ZTUA 4DHEA 1M8GA 2PZKA 4RA9A 3LDAA 3T3PB 1HDGO 1U9ZA 2FRXA 4G4SO 1UJ2A 2CB9A 3AHHA 5I7FA 3GP8A 1D1PA 3BPSA 1L7VC 2XCIA 2E6KA 5ICCA 5IT9A 1XZCA 3EULA 1CRPA 2Q8QA 3I6BA 5E6SA 2IZ1A 4D57A 4C1NA 1X1TA 3ENNA 4D4JA 2QYTA 3AKYA 3AIMA 4K6KA 3F3SA 5DHUA 3ZWAA 3GEEA 3HYRA 3CJTA 3C45A 2FUG6 3E35A 3A6JA 2BGRA 5E2BA 5JLAA 3VU9B 3D6UA 3JX9A 1XZIA 4NICA 1NJ2A 3TSYA 5KNBH 1WW2A 3DNFA 2ZE7A 1FP4B 3VPFA 1TA0A 2Z4RA 4BU1A 4YO7A 5F76A 5FWYA 1J25A 2V6IA 3CSSA 3UPDA 4BP9A 2IUTA 1ZXLA 2B78A 3RBXA 3G1TA 1FSGA 3NIFB 2F62A 3RAEC 1KYVA 3OJEA 4L5IA 2UYOA 1W36D 1K9SA 4C78A 2RGNC 2VJLA 3FB4A 2XX3A 4IUDS 4MAFA 1W94A 3I1YA 2OG2A 4GR9A 5GONF 3HL0A 4M46A 3ZHOA 1RLTA 2XYGA 4KOAA 4QUBA 2YDYA 4AZ0B 4WEQA 3N5KA 3VV3A 1M6VB 1VIDA 1AIPA 1ODCA 2QNIA 1ISPA 2ZJAA 1GNRA 2JD2A 3IQDB 4QBHA 4EFLA 1FFWA 4ZDIA 5JBNA 1BCSB 4RKEA 2DLCX 4OSPA 4W7IA 4AUNA 3ISTA 1NBIA 2GZ1A 2XLCA 2LD4A 3JZIA 4TLMB 2F4VB 3BVPA 4JR1A 4IDNA 3EYWA 2UZ0A 1LF5A 4O3FA 1NHWA 3DAFA 2CXXA 1ZH4A 2JHFA 3INYA 3G13A 4BV3A 1FK8A 3EH1A 3MJHA 1EXMA 3OZEA 4V24A 5AJUA 5DX0A 1RAGA 4BPRA 4D3DA 4ENRA 2QTFA 3UBTA 1MAVA 1IDOA 2OQIA 1NP7A 1L8AA 4B47A 3R2JA 1YKSA 4X54A 2K7ZA 1R4NB 4OO3A 3PUXA 5GZ6A 5JNLA 2NAPA 3Q11A 1KZHA 3LY9A 1VBFA 2POCA 2VSYA 2XTZA 4HWKA 2IU0A 1XV5A 3I72A 3C3BA 3G9ZA 3P0RA 4GI3A 2UKDA 4IM7A 1Y4AE 3INTA 2XODA 2R00A 1EIWA 3L01A 2BDEA 4LGVA 2VYQA 2CVOA 3EDOA 3BJMA 3EGDA 3I3SR 4C21A 4CCWA 7MHTA 2UZ3A 1L4GA 1ZJ6A 1DU4A 2QU8A 3PUIA 3B70A 2NZ8A 5D00A 2EG9A 1EFRD 2CY0A 3TXAA 2VJOA 1EAYA 4QDXA 4RJTA 1NUSA 1MJHA 3BFKA 2HMAA 4EY4A 4INZA 3C0KA 4IHQA 2C2YA 3FCAA 4E03A 5CIYA 5LPNA 2H5LA 1R6UA 4PSDA 1QIFA 2Y1KA 1EWRA 3MQ2A 3TXYA 1SC3A 3SHQA 5KOJB 4UOQA 3ADDA 1H3EA 3G7SA 2Y1EA 1VMAA 2ZJFA 3WLNA 3J80A 1KVTA 1VPVA 3QLVC 1L4MA 3PUZA 2CMFA 4JVNA 2UDPA 4OHPA 1PGJA 2H31A 3I9JA 3OOHA 4OMDA 4WOBA 1Y5LA 2A94A 2P2YA 3DV0B 1JXOA 1U1FA 4HGNA 4WINA 1GOTA 1ZH8A 1BEUB 3A4IA 3GQVA 1LZLA 2B8TA 2BGJA 1WU8A 5DBEX 3ZY4A 2KLHA 1CJKC 2Y1OA 1TXGA 3HXTA 4CU2A 5KNBA 3WAJA 4KFTA 2HIAA 4QPCA 4QBGB 2IWRA 4TVKA 3BILA 2HA4A 1H1DA 1WZNA 3WGGA 2KX7A 4EZIA 2WFAA 4GSKA 4I5EA 5AUPB 5AM4A 3NHRA 1Y63A 1OKKD 4MTCA 2Q1SA 5LIPA 3ZBUA 3K53A 4HI0E 4ITVA 3N2KB 3WYNA 4LJLA 1FNMA 1KK1A 1K98A 4UCFA 2PL9A 3ZJVA 2IQIA 2H2FA 4BATA 3QGMA 1L6RA 4U7TB 4QRIA 3W2EA 4JVSB 4N6GA 5FWAA 3C1UA 1QIIA 3OM8A 2PGAA 2ZIXB 6ABPA 2ERCA 4CKEA 1YZTA 1AURA 1P2FA 1V8DA 4OHVA 4YJDA 1L7OA 5DT2A 1AKQA 4PSAA 4D3YA 4FZVA 3I62A 2OD2A 2IYEA 2QMUA 4G8DA 4GNRA 2WKRA 5CVCA 5EMNA 3PGKA 2HH9A 5LP6C 3SC2A 5AXAA 1E6MA 1OH7A 4EKNB 1VYVA 1M34E 2X77A 3B2QA 3ESYA 3LOUA 5CCBA 3VJLA 1XMOB 1YF3A 3FG9A 3NWEA 4JBYA 4DC9A 1NNSA 4FSDA 4UEWA 3PQ7A 1CF4A 2AOWA 5L3VA 2TMDA 2IYXA 1QFMA 4JUFA 2JAPA 3EF0A 5B4VA 1PQWA 2CBXA 3GOQA 1Z82A 4FHZA 4Q3CA 3VHLB 5I51A 5C51B 2FNAA 1NW6A 4R8KA 2IH5A 1XZGA 2FWJA 3GEBA 3MCTA 5KTMA 4FIZA 5AVVA 2IZ6A 5JAOA 5BMOA 5DSXA 2GYUA 1C9KA 2R8RA 3U7JA 4JQYA 3R40A 2J0QA 3D3KA 3M1LA 3QM1A 3QJYA 3QV1A 4J7AA 4HQOA 1A50B 4MPTA 1GCIA 5BT9A 2JFYA 4GUDA 3W8RA 3CA8A 3Q87B 2D2FA 4N7RA 4C14A 3TUZC 2VP5A 3OIUA 4PCVA 2PQMA 4GF5A 3L0YA 3PXUA 3ZYCA 4CIBA 3GZNB 2C3UA 1UH5A 3JQRA 3QQ5A 3K5WA 1XOIA 1PSZA 2W6JA 4L0DA 2MT9A 2HFJA 1ZOPA 4BQPA 2C8VA 3NEAA 1RC0A 3BK7A 1NVTA 2O6LA 1ZIXA 2ESRA 2QHXA 4O1HA 2IXGA 2ZI9A 2BHRA 2Q29A 4AS2A 2P2ZA 4LYGA 2EV9A 1ZJWA 4FDUA 5M34A 1G8MA 2J5QA 5KHAA 2CLOB 1DINA 2RB4A 4ZTUB 1LTKA 4M8NE 4XVCA 2QVGA 2F3TA 4KUHA 4RMNA 4C4ZA 1ISSA 5UKDA 3RIEA 1HRKA 1KMMA 2DPGA 2GAJA 3PRKE 4ZD6A 1R6BX 4B8WA 2Q6TA 4OLAA 4W5OA 4IXNA 2PH7A 4RV9A 3CH6A 3ZDYB 4E88A 1GKIA 3GD5A 4NBKA 3ABRB 1R0ZA 5C18A 5DW0A 7REQB 3BD8A 2GN8A 1HYGA 1QKKA 2HSWA 2QG6A 4E5NA 3BGDA 1RWBA 1KI2A 4KIJA 2OXTA 3IOEA 1XTUA 5WRFA 4UFOA 1XZEA 1SGWA 2XMPA 3WL7A 2QEQA 4EJMA 3W6OA 3NH6A 4XPIB 1Y7LA 2ZDHA 3ZGYA 4JI0B 2WFLB 4BHTA 3ZGNA 2XMGA 2PV7A 3B48A 3LXMA 1HUQA 3HPQA 2XMQA 3M6LA 4KXLA 4UFNA 2IHJA 1QE3A 2RGGA 4EG1A 4CIAA 2CF5A 1IVNA 1IBCA 2VF4X 3OJLA 3N8IA 5AI9A 3H17A 2J5KA 1OX4B 2HYIC 3PUKA 5FHRA 1TZMA 4Y1EA 3A70A 5I9TA 3B9RA 4EG0A 2JGAA 4W9RA 2JDID 3V8QA 4RA9B 4PAGA 1VRWA 1WD5A 2EHDA 3IPYA 1NLUA 2R7NA 3E70C 5FTNA 2QLFA 5I9BA 1JZTA 1G21E 4I4LA 5E6SB 4C07A 1PNQA 3JSXA 2NTVA 3NR2A 2E89A 1TYZA 1K0FA 4FYYA 1SBQA 1DQSA 4N0MA 5LUBA 2WD9A 2GTPA 1DAMA 1QG2A 2WDPA 1D1SA 4J1SA 5TR9A 3GNSA 1ZNWA 4YYEA 5DNEA 5H4GA 3ET4A 4UARA 3ZEAA 3FLMA 4L75A 3QOXA 3PENA 4UBOA 1GFZA 2WKPA 3OIVA 4QPNA 5FWYB 4CTJA 1L3BA 3B3FA 5C35A 3QLJA 4BNJA 2WHRA 3QKUA 3GLUA 2QTRA 3QUAA 5JC1A 5ECGC 4BVAA 1BX0A 3AB3A 3ADBA 1R27A 2AOUA 4KQ9A 1CXZA 4IG4A 3C5VA 3NH9A 5B7NA 2HRRA 5DN9A 4PYRA 4ZKEA 4MDFA 4OQFA 1KI6A 3MJEA 3HI4A 4LOLA 4O2RA 2C0PA 1FFBA 3DH0A 3JQBA 4B4VA 3UMYA 2QD3A 4ZCPA 2XD9A 4JC0A 5HOQA 4BQSA 2OAP1 1E3WA 3QXCA 2D7DA 3ILHA 1EP1B 4MARA 3U3XA 1UBOS 1JHDA 2ZVDA 1ZGZA 2FFBA 4J16C 1LLFA 3ILYA 4MJ3A 3WZ2A 1NXVA 2BGNA 1FNNA 3AV0B 4OG2A 2ZU6A 3VU1A 3SXUA 3WRVA 1DEHA 1KDRA 5BN1A 5I7VA 3WKEA 1SUCA 2BKXA 4RF3A 3GUVA 4QO8A 1KEWA 3QWIA 1QLJA 1T5DX 1PVDA 4MVJD 1VMKA 5IKMA 3N2NA 2C8KA 2CNWD 4U2FA 4I8XA 1U3GA 3T3GA 2XMZA 3ZBQA 4X62B 1VJDA 4GPTA 1HEUA 1XI2A 2LCFA 3D2LA 3EGDB 3OO0A 1XVVA 5LXTA 2QAGA 3H2KA 2SHKA 3EEOA 4O2LA 3IKMB 1M6WA 4F3KA 4QSMA 1OXUA 1KI9A 5E9JA 2ZUEA 1UXGA 2IYNA 3WA6A 4TUYA 4RQBA 1F4PA 1OYVA 2L82A 5GPBA 5JHHB 4K6CA 3G1UA 1ORRA 5DGDA 4NBSA 5LZ8A 4BCCA 1I1NA 5CW1A 2ZB7A 2WWFA 4JL6A 1QCYA 3CRNA 4RKQA 1HGXA 1ZVKA 4Q5IA 3CVOA 2DFNA 4R6XA 1JQBA 5JXJA 1ZH2A 3R7FA 3PGA1 1CF9A 2O2ZA 4NECA 4OQYA 3I0NA 4MAMA 3KB2A 4HXYA 5TS2A 3PLNA 3QIAA 5AOVA 3WZMA 2QX9A 4JODA 1TTHA 1F4LA 1N25A 1VI2A 3TD2A 2X5JO 1V71A 1JJ7A 4HB0A 1C0LA 2P5YA 3G2KA 4QODA 3CLRC 3R3ZA 1V9SA 5ALHA 2VJNA 3KRTA 4GX0A 4KWTA 1NWHA 2RC5A 1IBSA 4DMHA 1HRDA 3LUJA 4RDIA 4RABA 5K4AA 3THOA 1NLMA 4W1QA 2Q1WA 3BXPA 4B1FA 1PR0A 2ZRDA 3TQOA 1YAHA 3OESA 1SM4A 4O08A 2EU8A 5AI5A 1P3JA 1CUZA 4HDRA 4LN1A 3UMVA 1W6RA 1M66A 3U7HB 2C3YA 2ZTVA 3R74A 1BN7A 1U0HC 3LC7O 4Q1BA 1MIOA 3NVKI 3T4PA 4CKEB 4G07A 2I4TA 4V0KA 4BNFA 3BF7A 3DCIA 1IC6A 5IM4A 4QTXA 1RPZA 3H8SA 3L4SO 4PLWA 2CZQA 2GSWA 4TTJA 3QOYA 9MHTA 5B5SA 2HXSA 3Q3IA 2A33A 4GI7A 4QXRA 1T3LA 1DUSA 4BN4A 1N33B 1GD1O 2YTZA 3SC2B 3AUFA 4PO8A 3AGQA 3ONEA 2QQ0A 5IBPA 4F04A 3N86A 1IULA 2EC5A 1P1KA 4CMKA 1R18A 2EBUA 4CL8A 1EJ2A 5B1SA 3ZWMA 1OFGA 1MH1A 2FKNA 3NBYC 4P1ZA 3RT1A 4JV5B 1OFVA 3CUUA 5DPMA 1DQNA 3ZBPA 5L4SA 4H27A 2G70A 1DWPA 1ZVJA 1PBNA 4BGUA 3FMIA 4GPAA 4LWPA 5CT4A 2PJRA 3D4NA 1WKBA 1GPKA 1YKFA 2IOFK 3CPEA 5AM2A 2A0KA 3AY6A 1HNXB 4FOTA 4LXQA 1SUAA 5AK3A 1YU9A 3FETA 4ZXPA 5A0FA 3W9BA 4B74A 3WX0A 4D41A 3LX8A 8MHTA 3BA1A 4E22A 4PLVA 2NV2B 3B9BA 3EVAA 4YMIA 5AOAA 4TTAA 5AKIA 5AKXA 4HYQA 5SICE 3UMGA 4N76A 1FJGB 3OUTA 1S9HA 1E1QA 1KARA 2GCOA 4ILKA 4TYMA 3L7BA 2WP0A 2WYHA 1X8JA 4DTCA 4DZTA 2F9FA 5G3ZA 4UVDA 2NX2A 4AIRA 1JBQA 2XE6A 3OEYA 3DHWC 3IEKA 4P7JA 1NTRA 1ZX1A 4ISBA 1RXEA 3RVKA 3FA2A 4BNLA 3HJFA 3PXEA 3TK1A 1U4NA 1ULSA 2R5NA 1BD3A 3NT2A 4MWDA 2XMDA 2CWWA 3G8AA 2FQ1A 2W6MA 3G9TA 4HRXA 1EWYA 4DMFA 1S7CA 1YJAA 3F6BX 3P9QA 4W9NC 4QAQA 3RVPA 3E5MA 4RFSA 2GHRA 1GZVA 3QIVA 3DYIA 3KZCA 4OM7A 3V00A 1EHIA 3UHPA 3RUDA 5C3MA 2XTNA 2H52A 3FX2A 5AKEA 1VHLA 5KYXA 3RREA 1W47A 3DLHA 3QKRA 5FX2A 1PJ8A 1CDZA 2P68A 1CLEA 5KYTA 1FFCA 1RS0A 2XUFA 3SLKA 4O4IA 2PKQP 3Q40A 4C20A 1AA6A 2H1RA 3TR6A 4HLUC 4K81B 4WTOA 1H2ZA 1UBCA 3Q2IA 4TMKA 3VNBA 6CHYA 2EKDA 3A10A 3GAFA 3JVDA 1RMQA 4IV5A 2X4GA 2O2GA 2QT0A 4KXUA 4RVDA 3N07A 1L7RA 3DMDA 4Q19A 1BMFD 2K2QB 2WZQA 2OPHA 3PXBA 5ALXA 5DLPA 1DC5A 4E3WA 4CCSA 4G4IA 1T2NA 3FDFA 3PU6A 1W49A 1XTKA 1D1QA 2BHSA 5T4BA 1JPVA 4POOA 1ZUIA 1NOKA 5IVKA 3VTFA 1EHYA 1RD4A 5CH5A 2O8FA 4IF4A 1ACMA 3HS3A 1NW7A 3HR4A 3JWEA 1TQ4A 3Q3VA 2FK8A 2OLEA 4Q82A 2X0KA 1ILWA 1EHCA 1U28A 3O2SB 2AW3A 4BWFB 5DNUA 3OFVA 4PTYA 1HMPA 1LX6A 4XUGB 4EPTA 3H3FA 3FYUC 5IXSA 5FL7A 4YALA 1H8HD 1QRDA 2XOKA 4RLHA 4UNQA 3TTXA 4EF6A 4AKGA 2YJ3A 3AY0A 3CRW1 2CFSA 1O58A 1DEKA 1FDRA 2C0CA 3IRUA 3KSRA 2I87A 3KELA 4KDCA 1ES9A 4LY9A 4NMLA 4ZRMA 3FTFA 4ZTBA 1UP7A 3AP1A 4B84A 4HWSA 3O3OB 4ZCRA 1HYQA 4N5LA 4B2PA 4PS0A 4QOGA 5F64A 5CFNA 2LP4Y 3VYWA 4P5PA 4FHFA 1RHKA 1KMCA 1N0UA 1BFDA 2IOQA 2Q1UA 2WM2A 5C0OE 2C7QA 3PNKA 4A36A 3LBYA 1XLUA 3VKHA 1VZ3A 4HH1A 4JX8A 2NMVA 1B74A 2GPAA 1SK8A 3CUEF 1TRKA 2GASA 3QPDA 4HNUA 2AR0A 1GL3A 4DNXA 1R3DA 3AFGA 4OB6A 2JEYA 4O2BF 2OGWA 3GNTA 1IZ8A 3F6SA 1VRCA 1ML4A 2VYVD 4S0ZA 3R3XA 1X74A 2AOUB 1CR1A 2HLHA 4GI2A 4N8EA 2Z83A 4KN6A 1R6DA 3PQ3A 4Z3OA 5T4FA 1QCCA 3R0XA 1YD7A 1HYEA 4A10A 2JI8A 2RH5A 3OVMA 1NVFA 2O54A 2JFWA 3IQHX 1ZD8A 4PN3A 2ZITA 5M3BA 1Q6ZA 4OI0A 2IPAB 2NXWA 4P7FA 5DYYA 1YB2A 1Z06A 1J7JA 1H4TA 2BELA 4YCDA 4AWXA 3Q15C 3DKIA 1UQTA 1E3WB 1W73A 1X7WA 3BE4A 5ER6A 2VZ9A 4DV4B 3T15A 1EM6A 1XTPA 1ZONA 4J9VA 4W5WA 2FXVA 2RG7A 1FXUA 1RHRA 3SSMA 4BUCA 2V7VA 3TQRA 1NPDA 4NYJR 3R4VA 5FWXA 3W0LB 3SXUB 3KVNA 3NHBA 3DDCA 2QVCA 2OYCA 1XK7A 1B8OA 5IMBA 3RVJA 2EHJA 1NNLA 5IPFA 3G6WA 2P5SA 3F1KA 3Q3HA 5J4VA 3CUSA 4Q3OA 3AINA 1O97C 4KE9A 2XUOA 1MAWA 3PJGA 4RKWA 1LPOA 4D8UA 2YICA 3PSAA 3W5VA 3ZD8A 1K7CA 2GERA 2IK8A 4CZ2A 1XHLA 1EXNA 2C5HA 1Y6JA 1XXHA 4L76A 4C87A 5LXTB 2QAGB 2X4LA 4MV5A 4NYMQ 3B60A 3O8RA 5IAGA 4IWYA 1OW3B 1C9YA 2GA9A 4YP7A 3WV5A 3GLSA 4BMSA 4DHWA 3KKKA 3ER8A 3KJQA 4K9PA 1O0SA 4N65A 4RJIA 1E77A 2ZB2A 2IT1A 2J30A 1JUDA 1PX0A 3KR0A 4TUYB 5ARCA 4ZEMA 2QD4A 1CQXA 1SBCA 2FSHA 3B5IA 4X20A 3ZWOA 1KBOA 3T06B 1I3OA 2Y0EA 3E0XA 2EBHX 3CZ4A 2PT7A 4B3JA 5FBQB 4LTDA 1ZSVA 5A4MS 1MX5A 1QO0D 2XQFA 4KO8A 1KF0A 1PJLA 4XGNA 3FSRA 3UJAA 5CFQA 1ZXXA 3SHOA 4UVGA 3UGJA 5A4FS 4PU0A 3QWAA 4RWEA 4D3FA 2AMFA 4DG9A 5I7WA 4H6VA 1U0SY 4LJRA 1YFZA 2EDAA 2GFHA 2HGSA 1HEIA 4IGIA 4RSMA 3SYLA 5B7QA 4LF7B 1I94B 1XE3A 4DCPA 5IWCA 2XQIA 2O0MA 4WL0A 5KVAA 1X8XA 1NNEA 2DUUA 3P9RA 1P7WA 1XVTA 2WG1A 4FEEA 4PZPA 2WINI 4UW9A 4UNSA 3G2IA 3UEOA 4KR3A 1U7WA 2QPAA 1PUXA 3OZFA 1Q0UA 3SXPA 4YRBA 3U3OA 2FG6C 1QC5A 3EMKA 3IBCA 4FWTA 4ZPJA 5C7OO 2JKVA 5JASA 3LC1O 3NHFA 5HBRA 2B3DA 4AFNA 4HDRB 3C7CB 1C2YA 2AK2A 2CD7A 4DILA 5C2JB 2W48A 4OATA 3PPXA 4LOJA 1T13A 1MIOB 3KWMA 3QWHA 3SQDA 2XB2A 3PNOA 2XYPA 1FFHA 1LPBB 2FWNA 3X1ZA 3NCTA 1RXUA 2YFKA 3UC5A 3I4FA 4EA7A 3FGOA 1YBAA 2D0DA 2TECE 1C1DA 2RKOA 4JYMA 1W5AA 3P9YA 2G82A 2BAGA 2BEJA 1E89A 4G5GA 4Z53A 1PWHA 2J46A 5L7YA 4KTTE 1B4DA 3TZQA 4YUXA 1RIIA 4OQLA 3SBEA 2AJBA 4X1YB 3DUFA 4BKUA 1QE5A 5JPIA 2R85A 2RHOA 1BKYA 3BIFA 1II9A 3M5PA 4B82A 1WUJS 2ZJYA 3A2LA 2FJ0A 1P7ZA 2SKCA 5TSDA 3WE7A 2IHBA 5C5DA 1TI7A 1PFQA 1XD2A 2ECFA 1Q1NA 4IMPA 2AQKA 3K2QA 4LSWA 2NVBA 3FTQA 4FN4A 3R3YA 3EC1A 4D0GA 4EKYA 2E4UA 3CNQS 4JY7A 1G16A 4L3OA 4ZCLA 2GKOA 1F8GA 2A9OA 2RHLA 3TBKA 1A9XA 1W48A 5LB2A 2NXNA 2XUKA 1RYMA 2LR0A 5DE3A 4ZI3A 3O74A 4OTZA 4PNEA 3GFRA 5D8DA 2H2WA 3BRQA 3D6JA 3M49A 2Z6UA 3LHDA 4B85A 3DOIA 3RFFA 1GYPA 2GCOB 1NYRA 1X7HA 1TO6A 2PAAA 3FLEA 3HDVA 4JK3A 4EABA 2XHEA 3BH7A 2XF2A 4QDZA 1OY1A 4RTRA 1ZSYA 5J5CA 2W6PA 2GAFA 3MWGA 4IH4A 5GAJA 5I8PA 5FQOA 5F1PA 4R7GA 1LK0A 2XZDA 4EF5A 1E60A 2Q2VA 3E05A 1D2CA 4KR9A 3I1JA 4BFUA 4R0MA 2WG0A 5HZHA 1QCZA 1WF3A 1Z29A 4RFSB 1OFIA 1ORDA 1GGNA 3PI7A 1XCGB 2DWQA 2EGUA 4MWBA 2AFIA 3ORRA 4ZWNA 3TQCA 1NC3A 5EG5A 2H4JA 4DLNA 5KYXB 2AN4A 2VCEA 4RDHA 1GKLA 2AOTB 1M1YE 2VJYA 2ZTHA 1K8XB 3QFTA 1CULC 3QKRB 3IOCA 1LPSA 4YR7A 1M8FA 3SVLA 4KZPA 3NWPA 4X00A 4O4IB 3T35A 2LBPA 1YDWA 1IY8A 3STHA 4CMEA 4YRMA 1BA3A 4PR3A 3WMWA 4YAUA 1AHHA 1Q7BA 2LRHA 4KQEA 2PKWA 4FMCB 1NVMB 1H94A 2AD5A 5CRIA 4OXIA 3FJ1A 2DBRA 3E8MA