5AVKA

Crystal structure of proteinase k from engyodontium album
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Derivatization of Proteinase K with Heavy Atoms Enhances Its Thermal Stability.
doi rcsb
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5avkA00
2DP4E 2GKOA 5SICE 1AK9A 1KE1A 1CSEE 1BE6A 1R0RE 1YJBA 4CFYA 1ST3A 3WQBA 2ZRQA 5I9SA 3SQOA 3TI7A 1NDUA 1SUPA 3VSBA 3I37X 5AQEA 1S01A 2DQKA 3QTLA 1PJ8A 1SCBA 1GA1A 5AMXA 1AH2A 4DZTA 3I30X 4KPGA 2DUJA 1PTKA 3BPSA 3A3OA 4FONA 1P8JA 3AFGA 2W2MA 1SVNA 3DWEX 2PMWB 1TECE 1VSBA 4KB5A 4OV6B 3DW1X 4YN3A 1GNVA 1AQNA 3PTLA 1Y48E 3DVSX 1WMDA 4LVOA 4WOBA 5AVJA 3DE6X 2PKCA 5JMOA 4AKSA 3GCXA 2SICE 3DE7X 2Z57A 2Z56A 3UNXA 4ZOQI 1AU9A 2X8JB 1HT3A 2SNIE 2PWAA 2Z2XA 1V5IA 1SCDA 1SELA 3OSZA 1SIBE 4C3UA 1SH7A 3Q5GA 1C9NA 1Y4AE 1S02A 1GTL1 3EIFA 2XRMA 3EE6A 5CW1A 1PEKE 1JEAA 5ARBA 3LXUX 1R64A 1ST2A 3AJ9A 1YJCA 3D43A 3WHIA 1TM1E 4NMXB 4WOCA 3BGOS 3Q40A 1KDZA 5ARDA 1C9MA 1TM5E 3DVRX 4ZARA 3F49S 4DJ5X 5JXGA 3LPDA 4HVLA 4NE7A 1TM3E 3DE3X 1BH6A 2WUVA 2W2NA 3VTAA 1Y33E 3WIVA 4M1ZA 1SBTA 1WMFA 4I0WB 4OMDA 4AKTA 4CG0A 1R6VA 3DE2X 1TMGE 1CNMA 2W2OA 3D9QX 2ZWOA 5B1DA 1GCIA 2Z2ZA 4H6VA 4K8RB 5JXHA 1Y3FE 1SBIA 1SUDA 2E1PA 4RYDA 5ARCA 1Y9ZA 1T1GA 1XF1A 3F7OA 3LPCA 1TM4E 4CFZA 1DUIA 3PRKE 4NE9A 5B1EA 2PRKA 1AV7A 2WUWE 3CO0S 1EGQA 4Z2AA 1LW6E 2Z30A 3F7MA 2V8BA 4DWWA 3DDZX 2XTJA 4H6XA 1Y4DE 1DBIA 1TK2A 3DVQX 5JXJA 4C3VA 1UBNA 3AJ8A 5AVKA 1SCJA 2PYZA 5FAXA 1SBHA 5JXIA 2PWBA 3TI9A 4JP8A 1WSDA 2HD4A 1IC6A 1Y3BE 1SCNE 2PQ2A 1PFGA 2WV7A 3DE0X 1Y34E 1WVMA 1ZVJA 3CNQS 3SICE 1GNSA 3H42B 2WWTA 1TO2E 3DE1X 3DE4X 3VV2A 3ZXYA 1OYVA 1KDVA 1SN7A 1GT91 1TO1E 1AVTA 2HPZA 1SIUA 1SIOA 1V6CA 2W2QA 2ZWPA 3TECE 1OYOA 1KE2A 1BFKA 1T1IA 1Y3CE 2IXTA 3EDYA 3QMPA 1BFUA 1GA4A 1SPBS 2Z2YA 2G4VA 1Y3DE 1A2QA 1Y1KE 1SUBA 5K7SA 1C3LA 3DE5X 1SBNE 2ID8A 3A3NA 3VV3A 1NDQA 3T41A 4OMCA 4BWGA 3HJRA 3I2YX 1SBCA 1SUCA 1MEEA 1IAVA 1ZVKA 2X8JA 4J94A 1Q5PA 3DW3X 3QFHA 3ZXXA 4LVNA 2P4EA 3P5BA 1YU6A 3BX1A 3I34X 4GI3A 2ID4A 5FFNA 1KDYA 1BJRE 1OT5A 3LPAA 2ST1A 1SUEA 1EA7A 1THMA 2TECE 5FBZA 1WMEA 1P7WA 1SUAA 1BE8A 1S2NA 4H6WA 4MZDA 2W2PA 2SBTA 1AF4A 2B6NA 1NLUA 1YJAA 1SCAA 3DYBA 3L1KA 3A3PA 2QTWB 1GTJ1 3GCWA 1T1EA 3VHQA 4HX2A 3GT3A 3WIUA 1TM7E 2SECE 1GA6A 1GTG1 3VYVA 1MPTA 1C9JA 4B5LA 2IY9A 1P7VA 4KG7A 2Z58A 3GT4A
chains in the Genus database with same CATH superfamily
2GJ8A 3HBNA 3DZGA 2VFAA 3T0IA 5KX5F 3JASA 2OQRA 2DPMA 4U63A 2ERCA 2Y1CA 1B1CA 3I8XA 3MS7A 4FU0A 5ALZA 3UHOA 3QLUC 3WNCA 4LOLA 4JI0B 3I53A 4WQMA 1X7XB 5TNXA 3ZZ1A 4KMMA 2WC1A 1JQAA 1NMYA 1Z2PX 1O77A 3QWFA 1XNRB 4XJXA 4N3CA 1UBMS 1O6CA 4PPQA 3TEJA 3TBFA 1OXTA 3FPSA 1DAFA 1TT5B 1B0AA 1TX4B 1BSVA 2AR9A 4QYWA 3FUCA 4XVRA 1RADA 4ZHQA 4I55B 1CUHA 2QQEA 4RQAA 2CXPA 4LJ7A 4RS3A 4JLUA 2E82A 5CM8B 2X58A 3OO0A 3P2YA 4HLDA 2HEIA 3LNCA 2EDCA 2ZUSA 3CRRA 4DMHA 1KIAA 2H2IA 3RUDA 1Q20A 1IVYA 2PKQO 2PSEA 4ND2A 1K8XB 2P9TA 2QLTA 5HKLA 5K3DA 4QUDA 3L4BC 4CF6A 1QRSA 2EFCB 3H0EA 1OROA 3GGPA 1JIKA 4CFSA 2CDNA 1M2VA 3VGPA 1RKVA 2LGJA 4MR9A 2F1RA 4DZTA 4YUYA 2XDWA 5KQLA 2QRVA 5DB4A 2PVPA 1W4RA 4LDRA 2ZRIA 4Z4HA 1Z2AA 3NOXA 3U7FB 4QWWA 4UNQA 2J3QA 3CPJB 5C52B 5NULA 2XJ9A 1DBRA 1O2DA 4GBGA 3GDFA 4FONA 2IP4A 3FJYA 3OQVA 5FTWA 2XHZA 2IV3A 2XLBA 2A7XA 1LGYA 4A0HA 2BHLA 1Z62A 2MSDB 1P2TA 5BN1A 1P6QA 2AOTA 1QH0A 3FI9A 3GJ5A 3EQ6A 5H0IA 1OPRA 2ADMA 3K4HA 3RGGA 3UFXA 4X3CA 4BMNA 3GC6A 5LXTA 1FFYA 5EY5B 1H9AA 2DEUA 1LPPA 1BWSA 3L7IA 1KAGA 3WGNA 3PHLA 4JJ7A 4NCHA 3E1KA 3RARA 4M22A 1YFKA 3Q0TA 5AXAA 5T4BA 3X3HA 3R7LA 5IWAB 3AR2A 4LXXA 4MX8A 2ZI9A 3IHLA 4NU5A 5ILOA 1P33A 1DNPA 1ZOLA 5BSTA 3N1UA 4CN8A 2JPDA 2QD5A 1MJHA 5FOTA 4RYLA 3VVCA 1HT3A 3H87A 4AVYA 2DKOA 5D2CA 1V5IA 5JSZA 9ABPA 1ZK0A 3BH7A 2B1QA 5BSRA 3QKUA 4IDDA 1DE0A 1V39A 1OASA 2ID9A 1NM5C 3Q2IA 4L8WB 1J8QA 4CW7A 1Y6FA 2ASEA 4YH1A 1GSAA 4P4SA 1QCYA 2WM2A 3S4YA 1C9NA 1ES9A 5B6PA 2HK9A 2J7KA 1OT3A 4A03A 1I3NA 3LMKA 3RVJA 4EYQA 2QD2A 4N8DA 1CQPA 5CW1A 2B2CA 4ZOAA 2J4CA 4PQYA 1SKAA 2BPOA 4HNHA 3U49A 3V1KA 1XN1A 1GPH1 1T5IA 4B09A 4KC0A 1J22A 1C8VB 2AEFA 2BIFA 3ABIA 3DZ8A 3M4XA 3UWSA 5F7OA 3UUEA 4F8YA 3V42A 2C5GA 1EH5A 3P9ZA 2X1VA 4U0KA 3D8HA 4FEEA 5B7QA 3ET4A 3KHKA 4QG3A 4G1BA 4IFEA 1XR3A 1T2DA 2W6JD 1VOTA 4JQCA 1N0UA 1W0KA 4RHEA 4TTRA 1UFKA 5LB2A 1DIHA 1UP7A 1T26A 3BZBA 4OGKA 4AMZA 3EHEA 4FJ0A 4URHA 2I9PA 4ALMA 4F4DA 1LNZA 1KY3A 2WWGA 5L53A 2EYUA 1XRLA 3IP7A 3NTUA 4M8KA 4RHYA 5AI4A 1DKUA 4REMA 4PLZA 5EL0A 4KR0A 3GJ0A 1ZD9A 5AXBA 3WGKA 4EHHA 5IM4A 1Z06A 3GLHE 1XG5A 1YH3A 1CZKA 1E64A 2G5CA 2J4FA 2CCKA 2RDMA 3Q6IA 1VKOA 4J0DA 4E21A 5KREA 1ZPDA 4OA5A 3RANA 3ZW9A 3GMDA 2HMSA 5B7NA 1PZEA 1C9YA 1E4EB 2GJKA 6CHYA 2ZSJA 3HTXA 4HB2A 1UM9A 2OAQ1 2XGGA 5U4XA 3GNTA 3ZBTA 2JRLA 3ILSA 3O31A 4EG5A 3KFLA 4ZV4A 5IAOA 1WHSB 4HX9A 4E51A 2AK2A 1WB5A 4ZGWA 1QXSA 2EJCA 2X0KA 3QFCA 2G9ZA 3VNQA 1Z82A 4PX5A 1BDJA 4OKIA 2A4MA 5DNYB 4L4ZA 1EX9A 2UZ1B 4KVGA 1HH4A 1UPUA 4NF2A 1NC3A 1RZ3A 2AH5A 2X8AA 3EIOA 4KK3A 1HM5A 3DD1A 4XTRA 5CNMA 5EP1A 4R31A 1A95A 1RHQA 3AFMA 4RPKA 1Y7PA 2MINA 3NP7A 4MGZR 4Q05A 3SXUB 1D0SA 2W2OA 2P4HX 3Q98A 5ANRB 1W59A 4TKVB 4U3JA 5JSKA 4QT0A 1S8AA 5ALKA 1QVWA 4FHFA 5J1SB 4LC1A 2VDOB 1IM5A 1L5ZA 3B1FA 4BTLA 4CKXA 1Y6GA 2GYYA 4I2NA 1OGJA 3R7BA 3NAQA 5EUQB 5NLLA 2PA3A 1JZTA 1R6UA 2BF4A 4BZWA 1H2FA 1FMTA 3F6CA 4B3RB 1P7CA 2B4YA 3NUQA 4RYDA 4MKRA 3WWDA 5JO0A 1J5EB 2GLTA 1EFLA 4B3TB 4B46A 5SYAA 5JROA 3UWOA 2VDRB 1THTA 4XGNA 2J8ZA 2XAAA 3VX4A 5IEJA 3HJCA 4FHDA 1VSTA 2X15A 4M0MA 3U2QA 2UZ0A 3BGVA 4D9BA 2AG0A 5A9TA 2ZRLA 1PQ4A 2GO7A 4L8YA 1PKXA 1K8QA 1ULUA 4QVGA 2IF0A 5JSZB 3BCHA 5U1PA 3N2IA 3JQRA 5I47A 2X22A 1FLNA 1H8ED 3GPDG 4A0GA 3CR8A 4RZUA 2V7QA 1WF6A 1IZ9A 3Q9SA 1FIUA 2QZJA 1T9KA 1KH1A 4C88A 4RMNA 3IURA 4EFLA 1CEQA 4ITUA 1EBFA 1MVOA 2B3DA 2WYIA 2JGKA 3KUKA 2BSQA 4D6YA 1Q7GA 1OV6A 2NYVA 4WXYB 4LHYA 4OQLA 1UKVY 3HP1A 3SEAA 1VBFA 3U9SA 5CB4F 5LP6B 2QZ4A 2ODWA 3IKTA 1WD7A 1XA4A 2FR0A 3VPBA 3CO0S 4GOMD 3TFOA 2X5JO 1R15A 5HCUA 3MUEA 5TX7A 3EZNA 4ZMRA 4CKCB 3JPYA 3LK7A 3PDIB 2A78A 3AUAA 4EY3A 1SVKA 4CMKA 1ZNYA 4OAQA 3ZHZA 4ND5A 3L7MA 1TW2A 2PBFA 3WK4A 4A8PA 1JWAB 3TOCA 3JQ7A 1VLMA 1TK9A 2P67A 2R8XA 2ZPUA 1DX4A 5ALIA 3TTYA 4EYGA 1JR3E 3DZIA 2YNMD 1JEJA 1ZBDA 1PFYA 3JAKB 4XSHA 3WBFA 1PLJA 1UJCA 4PCAA 3EX7C 1ENPA 1LDBA 3AHHA 4DKJA 1CEEA 2QTZA 1BYIA 2WY2D 1VKJA 1O6GA 3G02A 4NPAA 3Q6MA 4H0NA 5L6MB 1FP4B 5K45A 4NIMA 1A9PA 3JARB 4YP5A 5JXJA 3D2CA 4K28A 2YZMA 3PQFA 4AZWA 3ZBUA 5AVKA 2FSFA 4NX2A 2AMVA 3DKVA 5IJ9A 3VHRA 2AN4A 5K0FA 1XZLA 3PFCA 1PGOA 2QYSA 1EVKA 4AO6A 4GRAA 2GUGA 3KQMA 4HP8A 5GVRA 5TEVA 5D1NA 3PJDA 2HDWA 2O8NA 2Q9BA 3CLSC 5B5SA 4MYUA 1O9HA 3OQIA 4GEKA 4B2IA 4BLUA 5E2AA 2WU8A 4QLBA 4BGDA 1XXHE 4EHLA 5JC1A 1R37A 3MTGA 3VBEA 3A4LA 4FFMA 1SCNE 3L7JA 2VJPA 3EAGA 1N1MA 5AKXA 1V8PA 3K0CA 1P1KA 3C1UA 1D7OA 2JAHA 1R8QA 1V4NA 3D6NB 3KR2A 1CUVA 4NTZA 4R2IA 1KVTA 3EVAA 3V7FA 5D3MB 4AC9A 4J75A 2NU8B 4IICA 5J4LA 1NQTA 2XDYA 3KOUA 4H7PA 3CLRD 4E2WA 2P9ZA 2OP1A 1GY8A 2KJQA 4I3GA 3OIVA 1F0PA 4LMBA 2WD7B 2VZ0A 3ELUA 4Y2HA 4F06A 3CNQS 2WBLC 5BWLA 1EQ2A 3MJVA 3S5UA 3NGMA 4PWZA 3EMVA 3UJAA 2QQFA 2MOKA 3DCNA 3Q4GA 2X7XA 5FNVB 2BKEA 1SC9A 4HJXA 1I10A 3I6IA 1YS2X 3SG0A 2BONA 3GUYA 3KVNA 3UT5B 1M1ZA 2HYDA 1DXQA 4A8JC 1PNVA 1OIWA 3O8DA 1MQ8B 1Z7BA 4K9NA 3BREA 1V4BA 3OU7A 2ZQ5A 4HFRA 4N41A 1DC6A 1RP1A 3ZXYA 5A7GA 4QYSA 1GN8A 2AJCA 4JUIA 2QPTA 4DIBA 4MR8B 4BO1A 5HZKA 1Z8NA 1OWOA 2YXEA 4LZNA 4ZWNA 5I4CA 1CC1S 1A3CA 2G08A 2HQBA 2VHEA 3A1SA 2DOKA 4DCPA 3L1UA 4M76B 4KSCA 1BKSB 4HN2A 2NTNA 3WJ7A 4IZIA 2JJ1A 3L6CA 2H1OA 2RH9B 4QJ5A 2CLMB 1JYEA 3GFRA 5DNDA 4YREA 1JHRA 1ODIA 2OGWA 2H1IA 4GKBA 2LDBA 2R9VA 1X19A 4M9XA 1NN1A 4MROA 1SKMA 1VPWA 5DH9A 2X5KO 3N2NA 3COZA 1KYZA 3CISA 5CFMA 1MO5A 1T1IA 2ZT6A 3R6LA 4M7RA 3VC7A 4V3CA 3VNAA 3PR3A 5CLLA 4IIEA 1NPTO 2NVUB 2RGDA 1GA4A 1ECJA 1K97A 1P17A 2JJQA 3ISTA 1KK0A 5F3RA 2VWGA 1L7VC 5BSMA 2PE5A 5YASA 4BGVA 1B15A 3LD9A 5B58C 3H9CA 4LDJA 4DT1A 5C8YA 3AO0B 2IHKA 5SZKB 4B6GA 1W4LA 1ISSA 2PFSA 4RDHA 1HDYA 1W1UA 2R7AA 3NHZA 3QE4A 3VNBA 3X1YA 1NVEA 1JHAA 2VPWA 3AHJA 3KHUA 3ADOA 4QX6A 5AJVB 1QIMA 4RTMA 1K27A 5AW4A 2I6GA 3AILA 3DAFA 4A8HA 1W0CA 3QEMA 3QGMA 5IAAA 3WL5A 5JSQA 3NKVA 3T5TA 4F38A 3SC6A 3T7SA 5IBPA 4RK6A 3ETGA 4TMZA 1PNQA 621PA 2ZIAA 4TKUB 2NT3A 2VNHA 4KGZA 4YRZA 5EHGA 4EGAA 3K3PA 1B8OA 3H2YA 5GZ6A 3OA2A 3R3XA 3VI4B 4CIWA 4HQRA 3CWQA 3OPNA 3QXHA 1ESCA 4UBOA 3LX4A 4KR3A 5WRFA 1DFHA 2HMVA 5IANA 3B89A 1A0OA 3ZWMA 5LVAA 2XE6A 3DC2A 1FF9A 2W2LA 3E2IA 3IMKA 2WP8J 4OPMA 3RTAA 5ERXA 2RD2A 2GZSA 3I01A 5E3HA 4YRQA 1UT5A 4E7OA 3BERA 2PFKA 1M1NB 3BILA 1ZONA 4ZO6A 4QM6A 2HLDA 3KQPA 3IIIA 2AFHE 1ZCJA 1DS6A 2OKGA 2WSBA 3TMKA 3VX3A 4M9QA 1FFBA 2I87A 5CT6A 5C4GB 4BP3A 5DCWA 4WXRA 5AM1A 1XQ1A 2F9LA 4TTTS 4WLNA 3NYIA 1P5FA 2LPMA 3QBEA 3F7NA 3H1TA 5FI5A 1L5KA 2O0LA 3HCEA 3QFSA 2TRSB 1GGEA 5LUAA 2FG6C 1EBBA 1P4JA 1H4VB 2Q28A 3KOZA 4HAXA 4YTEA 3ODGA 2FJ0A 1WZEA 1VHWA 3QNMA 4FS3A 3MT9A 5KVVA 1JKMA 2FHSA 2NU7A 2HMAA 4BV3A 1MA0A 1ZC3A 1KXJA 1SA0A 3FNFA 2GD2A 1Y37A 4FQ5A 4OHKA 4UBJA 2E89A 5D86A 3T1VA 5EHIA 3CY6A 4EARA 5IYZB 2C4UA 1EA7A 4PPFA 2AHOA 1XRRA 5F1KA 2KX7A 1Z6XA 2RKBA 1YQEA 3BFXA 3D3EA 4Q1AA 3V8EA 5FOXA 5AK6A 2ZBQA 2QD4A 1L5HA 1DAPA 1JTEA 4LXYA 2R7NA 3TLZA 1B93A 2GZRA 2RG1A 1BE8A 4U7JA 5F51A 4YACA 2R8EA 3UT6A 3IBFA 2FSUA 2MYNA 3I92A 1H9BA 4HK4A 4PEVA 4WNAA 4ZEXA 1VMDA 3I6QA 4NCAA 2CCGA 1ZMTA 4J7XA 2A0XA 4BLRA 5AVYA 3TTXA 2HFKA 4D8WA 2ATCA 2V8OA 3W2TA 4DIEA 2BKXA 3KM0A 1U2ZA 1WLSA 2BMJA 2ZATA 3I4CA 3R6DA 4OM8A 4IIJB 1FRQA 4YJ2F 2PUTA 3WOVA 1WUTA 2HCJB 4AUMA 4D46A 4MVJD 3K6SB 1Q0PA 3STXA 3GLUA 1F5SA 2AHRA 2CK3D 3FWYA 4W1SA 5F7JA 4RZ2A 4F4HA 2OPHA 3GJSA 4TS1A 3SS8A 1XE3A 2VO1A 1S9HA 5K3EA 5AIBA 4EG3A 5JAMA 4XCVA 1QWOA 3PNVA 1RFLA 1F4PA 4TYQA 1MHPA 1UBEA 4N6NA 5E3IA 1TUEA 3MMSA 5HS4A 2WTNA 1X1DA 1DT3A 3WWZA 3GJQA 2FZ4A 1NV9A 2QAGA 5DE3A 3WWOA 4TTPA 5J4KA 4XZ3A 4IQGA 4MDYA 1UODA 3VUFA 2QUHA 4NZOA 3A3KA 2NV0A 1RQRA 2VCHA 1UBLS 4PYMA 3BE5A 3ENKA 4Y67A 3AESA 4YXWA 3V8MA 4C9BA 4MW1A 1D6NA 4II3A 4KPUA 1R12A 2OBLA 2C2XA 3LXRA 1XHEA 3BWEA 3ORYA 4QYIA 3GUCA 4QATA 3WK6A 5BN4A 4ZXPA 1V5WA 3ZBQA 3HJHA 2B9EA 3OPYA 1JR2A 1ZBQA 3ZGNA 2LNDA 3HCAA 4LJ4A 4PLFA 3W2EA 4WL0A 1S2MA 1KBQA 2ECQA 4Q3NA 3ISJA 5TPWA 1TVEA 3QELA 4KVFA 2EG5A 1P44A 1OX4B 3MVEA 5I7VA 1Z0KA 3O92A 3TXAA 4JITA 2ATEA 1BEZA 3QIAA 1V3VA 2W22A 1QTQA 4ZJYA 3D54D 1P2GA 5AK3A 4G5YA 3QTTA 3T34A 3I6ZA 3AM5A 2OLJA 3REFA 3EJ6A 1R0WA 3SNHA 5LC1A 4L0QA 3ZE9A 4NDNE 5EP3A 3U60B 3JYQA 5I48A 3COSA 2ZM5A 3H6GA 3K09A 1E7QA 4IQ0A 4AXBA 1TJ4A 4RMHA 2Q9AA 4PTLA 2NO0A 3NT4A 3CRZA 1H5NA 2WTXA 3CS3A 1DXHA 2PG3A 4DANA 2W9XA 1GFZA 1XNGA 3EXG2 2C7QA 3SHVA 3KSBC 1GXSA 4WFQA 3AR6A 4HPJB 2OYRA 1SVNA 5JG7A 5JUWA 1SOAA 3VAZA 5FV7A 4FUTA 1X80B 4J6FA 5KO2A 4KQKA 4ZVVA 4RK1A 3QV2A 1E60A 2OV1A 1ZJJA 5E2BA 1F48A 1QHIA 3F1LA 3IEUA 1J00A 3DVSX 3MGAA 1ICEA 2XYQA 2PO5A 3AHEA 3EXEA 4WCDA 5TMEA 5A06A 1WSBA 2BC9A 2M2IA 4BUCA 5F23A 3ENQA 4KPYA 1UF9A 2EF0A 3CM0A 2A30A 3AVOA 4EUEA 4RTKA 2H2DA 3U9TA 4ZCLA 4W9RA 3TX6A 2FZCA 2HRCA 2DWUA 3A1UA 3LTEA 4I36A 4M7OA 3GCXA 4PAMA 4WPGA 5CURA 5ER6A 2EYQA 3TQHA 4NDZA 2PUWA 1A9XB 3TB6A 2PAFA 4PZ0A 4YDRA 1J9ZA 2XSZD 2XUOA 3BFKA 4TL7A 3TDKA 3INTA 1EJ2A 1MT0A 4JJAA 2BCGY 2I1VB 1KEEB 4LGMA 4YRTA 4BP9A 1ISGA 3DTVA 3U39A 3AG5A 4BMXA 4ZVQA 2FGJA 4JU8A 3ZWPA 4RVCA 3WMFA 5I45A 3GLHB 1XD2B 2F64A 4BNKA 5DBFA 4D0GA 1IWOA 3AF2A 3TW8A 4EYOA 2C4NA 1HQYE 1I80A 1USGA 4Q3DA 3RWBA 2GAOA 2QP9X 5BSWA 4L9WA 1KTVA 1EK1A 3FSGA 2I9KA 1UC4B 2P3QA 5FD8A 3AOEA 5CLJA 2RB5A 4JI7B 4UNSA 4O63O 5EQFA 4EJSB 1AKMA 2IX3A 1OH6A 1UDRA 5JWRA 1QBKC 1KSFX 2OLEA 4LOHA 2VYND 2X3UA 1OQAA 4X66B 4J8PA 4AWBA 2AL7A 1O03A 3A6LA 1YS4A 5JMPA 1WEHA 3E1GA 3QLEA 1YJCA 3WHIA 4CMBA 4EB8A 4BYGA 4BX0A 2YJ6A 4UEQA 1EGMB 4ZYZA 3BMNA 2QHXA 3P0JA 4JVMA 3K9CA 5F5XA 2XBMA 2JCBA 3ONWA 4DDMA 3HUDA 4NNJA 3BJMA 2EIHA 4RUKA 3SZRA 4R0MA 1OFIA 1LJUA 2FHPA 3PF9A 4X7PA 3CEPB 1CQIB 3L6DA 1MO4A 1RYDA 2MWMA 2PX3A 3ZUGA 1Y1TA 1JFFB 1LCIA 2JI9A 3PQCA 5K0TA 3U16A 2Y3IA 5JQGB 1GL9B 3K0CC 2OHGA 5TQ2B 1Q50A 3R6GA 2CMKA 3DE3X 1Y4SA 2OZKA 2IP2A 3MS2A 3W5IA 2PZGA 4LQDA 4DLUA 3EY9A 4L5IA 5HJEA 1G64A 3EOBI 5H59A 2XA9A 4OQPA 4NYIQ 2HREA 1A72A 1W44A 2IT1A 4NQRA 3RYIA 1RHKA 3L06A 1U2PA 2O8VA 2W2NA 1PVVA 5F3DA 5C9ZA 4YCMA 1JBEA 1JDZA 1H66A 1QDEA 3M4NA 3OTIA 4AMUA 1XZGA 2OILA 1E1KA 4GX5A 5I7WA 2PU5A 4Z4GA 5AVRA 1JHZA 1K7XB 2VNAA 3EEOA 3C3KA 3I01M 4NDAA 2F9MA 1P31A 3NPAA 1R10A 3GZ4A 3ICPA 3E0QA 5CHYA 3RVBA 3FPAA 1XLTA 3WGOA 1TD9A 1TTPB 2CJXA 2EBFX 2ZSDA 3LWDA 3N2EA 2HWYA 1CTQA 1NSFA 2O1SA 3RM3A 1D07A 4HXEB 4LSGA 1OAAA 2ZTMA 5CJJA 2EL9A 3DR3A 3KP1A 2V7TA 4EW6A 3B1ZA 1KPHA 3HYTA 2H0AA 3A6ZA 3ONEA 4HTAA 4BAZA 5TDHA 3CJTA 5M34A 1JZSA 3VOTA 3W8DA 2JFXA 3ECAA 3F5SA 4HATA 1OLSB 2LRHA 2X23A 5FL3A 3C8HA 4GNRA 3KB6A 2GZ3A 5I7EA 3KDPA 2BEVB 1BN6A 3PUWA 1G4HA 5JSUA 1FCJA 3QKSB 3W6OA 2C4KA 4RL6A 4DMGA 4Q00A 3TTWA 5J47A 1GKYA 4H1VA 3ZEAA 1PD1A 1OFTA 1WJGA 4PYIA 4QDOA 2BFOA 5ARCA 2OXIA 3UQYS 4EUNA 1C4XA 4JJIA 2D1SA 2B30A 3II6X 2B8EA 1KAOA 2NO5A 5U4QA 3OKPA 1YDMA 2P8JA 3SR3A 1F0KA 1FSSA 2ZVJA 1J20A 1C1DA 3AM4A 4UZSA 3T7RA 4AS1A 1SC1A 3G23A 3G8BA 1NULA 1Q2XA 3UA3A 4F6RA 3F7OA 3ZY5A 5CDSA 2C42A 3DYIA 3FTNA 4WD3A 5G02A 4YR9A 3KKPA 1XVAA 4MUHA 3IXMA 1OU0A 1PYOA 1KO5A 1UMDB 3UAXA 3IBYA 1YZNA 1TM4E 1BXKA 2GAFA 1N6HA 1QVZA 5L3VA 2E6UX 2Z9CA 4JEUA 2V65A 4UZFA 4EGJA 4DA0A 3GGOA 2FFHA 2XT0A 3I04M 1C7RA 4A0QA 5C2JB 2HMUA 7REQB 2AEEA 4WKBA 1Q7TA 1AKQA 3QQ5A 3EYAA 1JFVA 3BF7A 4TL6A 4B8WA 1IN1A 3PTZA 1MABA 1YB2A 4UHCA 3DZFA 3HU2A 1W47A 5IAGA 5CFRA 4JI2B 2PLFA 1EUQA 5LQJA 1YBVA 3N39C 1EE1A 4Q21A 4WK2B 1DELA 3SOPA 2VT7A 4B2LA 3Q7PA 1QYIA 2ZBFA 1Y5IA 4G0OA 4HWSA 3SP1A 4RORA 1Y3HA 5M5BA 4MA5A 1X2BA 4L2IA 5T67A 2A94A 1OXXK 4F46A 4HVAA 4K9MA 5LP6F 1XCOA 2FOLA 1TGVA 2XNDD 1VG1A 3SBEA 4H6XA 3VR3A 5KNCA 3RLIA 1RT9A 4WZAA 3BRCA 4IZ6A 3ITKA 2HIAA 4OH7A 3TL2A 1USIA 2OBMA 4UEJA 2XZPA 4KO1S 4OTZA 5IKEA 1KY5A 1JHYA 1JHQA 2GCOA 2NLOA 1NUHA 2PJUA 1Y0BA 1PS8A 2H4JA 3G5LA 3HWWA 4RO0A 1NUQA 4RY9A 1L7PA 1P2UA 3CUUA 4D4KA 1Q57A 3DVQX 3RKSA 3DS8A 1EE9A 2E4WA 5E1DA 1PJ3A 4KO3S 2K5UA 2FK8A 3QW2A 3BT7A 4HYEA 1TIBA 3C6QA 1S1MA 1L4EA 1NAHA 3DO6A 1A71A 1DIAA 3FTPA 1Z37A 5HA5A 5DYYA 4F5EA 5EIOA 1UT8A 4YRBA 2WFMA 3ESZA 4X1KA 4YMUA 5H9WA 5LPNA 4J16C 1L3CA 4W5WA 4Q9AA 3RSOA 2WAYA 1DXOA 2HSGA 4HMOA 3T3GA 3HLYA 2CZCA 4JU9A 1XKXA 1GSIA 4C22A 1T0UA 4UZEA 5FI0B 2XOKA 5BUCA 3BGWA 1QAOA 3C3CA 3IQDB 4IXDA 3CUSA 1BS9A 3QE0A 4UATA 4QUHA 4UDNA 5EFZA 1PYGA 1XTVA 2Y9MB 4Q7MB 1AK2A 1KZ7B 4YA6A 3P2OA 2R751 2QJFA 1YACA 3RO7A 4BVFA 1KI6A 4BV2A 3MM4A 4JL6A 5HK8A 4CMAA 2VOEA 2A57A 1P60A 5F52A 4NFSA 2HRZA 2GN1A 1IH8A 5TT1A 3V1YA 3VJRA 2E48A 2PH1A 3DJYA 3KTFA 3T06B 5DNCA 4NCIA 3AZPA 1U8CB 4Z8YA 4FGWA 5F21A 1MKYA 1Q16A 1YSCA 3BWMA 1EUCA 5LZ7A 2XOEA 2CL6X 3VV2A 4BFUA 4QEKA 3RIMA 3DV0A 2IZ5A 1HSOA 1B6TA 1OYVA 3MT0A 2QENA 2GSDA 4TMXA 4TQUS 5FNVF 2JIQA 2QB5A 3A2MA 5HTKA 1G8GA 2ANCA 2CN1A 3SF0A 5HKKA 2FPKA 4MVJI 1RHJA 2VPXA 4FGZA 4XH9B 2IOQA 3RC2A 3GD5A 5D5HA 2Q3HA 1LI4A 4E5KA 1K9VF 1J33A 3ZIAA 3ELWA 1YRYE 2VTBB 2ECPA 1ZD3A 2QAGC 4G0QA 4XXHA 4C7OB 2Q5CA 2W2QA 2YHSA 4MPDA 1WUJS 2MYTA 3CZ5A 4MUEA 5CLGA 2IF2A 1BDBA 3IPCA 1GNLA 3IPXA 5EXDA 3A36A 4ZEMA 4OHCA 5FWAA 2FFAA 5T4EA 4JUCA 2VA8A 3SOZA 1Y3CE 3G5TA 4F3NA 1FTNA 1M2OB 5AI8A 2IW3A 2JL1A 4IG4A 3O4JA 4QO7A 5TJ9A 3KZKA 2XZTA 3U3XA 4JBIA 3ZOZA 3GR6A 2AFVA 1XX6A 2AFHB 3F74A 1JP7A 4M86A 2G17A 1KC3A 4OLFA 5B3AA 3NIFB 3WL3A 5HOQA 1E58A 5JY1A 1CR6A 1R8XA 5K3SA 1I7DA 2N1BA 2GZAA 4JMPA 4IO1A 1WSWA 3DE5X 1MC4A 4WZBB 5DXAA 2EWVA 5T5QA 1RAGA 2E6KA 3LF1A 4BMOB 4RQBA 3FPLA 3W6NA 3PS9A 5ULLA 3QPWA 3K09C 4GZ5A 2X4LA 2XODA 2QTMA 3FNEA 5DHFA 4BRWA 1FYVA 4TWAA 4J1NA 4OMCA 1BS2A 1RI5A 3R9KA 3SM3A 3UY4A 1LPNA 3WSWA 4I8DA 2FVYA 3RRMA 5ED4A 3PU6A 4QFDA 4CZ2A 5KSYA 1NJSA 3OY7A 4PYJA 2BOVA 4WDQA 5A1TA 1NKSA 3HGTA 3I62A 1ZVKA 1QU3A 3B60A 4ZI7B 1XMOB 1F1BA 5LD2B 4ZXFA 2OEPA 1OKKD 2PT9A 1G5TA 1L7MA 1RQXA 3KTOA 5ADUS 4NJMB 3MQFA 4XPIB 4X97A 3REQA 3THWA 3QFHA 1MEOA 4FCTA 3R74A 1BJTA 3F2VA 4GOKA 5F7ZA 1W4BA 2NXCA 3KU4A 4UCQA 4FYPA 3ZH9B 4GP9A 3RYCB 5MF6A 2FUG1 4X92A 1MOSA 2W8BB 4CV1A 1KVQA 3DLPX 3FPKA 5KYXB 2D7CA 5IWCA 3IDQA 5JANA 5KVCA 1WB6A 3L49A 3L02A 4EGFA 1QLWA 3ZNOA 1KIMA 3VZQA 5FOVA 2RJ3A 3HFJA 2MSKA 3E8SA 5DMXA 3QUAA 3EQ8A 1EHYA 3PICA 2WINI 1KU6A 1E6EA 3ZIUA 4G85A 3GRAA 4AQ7A 3OMXA 2FLWA 2IUEA 2R6HA 3FMVA 2ZRNA 3JWGA 4QTUB 5DZSA 3NS7A 2V7WA 4CUKA 2H2AA 1BQ4A 1GZUA 1O6FA 5LYJA 4IJQA 3LX6A 3GJYA 3HP7A 1IVNA 1QGOA 2C4VA 2OUIA 2YHIA 4NV3A 4XX0A 2A1UA 5CCXA 2ZQYA 1BFDA 3GROA 4N18A 3OM9A 3RAEC 3O38A 3DDOA 3TIXB 4PYNA 3DMHA 4RJIA 4D8VA 1BO6A 4PQFA 4XR4A 1O96B 4D3XA 4GGPA 4OUDA 4HPWA 4PYQA 4R5MA 1DAIA 3WBKA 4N5MA 2CBGA 3AOEC 1GPMA 2FR1A 2J32A 5BY2A 4TYNA 2VHCA 5FI3A 1NBWB 5LA6A 2VDJA 1RTKA 1Y98A 3AERA 2KB0A 1E9EA 3L1KA 4JR2A 1TCVA 4UMVA 2QWXA 1O94A 4W6ZA 4AMGA 4B7UA 1JN0A 1V1RB 2ZTUA 3OOYA 4MV3A 2ZYIA 4YQFA 5HF6A 1LFDB 3AHIA 2RCNA 2I65A 3HJGA 5G0UA 4FBGA 1JKFA 3OTQA 5J2UF 4XKJA 2WIBA 2X9NA 4IV8A 2Q21A 4EVRA 1G5IA 2Y1GA 3WLKX 1GTG1 1Y89A 3PR1A 4S0XA 1AUVA 1PN3A 4F9FA 1C4KA 4IIJF 4KR2A 4PCUA 2R7LA 2EBUA 3OJWA 4NPCA 1NVTA 3Q1KA 3TZKA 1M34B 2I7XA 3MBIA 2J41A 1GPJA 4U5QA 1H2BA 3KZCA 3THYA 2XAUA 5FTNA 5LR6A 1ZJ4A 2EGGA 5H7XA 1SUPA 1ZKDA 4P98A 2KHZA 4IGFA 4IJWA 5TV2A 3N0TA 3GRRA 1B73A 4C0BA 4URYR 2CVHA 1KJWA 1UKZA 3DKIA 4JBXA 4DBLE 1DBQA 1DG3A 3NWBA 3PDJA 4GXQA 3U4GA 1CBUA 3F8WA 2FQWA 2Z04A 3QEJA 3TNLA 3H99A 4AS3A 5ICFA 1QQBA 4KYIB 4YPFA 1E4VA 3AH8A 5E38A 1JE0A 1O0SA 1N0WA 1QK4A 2PIDA 2YV4A 5DWQA 4ML3A 4NJEA 3KTDA 5DF1A 2CNDA 1YB4A 2Z98A 2ZVPX 1Z6TA 1L5VA 2V97A 5IRCD 2H9IA 3D6HA 4XEHA 2F3RA 2ODPA 5JPIA 4DMFA 4LRUA 1RAHA 3VSBA 1PJQA 5JFGA 2GKSA 1CJUC 2C59A 5BUQA 2FH5B 1QHHA 2XMRA 3GRCA 1EXWA 3P2MA 4MAMA 4R1SA 2BFBB 4OHOA 2O2IA 4MMXB 1AH2A 4ZAZA 3AWDA 3JR3A 3A3YA 4KQMA 1I24A 3NUZA 5CT8A 2HT6A 5CCBA 2HSWA 1H6DA 1WP9A 1SFRA 2B5VA 2X13A 3JQAB 4IHAA 4TRJA 3BGDA 1J7KA 4MW7A 5DOVA 3PUVA 1QMPA 3D8NA 3B5JA 3JQGB 4EW1A 5EJEA 3TQIA 4WKCA 4GSLA 4X1YA 5I5EA 1HNXB 1W46A 1WBJB 2H11A 2NVBA 3OY2A 4YO8A 4NS4A 2WWFA 3DEFA 3UBTA 4JT9A 4LA4A 4MOWA 2IHVA 4V3BA 4Y1RA 5EIHA 4C3ZA 1JBKA 4PIMA 4KB5A 3ST7A 4HUJA 3DEJA 2QLFA 5BORA 4DM3A 5JZSA 4EUFA 3PHHA 1ZIDA 3MLAA 3MGKA 1D2MA 1TGYA 2O07A 3KX2A 3R9IA 1KO4A 2ZB7A 2FETA 3CPEA 3DHVA 3N5KA 3I9OA 5EZYA 2AMLA 2DFKB 1I3KA 1OYYA 1YOVB 3QG5A 4JD5A 3SKYA 4OSOA 3RV3A 2P3OA 4P32A 4TVBA 1P19A 1DOZA 2W6MA 1QH9A 4IKOA 4ITVA 2ZPTX 2VTVA 2JCYA 2QVLA 3D6UA 4ASUA 4EB6B 3IVCA 2VN8A 3BMCA 3GWGA 3ZWYA 4YRAA 5CFZA 2JEOA 3OCUA 4Q9NA 4DLVA 5SY4A 4I4LA 4JOSA 3N07A 1SBZA 4P83A 4ZVPA 3V4SA 4QYMA 1M75A 1L3BA 2X8JB 1EIWA 2V7EA 2Q46A 4GPAA 2SNIE 3UENA 1CUFA 1B8NA 1DKRA 2B1RA 1O9GA 1DT5A 1A1VA 1JEEA 2P90A 3H9UA 4ROTA 3DAYA 4GF5A 3TD9A 5K99A 4ID3A 3OX2A 4AJKA 1O4WA 4R9SA 4PNZA 1JEOA 1P4HA 1PK8A 2YV5A 4GR9A 1TEZA 1OH8A 1JIQA 1YO6A 1Z4NA 2OCKA 2QROA 3LDFA 4MI1A 2WF8A 4P08A 3MD0A 3E2PA 1S02A 1JDBC 3D2AA 4QLOA 4NEGA 1TYBE 4RVUA 3ZDYB 2DC1A 4D5GA 5KOIA 4QPJC 2J59A 4MDFA 4G0MA 1U0JA 1IEVA 3QU9A 4BNDA 4CQLB 1ISFA 1BRMA 4ND1A 3NRCA 3BF8A 4EY7A 3VR5D 1T5HX 3JALA 4ZICA 2EKZA 1JEAA 1J09A 3SFZA 1V43A 1DWUA 2AMYA 1DTWA 5AK5A 3LXUX 4TKZA 4YMWA 3CN7A 1KKLA 5G4LA 3KSAC 1QKJA 4RIEA 4WOCA 1I0IA 2P6NA 1TM1E 5J9FA 4CLOB 1VG8A 2YZGA 1U0EA 5HQ3B 1VI2A 4KQ2A 1EFVB 4B6QA 1MFZA 4B3SB 1PR0A 1AUXA 4B76A 2JI6A 3MWDA 4B7AA 1Y1SA 1CRPA 3B5EA 1GV1A 1E0SA 1Q84A 4IDEA 1PSZA 1C8BA 3CNOA 1TKAA 3F96A 5BNZA 4BUJA 2H9YA 3TTUA 3DVRX 5IHXA 3QMVA 1GAEO 4DR5B 3AEYA 3AI1A 4N1AA 3TTTA 4Z3DA 4QYTA 3NBUA 1GD1O 4MHOA 3W2GA 2IU6A 5CDGA 3QE9Y 2OM2A 4R4JA 2KM1A 1PQUA 2R1VB 2Q7XA 1W48A 1K8RA 2G7ZA 3KB1A 1IOWA 4OK6A 5A0TA 3FOCA 4GU5A 3HGMA 2CBZA 5FADA 4HQ6A 4Q9KA 4RNDB 2VR1A 4UBIA 4EZBA 2QV7A 5JQGF 3DPUA 3VTAA 4A0FA 5C8VA 2WG2A 3W2FA 1CUXA 5AUOB 1YZVA 4R2JA 4A8JB 3PGVA 2AG8A 1PZMA 4YP1A 1CVIA 1J9EA 1UK9A 3A9RA 5DVZA 2XLCA 3GARA 4DG9A 1P0FA 3OC6A 2GOYA 1NG9A 1GEGA 3R3JA 4L5CA 1M72A 2G28A 2ZRKA 2OYSA 1ZITA 1EWVA 4IBOA 1LSJA 2LE0A 2XY4A 2YHBA 2CJWA 1NVFA 2NGRA 1EP9A 4RMGA 4X84A 3ERCA 4HYTA 5T6BA 2JCGA 4PGAA 5ERYA 5C31A 4WFIA 1N2CA 3KB2A 2HKIA 4RM3A 3QEBZ 4BN5A 5C1OA 3BCRA 1L1EA 1I14A 1YQ9A 1PWHA 1EYZA 4QQRA 2WJYA 3TB4A 3ZXUB 4J0EA 4ZDJA 3JASB 4X71A 2OFOA 4XYEA 4I3HA 3U4MA 3ZC3A 4GYYA 2HA7A 1H3FA 1NSYA 4L3WA 1Y7LA 1F8UA 1OUMA 1BMDA 1OVMA 4RSRA 2C5SA 1SUDA 5DWDA 3U3MA 4BOYA 1Q0TA 2J0QA 3ZHSA 4FLFA 3EPHA 3T9EA 3UPTA 2XCIA 4DQKA 3S1SA 1MGOA 2BGUA 3DFKA 3OEHA 3NVDA 1FDTA 3MBKA 3QE2A 3ZHQA 5IT4A 3EFHA 3UJDA 2QG6A 1RWBA 1ONSA 2RONA 2H57A 2ANBA 3L84A 3NHUA 3Q3VA 1ZX1A 3P26A 4MO2A 4ZQBA 1ZDMA 1JSXA 3CLKA 3CEHA 4E07A 3KVOA 4FNMA 3FUUA 3WLNA 1C41A 3OOSA 2BGIA 1YBHA 2Z6VA 2C7OA 5ALMA 4W6QA 4GQAA 1XC7A 2FZGA 3FPFA 3RR2A 4B74A 2HAEA 2HHAA 2IE8A 2NTEA 2QLLA 1JG2A 1ZKMA 1N8NA 3D0RA 1UAGA 3LPCA 1B2LA 2OD7A 3ZZMA 2G25A 1V9SA 2F00A 2XMDA 1SEVA 4NFHA 4CFZA 4FFLA 2R1TB 2E7ZA 1AQLA 4GKKB 1WCIA 2FK7A 3M6AA 4Y2QA 1Z8FA 4ERNA 2PTHA 4Q5IA 3R0VA 3TQOA 3B38A 2WQ7A 2VQ6A 3ND7A 4PHTA 2IOFA 1ZM4A 1BZYA 1ZWLA 2NSHA 2OV6A 4WZZA 4MR9B 3KUDA 1YL5A 1KZHA 2B1JA 4I4NA 1RRPA 1P2SA 5TRTA 1PZNA 5JY6A 1XROA 3UMMA 3KAKA 4B45A 3L3BA 1R3DA 1VFNA 2H48A 5ECGC 2I4RA 2CZQA 3RC7A 3T7DA 4AJ2A 2Q41A 3WQRA 4D99A 3KR0A 1Z5NA 1I3CA 2XMSA 3PPIA 3LQRA 3PXXA 2DFDA 4FUQA 4HSEA 4Z2AA 4WERA 1PZGA 2PX6A 3O75A 5AICA 5E2IA 2AOTB 3E58A 1EFDN 1YI0A 2G09A 3OM8A 3Q7EA 3UFXB 5LXTB 3MHTA 5C5CA 3PQ8A 1AZLA 4FGJA 1XPUA 5KOJA 1DBIA 5ITVA 2ZRPA 4CCYA 2I6TA 2LR0A 1ADBA 1XALA 3CEAA 4X62B 3IALA 2J3MA 4IZHA 1DAHA 2L0XA 5KNBH 2PWPA 3V4FA 4FIZA 3MWEA 1DMSA 2V0CA 1QQ7A 2AN1A 5DI3A 1HR0B 1SRQA 1E94E 2AYYA 1MO2A 1J2YA 2PJDA 1CF2O 3GAAA 2FFQA 3BFPA 1QQ6A 3SX2A 3TFWA 3PNMA 5I5GA 2PS0A 4JI5B 4DEYA 1VZ3A 1SB8A 2JFUA 3OG9A 1ZXBA 3I5YA 2A14A 1T0PA 4WHMA 3IAAA 3IS3A 4GOJA 1VB5A 2AQIA 2HI0A 4KBYA 3PI7A 4L07A 4W5HA 3SQLA 2OG1A 4DWOA 2C7VA 4MUXA 4LGCA 3TI9A 1K0FA 4ZVMA 2J3JA 3WL8A 1O0CA 1G5RA 3QEOA 4P4SB 3IAHA 5B1SA 1SD5A 1CB7A 1Y3BE 2C2OA 2LKDA 2VP9A 2ZJAA 1KZ9A 2CD9A 3CEJA 3LBNA 1AKWA 2C5HA 2F43A 3QVOA 1V48A 5IAJA 4AJNA 1ISJA 3NB0A 3QIVA 3VGJA 4F72A 3M5PA 4M49A 2Y93A 4RIGA 5FI1B 2VPQA 2I0FA 1FVXA 3TTVA 2NZ8A 3R3ZA 4A7PA 4C0WA 2HGZA 3HNOA 5J59A 4BKRA 1WVMA 5FWNA 1FX0A 1W9HA 4A4DA 2BTOA 4FI3C 4PGMA 4ZALA 4ZA2A 2ID7A 5IH7A 3K2QA 3HYCA 2LXNA 1GTSA 1H1TA 3H8SA 1GUAA 1O94C 2H63A 5EHQA 5KKCA 1ISPA 5E3JA 2X4IA 3RK4A 1I7LA 2IDMA 4M98A 3ORSA 3WLPA 4MS3A 2DU8A 5L3QA 1FU4A 1C7JA 1W93A 4BB5A 1U9YA 5I7FA 3WY9A 5HIKA 5JTTA 3GCDA 1RBZA 2OLKA 2QG4A 1C0LA 4Z4IA 2G5PA 1SO8A 2PPLA 1G6OA 2RHLA 2OBBA 2XVAA 5F1OA 3VKUA 1CUCA 2X1LA 3X44A 4E3WA 3W5DA 4EVQA 2KQUA 1OIVA 4E1AA 4ER3A 1I1QB 1CIJA 1UM9B 1FYDA 3KWFA 4MICA 4M0LA 2H9AA 4JFRA 4C4TA 5FTKA 3U56A 4Q93A 4MQ6A 4PC1A 3IKVA 3MXTA 4C14A 1NMSA 4EPRA 1SVSA 4MI6A 4QGBA 1GR1A 3SI7A 1VKHA 2C54A 2IPMA 3PR2B 3QENA 4GQBA 4PX2A 4ZREA 2P9FA 2AN9A 2B4TO 2RI6A 5J63A 3DV9A 1YIOA 2DFVA 2YVKA 3UV6A 3S40A 4Y7DA 4P5PA 4K9RA 5ALNA 2P6PA 2P2DA 3EXHB 4HZUA 1GG2A 1GUZA 4CCWA 2MINB 2QG9A 2ORWA 4A73A 3WYBA 1A8PA 4DIOA 2XF2A 4W99A 5FL7A 1SD1A 1TCCA 4TV9A 3ETNA 5LBIA 4AW9A 3ZU6A 4U3JB 4OJKA 3S5JA 1SQ5A 4KFSA 3TS1A 1K88A 1EKXA 1ZGBA 3ZTWA 4C7MA 4DNQA 4E5DA 4ECEA 3LT5A 5AK0A 5CA1A 1T8PA 4DR7B 1E3LA 1NVXQ 2G1AA 2ZAOA 2E4UA 3P27A 4Z4FA 4EF5A 1P29A 4NZ9A 1VMEA 5A4MS 5B58T 3FR7A 3K53A 4DR2B 1Q11A 1KEWA 1XZJA 4D4HA 3CZCA 4UU7A 3X2SA 1XRSB 5BXQC 5K8TA 5DP1A 2FPMA 3EVCA 4RD1A 4DR1B 1PGJA 1A9OA 3NUGA 3ZJ5A 5JRZA 2J9FA 1IMOA 1RYMA 1VPLA 1BXZA 4RV9A 4WN9A 2PPVA 1MEEA 3REGA 1U98A 2RI1A 2N0SA 1O97C 3AY6A 3HL4A 2ZM6B 4FGUA 4MQLA 3OAAD 1CR1A 4RANA 2XUQA 3LDUA 4HADA 2G83A 4OI1A 1GLGA 2FPUA 2ILTA 1ZHFA 4UJ5A 2HXYA 1U8EA 4ZQCB 3PEFA 4H60A 1E0DA 3WJ2A 1RXEA 4OM7A 3WKAA 3F4LA 3IKMB 3N76A 3JAWA 2BGMA 2P4EA 4G84A 3DBRA 2KSQA 1QPBA 2Q62A 1U9ZA 4MCAA 2H17A 3N87A 4TRMA 4WKOA 1GAWA 4ZI7F 1DIBA 2HWWA 2NZ2A 3E9MA 4MUKA 2V6GA 4B48A 3BBLA 3BK2A 1RYEA 1UOEA 1VC2A 1RYZA 2G88A 1Q1QA 3DKKA 4X24A 1D7AA 4WBNA 5LDGA 3WWEA 3GDHA 3L7KA 3HJFA 3GLSA 1L3IA 4NAHA 2ID4A 2JHPA 3MJHA 3PQDA 1X15A 1C30A 1XTKA 1RWWA 2FWRA 3KEMA 3SSOA 1CPYA 4WNIA 3H8JA 4Q6BA 5TLSA 4FOLA 4P2GA 3GFVA 1LBQA 5KVQA 1ZD4A 3ZZNA 2FA9A 2H1FA 5FLEX 4P38A 4HNAA 5K6RA 3R3SA 3B3GA 2GN9A 1SB9A 1CXZA 2QSZA 3TIGA 3VPFA 5I3ZA 1THMA 3IV7A 1G6Q1 5AKJA 2Q8PA 4OHBA 5JBNA 3NIBA 3CNEA 1KBOA 4MVXA 3EOAI 4H7KA 2W6JA 4LJAA 4J3NA 3RWOA 4ZYXA 5GP1A 3TG8A 5AI6A 5M7EA 3TPFA 2E2WA 3SJCA 3K15A 2JGFA 1U6KA 1E2QA 3FAZA 3NHMA 1VMIA 3HWX1 4LV8B 1NLUA 3GRVA 5IJ9B 4E5NA 4QGSA 3OQJA 1KO1A 2OP0A 3S2FA 1GRVA 3UWMA 4ILKA 2KWIA 3NWJA 1NMQA 4MUJA 2AEJA 3FFXA 1A4RA 1GTJ1 4TRRA 3SZGA 1J2TA 1CZUA 5I7OA 3HDVA 3NV7A 1OJ7A 5KHAA 5EMHA 4HYYA 4YJFB 3TKLA 5JVDB 4QRHA 2GM3A 3OQIB 1DLIA 4AJIA 3V4VB 3O94A 1TLLA 2QAIA 4BY9E 1Y6JA 4TLMB 2PKYX 4H7DA 1COZA 5ALOA 1RM0A 1X9GA 4QDUA 4KO4S 1WVIA 5D3KA 4AY4A 4BQIA 2OC9A 4U8GA 3RVQA 4CIAA 4BFTA 1CV2A 2Y0CA 5HFAA 2ZYAA 4BPBA 2WFZA 1P74A 5KWSA 4E4RA 2YQZA 2GZMA 2VDVE 3EAQA 3SM9A 4WZAE 3GT4A 1HTTA 1KK1A 5KSZA 3O4RA 4R6XA 2PX8A 2DP4E 2C2BA 1SC6A 5FPKA 1EHCA 2IYLD 5FWXA 4NG4A 1U7PA 4HEA6 1AK9A 2Z8YA 2MCFA 2ODEA 3L1HA 1XAGA 1LSSA 4TWZA 4A2PA 4QOHA 4CJXA 3MJSA 2QSJA 2FDRA 1NT2A 1NR7A 4QECA 3GRZA 2XQIA 3FLBA 4GE3A 3D3JA 2XV1A 1KU0A 3NHWA 2W98A 1NLZA 3L8DA 4LY0A 3IHWA 4L27A 4OAOA 1FXSA 1W76A 4G1FA 4DMLA 1K6EA 2EZ9A 2G04A 1JV2B 3VFDA 5JSHA 1M7GA 2XIJA 5HTOA 1Z0AA 1DJQA 3BK7A 4FIDA 4BMVA 1Y3AA 2DUNA 4DV6B 2OK7A 2XUZA 4K9KA 3A4TA 3R5XA 3W34A 3NC4A 2YXDA 1CUUA 4M53A 4DCGA 3P9CA 3VZCA 4B71A 1DJMA 1BG6A 1N4DA 2J9RA 3CE6A 3GUHA 4DMRA 2CJFA 4J76A 5IH3A 4CTNA 5JRJA 4OQMA 2ZR7A 5FPHA 3FNIA 4PLCA 2FY8A 3DZBA 5ALHA 4XSVA 1GA1A 4PLGA 2BFFB 5EEHA 1JR3D 4UU1A 2D1FA 4HDCA 5H02A 1AQUA 1RKBA 5FJJA 3B8HA 3LC2O 4OVKA 4TN5A 5F2KA 1H8EA 5KTYA 1J1UA 2W2VA 4UE3S 4Q3OA 1XJQA 4RPGA 3I64A 5GVSA 1EESA 4Y1EA 2FSGA 2A9QA 4MHSA 3BL6A 1NZFA 1EWTA 4NV0A 2AK3A 5GONF 3RUHA 4D9MA 2JA2A 3VNSA 2DCUA 3Q12A 5EIBD 5DDIP 1M74A 4CLRA 2PMWB 1RR6A 1VYHA 4HNQA 2C4MA 1LY1A 5BN5A 3JD1A 1CD5A 1MB3A 1PX2A 4Q15A 1ACMA 2GN8A 1YBAA 4NYJQ 4DT1B 1T10A 5C8YB 3HLKA 3FLAA 3O21A 3HR4A 4OJTA 4C43A 4H31A 3LX8A 1E3IA 3ZLVA 3QNWA 4LVOA 3CW2A 1XKQA 3SZMA 1S2IA 1P5JA 3PHGA 5HQJA 2GVDC 3W9UA 1OA0A 3USCS 1TCAA 4FM9A 1SC4A 8ABPA 2IUYA 5LDHA 3IAUA 4TWRA 4E22A 3QEMB 2WU4A 2YNMA 1QYXA 4GMXA 4ZT3A 5DHSA 1PR6A 2OC4A 1PT7A 1WABA 1WM1A 3TOVA 3IO3A 3FVWA 1N0HA 1CDDA 1TYEB 2MSWA 4IQFA 4B3MB 1IONA 3I2KA 4QWMA 4C0AC 1MOZA 4O2RA 4B33A 3C3JA 1JQKA 2G1JA 2BFNA 2BUAA 3DWIA 3G2PA 1D5CA 3IQEA 3KL4A 2BH2A 3VH2A 3QW4B 3GP8A 1WMAA 3OJLA 1I6LA 2VJAA 3OEWA 3TOXA 4N5DA 1NUUA 3PDCA 4I7EA 3H17A 1QJCA 4RA6A 4XGIA 4X45A 2CLIB 1P2FA 3OE4A 2CXSA 4FZ5A 1SHLA 2DFLA 2YIVX 2JDID 4ZVUA 1XLWA 3KQKA 3FCEA 3V1MA 1Q0UA 2DH6A 1ZN7A 1RI3A 4DIKA 1EVQA 4CM7A 5KYYB 5LM3A 3VZDA 2V3CC 1I6MA 1SZJG 1XZDA 4BNNA 1E9BA 4MEBA 1GPDG 1MAUA 2VWPA 1PJ2A 2WIGA 1LDMA 3IPYA 4Y9UA 1CW2B 1RRVA 4CT4B 4F45A 5TARA 4B4WA 1XU4A 2B83A 5A3VA 4JGIA 5E7IA 5JDCA 1B16A 1WUHS 4I4IA 4FC7A 4MWBA 2GF9A 2D74A 2Q9CA 3CZAA 3JQ9C 3C8UA 1WR8A 4BQFA 2PHZA 4DUZB 1GR0A 5KMGA 4WWHA 1TI7A 4LYFA 4IDPA 3KD3A 2WT9A 3KLMX 4IRUB 4TV8A 5JS2A 1ZR4A 4MVYA 3G0HA 2BAGA 1XNHA 2WWIA 3VNRA 3B78A 2CFSA 1RZVA 4CPDA 3P96A 3TW0A 2A0KA 4V0LA 4W63A 2H5IA 5FTLA 3A32A 1RYBA 3B7PA 3BVPA 1DC8A 1L5HB 3X2FA 5BQXA 3PJRA 4P0PB 3W77A 5B6JA 2PS9A 1KQFA 4F5DA 4JUBA 5ER9A 4YONB 2WT8A 2W58A 1W4CA 2CB9A 3TXXA 3T3DA 1ZC4A 4WNAB 3F9CA 2FMKA 1AKYA 1OTHA 5EHNA 3QHAA 4Y2RA 4ACAA 3GT7A 4RZIA 1GUYA 2CHEA 1NDHA 1P4RA 2A86A 3R8CA 1UZMA 3BE6A 2WJAA 3HQ4O 4HTFA 2P1RA 5B4TA 1G98A 2AE2A 1G55A 2FKNA 1Y33E 3I8SA 1KKUA 3ZGXA 4MYTA 3BGSA 3QU4A 2WF6A 3LUAA 4HWTA 1YRHA 4M0KA 2Q4BA 2FP3A 1BQEA 3GJZA 1RXVA 4NAVA 2BE7A 4IXNA 3LHSA 3K0FA 5EJ8A 2I3BA 5I9NA 4CG0A 4MKHA 1ZGZA 1AF7A 1RJDA 1R6VA 5DBEX 1DWQA 1P4AA 2BEWA 3P9SA 1P4GA 1VCOA 3HB9A 3IERA 3MJEA 1AMNA 2OESA 1V37A 1T3LA 3D9QX 4Q3KA 2V7XA 2ZWOA 4NE2A 4R9RA 1S7GA 2YV1A 3E3LA 3FUWA 3DBVO 4ED9A 5K0EA 4EYKA 4LNHA 4RKWA 1QFXA 4I81A 3U1VA 4JEMA 4KXYA 4NKRA 4YAKA 2PX5A 2FXIA 1RC0A 4GG1A 1LTQA 1DO8A 2WIAA 2VTEA 3LL4A 1U3UA 4DBVO 4CM8A 2YQ5A 4AZ3A 3Q9NA 1B14A 3E18A 1V2GA 2H29A 1ZSNA 4NYMR 3TLKA 5AQ1A 4PINA 2UXDB 1DHRA 3AESB 4QVKA 2FW0A 3P7MA 5BVHA 4KPUB 3KHTA 3F73A 4BNFA 1YA8A 4U2CA 1NXTA 3B1VA 5BN4B 4N47A 1MRNA 3D8BA 4FT4A 3E7PA 2H7VA 1P0PA 2YJ3A 4KO8A 4JLNA 5KINB 4PSKA 3U4DA 1FTGA 1HETA 2BGNA 2FPPB 2DR0A 2IXFA 1JHMA 3QELB 3B1JA 5TPWB 4EKDA 1FMLA 3OA0A 1MQSA 3PD7A 2QX6A 2Z4SA 4FCCA 4PN3A 1WUIS 4KSBA 3V32A 3C3AA 1P9RA 4MCIA 4ZHQF 5BYAA 2ROQA 3HJNA 2O8FA 4RULA 4HSGA 4Z8XA 3NDRA 3O1HB 1KTIA 3PKIA 1ND6A 1FSPA 1L8LA 2AZTA 1T8YA 3LW7A 1PR1A 2W70A 2DR3A 2Q6VA 4GSYA 1QPZA 4F4FA 4IKEA 2A92A 3BZWA 4R2KA 4UQPA 1N3IA 2EEPA 1E5LA 3EWAA 1XEWY 4W8HA 2CWWA 4AJPA 2XE7A 1NPYA 3IJRA 3P4XA 3SNKA 2IYVA 2ZE8A 2GSWA 1DKMA 2PIAA 4JI1B 1GXSB 1QSGA 4YROA 1Y8QA 3S1AA 5IEBA 2JFZA 4XWWA 4DCOA 1QGUA 3HBJA 5JD6A 4D4JA 2D3TA 3AFNA 3CNNA 1UJMA 3AG6A 3EQ9A 3ZGOA 1S4QA 2WPDD 1MFPA 3IB6A 5A2QA 2Z8YM 4C4ZA 1ZEMA 3EXEB 1SIWA 2QX9A 3UMYA 2NIPA 3U4QB 3TCKA 2COEA 1EQUA 3PXCX 4EUSA 1PG2A 3B12A 3TVYA 2E4YA 1NVGA 2W6PA 3PQ7A 1UIMA 5LXTF 5BWMA 4QA9A 1PYDA 1XDSA 2JK1A 2XB9A 2ZXFA 4X8OA 3ROFA 1W52X 2L2QA 3A11A 4R3NA 3HBLA 4K26A 4F3RA 4FE4A 1C1XA 3DTVB 2HMYB 3PC3A 2EW2A 1J2RA 3K5PA 2AFIE 2XD9A 5GOTA 5C5DA 3NEAA 4LXUA 5KIAA 1CZOA 2WU0A 1LTHR 3CRMA 2ZSIA 3HS3A 4LRXA 3W5HA 2AEMA 1H5UA 3IAS1 1RQ7A 3ODPA 5FFNA 2VKTA 3HXKA 4OFBA 2EERA 3EVGA 3LY5A 3MJCA 3Q7RA 3P45A 1LLDA 3TW8B 5I6DA 1L5SA 4OKNA 1MX9A 2PUVA 3V9AA 1G2QA 1VIYA 3O9VA 4MVJA 4QQKA 3D1LA 3A28A 1D6SA 3CCCA 4LCEA 3UPDA 3C4VA 2CK3A 3AVWA 3DT8A 1J2UA 4JENA 5BW6B 2X1MA 1PT6A 1ZA2A 2Z6QA 3KSDO 2C9OA 1RMYA 3BJEA 3DLTA 1YCDA 3TSCA 1I2BA 4DR6B 1JHDA 3QTBA 1AMUA 2Y1FA 3OOEA 3SJZA 1WY5A 1UMBB 2COUA 3BMNB 3LLCA 3RS4A 2OBYA 2M1XA 2F8SA 3DNMA 3C7DB 3PQEA 4BNXA 5A4JA 3A1TA 1W1IA 3N70A 3X2EA 4G8DA 1RPNA 4LOKA 1U3WA 3I0MA 4PSDA 1MXHA 4P4NA 4RH3A 5K3CA 1NIPA 1JJBA 5FUXA 1ZAKA 2PBLA 1R9MA 2A33A 2ZETA 3IQGX 3PXBA 4EDHA 1QUEA 1QYWA 3VZBA 5DGTA 5LMZA 4XQCA 4AY3A 1EAMA 4HNTA 1FE8A 3EIWA 2P1DA 3VPXA 1A8QA 5DCYA 2VH5R 1FJ2A 1H85A 5B57C 5GIPE 3J81A 2F3SA 3SSAA 5BNWA 2HPZA 5DGDA 4RTPA 2QXYA 3RYIB 3ZY3A 3W3AD 5IN4A 2NP7A 2ZJBA 3D3QA 1F14A 1M1YA 1RM4A 1YZYA 4V38A 3WZLA 1Z0SA 2IHBA 3GFTA 4QPDA 4OQZA 1P3Y1 1V26A 3F9RA 1WW8A 1YIDA 5B3LA 4LDZA 2OO5C 3KT6A 2DZDA 1URPA 1DPFA 2CVPA 3C5HA 2D4AA 4X91A 1RXIA 4RTOA 1P0IA 4LZOA 1XHLA 4F7DA 1ZOPA 4A1FA 1GCAA 2CF5A 4YMTA 4XD2A 4FT2A 1UJNA 1E18A 3DHNA 3G2NA 4C6SA 6ADHA 3AEUA 3GPBA 3HZOA 4GOXA 3X1KA 5KU7A 1DCKA 2VNKA 4XGRA 4RD4A 2R8RA 5K3OA 1GRQA 1PL7A 2I3AA 3D4NA 3HXTA 3LCJA 1NQXA 3BICA 3COVA 4G1UC 1C3LA 1W8IA 1OXKB 4Z9YA 3DOUA 1CYEA 3ANYB 1CHDA 3EW7A 3LFUA 4EFNA 5ES4B 1R5BA 3VR6D 3V34A 1Z35A 3RJ5A 4QRDA 4CIXA 1IE3A 4RKRA 5ITWA 4BCBA 1DO0A 2X0JA 1E4OA 4RDCA 4UFOA 4PG4A 3UC9A 3V80A 4BWGA 1LKZA 1XVTA 1WXIA 4E33A 4Z3KA 5DTRA 3I2YX 2XNKA 1OD6A 2UV8A 1C1DB 3EBLA 1X92A 3R5HA 4F6RB 5C3MA 1A96A 1EVLA 5CLFA 3GDWA 2G0AA 2QPAA 4HMPA 4HB0A 4IDBA 4Z7OB 1NFRA 5E6UA 1YVEI 2DWOA 4JBYA 5TIIA 2XSZA 4PAWA 2P3SA 4JB8A 1ARZA 2UYQA 4QGFA 4C01A 2YFYA 4RABA 2DFNA 1VGQA 2ZSKA 4R0NA 1REQA 3H2HA 1G21E 1SQ6A 3T3MB 3R5KA 1T2CA 5EWJA 2ZUWA 4K6HA 3FF4A 3M1LA 1CFZA 1N2CE 3BE8A 3ZVMA 4JLBA 1KYXA 2K2QB 4MITA 4EUKA 4GC9A 1MABB 4IHKA 2R8OA 1XTUA 1DDOA 1FVFA 2WZBA 3BSSA 3HV0A 3QWHA 5K0LA 2I22A 2NX2A 1TLFA 4OHXA 4KCGA 4OF4A 2X0FA 1Z33A 3R7SA 1ZUHA 5ALLA 5JJKA 2AWNA 4S05A 3KKOA 3IIKA 1ONPA 3FSJX 5CU7A 5IXSA 3PHIA 3IVRA 1H2EA 4LDAA 4Q1CA 4L2IB 4R9VA 5AP9A 2A3NA 3D7KA 1E3WB 5CVJA 2VYNA 1F8YA 4AP9A 2JEYA 3NALA 2DGDA 3AY7A 3WTCA 2QGFA 3CZ4A 2A8YA 3FH0A 4WZAB 5K51A 4ESVA 3IRVA 1JDBB 4DIFA 1SVWA 4QKQA 1A2KC 3BDIA 3QBJA 1GLVA 1MNQA 1X13A 4G4JA 3GFSA 2GCOB 4ALIA 2QYHA 3CUYA 3GLVA 4I5FA 2ZSEA 1TC2A 4QDJA 2Z08A 3TM4A 1FZQA 1GAXA 3P4YA 3O95A 1YK0A 3R7DA 2Z5FA 1CF4A 1SOUA 1OH5A 1FSZA 1V5FA 1DO2A 2QW0X 5L3RA 1WPXA 2OZLA 5JDCC 4A3SA 3A3PA 2OOKA 3D0OA 3G0OA 3Q5DA 4HLUA 2HNAA 3GCWA 1ZEJA 1NJ6A 3EFOA 4EABA 1N5RA 1VKZA 1T1EA 2QVBA 3DP9A 4X1KB 5K8LA 1SVMA 2XWJI 5EEGA 4BX3A 1JQ5A 3CLRC 1B23P 1K5DA 3NM6B 4L5JA 2EFHB 1EP2B 3BIXA 3JATA 4YY3B 2O8DB 4KTVE 1QCCA 2KLHA 4HDMA 4OQFA 1T8UA 5KYGA 3VYVA 4IDGA 2AKEA 3KPUA 4FLMA 3RF7A 4MSUA 2YUIA 2H92A 1IBLB 1G4UR 4MPPA 2X0NA 4MMYB 3KLBA 1FJGB 2RGWA 4G23A 3EBPA 3W04A 3TZLA 2IS1A 1KI6B 1SWWA 3P4UA 3ICVA 3TEMA 5AW2A 3WXMA 5MHTA 2QMZA 3M6LA 3SFVA 3GUZA 1AO3A 1JA1A 1TCBA 1DKPA 1BVHA 1N8TA 1CRWG 3FA2A 4GMFA 1YJBA 5CAEA 3T0FA 4BNZA 3O1LA 2G77B 2QVYX 3FGZA 1EUCB 4D81A 4DTIA 1FDIA 4UCWA 2RJNA 1P6XA 5SZHB 3AKYA 1KI8A 3DV0B 3SMVA 5I7UA 3MT8A 5FPQA 3EWNA 4R1LA 3FROA 4TQAA 1YJ8A 5C0OE 4Y6OA 1F6WA 4HS4A 2JGEA 4WZ6A 4Y2XA 2FSSA 2ZU6A 3N58A 5FOSA 4DM7A 1VL2A 1XHFA 2FMUA 2WVGA 5T57A 4NH4A 1OXMA 3F47A 3RABA 1R3UA 3ZI0A 4BKQA 4BEVA 5LQKA 4Q1VA 2NUBA 2B98A 1ORHA 3M1YA 3QTLA 2RGRA 2IYEA 1XNJA 3QBVA 3FPGA 2FB9A 5B1IA 1GZ4A 1YE5A 2I6QA 3E7XA 5LNK6 4QUBA 1NVKA 5BMOA 1BOOA 1F6DA 2I6XA 4F6LA 5A3JA 5AKYA 1G5QA 3K0AB 3HVKA 3FB1A 4REOA 1EI9A 4MVJM 3A3OA 4JP2A 1XWIA 2GDJA 3KLPX 2F2TA 2P30A 4JI4B 1E7MA 4EKEA 2PRJA 2PTGA 4YC7A 4EBFA 3W5JA 1H5QA 1EU1A 3FXAA 2GVNA 5JPCA 1ECBA 3L8GA 3UTCA 3MWLA 3RQIA 3ZD8A 1MHTA 2P65A 3DAPA 3PPYA 4WAUA 3AK4A 5BSHA 3H9GA 2UVDA 5AI0A 4CEIB 1DAEA 5CVVA 1CUGA 2P9YA 1FFXA 5IFKA 2IBMA 3EW9A 5HUHA 4EF6A 3WWYA 3DXZA 4JR0A 1R6DA 2EFEB 2PEYA 4L50A 5EP2A 2XUKA 3E05A 4DCTA 2XNDA 4ZMSA 4DDWA 5C8YF 1ZN9A 3AR3A 3LUHA 2QN2A 1ULAA 2SICE 3TBKA 3WHPA 5KTRA 3AGQA 2BDTA 4KFRA 4DIMA 3DG9A 5HIJA 4DCJA 1LC3A 3R3HA 4P54A 4F1WA 2PGNA 5EE3A 5TF4A 2ZKIA 1DC3A 1ZRHA 3R41A 5HFNA 3GNSA 1JB9A 3GYBA 1A88A 3DWGA 4RETA 3SDBA 4C1NA 4FOOA 3REQB 1PG5A 1H69A 3THWB 4ID9A 4BV9A 5JATA 2QZPA 2JLZA 3MRVA 3AKDA 3I9V1 1TMOA 4UUAA 4RVFA 4R8LA 1N0IA 4D74A 4ER7A 3LE8A 8GPBA 3GIDA 4EPYA 4WJZA 3L4SO 1KK2A 1GYRA 1ZI9A 3GVCA 3QI2A 2O5VA 3MT7A 4CVNA 1E77A 3IESA 4ARIA 3EIFA 2QRPA 3MUOA 4E5MA 1EK0A 4BNMA 1XJ0A 2XDAA 2PJZA 3BBPA 3WAGA 2QJRA 1BW9A 4NBRA 3KZNA 3A06A 1K7SN 4EA6A 4IINA 3IE0A 1SVLA 3DGEC 3SK0A 1L6RA 2EEZA 2SCUB 3OX4A 4F04A 3TUZC 3L6UA 4GM4A 2XT6A 3G2MA 3H7AA 3AJ9A 2LDXA 4KQJA 4TMKA 3U13A 4EKNB 3ZYZA 1PWZA 1G6HA 2IPNA 3BGOS 4O2BA 3S2UA 2WMYA 3IE2A 5LYJB 1DBPA 1I0ZA 1R5OA 3A31A 4I1VA 4LYHA 1ETHA 1Q6YA 1KDZA 2YHIB 5ARDA 4ZKDA 2VVTA 2E85A 2A1UB 3ANSA 3B3FA 1HDGO 4L22A 4G1CA 1I8TA 4XX0B 5JAIA 4IH4A 2OGSA 3ZD7A 4JT8A 1L5OA 4PW0A 4TXMA 3ZVNA 1NSTA 4OUDB 4IGIA 2AXNA 1NUAA 1J99A 3BK1A 4U39A 4YWHA 3Q3CA 1CY4A 2QRHA 1FBTA 2PGJA 1YA4A 5EPEA 3ZH2A 2JLRA 2PMKA 2CSXA 1Z45A 2OCGA 1UPFA 2H52A 4HH4A 3RYFA 1D2GA 1NXVA 1UBGA 3HBAA 5LA6B 5LZ8A 1ZN2A 3NI2A 4E5PA 2G6TA 2EFDB 4B2PA 3CF4A 3JZMA 5AVWA 4D9FA 3NBQA 3PUYA 3O73A 1IY1A 1Z3CA 5IFLA 3RVPA 4ILEA 3N7UA 4AQYB 1N9ZA 1XELA 3GAZA 4FFSA 4YT8A 1SBTA 1X1BA 1TT5A 1VKNA 1MF7A 3PFIA 4KFUA 4V2IA 3H1GA 5GPBA 4IH9A 4I55A 4AKTA 4F84A 4YUXA 5KHLB 1QP0A 2BL4A 3DE2X 4YB8A 4K03A 2A9PA 4GSKA 4FEAA 2ZTSA 1YAJA 1B6RA 4X85A 2PH7A 1LBEA 4JUFA 1OYWA 2QM3A 5JW6A 2BM9A 5A4DA 4U7WA 1F20A 4MIKA 2OPBA 3OJEA 2PWYA 3RWMB 4DEXA 2P5UA 1RWVA 1FNCA 5K4AA 3KKZA 2JVIA 1IIRA 1YR6A 2GXSA 3LS2A 1O89A 4L8FA 4ANFA 2B1IA 2IUFA 4KLZA 4Z2YA 4CRWB 1PJTA 4JLWA 1PQWA 1CLUA 3ETHA 1Q6ZA 1R74A 3D6VA 3C70A 1CZLA 4N5LA 3VH4A 1J06A 5IJ0A 4WESA 4MEAA 1AE1A 4NJEB 1R0CA 1MAVA 3FPCA 5GAJA 3ESDA 2I8LA 3IX7A 4MQBA 1IXYA 3C48A 1YQDA 5KVSA 5EXEA 4P4UA 1C8KA 1I6WA 4XB6B 1GU7A 1YZUA 4IX1A 1P39A 3L7DA 3CCFA 3KFVA 4BB6A 3GRYA 4HEHA 2C2ZA 2RKOA 1OFUX 1OKKA 5I7SA 1JUDA 4YRFA 4WLOA 4AF6A 3C4JA 3FNRA 4G65A 1MOQA 3EGOA 5FP0A 3PXAA 1G20E 2AFIB 2I7DA 1XMQB 2NTVA 1IBMB 1B00A 1XPJA 2YXPX 4QOSA 3ZJTA 3V8BA 4XM1A 3MFYA 2XBUA 4J49A 1NBIA 4FMBB 4KV9A 1OI3A 2D5IA 1ODTC 2WUWE 4ABYA 3I9FA 1KHHA 2CVFA 3TPZA 2R5NA 1Y63A 2JFOA 3HMQA 4JYMA 1DRVA 1GNRA 1A5SB 4UASA 4C2AA 1ECLA 2FRDA 5JLAA 2D62A 3D3WB 4PYLA 1VECA 5FUVA 1SHKA 5FA5A 1QH8B 1L5WA 3VR2D 2QP3A 2O8BA 5BQPA 1F1JA 2GI4A 1ZS9A 3LH5A 2YXNA 4GM1A 1UQUA 1NFQA 1YI8A 2JARA 4PN7A 1GCOA 4HAUA 5JDIA 3AEKA 1TYDE 4PG6A 1XQ6A 3LHKA 3SBDA 2GD0A 2CHVA 2HWXA 3G82C 1V47A 1FQWA 3FUVA 2A9OA 2IZ1A 3EIHA 3CZPA 1SU4A 2B9VA 3MQ4A 4JLPA 1Y8RA 4QREA 3FDZB 3RSFA 5TMBA 4JWKA 4PYKA 1ZSYA 2WWVD 3RW9A 3BGIA 4YX9A 3VR4D 5CEEA 1H0HA 4K46A 3CRW1 2X9VA 3IMEA 1NE2A 4FMDF 4XR9A 1HMPA 4RTQA 1KARA 1NVVR 1X8JA 3NHAA 3B36A 4C4AA 4HRAA 1C8LA 1QTIA 1XTBA 4UXIA 2IXDA 4L51A 5JXIA 3DLBA 1EFAA 1U7WA 3WE7A 4CF3A 5DYWA 5CCEA 4QO8A 4RIHA 1T6YA 4AQDA 4F60A 4LXIA 2PRSA 3DZDA 1C50A 5I9LA 1BX0A 4X54A 4BNDB 2X19A 3E3AA 4Z1MD 2G1UA 1KMQA 3H2SA 3P1JA 3PFFA 4I4TA 1SKYE 3JALB 1KQPA 1DB3A 2YOFA 3HRHA 3PA6A 4KGXA 4OG2A 4PLVA 3L8EA 4A23A 2GBLA 2VZLA 1DTWB 4NR0A 3HPRA 3T4XA 1RQPA 2G80A 4GLOA 3FCAA 3OJCA 4U9UA 3C16C 4W4TA 2R85A 5LZ4A 2NACA 4X6UA 3H2ZA 4FN4A 4H7HA 3WDSA 1U0TA 4HLUC 4BGIA 4UVIA 1ILWA 4FSDA 2IEGA 5H3HA 4DTCA 2W48A 4B73A 3FTFA 3MWDB 1G8SA 2QSYA 1U63A 4RKEA 5JEDA 2D5CA 1WAMA 4CLHA 5G3YA 1B8VA 3P9RA 3Q0IA 2P2SA 2XNJA 2QN1A 1FXWA 3P32A 3DQPA 5LMNB 2G71A 2BR5A 3K8ZA 2GCNA 5GJVC 3WLQA 4ARZA 3A2KA 2YMLA 1FNNA 1EXDA 2JLVA 2ZIZA 3IVGA 1TO1E 3DYVA 4PAOA 2HEGA 4JASB 2C9BA 5CJPA 1ZGCA 2BLNA 3FZEA 1XYVA 1XWWA 3HRKA 1IBRA 4Q9JA 5KBYA 3NYQA 3QG1A 4FYIA 3HXPA 4FYMA 1GKLA 3COYA 4NBSA 3WRYC 5JCZA 3WIEA 2YY5A 3WLOA 3ZCXA 1KZ6A 1PGPA 4D3DA 2ZCJA 3H5LA 3IP8A 2ECFA 2ZB8A 2YMQA 5DGHA 3JWPA 3F0TA 3V97A 3KJFA 1BFKA 4QBFA 3ZQKA 4RLHA 4HVTA 3QUCA 4JJEA 2VP5A 2HU7A 4MINA 3HG7A 4P1ZA 2EKLA 3RCBA 4A6PA 4CODB 2BJVA 2P2YA 4MV8A 2Y99A 1N2HA 4JB2A 1LF5A 4URFA 4ZCTA 5BWCA 1YMVA 4FGLA 5CBKA 2JIZD 3CBGA 1GPAA 1KJ9A 4IZOA 1UZUA 1N2CB 1DPGA 4K2AA 5IARA 4AN1A 3NOVA 3EDMA 2NV2B 1G3IA 3GEMA 3OICA 3L1VA 3W9BA 1JDUA 3F4BA 1GTVA 1L9KA 2P91A 3FMOB 4Q3EA 4TKLA 2HRBA 2RAFA 5JS7A 3AWIA 3UG7A 1L7QA 3C2QA 1WOMA 2C88A 3F1KA 4PQRA 2AQ8A 3A9UA 1M8FA 1MO6A 1TQ2A 1T8RA 3PK0A 4JKYA 4XM2A 5TC4A 3QXGA 2QN7A 3TGWA 2B5OA 3I4LA 5AVVA 1QVVA 3WB2A 4MRMB 3VJLA 4IP0A 1USVA 1JDJA 1YQUA 3BB4A 4IJMA 2YIDA 3C5VA 3CG4A 4P58A 4AMBA 1A8HA 1KFKB 1Q19A 3LT1A 4M60A 2HQSA 1G8YA 5EQJB 2QTHA 1V8OA 3CW9A 3LLUA 2Q2QA 3MPUA 4B81A 8LDHA 5HFJA 1YWGO 4ZRDA 3RAPR 2IZOA 2IITA 5FBWB 2A9FA 4CMGA 1XPRA 1AO0A 1R6BX 4PNPA 4DR4B 4Q1EA 2P9JA 1WNFA 4LY6A 5LP1A 2CLFB 1WVGA 3ZK8A 3PVSA 2BMDA 2VAXA 2Y66A 3AEQA 4BO3A 5IULC 1I4WA 3SJBA 4LIPD 3Q3HA 1P77A 4LPSA 5ETJA 4RMJA 3GBPA 3FVTA 2QK4A 4XE5A 3TOSA 1YR8A 3M5CA 1YRBA 2GT1A 4YMSA 4C08A 2QRQA 3AHDA 4IOLA 4FMCF 2OORC 4QOFA 2AN3A 3BL8A 3JARA 1IHXA 5B1HA 1I5OA 1RS0A 1CWUA 3U0VA 3OHPA 1QP8A 4MWDA 3SFTA 4HOYA 4E11A 5L6LB 1DRWA 4R69A 2PQ6A 2HN9A 1ZMXA 2YWCA 4QQ8A 4FOTA 4C04A 1ZHOA 1W8DA 3PHCA 4RSHA 2VJMA 1GUDA 4BJHB 2CMFA 5K2OA 1ILEA 3VR5A 2KYRA 1YZFA 1QIDA 2PZFA 3EEBA 4WN3A 4S3MA 3F8TA 2ZRBA 4JSTA 1BKYA 1DCTA 1TAQA 1ZIYA 3K70B 3SQMA 5FBZA 4ZVOA 3EWIA 4R1PA 5JNLA 1QAQA 4M0PA 1DJPA 3ROEA 4CCYB 3GG2A 4PIPA 3RROA 5BURA 3FNBA 4YYEA 3R77A 4MO9A 3VOAA 3MWEB 3IUYA 2JJMA 2OCYC 2AI1A 2VIIA 3KLOA 4KBGA 3GVHA 2Z3WA 2DY1A 4R3WA 5DI3B 3VU3A 4B43A 4F6CA 1NPDA 5E4JA 3U1BA 3E1SA 5AUQA 3LKDA 3EC1A 1N2OA 3HCWA 1XMXA 1X7DA 2ZROA 3FPHA 1DUVG 3F9IA 3QVTA 4RC9A 5LCXA 4W5OA 3TLGA 1BN7A 3M2TA 1G1MA 2X3YA 3COPA 3OTGA 4LWZA 5A5EA 5KHOC 1IMJA 3TNFA 1E9VA 3CKMA 1W5AA 3NBYC 4MWGA 4DKXA 4RD0A 2J7PD 2B21A 3MAAC 4BEWA 1D6MA 2AVDA 3GZJA 2UU9B 4H1UA 3MLEA 3OZTA 4TM7A 2F43B 1VE6A 2WSIA 2FFJA 2QR2A 5CB8A 5EJ6A 4BQSA 1NW8A 1IPEA 2IZ6A 5AJZA 1QHXA 3MCUA 3OVMA 4LXQA 2JBAA 5H68A 3M81A 3TNDA 1IK6A 3B85A 4GMKA 4XFDA 2CFTA 3WGQA 5A5VA 5EE9A 1HZZA 4I6GA 1IZ0A 1TQ6A 3R24A 4C29A 4KWHA 2WWTA 3FYDA 3W9SA 1YZKA 4DMUB 2OXFA 4M2LA 3C97A 4IHJA 3UOWA 2C7PA 1ETUA 4J4BA 5AW9A 4UAVA 4E4TA 1USWA 4GRDA 2JF0A 1Q3TA 5HWSA 5IJWA 2XZOA 3HEBA 3AIKA 3GUVA 4KRXA 1RW4A 2H59A 4X6LA 2DH5A 1EVEA 1ZK2A 3CRQA 4IQ4A 1BE6A 2V4UA 2HWKA 3NDIA 4H3SA 4IDFA 2HM7A 4L0MA 5BYBA 3UQZA 1ESMA 3O2JA 3PUIA 1PR3A 1VL8A 1NGSA 1JR4A 5KOYA 5DLQC 3GIWA 1XU7A 3PGJA 3BQNB 3JTMA 3JVIA 3PEUA 3C8ZA 3FE2A 3R5FA 4MS3B 2NVUA 2FFRA 5L3QB 4HAZA 1Z4LA 3GLGE 4UTOA 3UK0A 2HL6A 1ZO8A 4G0VA 3EMKA 1WQ4A 4DV7B 5FUMA 1FNBA 3M0EA 2VYFA 4IJ6A 4CL8A 2GHRA 3WNBA 1QONA 4DL9A 4ZFNA 4LZPA 1FPMA 1PZHA 1CJCA 3WGYA 1U28A 3CGWA 3K72B 1HFKA 3L0DA 4A5OA 1S01A 4B3DA 2LIPA 1HEYA 3AUYA 3UK1A 3WV4A 2XGOA 5SV2A 4MGYR 1SRRA 3C3MA 4I5EA 1J70A 2I34A 3L92A 3ZU4A 9LDBA 4XD7D 1KR5A 1NF9A 2FWPA 1I51A 1PZFA 1DAKA 2OZVA 2YOGA 3KNZA 4EECA 3AVPA 1NKVA 5KQPA 2Y6UA 3RF6A 5CD9A 2B8NA 5DPMA 3WFJA 1OBOA 5KYUA 1ZHHA 4TKUA 5JISA 1PTKA 1JWBB 4LTMA 3X1XA 4M9UA 2PANA 1YQXA 2IYUA 3KETA 3GEPA 1P8JA 1A7JA 3DC7A 1XD9A 3ZK9A 2NSJA 4XLZA 2XXAA 3DWEX 3Q8WA