2D06A

Human sult1a1 complexed with pap and estradiol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
publication title The structure of human SULT1A1 crystallized with estradiol. An insight into active site plasticity and substrate inhibition with multi-ring substrates
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d06A00
1G21E 5JJLA 4QGHA 4TN1A 3THYB 2G1KA 1G6OA 1QRAA 2IC5A 3U6BA 2GZAA 5DH9A 3UPUA 3MFYA 3Q85A 1ZM9A 3FVQA 5B58C 2CCJA 2CVFA 2ZUDA 1VCNA 5DIFA 5BW8A 2GJAA 1YE8A 4ARZA 5HE9A 3FKQA 3NXSA 1NG9A 2V3CC 1FUKA 4LBWA 1ODFA 1GVNB 3VU9A 2IF0A 4F38A 1YHNA 2WIBA 2QSYA 3P26A 4MKHA 1WF3A 4WIAA 4WZ6A 2P6UA 2O8CA 1A5TA 2IXFA 4HB3A 2BWJA 4A2QA 2GNOA 5E7MA 4BLTA 1P2UA 1E2FA 5JBQA 4Q5IA 2EYQA 3NBFA 1NMZA 3THXB 1N3BA 2K5UA 4BFTA 4LCBA 4US0R 1I4LD 4P0TA 3CO5A 5CYOA 4POAA 4LJ4A 2ZSEA 3KTAB 1JB1A 2Y8EA 4DLYA 4A4DA 2GJ9A 3R8FA 3ZJYA 1KKLA 2DCUA 4JLNA 3RC8A 1VG9B 2J9RA 2RGEA 2N46A 3A37A 3LRPA 2IS2A 2OM2A 4RKFA 2ZRIA 1E2LA 2PMDA 1T5LA 3MLEA 1UFQA 4PO9A 3R8CA 4DHEA 3ASYA 4L15A 1CR2A 1WE2A 4JKIA 4HATA 3W6NA 1R8QA 3BAFA 2XJ4A 5JMTA 2ZSAA 4ZKDA 5L3SB 1XTRA 1UAAA 1OH5A 3FFAA 1OPXA 1US8B 4XJXA 2C9CA 2AKYA 1N2CE 2QMEA 3E70C 3EC1A 2W6JA 3IBGA 3MWLA 4JVMA 4JLDA 4NMMA 3K1JA 3UK6A 4RZ2A 3BB4A 2JJ2A 4LJ8A 4AYTA 1H65A 4ZDJA 4M1TA 3EIHA 4PR0A 3RSLA 2VHUA 3AH8A 1YU9A 1YVDA 3QKSA 2FX3A 3LWNA 4O25A 2DFTA 3IKJA 2R9VA 1OXSC 5EQTA 2IS1A 2XTNA 2YOFA 2FU5C 3K0CC 1AK2A 1E1RD 2GRJA 4EPRA 3VNUA 5C4MA 1X1RA 1SKQA 1WXQA 2DPXA 1ZD8A 1FP6A 3SBEA 5K8IA 1GZSA 3ICQB 2CK3D 1GRRA 4P4SA 4Z51A 3EPLA 1XTIA 2H5EA 4QFMA 2P6NA 2XNDD 4M53A 2V4ZA 3GJ4A 4HDCA 5HZKA 2HUPA 1VMAA 4PAMA 5JSZA 1HE8B 2F1RA 5KO2A 2RGDA 3GQBA 1VDZA 1WDTA 2Q3MA 4F91B 4ZIRA 4QRHA 4HB0A 4RFSA 2ZAMA 4JVNA 3SNHA 3KB2A 4LX0A 4BZPA 1R7RA 2F7SA 2RCNA 2ZRMA 2WSSA 4BZXA 2KSQA 5JJIA 2ZRBA 5CM8B 4C7OB 4BLOA 4Q18A 1QHGA 3K0AB 2KI5A 4BLPA 4JL6A 1RRPA 2BJVA 2G1JA 2ZSBA 2F3RA 4LJ7A 1SQ5A 1U9IC 2YYZA 1XPUA 3CH4B 4AURA 5KOYA 2BBOA 3RS4A 3FMOB 5H8WA 4KFSA 1IBRA 1R2QA 2VSXA 1SXJD 4TL7A 4ESHA 1OLOA 1OIXA 3EG5A 3U6KA 3FKSD 3DO6A 3FMFA 4XWAA 1CP2A 2OBNA 3U3JA 5C46F 1HTWA 4QM6A 5IDVA 1XEXA 3CH5A 3PUVA 4B3GA 2V7QA 3PCRB 4CF7A 2W0MA 1P2SA 5DO9A 3AF1A 4HAUA 3SHFA 2OCAA 4MKIA 3K0EA 4K46A 4R98A 3UMRA 1CJTC 1KHTA 1YR9A 2FSFA 2FGKA 3L8ZA 4BRUA 2NOAA 2CL6X 2WSMA 2P5SA 1VECA 4PSKA 1P73A 3CKLA 3DKVA 4F7WA 1M7BA 3NDPA 3RS2A 4DCTA 2OFOA 2ZU0C 4E09A 3QQ5A 1NI3A 3M0EA 2GEUA 3OIUA 3WYFA 2DFLA 2BBSA 3B1YA 5L3VA 2CL0X 2R65A 2ZJ5A 5SZIA 1ZC3A 5JJKA 4G5GA 2CMKA 3QKTA 5DE3A 1DO0A 3T12A 3X1XA 5JZVA 4NONA 3LFUA 1NBME 2QP3A 5CM9C 2ZITA 4KBFA 4PPNA 1KSGA 2V6IA 3MG9A 2YC4C 1OW3B 4NYJQ 3THWB 3A6PC 2JGNA 1G8FA 1ZIOA 2HDNB 3BC1A 2FFAA 2UZ3A 3T34A 3OF5A 2WKPA 2AK3A 4G3XA 1Z6AA 3GD7A 5AJWA 2AN9A 1RYHA 1DEKA 4I99A 2OFXA 4PZLA 1E0SA 1YZTA 5JCZA 5K8LA 3T1VA 8OHMA 4A36A 4ERNA 1XCGB 2HT6A 1XPRA 3PFIA 4HZUA 2FNAA 2ZUBA 4Q66C 1P9WA 1VHTA 2P67A 1SKYE 4PQYA 1V5WA 1NSFA 2FFBA 5FFMA 1W48A 5DN6D 3OEED 4K81B 4A0FA 3RC3A 1XNJA 2JDIA 2WAYA 1DELA 3B13B 3EASA 2LKCA 1J7KA 1J8YF 2QGZA 1C4OA 2CEAA 2ONKA 4OQFA 5AJXA 2FMXA 1MKYA 2ZUCA 1P60A 3EZFA 3SE0A 5FBVB 1Z07A 2EVWX 5EZ5A 3UWOA 1ZM7A 3VHLB 1OIVA 1U2RA 1ZNZA 2PH1A 4CGZA 1TAGA 1E94E 1NY6A 3AVVA 2GCOB 1KGDA 2G6BA 4RSGA 1KDTA 2YWEA 2W0SA 4D25A 1M7HA 4OQLA 4QNRA 1G8PA 1IN4A 5JECA 2EYUA 4PX9A 1XCMA 1E2DA 5KDDA 2J45A 1R10A 3UXMA 3LH5A 2J0QA 2Q3HA 2ZRNA 5JLJA 2PT7A 1G18A 2ZI7A 4M9QA 3DOEA 4Q4HB 3TW8B 4HAWA 5AR1A 3GEEA 2J0UA 4IJMA 1UKZA 2MSDB 4TMVA 5KPJA 3PEWA 4GL2A 2NPIA 4DT1A 2PMKA 3U3MA 1J2JA 5F98A 2WM9B 2IHYA 3KFVA 3OFND 3VR5A 4D0GA 4MUBA 4LJAA 3GCGA 1TPZA 3H1TA 2IYZA 2DB3A 3BIFA 2C78A 4QHSA 2VL7A 3IIMA 1QBKC 3WRXC 4A8JC 1KZ7B 4DSNA 2BHRA 4DIEA 3GJ6A 2QP4A 2XITA 4YXWD 2H17A 2GKSA 5AUNB 3QKUA 2X77A 5JWRA 1KDOA 3AKYA 3EC2A 3J81k 4OJQA 2WIAA 4UNPA 3VU9B 3X1ZA 1GNQA 4NYJR 1PLLA 4PFSA 4YMUA 2AWOA 2DYKA 4O2LA 4F93B 3LW8A 1BH2A 4PQRA 3DM5A 1OB2A 1Z5ZA 4XD7D 2EFCB 4PAOA 2O8CB 2FPKA 3A8TA 2ZR7A 2WKRA 4Q1DA 1IY1A 2JLYA 4PC7A 1BO6A 2RHDA 2JIZA 3RWOA 4C0QC 2YJTD 5EUMA 2I1QA 3DMNA 1GNPA 3K9HA 1HV8A 2D74A 1COWD 1MRNA 3GJ3A 2J3EA 3T06B 3CX8A 3QPUA 1MV5A 1QZXA 2DWQA 2KE5A 3K0SA 4DDTA 1EWRA 3AVWA 3FWYA 1Q22A 1P61B 4LJYA 5AJYA 4BGDA 4ABYA 4M1KA 4OK6A 2A5GA 2JA1A 1E9AA 1H8HD 1T9HA 3P32A 3E5HA 3WBJA 2C95A 1OF1A 1OXVA 1FMJA 1CXZA 1QVAA 1UF9A 2F1JA 2ZR9A 4IEEA 3PEUA 4IRUB 3GLGB 4JMPA 3A1WA 3TK1A 2XAUA 4IFEA 2V54A 1T91A 4C30A 1KZGB 2GEVA 5F9FA 5LB4A 1SULA 2ORIA 1LNZA 3TUZC 4TT3D 2C98A 1MT0A 1KI6A 1VYUA 4A6PA 5FH9A 1KNXA 2FN4A 3OZXA 1KO8A 3VX3A 2AHOA 3DPUA 3IDQA 1NP6A 4KFTA 1GILA 4KYIB 4NPHA 1Z2CA 2KBEA 4H9GA 3BGWA 2PZGA 1Z0JA 3TIFA 3OHMA 2UZIR 2ZJBA 1DBSA 2P0EA 4URXR 3QKSB 3HPRA 4HI0E 5TB5A 1G20E 2EFGA 2WWIA 4KVGA 1IJFA 3OEHA 3ZZUA 4HUQA 1LF5A 4IDPA 1G291 4LYJA 5EJEA 3BERA 1EFHA 1FPMA 2QNRA 4Q1BA 3CX7A 3SYKA 4DEYA 2EFEB 1H8EA 1NY5A 1Z83A 2ZIAA 2B7BA 4P4SB 4BZQA 2BMDA 1OYWA 4TL9A 4B6EA 4L16A 221PA 2ZE7A 1DOAA 1YJ5A 1XXHA 3HJNA 1NMXA 2Q9AA 4Q4AA 1ZJ6A 2OLKA 3ZIAA 4Q1FA 4C0HA 5FBWB 5L8VA 3KKMA 5FBRB 4PC3A 4HDOB 4Q1AA 4ZIRB 4URUR 4RFSB 4S2EA 3BBPA 3U7GA 4HAVA 2OLJA 5CJPA 3NEJA 2H1LA 2ZVPX 2C5LA 3ZVMA 2ODWA 1GIAA 2LWIA 3LDAA 3D6TB 2R44A 1XRJA 3DEFA 3JZMA 3OESA 3D3QA 3PEYA 5J4LA 4TYQA 2H7VA 2ANCA 3QXXA 4HB2A 5DI3A 4EFNA 1GDDA 3SJBA 3ADKA 3RS7A 4CEIA 5KSPA 1SHZA 4MUAA 1G41A 1G7RA 3TE6A 2R6CA 1GL9B 3OIVA 2XTZA 4I4LA 1LVGA 2C2HA 4A8JB 2C04A 3LBIA 1KMHA 4BFWA 4Z8YA 1B0UA 2A5FA 2DBYA 4OHVA 2UVQA 4L9WA 3GJ7A 1X86B 3CRVA 2R8RA 2ATXA 1L2TA 4ZDKA 4LPKA 1IONA 2O0HA 5FBQB 3KXIA 5LB2A 3CRQA 5H1YA 4OI0A 4Y0VA 3JZAA 1E2NA 2QRNA 4NU0A 4UQOA 2FG5A 5DI9A 1F60A 3ZH9B 4DLRA 4QG7A 4B44A 4URVR 3FTQA 3BH0A 4B74A 1R5OA 3BFXA 3IUYA 821PA 3AVPA 1G9XA 3LQRA 1JPJA 1PJRA 3BJIC 3AF0A 4JSYA 2OILA 521PA 4M1WA 4U5XA 1W2HA 4B2IA 1OIWA 2ZQ5A 3EZ6A 2WJVA 1NN3A 4B71A 1LF0A 1R8SA 1Q3HA 4IDOA 4KJZA 1D9ZA 3GPLA 4AY2A 3QVUA 4US2R 3TQCA 4N0EA 3A4MA 4AYWA 5IK2A 1QHSA 3DL0A 5AWFC 1I2MA 2WZQA 4XTCS 3SU8A 4LZZA 1E2MA 1JQLB 2GJ8A 1II0A 2Z4RA 1XEWX 4D82A 2WJJA 5DLQC 4PHTA 4TSFA 2ZS9A 4D4KA 3BB3A 1JAHA 5KNBA 3W5IA 1EFRA 2VP6A 1G3RA 4GSYA 1OFHA 3BWDD 1F2UA 5LDDC 3N2IA 3LD9A 3A1SA 2IHBA 1TUEA 2QZ4A 3K9NA 4BECA 2QMOA 3MJHA 4ASUA 2CJWA 3FE2A 3CR8A 3OAAA 4DJTA 4A6XA 3RS5A 3LBNA 2PLFA 3MMPA 4NL4H 5JFGA 4HZUB 1G8HA 3TKLA 4B48A 4DKXA 3RABA 5GJWC 3AP3A 3K0FB 1R5NA 2VA8A 1G3QA 4GP6A 3RSOA 5J4YA 3KZ1E 5EP2A 2VSFA 3ASZA 4LBYA 4M0LA 4BLRA 4Q9IA 3SOPA 1WCV1 2OUKA 2R6DA 3B78A 4JL5A 3ONWA 2HEIA 5KNCA 1U90A 2J87A 1JR3A 1JJVA 2BC9A 2JLUA 1F2TA 4IXMA 4MGZR 2FSIA 4GOKA 3KUDA 3NWJA 1OV4A 3PR1A 1C1YA 4QBHA 2JLXA 3KDSE 3TLXA 1EK0A 1VCMA 1PZNA 4HSEA 4Q02A 4EQ6A 4FN5A 1VG0B 2EFHB 4NE2A 5FPKA 3PQCA 1G5TA 2QBYA 1G16A 4NP6A 1T0HB 1T3HA 2P65A 4RVCA 2WMOB 4GT1A 2ZE6A 4LGMA 1NJGA 2O8DA 3QG1A 2ZPTX 1K6MA 3BRWD 2IYTA 3EZ2A 5EE1A 2QENA 2OZEA 3JVVA 4D26A 2E9SA 2WSSD 4WAUA 2JLWA 3AKDA 2J0UB 2R2AA 2EWVA 3CF2A 4HB4A 3C5HA 2IEYA 1Q0UA 3B1WA 1ELOA 2GWHA 4DT1B 5FOWA 4CEJB 2J7PD 2GHIA 4OI2A 1W4BA 4M9SA 4MGKR 5C1BA 3UMFA 1Q20A 1ZYUA 3BFKA 5KSZA 1IY0A 4GRAA 1U0HC 1DO2A 5J5CA 4FWTA 3AKEA 1G8YA 3R7WA 3MWYW 3C8UA 1A2KC 4DZZA 4AYXA 2NPFA 2GVDC 1AS2A 4IDHA 1KNQA 2XX3A 4L4UA 4MA4A 2VP0A 5FL7A 5KSYA 2V7QD 2QT0A 4D80A 1UADA 2YOHA 4Y0AA 5AUPB 3GEHA 4N0DA 3O47A 3IO5A 4RZXA 3RWMB 5G41A 5HZHA 1NF3A 3ZDQA 1FUUA 1MR3F 1NJFA 1P9NA 2BM1A 3ZS8A 2XXAA 3QKRA 2D3WA 2NIPA 2JLVA 3EXAA 4UJ5A 1G5RA 3CWQA 3GFOA 1YRAA 1DAKA 2WAXA 4C0SA 3K8YA 5ELXA 4MDFA 1XD2B 1Y63A 4V0KA 1MABA 4LHVA 4JYCA 1A2BA 3KXKA 1G7TA 2A5JA 3FOZA 2ZM5A 1PUJA 4A0HA 3TGPA 4LWZA 2YNMA 4Q19A 3U3KA 3K09A 3BXZA 2PT5A 4O2RA 1LY1A 2VPPA 2HT1A 3B60A 1SVIA 3AVQA 2O8FA 1Q21A 3SYLA 2QSZA 4NZYA 4M1YA 2F55A 2C9YA 1OKKD 2RGBA 4V0MA 1E2GA 2HF9A 3HWSA 1YQTA 4W5WA 4ZKEA 3TSOA 2OCPA 1OHHA 5HTKA 4U02A 1G4AE 1DG3A 2GXUA 1TEXA 2ZANA 4GPTA 4I1OA 1UKVY 3KQNA 4AKIA 3CM0A 4KYUA 3UANA 1YZNA 3T1OA 1UEIA 3TMKA 4CYMA 3SQXA 2QQEA 5FOSA 4QGGA 5G53C 4HYYA 2C96A 4B2LA 2MMCA 3EPJA 1IXSB 3SI7A 1XJQA 3A1VA 2HXYA 3N70A 2D4HA 2RB4A 4KO8A 1Z29A 1UEJA 3LV8A 3ND8A 2PEYA 5BYKA 2O8EB 2RHMA 2PJZA 4WZBE 5CLLA 1YZLA 1TQ6A 5TVKA 4D81A 1DAFA 1G19A 2BEJA 2H18A 3HU2A 4QJ3A 2ERYA 1N25A 1DTSA 3B6EA 2JDID 4HAXA 3GLIA 3FYHA 4HUQB 1CR0A 3VNVA 2QTVB 5BN5A 1QHHB 3VKGA 4B3CA 1FOEB 1ESMA 2BBWA 1S3SA 3EIQA 1AJEA 2D06A 1AN0A 1N5JA 4M9ZA 2G77B 5SZJA 2H8KA 1HEIA 3FFBA 1E9DA 4GBMA 1OB5A 1XXHB 2BJWA 3IHWA 4GMXA 4Q4AB 1U0LA 5GJCA 1JEEA 4BFVA 2GZHA 1XEFA 4C0AC 4AG5A 4OKSA 4R71A 3RVBA 4MRRA 3GLFA 2JJ1D 4GMDA 2ODBA 1XU4A 3GMTA 3HYTA 4DLZA 1G6HA 3I92A 3W34A 3SC3A 4CDGA 5CIQA 1AS3A 1P3JA 3HP1A 3CRW1 4Q1CA 3M1IA 4PO1A 4FI3C 3NEYA 3ZQJA 3NG1A 2CL7X 1FX0B 4B43A 3B1ZA 4CEIB 1Z28A 4EPVA 5B64A 3U60B 3BFVA 4IOJA 3CNNA 3CPJB 1KMHB 2VO1A 2ZS7A 3CNLA 4Q4JA 3WXMA 1VG1A 2IYQA 4LJ6A 2W83A 3C5CA 1X8JA 2FFHA 4ZCLA 3SFZA 1VYVA 1ZD1A 1T5IA 2C99A 4JS0A 5G3YA 1JXOA 4UKDA 1Z06A 3VFDA 4BRWA 2QE7A 1N6OA 3T35A 1NBMD 4B33A 4JLJA 2GCNA 2Z43A 1RW4A 1E79D 1N6IA 3CLVA 3W6OA 1UKEA 3Q5DA 4IFBA 2DY1A 2ORWA 1J90A 3QIAA 4QBIA 4EKDA 4B3FX 5HPYB 4M4SA 1ZRHA 4A92A 3BE4A 3LXRA 4XVQA 1LS1A 1XWIA 5CLQA 1QHXA 2WWYA 1AZTA 1XD9A 3Q3JB 1R6BX 3U44A 4B2PA 4M21A 1RPZA 3A4NA 1DAHA 1SVLA 4YDSA 5TY0A 1DS6A 3V4RA 1L7VC 1N5IA 3KQHA 3I73A 2OCYC 5CK4A 3DHWC 5FUWA 1E96A 1II8A 1MOZA 1S3GA 3A1UA 4KSCA 5FOUA 2ONJA 1FTNA 2CNWA 3B85A 3W8NA 2QP9X 4O3MA 1KDPA 4YLGA 4Q47A 3ZLJA 4RD3A 2QG6A 2ZRPA 2QU8A 4RD4A 2QN6A 1TL7C 1M7GA 1GSIA 3DM9B 2ANBA 2ZSDA 4HLUA 1G7CA 3EPKA 2OEPA 2I3BA 1HURA 2GILA 3B82A 2FE4A 1SHKA 1TEVA 1GNRA 4DUGA 2G3YA 2FF7A 1XBTA 2PZEA 1F2UB 1SVWA 2WBLC 5IF9A 2XB4A 1P7CA 1KK3A 1TADA 2W6ID 4MRVA 1GP2A 5KTYA 4I1UA 2BVNA 4W7SA 1ZCBA 1ZINA 1GTVA 2QPAA 1XZQA 4UXJA 2V8OA 1AQYA 3L82B 4MITA 2XZLA 1DE0A 1HT1E 3QSYA 5CDFA 4C9BA 2QMHA 3TBKA 1E9EA 1FFHA 1E2JA 2B8TA 1B23P 2ZREA 3X1DA 4XSGA 3AGQA 1II9A 2OBLA 2C77A 3QEJA 4IDQA 4WXRA 1SZPA 1KK0A 1N5KA 1N6HA 1R5BA 4P4TA 3T5DA 1TQDA 5IHPA 1KK2A 5CITA 1TF2A 4W5JA 1NVWQ 1FNMA 1F2TB 3E1SA 2QROA 2Q0HA 4JLVA 3Q5EA 3V00A 1W0JD 1KDRA 5JCPA 4YC7A 1U8YA 3SDZA 4DEXA 4A0GA 4PTLA 2UKDA 4BASA 1H8ED 3U61B 4LHWA 1D9XA 4UNNA 3NBYC 3KL4A 1HE1C 4I81A 4BFZA 4TQUS 4IVRA 4OQNA 3A4LA 1CIPA 1NMYA 2OFWA 2IW3A 1ZBDA 5TARA 2Q6TA 3M6AA 5B57C 1HQCA 1M34E 4PPGA 1WBDA 4R7ZA 3W3ZB 4CT5A 2ORVA 3PJRA 1CULC 1G1MA 2XZPA 3AUXA 3AQ4A 3AF2A 2V55B 3TVDA 1D6JA 1RKBA 2A30A 1PV4A 1J8MF 1KTVA 3SJCA 4JVLA 4C2TA 1G4UR 1CJVC 2X8AA 1O3YA 4FCTA 1NLZA 1DAMA 4Q9LA 4WZAE 4F4CA 2VIIA 2GBLA 5HKKD 3PUYA 4EPYA 5EXSA 4LUCA 1E2EA 2FOLA 3GJ0A 5J47A 4TLDA 1S2MA 3PUXA 2GEDA 1P2TA 4B3BA 3UG6A 4IOKA 1OYYA 5FOXA 2VEDA 1CBUA 4OK3A 3AGPA 1GFIA 2QTFA 5A5GA 3KKOA 1Z2AA 1N6LA 1ZUIA 2WVJA 3KUCA 2B92A 4TTPA 2IEZA 4DCUA 2EWWA 1RIFA 2QAGA 2YHSA 4DXAA 1CR1A 2AR7A 4DDVA 1Z0AA 5F9HA 4EDHA 2XXAB 1QF9A 5P21A 2RKOA 3W5JA 5JRJA 3MGCA 2J0SA 5DYIA 2NO0A 2Q3FA 3P4XA 1BKDR 2CCGA 1UDWA 4B3XA 3D8BA 4NKRA 1JEDA 4IOLA 4XIGS 5F2EA 1DADA 2V1XA 4U7DA 1MABB 2VP9A 4AKGA 1WA5A 4US1R 4BEJA 5FPSA 5JI2E 4DLUA 4P32A 1E1QA 4RJLA 1OFTA 4DB2A 1S96A 5A0FA 2IWHA 2QY9A 2YZ2A 1W1WA 1OXUA 2JEOA 2WOOA 4UNQA 3TUJC 1M74A 2ZRDA 1FTSA 3R9IA 1LS6A 2XGJA 1VHLA 4LC1A 4F4JA 3W90A 3Q7PA 5M04A 4G5RA 4MKGA 1EFUA 1W7AA 3B1XA 2N42A 4CEHA 1KI8A 1XXHE 3QG5A 1N0WA 2FDCA 4URYR 4XH9B 1VPLA 5JHGB 1VIAA 2GAAA 2BIFA 2OG2A 2FGJA 2ZRGA 2ZTSA 1K5GA 3TR5A 1Q1BA 5FUYA 4C4PA 4D4MA 4ARZB 5LD2C 2A5YB 1ZC4A 2B8WA 3U7FB 3RS0A 1XTSA 3MD0A 2ZETA 4JZKA 3QI2A 4QHYA 2IYUA 4TMTA 3VR4A 4YONB 2F6RA 3FMPB 3I8SA 2CHGA 4ASUD 3OAAD 1W0KD 2PCLA 1IN8A 4Q01A 4UXHA 4WOPA 1ZUHA 4MDEA 4TLEA 2WJHA 1E1RA 1LTQA 3NBXX 3WMGA 1EG7A 3BS4A 3AF4A 2GXAA 5GVSA 3P20A 2CK3A 2GK6A 1YKSA 3LA6A 3Q9LA 5EUQB 3IIKA 2XNDA 4DSUA 1OXXK 3GLIB 2QI9C 5SZHB 2A7QA 3NTUA 4TLBA 1Z6GA 3UATA 1NIPA 1JR3D 3GEIA 2XOKD 5CB8A 3PVSA 4I1SA 5KNDA 3X2SA 4EFLA 4OI1A 2J41A 1CJUC 1WP9A 1AKYA 5E7JA 2ZYWX 1VCOA 3TUIC 1E6CA 4TYNA 4ZPXA 1XTKA 2ZYUX 4AKHA 5EE0A 3U7HB 3B5JA 3RRNA 3K9GA 4V02A 4MRPA 3VKHA 3K53A 3GLFB 2FEOA 3JVUA 3WNBA 5CB6A 2IYWA 1ZNYA 1X1SA 1UBGA 4A1FA 4ILEA 2EQBA 1IHUA 2QGNA 3ND9A 4FIDA 1SXJA 2AXPA 3CF0A 4NYMR 3WP1B 5J4VA 4KU4A 4PANA 2CBZA 2IXEA 1E9SA 3MRSA 1E2HA 2OESA 3CBQA 1KMQA 4Q48A 4Q7JB 3KKPA 4FCVA 4ZDWA 1YR6A 2RGAA 4LV8B 4TL6A 3LAWA 1ZU5A 3F8TA 1S4QA 2CLSA 1RZ3A 1SVKA 4W5HA 2W00A 3IPYA 3FHTA 1SVSA 1TF7A 4TZ6A 3NC1C 1N0UA 1DAEA 2AFHE 3BH7A 4KI0A 1HUQA 4MGIR 4A9AA 2F9LA 3CX6A 1W44A 1E32A 1PVOA 3C4JA 2J46A 3M4YA 1XD8A 3O8BA 2FSGA 3GJXC 3P4YA 5C4GB 3SYNA 2O8BA 1BMFD 3QENA 1JPNA 1ZU4A 4R9UC 4KV9A 3ZVRA 3SEAA 5TMPA 1E2IA 1V43A 4A15A 3ZD6A 4JBYA 2MSEB 5JSZB 3NH6A 1IOZA 3CPHA 3F5FA 3ZS9A 1KI9A 1X8KA 5JWHA 5J4HA 3LQQA 1GL6A 3H4MA 1XP8A 3CRMA 3FMIA 4KHZA 5IT5A 2QPOA 1NKSA 3I72A 4NCIA 3THXA 2A2ZA 4RCYA 4JYBA 4MYCA 3U44B 3TR0A 2YOGA 5CJ2A 1WQ1R 3ADBA 2GK7A 1JR3E 3CPEA 5E3HA 1ANKA 3MCAA 2GF9A 1KI2A 2XJ9A 4MGYR 5KSOA 2QPTA 5FR2A 1XJCA 2ZRKA 4BFYA 1U98A 1W46A 4Z1MD 1T4GA 3RRMA 2IYYA 1UKYA 2NO1A 4NBSA 4S35A 1TQ2A 2QEQA 5JS7A 1TU4A 1OHHD 2FJUA 5EXPA 1TF5A 2BCJQ 1OXTA 5KHOC 1XEXB 4B73A 5LD2B 1Z47A 1M1YE 2QL6A 4MH0R 5JRZA 5LPNA 3G5UA 4HLQB 3WHLA 3S1AA 1NVVQ 1OFUX 1E98A 1N6PA 1NVUQ 4D0LB 4B47A 1HYQA 1E0KA 2ZRAA 5JWOA 3R20A 3VAAA 1ZW6A 4P31A 3OIYA 4FMCF 3OEEA 3QXCA 2VF8A 4IXNA 4A0RA 1N6KA 1I2DA 3KJHA 3TW4A 1DARA 1JBKA 2RGXA 3NIBA 3CWZA 4NH0A 1SVOA 1EX7A 3NH9A 1E2PA 2WWWA 4AKEA 1AGPA 1BYUA 3VMFA 1QHYA 1XTJA 1JXMA 5FTKA 2IWRA 1GG2A 3QJYA 2X1VA 1D2MA 2NO7A 3LBHA 4JKYA 1M2OB 1OH6A 2ZS8A 4JIMA 4OK5A 5E7IA 2YVUA 2X19A 3KJEA 3EA5A 3TSWA 3IGFA 1GM5A 3IILA 1Y3AA 3GJ8A 5HCNA 4NCHA 5D3MA 3IPXA 1X3SA 1ZIPA 3AB3A 4KFUA 5L3RA 2G9NA 1EFTA 5IRCD 1HH4A 1GITA 1I4DD 1T3SA 4MYHA 2AWNA 4PHHA 1JNYA 1KO7A 4PPQA 2AL7A 3LVQE 4XTRA 2GCPA 2YV5A 3WRYC 1CJKC 4Q21A 4L8GA 2FEMA 2IS4A 2V9PA 2ZXUA 3AKCA 4DIDA 5CK5A 2GF0A 1QDEA 1VYTA 1F3OA 3R9XA 4TMXA 4IOMA 4BLQA 1FQKA 3N2EA 2XSZA 5FPTA 5JEEA 1FMLA 2QUZA 3OFNA 1YZUA 3MUFA 2X2EA 5B30A 4RZUA 2B6HA 1Z3IX 1LV7A 2BCGY 2YKGA 1CF4A 4EIWA 1CRPA 4BWYA 2F3TA 2W6JD 4XWKA 3ZVNA 1LFDB 3NC0C 2JJ2D 4BE7B 4OJKA 4V0ME 5DGXA 5DHFA 1KSFX 1YR7A 4EPWA 1CR4A 3OIWA 1JQJC 1E9BA 1RRGA 3ADCA 4EFMA 4PC2A 1N6RA 3I4LA 1I4TD 1KOFA 2MMGA 2RGGA 2F43A 3THOA 1K5DA 4D4LA 1RRCA 5EZ6B 4TL8A 1KO4A 4DVGA 2WTUA 4XD7A 1Z22A 3P27A 2JLSA 3REGA 2O0KA 4QL3A 4IVPA 3H0KA 5FL3A 5GVRA 1CKEA 3DDCA 3O8DA 4GZMA 5FTLA 2I4IA 2QE7D 1ESNA 4JLOA 2AX4A 4ZV4A 3AM1A 4ITRC 4HAYA 3HDTA 4TQ9A 1COWA 1RVDA 3WHKA 1PLKA 4V0OA 1NVVR 1VKJA 4KITB 2WPDA 4FMCB 4Q9KA 4EUNA 1AS0A 1Q57A 5FOTA 3GLHA 3G0HA 4KBGA 3IHLA 2GZDA 4DLTA 3QUSA 2NO6A 2P3SA 5BYJA 1E99A 3RRYA 5G3ZA 1NG1A 4OHWA 3GLIE 3KQLA 2A3RA 2JATA 4BQSA 2HYIC 2WWFA 2VHQA 4MRSA 4JVSB 4PHFA 2VP2A 5UKDA 1Z63A 2X2FA 3CW2A 3THWA 4R2HA 3I5XA 3KKNA 4G01B 1TUIA 2REOA 4TTQA 3K9LA 4TMZA 4TT3A 3LNCA 1E0AA 4YMVA 121PA 1NKTA 4RKEA 1E4VA 4Q4LA 4Q7LA 4C3ZA 4QBGB 3GLFE 3AV0B 1DPFA 1W4AA 3U7EB 4DSTA 4ZCIA 3AP1A 1DAIA 3TSZA 4DUGD 2YINC 4PZYA 2FSHA 5H70A 4TLCA 2HYDA 4FD2A 2L0XA 3A36A 3PITA 2GDJA 1FNNA 4XWOA 1GKYA 5FI1B 3H86A 1S9HA 4ZI3A 2WHXA 3GJ5A 4QXAA 1AZSC 2ZSFA 1A4RA 4ACAA 3U3RA 3DKPA 3I3SR 4X8OA 4D2IA 1ETUA 4KVAA 2WMNB 2WWXA 1JI0A 3QE0A 1Z6XA 3EZ7A 2GAOA 2VSOA 3KX2A 1XEWY 4LC0A 4Q00A 4IDNA 5EXTA 4LHXA 1AIPA 3HR8A 4EPXA 2VQSA 1KKMA 3EWAA 4NYIQ 3SFVA 5JHHB 3REFA 4HLDA 5F3WB 4DBLC 5AUOB 3MAAC 1ZM2A 4PSAA 2RGCA 2ZJAA 3UWKA 2QTHA 4V0NA 4C0JA 4QKQA 5EP3A 1PLJA 3C15C 3SJZA 2VF7A 5FOVA 3WY9A 1A1VA 3CR7A 1UBCA 1E9CA 1G17A 2FPLA 5FTNA 1ONBA 4G0NA 1U9IA 4URWR 1OJLA 3VR3A 2F1HA 3WNCA 4BUJA 4OHYA 3PXGA 3V9PA 4RD1A 2BM0A 2IXGA 1Z6YA 1S9DA 3RAPR 1NL3A 3C16C 3BORA 5BXQC 1KI6B 3EW9A 2ZI6A 4OQMA 1GRQA 5J4KA 2XNSA 4NCJA 4TTRA 1Z0IA 5EE5B 3UKDA 3KFXA 2JAQA 2IYVA 4DWJA 1VTKA 1W5SA 3DOFA 4A2PA 4WA7A 4Q1EA 1VG8A 3GFPA 1UM8A 2IYSA 2BMFA 2GVZC 4M2LA 3ZYCA 5K8TA 4KXFB 2Q21A 1NN5A 2ZYTX 3VHXA 4LYHA 1AM4D 2OAQ1 3BB1A 4G5QA 1OSNA 3P1JA 1XPOA 1KIMA 1W49A 4LSGA 4Z54A 2DFNA 1FQJA 2ECKA 2ZRHA 1F5NA 1IN5A 3FDIA 4BLSA 2O8BB 1HQYE 5TV2A 4FW9A 2DWOA 1XJ0A 4Q9JA 1JALA 4Z8XA 1KJYA 2R6AA 4JLMA 4X8HA 3L8YA 3TJZA 1OE0A 1EWQA 4NTZA 5JEDA 1E2KA 1K8RA 2DWPA 3B9PA 1VCIA 2ASEA 5CDFE 4CVNA 4KODA 1KO5A 4JSTA 3UG7A 4FWIB 2IX3A 1A82A 1KI1A 3EZ9A 4DLWA 2BKUA 4YMWA 1G3MA 1E1QD 1OT3A 4MYUA 2JLQA 2ZU6A 5AUQA 1RYFA 3HU3A 2WICA 1N5LA 2BMJA 5DI3B 1T8UA 2WJIA 3CONA 2GA8A 1P75A 1IAQA 1QVRA 5BQ5A 3GLGA 1TX4B 1CU1A 3MWKA 3VR2A 4Q9HA 1IM2A 1DG1G 2RH5A 1S1MA 2ZI9A 4PC6A 2N1BA 4NYIR 4HUTA 421PA 3O8CA 3SN6A 2VYFA 3S1AB 4Q7KA 4JT2A 4HAZA 2E1RA 4EPTA 3ADDA 1WB9A 5AK0A 1R0YA 4AWXA 4XVUA 1MRSA 4E07A 3QXSA 1P9RA 2AD5A 2D62A 3L0SA 1U0JA 2ZRFA 4UJ3A 3BK7A 2VP5A 3CF6R 4RD6A 1T6NA 1WMSA 5EE9A 2ZVQX 1XMJA 1W5TA 2D2EA 2FFQA 2NMVA 1DAGA 4H1UA 2Z6VA 4NCNA 4RCZA 1JAIA 2JLRA 2DR3A 4DC9A 4LV6A 3BH6A 1QG4A 1JR6A 3G82C 2JIZD 3FHCB 4ZI2A 3ZZTA 2ZAOA 1KI4A 3B2EA 1RJ9A 4FMBB 4OBEA 4LPSA 3K09C 1W4CA 1XB2A 4N3NA 3LLMA 2WWGA 1S8FA 1AKEA 5KPDA 5D3MB 2AFIE 1KAGA 2O0JA 1LW7A 3IEVA 2YC2C 1U94A 4LYAA 6Q21A 5L3QA 5AJZA 2IBMA 2PX0A 5E95A 3R9WA 4ZCMA 2KWIA 2Z5FA 1GL7A 2QQ0A 1BYIA 1NLFA 4KCGA 1R0ZA 1TQ4A 3CIOA 4DCSA 2OE2A 2R62A 4PO8A 3OE7A 1G5PA 2J0VA 2OAP1 2J7PA 3PEVA 4FCWA 1IJEA 3SR0A 4CRWB 4G1UC 2ZE8A 2ZJ2A 1QHIA 4DB4A 2CJWB 1VIYA 5HCIA 4LJ9A 3AVYA 4MRNA 4JJZA 4C2UA 3BOSA 4PQFA 4OHZA 1IN7A 1U8ZA 4KLNA 4A8JA 5GJVC 5FBLB 1HY3A 3QXHA 4PPFA 2ZI3A 5CYPA 1N0VC 1Z0KA 4DLVA 2OO7A 4G5OA 3NDBB 1LB1B 1ZM3A 2HLDA 3PENA 1Q12A 3SJAA 5KU1A 4D4JA 3PUZA 5GJBA 1AGRA 4QC2A 4X8LA 1T3LA 2F43B 3B9QA 3OEHD 4IEIA 2ZJZA 4QM7A 1ZD9A 2J5XA 1TMKA 1G3IA 3QPWA 3T1TA 2CLDX 3LVRE 3ZD7A 3QNUA 1GAJA 1TU3A 1ZMXA 5HE8A 4QBFA 4C0KA 4W9MC 4GZLA 4EQ6B 3X1YA 4DCNA 3L43A 1G3UA 1ZCAA 5FI0B 2QBYB 2IS6A 3IQWA 3ZIAD 3ZZ0A 1NN0A 4GOXA 5A4JA 2R6GA 2ZR0A 1RC8A 2O8DB 3GLHB 2NQ2C 4IW3B 1OKKA 2ODEA 1RE0A 3C14C 4MYTA 3L0IB 1Z8FA 1YZQA 5JI3E 4KLZA 1W4RA 2Q9BA 2PJRA 3AVOA 2PBRA 2CVHA 4GNKA 1YRBA 4M1SA 1EFCA 1GOTA 4RD2A 1Q1QA 2CDNA 4GI7A 4JT4A 1TTTA 4U00A 1P62B 1W47A 2A9KA 2CCKA 2VP4A 3UIEA 3AP2A 1KYIA 3AVXA 1KK1A 3GFTA 3QVVA 2DHRA 1KY3A 3DZDA 1S1CA 3I61A 2C9OA 3R7WB 2NZJA 1CRQA 3LXXA 1QHNA 2JCSA 4TYWA 2EU8A 2PX3A 3WBKA 3V4FA 4LBVA 1KI3A 2BMEA 3DVLA 3WMFA 4RZ3A 1JJ7A 1Z08A 1Q1EA 3K0FA 2PL3A 3I8XA 5JS8A 2YWHA 3QKRB 3WMEA 2ZRLA 1SXJE 4FINA 5DSZA 3QF7A 4NYMQ 3U4QA 4AIIA 3I62A 2J1LA 4GDFA 1OH7A 3WYGA 2GJSA 4B6FA 4GP7A 2RGNA 4TMKA 3ICEA 5EXXA 4ESVA 1KO1A 4MQBA 2OXCA 3VR1A 4TWZA 5GADl 1OH8A 1MO3A 4IVQA 3MWJA 4C0BA 4AG6A 2VLIA 2O8FB 1KJWA 2FWRA 4QJ4A 3CZQA 3FB4A 3RNLA 1GKUB 3KQKA 2BV3A 2B21A 3EARA 5IK2D 1U99A 3L0PA 2JJ1A 2FH5B 2A5DA 5HR5A 3NBZC 4AK9A 4QOSA 3L0OA 5EP1A 1KSHA 4HZIA 3RHFA 2RAPA 1A7JA 3A58B 2BEKA 2FZ4A 1RRFA 5K8UA 1W36C 1XTQA 4TSFD 2ZI4A 2AKAB 5DISB 1W2GA 4HLUC 2GETA 1CLUA 1EFRD 3IO3A 4URZR 1MH1A 3PIRA 1P6XA 4CEJA 4FMDF 4QHTA 1U81A 2XSZD 4DLSA 1F48A 4CW7A 1NVXQ 1P4SA 4HDQB 3DZ8A 3TAUA 4CZ2A 3Q8XB 3QXJA 2VHCA 4E5UA 2ZJOA 1MO6A 1XMVA 3N5CA 1UBFA 3RLFA 2XEXA 1P5ZB 1L4UA 3GP8A 1OFIA 2IUTA 2W58A 3NHBA 5FUXA 2RMKA 3HYRA 4QJ5A 4E22A 4A2WA 1KY2A 1NBMA 1NSTA 2J59A 1YR8A 3F3YA 3IEUA 3CNOA 1E79A 1KSJA 2E87A 2WOJA 4K8OA 4OI4A 3ZQ6A 2G0NA 3SZRA 3FGNA 2C8VA 1E0JA 1XD2A 2ZJYA 4F92B 1E3MA 2HV8A 4EJSA 4YMTA 1UPTA 3CZPA 1D2NA 1G64A 1L4YA 3EAQA 3LW7A 3QF4A 4PSVA 2AXNA 4RY2A 2W2XA 4Q7MB 3EIEA 4KFRA 2WPDD 2ZI5A 4DCVA 2PLRA 4IHQA 2ZE5A 1UDXA 5LBIA 2WJYA 1HA3A 4ZO4A 3K70C 1E9RA 1E9FA 4HLCA 2G88A 4FXPA 1ZM4A 3FKSA 1ZAKA 1GKIA 1FZQA 1XZPA 2F9MA 4JBXA 2JLZA 3THYA 2HXSA 5BWMA 1NRJB 4KSBA 2IF2A 1FP7A 2IUSA 2VBCA 2DFKB 5CIWA 5DYGA 4LYFA 1YZKA 5DNYB 4D6PA 2GBLC 2AD1A 1IXRC 3W3AA 2W6IA 4Q4JB 3HPQA 4BFXA 3Q72A 4JJKA 3RANA 5FR1A 2MSCB 2F1IA 1KAOA 2OXRA 1CTQA 4AD8A 1ZNXA 4WW0A 4B75A 4X8MA 2P5TB 5SZKB 3RDPA 2QRZA 4TYPA 5C18A 2REXB 3HU1A 2OT3B 4JBWA 5FL7D 1KJZA 1XF9A 4WVFA 1Q1ZA 3KXLA 3SQWA 2G83A 4ACBA 2O8EA 2XZOA 1IQPA 2IA5A 3KJGA 1Q3TA 4KAXA 2NTYC 2QAGC 4WXPA 3SHWA 5H68A 4FMDB 4TLAA 4LV5B 1FW6A 2LCFA 2QA5A 2QORA 4GOJA 4PAQA 4YQFA 1WBBA 4LI0A 1D8TA 1W0JA 4QGAA 1CJMA 1QHHA 5FPHA 2IUUA 1BOFA 4LBZA 2RGNC 2IK8A 3KTAA 1R0XA 3EX7C 1Q44A 1RJ9B 4P3YA 1GWNA 2IT1A 2YWFA 2XB2A 3T1QA 5EP4A 3TQFA 4DRZA 2OV2A 3AVTA 1II8B 2KB0A 2VRWA 3H84A 4TMWA 1FL9A 2B7CA 1N6NA 2KJQA 2BOVA 4R2IA 5TDHA 3QEOA 1UBEA 3LLUA 4JLBA 3W6PA 5L3QB 4H1VA 4LJ5A 5J40A 1W36B 5KDOA 2R6FA 2ZROA 3CUEF 5KDLA 2H16A 1R4AA 1GUAA 5L3SA 1AA9A 3B7GA 3PUWA 5AJVB 1EESA 2CE2X 2IYLD 4NCKA 1US8A 4RD0A 4M1MA 1MO4A 1CEEA 3GLHE 1M8PA 2Z0MA 5HKKA 3U2QA 5DN6A 1FX0A 4MKFA 2Z83A 3D31A 4LRWA 4B32A 4L5BA 1NNEA 3KB1A 3NVAA 1X8LA 1G7SA 3ZVLA 2A78A 3VX4A 1C9KA 3BD9A 5EE3A 4NHOA 2YWGA 1AQUA 2VHTA 2WV9A 2ZEJA 4LHZA 4XSHA 2WJGA 2WKQA 3C41J 3KKQA 3U3OA 3NKVA 4YMSA 1IY2A 2VH5R 1QG2A 4QNMA 2GJKA 1Z6TA 4M1OA 2P6RA 2FV8A 1EGAA 3QY0A 1ZUNB 4B76A 5DHAA 2J7KA 1D5CA 5E4FA 4N1AA 4HEJA 2VTKA 3RRZA 2HJGA 4M9XA 4AC9A 2BKEA 5FTJA 5B2ZA 3I5YA 4OQXA 2FA9A 4ZDIA 4OHXA 2ZJ8A 4D0NA 3Q7QA 3ECCA 5ANRB 3IQXA 1HT2E 3LX5A 1YZGA 1D2EA 3QOFA 4TYYA 4DLXA 1E4YA 1U8AA 1Z0DA 3T15A 2ERXA 3TH5A 4G5SA 5FTMA 4EJSC 4C7OA 1XMSA 3I32A 3CB4A 1GRNA 3K0AA 3K70B 3IBYA 3EWSA 4LHYA 4OL0A 4F4IA 4I1VA 5FUVA 2W2VA 4BFSA 1S0UA 2EW1A 1R0WA 1DVRA 1XDBA 1ZVQA 3EA0A 4V03A 4BEBA 3QPVA 4JL8A 3RYTC 2O52A 3W9YA 2CHVA 1J70A 1SXJC 2JASA 2PCJA 2Z4SA 3AF3A 4M8NE 4E03A 3EPHA 2ODNA 3MSXA 2H57A 4P33A 2D2FA 1RFLA 4YXWA 4ON9A 2EFDB 2G0TA 1P72A 3FPAA 3CRRA 3B8HA 4A82A 4AI6A 4B35A 2OCBA 5C2JB 1ZNWA 3LY5A 3PV0A 4TZ0A 3D7MA 2GXSA 3HR7A 2GTPA 3C7KA 3LO5A 4DDUA 3W8RA 721PA 1MO5A 1JECA 1UJ2A 1W0KA 2LKDA 1E69A 1NLYA 2REBA 4LY6A 1X6VA 4II7A 5D3QA 2CHQA 4UNRA 5KUTA 3AVUA 2QAGB 2QM8A 4BPBA 2HJVA 2D7CA 4PXAA 3VQTA 4LDJA 4UNSA 3PG5A 2HCBA 3U4QB 2AK2A 1F6BA 4Q03A 2CXXA 4JLAA 2QT1A 2FZLA 1TNDA 2C03A 3VTKA 1KI7A 1ZP6A 2ZYVX 3DMDA 3WYAA 2ZRCA 2XOKA 2ATVA 4DSOA 4L9SA 3F0TA 4RFVA 3X1WA 5TXGA 4YDHB 2V6JA 3SBDA 1H8HA 2QM7A 1Z0FA 2HCJB 4B34A 2TMKA 4CT4B 1XX6A 3NHAA 3VR6A 2NO9A 2IL1A 3IIJA 4C0LA 3WNDA 3AUYA 2CNWD 3QBTA 3TAHA 1J99A 1XFAA 2XTMA 4CEHB 2VHJA 2QMUA 3SS8A 2HF8A 4J0QA 3TNFA 3FHOA 1W36D 3L2OB 2FPMA 3E2IA 2ZRJA 2V1UA 2GESA 3VKWA 1IXZA 3T61A 4EAQA 1EXMA 2D7DA 2QAJA 3TVTA 1P2VA 2CE7A 3OE7D 3WP0A 2IYXA 1XMIA 1CS4C 1WRBA 2BBTA 4GFDA 4JLPA 4JLKA 1IN6A 2PZFA 2Q9CA 3I1FA 1NN1A 1M6NA 1SVMA 3K0CA 1E2QA 4UXIA 3KQUA 2O5VA 4DDWA 1T0JB 1G8GA 2PEZA 4M22A 1XCPA 2W2TA 3GLGE 4PC1A 2IYRA 1O87A 2NGRA 2NG1A 1BMFA 2BDTA 3AEZA 4O0MA 4PHGA 2HLDD 3B1VA 1BS1A 5BN4A 2GCOA 2OBMA 3LX8A 1BIFA 4PZZA 2P2LA 1EX6A 2NZ8A 4NDZA 4LOAA 4P4UA 2WWHA 3MJRA 2I1VB 4OYHA 4XOIA 1T8TA 3QBVA 4QGFA 4WBSA 1NIJA 3A1TA 4CIDA 2GXQA 2CLCX 5FPYA 3T5GA 1PUIA 4LK2A 4B3DA 2KBFA 4XVRA 4EJSB 3ETLA 3H2YA 2JJ8A 5BN3A 3RS3A 2OSBA 3O8RA 3QF4B 3UMSA 4Q4HA 4BFUA 621PA 5KYKA 4IKEA 1L8QA 1SGWA 2H92A 3TRFA 3K70D 4TQAA 4V0LA 3ZGXA 1SKYB 3U5ZB 2OHFA 4Z1MA 1SXJB 2SHKA 3KJIA 5G40A
chains in the Genus database with same CATH superfamily
1G21E 3J7TA 4QDJA 4ZHQF 2XTAA 2CHEA 4KQ1A 5A7FA 5BV1A 1WDLA 2IC5A 2YRWA 3QYFA 2J6CA 5ALEA 4ZCRA 2Z08A 1A9XA 3PJEA 3FVQA 1CRLA 2AQKA 4FQ8A 2CCJA 4X44A 3D3NA 4J8PA 4G0MA 1A9RA 4QTZA 1VCNA 1QTNA 4ARZA 5HE9A 3FKQA 5TMBA 1U8CB 4EVSA 1CS0A 2O6HA 4WKBA 4KB5A 1CDEA 4JYMA 2MHCA 5CHEA 4LFBB 4EEZA 2YJ5A 5LZ7A 3VGPA 2XBMA 4M0MA 3PYMA 4X93A 5EG5A 3OH8A 2NM0A 1WTAA 4PNPA 5JMPA 3LECA 4WZ6A 5T6MA 3CISA 2O8CA 1QK5A 4P0PB 2NN3C 1CY0A 3DEKA 3DE6X 1KY5A 4GW3A 4F8YA 2F3SA 2GNOA 5E7MA 2P9EA 4CKEA 1OXMA 2DH6A 3T94A 1WXXA 2VNHA 2ZBFA 3ON5A 3OMLA 1RKUA 3SAJA 3EVAA 4CKCB 2LIPA 2Q4EA 1M1NA 4GMGA 4WCFC 3EAFA 4GEKA 4CIVA 4LVCA 5GOTA 3TRJA 3CLSC 2B20A 4LCBA 2ZSUA 3QVJA 4GR4A 3ZI7A 4POAA 4LJ4A 4BP1A 2ZSEA 1ZGJA 5K6RA 3TOXA 2FKAA 3WDSA 4DLYA 4A4DA 3R8FA 4I55F 4JLNA 4ZZ1A 3VC3A 5HFJA 3ZV7A 2J9RA 3CKYA 3PGMA 3A37A 1A7KA 1E66A 2J9XB 3MBOA 4RKFA 4G2TA 4MWTA 5EJ9A 2IS2A 1IZ7A 5I3CA 1SU4A 5CFMA 3QVKA 2CV1A 4LW8A 4M7RA 5F7JA 1WE2A 5CHYA 1R8QA 2XJ4A 4DR4B 1LD3A 3P0FA 1MXHA 3QWFA 1W52X 3ICCA 3S2YA 4ZKDA 3W9BA 3OEYA 2BP7B 1XTRA 3IDAA 4LZLA 4UCXA 4BTEA 2DBRA 3T5TA 1OPXA 1GT91 4LZNA 2C9CA 2W6JA 4BDTA 4G0UA 4MR8B 3O94A 5MHTA 4JLDA 1ULAA 5JPIA 1FYFA 2JJ2A 4LJ8A 3NDJA 3C1TA 3A05A 4LC9A 4R1MA 3S2GA 4QXPA 2F4VB 3UXHA 2PVPA 2JGJA 2VHUA 5J2UB 1SXPA 3AH8A 1YVDA 1CEQA 3N3BC 3QKSA 3I6YA 4HGYA 2DFTA 4LZOA 3IE0A 4XDZA 1YS4A 3OQVA 5T4HA 2DETA 1WU8A 3ZDEA 4E5SA 1OJ7A 4FFPA 1JG7A 2BDUA 1AK2A 4NJMA 4RWEA 4CM9A 1E5XA 1EHYA 1BAPA 2FDXA 3VNUA 1OILA 1WHSA 2IUFA 2VJLA 1IY8A 1SXQA 1FP6A 2QX7A 2PX4A 1GZSA 2OBXA 3C3KA 1YJXA 3T7RA 3VSCA 4ZICA 4F71A 2XCSB 4J7CA 1QIGA 3GOHA 3ZZ1A 1SWVA 2GRAA 4M53A 3GJ4A 4HDCA 5HZKA 3LQYA 4Y6GB 1VMAA 4PAMA 2O2EA 5JTTA 3CEHA 1I5EA 3QV1A 1I1HA 3WGZA 1TYDE 1WDTA 1QX3A 2Q3MA 2RI0A 3BUSA 6YASA 1NW9B 1DXHA 3E3MA 3DUFB 3ETGA 2QW8A 3HMQA 2RBEA 2YJZA 1PZGA 1V5IA 4Q18A 1UMCB 3WNDA 2GO1A 1UK8A 4JL6A 4OUDB 3UAWA 1DQRA 3DDOA 1IY9A 3MUEA 2ZSBA 2F3RA 4JP1A 3FVRA 5AW7A 3R9XB 1ORTA 4RA6A 1SQ5A 1U9IC 1P8JA 2MSLA 1XPUA 5I9BA 3CH4B 4GBED 1X7YA 3L4EA 2HK8A 3PXUA 1A5AB 1UZLA 2BBOA 4P54A 4I14A 3ISTA 4Y1RB 1XMQB 3WNVA 1HYBA 4KFSA 3I9JA 2HJ9A 3N28A 4PV7A 3BREA 1MNQA 3EG5A 4N0PA 1PV1A 3FKSD 2OD2A 3GZ4A 1G20B 4HXEB 4UULA 4B81A 2OBNA 4BIIA 4ECEA 2HQBA 4NXMB 1IWPB 4QM6A 3BMCB 2GHRA 4N48A 4LYEA 4EW6A 3PCRB 5JDCC 3RVRA 2W0MA 1P2SA 3WL3A 4IMRA 1PT5A 3L46A 3SYTA 2OCAA 4HVAA 4YT2A 5MDHA 3UMRA 1M5UA 1REQB 3ACBA 5C37A 6AT1A 4MCAA 3L8ZA 4DBZA 2NSHA 4BRUA 1OMOA 1U2TA 1MEOA 2JFOA 2C07A 3NOQA 4OQ4A 3SZMA 4H4DA 4MV8A 4FE3A 1K9SA 5HFNA 4ZYVA 4CNBA 1WPRA 4UTZA 5EKTA 2MDTA 3NOVA 2WD7A 3DKVA 2VTBB 1DIRA 4F7WA 2HHJA 4NV1A 3Q8LA 1VHWA 1P4GA 4ZVSA 3UK1A 1HFKA 3MBIA 4F96A 3L49A 1ZIDA 5DBHX 3M0EA 5M7EA 3PR3A 3TCKA 1P9LA 2GEUA 2HK9A 2HV9A 2DFLA 2BBSA 2P11A 3B1YA 5CVUA 3LT4A 3V33A 3WLIA 1EXVA 1ORHA 2CL0X 4BAUA 3I1YA 2FPIB 2R65A 2ZJ5A 2H4WA 4EM6A 3HKDB 3LT0A 4MRMA 3QKTA 2GSWA 3DFUA 1QHFA 4P1ZA 3GYGA 3X1XA 4YJ3F 1PR2A 2FVYA 4HNRA 1YT5A 3I2HA 5CM9C 4E5NA 8ATCA 1Q92A 1WUIS 1Z62A 2NO5A 2AYXA 4H35A 4XXHA 3AUSA 3OQHA 1IVSA 1OW3B 1VJTA 4RTPA 3THWB 1QVVA 2JGNA 1ZIOA 1P3DA 2HDNB 1NVAA 1CV2A 2EKQA 2WKPA 3N53A 5CB4F 5FEUA 4KWHA 3VTAA 3WL4A 1M2VB 1U7ZA 3FYUA 2FPGA 2AN9A 1RYHA 4I99A 2GBFA 4KXMA 3V8QA 3GRKA 3PNMA 4PZLA 3R7LA 8ADHA 5JCZA 1OC4A 1YGYA 4C08A 3CF4A 5AK4A 4A36A 3VDNB 1SOWA 2HT6A 8GPBA 2C9BA 1XZNA 4HZUA 3QVXA 5DWVA 5ALPA 1P9WA 4MOWA 1SKYE 3AJ8A 1V5WA 2WD8A 3ROQA 2CZQA 4JJFA 3GUCA 5KHLB 3A26A 4RACA 3HB1A 1RPAA 3FYSA 3LKDA 2RBKA 1W85B 3KOWA 5LL6P 1PYGA 4HWTA 4HQ6A 2ADFA 5IDYA 2P9GA 1Q2UA 4BKOA 2LKCA 1H9BA 1J8YF 2QGZA 1C4OA 2B98A 2CEAA 2ONKA 4OQFA 2VOEA 1EBFA 3DF9A 3PJDA 4WN9A 2Z2KA 1BOOA 1WQ3A 3LC0A 2G82A 1Z07A 2EVWX 4TUYA 4YNBA 5LP6C 4ZU6X 1DHRA 3VHLB 1U2RA 1IZZA 1ZNZA 4W82A 1HYEA 4RELA 3BTSA 2AW5A 1P7YA 4WGFA 4XPIA 2RJ3A 3FOCA 5BN4B 2GCOB 5EKUA 4DLBA 1B93A 1HDEA 2WYIA 1FLVA 4RDXA 2H7XA 3F96A 4M1EA 1KDTA 2CWWA 4HNTA 1YJAA 1G8PA 4IAOA 3DLIA 4XVCA 4PX9A 1T15A 2I7XA 4EJMA 3AG6A 1R10A 4F3YA 4MINA 3AIIA 3G89A 5TQ0B 4MMYB 1GADO 2C97A 1MU0A 2YDXA 2AV6A 4YTEA 1HMYA 1KOLA 5BN3B 2YWXA 1O54A 3DOEA 3TI7A 1LDBA 4Q4HB 1KORA 3D4OA 4GL2A 1PJCA 5CGZA 3WKBA 1CZUA 4X41A 4WINA 4BO2A 1E6EA 3UJBA 1PYDA 2IHYA 2WM9B 3KFVA 4TYMA 2H3HA 3THRA 3ZX4A 3VR5A 3WDKA 5B58T 1IG0A 5KZMB 4MUBA 1SB8A 4YUWA 3H2GA 3AKZA 1X1CA 4QHSA 1YDFA 4UAGA 1A9XB 3PTLA 3G8DA 3PC2A 1GGNA 3Q9UA 1P1KA 3RARA 5AW6A 1SURA 4C5AA 1PDVA 2H17A 1KVRA 4YASA 1FBNA 2VP3A 5CVDA 3AOEC 3WWOA 3DYVA 3J81k 4KIFA 7MDHA 1E8MA 2GWRA 2DPGA 2R86A 3LKBA 4OFXA 4UNPA 3WLRA 1CS0B 1EINA 2HHCA 3T7SA 2J3HA 1J2TA 3HY4A 4PFSA 5HF8A 4YMUA 5L4LA 3TX2A 1KIFA 3CH6A 2P6OA 4O2LA 4OCZA 3RBXA 2HCRA 3A04A 1OB2A 1Z5ZA 3MFQA 2AUNA 2HA3A 2O8CB 1FFCA 1R0SA 2WKRA 2ZR7A 4ALKA 2PX8A 4ZPJA 3CXUA 3L06A 4CMIA 3MMXA 4AWBA 2ACVA 2HHLA 2YYSA 4M76B 3ZNNA 2VDRB 3DMNA 5EZYA 1HV8A 1B43A 1FSFA 3T7TA 2Y4OA 4BO7A 1QIJA 1M1NB 2J3EA 3T06B 4DREA 1WXEA 3QPUA 1QZXA 3RK1A 2DWQA 2H1SA 2C0PA 1QH1A 4WZAA 3E5MA 3GAFA 1EWRA 3GAAA 3AVWA 3FWYA 1Q22A 5U4QA 1NT2A 3VSDA 4QFBA 2DX7A 5J2TA 4FM9A 4PZUA 1H8HD 3ZQ4A 4C7XA 3ER9A 3WBJA 4KIWA 5B3JA 3HC7A 4ETIA 1SBNE 1QVAA 2QRPA 5FTWA 3FPSA 4K6HA 3B3JA 5BQPA 1YUNA 1XHLA 2C54A 2C5GA 3IQDB 3K0HA 4JMPA 4OLJA 4RM3A 1RTTA 4S0XA 2C8JA 4YALA 3TK1A 4EF5A 4DSAA 5CEEA 4D6XA 4CHTA 5FIUA 4I5DA 3BZUA 4GMHA 4F9TA 3AFIA 2ZYAA 1TAQA 2XWQA 5BRNA 3BL8A 1AHNA 5HKBA 3MILA 2B4YA 4X24A 1KI6A 2WF5A 4P82A 1FDUA 1KNXA 4GBJA 4MQUA 3UMVA 1KO8A 1P2DA 4G0PA 4GVLA 3VX3A 5AVYA 1FSPA 1ZITA 2QMZA 2W11A 1U1FA 2LXNA 1Z2CA 1VL2A 3KAPA 3BGWA 2KLHA 2PZGA 2XDYA 3KE8A 4IV5A 5T8KC 2HQRA 3QHQA 4NICA 3QLUA 1G5HA 2W6CX 2J09A 1DBSA 3A1CA 2IHVA 4J1SA 4WOCA 3QKSB 3SNKA 3HPRA 2PKRA 2GNPA 5C46F 4ZZ0A 1QYWA 3HXTA 2A9RA 2A14A 2AN1A 4J3JA 1G291 3UB3A 5EJEA 4KO3S 3BERA 3BULA 1H3FA 3HHEA 4LY3A 1WHSB 4DEYA 5IT9A 2EFEB 4UM7A 4Y1GA 2DRIA 4AS3A 1Z83A 1TVCA 1R74A 4UDOA 1GHTA 2G06A 4D5GA 1QGED 4RXUA 4BZQA 2WF9A 5KJ1A 1OYWA 2GDZA 2CDRA 1PG0A 3ABOB 1KQOA 2WYHA 2XGOA 4L16A 4Y1FA 4B3JA 5LLTA 1HE3A 3HJNA 1NMXA 4D8TA 4XIIA 4ZZ2A 2BL4A 1P39A 3ZIAA 1QR2A 4C0HA 3CHYA 2LNDA 4XYBA 3IPAA 3N9IA 4I1YA 4UHFA 1Z2DA 5TJ9A 4CG0A 4AW9A 1UDCA 3RU3A 3T52A 1WNFA 4RAQA 4HDNA 2H1LA 1YNSA 3WGTA 3WWDA 2ODWA 1GIAA 3ZVMA 1JZQA 2VYQA 1OAKA 3OESA 4AT1A 4U0JA 1EFVB 3A3KA 2WHQA 4Q15A 3SDBA 1X7ZA 2AYZA 2C1EA 1EJ6A 1KYTA 2H7VA 1NF8A 2DPYA 2FWPA 2ID4A 2Q1TA 3H5LA 3JQGA 4RA6B 4Y2VA 4ZVMA 1H94A 2BGIA 2P2YA 4FJ2A 1SHZA 1P91A 3GEGA 4GUDA 5DGTA 3VZSA 4F5ZA 4OV6B 5EMNA 1Q11A 1YQDA 5F1OA 2C2HA 2C04A 3DBIA 3CA8A 1BHQ1 3LBIA 1KS2A 4GOOD 4BFWA 4CMGA 1DFGA 3TAXA 4ZJYA 1PGNA 4HBZA 1DBWA 2C5FA 3PD7A 5SICE 1TZMA 1X1EA 1T1GA 1INLA 2ATXA 3N8GA 1KVQA 1QM5A 3LWBA 4QOGA 3SVLA 2D0DA 3OOJA 1QFSA 4QPJC 3CRQA 3JZAA 4EMTA 1FJGB 3OVMA 5DHUA 4XIJA 4MWBA 4COKA 4MB2A 3FTFA 5IAOA 4QG7A 5AKIA 1JVBA 3ROKA 5JAMA 3FTQA 4AMZA 4YA6A 1ULSA 3BFXA 3IUYA 3PSHA 5LKRA 1G9XA 3LY8A 4MJXA 5CD1A 3C7DB 3L6OO 1RWWA 4ISBA 4I50A 3MRXA 3ZG6A 1GYPA 3DP9A 3ND5A 5DTMA 5JSUA 4I9HA 2DQYA 3GJRA 4EDFA 2EZ9A 3LC2O 3OJFA 4TXNA 1JSZA 2X0IA 2ZJ3A 5LP6F 1NYTA 1YMVA 1UCFA 1B26A 2IIQA 1UWLA 5KQRA 1OIWA 4PZCA 4CXMA 4CM6A 2WJVA 4D9FA 1LF0A 3MELA 4KJZA 4AU1A 3GPLA 4AY2A 3QVUA 2PA0A 4KWTA 3O73A 4N0EA 3A4MA 1CW2B 3MM4A 1USGA 1HLPA 4FYVA 4JGIA 4NZMA 1QHSA 5IK2A 1F4VA 3N39C 3JWGA 4IEFB 2Q46A 4LZZA 2CSUA 1E2MA 1ZBQA 2R2GA 1DTEA 1II0A 3U1VA 1AO3A 2Z4RA 4LF8B 5HP4A 1L5GB 3B6KA 2EJUA 4D4KA 1JJAA 2JF0A 4QPCA 2DY0A 3Q98A 1G3RA 2L18A 1OFHA 2GNAA 4KPUA 5IC5A 4EHBA 3FYUB 1BD4A 3QFHA 1F2UA 4KG7A 4CV1A 1OI2A 5I9IA 3LD9A 3TRIA 3F9CA 1IG3A 1LK0A 3A1SA 3VR2D 2B7LA 3L3BA 4BECA 4EG8A 1PHRA 5F78A 4X9XA 1OZGA 3IALA 4DJTA 1B42A 3OAAA 3CR8A 4UDXX 1QOPB 3AU8A 3LBNA 3MYRA 4NL4H 4HZUB 3TKLA 4OEHA 4DKXA 3LQFA 1ODKA 1OVGA 4KQHA 1N5OX 3K0FB 4AJ2A 2XGMA 1R5NA 1Y4DE 2NTVA 4MKZA 1G3QA 3RSOA 4CL2A 1VXOA 2GAJA 5LC1A 3V7YA 5EP2A 3ND7A 4RY0A 4BLRA 3O2SB 1EDOA 4Q39A 2HA7A 1Z5UA 2TYSB 3SOPA 1C3EA 1OWPA 3PFNA 3R5JA 3RC3A 2J3LA 2R6DA 3PQ4A 4JL5A 4U6SA 2HEIA 5C81A 5EIBD 2IODA 2J87A 2V7UA 4OLFA 4ZWNA 3TX6A 3VYSB 4ND7A 1F2TA 3LUCA 4D0RA 4WN9B 1JDBB 3C43A 8LDHA 5E38A 4D5EA 4MVJA 4IIEA 2FSIA 2VSYA 2NP6A 3KUDA 2Z2YA 2XAAA 2F90A 5KREA 1OV4A 4WNCA 3ZDXB 3GBPA 3UCFA 5BPHA 1XA4A 3PR1A 1C1YA 2HNBA 1E8DA 1MG0A 4XPIB 5HMLA 5C0OE 3TLXA 4BC0A 2JLXA 2DUUA 3CVJA 1AV7A 1KOJA 3CMMA 3OU7A 1G8KA 1CUFA 1PR3A 4FN5A 2IKSA 3A4TA 4MIEA 5LIRA 3PQCA 3PIIA 2JS7A 4HAIA 3RFFA 5JMOA 5TT0A 1T3HA 2ZYHA 3O2NA 4G84A 5DOZA 4QU0A 4G6ZA 4E5VA 1PHPA 2X4LA 4DMRA 2ZE6A 2B6NA 2ZPTX 3E9MA 4R6WA 2IYTA 3ILHA 5EE1A 2OB1A 3CUUA 1X8XA 2H52A 3MRTA 3TSAA 1MX9A 1IZ9A 1RACA 2JH3A 4WAUA 3WYCA 1X1DA 5CBKA 3CF2A 1PZHA 2F00A 1VGVA 2IEYA 1Q0UA 3GT3A 1L3BA 4GLJA 5HG0A 4RKQA 4G9BA 1QTIA 4HDAA 5KPDA 1IM8A 5JH7A 3COWA 2QTWB 5K8VA 5FNVF 2QV0A 2PGOA 1VP9A 5CX4A 1ZYUA 1RQLA 1ICEA 3T5BA 3AM4A 3UWDA 1N2JA 2XMQA 4FWTA 2HB6A 2HHAA 3KYIB 3D4BA 3PRYA 1ISMA 5AM3A 4NU6A 5A4MS 5SYMA 1H69A 2NPFA 3T95A 1AS2A 1DBVO 1C2TA 4E4TA 4FX5A 4L5JA 2W2NA 1KJ9A 4ZODA 2V7QD 2IOHA 2QT0A 4RTSA 4TKUA 4DR5B 1UADA 1CB7A 4I1IA 2YOHA 4ZAXA 3GEHA 3I2IA 4AJJA 3IP8A 4RZXA 3ILSA 4RF3A 3RWMB 5HZHA 1OLSA 1DOHA 1FUUA 2A35A 1X7GA 2XXAA 2PFSA 4KQ2A 2UXDB 1KYYA 1L1QA 3EXAA 3USES 3UT5A 3CWQA 3PE3A 1YRAA 4FX2A 4C0SA 4RUKA 4V2IA 1H2FA 3F8SA 4NEHB 3H04A 1TJYA 4NR0A 1ZD3A 1U3VA 4LHVA 3QWIA 1A2BA 3JVEA 5FQNA 4CMIB 1G7TA 2A5JA 4LMAA 2HOQA 3OWOA 4D74A 3KETA 3QW2A 2GN8A 5BSGA 3TGPA 3SMVA 1GR0A 3K09A 4DNXA 2JFGA 2P7IA 1YMUA 5IAJA 1QZ3A 5KVAA 3MXTA 2CLIB 4BO1A 4N9QA 3UWMA 4O4LF 1FLDA 1QH1B 4WZAB 3GUZA 4QTUB 2VDKB 4PCLA 2WHRA 4FBLA 4D3XA 5J2TB 1E1DA 4M1YA 1RSZA 2C9YA 1OKKD 2D2XA 3BGOS 2WM3A 4V0MA 3HWSA 1L5YA 5I9MA 3TSOA 2PUFA 1QQ7A 2LVBA 3E23A 2FB9A 3JYQA 1T9CA 3O8QA 4U02A 3Q6NA 3W1WA 1ULTA 2FEWB 2VDLB 2YV4A 1O7JA 2FW6A 2JIQA 1TEXA 4WKPA 4N8EA 3K4HA 1GUZA 1JE1A 1QRDA 1R18A 3DE7X 1Y6QA 1YZNA 3ILVA 2XZDA 3R0VA 2LCQA 4YR7A 3DTNA 3M9WA 2PE5A 4INZA 2H2WA 3ZE0B 5B6IA 1SOMA 3O2QB 2GPNA 4NAHA 5JCJA 2AUTA 3O1HB 4RABA 4YRGA 1FS4A 3V3KA 3SI7A 2B30A 3A1VA 3ZWKA 3C3AA 5T64A 3BA6A 3O9VA 5K4GA 3DDSA 2D4HA 2RB4A 3LOQA 3HM9A 2B0JA 3VPBA 4LXHA 1VSTA 3ND8A 4UD2A 2MIIA 2PEYA 5JNSA 3GFFA 4Q82A 3E18A 5BYKA 5CLLA 5DW3A 1TQ6A 1H2AS 3U0BA 1WKVA 4PS0A 5LUBA 1GO2A 4UUPA 1T3TA 2Z5LA 4NE9A 2O4CA 3QLVA 2P91A 3B6EA 4HAXA 1C9MA 1WU7A 2R96A 2FUG1 2GM3A 3TDKA 3VKGA 4GYKA 3J80A 1ESMA 4ZXFA 2ZKLA 4RHTA 4KPEC 1I13A 2D06A 5JALA 1N5JA 2FLVA 3NV9A 5SZJA 2AFVA 4ZCSA 4I4CA 4KGDA 2G80A 2BN4A 2R7AA 4P3KA 4GI2A 4DNOA 4DE5A 5HZGA 5IC4A 1OB5A 2FQ1A 3STVA 1LBQA 2C8KA 3HCBA 4K6FA 4BFVA 2PUDA 4QUJA 5FLXA 1QUEA 5ALSA 4YAKA 1RBQA 1XROA 1WEKA 4GSKA 2ACEA 2FSSA 3R3JA 1JVSA 5HCUA 3N2KA 3F8WA 1QONA 2JJ1D 1ZSYA 2XOXA 1A8UA 4QZVA 5HS4A 4XOUA 4HDNB 4IDAA 3GT4A 5HF5A 4DLZA 3W34A 3LKZA 4CDGA 1PTKA 2EGHA 4XYGA 1TB4A 5ESXA 1K63A 1P3JA 3HP1A 3TMAA 1N9GA 5C8DA 1JAZA 1X7ZB 4PO1A 4NMHA 1ENPA 1GPJA 3EXEA 3KUKA 3JQGB 4QUIA 3EQ7A 3SHVA 4YO7A 3O9MA 3UUFA 4Q0MA 1HNZB 3KD2A 4HFNA 1Z28A 3U60B 4GUAA 4BJ3A 4JBGA 2QLFA 3C5VA 3CPJB 4Q3LA 4CKZA 1YBFA 3HCEA 3R74A 3DKRA 2WABA 3CNLA 3R5TA 4Q4JA 1NVKA 3HBLA 1E62A 4X20A 2PUBA 2GFQA 4H6PA 1E0DA 3GN2A 1B0AA 3OZEA 4EBFA 5YASA 1GG8A 3UGJA 2B1IA 4UVHA 5M3BA 2H65A 2HI0A 3D6MA 1JXOA 2GZ2A 1UFVA 1Z06A 1N36B 2VI5A 4HP8A 2QE7A 1A4IA 1KMMA 4D9HA 1NR7A 4JLJA 2GCNA 4OSPA 3O83A 3RK4A 1RWQA 3KC2A 1E60A 4RVDA 4OYLA 1C50A 3O2JA 4IFBA 2DY1A 3O38A 5BT8A 2P5YA 2FSVC 3FD8A 4XCVA 3V42A 4M4SA 3BXGA 1RTKA 4JROA 1CY2A 1NUTA 1NXPA 2IIPA 2OHXA 3IT0A 2RH9B 1LS1A 2WJ6A 4I50B 1QHXA 4XVQA 5F12A 1IEVA 4A8TA 2WWYA 3CLRD 1L7DA 3IERA 5JSHA 2BE9A 2H1FA 3A4VA 1SVLA 2AMJA 3FJOA 1QF6A 3NAQA 3S55A 4KMOA 3INNA 1L7VC 4O2BA 3KQHA 5DM1A 3I73A 1U4NA 3ZWDA 4RPJA 3FGPA 2ZZKA 5BNZA 3A1UA 7REQB 1ZCZA 2WJPA 3HKEA 3O3MB 4KSCA 3OE1A 1Y3BE 1JQAA 4B8WA 3OO1A 3HU5A 1JFLA 2FOXA 2W4QA 4P34A 4Q47A 4HGZA 1RQRA 2W48A 4K28A 5BV8A 1JF8A 2ZYDA 1PT6A 1RADA 4WVLA 4U9HS 4F2GA 3UYLA 3K9CA 4HLUA 5KTTA 2FRDA 2W9XA 4LDPA 1ECLA 2I3BA 5IAKA 2GILA 1W94A 3B82A 4Z6KA 2J6IA 2FE4A 2NZYA 1RXYA 4KPUB 4BMZA 1ZK3A 4DA0A 1BCSA 1XBTA 1GTRA 1F2UB 5ITWA 1MDFA 2WB2A 3V1UA 4FNOA 3GGCA 2W6ID 4MRVA 3R09A 3RUFA 3BD6A 4UHEA 4W7SA 1ZINA 2QPAA 1I24A 4QUKA 4CKBA 4GGOA 3V8RA 2XZLA 1DE0A 1WPGA 1XZ8A 4RHCA 4HQ0A 5CDFA 3AINA 3TBKA 1E9EA 4RADA 1E2JA 5KBYA 3Q0TA 3AGQA 2HRBA 1GNVA 4X7PA 1AY0A 1JA1A 4IFIA 4MVJP 4W1PA 4Y3UA 1ZH6A 1R6UA 1KK0A 4GM0A 2VRBA 3O3NB 1D4FA 3L1KA 1R5BA 2ECQA 1JU4A 2FW9A 2I5PO 3DMGA 1Y8AA 5FWAA 3T99A 5CITA 1TF2A 2P0AA 1FNMA 5CU7A 3S2FA 1F2TB 1AZLA 2QROA 1JFFA 2UUAB 2Q0HA 3X1MA 2XXBA 3FIUA 3V00A 2FPOA 4YCNA 3ZDBA 5DHQA 1D6MA 1W0JD 1PNQA 2PKCA 4K9QA 5JCPA 3HXKA 1U8YA 4DEXA 3ZHCA 4BASA 4C4OA 2HMWA 3HYNA 4J49A 4X6YA 3KL4A 1XLTC 4J4HA 1WHTA 4YJ2A 1SA0A 1Q0LA 4BFZA 3DVQX 1PEKE 2O4UX 4I66A 2XKBA 3L6RA 4FSXA 1VPVA 2BGMA 1KP9A 1NUQA 4L6CA 2QVZX 3OCZA 3NBAA 3A4LA 3MD9A 5ELLA 4C87A 5KWIA 5TARA 2UZ4A 1U3WA 1UT6A 5BVGA 2XRZA 3HEAA 1EVZA 4LWPA 4CLEA 3A2NA 3GNTA 4XQGA 3ABQB 3M2TA 3H19A 3N6RA 1MIOA 4CMEC 1X42A 4Q7QA 2V55B 1D6JA 4YRTA 1SN7A 1CVLA 2H4JA 3N3AC 4PY2A 3LFTA 2I4MA 5FUBA 2EATA 1K3TA 3WL6A 1CJVC 1YI8A 1P1FA 4GWKA 5TVGA 4Q9LA 3WBFA 1RI1A 3EZXA 3KU4A 2PN1A 1EJBA 4Z3DA 3V2GA 4A8HA 4EA8A 2XA2A 3FPCA 3KD3A 3RJ9A 3PKJA 1E3IA 5HKKD 2E5WA 2XADA 3A4IA 4Q3CA 4IINA 1E2EA 1ECPA 5LOVF 2RHWA 4G5HA 1NF9A 4BCBA 3PUXA 1E3QA 2EEPA 3DMTC 2I8AA 1OYYA 1D1QA 4BVFA 1G4HA 4R3NA 5DLYA 4C4XA 1CBUA 1Q7BA 5B3KA 4QYIB 4JASB 4EH1A 1GFIA 4RNCA 3QHAA 3LUFA 4FFNA 4TKUB 3SIRA 1XTUA 3E8XA 3IT1A 3ZDZB 3CZAA 2IEZA 1VE3A 4M98A 4UU1A 4DCUA 2BFMA 5FV4A 5MFPA 2QAGA 1O03A 1W34A 2J85A 2YHSA 2AR7A 4DDVA 2XXAB 4P7JA 1Z12A 2OORA 3MGCA 4J76A 4U2GA 2IITA 5DYIA 4V39A 3G1TA 3NNSA 1BKDR 4EB6A 1PTJC 1UDWA 2CCGA 4Y6OA 3D8BA 1ZICA 4B3XA 4YCAA 3IDSA 3CNHA 4U7DA 1JJBA 4QXQA 3E81A 3ZCUA 1X38A 3DE4X 1NQUA 3P9XA 3K0SA 1RM4A 4RANA 2C2OA 1WLSA 1EI9A 3CTMA 2R8XA 1MFPA 1BE6A 3REQA 4ZFNA 2ZB7A 4DB2A 2Y2VA 1WUTA 1IIRA 2LBPA 3OSZA 3AEXA 4UPDA 2IWHA 4A91A 5D2CA 4RAOA 2JEOA 2WOOA 3BXPA 3GEDA 4EGQA 5I45A 4C4TA 1NFFA 3DZIA 3H5WA 5DWDA 4MHTA 1I80A 4LC1A 4MR9A 3CVYA 2R8YA 3F47A 1IAVA 1Q7RA 1UBMS 4R2XA 4J3NA 1QF7A 3Q7PA 3W90A 3F3KA 1E7QA 1NU8A 3B3FA 3CVXA 4NF2A 2D2VA 2EX1A 4HFRA 1EFUA 3A14A 2J31A 4GVXA 1GQOA 2JGLA 1JHUA 3U19A 1PK9A 3RVDA 1R6TA 4OKIA 1QBGA 5JHGB 3CXRA 3HE3A 3M7IA 1WSDA 1DMSA 3U13A 4RK5A 5CR9A 2Q7OE 4B6SA 2ZRGA 3CVWA 4DS3A 1K5GA 4TQGA 4BUZA 4EEXA 1Q1BA 3HBNA 5FUYA 4C4PA 4IDFA 4EGCB 5I7FA 4ZQIA 2V65A 1VMEA 3KLOA 4Q16A 4IIUA 2Q8PA 4OATA 3BAZA 1XTSA 3MD0A 4GYYA 3TNDA 3ABRB 3QI2A 4JZKA 3GN1A 2Q27A 2HKIA 4H6VA 4QHYA 1DC4A 1KFBB 2DERA 1YHYA 3PKIA 1CNEA 1IEXA 2WG0A 4JWTA 5K1ZA 2W93A 4MDEA 3HKCA 4TLEA 1VI5A 4CN9A 2Q3DA 5ALWA 1E1RA 1LTQA 4QUBA 1V35A 2RHGB 3HI4A 3WMGA 4FB5A 4ALIA 5GVSA 4Y2TA 2IYPA 3P20A 3LCMA 3NX4A 2C0QA 4H3HB 4R16A 3RBAA 4M9CA 4JK3A 2CK3A 4CU5A 5EHGA 3RC1A 4I46A 4ZU1X 1Q2XA 3IIKA 2QG4A 2CW5A 3CF4G 3BGDA 5SZHB 3PT5A 5KNCD 1Z6GA 4W9RA 4UMDA 3ASVA 3WLQA 1UBKS 1MZPA 2FCRA 1FVXA 1ILEA 1QC5A 3OZVA 1SM4A 3AR8A 3PVSA 4WLOA 3I0MA 3X2SA 2YX1A 2D1QA 3V1KA 2ZSIA 4BB6A 4EFLA 2Q5CA 4B4OA 1VHDA 2WLSA 3AHEA 4HYQA 2ZYWX 3SXUA 5D86A 1G2OA 4IO0A 4EEKA 3LIIA 4O2AF 4YJDA 2HIGA 4ZPXA 1EP3B 5BQ3A 2YN0A 1M67A 1E20A 3H3JA 1NKVA 4MRPA 1MFZA 3N2KB 5GP1A 3R0JA 1ZNYA 1WOMA 3GU3A 5AVSA 2PRSA 3CN7A 1UFKA 4YMHA 4ILEA 5LYYA 5LXTF 3GPIA 1B1AA 3DH0A 4Z2AA 1WUKS 5HJ5A 3VNBA 2ET6A 3D6UA 4NZ9A 2ZUWA 3ND9A 4FIDA 3RIGA 4NYMR 4XQ0A 3WP1B 4P08A 2CBZA 3LUKA 2HLPA 3MRSA 2FWBA 5TSDA 1DL5A 1KMQA 1QANA 4Y2JA 2RHHA 3YASA 1H0HA 1YR6A 3MJ4A 4YAOA 5IAAA 1XAJA 4DV7B 4UZFA 4YRCA 3GGDA 4B8ZA 3K6JA 3AUFA 3A0UA 2HBRA 1W93A 1SVKA 4A26A 2GBGA 1SVSA 2OPBA 3EZGA 4HF7A 1D4AA 2AFHE 2J6BA 2QUAA 1HG1A 3GRAA 4PYLA 3K94A 5B4VA 1XDSA 4P7KA 1W44A 2OCXA 4HDRB 4X20B 3PUHA 2E6KA 3C4JA 2J46A 4NRDA 3UK7A 1PS8A 5I5EA 1RM3A 4MWGA 1S01A 2PSJA 1I30A 4PCUA 4EWLA 5AW3A 2FEAA 4CUZA 3IIIA 1SC4A 4ZO8A 5B6JA 3P4YA 4L50A 3DUWA 1BMFD 3OCVA 3QENA 4LSWA 4BX3A 5C1BA 1O96A 5TMPA 1V41E 4MV9A 1E2IA 1OXBB 1V43A 5FI3A 4D96A 2CKMA 5ICCA 2WG2A 1IOWA 4HJXA 4KQWA 3FZEA 2GYVA 3UH0A 1M3SA 4JBYA 3ONVA 1UOQA 3NH6A 4RL4A 4ALLA 5K3BA 3FCOA 2G9UA 3F6RA 5JWHA 4BNTA 5J4HA 1YMQA 3LQQA 1GL6A 1DIHA 1PO7A 3H4MA 2HDHA 3CRMA 5BW4A 1N2OA 1FXWF 2AJDA 3TOZA 4DM4A 2A2ZA 4RCYA 4JYBA 3STYA 4MYCA 1FZTA 2AXQA 1RPNA 2YOGA 3FWHA 3C0KA 1QQAA 1WQ1R 1KZ9A 3G23A 2GK7A 1JR3E 3CPEA 2FR8C 3T3MB 2WIDA 3LTNC 2XVYA 1SBYA 4O2BB 2OGSA 1TJ3A 3P0RA 4L8WB 3FRJA 1XTBA 1KI2A 2XJ9A 4ONEA 4UTOA 2C7BA 3UMBA 4D9JA 5B2FA 3ZDDA 3I9KA 1YQUA 2NO1A 1U9ZA 1UL1X 3Q8MA 2E89A 4FD3A 2QMQA 2R87A 1R0CA 1V11A 2NLOA 1U02A 2XIQA 6CHYA 2PJUA 1A04A 5JRZA 4HLQB 4L4SA 4O59O 5LPNA 3MTAA 3S1AA 1YACA 4HXYA 1NVVQ 4FOTA 4NAVA 3BD7A 1QE5A 1E7WA 4XWGA 3EZLA 2C2KA 1P31A 3AR3A 3VVLA 4GHWA 4JJ6A 4B47A 4EY8A 5JWOA 3EIWA 1XZMA 3BSFA 5AMXA 4GX5A 3QY9A 5IT4A 4CKBB 4KH0A 4A0RA 1N6KA 1I2DA 1QPBA 3KJHA 1ML3A 1XU9A 1JBKA 2AJCA 3KR9A 5F2OA 2CUTA 5ITZB 2RGXA 5CTAA 3NIBA 4MPPA 3VPAA 1N3IA 1T0UA 2YWBA 3CWZA 4NH0A 1EX7A 2YJNA 1E2PA 2Y3IA 3NH9A 4ZQCB 1AGPA 1CY6A 2KS6A 2GM5A 3HSSA 4HRXA 4DOMA 1UXHA 2XMDA 1YC2A 2X9GA 5BQXA 1DJNA 1XTJA 5K6AC 3UJ6A 2HREA 2XT6A 2X1VA 3LBHA 2D0PB 4OK5A 1JKXA 3F7NA 5E7IA 3ISJA 2X19A 3EA5A 3T3NA 3TSWA 3QJ5A 1GM5A 3FLEA 3H87A 2QLJA 1AV6A 4DTCA 1K98A 3PGJA 2HGSA 4FGSA 3RW9A 4XGNA 1Q14A 2XNJA 2ZTUA 5D3MA 5AVUA 3WWYA 5BY2A 4MX8A 3CGGA 2YXBA 1LFAA 5IRCD 2B25A 1I4DD 4EHIA 5C5IA 4YJ2B 5BMVF 4YP5A 1WHTB 2CLFB 1WO8A 1F1JA 1Y6RA 2ZPAA 3F5QA 4G24A 3VUFA 2VHXA 3EQ2A 5EA2A 4JAVC 5EEGA 3RVPA 1R6AA 1ZK1A 4JR2A 4L8GA 2IS4A 5TGDA 1UAYA 4JB2A 3HA3A 2ZXUA 3AESB 5BVGB 4PIMA 3D4LA 1ZGBA 1Y37A 2JLCA 3MCWA 1E6KA 3WK6A 4IOMA 4BLQA 3TGWA 1FQKA 2XSZA 1MIOB 1O94C 3V8PA 4X1OA 4C7BA 2VQFB 3MUFA 4RVFA 4RZUA 3U81A 3IULA 2XUHA 1POWA 1T8RA 3BMXA 1DUSA 1JHPA 5D6OA 2YKGA 2BI4A 3BWVA 2BGWA 1PW5A 2W6JD 2R48A 4TRJA 4ENWA 5IULC 4UE2A 3I0NA 3ZVNA 3DGFC 4J16A