5AVKA

Crystal structure of proteinase k from engyodontium album
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Derivatization of Proteinase K with Heavy Atoms Enhances Its Thermal Stability.
doi rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5avkA00
1EA7A 3SQOA 1TM1E 2X8JA 4I0WB 4DJ5X 1AH2A 1C9NA 2V8BA 5FBZA 1GT91 2ID4A 1BE8A 3AJ8A 4CG0A 4FONA 4CFYA 1SCBA 3LXUX 1SUPA 5JXGA 3ZXYA 1EGQA 1R64A 2ZWPA 3DE6X 5B1DA 3DWEX 5I9SA 3OSZA 1GA6A 3DVRX 1C3LA 1Y3BE 3TECE 4KG7A 1ZVKA 1S01A 4OMCA 2ZRQA 1TM5E 4H6XA 2P4EA 2SBTA 1TM4E 3CNQS 1KE1A 1PEKE 1AF4A 1MEEA 3CO0S 1NDQA 3LPAA 3SICE 4AKTA 1TM7E 1S2NA 1BFUA 1P7VA 1YJCA 2W2OA 1GTG1 4OV6B 1Y4AE 1TMGE 2DUJA 4GI3A 5FFNA 3WQBA 1R6VA 1SH7A 1SUDA 3L1KA 1YJAA 5ARCA 1THMA 4KB5A 3EE6A 2HPZA 2PWAA 2SECE 1SCDA 4JP8A 1V6CA 1WMDA 1Y4DE 5FAXA 2PYZA 1CSEE 1TK2A 4OMDA 5AQEA 1KDVA 3Q5GA 1R0RE 3F7MA 4NMXB 1Y33E 3VSBA 4CFZA 2ZWOA 1OT5A 2PQ2A 1V5IA 2WUVA 1DBIA 4J94A 1C9JA 2W2PA 1TO1E 3VV3A 1SUEA 3DE4X 3F49S 2PRKA 1KDYA 1BFKA 1TM3E 2QTWB 2Z2YA 3DW1X 5SICE 4B5LA 3ZXXA 4H6VA 3TI9A 1ST2A 2G4VA 3BPSA 3VHQA 3EIFA 4DZTA 4ZOQI 1WSDA 2DP4E 3P5BA 1AK9A 3I34X 3GT3A 1MPTA 1SUCA 1Y3FE 4KPGA 3GCXA 4K8RB 5JXJA 3DE2X 1KDZA 1Y3DE 2SICE 1OYVA 4WOBA 3T41A 1TECE 1HT3A 3DE7X 4MZDA 1XF1A 1ZVJA 3Q40A 3I2YX 5ARBA 1SCAA 4HVLA 1JEAA 3VTAA 1NDUA 1UBNA 5JXIA 2X8JB 2XTJA 3DW3X 1AV7A 1DUIA 1BH6A 4C3VA 1SBNE 2WWTA 1SVNA 1GTL1 1IC6A 1SELA 1SUBA 4C3UA 4Z2AA 2TECE 1GNVA 3BX1A 2Z2XA 4DWWA 2ST1A 3DVSX 2B6NA 1A2QA 1CNMA 1C9MA 1BE6A 1T1EA 3DDZX 3LPCA 1AU9A 1PJ8A 5ARDA 3GT4A 2Z30A 1Y34E 4LVOA 2WV7A 1Y1KE 1Y9ZA 1Y48E 2XRMA 3DE0X 4RYDA 3DYBA 1KE2A 3QMPA 3VYVA 1SUAA 2W2QA 3AJ9A 4NE7A 3I37X 4YN3A 3WIVA 5K7SA 3LPDA 3DE3X 1SIOA 2HD4A 1AVTA 1YJBA 4NE9A 1SCNE 1GA4A 1SIBE 2WUWE 1S02A 5AVKA 1P7WA 5JMOA 3H42B 1AQNA 2SNIE 1SCJA 2E1PA 4AKSA 1Y3CE 3QTLA 1SBIA 1SIUA 1Q5PA 1SN7A 2PKCA 3DE1X 3GCWA 4H6WA 3HJRA 3PTLA 2Z57A 5AVJA 3VV2A 1WMEA 2GKOA 2W2MA 3UNXA 2Z56A 1VSBA 5AMXA 3AFGA 1GCIA 4ZARA 3A3PA 1P8JA 3F7OA 3DE5X 3DVQX 1BJRE 1OYOA 1PFGA 1GNSA 1SBTA 2PMWB 2W2NA 3A3OA 4M1ZA 5CW1A 5JXHA 1SBCA 3TI7A 1SPBS 3WIUA 4WOCA 4BWGA 1ST3A 2DQKA 3A3NA 2ID8A 2IXTA 1NLUA 1GTJ1 1PTKA 1GA1A 2Z58A 3D9QX 4LVNA 2IY9A 1TO2E 3WHIA 3QFHA 1T1GA 3D43A 3EDYA 1LW6E 1YU6A 1WMFA 3BGOS 5B1EA 2PWBA 1T1IA 3PRKE 4HX2A 1IAVA 1WVMA 2Z2ZA 3I30X 1SBHA
chains in the Genus database with same CATH superfamily
1MW9X 4IDHA 3DEZA 5LBTA 3C6YA 2XLBA 3V4PB 3DL0A 3LF2A 5CBPB 4MW9A 2PUCA 1TF5A 2N1MA 2BSXA 2EC5A 2ZJYA 2QMZA 3LG2A 3W0LB 2WZQA 5ALUA 5JAHA 2Q0HA 5HGXA 3WQQA 1XWFA 1T25A 3HN2A 5A05A 2CDNA 1IHYA 3ANMA 4BNJA 1VPDA 1YKSA 3MXOA 4EL5A 1JVSA 2RGCA 1UIMA 3DKVA 4K6OA 5HF5A 1Z0KA 1EGAA 4IIUA 3DBVO 2PZBA 4ZXFA 5EQTA 4RFSB 2B2NA 1T3LA 2PH1A 3B5EA 3PNBA 4KIFA 4L57A 5FUYA 4AKTA 2VTBB 4WEOA 1SC6A 1O5IA 3G2OA 2WWYA 2DPYA 1U7UA 1LK0A 1PL6A 2ZYWX 1QF6A 1RAEA 2ZBEA 1SZDA 2FDRA 3C7CB 3H9GA 4FZ3A 2ACWA 4B47A 1SVLA 2FW7A 2WJJA 2P9BA 4OFWA 4TUYF 1N2CE 3GLUA 3PE4A 4HDNA 2CNNA 5GV7A 2C07A 3HBFA 3UUEA 3S81A 4ZEWA 5JC1A 4P3NA 5DISB 4ZREA 2C9DA 5IU6A 3V8VA 3B3GA 5C4GB 4P2BA 3VKVA 1DFGA 2B36A 4I8IA 5JSFA 2DXIA 2XI4A 2GK3A 3W3AD 4BQNA 2YH2A 4ZV4A 2R6ZA 3DOUA 3HLTA 5DN6A 3RC8A 5BNFA 4XJXA 1YUBA 3CH4B 1CIVA 3TNYA 4EO4A 4ZOQI 1JQKA 1QO0A 3BE5A 3H7IA 1DXQA 3DBRB 1XCMA 1ZI6A 3CO5A 4HLUC 4NDZA 3GUUA 1DV2A 4KE9A 4O2AA 5CVUA 3WZMA 3KKLA 5JRZA 2I65A 3R1IA 1PU2A 3BXPA 4WTOA 1LPSA 4LJ6A 1P2BA 1QWSA 5JNTA 4G0UA 4DQVA 4RPKA 4JJ8A 1ISIA 2RD2A 2ZU6A 2VP6A 3AR4A 3TSWA 1QP0A 4EGQA 1J0AA 1AU9A 2CLKB 4MYRA 2RONA 3S40A 3N76A 1FK8A 3A1DA 4CGZA 5CLIA 4DA9A 4UBJA 1POWA 2H9AA 2CV1A 5KYUB 2A0FA 3G0IA 3LYAA 3U9LA 4Q4CA 1RI4A 3NHAA 4TLCA 5F7OA 1JR3E 1XRNA 1IN6A 3FR8A 4HNGA 4ES6A 2EYQA 1XNJA 1L8XA 1SHZA 1X7ZB 3PU6A 4H7KA 2N3ZA 3UN1A 3GHYA 2HDHA 2DBYA 1KL7A 2Z98A 5D87A 2QS9A 3DQQA 1E2LA 2J5KA 2YWJA 4G09A 4XTRA 3FNHA 4LISA 5E6UA 5EIHA 1K9SA 1WCXA 1P7PA 3I9KA 5C1DA 2IDJA 3PA8A 4WCFC 5AVJA 1E8DA 1U0EA 3AHFA 1E1DA 5ENZA 5TJ9A 4J7AA 2PLFA 3E22A 3ECAA 3B1VA 3INRA 4IJKA 2OZPA 3RBVA 3PHHA 2W4IA 1JJVA 3IV6A 3EVEA 4V02A 4LZPA 3CLHA 4PRZA 4M0KA 4N0QA 5FFMA 3R3SA 3PLNA 1U2GC 1NBEA 4R81A 1R5JA 4CLEA 1DBPA 3UUGA 4L0MA 2IS1A 1PQPA 3G8CA 3HZZA 1LY1A 5FR2A 3V8RA 1AV6A 2I66A 5K2MA 3KKMA 1XVVA 4A10A 1GSAA 1GSIA 1MLDA 2H2HA 3M5WA 3N0RA 3U62A 1E3WA 2V9CA 4L6AA 4YUWA 2VQEB 1P4RA 3EDQA 3FDFA 1MB3A 2J6IA 4IKPA 3SQOA 2VDWA 4DPMA 3DV0B 4OB6A 1FVFA 1TCVA 1FLDA 2CK3D 1EQAA 2FSPA 1A8QA 2CJXA 1LC3A 2JJ1A 2ZJ3A 2QMEA 1SCBA 2GBIA 2ZT8A 4Q47A 4BVLA 1L4UA 4OF4A 3FVVA 5ICFA 1QHGA 3TEJA 1JYFA 1N2GA 2OXFA 3VU3A 4G25A 1Q7RA 3D4IA 3ABIA 3E9QA 2W2LA 3FZYA 1K08A 2RJ3A 3HKBA 1VG9B 4NQZA 5LUBA 3CB4A 1KOLA 1J5EB 2DE0X 4M3NA 2WK1A 1CUHA 1T6ZA 1GZ5A 3OJLA 4B3BA 2Z83A 3KP1A 4LCEA 4NZ9A 2ZUTA 4Z4GA 4KXUA 1PV2A 2YWHA 4OUDA 3CTPA 3PQ8A 4LZJA 4OB7A 4DC1A 5JR3A 4DV4B 2O8EB 1DGQA 1FMJA 1GILA 3EE6A 4N5DA 1SCDA 3CVJA 3N3AC 2OV3A 3BGIA 2BH2A 2LIPA 3H05A 1GOTA 5JFOA 1Z62A 3WYEA 5FWXB 3AGQA 5EA2A 1K5GA 3B6KA 4HLCA 2P4HX 5F9HA 1XQXA 4YMLA 2ZJFA 3M6LA 4KQ1A 1CJSA 1DO8A 4E5VA 5KWJA 4G5OA 2I55A 3PGLA 3BFJA 4K9RA 1TJ3A 3URMA 4DNXA 4C3OB 3OE4A 1IBSA 1PZXA 1UCFA 1TF7A 2CJWA 4DB2A 1GNRA 3EIFA 1K98A 5DWDA 4FEYA 3ND8A 3S7TA 1H8EA 1U9IA 4GMKA 5JYDA 3QKRB 3T6KA 5FOSA 3U13A 1XVIA 3IS3A 3D7SA 3BFKA 3GGSA 3L6EA 2PD6A 3IO3A 2B37A 4YAGA 5KJFA 3HUTA 3GPDG 3L4BC 1OX5A 4KOEC 3GUVA 2C8KA 2QGNA 1ZWKA 1OLSB 3DC7A 3M6XA 3ME5A 2AWNA 2V58A 2YW2A 4JLVA 3T1QA 1I3OA 3Q7QA 3W1VA 3SQWA 2WVJA 4F9FA 2EF1A 4OJTA 5DXJA 4ALLA 2PXAA 2B82A 5ELMA 3A0RB 1Q95A 4BX9A 3T0FA 4DWWA 1D0SA 5EHGA 3DVSX 1ULZA 2I4TA 4J6EA 1RQLA 1RYHA 2NX2A 4KQEA 5C8YF 1JEJA 2C3MA 4EGFA 1C8KA 3SGLA 5COAA 3HL4A 1AT1A 1IEXA 2ZYIA 2B8WA 2HRRA 2R00A 4DV3B 2XY4A 2R1TB 1CNEA 1UDBA 4XASA 3T15A 1D6NA 2WJZB 4DLVA 1X19A 1MO3A 5JSKA 3DAYA 4QEDA 1ID8A 3AUJB 5CNMA 1TZMA 2IU0A 4D6PA 1O9GA 2CXXA 2RHMA 5AM5A 1UBRS 2O2GA 3BSSA 5ALFA 5BWMA 4FR2A 4PYQA 4HNQA 2HK9A 4R1PA 3W4IA 4BQRA 4V0SA 1I0IA 3QVJA 4YI3A 2GKGA 3HFGA 1OAAA 2FZWA 1FPQA 1N6NA 1H94A 1VSBA 3G2MA 3IC5A 2OMKA 3A9CA 3IYLW 4OHYA 3FM9A 2A4MA 3FYUC 2O2ZA 3GNQA 3TS1A 2C7OA 1E62A 1R88A 2W2NA 5HCUA 3RK0A 2O8NA 1Z4NA 5HA5A 1SBCA 3JQ6A 4AX4A 4UFPA 5FBVB 1TA0A 1YRBA 2GR9A 1GV1A 2I8AA 4KQFA 4PW0A 5CIYA 2EQ5A 3CPJB 1ZH4A 5DHFA 1YDFA 3AVXA 3D4NA 2TMGA 3RRMA 1CUZA 3N9IA 4GE0A 1ORIA 1Q57A 1RQNA 1T1IA 4NX2A 3KVVA 2XRYA 3PJDA 2GEKA 5K99A 2JHPA 4BVBA 2H1SA 2Y0CA 1U0JA 3C74A 2I1VB 2P6OA 3L4BA 2R7AA 1UFKA 3VYRB 5DYWA 3BK2A 1EFPB 2C42A 5CK4A 4BN0A 2RKOA 1LLCA 3AI7A 2VPWA 2VSNA 3GDWA 3YASA 2B8EA 2GARA 3C8UA 4JNKA 5FJIA 3ZXYA 1WAMA 3DUFA 4Q9KA 3KALA 1EFTA 2NO7A 2IIVA 4ARAA 3K2QA 2R47A 5HTKA 4E1BA 1I4DD 1QP4A 2PX5A 3THWA 3NM6B 2QRMA 2IITA 4RVOA 4IEEA 2KLBA 4IVQA 1T2FA 4YUZA 3L7LA 3I42A 3LY9A 3EDMA 4TKUB 1EP1B 4C22A 5L4LA 5BQ5A 2DCUA 5JYCA 2DYKA 5DHQA 1Z0SA 3RSGA 3Q41A 3R0XA 3ORQA 5DHPA 2GN2A 5REQB 1QNFA 4EPRA 4PX9A 4U0KA 3NHPA 4GWKA 3ZTWA 1ZVVA 5JCPA 3KD2A 3PXCX 1XZQA 2B5VA 1J9EA 1B6TA 3MINA 4ZMBA 2NMVA 1Q84A 2GVNA 2PRKA 1V1MA 4MB2A 4BNLA 1KJWA 2RARA 1GY8A 3I64A 3IP1A 4PTLA 4Q1DA 2GO1A 5KAMA 4TZKA 3JPWA 4DAEA 1UT6A 1FEZA 2ODPA 3VYUB 3JQ8A 1DHRA 1E9FA 2NW6A 4XVUA 1MPTA 3A9WA 4IG9A 5DBIA 4K8RB 3BL5A 5HJ5A 1SKUA 2FMIA 4KQIA 1EBUA 3LHKA 4HBZA 1XQYA 2IWHA 3OLYA 5LDHA 2Z6VA 3HR7A 2C84A 2DHQA 4HNHA 1QJ4A 1Q7CA 2C31A 2PS9A 5E6SA 4CEIA 3KAKA 3LXMA 3QVTA 4XLZA 2ILVA 4TZ0A 4NG5A 5ALKA 2I87A 3QLUC 4HVTA 4QHYA 3UHPA 4EEXA 1IC6A 3WK7A 2FEKA 1HG0A 3LJKA 5KJCA 4LW8A 2IV3A 3GUYA 1XTZA 5LQAA 4PG6A 3C7AA 3RVOA 3CINA 1ONPA 3ECSA 4UEOA 2Q0QA 2ZUSA 2FQ1A 3WGVA 3SBXA 3GNTA 1IZZA 1I1HA 1VJ5A 2B1RA 2DHEA 4AY4A 3KETA 2QU8A 5AHKA 4D82A 1T0PA 3WHPA 4GYJA 5EQJB 4AAYA 4IM7A 2QJFA 2OM6A 2Z09A 1ODFA 4CLOB 5MF6A 1TKAA 1L5FA 3BWVA 3ENQA 3LWDA 1MH9A 4IG4A 4L6CA 4G9EA 5G2OA 3PJFA 4AFNA 4LOJA 1TRHA 1GEEA 4QG7A 2P77A 4EO7A 2XD4A 3E70C 3Q7TA 3G2NA 4LYHA 3PYMA 5FWDA 2WU8A 4LF4B 3VV2A 4DBLE 4RJLA 4Z4IA 1PUIA 3CC8A 4BFWA 1WMEA 2VPTA 3VI3B 3VRHA 2ZW9A 4I4TB 1JMVA 4F9TA 4HAZA 3FRJA 3UHFA 4NR0A 1BN7A 1VHTA 1DC7A 3OJCA 2HMYB 1QMPA 2CF6A 4K1XA 1ILWA 2ZJOA 1TXGA 2ATIA 2P3SA 2Q2QA 4AURA 4BWYA 3WLPA 1MX1A 1Z06A 2WIAA 3TEMA 3OVMA 1NYRA 4H15A 3F6YA 2QN7A 1O6GA 2A0UA 2HSEA 2NVOA 2Q6LA 1TKRA 2IY8A 2V97A 3FJ1A 3LBFA 4IIJB 2IL1A 3F6BX 2H18A 1JVBA 2CCGA 2BGIA 2RGWA 4WXHA 4CT0A 1SQ0A 4GR5A 1OZHA 3CNOA 1KY3A 1IAQA 2A84A 2AI3A 2QMUA 1Z5NA 2AEMA 2H00A 1COWA 3HL0A 3FWKA 4LZZA 5C8XA 4JUIA 1YHYA 2TS1A 2ZJ4A 5KVVA 1QZUA 2AFVA 2VAWA 2WRZA 2BY4A 1Z13A 2FEWB 2FLVA 1GGJA 2Q1XA 1CD5A 2Q29A 2JANA 3B89A 3HFJA 4HLUA 5A3SA 3AFNA 5K0TA 1NX6A 2G80A 1T15A 3U7EB 3OU7A 3EK2A 3D8UA 1B8PA 1Z5VA 3HCDA 4W7IA 4XOIA 1NIPA 5BOVA 5U4XA 4K6FA 4D81A 2A1UA 2H85A 4HEA1 5I7AA 4H6XA 3UVEA 1W581 1A9YA 1JS1X 3CG4A 3EWNA 4H1HA 4C7JA 5DW0A 4GZMA 1CXZA 3W2TA 3D6MA 4L5BA 1TAQA 2FCRA 5FPKA 2CXTA 4KB5A 3DULA 3AIIA 1DKPA 4CMAA 2B2CA 3MTEA 2HHJA 2B8NA 1OTYA 1UQRA 1A8SA 1ZLXA 5JNSA 4FYYA 4TMWA 1XAGA 1JPJA 1O2DA 4XVRA 3PP8A 4CF7A 5IJZA 5KWIA 1W0JD 4ZRMA 1BO6A 2QRZA 1SUEA 3D6JA 4BNNA 4UNRA 1OREA 5EIEA 1UBUS 4RNDB 3OCJA 2OV2A 1ZIDA 3TTUA 2Y9PB 4MW0A 4HT3B 1VGQA 3N74A 1FTNA 3KJZA 3UT5B 4YP0A 1FXWF 5D3MA 3OWOA 3WB0A 2F3RA 3KSRA 3B3FA 5T64A 2NZUG 5H9WA 4F3RA 1KY2A 4MDHA 5K3BA 3FAZA 1UMBA 1ZD1A 1LRJA 3P8ZA 3ZLUA 1YE3A 3KQTA 5BV8A 1P6UA 1E59A 2OV6A 3PD7A 5ALJA 2JZOA 3NGXA 2FU5C 3BSYA 3D4LA 2XYQA 3CWQA 3L7IA 4KQMA 1Z82A 3T0IA 4B31A 1KMMA 4C78A 3UTCA 5GMOA 1KWGA 3HN6A 3B36A 3M6IA 3OO0A 4NU0A 2XSZA 4IGEA 4LJ5A 1QGYA 3LA8A 5DI3B 3ZD8A 4FIZA 1EEXB 3C7KA 4C05A 1JN0A 1H69A 2GN0A 2PKQO 4YJGA 3UV3A 3X2SA 3T7JA 1JMYA 3LV8A 5DZSA 4RC9A 3QOWA 1G16A 1XVUA 1C9MA 3JAKA 4IUYA 4P92A 5E9AA 3TCXB 4BNVA 4BMSA 1LS1A 1TK3A 1RJEA 2EGUA 2Z95A 3C24A 3FN4A 1NJ1A 2A9QA 2MYUA 4U1RA 1BD4A 3ANSA 1W94A 3VA7A 1V3VA 3JALA 1DO2A 4NK5A 4OFXA 5IVDA 4OKSA 5A2QA 4Z0TA 1FYDA 1J39A 4LWQA 4KLRA 4UHBA 5KDDA 2OG2A 1CTQA 1GYQA 2W22A 2MSDB 3WC4A 3MD0A 5C1OA 3I73A 3UQYS 3A6FA 1E4EA 4HB2A 2I6UA 4B6SA 5CFZA 1E69A 2EBUA 1R74A 2EZUA 2ZRBA 3HCNA 2XBMA 1B6GA 2J48A 4LSGA 2BRUA 4CPDA 3VU9B 4AS1A 4KE8A 1IJBA 3HNOA 5SY9A 3GL9A 4G26A 2BDTA 3B38A 2PUVA 3R4CA 3DE5X 4YCJA 2Q3CA 2XT6A 3ILYA 1EWQA 2OUKA 1DEHA 1GVHA 1SVMA 3T34A 3G17A 3G0BA 3UWKA 1BS9A 1WHTB 1ADJA 3TCKA 4I19A 4MINA 2XCUA 2CDCA 2Q28A 2B99A 4GGMX 2PANA 4PYOA 3KO8A 2R1VA 5EMLA 1QS0A 4F2GA 4JR0A 4MR7A 2PO7A 1XTRA 5KOHB 3PKZA 2F3PA 2GBPA 5K8JB 3L49A 2C59A 1QIIA 1Z12A 2JGFA 2ONJA 2D1YA 1RLJA 1DDIA 5IVIA 3U3XA 3NKVA 5E4FA 1A50B 5CHYA 2GA8A 5IPFA 2VDRB 3U1VA 4I1PA 4UU8A 4CNQA 1XWWA 2P9JA 4JX9A 1E2BA 1BAPA 1NW3A 4X00A 1MORA 5FTWA 4BLWA 3S1SA 4KI7A 3EEYA 2QSUA 1EA5A 3E8XA 4YCSA 4PEVA 3WKDA 3C85A 1U1DA 4DV5B 4WXYB 5FD8A 4GR4A 3T9BA 2IYOA 5TJHA 3SVZA 4A73A 1V11A 3HXQA 2DFKB 2JLUA 4N49A 4D41A 4KH0A 4JQOA 3R9XB 1LRKA 3JZFA 4Q1CA 3LRTA 3GF4A 1Z33A 1LUAA 1Z35A 3IB3A 4HI0E 4YGXB 3H17A 2HREA 4CKYA 1QZXA 3LCCA 1T4CA 3HJFA 3WL3A 1GAXA 4WBXC 3FKJA 1CSEE 3LDFA 1KZ4A 3KJGA 3MLAA 5ITZB 2Q1YA 3PNLA 5JWRA 4F4CA 3C39A 5J1SB 3WY9A 1BXGB 3H99A 1H2WA 1RADA 1D6MA 4JBNA 5DFAA 4Q05A 2EATA 1TT5B 3DDSA 3BUSA 1FTWA 2OUIA 4Y1EA 3VX4A 1NP3A 1ZICA 2OESA 4J3FA 5A0VA 1QLHA 2OE2A 3K8OE 1V7PC 2EV9A 3PJGA 4ZK2A 5JNRA 4HFJA 5ICSA 4W5TA 5EZ6B 3G9UA 3FZNA 4XA8A 5ITSA 2J5RA 2Q07A 3QX3A 2EWVA 2HOQA 3HGMA 2JEZA 1K66A 4MS1B 4TSFD 3K94A 3RRFA 4QAJA 3GT3A 4Q93A 4YAUA 3SNKA 1ZISA 1NRXA 5E6RB 3ZV5A 4LQDA 3T5PA 1NVMB 4P4LA 2WV9A 3TX6A 1Z0IA 2RH9B 5GINE 4B9EA 3CVXA 5HOQA 1LD3A 2XQIA 1DUIA 2IHZA 4FS3A 4LTNA 2JAXA 5DW3A 1MA0A 2HBRA 1YWGO 2YVLA 3GZ4A 4TS1A 3VR3A 4YDQA 1OWPA 1ZA1A 3P9NA 2DUMA 4X41A 2JFGA 2QL7A 1T3SA 4RQBA 3PFCA 1MV8A 4NJEA 5A4DA 2ACVA 1VCNA 1BOOA 1ZOLA 1YZLA 1Z6AA 3KQOA 4WNCA 1X80B 3AY3A 3TW6A 4E11A 1IOVA 5LN1A 4UOZA 4KIGA 4FINA 4IVRA 3MYYA 3JQQA 1F0YA 2Q5CA 1T2EA 1SY7A 3ZV3A 4V1CA 1XDGA 4C87A 1G3IA 3UMJA 3O93A 3QLEA 4D4HA 4MITA 4HUJA 1S6YA 2H5LA 2OCXA 2BGUA 1Q5PA 4JQYA 2KQUA 3OTGA 5TT0A 4ALNA 3DT9A 4W4TA 2BT4A 3CUTA 1U3CA 3LUBA 1N34B 1EUCA 2SKEA 2PUHA 3DMTA 3EXFA 1ZJYA 5E2BA 2OGSA 4FOTA 4C6SA 4DR3B 1H1DA 1IONA 3DEJA 2FYTA 3HY3A 4DCPA 1T29A 1OTXA 3STWA 2E6KA 1RXVA 2XJ9A 4FCCA 1S8OA 2F8SA 4YUVA 3GA0A 2RH4A 1V7CA 3GRUA 4DKJA 3FIUA 2GPBA 3TRIA 1LV8A 1PI3A 4JJEA 3RQSA 1U3TA 1KOFA 1FP1D 2OM2A 3H2SA 4RK0A 4YCCA 5CH3A 1FS6A 3HTXA 4G37A 2Q7OE 5JASA 1NZJA 4S1PA 1OC4A 4KIJA 1Z9BA 1SHLA 2KHZA 2HXGA 4LJKA 4ND7A 5BNIA 1DINA 4YS6A 2GD0A 1X1QA 2PRIA 1Q0PA 2DBVO 2H1IA 2JCBA 2YN2A 1TYAE 2XMBA 2DQYA 2IE0A 2BFWA 3RYIA 4H77A 1XZLA 2JNWA 3S27A 3QHAA 5ITWA 4ZT2A 4TPKA 1N9GA 3KTAA 1C3JA 4GPD1 3R7DA 3J81k 3PT5A 5EQFA 1KE1A 4D0RA 2F90A 3X2FA 2YIDA 4MROA 4RE6A 2ZAMA 2VDKB 2P30A 2Z5GA 4YT8A 4OV6B 3UB2A 1BHJA 3CX4A 3QVVA 3W6PA 1KJ8A 5G4KA 1CUAA 4K88A 4MULA 2RK4A 5A04A 1R0YA 5FH9A 3GMDA 3I12A 2YV2A 2W6JD 2GM3A 2QG6A 1QYWA 4MCAA 3AL0C 1X8XA 4YIHA 3F7MA 1KMHB 4XB6B 4BEWA 5J4LA 1QRDA 2ZTHA 5K0GA 3EPHA 4QXAA 1LK7A 2Z3VA 3LM8A 4FJ2A 5IYZF 4IUCS 2D0PB 4NY1A 3WLKX 1SURA 4LXQA 3AKDA 2VNSA 4IEIA 5EJMA 1Z16A 4YT4A 2PVPA 1L7XA 4CM3A 1K68A 4K5QA 2CNOA 4Y30A 5CNIA 1U2QA 2WF7A 4EGCB 3PGA1 4PBTA 1A0OA 2AZMA 3HYNA 4L7QA 1M0TA 3AIOA 4BWFB 4JYAB 2QX6A 1BZYA 4FX2A 1U1EA 3OZVA 1Q1EA 4RDIA 5I8PA 1TMOA 1J9ZA 2PMFA 1SEPA 4H3KB 1T9GS 1WDLA 3E7WA 3H3XA 3JR3A 4Y2SA 4L3OA 2QTLA 1F12A 1BD3A 3F3KA 2H1HA 2YRWA 4RCVA 3RYCB 1SJ9A 4KFRA 3R8FA 5DT2A 3BQMB 4YCMA 1V39A 2IE8A 3COWA 4BLOA 5BR4A 1AKTA 1EZ4A 1KR5A 3E5RA 5DHRA 4YQEA 2O8CB 1CY1A 4DLBA 2SHKA 4UQLA 2J8ZA 3JQ9C 2Z6UA 4O4LB 3WLLA 1YR3A 3MC1A 2J7PD 4NABA 1ZRNA 1KE2A 3JRNA 4PZ9A 4JI1B 4YK7A 1F6DA 3B52X 5BYJA 4LV8B 2QW8A 3OETA 2A0XA 4X93A 2VUTA 1CR0A 5HJEA 1EFAA 2FR1A 4U6NA 4YNBA 1U8YA 1X9GA 4EA8A 1JHXA 3TUZC 2OBMA 2SNIE 4C6TA 3QTLA 1U6JA 2ZI7A 3U56A 1E3MA 1EFPA 3VC2A 4Q9DA 5AI5A 4HAUA 1MHPA 4X6XA 1Y6FA 5AM3A 1UMDA 2OO5A 3O8DA 4FXOA 4RMIA 2AOWA 2QX8A 2XNDA 2XYRA 2ZYVX 1YS4A 3AV0B 3ORFA 4L4SA 4TQAA 3UNXA 5NLLA 2H3HA 4KZKA 4NICA 3K05A 3NIFB 3GLFA 2AYZA 3CSUA 3G5MA 2RGAA 1GZUA 4HPWA 5D3ZA 3VZQA 4BNIA 1EDEA 4GBGA 5HXAA 5ILOA 3TJZA 2QNRA 2ZB7A 2I6TA 4B34A 1OVGA 4OYLA 4RD3A 4TL9A 2QP9X 1MABB 1OHHD 1N4AA 1J9GA 4JZKA 2R60A 4BHTA 5JW6A 5JWOA 3K6JA 3BM5A 4J0KA 3QH4A 4QWMA 3HM2A 5J4KA 3PDCA 4EA6A 1CEQA 5JSZB 2F3TA 4X5OA 1XZCA 3JYPA 4YP1A 1BVUA 1OYYA 3I2JA 3N75A 3I6BA 3W5AA 4KNYA 5JJKA 4E6PA 3U48A 3HU5A 3OPQA 3WLSA 1JA9A 3AEZA 3B1JA 2GZ1A 4D42A 5D6OA 3KSDO 1AXGA 3L4EA 1Y7IA 2P2ZA 1R4NB 2I62A 4QOIA 5IDVA 5CB4A 3WMGA 1K7SN 3IULA 4D8YA 1G5PA 2X22A 3O1JC 1V1RB 5IAGA 1Z6TA 2HDOA 2FKAA 1DQSA 4KE7A 4LE1A 5LCXA 4DLKA 4YRAA 1JLRA 4BN5A 1DFHA 3CF2A 1G5IA 4BJ1A 1MDBA 2P9YA 2VOEA 4YXWA 4DMCA 4KE6A 4MQ5A 5ICCA 2AFRA 1VL5A 3LWNA 5TE9A 2RHDA 4KR0A 2W6JA 3MWEB 3FMOB 1N8KA 2ZZKA 5AKHA 3ZVNA 1MR3F 1RJ9A 4C0KA 3ICOA 5DHSA 3QQ5A 3BJEA 3EXG2 3W8RA 2G25A 4DDUA 3U4QB 1BDJA 3JZIA 5JD6A 4EL0A 4I1VA 1W8DA 4LDNA 4V38A 3HKCB 2XE7A 3KYBA 1WMDA 4ZCMA 4RTNA 2ZULA 2R48A 1IH8A 4DLWA 2YQ4A 3GOQA 3VJMA 4HDKA 3LK7A 2IIPA 2PZ8A 1KH1A 1MJGA 2QE7D 2VHJA 3K1TA 4M9RA 1RQXA 3CXUA 2E55A 4GYKA 4CKWA 2H8GA 1H4VB 3CUUA 1W0CA 4E2ZA 1KBOA 5KCZA 3KU4A 1O9HA 1L7OA 4I5FA 5IANA 4LV6A 1WETA 1JKJA 4P84A 3PWTA 3ZPXA 1NW6A 2NLOA 4ZO4A 4M9CA 1Z3IX 2BGMA 2D1TA 1JFLA 1E1QA 2JIRA 2HIGA 2FK8A 2PBZA 3EIOA 3SEZA 4BC1A 4MJXA 1CKEA 4ZKDA 1QMGA 3QUTA 1V41E 2GCEA 2XXAA 4S1OA 4UREA 4OHZA 4LY0A 3V6LA 1BGXT 1KPHA 2J9XB 2JD0A 1NDHA 2ZR9A 3O4JA 3Q4GA 2BTQB 2O19A 4LBWA 3TGLA 4MRMB 1JSCA 2JVKA 1VKRA 2PUFA 5A5FA 4N6GA 1WSWA 1BS2A 1CUFA 4A9AA 1LVGA 4M7PA 4QOSA 4XDGA 1FF9A 5BPFA 4P9NA 5H9VA 4E7OA 3RFCA 1PT6A 1G18A 3JQAA 1LVHA 2OV8A 4B3TB 3A1FA 4KYVA 1B0ZA 1YL5A 4MQ4A 1RD4A 5DBHX 5IZCA 3RYHB 3AG6A 5L9AA 5MDHA 2WW8A 1C9DB 4ZDIA 1V47A 1AZSC 1E2KA 1HV8A 3E9NA 1H2HA 4H7FA 1E4VA 4JL6A 4UDNA 2YYAA 3RK1A 1U98A 3S2FA 4PNHA 4FFMA 4IIFA 1VG0B 1GPAA 2B7BA 4D43A 4JXZA 3HXTA 4IGIA 4FDVA 1WBBA 4ZANA 5JO9A 2WAMA 3WK4A 1T24A 4WNAB 1Q22A 2YZKA 3SN6A 3AHJA 5EIAA 1P7WA 4MQLA 4D80A 4XCVA 1SOAA 3KZMA 3LOUA 4EQ6B 3EF1A 4FYPA 1OH5A 1JSZA 1N1MA 1NBIA 1XTKA 3WLQA 1JFTA 4JL5A 5BORA 1E2MA 3MCAA 1DQZA 1GAWA 3TQCA 2AUMA 1OHHA 3EPRA 1TGYA 3ADDA 1XRLA 1KU6A 2PZLA 3CXRA 2PRZA 4UHFA 2I29A 2VF8A 3PDHA 1QIHA 4RJ2A 3U26A 5IXSA 5LKAA 2EZ9A 4NARA 3Q15C 4MKFA 2WKQA 4HZIA 2BC9A 4RY8A 5B2FA 8OHMA 4FD3A 2O2DA 3M4JA 2Z8XA 1G6Q1 2QRLA 3IMGA 4GI2A 4TVSA 3BVPA 3TAXA 1M7GA 3IP8A 1W5TA 3B9RA 3WGHA 1PX0A 2HSGA 3BE8A 3NZEA 5BMOA 5LFAA 2YHSA 4G0MA 1F14A 1O58A 1ZI9A 1WY5A 4JKIA 1NC3A 3V2HA 3PTAA 4IV0A 4DS3A 4JJGA 3TB4A 2CFRA 3ACCA 3CLUC 4UAVA 3FVRA 3BQ9A 4C7KA 4MV3A 5BUCA 1JFRA 3NH6A 3C3BA 3CCFA 3ZNNA 4YAIA 2J59A 2IGTA 4I5EA 4LYYA 1IATA 1UJ5A 2ZANA 3DBHA 3FMGA 2EFHB 2QRPA 3HY4A 3KQQA 3NBXX 1ORRA 3HS3A 4IDAA 4QUJA 4YRTA 3F98A 4BB9A 2E49A 4GX0A 1V8PA 1TMGE 4R9RA 4O33A 4D0SA 1SUDA 2CMHA 3AOGA 2GN6A 3MINB 3PLRA 4DPLA 2BZGA 4JBHA 1PS0A 4RX1A 1PJSA 3T9EA 1PTJC 4AN1A 3NYRA 4OMDA 1N5RA 1IULA 3P1JA 2QTZA 1DX4A 5EPOA 3TE7A 5L8VA 2MSLA 2VXOA 1GZ6A 1W0KA 3NBZC 1F8GA 2Q4OA 2BM1A 3PTZA 4UUAA 4AZWA 4AT1A 3IJEB 1CY4A 5AM1A 5BN4B 3IGFA 3KVYA 3UT6A 4KKVA 3WYBA 3I5YA 3HPQA 3UF0A 2QBYA 2O1SA 3X1JA 2HHLA 1KI7A 4FT2A 4G86A 4Y9UA 2FSIA 2MR5A 5EJ9A 4BYMA 3GGOA 2HMWA 2QTRA 5I8ZA 2IIQA 1AQ6A 3GCXA 4HJXA 2XCLA 4DMMA 2XR1A 3A04A 3LX8A 4ILKA 4KQ2A 5FXMA 3WBKA 3RCBA 3TIFA 3V8EA 3H0KA 3DJYA 5G4LA 4DCCA 2ETXA 4WZAA 4J1NA 2CLEB 1M5RA 4BYGA 1B00A 4AG6A 3S7ZA 2OCAA 1J49A 3FUVA 1T13A 4OJKA 1CQXA 4DABA 2EHDA 2YWDA 2B9VA 1J22A 4JY7A 3KDAA 2QE6A 5LDDC 5H59A 4EEKA 3UGTA 3EISA 4QL3A 2A30A 3GMTA 2ZSIA 1YDGA 3DB2A 1JZTA 2XUQA 5CFRA 1KPIA 2X77A 1UP6A 2XDYA 1PO7A 3H1TA 1Q7GA 4CI9A 4BGVA 4NSNA 4XDYA 3U19A 3FOAA 4QYIB 3K0HA 3WIVA 2F8MA 3G49A 5KVQA 4HATA 1YTLA 1U7ZA 1YULA 1W49A 2IX9A 5ERYA 5KTOA 5L3QA 5TRTA 4BFXA 2X0RA 4AIIA 5DGHA 1MB4A 1W85A 3KU1A 2P27A 3I0NA 3CLTC 1ZGHA 4O2RA 3E5MA 1U7TA 4O2BF 4WK4B 2GCOA 3ZHVA 3VKHA 3OA0A 4TXLA 1T2UA 3P9RA 3QQPA 2Z4RA 4MMZB 4LJ7A 4F84A 3LUDA 2JH9A 4BP9A 1U1CA 2AVDA 1N2CB 1S8FA 4K05A 4C7XA 3H13A 2JJ2D 3ITNA 3GPCA 1XHFA 3GGDA 1HYHA 1V16B 2CYAA 3EZ7A 3T99A 4FDTA 4Y7DA 4B84A 5I5GA 3O1HB 1X7WA 2Y4OA 1W76A 1JIXA 3D7NA 3DCJA 3NAGA 3RIMA 5BNZA 4XB1A 2CB0A 1M2FA 1KH2A 2AN3A 4JC4A 4CV0A 4LOIA 4BV8A 2CUNA 3QTTA 4BB5A 4ZZ1A 5GGXA 1UC8A 1I36A 4MPRA 2IOHA 2JIZA 1C30A 1JDBC 2QDKA 3QBJA 2WD7A 4DB4A 2JCSA 3NS7A 1TZ2A 3ETGA 2HWUA 3MJEA 5JAPA 1VIVA 2Z9DA 2MSKA 3EG9A 1JPVA 1JB9A 1PT8A 3FNIA 3HC7A 1WVIA 3K53A 4RKFA 5TGDA 4G5XA 4QJ3A 4GECA 1XKQA 1HLDA 4ALIA 3TL6A 4R16A 1BQ3A 2HO4A 4I50A 1J8VA 4OXRA 3VH4A 1P2FA 4R2JA 1FJGB 4KVFA 5HFNA 3LW7A 1MFPA 2JGRA 1TI7A 5CVEA 2FDXA 4F4DA 2MHCA 2W90A 4A0SA 4JYPA 3UJNA 3NTUA 4QFDA 1ZUWA 4Q7QA 1T8TA 1UPUA 3R74A 2R4UA 3DZDA 2PUBA 1IJEA 3BTOA 1DV1A 1RWBA 3I9FA 5D6NA 4RKWA 5JAMA 3RIGA 3I1YA 1FRNA 3N2EA 3WYDA 1JG4A 4M1SA 1XP8A 1KAGA 2A0YA 4ZI2A 5CA1B 4ITRC 1FFCA 4RVFA 4CQMA 1T8UA 4YAEA 1NBMA 2XQGA 3A4YA 1UBHS 1YGYA 4D1YA 5EGNA 2JDID 3MWLA 1V1RA 1VDMA 4GL4A 4WWHA 4URFA 3ZU4A 4F4HA 1LH0A 1FZTA 2VT7A 4BATA 3I0ZA 4KTVE 2WMYA 2IHVA 4LI3X 4P58A 4RSRA 5F3WB 4JENA 4AMUA 5EWJA 3AC0A 4HFNA 2OZLA 5AK3A 2JFBA 2H9IA 2ZGVA 1ODCA 1RM5A 1WCWA 4FP9A 2PNFA 3FNFA 1RLTA 4HAWA 1T9KA 1KEEB 1PTJA 3AERA 4ESOA 3A1CA 1A2QA 2C1ZA 3IAS1 4R83A 3PK0A 2XECA 3JWGA 5IXYA 1EIZA 2CMDA 5DCYA 2E7ZA 2C1EA 3KPWA 1FYWA 1EAYA 1YCHA 1ID1A 3WFJA 3RGGA 4IOMA 4K9PA 1JJIA 1GAQA 2IOFA 3FY4A 2RDMA 3LUFA 3TQHA 3TZQA 4DLPA 4EKNB 1QQ6A 4K6CA 2BMDA 4A6PA 1Z28A 4CCYB 1H4QA 4NCAA 2A2ZA 5MHTA 3LBYA 4IQFA 3MERA 4PGGA 1LDGA 2XUFA 3H83A 3C87A 2H65A 4TV8A 2P9HA 4PONA 1SU4A 4MW7A 3STYA 1GIAA 3NYIA 5KUTA 3L0BA 3ADKA 3CUVA 4K87A 3UIEA 3G0OA 3QFRA 3ZZNA 4B9AA 2G06A 2Z56A 2PSSA 4IL5A 1XN4A 4AF6A 4NC9A 1WBDA 4WSOA 3L6BA 4Y2YA 2GF2A 3DZKA 2A0WA 3MWYW 2BUCA 1G5TA 2G4CA 3G85A 2CUKA 1PJCA 1YQTA 2UAGA 3LLSA 4B4OA 5CA0A 3RSZA 1BJKA 1SM4A 3HVHA 3ITKA 3MVEA 5K0SA 3QEAZ 4LF9B 1DLJA 3DHVA 1X39A 5INTA 3R7SA 6CHYA 4EB0A 2EHJA 4PZZA 3TG2A 6ADHA 4P4SA 3B9QA 3U5TA 2R6R1 1CUUA 5L6LB 1RAHA 3JAKB 3UWDA 1MZPA 1NN3A 2QR3A 4UHEA 5DWQA 2ID4A 3C6QA 4JVLA 4QTZA 3DTVA 3GROA 4FT4A 1M8GA 2WHRA 3ABZA 4OI1A 1VGRA 4A2CA 2WYIA 3L2OB 5C32A 1BHQ1 1WU8A 3KAJA 4DIDA 1MA3A 2GOYA 2F1JA 4P93A 1C7FA 1NKVA 2HNKA 2JI6A 4I3FA 3VFDA 4JYZA 2AC7A 2PKYX 3EVZA 3M6FA 4F3CA 2GZMA 2NV0A 3SYKA 1EH5A 5KQMA 2B9EA 2QP3A 2WPDD 1CUXA 4PU0A 5G41A 2BCGY 5BURA 1P44A 5AM2A 2ZIEA 2IYNA 2ATEA 3JVEA 3OOHA 4WZAB 5K3CA 5KCMA 5CAEB 5AIBA 5IAOA 1UDWA 3HHEA 2WILA 1U9ZA 1JJBA 2HK7A 1P5HA 3IPLA 3NBFA 4QT0A 3VZBA 4A2PA 4ZDJA 4LFBB 5DN6D 3RJMA 4L7VA 5FNZA 4GG1A 3ZGXA 4DXDA 4F92B 3SVLA 3R23A 5CHEA 1M2NA 5T5QA 3TLXA 4E2FA 1ATIA 2FFAA 1WB5A 5HBRA 1NOKA 2Y99A 4CEJB 4RVUA 4KMOA 5E4TA 5K09A 2O1XA 1ZMOA 1UBSB 2G88A 4HKTA 4UBLA 1R10A 4J7XA 3B82A 1TMYA 3HB1A 1W4CA 4BQQA 4AJEA 3ZNOA 3WYCA 4LPSA 2QRUA 4OX9Y 2GWRA 2VHZA 1GXSA 4RA9A 4RIHA 1I6MA 4MQMA 1SUCA 4LZNA 4UHCA 1T9CA 3W9BA 5HM8A 4EFLA 4L4RA 4ENQA 1C8LA 5EJ2A 1KYZA 1LF0A 1QH8B 2O05A 3INGA 3T38A 5B6IA 4WMLA 5MN4A 4CQNA 1ZLYA 3QFCA 4WKCA 1WXIA 2ZVDA 4C29A 2O8DB 4RULA 3SS8A 4GX5A 4O6VA 2VF2A 3EPKA 1U2RA 2UZ1A 1GCGA 3GJXC 1C1DA 1FVOA 3HBMA 1ZIPA 3LECA 3NKLA 3F9IA 2C99A 4MLPA 1VBFA 2G08A 4PC3A 4AKGA 3N8IA 1H1TA 2FPIA 3QEMB 1JG1A 5TQ2A 1RRKA 1T2AA 3BH0A 1DQNA 1G4UR 1OA0A 3Q3IA 4LDRA 3NPMA 5BT9A 5KNDA 5IHPA 1FW6A 4FLEA 1T5IA 4PSUA 3EWIA 2JKZA 2VF5X 1BWPA 4O4IB 5T3YA 4YEDA 4Y0NA 4L9AA 3FJYA 3RVBA 1NQAO 3WK8A 3U3KA 5BRJA 1E2NA 1NIJA 3RFTA 4YMWA 2XODA 4LZLA 2AEJA 3FKSD 2AQ8A 1MN6A 3SU8A 5LP1A 4H1WA 1ORDA 1ZBQA 2VXYA 2XOXA 3KTOA 2GXQA 4CBVA 4ED9A 1NG9A 1EE1A 2X5KO 2QAGB 3IE1A 5ESXA 1WNTA 2QN9A 2Q49A 4ENVA 4XE5A 1F4PA 2QRJA 4H7JA 4FGLA 1QVZA 4L0QA 3O26A 5JE8A 3NDIA 4OHKA 4ETMA 3LUKA 2UYOA 3MCVA 4KXXA 1K3FA 2WJYA 2UYGA 1BEUB 5T4EA 1UFVA 2PZAA 4YDSA 5B53A 4IHKA 1CY2A 3HM9A 3MT8A 4D96A 3LSYA 3A8TA 2IEGA 1U3FA 3VO8A 2PSFA 3COSA 4N41A 1F2UB 4DT1B 2CWDA 5TGTA 2EX4A 1JDTA 2W6ZA 2CYCA 3PHGA 3EVGA 4RVHA 4ZC1A 3UXYA 3FRIA 5LVAA 5BWLA 5LXTA 1DRJA 5FULA 4CFYA 3NIGB 1VE1A 5AUQA 5JXGA 1H5QA 1GL6A 3RVKA 3UA4A 4EKEA 1N33B 1ZWLA 2A58A 5IG2A 1X7DA 3RSLA 3H19A 4DQ0A 2IOYA 1YMQA 5HDBB 1JKXA 5AJVB 4RTLA 4F0JA 4M37A 5IEJA 4AECA 4MOWA 3SS9X 2O2JA 1PEKE 1QFZA 1P0QA 3AYZB 2RKBA 3DWFA 3GG2A 3KZ1E 1XB2A 1K92A 2VF4X 2V7QD 3B5IA 1RHJA 3PZRA 2XVZA 1KI6B 5JVDA 4MVJP 4GI3A 2R1UA 3BSWA 4XW2A 4BBZA 1TUGA 4YDHB 1L7MA 5B3JA 1OLOA 4IRMA 1CQWA 2JFNA 1P2VA 1R8YA 4PSCA 5A06A 5I7FA 3SVTA 2Z6QA 2ZUVA 3VSBA 4YUYA 1F8UA 3HZHA 3TAUA 4OKNA 3L02A 1V5IA 4JBGA 2XUIA 2V1XA 4ND5A 3D2LA 2CJYA 2XWJI 2ALJA 3L7DA 3EZ9A 4Z2YA 1YKFA 2BD0A 1V5EA 2C04A 3E82A 4JGGA 2DUNA 2IXAA 4ZI7B 2GD2A 4D9BA 1EP9A 4FFVA 1F7UA 3FNBA 1AZTA 4BCBA 1QPBA 2ONKA 2C4NA 2QZ9A 5ALOA 3U44A 1YXMA 3TQQA 4GRDA 4B6PA 1D4AA 3V7FA 1S3IA 2ZG6A 2IYPA 1RSZA 2Q5FA 3KHUA 4DCOA 4C0LA 4MKHA 2X5XA 2HYIC 2HT6A 2WJPA 1BH6A 3JCZA 4HWKA 1GGNA 3PQDA 1HEIA 4Q1BA 4RZQA 5I9TA 4PYKA 2X0DA 1U8XX 5JANA 2P35A 4XWTA 4BOYA 2V7UA 3DTNA 5AJZA 4GL2A 1Q0HA 2D8AA 3DFKA 2CMFA 3OT1A 5JAUA 1YVPA 2Q2OA 1PJQA 1U2EA 4L3VA 3RUDA 1DTWB 4W5JA 4IXNA 1RMTA 1T0JB 1L5NA 5IKPA 2EKDA 2W98A 1V96A 3UAZA 4MRPA 2WTXA 2ATCA 1BXKA 2WU1A 4FYJA 5L4SA 1EBBA 1HLPA 3MIIA 1B8NA 1E7WA 2YWCA 3EUEA 4LRQA 1B15A 1N0HA 3F5FA 4B32A 1JJ7A 2EL9A 2VQ6A 1IBMB 2AN1A 2G7ZA 4M6WB 1VB5A 1YVUA 1L3BA 3HDTA 1UINA 3FSGA 3FWHA 4L27A 4TMXA 4XUEA 5TC4A 3TRKA 4B6GA 1IVSA 3DOIA 4AJ9A 4FYVA 3S6JA 2IX3A 3ZVKA 1UZUA 2JFXA 1EK1A 3WOVA 3H5RA 3QIAA 4I5IA 3GUZA 2MOKA 3KQPA 1HDXA 2CNWA 1HETA 4ZTZB 2AQIA 2G3YA 3TTVA 1Z8DA 1XZHA 5BVGA 3K09A 4OQFA 5JIBA 4WOKA 3E22B 1M2WA 3F7NA 2H16A 1HC7A 1USKA 2I2WA 1QIJA 3IR5A 4J1TA 4PLYA 1N92A 4XIYA 3ZW7A 2P0AA 1OU0A 1YA4A 3EASA 2C9ZA 3FDZA 3QLVA 1PJBA 4UU7A 3ZDEA 4Z51A 4ZIRA 1Q1AA 3E3AA 3BXHA 1IZ9A 4YHBA 2ZYRA 1OIWA 1OT3A 1VL0A 3ER6A 3GRZA 4FXPA 5I7SA 2CEAA 1ILEA 3Q3HA 4UXIA 5F2OA 1EINA 4PZPA 5JTTA 3DGEC 3KJHA 1BE8A 1JRLA 4A0RA 1CC1S 2I1LA 3KEGA 1KZ1A 1TEVA 3K35A 4IDOA 5FFFA 2WINI 5HE8A 4B43A 4EJMA 3TZBA 5FPTA 3A1TA 4MEBA 4DVGA 5JAIA 1VHLA 4MUMA 3F3MA 1H2ZA 4WGFA 4K3UA 3AO0B 1BXRB 4Y1RB 2YN4A 4Z9BA 3EZ6A 2AMLA 2MCFA 2EGGA 5IJ9B 3R7BA 4GE3A 4NAVA 4AZSA 5G40A 5EP3A 1DG1G 3R9WA 1CR6A 2NZJA 3B6ZA 4RQTA 4X0EA 3Q3CA 3TMKA 5JJLA 1VJGA 1BTOA 3QLJA 1CK4A 2R9VA 2XF2A 1G41A 4E5SA 3M8KA 2W6MA 4KVZA 4KNWA 2OBXA 1KVRA 2SECE 3MQFA 4MW1A 1IYZA 2P4UA 4MYTA 4TX1A 4C0HA 3ZDFA 2W42A 4M98A 1KF0A 2BFFB 1VL1A 3EBLA 1I6WA 3L6UA 4I66A 2OFPA 3PUKA 4UVDA 2C5FA 2XMRA 1NZDA 4PF1A 4KXWA 1R4AA 1DDOA 3R5HA 2I91A 2AZTA 3K0KA 2EOAA 3F49S 2AOUA 4K2HA 4K9QA 2BZSA 4Z4CA 4KFCA 1GG8A 4DBVO 2YUTA 3G9ZA 1P75A 3V1MA 1NJGA 2JZCA 1NW4A 4GBMA 2G4VA 1U7PA 1NXWA 3ONVA 4R41A 4DYDA 2NTVA 5A7FA 4AN0A 2GJKA 4HB3A 4KGDA 1CR2A 2FF5A 3KDSE 3OESA 1JB1A 4HD8A 4LRUA 4QREA 3M9LA 4OK5A 5JI2E 4ZRDA 2QP4A 3A6EA 3VJKA 1G7TA 2YOHA 2JD1A 1VE7A 2X15A 1J24A 4R2MA 3KPVA 1FJXA 2B35A 1J1IA 2XDQA 4Q9HA 2XGJA 3GRAA 3U60B 4WK0B 4RM2A 3SZRA 4N0PA 1GKYA 2JA2A 3ROXA 2PLRA 3PFGA 1T5BA 2E37A 4KYIB 3BRWD 2HR1A 1HZZC 1KAHA 5LP6B 4XQGA 2OFOA 1F2VA 3KLMX 2WUFA 2V7EA 5DWVA 3LWBA 1AXEA 1SZCA 4QYTA 1HNNA 4M76B 5IJWA 4JKOA 4N5LA 3FBTA 4RYDA 1C4XA 2AL7A 2J87A 2RH5A 2CL7X 5EGSA 1E4YA 1ZMBA 2BFDB 3R0ZA 4MA5A 3C7DB 3VU1A 4OQDA 1M1YA 4M0LA 3ZQKA 4N6OA 4TZTA 4MUXA 2ANBA 2V7XA 5H80A 2VKTA 1M66A 1SXJA 1T2NA 4LZOA 5GQSA 2W8BB 3V7WA 5KWSA 4M60A 2QVYX 2PX3A 2JJ1D 4CCAA 1N0UA 3IDQA 1U1IA 4MP3A 1U9YA 1UWCA 4EUHA 1JILA 1L8QA 1JXAA 1K7CA 1Z4JA 4WIAA 2OD9A 4PZCA 5ALTA 3O84A 2X2PA 4GYWA 4ZC8A 4MX8A 3Q6NA 1U1FA 3ZZUA 1HFWA 4ZI5A 3BHJA 4OIFA 2WWRA 2HWWA 3B5JA 5JT1A 5E3JA 1IN4A 5KKCA 4RGYA 4V24A 2JJYA 4IFEA 5DNVA 3OF2A 2WHXA 5JD4A 1XKXA 3P9YA 3I1FA 3TOVA 2GAJA 3BWMA 4C7BA 5HIJA 4ICIA 1V6AA 4BRUA 4R9UC 2BP7A 3OWHA 2ZRIA 4U7FA 2GPJA 2HRBA 2VYVD 3MA0A 4URYR 2G6BA 1PIWA 3C3KA 4HNAB 3AKEA 1DCKA 1E3DA 3FRHA 3SF8B 1N3IA 3VR5A 5K8UA 4CEIB 1WPXA 2GEBA 3F46A 1D2EA 2GAAA 5IULC 1W7AA 3MUOA 2PL5A 4U2DA 4E5PA 4E31A 4J2TA 2WYHA 4MV1A 4BMXA 1FCJA 4ZCIA 5CCBA 4OJNA 4H7DA 2NG1A 4L5CA 1GA6A 1C0KA 1B3BA 1DKRA 4HFMA 5DYGA 1KU0A 5C51B 4JI0B 1S9HA 4BNYA 3QVLA 1PJZA 1WJGA 4XGRA 1DI0A 3MN1A 5UKDA 1QQTA 4ZJPA 3SX4A 3S1LA 4RMGA 2WPNA 4UUPA 1IBLB 4ATNA 2I7XA 2Q1TA 3C8MA 3LTNC 2VZEA 13PKA 1AK2A 1UKAA 1YJAA 4S24A 3AOEA 1OXTA 3A10A 4NH4A 4QLAA 3ZE8A 2EFEB 1BE0A 2D5LA 2GXSA 3I45A 3I4CA 4UNQA 3M3HA 4B81A 2LCIA 1OT5A 4ESVA 2R6DA 2B20A 1EZ1A 2RE8A 1CF2O 1LTKA 2JBWA 3K31A 4EI2A 1XRPA 3QHPA 4YAOA 3A4TA 3OCCA 4LKRA 4MWEA 4OFBA 3TRJA 3ZK7A 1H4SA 3JZDA 3TDKA 1ORTA 4AJNA 2O4UX 1LBTA 4OAQA 4NIMA 3CVOA 2OLJA 4AY3A 4W9NC 1XA3A 4BRZA 1KYWA 3GLIA 1BXGA 2IVZA 2ZU0C 3DMHA 3JWIA 4KPGA 3AZPA 4PGAA 3U3ZA 4WBNB 3OQ1A 1RKQA 3FJOA 1LLQA 2O7QA 3C7TA 1R0XA 2Y1OA 4CDMA 3QJ5A 1ZEJA 1WLYA 4QU8A 1GZDA 5IBPA 3GT0A 3OZBA 5AVQA 2W00A 1FBTA 4JBLA 4N7MA 5F76A 3LXXA 4FW9A 1MOZA 1L1FA 3N0XA 4IPTA 4YPFA 1QF7A 2Y1EA 3L8HA 3MILA 1D2HA 3BMOB 2YHBA 4JLNA 1LSSA 3OEYA 4AI6A 1L7DA 3CPEA 4KK3A 2EJBA 4MUBA 3FA2A 1FLNA 1SXJD 4UCFA 3TZLA 1H2XA 4BLTA 3KQUA 2R8XA 1ZZGA 4YPVA 2FGKA 4MPPA 5F9MA 1NTOA 1V0JA 2O2YA 3AG5A 4UXJA 1AQJA 3DMFA 1EFHA 4E5NA 5T4FA 1Y8QA 1B8UA 1GA4A 3DUFB 4BGIA 5IYZB 1HPLA 2IPMA 1VYHA 4F8JA 3UTDA 5ES4B 4ZIRB 1YTUA 1K63A 2WR8A 1XKLA 4N5MA 4OHPA 4P80A 3JQEA 3G0HA 1VKJA 1JNXX 1XEWX 1SN7A 1HFJA 1M6WA 1JIKA 1MJFA 3A26A 3LA6A 3GGGA 1CZUA 4YJHB 4ZVLA 3EA4A 5L3RA 3WTCA 4QOGA 2RMKA 4L5YA 2NTYC 2HMVA 3JZAA 4EUKA 4DREA 4KQJA 2YMMA 3CIFA 3A3PA 5LJIA 3ZHTA 2EFDB 2QIOA 1U63A 1C5KA 2E4UA 2IXEA 1ZY2A 4MYDA 1YJ5A 3HFSA 3ZD9A 2Z58A 3D59A 4A26A 5IDQA 3TIXB 1U8AA 3T4XA 4YRRA 2GLXA 3U09A 4FB5A 4TT3D 5JJCA 1KFCB 2B4AA 2IYXA 3ZCVA 3TZKA 2AN5A 4YALA 1P39A 4LDZA 3PF8A 2RKWA 5IZ4A 1GQQA 4RACA 1RTKA 1N1DA 3KV1A 3CJRA 3O8NA 4OU5A 4QXOA 1YMVA 1DBWA 5TB5A 2NSDA 4KZPA 4OP1A 5EJEA 2X4GA 3K0FB 2DPMA 1HT2E 2NZ2A 3EEQA 1AIPA 2QUZA 3IFSA 2I7DA 1SUPA 3VSEA 4Q24A 3JRWA 5D3QA 5FI5A 4EPYA 1DVRA 2C2HA 3VVLA 4P3YA 1UP7A 4RVCA 2EG5A 3V7NA 1SG0A 2PTHA 3Q3JB 1RP1A 5TMDA 3BMCB 3GBVA 3VNBA 2W48A 3I4LA 4RZSA 3C2QA 3DBRA 4X1OA 2AMYA 2E1RA 1R2QA 2OOKA 3PX7A 2VJAA 2E82A 1P9OA 4G5SA 4RHXA 1XBTA 3IT2A 1NWHA 4MRRA 2MYPA 1CDEA 3WO1A 4KODA 3OF5A 4RQAA 3C5EA 1PK9A 4GKKB 4M88A 1I32A 5KPDA 3F7TA 4ND2A 1RXYA 1E66A 3SHTA 3UXEA 1Q12A 3ICWA 2AK3A 4L76A 1KRWA 3B1XA 3NFRA 2BTQA 4J9VA 4LBZA 1OA1A 1FP2A 1VP9A 2XVAA 3KOWA 3B13B 3ISVA 4PTZA 2C00A 4QSHA 5DYIA 2J41A 4AMZA 2A14A 2QGZA 2ZBPA 3SJUA 4AZ0B 2HQ1A 2IK8A 3EDOA 3LCUA 3D3WB 4LE2A 3R6GA 1PDVA 1B1AA 1QC5A 4K6HA 1V1JA 1KMNA 1U65A 4D7AA 2JG3A 1DUSA 4CMJA 2PT7A 1V9SA 3NUZA 5CT6A 1Y7LA 2CFSA 1D1TA 2HU2A 5BR8B 3QVKA 4N8DA 4ZVNA 1VKZA 5BSEA 3FHLA 2P68A 3F74A 4KXNA 2OP1A 2VP4A 4HGZA 3ZWMA 3RR2A 3NM5A 5KTMA 2GMWA 4W1QA 2YYSA 4OSEA 4PANA 1I5EA 4HH1A 5ALSA 4CM4B 4J03A 2VAPA 1UJ2A 5KTPA 2JA1A 2MTBA 4C0BA 1T4MA 3E5NA 9ABPA 2YNMA 4DEYA 2GVDC 3PSAA 3TLKA 1V16A 1MNAA 5KSOA 1XMJA 1X1AA 1KVSA 1ZG3A 3B60A 1KSFX 2EZ4A 3GNSA 3HKEB 3KJQA 4LVOA 2GNAA 4HGOA 1SBQA 5EHNA 1FLVA 5DMHA 1NGSA 3BIOA 4QRHA 1XPRA 4Z9XA 4RDCA 1BH2A 1Q0SA 3IB6A 1GEGA 4JP2A 4H3VA 1EEHA 1EU1A 3EAQA 1KZGB 3IHTA 5AJXA 3T7TA 2PJDA 4F97A 5BVGB 1HMPA 3BWYA 1KSHA 3VKGA 1S2OA 1PUXA 4N76A 1Q91A 1U2DC 4NPCA 1TLTA 4QRIA 4FZ5A 4D57A 2ENWA 5C7OO 2I7VA 1HBJA 2FW9A 2JK1A 2JL1A 3H9JA 2D62A 3OZGA 1PFKA 3VPXA 4EY6A 5B55A 1O94A 2A4KA 2PSHA 1P19A 2NVBA 2OPBA 3O2QB 5GTDA 1SCQA 2GPSA 2WJAA 4K9DA 1E4EB 1PFUA 4F3NA 1FYVA 1YS2X 5F1OA 4DCGA 2R751 2FJPA 2J9FA 3EC7A 1M73E 1NLUA 5AHWA 3WGQA 5KTNA 5L51A 5LQJA 1HZZA 1XD2B 3JD2A 2DULA 4POAA 4GKBA 4UUBA 1QOPB 1P77A 3BZBA 2ONCA 2GQ0A 3LX4A 1PZEA 3DZFA 4CLRA 1SUWA 1OSNA 3P9KA 3IAM1 3Q2KA 1RZRA 4MWGA 2DLNA 3WKBA 4F7WA 4TLDA 1DKUA 4MVJF 4OYRA 4RD2A 4BMYA 4OBEA 4TLBA 1G4AE 1I4WA 2GM5A 3TUIC 3K6SB 4O8CA 4M21A 3K4HA 1VZ3A 4L3WA 1ZCAA 5I9MA 3GJ6A 3G8YA 1O54A 3OC0A 3ONEA 2PYIA 2V45A 3HG7A 1TIKA 3R3ZA 4C30A 5EEHA 5JMWA 3RUHA 4EO9A 3QXXA 1Y8QB 1WCV1 2ACEA 2IU3A 1HE4A 1ZGAA 2ZYDA 4ZVSA 1DIAA 4FKZA 5HQJA 4DCVA 3NJRA 2YKGA 1JJFA 3CX8A 4DR6B 4JT9A 2ZK7A 1L5LA 3NPAA 3WDSA 1NDQA 4FGZA 3EXHC 3GEMA 1ZINA 3T3DA 2CL0X 2J0UA 4GLLA 5AW4A 2IYSA 2JH8A 2YVQA 3PICA 1OCEA 4QBTA 4OA8A 3P2IA 5E4JA 3WJ7A 2HRZA 1O57A 1I6LA 4OEHA 4UHKA 2Q45A 2ZB8A 3A2KA 1GM5A 1JEOA 3MGCA 4P5EA 1I7DA 5IJ0B 3SLRA 3P2MA 3WGUA 5A5VA 4AD8A 1GPBA 1X15A 4BIMA 4D3XA 1N5MA 2INGX 1QLJA 1AGRA 1E3TA 1LDMA 3GCZA 3VX3A 8LDHA 1K7EB 2OB2A 3BRQA 4Q34A 4MKZA 3ZXXA 1XZBA 1QH9A 2HPHA 2CKDA 3RTAA 1A76A 1J2YA 2O7SA 2VTBA 4PYLA 2PZJA 1XC7A 4UFOA 2Y1CA 4G8DA 2X40A 3DZBA 1AA9A 5AIAA 5AJUA 1UANA 1DAOA 3CLTD 4FHCA 5JVDB 3TL2A 5B4TA 2UXCB 1OYVA 2E4AA 4NRDA 3X1MA 4YJ2B 4EFMA 3F5SA 1L4HA 2QYSA 1URPA 4DMLA 3HB7A 1SVWA 1S2IA 1P2DA 1AV7A 1QTIA 2K5UA 4IIHA 1SQ6A 4EUNA 5GONF 4F7DA 1T1RA 1T8YA 2M6SA 2N9UA 2DUUA 2C95A 2QAIA 3IKVA 4PX3A 2V65A 3U7RA 4HEJA 1S9DA 3RC1A 1F06A 1ZR2A 1I3MA 1ZVMA 4ZK6A 1H9AA 5DXAA 3LQFA 2J46A 1A88A 2UDPA 2GXAA 1Y48E 1E96A 2CKMA 3HBJA 3MWDA 3NFYA 2HC9A 2RB5A 4HQ6A 1A04A 1II8A 3RSFA 4V0LA 3RUCA 1H1LA 1XIVA 3WDLA 1MOSA 4BKOA 4IDEA 2M98A 1MRNA 5CDTA 3ZGOA 4CF4A 2IUEA 2L17A 3ZE7A 2Y93A 1QE3A 5FEMA 3UH1A 1HDRA 1EM6A 3KEMA 4PO3X 2NTJA 2WJGA 2XA9A 1D7AA 1L5QA 1G17A 1B2LA 2OFWA 3QWAA 4F4IA 3LNCA 4DLYA 4ND4A 4ZVOA 1YRAA 1E8NA 3Q8KA 1HE5A 1FW8A 3BIFA 1E2HA 3SF0A 5KQSA 3PR2B 4FU0A 1GA1A 1H5UA 4WY8A 2M9MA 4XCXA 5EFZA 5H16A 3WL5A 4B2YA 4WN3A 1HNZB 3B9BA 4RV9A 4DGQA 4RCYA 5EIOA 1V9LA 3BGOS 1P1RA 2QU7A 4YROA 5KNLA 1E9EA 1WG8A 3TMAA 3VZSA 5FBKA 2LXNA 1MIOA 3GELA 4U00A 1OFGA 4ZCTA 2I7CA 1A2BA 2P5UA 1KPGA 4RYLA 3DD1A 1HFEL 3PT9A 1R64A 1SHJA 5G1PA 2HLHA 2YICA 5I51A 3WL8A 5IKEA 1SK9A 1MT0A 1YBVA 4WEQA 1L4LA 2V3VA 4DCMA 3CQ9A 1OB2A 2DR0A 4ARSA 3COVA 5T7BA 1M6EX 3HN7A 1B1CA 4RLHA 4D9KA 4AY2A 2I0FA 2AFIE 4FW8A 1PF7E 4GKAA 5IC5A 1JR6A 1K7FB 3O3NB 2C5LA 2R6FA 4H0CA 4HMPA 4M8NE 3WBBA 4IWXA 4TZ6A 4MR9B 2NXCA 4DSTA 1RQRA 1RHMA 1LK5A 4RPHA 4V0QA 3VR3D 1M2GA 1EXWA 3FX2A 1DWPA 5F4BA 4KO8A 1Z7WA 3QK7A 3VXKA 2WTNA 5BR7A 3FW1A 1FX0A 1ODIA 3M4NA 4IDGA 3FIJA 1H8HD 3PNYA 2XCRB 1WNFA 2CUZA 2ZBGA 1E7QA 3EHDA 5AI0A 2VBGA 1EVZA 1PQUA 1W46A 5IJ9A 1NYLA 1XNQB 4LXXA 4KLZA 4PZDA 5J2UA 3DEYX 4R3WA 4PS1A 3HVIA 2XBUA 1CE8A 1OFVA 2W37A 4TM7A 1SVSA 1QDLB 2AYYA 3PIIA 5JXWA 2BEUA 3PR3A 4J29A 2GM4A 2FW1A 2BFEB 3QEBZ 1QRSA 2Q27A 1N0WA 3SHWA 4Q7JB 3V8PA 5HIKA 4OGGA 2YL2A 5ITZA 1VZ2A 1E5VA 2BF4A 1AHIA 2DJIA 2MYTA 2ZOSA 1TAGA 3CHYA 3DFZA 4NNOA 3A2NA 4HN4B 5DGCA 5HWSA 3OJWA 4KX3A 3UPUA 2GJAA 2BKLA 2VDPB 3QVMA 3S2EA 3DLBA 1T1EA 5I4KA 4KSBA 1PK7A 1YZTA 2AN9A 3D0OA 3O7WA 5CVJA 4EG1A 5MN5A 2Z30A 3DE0X 4L0DA 3T4PA 4UNSA 3G2JA 3IQIX 4HQFA 2PR7A 3BWBA 3RS0A 1US8B 3VH2A 1NM5C 1VKHA 3VR4H 3P0IA 1VLVA 1L8LA 1Z8HA 1P5RA 2I99A 5JWHA 5CFLA 1M5UA 4D4MA 4MYHA 1KSJA 3X1KA 1PR2A 4FS8A 3R8CA 3CW9A 3OTWA 1DRUA 5L3VA 4BV2A 3A58B 3C98A 3L7AA 3NDJA 5BW8A 5CT4A 1ZGBA 5KO2A 1A1SA 1JR3A 1E5DA 3PB3A 1JR4A 2AI2A 1QGOA 3AW9A 3CT6A 3FCXA 5E9JA 5LLSA 2VQFB 4OOFA 4IS2A 2PMWB 3ZH9B 3B12A 3QA9A 3GLGE 3OPVA 3P9IA 1JBEA 2C3OA 3TZCA 3A14A 1SCUA 2Q50A 4IHQA 4EMSA 1QU2A 4Q3DA 2NACA 5FPPA 3H9UA 4NYMR 2NU7B 1VYTA 5AOAA 4RK1A 3N39C 4AF8A 1FRZA 1G8FA 1H3FA 4REQB 4WKPA 1CF4A 3O91A 5B1EA 4BFZA 1Y42X 5BMVF 1L1EA 3SJZA 3HKEA 2XCTB 1LI7A 3I6YA 3F6SA 4G23A 1TQHA 5AOBA 2WSBA 1L5GB 1KERA 1ODLA 2BVNA 1U0GA 2VPQA 2CWWA 1BKSB 4GD3Q 4QYIA 4RV4A 3TTSA 2AH5A 1Q1BA 3ECCA 4RA6A 4NCJA 5EPEA 1AMNA 2JGMA 2XUHA 3J80A 1QBKC 3QBDA 1QGDA 3MWJA 4TTRA 5EE5B 2ZKLA 3GJ8A 4ZU3A 1M34A 1E3EA 1SB8A 5TDHA 4C08A 5ALVA 2Q8NA 4X8HA 5DGXA 4BMVA 4QDUA 2NN3C 3I3SR 4E09A 4S35A 4B40A 4BVHA 5BUQA 4HWGA 2P2DA 4QGHA 1AJEA 5CDFE 2NXEA 3W7BA 3WLMA 4P36A 1W52X 3N2IA 4X63A 1UWKA 1YCFA 3Q5EA 5DHTA 5A6SA 5AESA 1UR5A 4GMGA 4GU5A 1E4OA 4YJGB 4BUJA 5JNUA 1FFWA 2H63A 3DOCA 5C7YA 2XNKA 3HB5X 1W5EA 3IMKA 1R0RE 3SE0A 1MUUA 1P4HA 3U3OA 2QB5A 2ZSEA 2ZM5A 3HDYA 2QYHA 4ZVTA 2RCNA 2HF2A 3ZJTA 2ID7A 4RNCA 3OQBA 4IJQA 3TW0A 1KI6A 3GDHA 5CB8A 5IM4A 2YHIB 4DCUA 1UMBB 1N6LA 2EZTA 4DUGD 3CA8A 3LUJA 2W8ZA 3ENKA 1YJ8A 3FPKA 4W8OA 1RACA 3MWFA 1EQ2A 1KXZA 1GRNA 2BEVB 3KFLA 6PFKA 4DIFA 3EOAI 1X8KA 1INLA 2QDXA 1SKAA 2O2CA 4XM0A 2QL9A 1VIDA 3R0JA 3P26A 5DEIA 4CU2A 4NFHA 5GPBA 5IKOA 3CLRD 1GFSA 2WWTA 1SVNA 5I4BA 4NG4A 1JQ5A 5C1BA 5AW1A 1R00A 2P5SA 4M9QA 4D56A 4RTKA 1E1MA 1GAJA 2ES4A 4NZMA 2AD5A 2YXEA 5F2KA 4R9SA 3WB1A 2VDWB 2BDUA 3TQFA 2NXNA 4Y18A 3C6XA 1CEEA 1R6AA 4M1TA 4C1NA 1Y4ZA 2PHZA 3M3PA 3VYVA 4BVJA 4FSDA 1TA4A 1LF5A 1U94A 2O57A 2GA9A 2XMCA 2ZS9A 5CJJA 5FA8A 1OGIA 4X1IB 3V4ZA 2Z2JA 4D8TA 5BMVA 2IODA 3LQQA 3DO5A 4LGMA 3MT0A 1JR3D 4LPKA 1P3JA 1T9GR 1YKGA 5FL3A 4ZHQB 5DYYA 5GONA 3JQGB 1ZAYA 2W93A 2H3EA 2JW5A 3GP3A 4KMMA 4Z99A 4ABYA 2G1PA 1UFQA 5SZIA 4C5AA 1MIOB 1FDWA 1DTSA 1QIGA 2JJ2A 4IHJF 4ZEVA 5BWCA 5ILQA 4TWJA 1BCRA 4EPTA 4H0FA 2ZRJA 1N57A 2JGDB 3PFFA 3V32A 1EJ6A 4EI9A 4YXWD 1XZFA 2IDMA 5AH0A 1E58A 2G71A 1MX9A 2JAHA 3P0FA 5EOVA 5K1ZA 4Y6OA 1NVWQ 2BM0A 2YWFA 3HNPA 3PPXA 4KXLA 3REQB 1FUYB 1J23A 3BGDA 2PQ0A 3DOJA 4ZU1X 2ZPUA 3A4IA 3AFMA 3SY8A 3OQHA 3TFOA 4NBNA 2VYNA 3COZA 3ROQA 3UFBA 2IFTA 3QKSB 2GZ2A 5I7HA 3CNEA 1K6EA 1M1XB 3ZWYA 4H17A 3AJRA 4AY5A 1L0BA 2QE7A 2Y1KA 4BP8A 2G1KA 2ZPAA 1D9XA 3GX1A 3I5AA 4UZSA 4YO8A 8AT1A 2H0RA 4G01B 3KYCA 3FPCA 1B0UA 1M2VB 1CUBA 2GZHA 4EWLA 5GIOE 2FEAA 4LHSA 4D9JA 2N0SA 3I04A 2IGBA 3FWYA 2AXNA 1IN1A 1QKJA 2Q5IA 2RK6A 3OUUA 4D3SA 4O5OA 4NXNB 1Z22A 4AROA 4PG8A 1MO4A 1D1PA 4DRXA 3Q72A 1HX7A 2NPFA 3JQAB 3H8VA 3BAFA 4HDMA 3X44A 4PCVA 1QX3A 5H68A 1JHOA 2JZNA 1FTYA 3GK3A 4AUEA 2QLBA 2Y2VA 4FPXA 1RAGA 2RHTA 2ZATA 2ZTSA 3HCFA 4PQGA 4QUHA 3GUCA 4D9EA 4DR1B 4L07A 3VISA 2JGNA 4ZQFA 1KJ9A 3SOZA 4DY6A 4NYMQ 1LTQA 2W83A 3QMVA 5FJJA 1XK7A 2PM8A 4OYHA 1WZIA 2R8EA 1RI2A 1HDIA 1YR6A 3FMPB 3FSEA 4P3XA 1T2VA 3IX7A 1AGNA 3FETA 1XLTC 3A1EA 1UK6A 1DU4A 1SULA 1WKVA 3E9MA 4LCBA 4PAGA 5H1YA 4R6WA 5IDXA 3OC6A 4MI1A 2DFVA 5C4IA 4TMYA 2L69A 2JCXA 1JHUA 2R2GA 4NS4A 4NHOA 3QPWA 4N3NA 2JS7A 2GRUA 2NYRA 1SC9A 2VS1A 3OE1A 3QXJA 4E5UA 1AG9A 4UE6A 3BHMA 4XDZA 3L7JA 2COKA 3STXA 1ECGA 3N7UA 3AESB 2PZFA 2DBRA 1PEDA 4Q1AA 3WVNA 4KQWA 3SSOA 1I2BA 4MLCA 4UDOA 1J20A 1VRWA 3BDAA 1ZOOA 5LQMA 3ICQB 4JBIA 5CVTA 4WLVA 1HI9A 4FGJA 4ZAWA 3LCMA 1VB3A 1HRDA 4KDFA 4E21A 1UT5A 4ZU6X 5IARA 4RF2A 4EG5A 4MV6A 4OMFG 4DHEA 2VRNA 2QD2A 4LQLA 3DAHA 2FE1A 4HLNA 3U6KA 3Q10A 2QT1A 3CVUA 1SXQA 1S7CA 3UWPA 1YFZA 3B3JA 5F5NA 3FOZA 3MS7A 4DG8A 1XTBA 3NJ4A 3KQMA 2WJ4A 1OAOA 1ELOA 1STOA 4Y9RA 3HCWA 3GLQA 4URVR 2V0NA 2BBWA 1G60A 4R2HA 5LB2A 1B41A 4BFSA 1HNWB 5TX7A 1WR8A 3PXUA 5B12A 1I2ZA 4AP5A 3CISA 4RZIA 2AJBA 4G8CA 3EYAA 3F2VA 2YY6A 3HDVA 4GH5A 5LYYA 3H84A 3RUEA 3ULKA 5IAAA 3QIVA 3PQFA 4H9GA 4ZALA 2QSJA 2VA8A 2GK4A 2PNJA 4HZGA 2ZI3A 1T3TA 5DI9A 5JY1A 4YBRA 1X8LA 3VPHA 5BUZA 1ZUD1 4LVNA 1SUIA 1PGQA 3KWLA 3JQCA 1SXPA 2IY9A 3UHAA 1Y3IA 2R7LA 1RZVA 1QFYA 3V80A 1TMKA 2H0QA 1B16A 2VSXA 1DOAA 3ORSA 4ZZ0A 1ZIYA 5HK9A 3JD3A 2HJSA 1LPNA 1RWKA 2R79A 3H6KA 1E1YA 3MAJA 1QOZA 2QW0X 4PNZA 1FP6A 2BJHA 2O0LA 4JFAA 1EVLA 4L16A 5EJFA 1TAUA 3FNEA 1QR6A 4KTTE 4IDCA 1GUAA 3BL8A 2C2GA 5LSAA 1UUFA 4LVUA 4CI0B 1T5SA 4DGSA 5A62A 4QVGA 2FP3A 3GQBB 2VLBA 1G4HA 4OXQA 3QE9Y 2C4VA 4LWZA 5U9CA 3H0CA 3MAAC 2F62A 4KDEA 2GZRA 4NFSA 4OJYA 2BMEA 5CUQA 1QH0A 1T43A 3WLEA 5HUJA 5AVXA 4L8GA 4OMCA 3RABA 5CXQA 4TQ9A 3BFVA 4G5QA 1OXUA 1PBNA 4P86A 4TTQA 1T5TA 3PUIA 1H6BA 2FAXA 3P94A 3P45A 4YAWA 1J1UA 1T10A 3URKA 3G6KA 3I8XA 3DOOA 4R84A 1Y9AA 2VT6A 1THGA 1G6OA 4R2XA 3HWX1 2YW9A 4NPAA 5JH7F 2OCIA 2PWAA 5HQ3B 4EZIA 4LDPA 3GLGA 1PWHA 4MEJA 5CT5A 4X92A 2IHNA 4C89A 2AOUB 4OQYA 4YCBA 3KELA 5WRFA 5FI1B 5GADl 2E3JA 3F71A 4X62B 1KYQA 2VA9A 4DJAA 3Q0IA 5IT4A 3NOOA 2IS2A 1YBAA 1TFUA 2P0YA 3QI2A 1LBSA 1VI6A 3ZCQA 4MI9A 3T3PB 5K03A 1NY6A 1XL0A 2GHIA 3KKNA 4U9UA 1TPYA 5JDCC 4F5EA 2BWJA 3E9CA 1OBVA 1Y3DE 1W93A 3Q7IA 4UTXA 2G8LA 2UZ3A 2X5OA 1AN0A 3A2LA 4WLUA 4UHHA 1C0EA 1EG7A 5EMKA 4EY8A 2LDBA 3BMNA 1B74A 4BVFA 4U9HS 2B4TO 4IMJB 4F2WA 2XTJA 3LVRE 3DFUA 4DC9A 2ZSDA 4PAQA 2Q8PA 4RK5A 1N9KA 1ZHFA 2H54A 1F4VA 5K51A 5MGBA 3ML1A 4X7BA 1DJLA 3FFBA 4LGVA 4DM3A 4OAOA 5AVYA 3QYFA 2HTEA 1CFJA 4UULA 4CF5A 3PDIA 1X87A 2UYQA 1P1BA 3MGGA 4X94A 3ZHBA 4R8KA 2XUJA 3OHMA 3L43A 4W7HA 3NRBA 2R68A 1EGHA 4I9GA 3S1AB 3L04A 1GTRA 3H1FA 2AF3C 1NN1A 1QVRA 1E89A 2YOGA 4J91A 4Y67A 1JHYA 1M1NA 5E8JA 5FBLB 1N5DA 3CW8X 1YS1X 4R4JA 3QKSA 4W99A 1YE8A 1XR3A 2A6PA 1R27A 3BHNA 1L7NA 3ZZ0A 5ESWA 3TMYA 4TSKA 4V2IA 3K32A 4RZ3A 1OE0A 2ZSUA 1IHXA 5C3UA 4EHAA 3C6BA 2DWQA 3VNUA 5AKEA 2OPHA 4YQYA 3N6RA 3G7SA 4NDAA 4QECA 2X0EA 4XRGA 1QB7A 2Y0PA 2BFNA 1UPAA 5EHQA 3H4TA 3NP7A 1ZSYA 4EZBA 4D98A 1G3MA 1L9KA 2OMEA 3WXBA 4ZYXA 1HDCA 3ZV4A 1IXYA 5DYNA 3ICEA 1MVNA 3LIIA 3ZUPA 1DAEA 1HOXA 5LYJA 1A82A 4CIAA 3COJA 2O8BB 3EARA 3KOMA 4KXYA 3LU1A 5P21A 4A1OA 5CDSA 3SQXA 1W4LA 2Q3JA 4G65A 1VJDA 4EX6A 4KO1S 2AOXA 4ZO6A 2YRXA 2KPOA 2ZQ5A 3BXFA 3LKVA 3ACDA 1YC2A 5FBZA 1IZ0A 2FVYA 2WJVA 4I5GA 4FBMA 1NXOA 3ISJA 1MG0A 4K81B 2OILA 2Q6IA 5EIBC 1KQOA 1H05A 2NO5A 2WWGA 4RL4A 4YMHA 3KHSA 1HM5A 1N6KA 1JKMA 3KB8A 3L1IA 3PXXA 1HMYA 1OY1A 1WXWA 1I51A 2WYVA 3KCQA 3PHJA 2WEKA 4ZHQF 4QE3A 4C4YA 2IBSA 1NVUQ 2QVZX 1Q0RA 5AT1A 4C5BA 3KSZO 1S7GA 3D6NB 3NQ41 4HADA 3QGMA 3W4JA 4J07A 1W47A 8ABPA 3IXLA 3W90A 1ZN8A 1X13A 2OGWA 5IX8A 1LPPA 2X4DA 1U2SA 3LHFA 5A5DA 1NW8A 3CMCO 1GG5A 2C2OA 4UVIA 1KJQA 4D8XA 1P0FA 3I6ZA 2BBOA 1XG5A 3RS8A 4KYTA 4DV2B 2ZUBA 3IBTA 7AT1A 3DE4X 2GEUA 4RZHA 2HN9A 2MWMA 3T9DA 4EATA 1UK8A 3WAKA 3IO5A 3U9SA 5CA1A 3CR8A 1NASA 4HTFA 3W5BA 3GP8A 1G6HA 2OQRA 4MRSA 4AJOA 3R76A 4QPDA 5CTAA 4ALJA 5HZGA 4CEJA 1YZHA 1ZAKA 3AUAA 3OCYA 4PRLA 5KU7A 3OZIA 1U8TA 5G4KB 1YHZA 4XD2A 3W06A 4FBLA 3W8FA 1T9AA 4DEVA 1RR6A 1XVAA 3MW8A 4WACA 3SFZA 5AUNB 3ACBA 4TWRA 2VF7A 1THTA 2HKIA 1T4CB 2FOXA 3F2IA 4G1BA 5DNAA 1OC2A 2BF7A 1SK8A 3VAAA 3W5SA 4BV9A 4BV3A 5KPJA 3AB3A 1C7JA 4JDUA 3T5TA 3R3VA 1QO9A 1D8TA 3OP4A 4YASA 2CFOA 2WNIA 5C0OE 4P3PA 3TLGB 3G68A 3RG2A 3ZKAA 2Z2XA 1X7XA 1D1SA 4L4XA 1RZUA 1Q7EA 1ZJJA 2C8LA 1WZEA 2OVFA 2Q1UA 4RH1A 4HUTA 3ESXA 1USVA 3Q12A 4YA6A 3EWAA 1EFVB 1O5TA 1MV5A 2HA6A 2LRHA 2WP8J 2ILTA 3I23A 2WWIA 4LHWA 4OTZA 2QTCA 3TPFA 4GDMA 4ENPA 1M76A 2C97A 2VUHB 3FHCB 4JC0A 4NE7A 1W30A 1G64A 2ZIAA 4LHYA 2QEQA 3AVQA 4O2BA 5KJEA 4HNVA 1LV7A 4IHJA 4M8KA 5DGDA 1KIFA 1TZJA 4YACA 1SCNE 4AB1A 4U6QA 3IVCA 4K6MA 1JW9B 4TV9F 5A4JA 1J33A 3Q9LA 2CK3A 3TDMA 1WP4A 1SU8A 1MG5A 2X42A 5J40A 3V7YA 4R0MA 2CNWD 2RGDA 2WE7A 4NYIR 5BYAA 2CL5A 5HR5A 1SVUA 1GLGA 3EEOA 2FH5B 4IMIB 1QQAA 2C2WA 3RSSA 1M1NB 3ZYCA 4E15A 2PPLA 1IHOA 1W25A 1JQDA 1WIWA 2Y0EA 3D8NA 1ZU5A 2QQGA 2O50A 2CZGA 2JB9A 4HLDA 4XSGA 5FBQB 2JATA 3UMGA 4AVYA 4PC6A 3V55A 1MOPA 4B7XA 4MUJA 1LLUA 1VBMA 2WLSA 4J76A 4RL6A 1ZK4A 4R2LA 4Z0PA 2P6MA 4HDAA 4PFKA 4OATA 2IS6A 1H2EA 2QN2A 4HAOA 3S68A 1IAVA 3ZK8A 2EKBA 3CYFA 1N1GA 4OQMA 1JLLB 4YV0A 2IUFA 1P1CA 5KSPA 4WDRA 2CLDX 3ET5A 3FYSA 3GUHA 1DUVG 1G0OA