5AVKA

Crystal structure of proteinase k from engyodontium album
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
molecule tags Hydrolase
publication title Derivatization of Proteinase K with Heavy Atoms Enhances Its Thermal Stability.
doi rcsb
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5avkA00
3DE5X 3DE1X 1SN7A 1C9JA 3DVSX 1YJAA 3LPDA 1SUEA 1XF1A 2PQ2A 3A3NA 3D43A 3QMPA 3QTLA 2SICE 2PRKA 1UBNA 3GT3A 4JP8A 1S01A 2W2OA 3WIVA 1MEEA 1SBIA 2E1PA 3P5BA 1TO2E 1Y33E 3VTAA 3ZXXA 4DWWA 4HVLA 1AK9A 1DUIA 2B6NA 3DE6X 3I30X 3DVQX 1GCIA 1GTG1 1NLUA 2WV7A 3A3PA 4LVOA 2PYZA 1BE6A 1TMGE 1YJCA 3WHIA 2XRMA 1SBNE 1BE8A 1SUAA 3PTLA 3AJ8A 3F49S 1SCJA 1THMA 2XTJA 4ZARA 3VV2A 1GTL1 1S02A 3TI7A 3UNXA 1Y3CE 4Z2AA 5JXIA 1TO1E 3AFGA 4RYDA 3Q5GA 1WMFA 1OT5A 2G4VA 4KB5A 1ST2A 2HD4A 1YU6A 1AH2A 4HX2A 4M1ZA 3VYVA 2ST1A 2W2QA 1BFUA 3ZXYA 1DBIA 1SCAA 1SPBS 1SCBA 3DVRX 4KG7A 5SICE 1WMEA 3GT4A 2PMWB 4MZDA 5FAXA 5JXJA 4WOCA 1Y48E 4I0WB 3VSBA 1PFGA 1TECE 3DWEX 1SUBA 2Z57A 4K8RB 1IAVA 1CSEE 2DUJA 1SIUA 2WWTA 1IC6A 1SCDA 4H6WA 1GA1A 1TM1E 3T41A 1ST3A 2ID4A 2W2NA 4YN3A 1BJRE 4CG0A 3VV3A 3AJ9A 1TM7E 3L1KA 3F7OA 1WMDA 1SBTA 3DDZX 1PEKE 4GI3A 3HJRA 3F7MA 2ZRQA 3I2YX 3LPCA 1GTJ1 3BPSA 1C9MA 1R64A 1TM4E 3I34X 4LVNA 1KE1A 4OMDA 4BWGA 1AQNA 1GNSA 1AU9A 3CNQS 2IXTA 3WQBA 1CNMA 1AV7A 3I37X 1OYVA 4H6XA 3EE6A 3EDYA 1Y1KE 2V8BA 1V5IA 1TK2A 2DP4E 2Z58A 1SELA 1HT3A 1NDQA 1PTKA 1T1IA 2PWAA 2WUWE 5I9SA 3DE4X 4ZOQI 3DE7X 1R0RE 1S2NA 1SUDA 4AKTA 2X8JB 1GNVA 1Y34E 1Y3DE 3CO0S 3QFHA 5K7SA 2SNIE 3H42B 1KDZA 1SIBE 2WUVA 3PRKE 4KPGA 1KDVA 5FFNA 1MPTA 1C9NA 1EGQA 1SUCA 1JEAA 2SBTA 5JMOA 1SVNA 1ZVJA 2DQKA 1WVMA 1WSDA 2ID8A 2PKCA 3DYBA 1P7VA 5AMXA 3BGOS 4C3UA 2Z56A 1P7WA 2Z2YA 3Q40A 5JXHA 1SUPA 5AVJA 1GA6A 2ZWOA 3SQOA 5JXGA 5ARCA 4C3VA 4CFZA 5FBZA 3TI9A 1SCNE 1VSBA 2HPZA 2Z30A 1AVTA 1Q5PA 2QTWB 5B1EA 1Y3BE 3A3OA 1TM5E 2W2MA 1V6CA 1R6VA 3GCXA 4NMXB 5CW1A 1GT91 1OYOA 3BX1A 4DJ5X 2IY9A 4FONA 4H6VA 4J94A 5B1DA 1Y9ZA 1ZVKA 1EA7A 3OSZA 1BH6A 1SBHA 1SIOA 3GCWA 1A2QA 2TECE 3SICE 3TECE 1AF4A 2SECE 4OMCA 2P4EA 1SBCA 3DE3X 3DW3X 1T1GA 3DW1X 3EIFA 3D9QX 4WOBA 1KDYA 4CFYA 4NE9A 1Y3FE 4OV6B 5AQEA 1C3LA 1YJBA 2Z2XA 2ZWPA 4NE7A 1NDUA 5AVKA 1P8JA 2X8JA 3LXUX 1T1EA 1TM3E 1BFKA 1SH7A 2PWBA 4B5LA 4AKSA 1Y4AE 4DZTA 1GA4A 1LW6E 3DE0X 3DE2X 5ARBA 1PJ8A 2GKOA 5ARDA 3WIUA 2Z2ZA 3VHQA 1KE2A 1Y4DE 3LPAA 2W2PA
chains in the Genus database with same CATH superfamily
2H1FA 3IP8A 4HL6A 3SEFA 3WZ2A 2AEFA 2O5RA 3R0JA 3V1KA 3UHOA 2IYXA 1WEKA 2JFBA 1MGOA 1T9BA 2XMQA 4GR5A 4XLZA 1MNQA 2J5XA 4YP6A 3NO4A 1T0HB 3D3KA 3HU5A 2FPIB 4BFZA 2DRIA 1BE6A 1MXFA 3Q15C 3I9V1 3D6VA 5I01A 1A5SB 2CK3A 5C1OA 1KPGA 1E2FA 4WKGA 1JLRA 2JLRA 3BDVA 4RK5A 1RHKA 5D01A 3GJRA 4HEHA 4M0LA 3TRDA 2ZT7A 4RH0A 4FBGA 2ZUEA 4LW8A 1QDEA 4UUOA 2IS4A 3C7TA 3LUFA 2ZCUA 3UB3A 3BGSA 1MABB 5HRAA 2YHUA 1AH2A 1GUAA 3ZKWA 5FBHA 1C7RA 1J90A 1IJEA 2CXUA 2LR0A 2ZSIA 1NAIA 3DONA 1RRMA 3PRJA 1XZBA 1I3OA 1S4MA 2NUPA 2OWEA 3Q2KA 4KIWA 2AC4A 4OYRA 2HA7A 3CEPB 1PR4A 2AXPA 3MTQA 3F4KA 1SVIA 5G0UA 2FY8A 2IVFA 1NNUA 1RHQA 1E5DA 3FNGA 4P1ZA 1IM2A 3IQDB 3OD1A 3LPCA 2AFVA 4CM5A 2PRYA 2ZSFA 1T8TA 2J1LA 2RH5A 3D54D 3DT8A 3GELA 5FPPA 3LZCA 4BVHA 5MF6A 3ITEA 5TR9A 4ODIA 4KQ9A 2PGAA 4UE3S 4TS9A 2ZTUA 1XMPA 1LS6A 1M8KA 2JHCA 5CCXA 1ZVMA 3W8EA 4BB9A 3GG9A 4RWEA 1M5UA 2HBQA 2XKBA 3GDHA 4NL4H 1G18A 2ZG6A 3W2TA 2C88A 3CCFA 3FKSA 2Z6UA 1QCCA 1Q7BA 4LC1A 3TUZC 2GYWA 1KAHA 1UXKA 3GLHA 3LLVA 5FUWA 3RIXA 1D1SA 4DE5A 2I9KA 1IRIA 5A7GA 3GGSA 4JVSB 3H2YA 3KOMA 2FN8A 4L73A 5GONF 1L6IA 2Q5HA 4P5EA 1SVNA 1Y8CA 2XZDA 4RU1A 1ECPA 6REQB 4IXMA 3VR3D 3C8ZA 5DKFA 2PGJA 4UXHA 4RLFA 1S2DA 4L50A 4YRIA 5FBZA 2WG1A 3HLYA 1WW3A 3JYLA 2X5OA 3PC8A 4DXDA 3OIDA 3AILA 4FK8A 1NW6A 5DCUA 1FJHA 1UXOA 1V26A 3UMVA 1AHHA 1FFWA 1JA0A 1YBMA 1RIFA 3F8SA 2J5BA 2VK2A 3OBIA 5ENZA 4MCIA 3HB4X 4FKBA 5CX1B 5AK5A 4H35A 3NIGB 1XMOB 2FQQA 2HNAA 1I30A 4MKGA 3G82C 4Z99A 5B3LA 5CB4A 1WCYA 621PA 3CNBA 1TL7C 5LL6P 1YS9A 2JBHA 1IY9A 2IPXA 3GEHA 3FPJA 4AB1A 2GVDC 2HF9A 5F52A 3ESXA 4KV9A 3IO5A 4M8IA 4Y2HA 4C5CA 3B5JA 2GTIA 2QQ5A 1IEVA 4JVMA 1A1SA 1EJ2A 4P5DA 4TKZA 3KFLA 4DQ0A 1KO5A 4RA6B 5TB5A 3IVGA 2C7VA 2UYGA 2DZDA 3G1TA 3W90A 3QKUA 4M0PA 1J6UA 3HVJA 3PDWA 1C9YA 4G8BA 1J42A 2JAOA 1P18A 2I2BA 3NEYA 3FGZA 4WA7A 2GUGA 3GPLA 1DINA 4FFPA 4XM1A 2ZTMA 1AKRA 4EW6A 3UHFA 4K0KB 2FWJA 4TYWA 1MENA 4IFIA 3U4IA 1I7QB 2CBZA 2NVUB 4FE3A 4JVLA 4PQEA 1FFXA 3OECA 3TN7A 1C4XA 4ADSG 2WC1A 3INYA 5K9ZA 2WAXA 2VJMB 1WTAA 3DHVA 3TOSA 5GJVC 5ICFA 1E3SA 1UOOA 4OBWA 3JD4A 4J0HA 5IW8A 3QPBA 1P1HA 5IAJA 2Q5IA 1N6HA 3PD0A 4EZEA 5DRTA 2AV6A 3O82A 1XJWA 2ZIVB 1NFFA 2ZJ1A 4OXIA 3T6KA 3CURA 5EZYF 2EJTA 3RTCA 2O7VA 2DUMA 2QG4A 4HNGA 1PFKA 2X0NA 2BM8A 5ALPA 5TJHA 2OY0A 1KK2A 2C42A 4RK7A 3C39A 2B8NA 4EGCB 2XQJA 5E8RA 2HCTA 1RM5A 4R68A 4ETWA 1RP1A 4M9QA 4QPCA 2I7XA 2W6IA 3KLPX 2XKAA 2P1DA 2Y0BA 3UJ9A 1EVZA 3ZHVA 1UF9A 3P0JA 4EPVA 1SO8A 3ADKA 3I61A 4Q48A 5CLLA 1NP7A 3L7OA 4Z8XA 2WPDA 2OENG 3RE1A 3HDVA 5I47A 2KI5A 4B3CA 3NVMB 2CVPA 2IZ0A 2W7TA 4NR0A 4MCJA 5K0JA 2BMAA 1YQEA 4ONEA 4UD2A 2O5VA 4J0DA 5AWFC 3SYLA 3V1NA 1AV7A 5B1YA 3WSVA 3EIQA 4F4HA 5JS6A 1N0HA 1TYAE 1FNDA 4B3HA 1NY5A 3WNQA 2XBMA 1YOVB 4EHAA 3UZUA 3L7NA 1XTQA 3NM6B 1I7SB 2Y99A 4AWBA 4EZIA 1ICEA 4DV4B 4QHSA 4FMBB 1BGWA 3RO7A 1BCRA 3TGWA 1R0RE 5DN9A 3VKFA 5B2FA 3A6PC 2HREA 5JO0A 4GAEA 2YXLA 1TMYA 2QRJA 2EKDA 3NOXA 4Z7JA 1XLUA 4HGPA 3HYTA 1E59A 1XEXB 2PN1A 4G1UC 2GZHA 4P7FA 4NH0A 3EXEB 4D79A 2B2CA 1JHQA 2P65A 4AQ7A 3M4XA 4N0QA 1KQPA 3CB4A 2DSNA 1ELOA 2WF8A 1U0OC 3GBSA 4HLQB 4ON9A 5DHRA 4BFVA 4IRXA 2W37A 1A95A 3ILYA 3IQWA 1XZIA 3VC7A 3TAXA 4RD2A 4KYIB 2X0IA 2A8YA 1LZLA 2HV9A 3L7JA 1K9VF 1QIIA 1P44A 1ZH2A 5EUQB 5A5DA 4U3JB 3AVWA 2Z43A 4NYMQ 1WW2A 3QU9A 3C24A 4YUAA 4MV4A 1XU4A 4ZQCB 5GMOA 5AW3A 4G8JA 2A94A 4XASA 4KAJA 1OV6A 1P77A 2EP7A 4U2DA 1EGVB 5EJ2A 2DPLA 3RSHA 2OZKA 3FFXA 4N7JA 4KXLA 4YV0A 4V1CB 4B74A 4D5GA 1YB1A 3BWMA 2ZAYA 3O75A 4ID3A 5D5HA 4FGJA 4URWR 3TLAA 3DE0X 1U3WA 1F1BA 2Q6TA 2O50A 3L7YA 4CRWB 4F9FA 3VMFA 4FZJA 4O5OA 2WICA 5E9JA 1P3Y1 2IEYA 2O4CA 4KNWA 2QD1A 1CUSA 3K1YA 4EECA 2OO5A 4D9CA 4PHTA 5J2TB 3GH1A 2BGWA 1QGOA 2HF2A 1YZLA 4JLSA 3WLKX 5CM8B 4GBED 1S01A 2FPMA 3CG0A 5DN6A 1MO2A 1EQAA 2PUAA 1AQNA 2V5AA 1OREA 4RY8A 2WTNA 5EQJB 1NVWQ 3BMOB 4YONB 3BGIA 3UMCA 2A9KA 1LJLA 4Q82A 5D1HA 3S2SA 5KB3A 1D5CA 1SY7A 1BVRA 2ODNA 1RVDA 5DM4A 1KYWA 3D6UA 4MH0R 2XT0A 3VR1A 1MCZA 1XFAA 2F2TA 3UJBA 3ULKA 4DG8A 2NT3A 3IJRA 5E7JA 1JNYA 3N59A 3EY4A 3ZJVA 3GAAA 4RPGA 5DHFA 5EJ4A 1VMKA 2F8LA 4IIJA 4FQ7A 3Q5GA 1N6KA 4PXYA 1E79A 4DT1B 5EIWA 4UUAA 1DKMA 1FFBA 1VLJA 1K5HA 4TVKA 2OCDA 3NATA 1LTKA 2G1AA 2ID9A 2EHJA 3T95A 1QX3A 2YWDA 3NNNA 4E5PA 3AL0C 1PEYA 1L5VA 1FP7A 1JH9A 5HF9A 2TMYA 3U5ZB 1OH7A 3IILA 3MUNA 4PIPA 5COBA 4IW3B 2FXVA 4TOIA 2WWTA 4TZTA 1WUYA 3ESYA 7ABPA 1SWVA 4Y7DA 1XNRB 2ZIUB 4I1SA 5FTKA 1NAHA 1WMDA 4XXHA 5E9AA 5KVVA 3Q8KA 2DQYA 5K6TA 1II8A 2ZRQA 3R8CA 1ZN8A 3CEHA 3J7AC 4KRGA 1PZFA 2GCOA 4RMNA 3UT5B 1QP0A 2ZETA 3FX2A 3QG5A 3OZUA 1VSVA 3OE5A 1KQNA 2QLMA 3GO4A 1E99A 2QJFA 5AW0A 2V0NA 4KR0A 1LVUA 1H42A 1IBLB 2ZRFA 2FZVA 3IP6A 1UKEA 4OHYA 2XKJE 4RK6A 4V1CI 4Y18A 4WKNA 2J48A 2CFTA 2D0IA 2JCVA 3MGCA 3PHLA 4UMFA 5AHWA 4D4KA 2Q3JA 3KZKA 1YWGO 1C7ZA 1NVVQ 1QZUA 3HA5A 3D1VA 3WVNA 4LRTB 3ZVLA 4AC9A 1XMSA 1LQUA 2IYAA 1H6BA 1MUUA 1TRKA 2Q4BA 3QNWA 3L93A 2CXXA 4G1EB 3C41J 3BFPA 5CVJA 2Y6VA 1WVMA 3DZFA 1JFTA 2FG5A 5KSWB 1AG9A 3G7NA 2MCFA 1Z17A 1QYWA 4PNHA 2TMGA 3ZCSA 1II0A 4ZAZA 2HSWA 4PN3A 3EJ6A 2JK1A 3ED5A 1QHGA 4EQ6A 1DJNA 4Z53A 1X80A 3DGFC 3OD5A 4RUKA 3PRYA 1ZH0A 2YZNA 3T7TA 3UO8B 3NWEA 1EUYA 1O9BA 5BW6B 5JC8A 4AJIA 4LTMA 4OEHA 3FYUB 2AG0A 4KSYA 1YSCA 4RVFA 2FTKE 3FNHA 4HLUC 2BMDA 2VTKA 2C4TA 2MINA 5DB4A 1AS2A 1BD3A 4FUQA 1GPMA 3MPUA 3EWSA 1TF7A 2XRZA 4W6QA 4W5JA 5C18A 3KVRA 2P4EA 3A14A 1PQWA 1E8MA 1ZCBA 2FZCA 1ZD9A 2BDUA 1FSFA 4CMEC 3BMCB 2VP4A 4C6SA 2GDJA 2Z2XA 3CX4A 3ZTYA 3ZY4A 3SZRA 4B82A 4HNQA 4FN5A 1P5ZB 5AVTA 1VXRA 1MDBA 3SZLA 1Q0SA 1S6YA 2HHJA 4ZRMA 3ZBUA 3QX9A 3VRHA 3DZJA 1V3UA 4YXFA 1NBIA 3AEUB 3CX3A 4KXFB 4DSNA 2YXBA 3U4QB 1NNI1 1KKMA 1EP2B 2J59A 1Q7EA 3HXLA 4PEVA 3NUQA 5D00A 3A9VA 4S24A 5CX4A 3UK6A 3D8BA 1PZXA 2WF9A 3GBPA 4QODA 3GFBA 4OREX 3JWGA 1RBQA 1QMGA 2BUCA 3FFWA 2Z5LA 1NY6A 5EE9A 3ZWMA 4CFSA 2GLUA 1T5LA 2XVYA 1EZZA 4H08A 3PKZA 4HFMA 2NTVA 4Z7NB 4WZBE 1KZGB 1XO1A 3HEBA 3NH9A 1CDEA 2CHVA 3HUTA 4K1XA 4Z8YA 3VPXA 1LVHA 1XV5A 3FYSA 2CVZA 4G1MB 3FNQA 3MINA 1YCDA 4GM0A 1VE7A 3AV3A 1QZ3A 1UBMS 4FNMA 4UBOA 4NG4A 3GW8A 2QAJA 5AM3A 2P68A 3PE3A 2GZDA 5HDBB 1QYRA 3K5HA 3DFKA 1CUVA 4NU0A 3RS4A 3H04A 1GILA 3N2KB 4M2LA 3O2JA 3SC2B 1H9AA 1DCFA 4D0GA 3MOGA 5KQPA 4TTQA 4FFMA 1AZTA 2EKZA 3CNLA 1YE3A 3FVTA 3N9IA 4FT4A 1CRPA 2OORA 1Z68A 3LRTA 3QYJA 2VH5R 5F73A 4MEBA 1G63A 4B0PA 2G0AA 1JR2A 1KJJA 4OLJA 1I3CA 4QOJA 3OU6A 4YIKA 5AJVB 1A71A 3ENZA 4L2IA 5HDQA 1JG4A 1CUBA 1MW9X 1ZUD1 2Y67A 2D3TA 3R0IA 5F2OA 2H4XA 5SZHB 3NJ4A 1GKKA 3RRNA 2OBLA 1CG6A 5JCJD 5E0KB 1EFHA 5JYBA 3UAGA 4D0NA 4E1VA 5HKLA 3M9XA 2J4CA 1JHZA 4WJKB 4EMUA 1PX2A 1TTHA 1QZTA 3HQ4O 1V39A 3H19A 2VOEA 1AB6A 1NYLA 1H8HA 3QLUA 4Q9JA 2V0GA 4W5NA 3LF2A 5AXCA 1G5TA 3OQHA 2DWCA 2AEJA 2PUTA 4QVGA 3UMRA 3T7RA 3ZEAA 3PHGA 5FV4A 1F2TA 1MT3A 3JQGA 1KOFA 1WHTB 3AESA 4OI2A 4HQOA 3C6KA 3AR9A 4CKZA 4V38A 3WLEA 5L53A 5FQOA 2O4UX 3OTQA 2NTYC 2P2DA 1PS0A 2OXFA 2AZ4A 4DY4A 4GDMA 3OP4A 3QEMB 1LPMA 3BH0A 1L5FA 2W6CX 3EGOA 4DRZA 4M1YA 2P2YA 1QRDA 2HN9A 1Z0FA 2DPHA 3DP9A 4JUIA 4RIFA 4UTZA 4J3JA 2XMDA 2D62A 3LBIA 1EFTA 4X24A 2NTEA 2IH5A 2F59A 4BP1A 1RKUA 3J81k 3WG9A 1NR7A 1GQFA 2C1EA 4N7RA 5EMMA 4ZT5A 4XVRA 4FFWA 4JIGA 1UK7A 1WE2A 3HCWA 3G5UA 3LVQE 4FINA 2JFGA 2IIBA 4JC0A 4JJ8A 2OHGA 1N5LA 4RK0A 1NF3A 1RYFA 1R8XA 1VJGA 5IMSA 3H2JA 3R6LA 1R8YA 4EOGA 2IEBA 2YL2A 3OE1A 2P35A 2RI0A 3GUZA 2F3SA 1YT5A 3HWSA 1O95A 3N53A 1QJCA 3KJGA 1NZFA 1G20E 3EW9A 2WAMA 4M9CA 3MGKA 4NCKA 2B6HA 3MWJA 1V11A 5JSZB 1L4EA 4B79A 4KSCA 1EB8A 2I99A 4CKBA 3MT9A 1UK6A 1ISSA 3UWDA 3VR5A 3ZDFA 3IHLA 1SXJB 3AF2A 1U6IA 2FR8C 3OZCA 2ATCA 2VWPA 5L3SA 2BRUC 2IXEA 2EBWA 2QYTA 3IXLA 4G89A 3KQSA 4UHBA 5I7WA 4PLHA 4K6KA 4OBXA 3AEZA 3EQZA 4HFJA 2XCSB 2OR3A 5JFGA 5D1NA 2GEVA 1L7EA 4ZAWA 1Z2NX 2ORED 1TMGE 3R20A 1S2MA 1VMDA 2IDMA 3VNBA 2GA9A 4IIEA 2I4RA 1MA3A 3CF4A 4AJ2A 1G59A 3UJCA 1TIKA 1YNSA 5KAMA 1JA1A 2G04A 1UUFA 3EXHC 5CFLA 2VQSA 3I9V6 3H5WA 2IYEA 4TT8A 3O8DA 5EVCA 3F67A 4WFKA 2V97A 3DXYA 4Z9BA 4Y2YA 4JQOA 5DP1A 2XECA 4LYGA 2P0YA 3MLAA 2WJYA 1C0LA 1KVTA 2E4XA 4A2QA 4CQLA 4CWAA 3QF4A 4P4SB 4QAJA 2VJPA 2ZAMA 1UBFA 3JQCA 3L8MA 3SSMA 4FGZA 3SE0A 1LWNA 2K5UA 5HWSA 4CQMD 2V3CC 2C5HA 1U8CB 1WXXA 4F86A 1EKXA 2AWOA 3UV3A 1RYYA 2D74A 2QI9F 4HQLA 5ITZA 5I48A 1IONA 4G5OA 2D1RA 3EJWA 3QBEA 2KQUA 2RHDA 3ZZUA 4BP3A 3AJAA 2PS9A 4MYSA 1K75A 1LV8A 3PITA 4J0KA 3EZ7A 4OMDA 4PAGA 2ZTHA 4WN3A 1QFZA 3WK6A 3LFTA 4FZRA 3FSJX 1RJGA 3E3AA 3UK1A 2GPBA 1P2SA 4HADA 2O8DB 1QDLB 1JIUA 2MDTA 2HXYA 3CZMA 5DLDA 1XZHA 3I6MA 3QVVA 4LHSA 1QYIA 2I67A 5AKJA 2JKYA 4G86A 4PX3A 1W8DA 3HLTA 1CEXA 1FJGB 3UKDA 4B6RA 1OAKA 3PEUA 3TTWA 5AJXA 4BX8A 1U8FO 1XU7A 1CR0A 2F1JA 1GRQA 1E1QA 3QVOA 4AJ4A 2JC3A 1D8TA 2DQKA 1C8LA 3PHBE 4OUDB 2P6OA 4V0NA 1RKBA 1ENZA 4IQ8A 1XRNA 2QV7A 3A27A 3PUIA 1P7WA 1X2EA 4WINA 3THXB 1QU3A 5HCNA 1YIDA 1E4OA 3PGVA 4C05A 4G2TA 2Q1WA 3E27A 1UBLS 1EINA 2BEUA 1LXCA 3I1YA 5FFMA 2QTWB 3F3YA 3C85A 2NZWA 2ZPUA 3A3OA 3TFQA 4CE6A 2UXBB 5JEDA 1FSSA 2H1HA 2G7MC 3KB8A 3M6UA 1RC8A 3K9HA 1OYOA 3LT2A 2C7QA 3KSZO 1SEPA 4DAEA 1BCRB 2Q3FA 1RP7A 1OF1A 1BE1A 2BZ1A 2L18A 2H29A 5DT2A 3WRXA 4I1RA 4HNTA 2C4UA 3KL4A 3VH3A 2JH9A 1H4SA 2BEVB 1YQDA 2B7CA 4EARA 4IJKA 1CF4A 2YC4C 2WNHA 2CUKA 3KBOA 3QJYA 5DM60 3Q10A 3TZBA 3OURA 3KE8A 3F2VA 3GDFA 3WV4A 2J32A 1ZUWA 3L4KA 1RQRA 3V4ZA 5MFZA 1UBKS 2GAFA 3O92A 2Q3BA 3G49A 4Y2JA 5D6NA 5TNXA 1H4TA 1NE7A 3RYHA 4G8DA 4DSZA 2C2HA 2IV3A 4I50A 4U8HA 1RRFA 1CHDA 1O96B 2JFQA 4UPEA 1I4EB 1B8VA 1QO7A 1OXMA 3CA8A 5LMUB 1T3GA 5L45A 4PNPA 3CVYA 3HYSA 3DPUA 3O1LA 2EFHB 2ATXA 2Q9BA 1SUFA 2CKMA 1IJKA 2JHGA 4EHDA 5C8YA 1WDTA 2D0PB 3NM5A 1FFHA 4BKRA 1GHTA 2PXAA 4W5QA 3S44A 1X1DA 1UEJA 2G77B 2ZDGA 3Q9LA 4IKPA 4Q1VA 2QROA 4BNDB 4E5YA 4HDMB 1EM6A 3DMGA 4W6ZA 4PAMA 4IR7A 4ZAXA 3I64A 2BR5A 2FOIA 3AJDA 3DOEA 3EEYA 3HKEB 3WL4A 1CQIA 3IT0A 1G19A 1USKA 3GGDA 1XP8A 3KKOA 1SRQA 5HF6A 5A06A 3KV1A 1NJGA 2PX5A 3UK0A 3JASA 3LY7A 4OAPA 3T3MB 3RGGA 3UT6A 3WGGA 4EO4A 4D9IA 5HFNA 1AQ6A 2I9PA 2GJ4A 5FNVB 3HJGA 2IWHA 4CM6A 2OGWA 2IU4A 3CZPA 4UBIA 5DI3A 3CVVA 3K15A 3HCNA 2HY7A 1A88A 1OZ0A 3FBGA 1D03A 4HDNB 4Q6BA 1H2AS 1O58A 3PKIA 4Q05A 3M1AA 1NXVA 1Y3HA 5LXTA 2QRPA 2VFAA 3UMFA 4A82A 5T5QA 3CWQA 1WPRA 1PT9A 3BK1A 1P2GA 3CFYA 1GL9B 4Y6OA 1I2DA 3REGA 1N2ZA 3I34X 3HJBA 4EG3A 1EXDA 2AW3A 4WXHA 1ZM9A 5D2CA 4OHKA 1A96A 1EHCA 3HXPA 3F73A 1ZWKA 3DDHA 3EE6A 3OAAD 4K2AA 4PSDA 5AJTA 2ZIWB 1D07A 1QG6A 1FDTA 1V5IA 2W4MA 2YFHA 3NNDA 4LJ6A 4V0OA 5AI8A 5DM1A 1ILEA 5FOSA 4RGVA 3ZV4A 5ESDA 2ETXA 1E5TA 3UUGA 2W42A 4BJ1A 1JB1A 1O9GA 1YRYE 1J1IA 1JDJA 1GZUA 2VSNA 2G5CA 1UEIA 1JXQA 2QUAA 3DTVB 2P2GA 3DV0A 4FN4A 4WOJA 1GGFA 5CJJA 4HATA 4FZVA 2H1SA 5H3HA 5B1HA 3S1LA 5BY2A 1KI6B 1HE3A 2PX3A 4RANA 5C1BA 2O8NA 3AP2A 4EFNA 4AWAA 2DERA 5JMOA 2P41A 3KTFA 1K98A 5I7UA 2WHYA 5GOTA 3L46A 5CHYA 4IDOA 3VR4H 1UANA 1P7YA 1J9GA 2YNMC 1B1CA 2QMQA 4RD6A 4H0NA 5ESXA 2W6JD 5JY6A 2GEDA 5FWNA 3I5MA 4ZYWA 1CVLA 1OIXA 1TM5E 2WKRA 4DABA 3B6ZA 4AF8A 3TZ6A 2E49A 4EGJA 2NN3C 2ORVA 4E5DA 4ZEOA 8GPBA 2KMLA 3O4FA 1ZJ4A 5FUYA 2QMYA 4JI1B 2C2YA 5K0SA 3E7FA 4BN0A 4FHZA 1ODJA 3H0KA 1BVYF 2WHPB 2Y68A 3EGVA 5GZ6A 1KMHA 3I6BA 2J07A 3C1AA 3CLTC 1V4VA 1Q1EA 3R77A 3JQ9C 5D8DA 4FOLA 4GMGA 4BFUA 4B7UA 3S7TA 3USZA 3HKBA 4L5JA 2NZXA 3CEJA 4NESA 3STYA 4BTLA 1MF7A 1GTZA 1SH7A 2RAVA 3L7KA 4F9TA 3PC7A 4H1TA 1Z4MA 2ZB2A 4TVOA 4TV9F 5EZ5A 5C31A 1KFBB 5ALQA 2ZT6A 3GH3A 3TZQA 1UWVA 4ME6A 2ZJ8A 1NBME 4DA7A 4K7JA 1IDN1 2YINC 4X64B 4BGEA 1KP9A 5HIAA 3HVUA 1QFJA 1TW2A 4Y1RB 1GDHA 2PMBA 2RAPA 1ILWA 3W79A 2R1TB 3ETLA 1JFSA 1CQWA 6REQA 1WETA 1Y33E 2PBZA 3A6GA 2AYXA 2VDJA 4RENA 1RRGA 4P83A 2VLIA 3QIVA 4P3OA 3O3MB 4HEJA 5E6RB 1OA0A 4TKMA 2IXBA 4DMCA 3ZGZA 1M0TA 2QAGC 4EB6B 4U7FA 4EY4A 1AIPA 2H51A 2ESRA 2XQFA 2D6FA 1IIBA 3VQTA 1MMFB 1NQTA 1GPH1 2H7XA 3GFRA 1R5OA 2C4KA 3ROFA 4NU8X 1M2EA 2HWUA 4FYIA 1Y7TA 2O8CA 5MGNA 3O9MA 3UK2A 1MB4A 1N2SA 4EGSA 4B2LA 3FWHA 3PFBA 4RGYA 3W6UA 1PVOA 3E0QA 3PZBA 3Q7RA 2OZPA 1LDYA 1L7AA 1MAAA 1T3ZA 4TXLA 4UHKA 3T4XA 2V6IA 4U0KA 3OEHA 1NMQA 3IHTA 1G3UA 1G8KA 3INNA 1DBIA 4LXGA 3OE4A 3IUSA 3CW8X 3PA8A 2QG6A 5FAXA 3HSSA 5THXA 3UAOA 3RAFC 3ENQA 1PR6A 2HMAA 2QN8A 3HEAA 1ZIDA 1GPBA 4RYLA 3GVHA 1Q22A 3AZOA 2DUJA 4R16A 1UXGA 3T54A 3ZWCA 3ECAA 2Q1XA 5KC8A 2RHJA 2EVWX 1U7HA 1HL3A 2HJSA 2ZRNA 2HJ9A 4ALLA 4AKHA 2J4FA 3FETA 1SWWA 3N75A 2FEMA 2DKFA 3K9CA 3V1LA 3ZDCA 4H59A 2HSZA 2V6MA 5K1ZA 1PQYA 4FFNA 4UNIA 4Q01A 5I3CA 1VHDA 2XMRA 5LYJB 4RPKA 4LRSB 1SMKA 3TB6A 2IEIA 4IDQA 3IPXA 5F2KA 2JNWA 4UDOA 4HYEA 1NURA 1QGUB 4AKEA 1NBMD 4QQFA 5IABA 2AOUA 2YJ5A 3E05A 2NW6A 4L3WA 1NDQA 1PJTA 2HQOA 4QOSA 5JJCA 3EQ6A 1D04A 1PFYA 4I1YA 3U61B 4Q4AA 3EOBI 3MF4A 2AXQA 4IHJA 1OXVA 1W8IA 3KZXA 3E18A 3GD7A 3FKQA 5T3YA 5BVGB 1Z73A 2NSHA 2OECA 3DYVA 4QTUB 2QR3A 3KVNA 1FVOA 4R8MA 1AMNA 3FFBA 4A8HA 4ITRC 5CU7A 5FBQB 2PQ0A 2W58A 3PPVA 3R74A 4CIAA 4BTVA 1ZOOA 2J8ZA 2V55B 3JYOA 3PPIA 5FNVA 1A4RA 3U3KA 1Z0SA 3SSNA 3WKEA 2CLIB 5FUMA 1K3UB 5GADl 4S0ZA 1VDZA 1JSRA 1NW9B 1RLIA 3Q6IA 4J16C 3DT9A 5JNSA 1L4FA 2AFIA 2WNSA 4P9NA 4QG7A 4LF4B 1QNLA 3BERA 3IAHA 3NTLA 4D56A 1ZOPA 4FFBB 4IYRA 5LXTF 4BNVA 3E82A 3ZHTA 1KETA 1LTHR 3A11A 1M1XB 1ZGGA 3GEGA 4B87A 1FSPA 4DDTA 2V3VA 3HYCA 4HJXA 4K2HA 5KYXB 3HCAA 1CEYA 4QXRA 1DX9A 1JLHA 4HLNA 4POOA 4NS4A 5DM70 3LLUA 4G5GA 3A8TA 2QSUA 1Y3FE 3GRAA 2VXBA 4O1HA 4PGHA 3W7AA 5M5BA 1X9IA 4BVKA 1H2YA 5FORA 4B3GA 3QXJA 4O4IB 1C4KA 1R9NA 2MSWA 4OQYA 2YZ7A 1VJDA 1ZITA 1B7GO 3CN9A 3P96A 5KNCA 4NE2A 2XW6A 3PX3A 2Z2ZA 4OXNA 1DV1A 4HCJA 3P9PA 3X2EA 4NMMA 4NCXA 1SN7A 1G20A 4EF4A 2LXNA 5DWQA 5TEWA 4P93A 2HRZA 2OCGA 3KCQA 4M7PA 3W5AA 9MHTA 4HXYA 2YW9A 1NW7A 4J9VA 4FNGA 4LI3X 4RY9A 4YY3B 1NLUA 2DBQA 2N0SA 1CUDA 2PRSA 5CLQA 1NIPA 2A7XA 4HQ6A 1YS1X 2QTRA 1E7MA 2FV8A 3DKVA 3UJ6A 2IU6A 2JFPA 2HQ1A 5HK8A 5A4MS 3JSAA 1KJIA 2J3JA 2WOOA 2QRUA 4UPDA 3IHKA 4A92A 4BN4A 3BXHA 4D8VA 1X7WA 2KE5A 1FXWA 2QPTA 3RJMA 3S2ZA 3ZW7A 4EY3A 4M1OA 1B0PA 2XMGA 5J1SB 4XIYA 3O6VA 2REQB 5H0IA 2JLWA 2BTOA 1D9ZA 4J90A 4YJ3F 3FBWA 2WWIA 2XQVA 1VLHA 3HRHA 3JD0A 3LC1O 3VMMA 3P9RA 4ENQA 2XB2A 2XGMA 4EFKA 4R01A 1CSEE 1EA5A 3ZW8A 2IHNA 3RBZA 2VKQA 1N6RA 4WK2B 2HPAA 3T3DA 2HU2A 4REOA 3ZGOA 2BTQA 2XBLA 3HFJA 4MW0A 3T94A 4J3NA 4H16A 4EVRA 2UXDB 3O03A 4O4LB 1XTRA 1NVGA 3S1SA 4YP7A 5K0BA 1H0SA 2Q6OA 3GJQA 4HXEB 4KPFC 2XAUA 2FLVA 3O38A 1IZZA 1NW4A 3INRA 4R2WA 5LQMA 5EQFA 2YWBA 3IP3A 3X1KA 2AG1A 4FC6A 3ZZMA 2WBLC 1FU7A 1E98A 4C87A 4BRSA 4DZZA 1EFVA 1QG0A 5DTIA 2PFSA 2B7LA 1SQ6A 3EFHA 3R5TA 5K2OA 1Q0PA 2AN4A 3DE7X 2QAIA 4MGYR 2ZRLA 1BKYA 1Z4LA 2V59A 2YZ2A 1NQVA 1CDZA 2YZMA 3M81A 3BWXA 1SIBE 1TMOA 4G5XA 4KPGA 3UGQA 1FJXA 4ENTA 5C8VA 4QUKA 1M1NA 1TUIA 2FPXA 1R4ZA 3QV2A 4OFBA 1JI3A 2NQ8A 3H4TA 4QREA 2QW1A 5KQMA 3IUYA 4ASUA 2QD2A 3WLJA 4JC8A 1S3FA 4KQFA 4DQLA 5M3BA 3WGTA 1M2GA 4GC9A 2C0PA 4PSCA 1CULC 3FAZA 1C2TA 2PZKA 4WOKA 2QTLA 3HKDB 4M46A 1JFVA 1IBCA 1X42A 1BRTA 4I3HA 2AQHA 3WGNA 5INTA 5C4GB 3RTAA 1Q0TA 5U4XA 3AUKA 3RI3A 3V7NA 3ZGYA 1JLLB 3WAGA 4WGFA 4I1OA 1SQ0A 1BS9A 1ARZA 1YRAA 1VJTA 1LGYA 3QITA 2DFVA 2OVBA 4P2BA 3WISA 1GNQA 4B35A 4E31A 1ONBA 1KHTA 4L6CA 1Q84A 1RSZA 5DNWA 2BP7A 3SYKA 1D8AA 4HDRA 3R7WB 1NDUA 2IK8A 2FDRA 2QMUA 2PRJA 1VPLA 2Q1UA 5DTQA 2WUEA 2CXTA 1KO4A 1ABFA 3K73O 2GXQA 4LZWA 4PBSA 5EKDA 2PG3A 4P4LA 1KZHA 5K6RA 1M6WA 3SJ7A 1T3LA 1RM0A 4OHCA 2IY7A 1AC5A 1DI0A 4S12A 1NBHA 1XZPA 2ZIXA 2HI0A 1ZM2A 4KXXA 4WH0A 1WR8A 2ZRBA 3HRKA 4RHCA 3G0GA 4GI5A 5TMBA 3A3NA 3SHWA 4ZHQF 5BSGA 1TIPA 1DAGA 3P2IA 3OZSA 4YUYA 1AD2A 1GDTA 3MD0A 3SY8A 1H4QA 1HR0B 5LZ2A 2DTXA 5EQTA 4IOLA 3S70A 3V8NA 1HDIA 1WX1A 4G37A 4IWYA 4FP9A 4MKFA 4K5QA 1H9CA 2GO1A 3NHZA 3VR5H 1MO3A 1LBEA 1NHWA 3JVVA 5CVUA 1R74A 3FAKA 1KARA 1TOAA 4LJ5A 3B52X 3NPMA 3NYQA 1XD2B 1UFQA 2P11A 3E4DA 1T9CA 1CXZA 2BZGA 1C3JA 4C43A 4K6MA 2PZFA 3EULA 3OEED 4M83A 4XVUA 3D3WA 2C5FA 1U31A 2VUUA 3G0DA 3JQ8B 3GA5A 3MJSA 4O4JB 3U7QB 3KPWA 1K6IA 1XVTA 3PXUA 2VPQA 3AUSA 5ERXA 1GGJA 3LY9A 5FTNA 3WYDA 1JRLA 1J2RA 1ZOSA 2HWYA 3D8NA 4ARAA 4M86A 1XWFA 2XUFA 1KZYC 4RFSB 2GHRA 2Q7OE 3EG5A 1IK4A 5CK5A 3MCZA 3PQ4A 5DLQC 4BFCA 4YUVA 3FHJA 3LU1A 4E32A 4CM8A 5J2UB 1M7GA 4HB0A 4TLBA 1YS7A 3MWYW 1P8AA 4GMXA 3ZV7A 1R0SA 1SB8A 2ZYIA 4UQPA 1HL7A 4MO9A 4IJWA 4QTTB 2JAPA 3G68A 2AOTA 4TYYA 5JALA 2ONKA 4J03A 5ECGC 4D6YA 1XK7A 4YJGB 3MS4A 2Y6UA 4C4SA 5T8KC 2VDRB 5JRDS 2FZ4A 2F67A 2E48A 1KYZA 1G41A 3R09A 1ZKMA 3BZWA 4OYYA 4M55A 4Z3OA 2GCGA 2BHNA 3B6IA 4HQRA 2WZCA 3GMTA 4CIYA 4FGSA 5T4BA 3QA3E 4L0MA 4LRQA 1W19A 3CUWA 5DN6D 1E0DA 1UEXC 2W48A 4QECA 1RXUA 1XD9A 1ZLYA 2M32A 5FBWB 2CEAA 2Y0CA 1SVOA 2FN3A 1E1MA 3OMLA 3QYAA 4Q4JA 1BA2A 3KM0A 4Q9IA 3QWIA 5DCYA 4NHEA 5ESWA 2RONA 3D6NB 5AM2A 1M2WA 3ZDBA 4S04A 3D02A 3EPLA 3IKJA 3PICA 1SCNE 3OZFA 3ACBA 4LY3A 2Z30A 3COJA 2I91A 3LYLA 2B35A 3F3KA 4L95C 2IKQA 4L5AA 4HSEA 4UDNA 1EEXB 1BQEA 4LJAA 2Z9CA 1JFRA 4CMEA 4QVKA 3RFCA 3O7WA 4LE2A 4YYZA 5JTTA 2PO7A 1OILA 2W93A 3DDSA 4G5SA 2I7VA 4YCJA 1X94A 3GF4A 1D6MA 1R5BA 3QBVA 3S2EA 3SICE 4LZAA 5KX5F 3WX0A 4EUKA 1GT6A 1E0KA 1QTQA 2IYOA 4IMRA 5AVKA 4M54A 2Q0QA 4JL6A 2ODTX 1BRMA 3PB3A 3UAWA 3U9LA 4NBLA 1F0YA 5EHXA 1TTPB 3D8UA 2QTAA 5FPQA 4M7RA 1A27A 1XJ0A 1I36A 2PS1A 5BUZA 1Y4DE 1O9HA 1XA0A 2FPPB 2YH2A 4N40A 2YQ4A 3I72A 1W76A 3ZYCA 3ZPXA 1FTWA 2P6NA 5F64A 1DPGA 1MAUA 3HGMA 2DFNA 3QX8A 5DGXA 4IMPA 1ZNQO 1AURA 2VUSA 2GM3A 4FE7A 4PWZA 5B58T 4C0BA 3B89A 1HZJA 4NY1A 3GFTA 2IUUA 1M2OB 2EYUA 3QFSA 4FXPA 3OJEA 1U0NA 3TQQA 1IWPB 3B20A 4S2EA 2JIPA 5EJAA 1UT8A 1J0EA 1NBWB 2PA0A 4KTVE 5K3AA 4HB4A 4P5PA 3QOFA 1VSQA 2O2ZA 4BX9A 5SV2A 4N5IX 3UC9A 4DM7A 2YZGA 1NXXA 5JWHA 3UATA 2PZ8A 1FYDA 3LHIA 4IG4A 2FG7C 4TLLB 4X45A 3AGPA 4MGZR 5AKZA 1V37A 3HZRA 3I8SA 5I5GA 3CPSA 5EQDA 3TYXA 3RKUA 4WXRA 3QA9A 4EELA 1KO1A 2JJ2A 1W4LA 1K89A 4WNIA 1NNEA 4MVXA 3PTAA 2GUWA 3IEUA 1VP9A 3DBHA 4Z9YA 1PJBA 4IXWA 1W2WB 2W70A 2H06A 4PPNA 2PNFA 3SYMA 5JAZA 3FFTA 3GQBB 2C7GA 4I7EA 1P19A 4AX4A 3DBOB 3AUTA 1RJDA 4NU6A 4X9XA 3RVQA 3RARA 5C3UA 3R6DA 2C7OA 4HPXB 1GGNA 1Z6XA 5L95A 4ZDIA 1RAIA 221PA 3DOOA 1M67A 4MSUA 2C2GA 4Z1MD 3RHSA 3Q7QA 3CRW1 1P0FA 4QXOA 1C29B 5F7JA 3GLFB 1XEXA 2I7CA 3A4LA 1FVFA 4JJ7A 1GO2A 1ECJA 4BL5A 5IM4A 1WCWA 3RYTC 5A02A 1MNAA 2J31A 4L57A 3HCRA 2DQZA 1IMOA 4PYNA 4JBHA 4EPXA 3C6QA 4GMKA 3GYGA 5EEGA 3RBAA 3B1KA 4NXMB 1YV9A 3UMJA 1ABEA 2CXRA 4CTKA 1ADFA 4A6PA 3KQKA 2A5GA 4YVFA 3WSWA 1TD1A 1OFHA 4B6PA 1AGYA 3TD2A 4NYJQ 1XZKA 4LAFA 2QN9A 3E0XA 3R6GA 5JD3A 3RUIA 3W2HA 3LCCA 4EG7A 4MP6A 2O8BA 1KMQA 2ZUSA 3B3JA 4XJVA 3D0QA 4WLNA 1VLMA 2NTNA 4R1SA 4MR8A 5K6AA 3OHMA 4IJ5A 3M83A 2X9LA 5DK6A 3V80A 5DXAA 2VJQA 4ZQBA 4WKPA 2OL4A 1YI0A 3CMCO 3NANA 5LQCA 1JJ7A 1Z28A 1NF2A 2EFYA 4B6SA 1OB5A 3IQFA 4FTWA 4UHDA 4YCSA 1N5MA 2ZXFA 4M6WA 4QHYA 4DCVA 1C1DB 3IUEA 3NB0A 4LRUA 3QU2A 2YWJA 1ECFA 1KI2A 3IUMA 1TCAA 2OBFA 5I9TA 1RC0A 1WRBA 4CU5A 1BHJA 1U2EA 1N2CB 3ZQJA 1I0IA 2OLEA 1CUYA 1V9SA 4FR5A 4H7KA 1EFUA 3MAJA 2H2DA 3F6YA 4H1VA 4II2A 4HDKA 3HR7A 4O4LF 2YASA 4Z4HA 1ZNWA 2FJ0A 4DUGA 2R5NA 1JIJA 2P0EA 2XVAA 2ZS9A 2FUG6 1E8DA 4YUXA 2F3UA 3T5MA 4UDXX 1XMVA 1GPLA 3B2QA 2BC9A 3LDAA 1SQSA 2W2VA 3QW4B 4JFAA 2Q2WA 4OJNA 3NGXA 4AQYB 3WL8A 1LDGA 1W4RA 2C8LA 3CUEF 1XMJA 1DQYA 5I8ZA 3RVPA 3QVUA 5CVDA 3C3AA 4WGGA 1TQ8A 1G38A 1RBYA 4PC1A 4ZOLB 1ZQ9A 4CCYB 1DAOA 1O95C 1K3FA 3MWDB 4LQDA 1F14A 1QHIA 5AJWA 5F7XA 1QG2A 1U4OA 1VL2A 2AOVA 1PLLA 1HDYA 2PX2A 3PUYA 3DTTA 4B9AA 4GOXA 4B2IA 3NFRA 2ZUVA 2PAFA 1UM9A 2FG6C 1TPYA 5ALOA 1R0LA 3N86A 4LGMA 1OXTA 3TZKA 5JCZA 1PJQA 3C3EA 2FVXA 1VTKA 3SHQA 3TJMA 2AKYA 3OM8A 1IULA 4BGIA 4ND1A 3ONFA 2P2NA 2X7XA 3QWHA 1QDUA 1Q6ZA 1Y48E 4ENRA 4DLNA 1ZNYA 2GFIA 3UYLA 4RY2A 1TECE 3WY9A 2BBWA 4KDRA 4L9WA 3GVCA 2EC5A 4B46A 2LP4Y 2PS3A 1P5JA 2AOWA 3AY0A 3IYLW 4YDHB 1NNSA 1NSFA 5IEBA 4CIWA 1MC1A 2QTTA 1A4IA 3B1JA 3PLNA 4ZPJA 4KQJA 2VP2A 2V4MA 1JILA 4FHEA 3TW8B 2HMTA 4Q7JB 4DVJA 1PL8A 3ZNQA 5D3ZA 1VB5A 3BRSA 1Y3AA 4NX2A 3RUAA 3ZS9A 3FI0A 4OK5A 2IEGA 2OV4A 1BJKA 1JSCA 1DEKA 1V25A 2QTBA 3B1XA 1E2DA 1WZIA 2NV6A 4H4DA 3A2LA 1KI9A 5HJ7A 2IYNA 3S7ZA 4R31A 2V45A 2WSSD 4LV8B 4XQ0A 4I1VA 5BXQC 4FHDA 5HS6A 2IDKA 3OUZA 4ETIA 1H8EA 1N8NA 2EX1A 3SQDA 3A37A 2XTMA 4NZ9A 1N2XA 1TVMA 1HX7A 4QQKA 1USWA 1FCJA 1I3NA 3MJFA 2QOEA 4H7EA 4RTLA 5B7GA 2J45A 1HRDA 4PZPA 2PT7A 3RF6A 4J6EA 4CIDA 2BGNA 2D2XA 2Z6VA 1SXQA 4E2FA 1P7VA 1OXSC 4H0CA 4B4UA 1GGVA 1PJRA 3BHMA 2OAP1 1JIVA 3LUHA 1P91A 5EP2A 1DKUA 4U02A 2CLDX 4RF5A 3ZC3A 2D5LA 1F20A 1OE0A 1ZK4A 3LKZA 4LRXA 4D3FA 1HLFA 2AH5A 4OM7A 4HFRA 2Y0PA 1XZFA 4G4SP 4HO1X 4KXQA 2AB0A 2EJWA 4AWXA 2C2MA 2P7HA 3R6WA 1S3IA 1HA3A 2CD7A 4GKVA 3HXTA 3BGWA 1LTQA 3I3OA 3URMA 1LLQA 3N3AC 4MKRA 4Y9TA 1VHWA 2I7TA 2JD2A 1FFAA 3IBYA 3NP9A 4G56A 4P84A 4RY0A 2FYTA 5FA8A 3COPA 2Z83A 2R0QC 2D8AA 1ACJA 3KJEA 4NZNA 1T1EA 2GN6A 1YFLA 3TRFA 1TA9A 4J7UA 4AECA 4DMFA 1IPEA 2HRBA 2B8EA 1JHXA 2QHXA 3N5CA 3IIJA 4OQNA 4A8JA 1ZHOA 2X6TA 4PSAA 3KTOA 4KE9A 1B43A 1HE1C 4YT5A 1VBKA 3WJ2A 1YQWA 2FKNA 1E3LA 1B8NA 1P61B 3FDIA 3L8FA 3QVLA 3SDBA 3GLTA 1L5HA 3IUQA 1DMRA 3P2YA 3GEIA 5A71A 2OO5C 4BO5A 2IX3A 5ELMA 2V6FA 1EQ2A 4FYWA 1RPZA 2WSBA 1CEQA 3DEFA 2HJHA 2WKWA 3DLTA 1HI9A 2B6NA 5K8IA 1K1EA 3HFRA 4GOKA 4PF1A 3SDZA 3I42A 3SK0A 4F9GA 2EFDB 4Q4CA 5L3VA 5IS2A 1MPXA 2NUAA 2PS0A 1I5RA 1SUAA 4UVDA 3TTTA 1THMA 4XX1A 1SVMA 3V7UA 2ERCA 1SC1A 2HLDD 4QLOA 4RKFA 4I14A 1KVUA 3NW9A 1VKOA 3QVXA 3AM5A 4C4XA 1RWWA 2A5JA 2CSXA 3TR0A 3G8AA 3C3MA 2RBKA 2A4MA 1FF9A 4LY9A 1ZICA 4YUZA 2VBFA 1JKJA 1Q83A 1AKEA 2Y1LA 4PM4A 5F1OA 1E61A 4KQ6A 5ALUA 3TPFA 2W2LD 4HFNA 1YZQA 1FUKA 1QFSA 2PJUA 4XAQA 2A0YA 1PFGA 2GXUA 2GO7A 3E58A 4K8RB 4C7BA 4EQZA 2DHRA 3AUUA 5I7FA 4B3RB 1DKOA 2Q29A 3IC5A 4BB0A 4BGVA 1IFXA 4TWBA 1EX6A 2JGDA 4HYTA 4MYCA 1KGDA 2COEA 3X1XA 2R1UA 4D0RA 1Q21A 2MMGA 2GPYA 3B48A 1MRSA 1DKQA 4RLSA 2PZJA 2EGHA 1N9ZA 4KL8S 4UVHA 3UB4A 3H9GA 4ARUA 3E9ZA 5BPHA 4HWPA 1FL9A 3Q12A 4ZU1X 1N6OA 1Y1QA 1L1QA 3UJDA 1YO6A 4KU4A 4CEJA 3MBOA 4G2NA 5GONA 1R18A 5TGTA 3IBSA 1ACMA 1YOBA 3ED1A 1Z47A 3IUPA 4U2EA 2OORC 4R1UA 1GCAA 4J9UE 4Z3DA 1ZNXA 3S8EA 2BCEA 2C5LA 2C3UA 1AHIA 4IDHA 1FFYA 5LPNA 4JP2A 2XIQA 3NIDB 1K2WA 3CNHA 4X84A 4JJFA 1W85B 3KXLA 3I9JA 1Z2EA 3F6BX 4QLAA 4OK6A 3UHAA 4EUEA 2DR2A 3A6EA 5THQA 3OX4A 2BD0A 2WUDA 2SBTA 4Z9AA 4LJ9A 1ZGHA 2AF3C 2VT6A 3NAGA 4DARA 1GZ4A 1K0FA 1IN8A 1TYBE 2C92A 1LRJA 3NYRA 2X5JO 4RVOA 1JQ5A 1ZUNA 1L5NA 5AM0A 4A03A 4CUZA 4A0QA 1YCFA 2XXJA 2QNIA 3OKCA 1FW8A 2GQ0A 1KZ4A 1P4GA 3EIOA 5HJ2A 1JALA 5K4AA 1DTSA 5LQJA 1WU8A 3E48A 1TZBA 5GQSA 2WILA 3A2NA 4KK3A 1Z8FA 1Z6ZA 1Y8QA 5A0FA 3S6JA 1A50B 1XXHA 2QLTA 2WJPA 3TZEA 3JQ9A 4K9OA 1HG1A 4LG1A 4RE5A 1MO5A 4J94A 4U3JA 4KPUB 2UYHA 5TQVA 3WO0A 4C6HA 2WDPA 4Q47A 1CVIA 1MJNA 5JJKA 1SXJA 3PFHA 3IAUA 1OWNA 3LY5A 2JFZA 4FCWA 1H69A 3KJXA 4W63A 4IAOA 4BLVA 3BB3A 4NCAA 4B47A 4B4WA 4FFRA 1YB5A 1A9XB 3KZCA 8LDHA 1T2AA 4ETMA 3TTUA 4EI8A 2ZQYA 1Z0KA 2VF4X 1TIBA 1P1BA 1Q1BA 2C2KA 2GEUA 3HPRA 4F3CA 3BZUA 3KOUA 3FRHA 4US1R 2DSTA 1TEZA 3M33A 1D2NA 4GPBA 3THSA 2A9OA 3OJOA 2CLLB 5FI1B 1JHAA 4KOEC 1TU4A 1Z75A 2C4WA 2H4WA 4QDOA 1R6DA 1GAJA 2H2FA 4W7HA 1U0JA 2ARKA 3A9SA 3SS9X 3DMTC 1PTJC 1YOVA 4QBTA 2HDOA 2FUNB 4IIHA 2IZ7A 4BNJA 5AKXA 3H6KA 2ZZNA 1Z62A 5KOIA 1N75A 3NHLA 3IDOA 1BNCA 3KIPA 4FYJA 4I46A 4JMPA 1JG2A 4H4CA 1PT7A 1Y9DA 3KPVA 4MWDA 3IMEA 3V8VA 2H1OA 3SQLA 1AKWA 1FBTA 1LSOA 1T5BA 1V8ZA 2J3DA 2RMKA 3GLIB 1OX5A 3I32A 4PVDA 3EBOA 5DBFA 3NHJA 4UVEA 1Z7EA 2G9NA 1TJ3A 2Q50A 1ST2A 2FKAA 2IZ1A 3AUYA 5ADUS 4MB2A 4EO7A 1PR3A 2P5SA 3PNSA 4DIMA 3KHTA 4E2ZA 5K05A 3Q8LA 4EG5A 2B5WA 4E09A 1SJ9A 4MIYA 1KFCB 3ZE0B 1YQGA 1GYRA 5L3ZA 3ZHSA 5JROA 1L5ZA 1EG2A 3HA2A 1CJUC 1RXYA 4EHKA 3NHBA 2I55A 2QVYX 2Z1MA 4BBPA 4CM9A 4EG6A 1T0PA 1ISHA 2IXGA 3QGMA 4LE1A 1IATA 4O63O 4N4AA 4BBZA 2NYUA 5NULA 1K7XB 2HEIA 1R9GA 4ECAA 5CIQA 3MMZA 3OX1A 1W2GA 3JRXA 1M6HA 4JBWA 4NSNA 3MNFA 3F2IA 5BSRA 1ZRSA 4DLSA 3GRYA 2O2IA 5DM0A 1YVUA 4DR5B 3DOFA 2I65A 3NIBA 4MUNA 2MR6A 1KY5A 2ZM5A 3QH4A 4NFHA 3F8WA 4LJLA 5HOEA 2PMEA 2HW8A 2QGNA 5HKBA 1HT3A 2XUAA 3LT1A 1OY1A 2M9MA 4JSYA 2PPVA 3LZDA 1YASA 3E9YA 4G23A 3ZGVA 5BSMA 1YGYA 1X87A 3N2GA 1MB9A 1N0IA 3SZMA 2VNHA 3C1TA 4EJ2A 2XCQA 5KC9A 4NV3A 5EFZA 3VR4A 3RSFA 3VAZA 1NKSA 2A58A 4MW5A 1I7NA 2PH5A 5EG5A 3B6EA 3H8JA 2O48X 4FS3A 4PZYA 4HBGA 3GUUA 4JJ4A 2F62A 2PQMA 3I73A 4PO8A 3ML1A 3RRXA 2OHIA 3LWDA 4Q00A 5HE9A 2ZS7A 4KMOA 3AR8A 1XAGA 3P2OA 1DCMA 3H5NA 1I3KA 2WJ6A 5AVZA 4JR0A 2AW5A 4P2GA 1X7ZA 2ACVA 4JIMA 4IS3A 2ZYHA 4Q9AA 3MRXA 3BSWA 4YMHA 1HDCA 1PD1A 4AP5A 2XA1A 1JP7A 2Q0HA 4NBWA 3GFGA 3H1TA 2JZNA 3GIWA 4V39A 1GU0A 2OGSA 3D3QA 3E2IA 3I9FA 4WFQA 2YVQA 4QBFA 3IQHX 4MV1A 1CEEA 1ADJA 4URYR 1C0EA 3GVIA 3DV2A 1NR1A 3HVRA 4LOLA 4Y2QA 5EXPA 5I7EA 4WBSA 4R6WA 4RTQA 2O8DA 5EZ6B 4B44A 3F71A 3ZE1B 2IP1A 1E1RA 3A6HA 3KOOA 3WIBA 5LU8A 2VR1A 3LPAA 3QKIA 4CM3A 4QJBA 1VG0B 1OBVA 1B6RA 2PD6A 4NICA 5JH7A 2PIDA 2VL7A 2UYCA 5LDGA 1TQDA 2BRUA 2PRKA 1AK1A 4UUPA 4E2XA 1Q1ZA 1L9XA 3MBKA 2Z1DA 2I2XB 1Q14A 3ZVKA 1HRKA 1EK6A 3VI4B 3WBBA 1SHTX 4ROTA 1D1TA 2DLDA 4BYMA 4JT9A 1INLA 1O5TA 3NT2A 2PZAA 1DO0A 4QPPA 4AY3A 2J3HA 3VUEA 1J2TA 1H4VB 2NUTB 3MJ4A 5T4HA 1K2VN 1FP4B 1F4PA 1F6WA 1O6BA 1Z6GA 2AKAB 9ABPA 3EXHB 4PNZA 2CT8A 2ZJ3A 2IS2A 4DQUA 5CXUA 4LX8A 5DT9A 4BMZA 4P4UA 1BSVA 3R4CA 2JZCA 3KTDA 4TQUS 2X8WA 3K32A 1J5XA 4MQ6A 1J1ZA 3I92A 3LD9A 5HTKA 3ZCXA 2BEWB 4C0SA 6NULA 2HAEA 4FKZA 4KG7A 4XX0A 2HA0A 2GN9A 3L8CA 3PLRA 3KP1A 1U7PA 1QQBA 1I6MA 3D8TA 2F4VB 4DF3A 1MOQA 3HYRA 3TM4A 1Z6AA 2XWJI 1CZLA 1CKEA 1MAWA 2UZ0A 4L2IB 4ER0A 2JRLA 1H93A 1G5QA 5BQFA 3SS8A 4ZQIA 1R8QA 2JD1A 3DQQA 2GPWA 3UMGA 3ER9A 4YCBA 4D5EA 2IHVA 4KYTA 4ARVA 4X62B 3SBDA 5CFPA 5JFOA 4LXYA 3EC2A 5E6UB 4FHFA 4Q9NA 1EI9A 3JQEA 2JFNA 1SHJA 2A9RA 4HB3A 2WE8A 1NYTA 1Z5OA 1U8ZA 1Y7PA 2CJWA 3BREA 2B5OA 2OM2A 3F6CA 4WACA 2WVAA 5F5NA 2J9RA 3QFTA 2I3AA 3SS7X 1P7ZA 3T7DA 4CLHA 4DIBA 1PGPA 1YK1A 4F6RA 3ZE6A 3SGLA 3LYUA 2HBRA 1X1BA 2XUPA 3TFWA 2R6CA 4ER3A 5HSGA 4E07A 4NBSA 1R4AA 2RHMA 2Z5VA 2VBGA 1NVAA 2Z4SA 5KMGB 2JI8A 3S2UA 2XGJA 3ZI4A 4BQSA 5IUNC 2Z56A 4UBJA 4MGIR 5FLEX 5K3DA 4ZCRA 4N18A 4HVTA 4MTLA 3GFQA 4TYMA 9GPBA 4U9UA 3L0YA 2AGVA 2PL5A 3T9EA 3ND7A 4LMPA 4DDMA 1HBJA 2NU6A 1RYDA 1ETHA 4WK6A 3RUCA 3VJLA 1DOAA 4MZXA 4EP1A 4OX9B 2AC2A 4AJPA 1YUMA 1QHHA 5IC4A 4ESVA 2VWQA 4X91A 3WGHA 3BSFA 1J09A 1P4HA 4EG8A 2RGUA 3TLJA 3WRXC 4EKGA 4S05A 1UAYA 2JARA 2XYVA 1ZD3A 1QIEA 1UDWA 2B4TO 2FSVC 3GUVA 3EB9A 3H17A 3A3KA 4N7MA 4XD2A 3U44B 2VZ8A 4QIHA 3Q11A 3UOAB 1M73E 2HRDA 3KZNA 1KAMA 1ZK2A 3H9UA 2JJ2D 4BMYA 3VKWA 2CBXA 4CLEA 2XTNA 4C78A 4JN6B 4TRJA 4PLGA 4F45A 3H3FA 2C84A 1H05A 1C7EA 4KN6A 3ASZA 2DECA 3CPEA 4PRLA 2O7NA 1YL6A 1PT8A 2W8BB 3PF8A 1S8OA 3DBRB 2FWBA 1GKUB 1G21E 3E5MA 3UWPA 1QS0A 1T6XA 1JEYB 2IOFK 3V1TC 2JLQA 2XUQA 1JIQA 2QE7D 1D6JA 3V2IA 1SBIA 1GM5A 5I4BA 2H9AA 2X7JA 4KLNA 4PLZA 3THOA 5FV7A 4ZTUB 3G2LA 2BFOA 4GPEA 4NV1A 3BD7A 3GPBA 1CIPA 3BIWA 3QE3A 2VRBA 4G24A 4RKWA 1O6FA 1VECA 3F5QA 2YWEA 3G88A 4NEHB 3PNOA 2YXPX 4B3IA 3A04A 1QONA 1Y6JA 3PNPA 4HGOA 3UNXA 4EUSA 4EL0A 1SOUA 5M7EA 4CXMA 1GQYA 2R8XA 3L8EA 3VNQA 4KE7A 2R6DA 3SE7A 2WJZB 3HP7A 3GIDA 3AF3A 1ZL2A 4I19A 1H1LB 1OX4B 4F6CA 1BW9B 4X1OA 3TO5A 4AF6A 5ALGA 2Q3CA 1AO3A 1JZQA 2AE2A 2B7BA 5JSYA 1THZA 3IVRA 2XHZA 2XF2A 4GVXA 4PYIA 5JYEA 3D4BA 3UWSA 5DHTA 2MYTA 2EKQA 5ADVA 1H0RA 1IC6A 3K4PA 3RC2A 3ROGA 4QG3A 1PZMA 4FIZA 3O93A 4QDTA 4ZC1A 3ZCRA 5FOXA 3F7MA 2PKWA 3JR3A 1JVBA 1MO6A 4KFRA 4YCAA 4RTSA 4CCSA 1TM4E 3DF7A 3E3LA 4H17A 1CERA 2EV9A 4F6LA 4QTYA 3WA6A 4UM9D 3QELB 1A7UA 2EJUA 1I9CA 3ETNA 4HZIA 4MQBA 3FI9A 3TZLA 5CEFA 4EKDA 1PEDA 2E6KA 5REQB 4XVCA 1SC6A 1S2LA 2Y27A 3C74A 1LPOA 3LT0A 1H6CA 1FOEB 1ZW1A 4PRYA 1P4SA 1PTKA 1T8WA 4NS1A 1G8AA 4QBIA 4B85A 4D45A 1NDHA 2WK1A 1P9RA 3RV3A 3PDIB 1UQUA 4ZYLA 3A1SA 3D8HA 1KDZA 1JW9B 4YFVA 2YJ3A 3TEFA 1RDFA 4B3DA 4C1NA 1ONNA 3D81A 1P72A 2D1YA 4B7XA 4J0QA 2ID8A 1ZOIA 2QUKA 3E5RA 3QP9A 2P5YA 1DS6A 3FMPB 4WBXC 2ENUA 3DO5A 2CB9A 4G4JA 4FM9A 1U63A 2VYNA 4X00A 2TMDA 4XGRA 1XA4A 1E9SA 3IIEA 4DW8A 3SIWA 3EGIA 3K9LA 2SKCA 1KSFX 3O9ZA 3F5DA 1CJMA 4NAHA 1UIMA 5E38A 2IQIA 3VHXA 4TRMA 4S1PA 4H7HA 4ZJPA 1IUOA 2GERA 4UPVA 2Y71A 2DR3A 4OXKA 3GJYA 4WCDA 3FHLA 4K87A 4E03A 3ZD7A 2J3EA 3E35A 3E9RA 1U6KA 2OKCA 3RRJA 1QU2A 2B9VA 1UCFA 3RIGA 4LXUA 2H52A 2WD7A 3VHQA 3VGJA 2QGFA 1NKVA 1PR0A 3PHIA 5FBKA 2PGOA 3ZDZB 3HL4A 3ZNOA 5JJ5A 5KU7A 1Y4AE 4Q3AA 5IBQA 1HEIA 3FCAA 1NXSA 2R751 3LDHA 4UXIA 1PWYE 3I8XA 4EWLA 3QPWA 1NOKA 5DGHA 1OLUA 1P4RA 3EBPA 3IR7A 4QEZA 3ICEA 1MQ8B 2RGBA 3CWZA 1SKYE 4PYOA 3RRZA 2YMPA 1VKNA 2WM2A 4UTRA 1K4MA 3E2PA 1Z6YA 3B9BA 3JZFA 4K0RA 1TUBA 1YI8A 4GXTA 1RXWA 2V98A 4C0WA 2VUIB 4MYRA 1JPNA 1J8FA 2IDZA 2IF2A 3C70A 1TE2A 4QDJA 3GGJA 1DHRA 3AI2A 4WDQA 1DQSA 1OXXK 2ZVJA 1AQLA 3WR5A 4CF5A 4ZYXA 2WQ6A 1VLQA 3MTAA 1C7FA 4QT0A 1VJRA 5LJLA 3DZKA 3WADA 3HMQA 1Y5RA 1Z56C 3CZ9A 3PZRA 3W06A 1ADBA 3S5JA 3EA5A 1QWOA 3BE4A 3KKQA 3LW7A 1JIXA 1Q0ZA 3CZQA 2ZS8A 2YWGA 1NVVR 3ZX5A 5AESA 3D2AA 3CUSA 2A84A 4H1WA 3ZDDA 1Z5UA 1OWOA 3L3BA 1FS6A 5GGYA 5JJBA 3R3ZA 1P9NA 1SUSA 2N3ZA 2P9GA 4WLEA 4GMFA 4F0JA 1WB5A 3HZOA 4IUDS 4R8SA 1EFKA 5CP8A 1W9MA 4GT1A 4P3NA 1R0BA 2JIMA 3H99A 3AUXA 5IKPA 1CUCA 3OO1A 2EGGA 3OQ1A 1KEUA 2XDQA 3QX7A 2ZWMA 1U8EA 2O5CA 3ZS8A 1XZ8A 2OCXA 2ZE5A 1E63A 1JIIA 3N6XA 4JH0A 4QEKA 3T5BA 4JEUA 3AHCA 5EYPB 2OFFA 4CN8A 3OCYA 1TCCA 1TK2A 1ORVA 3K0CC 4FMCB 2YFQA 4DJAA 1VBNA 4YMTA 4DV2B 3DZ8A 1V35A 4RKRA 4P7JA 3ZGXA 1P6QA 1Y7LA 1YS2X 1ZW6A 3A36A 1RRVA 4UNNA 3ZWKA 2NNLD 1UIRA 3MT0A 4FJ2A 3AP1A 4QJ5A 4ZFNA 5E1MA 4XJXA 1PFVA 3F5SA 3TQIA 3TTYA 1KXJA 3ZLUA 4WCFB 4B81A 3LYHA 1T2CA 1BEZA 3CTPA 3L5OA 4YECA 1L7DA 2F3TA 4WUTA 1JU9A 1OKKD 2VF8A 2QN3A 3GPDG 2HQBA 2OKGA 3O2QB 4NATA 5K0NA 2JIOA 4G1CA 2D2IA 3T4EA 3ICOA 2OYSA 1GA6A 3JQPA 3ANSA 4QGBA 4B43A 5BMVB 2DUNA 1XROA 2X3UA 3HCEA 3HPQA 3O3CA 2PUHA 1B8PA 1PJSA 2RKWA 3OVMA 4IFTA 1EGMB 1S3SA 2WD9A 1BX1A 1PNTA 3RVMA 1WB6A 4JBGA 1V3VA 2ATVA 1GSHA 2ONZA 2AMFA 5LQNA 4ZU3A 1IB0A 3UTDA 4CU2A 4OP3A 2QM8A 3BULA 3EWIA 2EJBA 4F5YA 5EKTA 1XTBA 3C45A 3O2SB 4G0QA 1GXSB 4ZQHA 1IY2A 3E7XA 5CXQA 5HBGA 4YRLA 1CJBA 4JUFA 1E20A 4LMAA 3BS4A 4WXEA 3SOZA 4G0VA 3B9RA 5F4ZA 1ULUA 2PANA 4MS4A 1EB9A 4K81B 2XUGA 4AM8A 2QMHA 2GKOA 4OCZA 1W5EA 3FSGA 2PYIA 4XB2A 4LXQA 3K0FA 2W2PA 3SJZA 1KGSA 3H2HA 1ISIA 1QVVA 4FEYA 3AB7A 2FZKA 4HMQA 4PX5A 1G8JA 2F8MA 5HK9A 1FZTA 3W8FA 1SZDA 3FHTA 4GPAA 5AVQA 3LFUA 2QE6A 4NKRA 4D43A 4ZV7A 1JLKA 5CA1B 4GOJA 3H13A 1J0XO 5LP6B 3W4JA 4ZHQA 1JDSA 1O8BA 1E6UA 5TPWA 2R6AA 1RW4A 5LB4A 2P30A 1M10A 4I4TB 4HPJB 4HN4B 1T26A 2FX2A 1W88B 1OBHA 5F5LA 5JI3E 1WEHA 1UBJS 3W5BA 1AUXA 1GZ6A 1UODA 1ZN2A 2EKPA 1J4AA 2CHQA 4JR1A 1O57A 2W6MA 3EGCA 5KYKA 3DTVD 3NHFA 1BX0A 1O03A 1PBTA 1U0EA 1RACA 3FIJA 1XRLA 3KSMA 3N8NA 3WGUA 2JK0A 2PMWB 5CYGA 4EDHA 3K53A 1NUSA 1YZGA 4FZ5A 2B1GA 3A6ZA 3CLSD 3ZHQA 2ZSEA 4HDRB 1L7OA 1U2SA 2VJDA 3ZGNA 4BEWA 1V2GA 1TEHA 2QLJA 4KFUA 1PLKA 4YXWA 4GP9A 1T5DX 2VA8A 3IVMA 3T3OA 3PSHA 3V4PB 2JIQA 4JC5A 1STOA 4N49A 3SLKA 1KMIY 2LW7A 1DEXA 3GEDA 4GWKA 1IBMB 2ZR8A 2NO9A 1SKYB 3AERB 5B3AA 3HJTA 3HCFA 1K5DA 1XXLA 2DYKA 4I6GA 5B1SA 3V8EA 3ZE7A 2HQSA 3M4JA 3BG5A 1P4JA 4H6XA 4R81A 2RHTA 3DJYA 4LHZA 3W34A 1Z3IX 4FGWA 5BVHB 4Q1FA 3EEFA 4BKUA 1HZZA 5DO9A 4ZVOA 4YJ3B 5A5EA 1SCIA 1TC1A 4K9DA 4JI8B 1OFIA 3FDZB 4ZOQI 5LBIA 3KHSA 3JAKB 4AZ0B 3RC8A 4JLPA 3MCUA 2GI4A 1K9SA 1T9HA 4Z51A 1WLSA 5ELLA 4AICA 2QRVB 3BWVA 4CEIB 5DGDA 4AW9A 4MUXA 5K09A 3QKRA 4KIFA 1G0NA 3EVZA 5JJIA 1NRWA 1MRZA 3C3DA 4MMYB 3IERA 1KYXA 3HACA 1XTVA 1R5NA 4HGRA 3ZWDA 4X20A 1CU1A 3Q3JB 1CPYA 2E4VA 4MVWA 4YRKA 1HO3A 3AHGA 5ED0A 3CF4G 5G1PA 3OA0A 3C7AA 3OG9A 4PGGA 4M36A 3VPFA 4V0MA 5LLSA 3LHKA 3LQ4A 5HE8A 2WA2A 3IH5A 4EDFA 3S99A 4EX6A 3KQVA 2HCJB 4ZVPA 1A2QA 4CM8B 3L0SA 2XQGA 3EXFA 4GOLD 1QC5B 4IICA 1DJMA 2HGZA 2NAPA 4IIVA 4K86A 4DT1A 1OIVA 4A8JC 1MR3F 1HT0A 3M3PA 1L7RA 4ZI5A 4N47A 3LQQA 5L8VA 4JL8A 2BFEB 4Q1DA 5FKJA 4N8EA 5KVCA 1RMTA 4U2CA 4GBJA 1UPFA 1U4NA 4B3TB 1SC4A 1BMQA 3AY7A 3U31A 2WKSA 4AIIA 4DZTA 4DS3A 5BN4A 5IEJA 4FDUA 1U81A 1ATIA 4MRMB 3GD5A 3PX2A 4P53A 3ZDRA 3JYHA 4MUAA 1MIHA 1UKBA 5CG2A 5JIBA 3CUTA 4YHBA 4MXDA 4EW1A 3A1VA 2ZZKA 1JH8A 1WQ1R 2P1ZA 4HKTA 3H5TA 5CLIA 3U3MA 3ILSA 1XTTA 4LY0A 2I8LA 2C5EA 4MVJD 3KUDA 3ONEA 4RZUA 5C51B 2RC6A 1Z5NA 5LQRA 2QX6A 3BMQA 2RE8A 1H2HA 5TS3A 2FLWA 1NVXQ 3WL3A 3HEMA 3ZVNA 4GRDA 4M7WA 4CT5A 4JI4B 4XYBA 3CN7A 1YB2A 3F46A 1EK2A 4PC7A 2FN7A 4DLBA 2ENWA 2HLNA 2O1XA 3FDFA 3NTOA 4FSXA 4UUBA 3I5XA 1H94A 1RQLA 4ND4A 1G5RA 3MVEA 3I5UA 2V3WA 2IT1A 2ZAOA 2HUPA 3I2HA 3VTZA 1SZPA 1UJBA 2ZT8A 1IQUA 2OHVA 4NWIA 5H3CA 5KBYA 4OJTA 1T4GA 1OGYA 2FUKA 1QQ7A 3L1IA 4Y2XA 1P2UA 1S5PA 1T5HX 4RKQA 3OWHA 1JR3E 1XKLA 3QE4A 5ALYA 4C4RA 4OHZA 4TUYB 4LECA 3KOXA 2HK9A 3B1FA 3L8HA 3OOSA 3K0FB 2QT0A 3NBXX 3TZCA 4FD3A 5IVPA 3C3BA 3VTKA 1BFDA 1GTRA 3PJRA 1A97A 1P75A 2BM1A 3ANNA 3RT9A 1REQB 3ZVRA 4YMGA 4YUWA 1L4NA 4AU1A 1ESDA 2QYOA 3ZD9A 1PW5A 4DJJA 1L4UA 3BAFA 1E7SA 3QKRB 4I55B 5T4FA 4M0MA 1GNSA 2UVDA 1OQAA 3N0TA 1RAEA 3M5PA 3ORFA 1SOWA 3JQ7A 2AD1A 1Z4NA 2BGTA 2NM0A 3JTEA 4F85A 5EWLB 3V4LA 3RNLA 3AIOA 1SEVA 3MBIA 5IXYA 4O2RA 4JOQA 1DG3A 3ONVA 4F7WA 4M0FA 5I9IA 1VLLA 1YL7A 4HXFB 3BXEA 2XCRB 1G16A 1LLUA 3G9UA 4RXTA 3TTXA 2PM8A 3BIXA 1RNLA 3OZIA 4H15A 3B2EA 1PZEA 2VQ3A 5JDIA 3AJRA 5I4IA 3EARA 5JDCA 5IXSA 5BN5A 2WYUA 2ZTLA 1CY0A 1CY4A 2P3LA 2YOHA 3T1HB 5B1IA 1E1RD 1LLCA 1XDUA 1ZSVA 2BR3A 1C3XA 2MYUA 4TPKA 3WWDA 1C9DB 1Z2PX 3NHAA 1L7QA 4GPIB 4KI7A 4WI1A 4XOIA 3MJHA 5AHXA 5F4BA 5JXGA 4JCOA 4EFMA 4Z0HO 1AHPA 4Y6RA 1B00A 1TQ4A 2GT1A 5DHAA 2PRZA 2FMHA 2VPZA 3CUKA 4YROA 1Z7WA 4B17A 3AWIA 1HLDA 1ICIA 1W4ZA 4M8LA 4TL8A 1X92A 3VR6A 4DYVA 1PK9A 5AH0A 4R0VA 5DXFA 5HG0A 4WD3A 4A6DA 2CHFA 2XIJA 1X13A 2BE9A 2LIVA 3EFOA 3DE3X 1XDZA 4IV5A 2HK7A 3DW1X 3H5LA 1ZUHA 2WLTA 3JQRA 3EH2A 5K2MA 3TL6A 4Z5XA 2JGMA 1I4DD 3MJVA 2Q3LA 1NMSA 1ZJZA 2P9JA 3I05A 2J7PA 1ISPA 4Q93A 4YMWA 3W1EA 3ZWQA 4TL9A 1LBTA 3NAMA 3HNRA 3SU8A 1RTKA 3A25A 1PWEA 1HKUA 1PWHA 2P4QA 5KNDD 4KLAA 4KWHA 4OQEA 3VDNB 3GDGA 5K6AC 4JP1A 4ZU6X 3I52A 1YL5A 1YHYA 4GQBA 3Q7EA 4JJKA 2YYSA 2FK8A 3UOGA 4BRUA 4QELA 3PDCA 1MT0A 3GT0A 3H4IA 4JLBA 3UPDA 3S1AA 1T6YA 3EVTA 4LWPA 2H8GA 3TNJA 4KK4A 5FWXB 3G2NA 4KMMA 1Z74A 2WF6A 3ZWAA 2AK3A 3MS2A 5F98A 4N5NA 5BSKA 2Y92A 3FMGA 2A0WA 1SBNE 1X15A 4IG9A 4V0ME 3VPCA 5IANA 1HNZB 2WIJA 1M2FA 5KYNA 1ND6A 1NI3A 1OSNA 4UUQA 5JBQA 3OQBA 1JEJA 1T4BA 2ZUTA 1C50A 3BFVA 2XZOA 2VH1A 2F64A 2W6OA 5K8CA 1ZGZA 3EVNA 5JI2E 1CR4A 1LVGA 4L8FA 4LZLA 4OSPA 3HM9A 1O4WA 3IJPA 1R8JA 2CCGA 3PR1A 1Z6QA 4YR7A 1SCBA 3DVRX 1UBCA 3QW2A 4RIHA 2X9VA 5CT4A 2PSDA 1Q50A 2TMKA 1VG1A 3CIFA 1Z25A 1CY1A 4TXJA 1ECLA 2QZ9A 1OBFO 2I1VB 2G9QA 1LFAA 1UBRS 2ZULA 3RC9A 3AHFA 1XL1A 5CUQA 4YN3A 2GK7A 5G40A 3GN1A 3A0RB 4JA2A 4X8HA 1GLVA 1TYDE 2QD3A 5FB3A 4TL7A 4WEQA 2X15A 3WGQA 4GI3A 3T38A 2LKCA 3DLAA 5F7ZA 1VPWA 3UBTA 1THTA 1U2PA 3SJCA 3BH7A 2Q1YA 1KH1A 3WC4A 4MTCA 1ODLA 1WO8A 3GA0A 2Y2VA 1OOEA 3ZHBA 4ILKA 1DRWA 3M89A 1EX1A 1SCUB 2IYQA 2BM9A 2GAIA 2D4AA 4JB2A 1JU3A 3LK6A 3T7AA 1D4ZA 3NFYA 1QX4A 4XCXA 3J80A 2Z6QA 2KWIA 4UTOA 4QQNA 1WMAA 4R2MA 1QAMA 4GPD1 2CDNA 2YWCA 3P5SA 1CJKC 3PXBA 3TGPA 2CZCA 1DBPA 2ZJOA 4RQAA 4V02A 1ZONA 1LPSA 1UC4B 4MVJF 5FL3A 4YREA 3SLRA 4J4TA 4RIIA 2AD5A 3VHXB 1XNGA 3Q7IA 2XADA 3OCJA 3D7KA 5IFKA 5G0VA 1TM2A 3L6RA 4H7JA 5FFNA 2H1RA 5C32A 3D2CA 2QLNA 2R1VB 1NLMA 2AR9A 1O7JA 2CUTA 4OATA 3K0BA 3MWFA 2QAGB 3BGDA 3HDQA 3OIUA 3TLYA 1OH8A 4FX2A 3FZYA 4FD2A 4AYXA 4ZIRA 1F2TB 1V3QE 5F2NA 3C4QA 2DTEA 1AGRA 2CMDA 1J0CA 2RDMA 4Z4CA 3WKAA 2W2MA 1KY2A 3R5FA 3U4AA 2YY7A 4GO1A 5DHSA 4QPDA 2ZDQA 1RWMA 3BMNA 4MUJA 1CR6A 4KHZA 1RXCA 4P81A 4XDZA 2BJVA 2ILTA 2HMSA 4AXBA 2GK3A 1A72A 2C5AA 3CR8A 5B4VA 1KEZA 3LH5A 2WVHA 4QGGA 3Q8WA 4PC3A 2G88A 5KTMA 1RYHA 5B57C 5I5EA 1KMHB 2AC7A 3BWEA 4ZK6A 1P81A 2YMMA 121PA 1QHNA 1LFDB 1URPA 2VZEA 3MGGA 3QZUA 3AR4A 4IUYA 2GCOB 5BYBA 3L1UA 1IJFA 1J9EA 4R2XA 2VVTA 4LEIA 5J2UF 3KJZA 4HDOB 4MWEA 4KR3A 1Z37A 3EDOA 4DCGA 1W25A 2DT8A 2EJCA 3FOAA 4LXXA 4AS1A 4JROA 4YGXB 3I0MA 5F1KA 4JQZA 1LW7A 1JDUA 4WCFC 2YJ6A 1BX3A 2DFDA 3PFIA 3L7DA 4BRZA 4ZYZA 1A8PA 2YWHA 3BE8A 4ID9A 4UHEA 1TK9A 4TLAA 5DBOA 5T64A 1PVVA 2H2AA 2XMSA 3DOHA 1L5WA 4Y1RA 4CEHA 2PMCA 1LI4A 4JY7A 3G13A 3ZU5A 1EUCA 2TSYB 5EMKA 3WP1B 4H3KB 3H1EA 5D7BA 5DASA 5DTMA 5E0OA 2IE0A 4C76A 3HJNA 2O7SA 3OTWA 1W46A 2FFJA 5GP1A 3WWPA 3BDIA 1H1DA 5I9BA 2GD6A 2ONJA 4TS1A 4L8GA 3TLGB 5KYUB 3DYIA 4D4JA 2CNKA 2Y4OA 4RYDA 2OCLA 3KETA 4WWHA 3A4VA 2KHZA 4AN4A 1KS9A 3AO0B 5ES4B 5JSHA 4M89A 4WSOA 1Q2XA 1WUTA 1YMUA 3D6MA 4IP0A 4Y6LA 3VU9A 5EJIA 1WD5A 1GL6A 1QANA 5EE5B 3DS8A 3JQ6A 1D0SA 4JZYA 4K9KA 2YOGA 2IYVA 3GRFA 2CD9A 3GJTA 5EIFA 1FDIA 1TCUA 1YE8A 2ZJ2A 3I6ZA 1JWLA 1W93A 4URHA 5H81A 4MR7B 4FFVA 2GBPA 3TMAA 1VBFA 1VPEA 5FEMA 1SD1A 2FW0A 4X1IB 5T4EA 4YJ2A 1YDFA 1YBFA 4JVNA 3N2EA 4BMDA 3WMRA 3BTOA 4KNVA 1Q20A 3S1AB 4CV3A 2ZI5A 4F7DA 5DYIA 2ZZMA 4DMHA 2HCRA 3KSDO 1T2EA 5AVUA 3DGEC 3QMMA 4TLCA 3THYB 1DX6A 3IOMA 1LEHA 2ZJ7A 3G2JA 1UFKA 4BB5A 5E6SB 1T0IA 2REXB 3EXG1 2C8JA 2P2SA 4IO1A 4NOJA 4CDRA 1WKBA 2ROQA 2VYVA 3RJ5A 3VAAA 4EH1A 1N5KA 2WHQA 1AXGA 3PC8C 4DC0A 5CDGA 2IIPA 3BIJA 5K0CA 4FFSA 3ETDA 3H9JA 1Q7RA 3TSWA 2E37A 4RM3A 3ROMA 3KPUA 1VA4A 1T35A 2RD2A 5H1YA 3C5HA 2ZKIA 1V47A 1H3NA 3LX8A 3CE9A 4OHVA 3TE6A 1PNVA 2VT7A 1A9TA 2XNJA 2V74B 4KPUA 2A33A 3IDAA 3B3QA 3MCWA 4KIGA 3C87A 1DHTA 4JHLA 4UMEA 1J2JA 3CW9A 5KINB 4YV2A 4QFBA 1QP4A 1JG1A 3DCJA 3EIUA 3NIFB 4G81A 5DX0A 4D4GA 3SQWA 1YIAA 4AG6A 3D7LA 4D26A 4KGDA 5TT1A 1G8MA 2EWMA 4FBMA 4P0TA 5AJYA 4QZVA 2CMFA 5J40A 2QX9A 4I9NA 2YBEA 5ESRA 2HU7A 4RFVA 4KDEA 5FUXA 1E6LA 2GPSA 3FDZA 4MAMA 2I4IA 3JVEA 1AQIA 3OT1B 3LKBA 4PO3X 4OAOA 1BXGA 2N1BA 1SIOA 3CCBA 3UJ3X 2PBFA 4KWIA 4D4IA 4DLWA 2Y0EA 2GFQA 3VZDA 5NLLA 4ZRNA 2IV7A 2O3SA 4HR7A 4S1TA 4JBXA 4RBNA 3EMKA 3WYFA 3I76A 3R7LA 4NNPA 4JLJA 3LQ1A 3H7AA 2A14A 1I5OA 4L0CA 4L7QA 2ZYGA 5BV8A 4YYEA 3OIYA 1XLWA 2W22A 5GM2A 1DC6A 4NZOA 1YB6A 4UVGA 4EY8A 2X5NA 3SSOA 2PZMA 3FJOA 3HBFA 1MTZA 2WD8A 4U39A 1EFDN 2ECPA 5E8JA 3WRYC 4ATNA 3DE1X 3F9IA 1SD2A 1S2OA 2NLOA 4J7CA 1A7AA 3WKBA 1GP2A 2OUKA 3MTDA 2ZRAA 3I3SR 2JJYA 3LGAA 1VHTA 2Q45A 5AKKA 5ALJA 3WNDA 4K1LA 1RAGA 1QO0D 1TLLA 5JS7A 4XGQA 3DE6X 3I30X 4OU4A 3I1IA 4WECA 2HIAA 4W9NC 2ICAA