4JNCA

Soluble epoxide hydrolase complexed with a carboxamide inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
312
structure length
312
Chain Sequence
GSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Bifunctional epoxide hydrolase 2
publication title Discovery of 1-(1,3,5-triazin-2-yl)piperidine-4-carboxamides as inhibitors of soluble epoxide hydrolase.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 312
sequence length 312
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jncA00
1QE3A 2VSQA 1H2YA 1QIMA 3O9MA 3T52A 1O6FA 2WG2A 2H1IA 4ROTA 3V48A 5JALA 1DU4A 1QIGA 2XDWA 1HQDA 5HK9A 2OLEA 1YA8A 4KR0A 2XMRA 2EDCA 3KDAA 1C7IA 4Q3KA 2XUIA 4UHCA 1E8NA 4ZRDA 1W75A 4H7JA 1HPLA 2WUGA 2PPLA 4BRSA 3WWCA 1UK6A 2C4HA 5T4EA 1BROA 4B82A 2FJPA 4M0MA 4EB0A 3EQ7A 1IMJA 4DLNA 4X3CA 5JATA 4QEKA 3WKCA 2QS9A 3KD2A 3HABA 5FKJA 3WWOA 5A62A 1MAHA 3VDXA 5ALYA 5IVIA 1TRHA 2R11A 1VE6A 4FLEA 4CIAA 4UHDA 1HDEA 5LZ9A 1KU6A 4QWMA 4B0PA 5ALWA 5C8VA 3C6YA 3QMVA 2HM7A 3LIIA 1ZI9A 2OG1A 3WMRA 1PJAA 3ZLVA 3D2CA 3DJYA 3OOSA 4BRZA 5HKAA 2W6CX 4IH1A 4J0HA 4B83A 3E0XA 4H7DA 5CT8A 5JZ9A 4JYMA 2GZRA 3R41A 3QMWA 1BN6A 5AH0A 4Y2QA 4MXDA 4F5ZA 4H0CA 4MEAA 2XT0A 4AN1A 2YASA 1XQYA 2JGJA 2WFLB 4C4YA 3DKRA 4LIPD 3FSGA 4H7FA 3LS2A 4AN0A 5AI9A 2OCKA 3VJLA 3WK5A 4K5QA 1XZGA 2JBWA 1LPPA 4HRYA 4X95A 5H3HA 1VJ5A 2Y2VA 4YPVA 3SK0A 3AINA 2XQJA 5EIAA 3ZLUA 3TRDA 1A7UA 5ALXA 5AKIA 1H23A 4BAZA 5KWIA 1XZIA 5JD5A 3H1AA 3GBSA 1MPXA 2AJ8A 3F96A 3AFIA 3AJAA 1DWPA 3B3QA 3FLAA 5EIHA 5CMLA 5AKKA 4PO3X 1X70A 2CJPA 1WHSA 3O0DA 4LXHA 2OGTA 3V1LA 4CCYB 4UBIA 4ARBA 2JIDA 1GQRA 4X6XA 2XMCA 4CIBA 1TQHA 4X90A 2DFPA 4L3WA 2XUKA 1JJIA 2WFZA 4W63A 3OM8A 5ALIA 1UZAA 4UBNA 4DNQA 1E8DA 4JH0A 3BDVA 3O9VA 2PU7A 3AIOA 4QNNA 2PUJA 1FSSA 5ALKA 2JGMA 3MGAA 3FVTA 5ALVA 2XLBA 1ZIXA 5AIAA 2O2HA 2QUAA 5AO9A 1TCCA 2JGEA 1LBSA 1ZJ5A 4OCZA 3WK9A 2XMQA 4H7HA 4G8CA 2WUDA 3CCCA 1J07A 1VZ2A 3IUQA 4X6YA 5DWDA 4P08A 2WIDA 3AIKA 4B9AA 5HFNA 1EDEA 5HCUA 1XZKA 1EVQA 2XUOA 5DTIA 5FPQA 4PSDA 1JU4A 2I03A 1QIDA 5K3BA 5AKLA 2WTNA 2QOEA 1BS9A 3JW8A 1RP1A 5FXMA 1VXOA 3IULA 3C6ZA 3DCNA 1D07A 3PE6A 5DNWA 5ALJA 3WL7A 3D4LA 3D0KA 1BCRA 2XE4A 2ZJFA 4ZI5A 4QLOA 2WUFA 2RHTA 3T4UA 4RE5A 5ALOA 1UOQA 1RWQA 4WFKA 4NMWA 1XKTA 3MUOA 4Y2VA 4JUIA 5CT5A 5JAUA 1P0PA 3FYUA 1W52X 5CH8A 3IIIA 4G4GA 2GYWA 1KEZA 4J0GA 2LIPA 1XLVA 1UT6A 2WIJA 2YYSA 3FYTA 3WIOA 2PU5A 3GELA 3C8HA 2AJDA 5CH3A 2ZYSA 4GWLA 3TJMA 5SYNA 5LZ4A 3N0TA 1E89A 4AMZA 5HFAA 3ESCA 3W9BA 4CCWA 5IVKA 2XLCA 4M0EA 3VISA 4KE7A 1U4NA 4U2FA 1K4YA 2AJCA 1MNAA 2VAXA 1RYYA 1LPSA 1ZIYA 4QA9A 2PSHA 3BJMA 4G4IA 3WJ2A 1XZMA 4OU5A 4MQMA 5I9IA 5HZGA 1QIEA 5C7YA 3F98A 3CXUA 4IH4A 5HK8A 4A5SA 3DEAA 4DIUA 5AK4A 2E3JA 3UUFA 1QIFA 4FBMA 4DTCA 4PF1A 5HQ3A 3GUUA 1DT5A 4CG3A 3F9CA 4IHAA 1JT2A 1Q0ZA 4H77A 4GLBA 2X5XA 2UZ0A 4Y2SA 3BXPA 2XUDA 3G9UA 2WHPA 1QFSA 2G5TA 5K5EA 2ECFA 2C5FA 1G5FA 1LNSA 1P0IA 1FJ2A 1MX5A 1TIBA 3R0VA 1E66A 5BV7A 4G1FA 2PX6A 3DKKA 1R88A 1XQWA 3Q8WA 4L72A 3IUNA 5AJHA 5DLPA 4QE3A 1QO7A 2WM2A 4KAAA 3OTQA 2ZSHA 5AOBA 5LYYA 4OYLA 3DNMA 4WDRA 1E5TA 1P0QA 3I2GA 1CUHA 4Q82A 4B80A 2WJ6A 4LXGA 1JMKC 2G63A 2WFMA 4FKBA 2BJHA 5CXUA 2Y2UA 1SFRA 1UKBA 1B6GA 1GXSA 2ORYA 3H2JA 4J3JA 4ZWNA 4U2EA 1VKHA 4QZVA 4FHZA 2XUFA 4Y2JA 3H0CA 5I8PA 3CN9A 4PV7A 4FFWA 4H7IA 5A6VA 1YCDA 5CURA 5KREA 1YA4A 3ILSA 4W1QA 3WWEA 4BC1A 1GGVA 1YAHA 2XMBA 4NS4A 4BDSA 4IO0A 3WK4A 3HACA 2NW6A 3DQZA 1VLQA 4E11A 1FFCA 1CUGA 2OPHA 4H35A 4CG2A 1K63A 5KWJA 3UUEA 1F0NA 2HU5A 5EHZA 4BVJA 2ZJ7A 3O4JA 4BZZA 3GFFA 1F0PA 1WB4A 5T4BA 3FWHA 4ZV7A 1LZLA 4G8DA 5HF8A 1Y37A 3WLAA 3NUZA 5FUMA 2P8SA 5LP1A 2OCIA 1KU0A 1CV2A 4LKOA 3WKAA 2HA6A 5AI0A 3H2IA 3OC0A 4UFPA 3FLEA 3QH4A 2PBLA 1EXWA 1CUWA 2HADA 4AXBA 3HC7A 4Y2UA 5BOVA 5EHXA 3WL8A 1QIIA 4QDZA 4I3FA 1YSCA 3EQ8A 1G66A 2QKYA 4E46A 4Y2YA 4B85A 4UBLA 3V1MA 1WHTA 3STVA 4XIIA 2VT7A 2GBGA 5CW2A 4C6HA 1H2WA 2AJLI 2RAUA 5AK3A 5ALMA 5AI6A 3D2BA 3AZOA 1CUBA 5AM5A 2HA0A 3R3VA 2GBIA 1K8QA 4UHFA 4C88A 2C58A 2FJ0A 3C45A 1WM1A 5EHNA 4DNPA 4BTVA 1UK9A 3HZOA 1XZLA 2WILA 2XQFA 2R8BA 3LP5A 4QDXA 5I7UA 2GBFA 1XLWA 2QR5A 1XZAA 3I2HA 1AC5A 2RHWA 5A7HA 4GI1A 4CI9A 2PSEA 3FYUB 4PQEA 3WK7A 4FMPA 4IH9A 3QPCA 5AM0A 1CVLA 2JF0A 4DMCA 2BFNA 4X71A 3VJKA 1XRRA 3HYSA 1FFEA 1UKCA 5JYCA 3A6ZA 4ITVA 1AUOA 4W1RA 4C4XA 5ISMA 2BCEA 2XMSA 5ALNA 5C8XA 3FVRA 1YASA 3GA7A 1TCAA 1IZ7A 2WU3A 5AK6A 1CQWA 4L9AA 2OQVA 4DSZA 3WWDA 3I6YA 1F8UA 3FSGD 4HVTA 2GBCA 3G9XA 2HDWA 1L7RA 4HXGA 4W1PA 5CBKA 1MT3A 3STXA 2ZVDA 3HJUA 2WJ4A 4XX1A 1H2ZA 2I3DA 5DNVA 4Y2RA 4KACA 4KEAA 3L1IA 3O95A 2CKMA 1X2BA 5HF9A 3O4IA 4XVCA 3D59A 3I1IA 4INZA 2AJBA 2ZJ6A 4AO6A 1DTEA 4Q05A 1H22A 1XZCA 2BUBA 2WG0A 3G0GA 2WHPB 2HIHA 5K3FA 3STTA 3STYA 3RK4A 4B9EA 3C87A 3PUHA 2WSLA 2HA5A 1CLEA 3PFCA 1LZKA 2DHEA 1BEEA 1BRTA 4EUSA 1WB5A 5AK5A 1K5PA 4W1SA 3WKBA 1EK2A 3G9TA 1E3QA 1ORWA 3BF8A 4G4JA 5EIEA 4F60A 2V9ZA 1QTRA 4Y7DA 3FNBA 2XMDA 4RNCA 4EY5A 3WQHA 4FLMA 1MTZA 1DWQA 1W4LA 5JADA 3A2MA 2QVBA 1DQYA 3O4HA 5ALPA 2Z8XA 3JYHA 3QVMA 1CUIA 3KSRA 3M82A 4HXEB 4K6KA 2DHCA 5CT6A 5AOCA 4DMHA 2OXEA 4BB0A 4ZGBA 5A71A 2VJBA 1BEZA 1MU0A 2QZPA 5IKXA 3R40A 2VJDA 3DL7A 1MAAA 5ALDA 1CUEA 2IIVA 4GW3A 3IB3A 3KXPA 4BZWA 1LPNA 3R3XA 5ALFA 2WKWA 4ZV9A 5FDFA 1PFQA 3PUIA 1SC9A 4X92A 3ZI7A 4FOLA 4YX9A 4WFIA 2QJRA 1CUYA 5CTAA 3DL4A 5FP0A 1XZEA 3ESAA 3R3YA 2X76A 5AKJA 1TKRA 1DQZA 2Z3ZA 2H7CA 2PVSA 4GBGA 4KE8A 3QYJA 3HXKA 1OCEA 1G42A 1EDDA 1SOMA 1WOMA 3PFBA 3VVMA 5AM3A 3WA6A 4P93A 2ROQA 5AI8A 4FDMA 3L1JA 1DX4A 4YK7A 1ZD4A 4LYEA 5AM1A 3LCRA 1Y7HA 3FOBA 3C5VA 2WLSA 3WYDA 5CRIA 3I1YA 4H7KA 5C8ZA 5AM2A 3SC2A 3NWOA 4UFNA 5E4JA 4U2BA 1AMNA 1F6WA 1R50A 2QM0A 3I2IA 1B41A 4L0CA 2DR0A 4BCBA 2WIGA 3H1BA 1EA5A 1YR2A 5HF6A 1EDBA 3DYIA 3DS8A 3D3NA 1FFAA 2BUCA 2XB6A 1EB9A 1EHYA 1LLFA 5LZ2A 2ZYHA 5BWBA 5DYTA 3AZPA 3LIPA 3ZPXA 4N5HX 5JASA 2O7RA 4MWTA 4J0IA 3IUJA 1UK8A 2QJWA 3IA2A 1DINA 3BL8A 1GPNA 2B9VA 5EGNA 1GQSA 1SCKA 2OGZA 4AO8A 5FPPA 1QGED 4FNGA 1VOTA 3DDUA 4FLFA 3GZJA 4X97A 3V9AA 5EFZA 1XROA 5LZ7A 2VEOA 3EF3A 1QIJA 3RLIA 1UOPA 1Z68A 4QDUA 1LGYA 2B20A 2WIFA 4TVKA 2Y6UA 4X85A 4TGLA 1XZFA 4G5XA 3WL5A 5FRDA 4BAGA 1Q0RA 1O6GA 1U65A 1AURA 4HXFB 1CUVA 1S8OA 3ZWQA 4UPDA 2XI4A 5KBYA 2ZYRA 1N1MA 1CIJA 4FNMA 4BCDA 3D5EA 4F0JA 1ACLA 1J06A 3AILA 1XZBA 2PL5A 1QZ3A 4BBZA 4XJVA 3G9ZA 4FBLA 3I6MA 1EINA 5JIBA 4I19A 3DLTA 3C6XA 2WTMA 3WKDA 2B61A 1UK7A 2CUTA 4KE6A 2VTVA 4D9JA 3U0VA 2VJAA 5J3JA 3E3AA 3ICWA 4TPKA 1JI3A 1R3DA 3H2GA 5C81A 4UHEA 1JJFA 1MO2A 4PW0A 4HAIA 4CFSA 4NVRA 2PSDA 2QT9A 3IVMA 4Q34A 3BDIA 2JGIA 2XUAA 1HLGA 1C7JA 3PICA 1XFDA 3H04A 2CMFA 3TGLA 3PF8A 3WI7A 2PKYX 1HL7A 2QUBA 3H18A 2BGNA 2J4FA 2HFJA 4UFOA 4J0JA 1Q83A 5AI4A 1AQLA 1GPLA 4OU4A 1LPMA 1CUCA 1JFRA 2Y1KA 2XMGA 3M83A 3OURA 5JAHA 2I78A 3FAKA 5ALEA 1WPXA 1PV1A 4JNCA 1QOZA 4B0OA 1A8SA 1Q84A 4BATA 6YASA 5JD6A 2O7VA 4Y2PA 3HRHA 4CCYA 1BU8A 2Y6VA 5A7FA 5ALRA 5DYYA 1ZD2P 2DHDA 1GKKA 4RE6A 1GKLA 4DYHA 1EX9A 3M81A 3RKSA 3Q0TA 1UWCA 1VXRA 2V96A 5JAPA 1CUJA 3C70A 4LHEA 4BYMA 3UMJA 4WY5A 1XRPA 3NGMA 1CR6A 4YASA 4OB8A 1EK1A 4X7BA 4QWWA 2XMZA 4WY8A 3CN7A 4C89A 2HRQA 3VJMA 5LZ5A 1BCSA 1YB7A 4BE4A 1MX9A 3GROA 3ESBA 3P2MA 4IQ4A 4DGQA 4FWBA 4BVLA 1JJBA 2RIPA 3QPAA 3RM3A 3WIBA 1ZICA 4G8BA 3ICVA 4KE9A 5EHQA 5AKZA 1ZGBA 3FBWA 2FX5A 4EY4A 5YASA 4PSUA 4KRXA 1CRLA 3AUKA 4PNZA 3WYNA 1AGYA 5AIBA 4B81A 5FV4A 2I3ZA 2VJCA 1UKAA 2EEPA 2ZSIA 4MJ3A 1XRMA 5AICA 4X91A 2DCMA 1K6EA 7YASA 1LBTA 3G0IA 3I2FA 3H17A 2WHRA 1L7QA 1VE7A 3C6BA 4AB1A 1USWA 3G7NA 3N2ZB 1X2EA 4AQDA 2YXPX 3QITA 1W1IA 3D7RA 4AZ0A 3AIMA 3JWEA 4LYDA 4RPCA 4HS9A 1ZGCA 2AXEA 2OQIA 1IUPA 2ACKA 2V98A 4UBKA 2IITA 3SX4A 1JU3A 4X94A 1J2EA 1QO9A 5K3CA 2RI6A 2O2GA 2RONA 3V1KA 3W2TA 1QONA 3D2AA 5AOAA 5JANA 1ODCA 5ALUA 1R9MA 3F67A 2XUPA 5DTJA 3L1HA 4UHHA 4C87A 2HA2A 3HI4A 1QLWA 4K6HA 4I4CA 3LLCA 3ANTA 4K2AA 3W06A 1CUUA 4WCVA 3RARA 2Z5GA 2WIKA 4NZZA 5HKBA 3EIOA 3F97A 1ORVA 3YASA 3WA7A 3VXKA 4FFVA 3A70A 4K6GA 5HQ3B 1VA5A 5FOQA 3MVEA 3C5WP 2HL6A 2HA7A 3KWJA 2XQKA 2PUHA 1VZ3A 5AKXA 1ACJA 2W22A 4BVKA 5ALSA 3BJRA 3CCBA 3WKEA 5T4HA 3QPDA 3WK6A 1YS1X 4DNOA 3STUA 5SYMA 1THTA 4H18A 3S2ZA 3PI6A 1R9NA 4EY8A 1MNQA 2VA9A 5AKYA 4Y2TA 1YS2X 4AZ3A 5JZSA 5IVHA 2J3QA 2JGKA 2OAEA 2QRUA 4UHBA 4JEIA 3WZMA 4U2GA 5DYWA 2GYVA 4U2DA 5E4YA 4GHWA 3G0BA 2WJ3A 4MYDA 1CQZA 2FUKA 3ED1A 3IUMA 3FYUC 4X6UA 3K2IA 4Q3LA 2XUGA 3BIXA 2ZYIA 4N8EA 2QXUA 4P9NA 3BWXA 1IVYA 2PM8A 5D7BA 2DSNA 4EA6A 2XUHA 3F8SA 1QFMA 3G0DA 3HSSA 3TEJA 1I6WA 4Y9SA 4KJXA 5ALLA 1N5MA 4ARAA 4QDTA 1AZWA 2G4LA 3BF7A 1THGA 4KAFA 1P0MA 1HKHA 1XRQA 2V97A 3W05A 5K3EA 4N8SA 3HLKA 1W6RA 2OCGA 2CZQA 4G9EA 1J1IA 1IUNA 2BGRA 5D6OA 1FFDA 1ISPA 4S0XA 5T4FA 5JAOA 5EI5A 2BKLA 3WZLA 4OSEA 1LPAB 2VATA 4XWGA 1DX6A 3KWFA 1CUAA 2XQIA 4N5IX 1R4ZA 2J3DA 5A2GA 1XZHA 4ZXFA 5K3DA 1ZD3A 3K6KA 2PSFA 3DOHA 1HBJA 4C4ZA 3A2NA 2Q0XA 4W9RA 4EZIA 3B12A 4KRYA 4UUQA 2C5GA 5K3AA 1XRLA 5ALTA 2BUAA 1WPRA 1A8UA 2X8BA 1OILA 2JEYA 4OYYA 1A8QA 1FFBA 4MYSA 4KYVA 4Q3OA 4X93A 4B7ZA 4J0CA 4EBBA 3C8DA 1ODTC 2RGUA 5IH7A 5LIPA 4EY6A 3AZQA 2HU8A 5E4TA 2JEZA 1XQXA 2H7XA 1ODSA 3OPMA 5D3KA 3I2JA 4JYPA 1YAJA 2J4CA 1T2NA 3W9UA 4J0KA 4OD0A 3SWWA 4J03A 1TK3A 1WCYA 4M0FA 3V1NA 2CEKA 2PSJA 4N8DA 4PSCA 5F4ZA 4FTWA 1CEXA 1E8MA 1IUOA 3M3DA 4HTAA 1MX1A 4EHBA 1QIKA 1SCIA 2VT6A 4WDQA 1MJ5A 3H2HA 2JGFA 3WK8A 2H7YA 1ZI6A 3HEAA 3G8YA 5A7GA 4BDTA 1CUFA 5ALHA 3ANSA 2VF2A 1BN7A 4HRXA 3I6ZA 5AP9A 5FLKA 2QMQA 3STWA 3K9BA 5CT4A 2ONCA 3MUNA 3I2KA 1ZJ4A 1JKMA 4AX4A 4GXNA 3KOOA 4OB6A 5DNUA 1YB6A 2VAVA 4MQLA 1U2EA 2C7BA 1ZOIA 1EH5A 2XUQA 5LKRA 3NOXA 2XQGA 5E2IA 2GZSA 3ZV7A 2ES4A 5LZ8A 1ZD5A 4H7EA 1ETHA 3VKFA 1CUZA 5DJ5A 3WJ1A 1N5RA 2OGSA 1CUSA 4Z49A 4WJLA 1UOOA 1A88A 2G5PA 2O2IA 1C4XA 2CBGA 2WG1A 3R3UA 1WB6A 4U2CA 4B84A 4E14A 3WL6A 1NU8A 2WU4A 2HFKA 4BC0A 2C0QA 4GECA 1TAHA 3OG9A 1GZ7A 3U1TA 5AKEA 2K2QB 2QXTA 4GEGA 3QMMA 1N8SA 4Q1VA 1QTIA 3H2KA 3O4GA 1T4MA 5AHXA 3ZLTA 3IBTA 1AKNA 4BP9A 5K3FB 3FLBA 2B4KA 1U8EA 2XUJA 5D3ZA 4UBJA 4UBOA 3EQ9A 4WFJA 4G9GA 3C43A 4DNFA 3R3WA 2WFLA 1M33A 2VQ6A 2WQZA 1QIHA 2YH2A 3VVLA 2CB9A 2D5LA 2Z3WA 1GT6A 3WWPA 3B5EA 1XQVA 4MEBA 4QDOA 4GDMA 1XZDA 1LPBB 1GPKA 1MN6A 1L7AA 4AMYA 4HZGA 3IURA 2QTBA 2GYUA 2C0PA 4BTLA 2HU7A 5CH5A 3E4DA 5AM4A 4DMKA 3DD5A 1NU6A 3G02A 3W04A 3BIWA 3PDCA 2BAGA 4J7AA 4E15A 4RGYA 1EVEA 2JGLA 4J0DA 4KAJA 4X00A 1CFJA 3ESDA 4A16A 3A2LA 4UBMA 4DSAA 1CUXA 3S8YA 1OXMA 1DWOA 4QLAA 3QZUA 2EDAA 3FCYA 4BP8A 3BE8A 2HHAA 1ZI8A 1LPOA 2DQYA 4EY7A 3I28A 2HRRA 4Y2XA 1XRNA 5AKHA 4CG1A 2ACEA 3E1GA 3QM1A 3DOIA 4MWSA 3X3HA 2H9YA 2IX9A 1QJ4A 5AKGA 4P92A 1BE0A 2WUEA 5JARA 4BCCA 1AX9A 4BE9A 5ALQA 1IZ8A 4AO7A 5ALGA 2HA3A 1CUDA 1XKLA 3FCXA 1SCQA 3QBJA 5JD4A 5AI5A 4BAUA 1VA4A 1UFOA 1EI9A 1Y7IA 4V2IA 4DMFA 4LXIA 1G4HA 5BWCA 5LLSA 1XLUA 5HF5A 1JMYA 2OCLA 5JZBA 1R1DA 1H2XA 4DM7A 4A23A 5CXXA 2D0DA 4B6GA 2DQZA 1TCBA 2Z8ZA 3PF9A 4ETWA 1NX9A 4F21A 4OPMA 3IDAA 1XZJA 2OAGA 3G0CA 5IVDA 4ZREA 4C01A 5LKAA 4OB7A 3DYVA 1W76A 2HA4A 3R3ZA 1UXOA 1DT3A 2WHQA 4O08A 5ALZA 1EB8A 3H19A 3EBLA 5CT9A 4OUKX 5ESRA 1CPYA
chains in the Genus database with same CATH superfamily
3WYEA 3TLEA 5DTEA 4ZVKA 3NAQA 1QP0A 2PGJA 4GL2A 3O9MA 3T52A 1E2PA 1GCIA 3AB7A 5BN4A 1P1HA 1Y5IA 3K8OE 3AERB 3E9RA 4RZQA 4LNHA 5H9WA 4ROTA 3V48A 1DBQA 3HXMA 3FCSB 1IEQA 3E5MA 1L1QA 3FF4A 5JALA 4NCBA 3BIFA 1NQAO 5FL7D 1DU4A 4B8YA 4PAQA 2WVHA 4KP7A 1CFZA 4D3ZA 2YOHA 5D86A 2Q1SA 3GRAA 1U7XA 1Z3CA 3BH7A 3D8UA 4PZ0A 5IN5A 3VR0A 5KZMB 4TLBA 1VL0A 2JI6A 4G0YA 4NQZA 3TECE 4EEKA 5JISA 3F73A 2IV7A 5FHQA 4D81A 3C5EA 2PKXA 5I8ZA 3WIDA 3H5RA 4LE0A 2J9RA 1C7IA 3EQ2A 4QAQA 2WB2A 4KN6A 1TZBA 3NGXA 3X0DA 1U3VA 2ODQA 2ST1A 4M9XA 1CYDA 3NYRA 5BOSA 1FDVA 2OEPA 3TQIA 5AXAA 5T4EA 3IVXA 1LFAA 4IFBA 2V6BA 1U4SA 5E8JA 4C29A 4WOBA 4GXQA 2Q1TA 1L5MA 4JVLA 2FJPA 1P1IA 3INRA 3DZHA 4OY3A 1NYLA 2DE0X 4KITB 2GX6A 2YUIA 1NVWQ 3NS7A 4X3CA 2IHBA 4L50A 1S7CA 3WKCA 2R7KA 3AKDA 1ADCA 3KD2A 3HABA 3ICCA 3P19A 3TM5A 4UTOA 1KYWA 4HDRB 2IUEA 1E4YA 1K7CA 1ODIA 3JQGA 3T7JA 3F3YA 4MKFA 3DLIA 3ZXXA 2FFRA 2XDQB 2Y99A 4N3GA 4YJGB 3WY9A 4WJKB 4UTRA 5IVIA 3DH0A 2SICE 3DP7A 3JD0A 1PE0A 3KAKA 5F5LA 7MDHA 3HU2A 3EDCA 1C3OB 1UEIA 3AT1A 3LVBA 3NNNA 1HDIA 3Q2OA 4P81A 5AHKA 2W98A 1QCDA 1WXXA 1Z6AA 1GSAA 2J0UA 3NRBA 2VK8A 4JJ7A 2G4CA 4UHDA 4WY2A 3FWZA 4XVRA 3NEJA 5E0OA 1KO4A 3BZBA 4QWMA 4H31A 4RM3A 3TD2A 3THWB 1D0SA 1CQXA 1JA1A 3AWIA 1B8OA 4W5QA 2HM7A 1XD2B 1LVHA 5F2KA 3BGIA 1OQAA 1U0FA 2W6QA 5K8UA 5J2UF 2I87A 3ND9A 1OBCA 5BV2P 3LIIA 4Q47A 3F6SA 4A2WA 3HYCA 1DE0A 1T35A 2C2MA 4TWAA 1PLLA 1Z6YA 2VHTA 3MTAA 3W7AA 4E7OA 1NFRA 2RH4A 3ZDEA 4W5NA 1KTVA 3FZEA 3D81A 1XTTA 1N9GA 3D2CA 2XCLA 3DJYA 3ZLVA 1H8ED 4ZTBA 3KJXA 4J90A 3T5PA 1NI3A 2FPRA 3JQ6A 4IJQA 3CZ5A 2Q9BA 3FJ1A 5TQJA 1ZC4A 2M98A 4LYYA 5LQJA 2JLWA 3DM5A 2BZSA 4A8PA 4HLDA 4J0HA 3ZWOA 3E0XA 3AW8A 1GG9A 1U2SA 3CR7A 2JGDA 2Q4OA 3RYIA 4GGPA 4H60A 2HEIA 1YQTA 4Z4CA 2G9UA 4QNRA 4BGEA 4E5YA 3FHOA 3A4TA 2H08A 1VL5A 1XQ1A 2HBYA 1JAIA 1JI0A 4D3FA 5DI3B 5F2OA 1DRKA 2KI5A 4WWHA 4AG3A 3QMWA 3DE1X 3TSZA 2AG0A 3U37A 5B57C 3L8YA 4DW8A 4FZ3A 4MXDA 2H2WA 2YWJA 4H0CA 3ZG6A 1F7VA 1RZRD 3UT5A 3Q3JB 3M5PA 3K5HA 1Q2UA 2AB0A 1QH8B 1RQ2A 4TYPA 3C15C 4TVOA 4I1IA 1X7ZA 1E7QA 1T43A 3MWKA 3N7AA 3SJZA 4ARVA 2B1RA 4F1KA 4P4NA 1WL8A 4YCJA 4LIPD 1ZD8A 3FSGA 1LDEA 2HGSA 2YMLA 3W1EA 5AI9A 5KWSA 3H3FA 1X0VA 2B1QA 4LHZA 1QRDA 2JBWA 4II2A 5JZVA 4S1WA 1X80A 1R5JA 2J9XB 1YFZA 3GCGA 1XA0A 3DTVB 4V0SA 3K5PA 1K3UB 1MRNA 2ZS7A 3PC8A 3QLUA 4NFSA 2GPSA 4QPJC 1N32B 2NAPA 2CXPA 2VHEA 3T0FA 3NKVA 4IHQA 1TFUA 4NDZA 5CGQB 2G1KA 4DWOA 4XOUA 2OC4A 2QSJA 1B23P 1QYIA 3W3AH 3PX7A 2QTGA 1FYEA 2IU0A 4RA9B 4XCQA 3WGHA 4A82A 1O1YA 4YPVA 4IZHA 2R9VA 3MUFA 1NG9A 2XQJA 1NKSA 2DULA 4B87A 2HBZA 3GUCA 5IMBA 2XNDD 1R64A 4C0QC 5ALXA 2J3HA 5B1YA 4TYMA 3FWPA 2VRNA 1W6UA 3PLAE 2D74A 2WFAA 1N7GA 1H23A 5BT9A 2P11A 3H97A 5DBFA 3RC3A 1GAEO 2ATCA 4HEA6 3SOPA 4OMFG 5IK2D 4IZOA 1SMKA 2CFCA 2WKSA 1EESA 1O4WA 3Q6IA 3TGWA 3FHTA 2HN9A 4M0DA 4P3PA 1XZIA 4FEYA 3RO7A 4YT2A 3GWGA 2AEMA 4Q9KA 5BXQC 2O7NA 3AJAA 1U2RA 1L9KA 4RJIA 2YOFA 3HFSA 3D6TB 3QXSA 4R0NA 5IUNC 1D1SA 1DC6A 1GNRA 2DPMA 1R4NB 2Y0PA 2ZAYA 3OIDA 4GX0A 1PD1A 3L8GA 4RHYA 1IVSA 1NZFA 3RD5A 1S2IA 1E96A 1XVVA 2GVZC 1XMIA 3E58A 3FTPA 4R0VA 3CFYA 2CLLB 4ZT2A 4PO3X 3ODGA 1RLMA 2PV0A 1TNDA 2F17A 3FKSD 4WXPA 2OGTA 2QUZA 1BQEA 4JUFA 1I3NA 1VGVA 2SKCA 3HL0A 3LI2A 3HCOA 4LRSB 5EE1A 4ZVQA 4CKCB 1QQBA 4PLVA 4KR9A 3B6MA 4X6XA 1C1XA 4KUHA 3H5TA 5B1SA 4CIBA 3ERCA 3LTNC 5CX1B 4YI3A 4C4SA 1UC5B 3IPRA 1R0WA 3L0BA 1GNPA 2FEMA 4TRNA 5DNCA 1XALA 2DFPA 3KHSA 4L3WA 4PLHA 1JPVA 3HNRA 4PQGA 2UDPA 2HSGA 5K20A 3OM8A 5ALIA 4FB4A 2JJ8A 3EULA 2IV2X 1Z33A 2CFSA 3OF3A 1OTXA 1ESCA 3GJ6A 3DLHA 3BMOB 4DNQA 1U2TA 3UMGA 3IUYA 3PQEA 2IQIA 3NNSA 4KQKA 5KJEA 4D7AA 5LQUA 1Y3AA 2VTBB 5KO2A 2JBHA 2JL1A 4GKBA 4ID9A 3ORYA 4BNXA 1C29B 2V4ZA 3L6CA 4KR2A 3PVCA 1BMFA 1YBVA 1PWYE 2XCOA 3CSSA 5IG2A 3KZKA 4PBRA 4Y6OA 5F1KA 3PWTA 3VYTB 3QE9Y 2PUJA 1JH9A 1SXJD 2C8KA 2I5PO 4AZSA 3MLEA 3EUFA 3TLKA 1Z9BA 2Q5FA 1WABA 1NXQA 2UZIR 1THZA 3OCUA 2VNHA 2JGMA 4JZKA 4TWZA 3GT7A 4KQJA 2B7LA 4RJJA 4BMZA 1X7GA 4KLZA 4EPTA 1CJCA 3DFKA 4PHTA 4YP5A 4O63O 3SEFA 1J8MF 2JZNA 5FF9A 4PZAA 1KWGA 2XMQA 3S2UA 4X66B 3EIXA 3L7IA 3EHDA 4FFPA 2BGKA 2OV6A 2PX5A 4RPHA 1ZU4A 1VZ2A 2NZJA 3K1JA 5DWDA 4MLPA 1AK2A 1VB5A 2NACA 3HB9A 3DOOA 3GJZA 3NW9A 3EZ7A 2PKWA 5DSZA 3D6AA 4E5NA 4CF7A 5H82A 2D2VA 4MR9A 5LP6F 2ZAIA 1EDEA 3ENWA 3ND8A 3U7EB 4CHTA 1O5IA 4XW2A 2BYTA 4QQKA 1C9JA 4HUQA 1EVQA 3Q7IA 5GJCA 2HF2A 1DKOA 2XYHA 3F5DA 5JR3A 2D7DA 1Y42X 4LWQA 3OJLA 1XP8A 5DHRA 4X1KB 3D5QA 4IV8A 3V34A 1QIDA 3Q3EA 3K5IA 3OEEA 3S81A 3CHYA 3HBMA 5LR6A 4CBVA 3AF4A 2FWMX 4CLOA 1KQFA 1DARA 1MFZA 1N2EA 4JEHA 3ZY5A 4BFYA 4S05A 1ECJA 8LDHA 2CHFA 1G38A 3ZDXB 2YCBA 4TLDA 1U90A 1K7XB 5FXMA 2IY7A 2YHUA 1SK8A 5JCPA 3ZCTA 2E87A 2GFHA 2ZTHA 3OTIA 1ODKA 4E2FA 1F38A 4B76A 2H3EA 2XOKD 3OD1A 1NW8A 2NYRA 3QKIA 2ODNA 4JLUA 3A4IA 4QIHA 3COVA 2HLDA 3D6JA 1KK2A 5JXIA 2GMWA 2C9BA 4POOA 3NPMA 1PL6A 3JASB 4ZVMA 1JTVA 2O2JA 5DNWA 1GN9A 4INAA 5C7OO 4ABYA 4GM0A 3P9KA 2PVPA 4DADA 4NFLA 3EY4A 4YP7A 5A5DA 3EA0A 2NU6B 2NUAB 1A9YA 4ZI5A 5KQMA 3KQSA 1F2TB 4AC9A 4EO4A 1JTEA 3RTAA 1FPMA 4JUCA 4KQHA 3AFNA 4UM9B 2ZB3A 1QU2A 1DAFA 4EX7A 2K87A 3GGCA 1M6WA 4R8LA 4G81A 1Y3IA 2H52A 1Y4SA 2FPWA 2XHEA 3T4UA 1UOQA 3IDFA 4IV0A 3C1TA 4JIMA 2FUG1 4I1YA 3KOXA 4AMVA 2REQB 2H2IA 2R87A 4WFKA 1QB7A 2OPBA 5JAUA 3DPIA 4B6OA 2J3KA 3DNFA 4X1IB 1M9NA 4M89A 2YJ4A 1P4JA 2D3WA 3AXSA 3IMEA 3AW9A 3LRXA 2VPYA 2GYYA 2QN3A 1LSOA 4GAEA 3HDQA 3RRMA 1GV0A 1IEVA 2XEDA 3HKBB 4DC9A 3NTRA 5CB4A 5TGTA 6GPBA 2YUTA 1HK7A 1N2CE 3HB0A 2X42A 3PQ3A 5EGSA 4YUVA 5CB8A 1SD1A 4BMNA 1NTOA 2PX4A 1DQPA 3ND6A 2NSLA 1G20E 1LX6A 4MAAA 1AQUA 4NJMB 4RHCA 4UMFA 1JILA 3NH6A 2Y1XA 3FPHA 3I73A 2I3AA 1SUCA 4JT2A 4EH1A 1QWOA 3SR0A 2CVOA 1JFFA 2CXUA 3D3QA 4UASA 1L8AA 1VI6A 1W46A 1D03A 1GG5A 3KUXA 3NATA 2PZJA 3DEJA 4REQB 4QTYA 4FOPA 2HDHA 2X58A 3DT8A 2IH2A 1PQYA 3NTOA 3TSWA 5IVKA 3QA3E 3KQPA 5JYDA 1IBLB 4M0EA 3ICQB 4OUDB 2D54A 1RPNA 1M1YA 3Q9UA 2P0EA 3KSBC 4EOGA 1W0JD 5I9LA 3HP1A 2QA5A 3ICEA 4DTIA 3IBFA 2XUZA 1U7WA 2HTEA 3ZH2A 4BV3A 4DMMA 4IL5A 1K4YA 1GQOA 1MNAA 1RZVA 2AOXA 4WGFA 4DZZA 4K0KB 5IJAA 1A4UA 4LZJA 1TPZA 3H9GA 4E5PA 3GV0A 4E4YA 2YDYA 1HLPA 1OIWA 1SCAA 4XRGA 4OU5A 1JDBC 4KNWA 4LY0A 3RU7A 2R6AA 1XO1A 721PA 3UAVA 1N6HA 2DBZA 3NCTA 1G4AE 1QIEA 3KJQA 4EA9A 4IDAA 2HRCA 3H8WA 3HCRA 3JARA 3V4PB 4ALIA 4L6IA 2JAPA 1RBMA 2TRSB 2Z3VA 3KJHA 5HKAA 2VNSA 5EKDA 1JFLA 1IDN1 5K0LA 2WAOA 1UDBA 4FINA 4RELA 1KJZA 1X77A 1MTOA 2BI8A 1NULA 2BFDA 1JR2A 3K9CA 1PTKA 4JLSA 5IYZB 5K4HA 1T0HB 3G23A 1U7PA 3LCVB 5HTOA 3MJTA 3JZDA 4FBMA 2V9PA 5ERGB 1DX9A 1CJBA 3T3NA 3LUDA 4O59O 4GWGA 2CE7A 4Z4IA 5HQ3A 1VHWA 2DWCA 1X74A 1ZMXA 3VU1A 4CFYA 1V48A 3GUUA 2FE4A 3IAFA 3R9XB 4JBHA 1HNXB 1JJVA 1GTVA 1NW7A 5MN6A 3AVWA 3LVQE 1CNFA 1YR3A 1KEVA 1R2QA 4JI2B 1Y4UA 2BSXA 3A1CA 3D31A 3BZWA 2FZKA 3A4VA 4GLBA 5CJJA 1UBGA 5FI5A 3WC4A 3PXUA 1GHTA 1LTKA 3UT0A 3LBFA 2JI7A 4DZRA 2WVGA 4UW9A 3EGXA 4MIOA 4Y2SA 4DIOA 3BXPA 2BKVA 3NRCA 5DBHX 3RVJA 3IILA 5HJEA 3R3JA 2VHWA 3PDUA 4QUBA 4YO8A 3EWAA 4I66A 3C3BA 3SNKA 3VHXA 4WLVA 1MH1A 2P9BA 4DCNA 4EHKA 2FRVA 1YR9A 2PL1A 3QE4A 2ZSAA 3G5MA 2UUOA 2ZT5A 5J1TB 3DMYA 2ZJZA 4RK6A 1G5FA 2BKUA 2P4QA 2ZE5A 4KXNA 2YWRA 4JB2A 1VBNA 3TD9A 4D82A 3R5XA 2P9JA 1IJEA 1EZ1A 3KLMX 3SS8A 2ZRAA 4DLSA 1WUTA 3CEPB 3DV0A 1E66A 4E3WA 1QRUA 4Q66C 1FL9A 1I2DA 1KNXA 4TXHA 3DKKA 1BDHA 1P5FA 1P9NA 4M49A 4NIMA 2D8MA 1GTSA 5AHRA 5TB5A 4Q19A 1G7CA 4FX2A 5AW4A 4IDNA 3IUNA 4M98A 4NCIA 1KE2A 4K7JA 2YJ5A 4ESVA 4K9SA 3UK0A 2VCYA 3BK2A 1K8ZB 1YOVB 2VWPA 2AFIE 2BLNA 3TCKA 5LYYA 2ORVA 4KIGA 4MMYB 1JMVA 4WDRA 4HDMA 5BXYA 3PCTA 5LYJB 1T2DA 5H16A 2CBXA 6ABPA 2GCGA 3N2KA 3EGDB 1CUHA 2P30A 1KVUA 4PLFA 4HWRA 4YROA 2X40A 4UU1A 3AVYA 1QTNA 3UATA 2WJZB 1KVQA 3MS7A 3A3OA 2PE5A 2QLMA 1LK0A 3T5GA 4J49A 3OAAD 5EPUA 1ISJA 4ZIRA 1IM2A 3UMYA 4BEJA 3HO8A 1GXSA 3FOZA 4AYWA 2ORYA 2G1AA 5CR9A 4Q3NA 1R0ZA 5BNIA 4BB9A 3D0OA 1SULA 1C8KA 2FR0A 7REQA 2AHOA 4TS3A 1VKHA 2ODEA 1BW9A 3R20A 1YS7A 4Y2JA 3ZWNA 4RLFA 3V4OA 3WB2A 5JNRA 1CDEA 4JOCA 1AQNA 3D6VA 3HKEA 4JS0A 4W1QA 3LYLA 4ZD6A 3GZNB 3FPSA 3P97A 2BM8A 2IYAA 3KPJA 1I51A 1YAHA 2NU9B 1WHSB 3M89A 1ZM4A 3AEZA 2EP7A 2JVIA 3CNHA 1ECGA 2W6JA 4YAOA 4BDSA 2V4UA 2G9VA 3HACA 1NBME 1GFIA 1NSFA 1ZVVA 3OD5A 2PMFA 3UIEA 4UTVA 1U0HC 1ATIA 1Y6RA 4GGMX 5BMVA 4WBNA 3V9PA 1ZYUA 3I9LA 2Q8NA 4EKGA 1J0BA 2E9SA 3L4EA 4EJSB 3B1FA 4FQ8A 2C20A 1KR5A 1W88B 2CLSA 1K6XA 2JHAA 3AHFA 4BIMA 1TADA 5EIEA 4BZZA 2DY0A 3EIEA 2ZT6A 4IKEA 4MK4A 5FQOA 4AD8A 4DLLA 4LBYA 2P69A 1OVMA 3OWOA 3OZTA 3JRWA 3OT1A 3I8XA 2AFHB 1GA1A 3FF1A 4K2HA 5LQAA 1LZLA 1SIUA 4L8YA 3K1ZA 1ZXLA 2EKQA 5HF8A 4UTNA 1GRCA 4RZSA 4LDZA 3Q8MA 3LK7A 4YRPA 3M33A 4MWCA 3ZN2A 1KAQA 2YZ2A 1M74A 1T26A 3A25A 3RK1A 1B7GO 3OZ7A 1U2DA 5LP1A 1XTKA 1EUQA 3ESRA 1CV2A 1G2PA 3ASZA 2NXCA 2WV7A 2BFMA 621PA 1CP2A 2HA6A 2ZZNA 2F6RA 3ABSB 2Z1DA 4E31A 1G3IA 2ETVA 2BISA 3FLEA 4UFPA 1QHHB 4UM5A 5AVZA 3OIUA 4XJXA 2Q8PA 3I04A 3INNA 4OAPA 4J1TA 3EA5A 3WL8A 2G3YA 4PCAA 3PPXA 4L5JA 1NA5A 4QDZA 5EMHA 3SHOA 1G66A 2P1ZA 2QKYA 5I6DA 4NAVA 1PZGA 2QV0A 4RKEA 2BDUA 1NYTA 1HG0A 3ZBPA 4W5WA 1NF8A 1OLXA 1QF9A 3NAGA 5G41A 3O03A 3DUWA 3SM9A 3VQTA 3LSTA 3K94A 2Z9DA 1L7XA 1Q0HA 3CIOA 1I94B 3CKMA 3RHSA 1SQFA 3VRHA 1I3KA 1XAJA 4EVIA 4ZDJA 4GPD1 2A67A 3DVRX 1I2MA 2FLKA 3L6OO 4IMIB 5DCYA 4NC9A 3NM5A 3PEFA 4Z0TA 1VMIA 1PJ4A 2RKBA 1LJ8A 3ZV5A 2GKGA 3D3EA 3L0SA 2AOTB 3LPNA 5AI6A 1L7VC 4OGGA 3TUIC 1E4VA 3SQOA 3BK1A 3DG9A 3I9JA 3FNHA 3SX0A 3AZOA 5L4LA 2ZB4A 4J75A 5DEOA 3BA1A 1Y7TA 3T9BA 2XD4A 2DKFA 4DS3A 2WW8A 4MR8B 2BGUA 4YRBA 3DPSA 1KYQA 2ZT7A 3M8KA 4XUEA 4CWAA 2FP4A 4V1CA 4K9NA 4EG8A 1N8KA 2HQSA 1DAPA 4UHFA 1UBJS 1RR6A 4GUAA 1U9JA 4C88A 2FJ0A 3WB1A 3C45A 1C8VB 3X44A 4MS1A 4MIKA 5JXJA 1BCRB 2ZRDA 1FDWA 5H3CA 4BTVA 1UJ6A 2AN9A 2JFNA 1IZ9A 4WA8A 5I8WA 4FFMA 2GF0A 5B1DA 4AJPA 1G18A 1NKTA 5CU7A 1DC7A 1KZ7B 4D4MA 2GOYA 3UJ3X 1Z82A 1ZJJA 3GEHA 1YZKA 1GFSA 2GBFA 4CN8A 5AMXA 1VKRA 2IBMA 3G0OA 3HVKA 3FCUB 1Q95A 2GAIA 5C5CA 3I2HA 3BCUA 3I92A 1WDMA 3HKCB 2J6IA 3AK4A 3PQ8A 4FR0A 4GI1A 4HWSA 3ETNA 3BPSA 4UUPA 4Q9DA 5GZ6A 4JXZA 4ENQA 4AJHA 2QR3A 3FYUB 5J2UB 1PLKA 1ZRHA 3CJQA 4A26A 1WF6A 4L4UA 5E0KB 1ZCAA 4IH9A 4YRJA 4HGOA 1QQ6A 4CT4B 1H66A 1CVLA 2QE6A 3VTZA 5JNLA 1JDJA 4YLGA 1ISMA 4OJNA 3USES 4X71A 1JWBB 2QLBA 1XRRA 1TTHA 3HYSA 3IVAA 4LQLA 4AMUA 4BXOA 2DAPA 2GJ8A 1U0NA 5F5XA 1QHIA 4EHHA 5G0SA 3FDZA 4IUYA 3SJCA 5CFQA 5EJ6A 3QJ5A 5BSRA 4BKUA 4OLAA 1W36C 4ZT3A 1V1JA 2O14A 3BOSA 2E5FA 1ZCZA 2ZWAA 5ICFA 3SQXA 3FVWA 2B1IA 4BQIA 3Q7SA 4NG4A 1RWWA 5L51A 1E7WA 2SCUA 3X2FA 3ORFA 2I2AA 1QS0A 3LT1A 4QRIA 4OREX 5AXDA 5C8XA 5HHTA 1L5FA 4OLBA 2QJFA 1DLJA 3COYA 4ZANA 4CE6A 1YASA 2QD2A 1U0GA 2DHQA 1PWEA 5A4MS 1E6LA 4BNIA 1QFJA 2V03A 3ECSA 3OX1A 1T5SA 2IYQA 4PTLA 5G53C 5AK6A 3M9LA 2X8AA 4KRFA 4DIBA 1CQWA 1XZQA 2OQVA 4B45A 3EW9A 2FPGA 3A0UA 4E1BA 4W9NA 4AN4A 2IL1A 4NX2A 3IXQA 1P5RA 3DO5A 4KFUA 3WWDA 1HC7A 3GRRA 3R6TA 3UHOA 4L7QA 3D6UA 3I6YA 3GRYA 3NBYC 4CQMD 2QJTA 3HHEA 2B3DA 5AVQA 2EYQA 1OC4A 5HXAA 3D6MA 1L7RA 5KYXA 3UG6A 5KWEA 2FZWA 4DEXA 2ZVDA 3HJUA 3N87A 3DCIA 3CY6A 4LJ9A 1PWHA 1RWXA 3GL9A 1SIBE 4QBGB 1NBAA 2ZJBA 3FW1A 3G2IA 3FVQA 4OO3A 1Y8AA 5JS2A 1RRKA 1T15A 3L1IA 4LJSA 4WESB 5A6SA 4PFQA 4CPDA 1NVVR 4KV9A 1KEWA 1GGMA 2DH5A 1K5HA 3RYFB 2R5FA 2CKMA 5E1OA 4MUBA 5HF9A 3CLTC 3F3KA 1YK0A 3OSZA 2QXYA 2WSSD 4JL6A 4NATA 3DFFA 3SEZA 3U3ZA 4P4LA 1LQUA 3KVNA 3N6VA 4GX5A 3H5AA 3QF7A 3CX4A 3I1IA 1OT3A 2Y76A 2AJBA 1Y33E 1HH4A 3FYDA 4HMPA 4KVAA 1P7ZA 1RP7A 1U8ZA 1S8NA 3QYAA 3WR5A 5JH7F 1M6VB 4AO6A 1BX1A 2J45A 1E0SA 1I33A 3WJAA 5IBRA 4O4IA 3LJKA 1EE9A 4Q05A 4RD3A 5K0SA 4HRAA 3WLHA 1X1DA 4D8YA 5L53A 2W2XA 4YAFA 2F00A 3DMNA 1DEKA 2BUBA 3G2QA 1EX6A 3TQRA 2V0GA 4BZXA 2UUAB 3L3BA 5J63A 4EF4A 5K3FA 1IQ0A 1X9IA 3C4JA 4P22A 3STTA 1EZZA 4I3HA 3BA6A 1K75A 4L4XA 5B3JA 3TLCA 1PVVA 1Z5NA 3MWEA 2D6FA 2GCNA 2YQ4A 1ILWA 4JA0A 1LV8A 4I5DA 1OV4A 1U2GA 3ZHUA 1G5PA 2HV8A 3SHVA 1LZKA 1Z7GA 2BFOA 1UBSB 3AHGA 2SKDA 3FWKA 4LJ6A 1P73A 4MV3A 3S1LA 1BEUB 1MXFA 3V7FA 3P2JA 4KXXA 2B8TA 4BYGA 2PXAA 3M49A 1BEEA 2AW3A 2DM6A 4PC3A 3IVGA 1UXIA 2D8AA 2B0JA 4H27A 4LK3A 1F6BA 4LXQA 2KS6A 4LZOA 4ND8A 1QO0D 3QG5A 4HAVA 3KRTA 4K0RA 4W1SA 2B5VA 5TVKA 2AQHA 1KOLA 4D6PA 2GSWA 2OV2A 1J8YF 3WKBA 2HMYB 3GXBA 1PJBA 3IMKA 1Z5UA 2R4UA 3VI3B 4KUEA 2F9LA 4URHA 3LBAA 1C8BA 1VBMA 4MI9A 1YB2A 3HYTA 4QU0A 2NX2A 4D97A 4L5IA 5F2EA 1TF5A 4PSKA 1XV5A 4OM8A 5ILQA 2D4AA 3KUUA 2XMDA 1PYDA 4EY5A 4E70A 3BL5A 5AJYA 1SU4A 4ER0A 3VH3A 1Q20A 2R44A 1M1ZA 4Q3EA 4NNPA 5I5GA 2G9RA 2OOSA 3EG5A 1WEHA 1YC5A 2NXJA 1N5DA 3GFBA 5SY9A 5FIUA 3PIIA 3QFHA 3VUFA 3A2MA 2FHSA 1SCNE 4JFAA 1Z7EA 2X13A 4DCPA 5CFNA 3PX2A 4GU5A 4PQYA 5JFGA 3T9DA 2IYOA 2L69A 3DL0A 4PLWA 2H18A 3SEQA 1LKZA 3KSRA 2HSEA 3M82A 3AUSA 4HXEB 2PWYA 3F5FA 3R4VA 2YZ7A 5CT6A 4QYMA 1QLJA 3BTSA 4AKGA 1M0SA 2ZK7A 3HU3A 3EXFA 3RYHA 2YBEA 1J5EB 1WUJS 4UE6A 3AY0A 2CXHA 3KTAB 3ZD9A 3KYDB 1XT6A 2OXEA 2B78A 3BMNB 4M21A 3H1GA 4S3MA 5B7NA 1E5VA 4ZAVA 4C7JA 1IHUA 5CEJA 5LOVA 3EXEB 2YJZA 1R74A 3ZQUA 1EFTA 2MSEB 3B3FA 4MI6A 3UM9A 2MSCB 5U4XA 3SN6A 3DQQA 3EEFA 4EVRA 1MO5A 2JAHA 3OA0A 3GK3A 4OA8A 4P7GA 3V4FA 1XLTC 1B1CA 4BVAA 2XXAB 2HPHA 2VJDA 1MO6A 2O2SA 2P1DA 4YV7A 2EERA 2YV5A 3DC2A 3L4BC 1WDWB 2AVNA 3P0IA 2WJIA 3FRIA 2A33A 4JT4A 3MJEA 4F3KA 2RGBA 4L4ZA 4ZVSA 1P77A 3BB3A 2CJFA 4YJ2F 5FO1A 2IIVA 1P2TA 3O38A 1EK0A 1DIHA 3QVLA 3HCPA 2PEYA 1N25A 1PEKE 4ZO6A 4OBEA 1QPZA 3I9KA 3U9SA 1E3TA 3DKPA 2QN8A 4ZV9A 4RTLA 2ACWA 1NT4A 4Y0VA 2QN7A 1SC9A 4NOJA 4PPGA 4BX8A 2JPDA 2QTNA 1OYYA 4QTUB 4UM8B 4WFIA 1E2EA 3H99A 1CUYA 2XF8A 3DHYA 1I3LA 4I9HA 5CTAA 5JAMA 1HO3A 1A4XA 3ACDA 1LY1A 1COZA 2J67A 1XZEA 3R3YA 1XC7A 3ABQB 3P45A 4LVNA 2HHCA 2NVUA 4PFJA 5CA0A 5KQSA 4Q6BA 4JU8A 4X8OA 3VU3A 1DQZA 3UB3A 5DNDA 4JI5B 1C81A 2XZLA 4JLPA 4TLMB 4F4JA 4N65A 3SICE 3BD6A 4GPZA 2DQSA 4FZRA 3V4SA 4YPFA 3H9JA 3Q7RA 1WY7A 4ND1A 5CFZA 1XHLA 3EAFA 3CZMA 4QVIA 1FS4A 1G42A 1WOMA 1G7RA 3VVMA 3PFBA 2NTNA 3HVJA 4KXVA 1V4VA 4JY7A 1Y8QB 3QWBA 3TLXA 1SVKA 4B3DA 1O0CA 3C24A 5EJ2A 1ADFA 2HDOA 1VG8A 2RH8A 2ZRFA 3AUYA 3F8WA 4GC9A 4UU7A 5AI8A 5T64A 1DPGA 3KEQA 1Z5PA 3L1JA 1JHOA 1HEYA 2HIGA 1U2ZA 4I9FA 3I12A 1YA6A 2BEVA 2ZI5A 5FOTA 5IJ9B 3K70C 5FEMA 2JFWA 3ENZA 3QJYA 3KVRA 2RBKA 2R8OA 1M2JA 4UKDA 1YDGA 1OJ7A 1H65A 1W47A 5DX0A 3CWQA 1N1EA 2Q1WA 3FFXA 2D7JA 1AD2A 5F7XA 3P20A 1N2CA 1B4DA 1Z38A 2FN4A 2NYAA 3IB6A 2FP3A 1S7GA 3WYDA 3QPVA 3AF3A 4TXLA 1G20A 1HM5A 5DWVA 3VYUB 4ZCTA 1E1RA 5AM2A 2JAUA 4R16A 2WWTA 2JLQA 2IKSA 1R8SA 4HPXB 4HKTA 2ZXFA 4P5EA 5DYGA 3LW8A 5K05A 4U2BA 1AMNA 1R50A 1V4NA 3KQLA 8MHTA 1E5XA 3GAMA 3H4MA 1B41A 2IYYA 1PI3A 4ZQHA 2X7HA 1JKXA 4XUCA 4CM9D 3UBMA 3C41J 2FZEA 2QYOA 1FBTA 1P5ZB 1XFAA 4Z9AA 4BS9A 1C7QA 3DA8A 3WOHA 4DJJA 5JNWA 5ELXA 2QVXX 2ZKLA 4KL8S 1EA5A 2LWIA 1YR2A 3HUUA 1TJ5A 4I46A 5HF6A 1BQ3A 2V6MA 3K71B 1EWVA 1XCGB 1FFAA 2RGXA 4OFBA 1Z88A 4RVHA 5IJWA 1WETA 1R8YA 3I37X 5LZ2A 4ZCQA 1K97A 3QIVA 4UEQA 4YRGA 1TZMA 1P7WA 2XODA 4M83A 4ZVUA 1I32A 4NOKA 3BJZA 4C7OB 4IS3A 1I7PA 5BWBA 2N0SA 3B51X 3I1FA 3R5JA 3Q9LA 3AZPA 4PNHA 3P9QA 1SO8A 2BJWA 2IOQA 2VPZA 4MUNA 5KI6A 5JASA 2VH2A 4A03A 3DE7X 3UWMA 3R3SA 1T36B 2M6KA 1U1IA 1RDFA 3KALA 5J4YA 1YZGA 1UK8A 3CO0S 3DOFA 3M1IA 4FEGA 4WE3A 5D1NA 4G0ZA 1EM6A 2DBRA 4KZPA 3N0VA 3TIFA 2ECOA 3TLZA 3GLIB 4R2MA 3TUJC 1ZWKA 3GHYA 4MR7A 2QQEA 3M34A 4IVNA 1TJYA 5FUWA 3U9TA 3UJ9A 2NZ8A 2BSQA 3MWGA 1WJGA 3MEQA 4RPJA 1FU7A 2HO5A 5P8WA 1CS0B 3DBRA 1QGED 1NQUA 3D7LA 1BXRA 3HDYA 3G2JA 5FFFA 4JI3B 2A35A 3V2HA 4IZIA 4JB0A 3IT2A 1E3DA 5TS3A 2ZITA 3NVMB 4ASUD 3TZ6A 1PL0A 3ZCUA 4FLFA 1PSZA 3EDMA 4G1BA 2PD4A 3S29A 3R6WA 1F8XA 2AUNA 1YU6A 4F97A 2FSUA 4N1AA 4MYCA 4A16A 1T9BA 1Z2PX 1WCXA 1SBNE 2A14A 3KKOA 3E03A 2G7ZA 3PEYA 5B2FA 2E0IA 4MQEB 2KM1A 1QIJA 2QQFA 3B48A 4XASA 3RCBA 3A3KA 2B4AA 4C3OB 4D3DA 2C5HA 4WCFA 1NYRA 2HDNB 3SHFA 5DM0A 3AESA 1PQ4A 2HY7A 1U7ZA 2YXLA 4QDUA 5I7HA 3RRYA 3E18A 5FNZA 2YFYA 5SY6A 3TXAA 2O2XA 4TVKA 2W83A 2WTAA 2Y6UA 4PLCA 4YRNA 4Z7JA 3OFND 3ZDAA 1ZMTA 4LJ7A 5K2OA 3K8QA 4G8JA 4KWHA 5HM8A 4GZ6A 4H1WA 3BXEA 4BJ3A 5BYJA 3WGGA 5FRDA 3GVHA 3BRQA 3Q5GA 1ATZA 2UXBB 2I4RA 4MMZB 4C4PA 3AF6A 2QB5A 4O8ZA 2XW6A 1QHFA 3WMFA 4EKDA 3SF8A 3BMXA 4URZR 1AURA 5F35A 1GZSA 3WO0A 1IXKA 4BRWA 1ZONA 2J4DA 3LXMA 3DE2X 3HBAA 2NUPB 3H9CA 3NUGA 3W34A 3GW8A 3H13A 4LX0A 2G40A 1NATA 3O1LA 3NXKA 4J9VA 3O47A 4C2BA 1ZINA 1NP3A 5ANRB 4LBZA 1CG6A 4M99A 4A8JA 2JVKA 2ZYRA 4MUXA 3F2VA 5IT0A 3MN1A 2WAYA 4WSOA 5IAJA 3TBKA 2JATA 2C84A 2AFIA 3GA0A 3MWFA 3OZWA 3PHJA 2NO1A 3V1TC 4AP9A 3SSOA 4BCDA 2ZVPX 3Q6NA 4KPEC 2Z30A 1UIMA 3D5EA 4D80A 4F0JA 5CDHA 2MSLA 4LY6A 2GNAA 3QVTA 1ZHFA 4I8DA 3HGMA 1C3EA 1P7VA 1QZ3A 2PQ0A 4I08A 3GH1A 3O5AA 1SIWA 4FE4A 4KBFA 4FJ1A 2VZ0A 4JODA 1G1AA 1X7XA 4HXYA 4R1TA 1LDMA 2J3EA 4GI5A 4AMGA 1PT8A 3O4FA 1GPH1 6CHYA 2ZYTX 3CBQA 2AX4A 5KYTA 1OWMA 5F73A 4D4KA 4Q16A 1T1EA 3ZBUA 4FIZA 4EZEA 2ODWA 3QVKA 3C6XA 1YVUA 2FB9A 3FXAA 5B4TA 1FX1A 3K05A 3U80A 1PZXA 4CQMB 4KE6A 4BFSA 1C9EA 2VJMB 3F9IA 1J0AA 1YB5A 2WHXA 3JQFC 1GUZA 1PG5A 4HQOA 4P4GA 3C3CA 3SJAA 4GH5A 1QGOA 4HGYA 4QM6A 4JT9A 3H7AA 3SDBA 2H1FA 1SY7A 2IS1A 3A14A 1FZQA 1EUDA 1R3DA 1Y81A 2QX9A 3R5FA 3ET4A 4XPIB 5EIOA 4R5MA 3V8QA 2N1BA 1VCNA 2FSHA 4KREA 2AGVA 3EN0A 2PZEA 1JDVA 2JGNA 3UB2A 1JJFA 2V5UA 4DYDA 1E1NA 1NBMA 3FRJA 3GJXC 4FYVA 1QAQA 2XTZA 4PW0A 2AUMA 1JLRA 1MHPA 4F9FA 5FBZA 1L4GA 1WMDA 3EMBA 4EMUA 4ZI2A 1QK5A 1Z6XA 2ZUCA 2QT1A 2OCYC 4AAYA 3A6LA 4Q34A 1F3LA 2JGIA 3BDIA 1OIXA 4AZWA 4CVNA 4XVUA 5KYNA 1E2LA 3E8SA 1W85B 5MGBA 1ULSA 3ISVA 5J5AA 5GADl 3NHZA 1OA0A 1XWIA 1F4VA 1NIJA 2GAFA 3PGXA 3BB1A 1QRAA 4IXDA 1ZY2A 1BE1A 2PX8A 2RGDA 3PF8A 4N6NA 1N77A 3GY0A 3KPUA 3PDHA 2C5EA 4BNHA 1AB5A 3LWBA 1QV7A 1N3YA 3PZBA 2ERYA 2PMCA 1BMTA 1SXIA 2ETXA 1KZGB 3CUTA 5ERYA 2XGGA 1N9KA 3GARA 3H18A 5IUJC 4EECA 4FCVA 3ETEA 4QFDA 3U49A 3ODPA 4D74A 3O8CA 1O5TA 2GARA 2E89A 2ORWA 4M0PA 4UFOA 5FWYB 5J59A 4AJLA 3KQHA 1YHZA 2FN9A 1MOPA 4LYAA 1V3TA 5COAA 4DV3B 1M2VB 5AI4A 3HVRA 3PSHA 1AQLA 1Z6GA 5BSHA 1GPLA 2Q27A 4NPHA 3ZDFA 5BV0A 2X0DA 3KHUA 3CR3C 4MVCA 4MINA 4MVJE 4HI0E 2AOVA 2YFHA 3QE2A 1HGXA 1P9RA 3OURA 4DLBA 3BMCB 4F4FA 3H1TA 3BKXA 1YKSA 2H4FA 4Q3DA 2YWHA 2C2ZA 1WE2A 4YJ3A 3EZXA 2QVLA 3IQZA 5BQFA 1RABA 5LDHA 4B0OA 5AQ1A 1A8SA 3OZFA 3DMRA 2R1TA 2HWKA 1M1NB 1XCLA 3THSA 3MS2A 1VHLA 1JIUA 4H1TA 2Y6VA 1JQ5A 3WS7A 4O1MA 1CJVC 3HSKA 3OZCA 3L9WA 1GKKA 3IR5A 5BNZA 2QRVB 1M8JA 2PL3A 2XQVA 1RWMA 4U3JA 1J8DA 5JO9A 3VYWA 4RCVA 5MGNA 2WEKA 1QP8A 3ZJUA 2FE1A 3M81A 4FYPA 4OHCA 3RKSA 4JXJA 2Q3EA 2OYCA 1BO6A 1SELA 3Q0TA 1SGWA 4L73A 4B47A 1MO3A 1CBUA 2BONA 4RPKA 1VXRA 1CUJA 1XXHB 2R6GA 3B89A 3H83A 4BYMA 1K5DA 1AXGA 5EMNA 3UMJA 2WE7A 4WY5A 1CR6A 1JZTA 1K8RA 1X13A 1X9GA 5HJ7A 1IOZA 5ITZB 3DMPA 3K8YA 1AJEA 5TQ0A 3NTLA 3E9DA 3L8DA 1JLLB 4A1FA 1D6MA 3QQPA 3BGSA 4P7JA 5JAIA 4XD2A 3MD0A 3LPDA 3V97A 3ZQ6A 1OBVA 3MWDA 3WGTA 5BNTA 1BSVA 2VSFA 2QRLA 2XMZA 3LPLA 3CN7A 3WL4A 5IW8A 3E48A 1FRVA 2HRQA 3F6RA 3K09C 3LRTA 4UHJA 1GU0A 1XTJA 1SVSA 4MULA 1G6KA 1E1CA 1VL8A 4B6RA 1R0XA 2UAGA 1E1MA 1G21B 1WVMA 1JQLB 2B5WA 1P2BA 1MX9A 3HDJA 5KJ6A 4A0SA 3EEOA 1FVHA 1EA7A 1MGOA 4E09A 4XCVA 2X2FA 3BL6A 5HIAA 1X8JA 4MRVA 3P2MA 1THMA 1BKSB 2FFBA 4LC9A 4QYIA 4IQ4A 4DQUA 1UDCA 1FFGA 2EJWA 1O77A 2ZE6A 1PRYA 4OVKA 4BLVA 1F9EA 1QUFA 2N42A 3I5MA 4IHJB 4LKRA 1QFXA 1KJQA 3SP1A 2P65A 4BVLA 5A5EA 3EVGA 3KS9A 4M7WA 2Q1XA 5MFPA 2PY6A 1ZICA 2YWBA 3KPWA 1UXHA 4G8BA 3Q72A 4HGNA 1FP4B 2ZUFA 1HLDA 5IS2A 4RF2A 1EHCA 1H1DA 5H59A 2XA2A 4MWBA 1G8FA 5FOSA 5YASA 3G5AA 4CEIA 5IASA 1NN5A 4L07A 1A8PA 3B82A 5CM8B 1UJ5A 4IRUB 3H4TA 3II6X 3R8CA 2IXGA 3HRIA 1TQ2A 4KRXA 1KJWA 1YTUA 1T4GA 1CRLA 2FMIA 1R37A 4HN2A 4OSPA 3ROZA 2QL5A 1OI4A 2O07A 3RSHA 2HI0A 1YMUA 3FAZA 4ZHQB 4JBXA 3HY3A 2CLEB 1ILEA 4W5RA 3I5AA 5B3KA 3PL5A 4II7A 1LRKA 2Z2YA 1Z4OA 3M4ZA 1G7TA 2QU7A 5M3BA 2VJCA 4LE2A 3UK1A 3OM9A 1UKAA 2FPLA 3NP9A 4HYTA 1UEJA 2EGGA 2EEPA 4MLCA 4ARUA 3ESXA 3AUTA 3BN3A 3DOUA 3TAHA 1BHSA 4HCJA 1Z08A 3UBTA 2PMWB 1U7OA 4BNNA 3AEXA 1K0UA 2EX0A 4MKIA 4OQDA 4P6VF 4AYXA 4R71A 4YJFA 1HDRA 7YASA 1OASA 3MJCA 1BZYA 2HZ7A 1LBTA 1ENOA 4G63A 4CDGA 3I2FA 2OXFA 2ZSKA 1X7YB 3FLMA 4LY9A 4BY9E 4KXUA 3RS3A 2Q28A 4A15A 3RF6A 2H4HA 4UOQA 4HNRA 1VL1A 2WHRA 3P0RA 4FHCA 5DGHA 5DNEA 5T67A 2A8YA 1MAUA 3A4LA 1KAHA 3NBXX 3Q1KA 1E9BA 2QNBA 4ZK2A 1PR2A 1A8IA 3N2ZB 2IEZA 2ZJ8A 3D4BA 4LV8B 3ROQA 3RVSA 3R6GA 1RKXA 2A2ZA 5LQSA 2QVZX 5BORA 1GNVA 2DUUA 3QITA 3DUFB 1Q7RA 3IP3A 5AYVA 5GPBA 1PSDA 2YQZA 5IANA 3OEHA 3PXGA 2JH3A 3O1JC 3WP0A 4HS9A 3MJSA 1SUEA 1Z45A 1ZGCA 3BRWA 2YXNA 3UHAA 2J7PD 1DJQA 1IUPA 2J33A 3IJRA 4A7PA 4ETIA 2NYVA 4YP1A 1DELA 4WW0A 2GPNA 3PUJA 2V98A 1OF1A 3T94A 3ADOA 2IITA 3UGKA 4B74A 2NOAA 5E2BA 5CCBA 4JJIA 3SFTA 5CA1A 4X94A 5JH7B 4UU8A 5ABPA 4RYLA 5K3CA 4RZUA 5BN3B 4M6WA 3E9EA 1R4MB 3V1KA 1FE8A 3A6HA 3KYJB 5T5QA 4EFLA 4AI6A 1KIAA 3JU3A 4ZQFA 5BQOA 2V5VA 1JB9A 1WEKA 2W2LA 4E12A 4HGRA 4YRAA 2BV3A 3LSYA 2GBLC 2O8CA 1C1YA 1R9MA 1B8UA 3F67A 2P90A 2XUPA 3L1HA 3QHAA 4D25A 4UNPA 2DOKA 4UHHA 2VSXA 1N2BA 1IY2A 2GKSA 2FG7C 3OEYA 2A30A 1NAIA 4RK1A 4CHGA 5JCOC 3KSAC 2PGOA 7MHTA 1N78A 4I4CA 4XGKA 2OGWA 3DTYA 2O6HA 3LLCA 5TJHA 5A5GA 2VDOB 3W06A 4DQLA 2L0XA 1CUUA 1WUHS 3QVVA 2PH3A 4C4RA 1PSWA 4UULA 4E1AA 1E3EA 1WUYA 1YDHA 1J22A 4I9NA 1Y9JA 4D4GA 2WZCA 3HFGA 4H6XA 4LBWA 3VKVA 3C3MA 3ZXIA 4JI6B 4WKBA 4TKMA 1K92A 2NT3A 5L4SA 4JJ8A 1U28A 1J0CA 1VJ1A 4K6GA 1KI9A 3WLKX 3CH7A 1B6TA 4GR4A 4OJMX 2AIRA 4Q01A 1J4AA 3FSJX 1VA5A 1JKIA 2QTLA 5D5PA 5FOQA 3MVEA 2JDID 3C5WP 2HL6A 4XQ9A 5DP1A 4CLEA 4RENA 4G97A 1NQ5A 1FNCA 1S1CA 4TYNA 3A9WA 1Y63A 3AG5A 3FD8A 1NNSA 4QG7A 3QELA 3M1LA 1FYFA 1I4TD 2E85A 2YY6A 1RPTA 1HE8B 1T29A 4TMVA 1RPZA 4MS3B 4Q9HA 2PKQP 4EHDA 3CS3A 1ACJA 5EE3A 4ZJYA 2ZB2A 3TRJA 2IPAB 3HJBA 4BVKA 4E33A 3A1DA 4L22A 2E5LB 2C5LA 5LBIA 2O0HA 3KYCA 3CCBA 4EW2A 3SVLA 3WKEA 3L6BA 1EE2A 5T4HA 1UP4A 3JRNA 5BNFA 1XTVA 4R1UA 5EFOA 5DBGA 3WK6A 5THXA 2Y93A 3TIIA 2OV4A 1VPDA 4L3OA 2HT6A 3QTLA 1U0TA 1E94E 1ZVQA 3NWBA 2RB5A 3I3SR 3M4YA 2FQ1A 1BXGB 1YVDA 1MG5A 3O1HB 5CBPB 3IR6A 1NR1A 5HRAA 3L1UA 5LVAA 4BWGA 1YS2X 1MVOA 2VP5A 1RWVA 2B30A 1HWYA 3BSFA 3LY5A 4NNJA 3TKAA 5JZSA 2OZKA 3Q0IA 2HHLA 2OAEA 2Y1OA 4DQKA 1JEQA 4JQYA 2RARA 3G59A 4JEIA 4UHBA 2H16A 2XB9A 3WZMA 2YFQA 1IXZA 1H0HA 5DYWA 1PHPA 1UCFA 1UPCA 2DWQA 2RHJA 3T9CA 4Q4CA 5K6TA 3G0HA 1H9AA 1MMFB 1NVEA 2ZBFA 1JSXA 2FUKA 4YJ2B 5JDCC 4ZCMA 5DP2A 1L7PA 1XMVA 4PPFA 1POXA 2PWBA 3NTXA 3UFXB 3ZJ5A 1PGQA 1BH2A 2IHZA 3O21A 1HRDA 4PXAA 4L78A 1O6ZA 3B2NA 5FUVA 3ZEAA 1YI0A 4L51A 2BEUB 1OV6A 3P8ZA 4PX5A 3FOFC 3SHQA 4HNUA 4N8EA 1E2GA 4DCJA 2FWJA 2QXUA 4LWZA 4P9NA 3UMRA 4C6RA 3E7XA 2BL4A 3CNNA 2QW8A 5D7BA 2X9GA 4RNDB 4IIUA 4V38A 2JKVA 1OGIA 3TKYA 4BB6A 4MKHA 2DSNA 2ISCA 2Y4OA 1KKUA 1E9DA 1OHHA 3KJFA 3OLVA 1P31A 4GYWA 4EA6A 1QGZA 4Z2AA 1QFMA 3OTOB 4PLYA 1ZUWA 3MOGA 1VI5A 2PWZA 3JR7A 1TLLA 2OESA 5LBUA 3S68A 4EYOA 2JCBA 2JLYA 2R8PA 1VHJA 3HUFA 1EGHA 1RAFA 4KWIA 2BRUA 1A50B 1X7WA 4XR9A 1MZPA 3PPVA 2F3UA 3NHKA 5B3LA 4V39A 2EL7A 3U4QA 3ILXA 1WP4A 1XDZA 3L79A 1NQTA 1ECBA 1UPTA 3ADCA 1OGYA 4MIYA 4NBRA 1AZWA 1E3JA 1A5BB 1SCJA 1USKA 2W6ZA 1TKCA 2JNWA 4QTTB 1P9LA 2F43B 4E2YA 2Q5JA 3K0BA 3FCOA 3U6KA 3M6VA 3BF7A 5HIMA 2AKYA 1LW7A 4Y8VA 2FH5B 4KAFA 5DM4A 1P0MA 2LIVA 4CTJA 5C8DA 2GA8A 3COJA 2FDRA 1RT9A 2XVYA 2QRMA 3C85A 2FFJA 1XRQA 2V97A 5HBRA 2XA1A 3W05A 3R7NA 1HZZC 4CF5A 1YV9A 4AJ2A 4N8SA 3HLKA 5HM6A 2VYNA 3QENA 4PVCA 2ZJYA 1L1RA 3UXHA 4OJQA 5CHEA 3SE7A 2C5AA 2PR2A 1UBLS 5FTLA 1F51E 5ELMA 1E5DA 3Q9NA 3LH5A 2BGRA 5D6OA 2WYUA 1MV8A 1RRFA 1TU3A 3KEGA 1ISPA 1O87A 2CL6X 3UJ7A 1RYZA 4S0XA 4OJYA 1XOIA 3NBFA 3FE2A 3KSDO 4TM8A 4NBNA 1KBZA 2G82A 2XGOA 4HSEA 3UC5A 1YRYE 2XD9A 4IW3B 3G2LA 4UAVA 3AR8A 4MS4A 4R1QA 2JI4A 4PIVA 4WKPA 4XB2A 1RC8A 1R8JA 4RMIA 3RFXA 1RRPA 2G1PA 3Q88A 5L7YA 2Q29A 3QU2A 2C1EA 4IP0A 5AVRA 3CLTD 2FZVA 4TVBA 3NHRA 2HSWA 1K27A 4GZ5A 2C7QA 2UVQA 4KDCA 4QUIA 4P35A 3U3DA 3W7VA 5IM4F 3WQBA 3HM9A 2I67A 3CUKA 4TLCA 1R4ZA 3RG8A 4CUKA 2F1RA 2RHOA 2ZWMA 5JPIA 3GLGE 2RAFA 1E69A 2HJHA 5G0VA 3TNJA 3TW8A 4Q12A 5A2GA 3OFKA 4ZXFA 3CLKA 1L5OA 3BFJA 4A6PA 3N8IA 3A10A 1IAVA 1EAMA 4TT3A 4MLDA 1V71A 2NM0A 1JDBB 4C4ZA 1HBJA 3SR3A 9ABPA 1OUMA 2B98A 3QEJA 3A2NA 9LDBA 3TL3A 3PENA 2VPIA 3EZGA 4CL3A 3OX3A 2CLFB 3GMDA 4KRYA 1DV1A 4KW7A 4UE2A 4KRGA 3WB0A 3UA4A 3FR7A 1M8PA 2P6PA 2R8EA 4KLRA 2NVWA 5HGXA 4Q7JB 1EGVB 3UV7A 2HWUA 5DBEX 1HQYE 2LDBA 5AQEA 3V4ZA 4EF6A 3A0RB 3F6CA 2X8BA 1H1LA 5T8KA 2ZIVB 2JEYA 3A1SA 3IOYA 3MIZA 1PL8A 4X84A 1P1JA 5JW6A 1XA4A 3I3OA 2H31A 1YKFA 2PX2A 5AVSA 2JKZA 3VNQA 3LQRA 4MGEA 3TWOA 1VJRA 4ZOLA 1N0UA 4UEWA 1J1ZA 3UZUA 1RM4A 1S2DA 1GR0A 4J4BA 1VHTA 4YRIA 3DULA 5IDYA 1XGKA 1U6JA 3DR5A 1OXSC 4B7ZA 3ZHXA 1QOPB 4BX3A 5K8TA 2FN3A 3QSGA 4OHYA 1JKJB 1Y9ZA 5E8RA 1VSTA 4JP1A 2RGUA 4TKVB 1CZUA 3D5TA 5LIPA 3VOBA 4EY6A 4S04A 3V8PA 3ORSA 1T0IA 4RULA 2AK2A 3HB5X 3WZ2A 2V7QA 4G2TA 2AFHE 3K32A 1ODSA 3OPMA 5D3KA 4DSOA 5FTKA 4JYPA 5DLEA 3OZIA 3K1YA 3TQOA 1EUCA 3ZU4A 4GE0A 5JSYA 1FP6A 2XH8A 3IPCA 3PT5A 5H70A 1RLIA 1YAJA 2YNMD 5B37A 3SKXA 4C6TA 4CMIA 4X62B 4RTMA 2J4CA 1HTTA 4O4HF 3D8SA 1XIVA 1WG8A 2LE0A 3MMXA 4J0KA 4JSRA 4OXRA 5DI9A 4K9KA 5KDLA 1B74A 3G5UA 3N3AC 4K05A 2VYVA 4RA6B 2GZ2A 1IN1A 2XNKA 1CZRA 4MGZR 5DV9A 3Q9SA 2BGGA 4M9UA 4M0FA 1SHZA 2QE7D 4O2LA 2PSJA 1J8QA 4YLEA 3P9XA 4BJ5A 1C9DB 3QHQA 1E64A 1NQXA 5REQA 2BM9A 1P5HA 2UYGA 3REGA 4UUMA 4NDAA 2XPCA 2PMKA 3HFJA 2PZ8A 1E8MA 3O3NB 1IUOA 3M3DA 1FQWA 2I71A 2JFFA 3V1UA 2Y0BA 3WGZA 3DBVO 3GG2A 4TUYA 1IEWA 4CG0A 1KTIA 1VLVA 1SCIA 3WAKA 3I9FA 3E9QA 4YJHB 2JGFA 4A73A 2IF2A 4KIWA 3WG9A 3Q5EA 1ODLA 3VPGA 5LNK6 3D6NB 3LQQA 3G8YA 4NYJQ 1XYGA 1J5XA 1CUFA 3DWGA 4HRXA 5ALHA 2IYZA 3THRA 3UXEA 5DM60 2IS6A 5FLKA 1FTQA 1G9XA 3NKFA 4W7SA 4CM3A 2HCBA 1J21A 3T3EA 4GM1A 2EKDA 5HKOA 1D2RA 5F12A 1JAHA 3QLEA 5EMMA 1II8B 4Z9YA 1EGMB 1AOXA 1NJGA 2PRKA 2D5CA 2QD1A 3HDTA 5E7MA 1IHPA 2BI4A 1ZJ4A 3ICPA 5LA6F 4R83A 4I2NA 4CMEA 3FTCA 1ZOLA 4N3CA 4Q4LA 4BO8A 4E13A 4RFSA 1NJ2A 2PWAA 4Y6LA 3VU9B 5JD3A 2HNBA 2LPMA 2XTJA 1YB6A 2VAVA 2M1XA 4MQLA 2NNWB 5GP1A 3MJHA 4Y2HA 5HRCA 4ESEA 3CZ9A 2ADFA 1PDWA 2EYUA 4RKWA 4A0QA 2BSAA 1T91A 3AUJB 1EH5A 1GAXA 3T3PB 1G17A 1T0PA 2VRWA 3NOXA 4RD2A 2CYBA 1YQEA 3GMTA 2R1UA 5DRTA 2J5XA 2AN3A 2XQGA 4BMDA 1FLNA 4BNDA 2VHUA 3CGGA 5E2IA 1WZNA 4M1MA 1BYIA 3VR5A 2P27A 2X4IA 3C3KA 1I7QB 5HE8A 2QRNA 1MB4A 2H5JA 4H1UA 4JBYA 1U0JA 3LWNA 3UJ6A 1TO1E 3MTBA 3W4IA 3WJ1A 4HMQA 3VPCA 1EX7A 1IH8A 2PZBA 1UZLA 1DUIA 1N5RA 3KXLA 3OE7D 4DLAA 1C3LA 4YCMA 1D2CA 1ZD9A 1YI8A 1UOOA 3S5UA 5KYUA 3ONEA 3RV3A 2V58A 2HSDA 3K70D 3K9GA 2KBEA 4LFBB 4J0FA 2OKCA 3QKTA 4U2CA 4B84A 4HOYA 3ZY6A 3R44A 3IAS6 5TJ9A 1PJCA 2HFKA 3RSGA 3WBKA 1RXCA 2OBXA 5HZKA 4QXMA 4WKCA 2SNIE 3HXTA 3S5JA 1TZKA 1B0PA 1JEYA 2QXTA 1GRRA 3L0IB 1TW2A 3GN2A 2VP9A 3FTNA 4IGAA 4TMWA 4CEJB 3REQA 2HQOA 3CH6A 3O82A 1CR2A 3R0IA 1K86A 1YL6A 1ZNYA 5AHXA 4MPTA 5DGCA 1IN6A 5TEWA 2WY2D 4AY6A 4M8LA 4K6FA 1AKNA 4RACA 5E4FA 1NJ8A 4BP9A 1RWKA 2ZQZA 2CNBA 4KR3A 1E2BA 1VCMA 1TGVA 1RI4A 1Q21A 2CDRA 4MVYA 3ZD8A 4ER7A 2B4KA 4FGUA 4Y1RB 1WPGA 2PUEA 1B8PA 3ZKWB 1PS0A 5D3ZA 5DLDA 4E51A 3UJNA 4J94A 5L7TA 4UBOA 1TYBE 4WFJA 5IEJA 4EQ6A 3OF5A 2QZZA 3M6WA 1F3OA 4G9GA 3TMKA 4UOEA 4F3TA 3RSLA 1K88A 4DNFA 4AW9A 2DBYA 2OCPA 4A2QA 3KTFA 1D7AA 2W2PA 3DV2A 4HLUA 2YBDA 4OQLA 1IXSB 1RMYA 2BM1A 2VQ6A 3ZJTA 4LYGA 3X43A 1SA0B 4D79A 4V0QA 1UPBA 1GCOA 2VFAA 3VX4A 3GRZA 3AJRA 3B5EA 4F06A 2H8GA 4QICA 1WUKS 4I1RA 4M9CA 4V0NA 1JHAA 3ZHOA 3OZBA 2BLLA 4M1SA 5BR4A 4F71A 5EJ9A 2RJ3A 2P4HX 5CDUA 1W5SA 4U7HA 1FFHA 3JD4A 1C1HA 3EFBA 2VHJA 4G0NA 2D00A 2EWVA 2EP5A 4HNAB 4Y6QA 2XCTB 1UP7A 3IURA 3RASA 4CUJA 2HZBA 1R8XA 1U94A 3WNBA 1CK4A 4YT5A 2OFFA 2W4MA 2G6BA 4UVEA 4H3HB 3RE1A 4ZZ1A 1MP0A 4KSYA 1EJBA 3T4EA 3W1VA 1V9CA 4H6PA 1E6MA 4NZYA 2Y05A 2J48A 2BGJA 3E4DA 2PUWA 5EN4A 5KU7A 3QF4A 4RIIA 1NU6A 4I1SA 3O6VA 1U8YA 1V5WA 2G0NA 3G02A 3AVOA 4KAXA 4X7RA 3H05A 4ZVRA 2OE2A 4B3JA 4EI9A 3CNEA 5ER6A 5AVJA 4I55F 1XK6A 1NONA 4LF6B 4BX0A 3S3TA 3PXAA 4RTOA 3OQHA 1QVWA 3MGGA 4J7AA 1XP5A 3C48A 2GDJA 3JAKB 3MAJA 3TCNA 2LRHA 3UMVA 1IK4A 2VRCD 5KTOA 4JL5A 3KFLA 3E5RA 4MAFA 3WIUA 4OQYA 3ZX5A 4AJNA 4HZUA 3EVCA 4X00A 4DQXA 4DJAA 2ZGVA 3NAMA 1P7YA 1Z13A 4YWJA 2UYQA 1V11B 4ZEOA 4JP5A 3L82B 1E1YA 4F4HA 1VIDA 4UEJA 4XB6B 3ZCPA 4XI9A 1BE6A 2O4UX 4QLAA 3RS8A 1RQLA 1FVFA 4URFA 3UJDA 3QI2A 1PFYA 1KERA 4QFBA 3NUQA 2YIDA 4OL0A 4OHKA 2GK6A 2HXYA 1Z75A 1I7NA 2ZM6B 3PXXA 3NETA 2G1JA 3MOSA 3ZE6A 2VJYA 3BE8A 1PFWA 2I34A 1TUEA 2KB0A 4M1ZA 3R9KA 1MIOA 3CB2A 4DIMA 1QJCA 2C95A 3BRSA 4JNKA 4EY7A 1FSPA 3A04A 3DZDA 3OPXA 2WWVD 3SJUA 4CKCA 3SJ7A 1R6DA 4GOKA 4ZU1X 1NUAA 2KJQA 1KVRA 3DDNA 2R6ZA 1CRPA 1WW3A 2CDBA 3PHGA 1NVKA 3T1NA 3PPYA 1XPOA 2IYNA 4R41A 4RTSA 2ZP1A 3OP4A 3QM1A 3DOIA 2C9DA 4H1HA 4MVWA 1ECCA 1XTIA 3UK6A 4LHVA 3P96A 5CFLA 2H9YA 3DOEA 1Z5OA 2VNAA 3LU1A 4PHHA 3BBLA 3AEQB 2Q6LA 1KDYA 3AM1A 4RD6A 1JIKA 2JLSA 5AWFC 3FR8A 4P92A 4LZNA 3C6QA 4CR8A 4PYJA 2QTTA 1ENYA 4IJVA 4C1NA 1V1MA 3MBKA 4DHEA 1ZJWA 3ZDRA 2D1QA 4KQXA 1L5VA 4BE9A 3B60A 4FMBB 3SNHA 5J58A 4JMLA 4YHBA 1K6JA 3K0AA 1XKLA 2B7BA 1UJCA 2Q5IA 3QBJA 3VNRA 5JD4A 3S2EA 3VR1A 4HFNA 1DDIA 1W44A 4ZKDA 4W4TA 2YZMA 3TLGB 1L4HA 3RRBA 4KK3A 1D4ZA 2Q6VA 1VYHA 3VKWA 3D3JA 2F1HA 2XWQA 3RRJA 1NOIA 1WCIB 2MYPA 1YJXA 2XTAA 1TM1E 1G4HA 3E5NA 4LXIA 2ZIXB 5CP8A 4AQ7A 5JJKA 5BWCA 3EIHA 3IQEA 4Y1EA 2BKEA 1Z15A 1N33B 1DBSA 1JMYA 3S7ZA 2ZWVA 4J29A 4CMJA 4MQ4A 1SOWA 2GRUA 1TMGE 3WRXC 1U7HA 1FSFA 2MINB 2Q07A 2PX0A 5E3IA 4EAAA 2EIXA 4DM7A 3IEUA 3PC8C 3TX2A 2OBMA 3K0FB 3PX3A 1NN0A 3EIQA 5CXXA 2IGTA 4CLDA 2C83A 4KX3A 2ZG6A 3A9RA 4X1KA 3TI9A 3ZHBA 2OLKA 1Z4NA 2DQZA 2QLFA 3QKUA 2Z8ZA 3GQVA 3U5TA 4AURA 4CDNA 5KB3A 4DAOA 4J8PA