2D06A

Human sult1a1 complexed with pap and estradiol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
b'SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The structure of human SULT1A1 crystallized with estradiol. An insight into active site plasticity and substrate inhibition with multi-ring substrates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d06A00
3GFPA 4AG5A 2C98A 4IDOA 1NVUQ 5JBQA 2OFWA 2JLVA 1GKUB 2B21A 3UWOA 1QZXA 1ODFA 1RFLA 4ZDIA 1R0ZA 2O8FB 3IQWA 5DI3B 4B3CA 1F2UA 3SS8A 2GAAA 3K09A 3CH4B 4A6XA 1D8TA 3A4LA 4TYWA 1YZUA 3PCRB 4F4CA 5JECA 2NMVA 4LI0A 3BAFA 1N2CE 4AIIA 5HPYB 2FGJA 3AKYA 3VHXA 2RGDA 5GJWC 2IT1A 3QXHA 2J45A 1B0UA 1KDTA 2V7QD 3LO5A 4EPWA 2BMFA 2ZVPX 1MO6A 5GJVC 4BRWA 2BMEA 2YWHA 3WHKA 3C4JA 1VG0B 1Q1BA 2WJJA 2BDTA 1E9FA 1JR3A 1T6NA 3CPHA 3KB1A 3IIKA 3AVUA 2XOKA 4PFSA 2VQSA 2KB0A 1VPLA 3EZ6A 1GFIA 2ANBA 4JVNA 3HDTA 3AGQA 2BJWA 1EXMA 1XFAA 2OXCA 4Q48A 4D4KA 121PA 3Q8XB 3MLEA 1SGWA 2FEMA 4B48A 3AF3A 1OIVA 2WJGA 5FL3A 2C04A 5LD2C 1SVWA 2ZE5A 1L2TA 4QOSA 1XWIA 3VFDA 4GPTA 3AGPA 2RGBA 2W00A 4V0KA 3MRSA 5EP2A 5EXXA 4EPRA 1Z2CA 1W7AA 1WB9A 2X19A 2CCGA 3I4LA 2GCNA 4Q7KA 2PBRA 2VEDA 3O8CA 1ZM2A 2PX3A 4Q4JB 3EZFA 1P2SA 2C9CA 4B2LA 2QZ4A 2F6RA 3HU2A 3PEWA 2PCJA 4MITA 1MT0A 2ZSAA 3B1XA 4L8GA 4M9SA 3SN6A 1WCV1 4HZUB 2JDID 3U5ZB 521PA 1TX4B 4MUBA 1P61B 1WE2A 2QTHA 1NSTA 4IOKA 2F1JA 4UQOA 3PEVA 4BZQA 1CJUC 1ZJ6A 4HLCA 5ANRB 3WYAA 4JT4A 5KTYA 1EFTA 5FPHA 4DSNA 3OESA 4TL6A 1P4SA 3OF5A 3TVDA 1UF9A 4JYBA 4DT1A 1GITA 4JBXA 1PV4A 3ZS9A 3H2YA 4AKEA 2BIFA 3CZPA 3ZVMA 3VAAA 1G8FA 4JLVA 1D6JA 4F38A 2QROA 6Q21A 3F3YA 2ZUDA 2NO9A 4HATA 1HV8A 4JVMA 3JZMA 2OV2A 3MD0A 4GMDA 4HAVA 3NH9A 1F48A 3TSWA 3ADCA 2C9OA 5IK2D 4Z51A 4URWR 2P2LA 1F2TA 4RZ2A 4BASA 3VU9B 4RZUA 4RKFA 5L8VA 3R9XA 1CRPA 4HLUA 2ZI9A 2ZE6A 4Q1FA 1JR3D 1E2QA 1E1RA 4LUCA 4QBHA 3AF4A 5EE0A 1XMIA 3QEJA 3FB4A 1CXZA 1E98A 5E7JA 5DIFA 2VHQA 3CH5A 2WSMA 1KI1A 1XP8A 2FU5C 3LXRA 4B34A 3VX3A 4LV8B 3HU1A 4QBGB 1TQ6A 4BQSA 1KIMA 3SEAA 2ORVA 2XX3A 4TT3A 4LJ9A 4O3MA 1LW7A 4KV9A 1X86B 1E0KA 1A1VA 2R8RA 1JAHA 2OXRA 4AYTA 2BJVA 3KTAB 3NWJA 1G64A 3GLHE 4Q4HA 2IHYA 3CR8A 3RS3A 1YZQA 3F5FA 1GP2A 2GCPA 3MG9A 4I1OA 1XCPA 3N5CA 4HDOB 3AVPA 3EWAA 3NHAA 4PTLA 2FX3A 4AC9A 3B1ZA 3KB2A 3BD9A 4C0AC 4MRRA 4ZDJA 1IN8A 5CDFA 4HLDA 3A1WA 1BH2A 2X1VA 4JL8A 4KHZA 3SJAA 4M1MA 4W5HA 3VTKA 3K0AA 1Z2AA 4EDHA 1RRGA 1WDTA 4XVQA 2IYLD 4UXIA 2IXGA 1GIAA 1EK0A 5TV2A 4DZZA 3BBPA 3T1VA 3T1QA 1Q57A 2PZEA 1S9HA 4HEJA 3GPLA 5CM9C 1G4AE 5KSPA 3QPWA 5IF9A 2FDCA 3U2QA 2O8FA 5DI3A 3BORA 2BBSA 2EFHB 3MSXA 3GLIB 4BGDA 4HB3A 4V03A 2OFXA 3B5JA 5EE9A 5F2EA 1TUEA 2PCLA 4Q4AB 4BFSA 4V0MA 2JA1A 1RPZA 1P2UA 2E9SA 2LCFA 2EW1A 1G291 2EVWX 2F1HA 3QXXA 5KO2A 1J70A 5CLLA 2WJYA 4NMMA 2J0VA 4QJ4A 4DLXA 3ADBA 3GJ7A 2ASEA 4JVSB 3GLGB 2CXXA 2W2TA 1W4AA 1DPFA 2ZR9A 1ZYUA 4KU4A 2ERXA 1Z6TA 3TIFA 3TAUA 1E9AA 2VP0A 3K9NA 3TR0A 4ZV4A 1XTJA 1E1RD 3LW8A 1GDDA 3U3MA 2GXQA 2CHQA 2H57A 3RRMA 1GL7A 4F7WA 4NCKA 3AQ4A 4Q1AA 3U7GA 1YZTA 3SJZA 1CTQA 1YZLA 4LV6A 2MMCA 421PA 4LDJA 1A2BA 1AIPA 1HH4A 3CWZA 1KO7A 2FGKA 4FWTA 3I1FA 1JAIA 1X8LA 2G77B 2P6UA 5B2ZA 1NIPA 1QHIA 4AWXA 2AKAB 3NIBA 1XJCA 3AP2A 4Q4JA 4CZ2A 3OHMA 4NCNA 5ELXA 4EKDA 2GVDC 5KU1A 2IEZA 4I1SA 1G41A 3CNNA 4DDUA 5KSZA 4HZUA 1GRQA 3QENA 4CVNA 4H1VA 4HSEA 4Q00A 1Q1QA 3FPAA 1W36C 1KJYA 2ZJYA 1XTIA 3N2IA 2YV5A 5KYKA 5A4JA 1O3YA 5G3ZA 2ZS8A 2ZS7A 3CRMA 3CF6R 3TUIC 3UPUA 3DKPA 1MV5A 3H1TA 4YMTA 4GNKA 2IS6A 1ZNZA 1E79D 2DY1A 3HJNA 1WMSA 3EX7C 4EIWA 2AWNA 3AM1A 4M1TA 2ZITA 4MKIA 3PR1A 3UWKA 1W48A 2ZRHA 1Z06A 4A2PA 2Q9AA 2RGXA 4JL6A 2XXAB 3NXSA 1YRAA 2L0XA 3N70A 4M1WA 5JSZB 1CP2A 2PEYA 3SE0A 1YRBA 1VCIA 3IPXA 4JLNA 3Q9LA 1DO2A 4Q7MB 4WXPA 1E2IA 1VECA 2I4IA 1GKYA 2PZFA 4BFWA 5BWMA 4M21A 1XD2B 4RFSB 2ZU0C 3BOSA 1N0UA 3VU9A 2P3SA 1KK2A 3CPJB 4US0R 4OK3A 4LYFA 3KKQA 1WBBA 3BK7A 3B1VA 5AUQA 3TE6A 2ZJ5A 3U60B 3SFZA 4GMXA 1XRJA 1R6BX 1FP7A 4C3ZA 3NC0C 2NGRA 1Q0UA 4LBYA 2ZJZA 5HZKA 3WBKA 3AV0B 1GOTA 4G0NA 1E9BA 1QHHB 4Q1CA 1COWA 4B75A 5FPYA 2GJAA 5BYKA 2QG6A 4QFMA 4C7OB 1AZSC 3E5HA 3BXZA 3KTAA 5CB6A 2D7DA 1QVRA 4UXJA 3CLVA 1G3QA 1E6CA 1JXMA 5D3MB 4DUGA 3EZ7A 1SVLA 1KTVA 2VP9A 2GXUA 3LVQE 2KJQA 3C5HA 4AKHA 1BIFA 2YINC 3B85A 2C9YA 1KDOA 2QA5A 2MSEB 1BOFA 5AWFC 5BN4A 5JCZA 2QEQA 5FOWA 4OHVA 4KSCA 3ZQ6A 4MKGA 1NY6A 1E2FA 5BN3A 3QXJA 1ZIOA 2OBNA 4DLUA 4IOJA 4CT4B 4URVR 1YR6A 3GQBA 3IBYA 3I5XA 2WWIA 2GEUA 1UBGA 3MFYA 1RC8A 1TAGA 4ESVA 1OYWA 2BEJA 4KBGA 4YMSA 3CBQA 2FPLA 4FMCF 5LD2B 5TB5A 1NI3A 2H1LA 2AX4A 2XEXA 3GLIA 3SBEA 5GVRA 1DAMA 2HYIC 4Q4AA 3W90A 4P32A 1IY0A 2BKUA 3K0FB 3V00A 2JGNA 1KDPA 1N6OA 4B3DA 2RAPA 2N1BA 2NZ8A 4F4IA 5IHPA 2NIPA 3W8NA 2WJHA 5LDDC 1AJEA 3B1YA 3GLGA 3VR4A 2WVJA 2YOGA 2ZJ8A 4R2IA 4TTQA 3SU8A 1CLUA 3TKLA 3BGWA 3T61A 2Q9BA 4Q1DA 2JLRA 3TLXA 3LWNA 5IT5A 2HXYA 8OHMA 4KSBA 4FXPA 2WKRA 4GI7A 3THOA 4LV5B 2BEKA 4BECA 1NLZA 2Y8EA 5FPSA 4F92B 1E9CA 3U3OA 4IFBA 1SXJD 4DEYA 1CU1A 2AFIE 4PHHA 2AKYA 1E96A 1XMJA 2DYKA 4NHOA 3IILA 3L8YA 4FCWA 4Q1EA 4WW0A 4Q5IA 3KFVA 1E0AA 4OQNA 1TUIA 1VG9B 4UJ3A 5J4VA 2H92A 1U99A 2V6IA 1SHKA 1W4BA 4DUGD 2O8DB 1S0UA 3C5CA 2QP4A 1CBUA 2ZVQX 4PC6A 2YHSA 4D0LB 1DBSA 1YU9A 3OEHA 3K9GA 2ZREA 2JATA 1OXXK 1MRNA 3RNLA 1KJZA 2ZRAA 3VNVA 2Z4SA 2ZR0A 4XJXA 3BB3A 3U44B 2HCBA 5CK5A 1KNQA 1NNEA 1E2PA 1ETUA 1M34E 4R98A 4PAMA 4DIEA 3FVQA 721PA 3IQXA 3LRPA 1RYFA 3MUFA 5CLQA 5L3VA 3NBFA 3VQTA 3MWJA 1Z07A 3TQFA 3SNHA 1XPUA 3NHBA 2IEYA 1LTQA 2W2XA 2OSBA 3OE7A 4I1UA 2BV3A 3RS7A 1FPMA 4B71A 1Q3TA 1ESNA 3RRYA 5JSZA 1GKIA 2IUSA 2YOFA 5CITA 4FMDF 3TQCA 1P2VA 1ZM9A 1XU4A 4JL5A 2JLQA 4IHQA 1S4QA 3U4QB 2CJWB 3IO3A 1M1YE 2WZQA 4TQ9A 3RWOA 1XD2A 1QHXA 4RFSA 3LQQA 1IXRC 5K8LA 1XCMA 4DIDA 4MKFA 3DKVA 1XXHE 1ZRHA 4LCBA 1OFTA 2DBYA 2ZSBA 2FSHA 1OFHA 2FEOA 2MSCB 4R7ZA 4HDQB 4IXNA 2ZYTX 5AR1A 1E9SA 4MRVA 5EUMA 1S3GA 1QHHA 2G0NA 2QM8A 4MUAA 4N0EA 4C7OA 3REGA 1OXTA 2CK3A 2ZRJA 1IJEA 4ITRC 3W5JA 1TQ2A 4KXFB 4PQRA 3IEVA 5D3MA 3OIUA 4IVPA 3QG5A 2BOVA 1E1QD 4DKXA 4QG7A 3X1XA 1W2GA 4BUJA 5LPNA 2ZJAA 2XB2A 2WWYA 2H8KA 4GFDA 4A1FA 4KJZA 3TH5A 5JRJA 1F60A 4S35A 2LKCA 2VA8A 3OEHD 2GBLC 4W5WA 3F0TA 2DHRA 3ZLJA 4TLBA 3LDAA 2GEVA 4ZDWA 1S8FA 1Q12A 3AKDA 2VF8A 4BRUA 3MGCA 4DB4A 2CEAA 2RHMA 1ZNYA 2R6CA 3QKSB 2HDNB 1AK2A 4L9WA 4MH0R 4GP6A 5FPKA 4C0HA 3IEUA 4ZPXA 4L9SA 4DSTA 4KYIB 4IEIA 3DPUA 2W0SA 1CR4A 4PO9A 4V0OA 2J0SA 1GILA 1M7GA 1YJ5A 3K0FA 4IKEA 1XEFA 2RGNC 2FWRA 5B30A 3VR3A 3OE7D 1TTTA 2O0KA 4CIDA 2C8VA 2W83A 3LFUA 2EQBA 3UMSA 1AZTA 1Z0KA 1WQ1R 2VHTA 2WWXA 1W36B 2VIIA 1JBKA 1CIPA 2JCSA 3EASA 1GNQA 1G9XA 4CDGA 2BBWA 1BMFD 4N0DA 1KOFA 3PVSA 3SQXA 2IC5A 2ZI7A 1X3SA 2J41A 3P27A 4XOIA 4O2RA 3A6PC 1Q3HA 3Q72A 2Z83A 1OV4A 2ZETA 2GF9A 1NG9A 3B13B 4LC1A 4XVRA 2IUTA 5G40A 1E2GA 1U0LA 4JLJA 5IDVA 3GD7A 3DMDA 4ILEA 4ZDKA 2CK3D 1KJWA 2KBFA 5FOTA 2GESA 1CKEA 1Z0FA 1K6MA 2AR7A 4LSGA 4YXWA 2O8DA 3PV0A 2F9MA 1T5IA 1G8GA 2B8WA 1F3OA 4TZ0A 3AUYA 1MO3A 3G82C 2R6GA 1IY2A 3QUSA 4JKIA 2X2EA 3QIAA 3T06B 1WA5A 5DH9A 2MMGA 1FMLA 4M8NE 4PPGA 4OI0A 3A1TA 1C9KA 3U44A 1R0YA 5KNBA 2JLWA 5JFGA 1F2TB 1OB5A 5CYOA 4D4LA 1DAFA 1XBTA 5H68A 2H17A 4MDFA 4FN5A 4NCHA 4MRSA 4JBWA 1EX6A 3CKLA 3R9WA 4XSHA 2GK7A 1DEKA 4G01B 4HYYA 2VSXA 4TLAA 1ZM4A 2ONJA 4BLRA 3TUZC 3W9YA 2H18A 2CLCX 4BLTA 3LX5A 2JJ1A 2VP2A 2J46A 3TJZA 2J87A 3V4FA 3H4MA 1JQLB 4URXR 2QBYB 2OFOA 2IYRA 3RAPR 4DCVA 1E9EA 2Z4RA 1VTKA 3O8BA 3U4QA 5L3SB 1G5RA 2CJWA 3KXLA 1US8B 5HE8A 4GSYA 2VRWA 3BFKA 2G3YA 1G16A 3VKGA 5JJIA 2DPXA 2XAUA 1ZP6A 3IBGA 1XD8A 4Q9JA 1P7CA 3B78A 2FMXA 1BYIA 3VR6A 4Q9KA 2ORWA 4XTCS 2VBCA 2QGZA 4GDFA 3SJBA 5EE3A 1XTQA 2ZPTX 1SVMA 2XJ4A 4HAUA 4R71A 3AVQA 2FSGA 3SC3A 1OPXA 1ZD8A 3AVOA 4WXRA 3ASYA 3QBVA 4NKRA 3F8TA 2DFTA 4TLEA 3LY5A 3G0HA 1XJQA 1QRAA 2AXPA 2QRZA 3QJYA 2BCJQ 2F1RA 4CGZA 4CRWB 4RD0A 4I1VA 1OSNA 1G6HA 5DLQC 4QNRA 4Z8XA 4DCUA 4ACAA 2IXEA 1KY2A 2WAXA 4NU0A 4E09A 1LF5A 3VHLB 1CJTC 1OKKA 1M8PA 3HR7A 3CB4A 2R6AA 2WSSA 621PA 3L0SA 3ZD7A 4GOKA 4EAQA 1L4UA 4LJ6A 4IVQA 4PAOA 4KI0A 3L8ZA 1CULC 3QKSA 1GUAA 4QBIA 2YWGA 1KO5A 1IN6A 3BFVA 1R10A 1CRQA 4TWZA 5E3HA 4I99A 4JLAA 1W2HA 2DFKB 2WOOA 4QGAA 1NBMA 1U90A 2CCKA 2J9RA 2GTPA 4UNPA 4DCTA 4DSUA 5BN5A 5KHOC 1E0JA 2JJ1D 5JHHB 3CR7A 3ND9A 1E4VA 4WAUA 4L4UA 1VYTA 3CONA 2CBZA 5F9HA 4IDQA 1I4TD 2A7QA 4TMKA 4YMVA 4M9QA 2RH5A 3Q85A 4OL0A 1JR3E 5EZ6B 5C2JB 2HUPA 3W3ZB 3T5DA 3TW4A 3VR5A 2CNWD 4QL3A 1P62B 2PLRA 5EXPA 4AY2A 1P5ZB 1AQUA 2ZJOA 4RD1A 4UXHA 3PUXA 1OXVA 2ZJBA 4A4DA 1TEVA 1PVOA 1LV7A 2HJGA 2ZSEA 4EFMA 4EJSC 4KFSA 2G83A 2ODWA 3K9LA 2JLSA 5EE1A 1G6OA 4ZO4A 3DMNA 4Q01A 3UMFA 3PUZA 3DM9B 4RD2A 4DC9A 1C1YA 2GILA 2PJZA 2ZAMA 5FTLA 1J99A 5CIWA 2V55B 4UKDA 1LS6A 1T3HA 1IBRA 1A4RA 1U81A 1NMZA 2ODEA 2EFDB 2V1XA 1BYUA 1V43A 3A37A 4NCIA 3GP8A 4HAWA 4OBEA 4D80A 4DLRA 1NN1A 3UG7A 4D82A 5E4FA 4Z1MA 3M0EA 4C2UA 3FMFA 4FMBB 3QKTA 3RRNA 4OHYA 3IHWA 1E2HA 1NVVR 2P5SA 5JI2E 4RD3A 2OAP1 3P4XA 3D3QA 2Z43A 5E95A 1EFRA 4HLQB 1IN5A 1OKKD 1G7SA 3EIQA 1ZD9A 3A8TA 2CL0X 4LOAA 2WSSD 1AQYA 2IYVA 1GNPA 3EG5A 1N5KA 4DLTA 3EXAA 3DDCA 2WIBA 1EGAA 3W5IA 2XOKD 2V4ZA 1UAAA 2WKPA 2GEDA 3OEEA 4MGZR 2WOJA 2R44A 4DCSA 3CW2A 3SYNA 2QT1A 1TPZA 4OI2A 1HURA 2BM1A 4G5SA 1RRCA 1NBMD 5FL7A 4NPHA 3IIMA 2N42A 4IOLA 1JEEA 2FF7A 4NZYA 3T5GA 2QBYA 1Z0DA 1FX0B 1KHTA 3GCGA 1CJKC 4CT5A 1R8SA 5L3SA 2QI9C 1US8A 4AI6A 5AK0A 1E9RA 2AFHE 5K8TA 3QPUA 3NC1C 2P0EA 1DAGA 5FOSA 2VP4A 3CUEF 1YHNA 2XTNA 2HJVA 5G41A 3KJHA 4MGKR 4DJTA 3L43A 5J4HA 2R9VA 2F3RA 2C96A 2OILA 3MJRA 2C03A 2WJIA 2F7SA 5BW8A 4TMVA 3TBKA 4ASUA 2GF0A 1AS3A 3GEEA 3A36A 3I3SR 1BKDR 3EIHA 5JI3E 3QF7A 1KNXA 2YVUA 4X8OA 5EP1A 3OAAA 4XD7A 5CJPA 4IRUB 5SZKB 4DVGA 1J8MF 1P6XA 4HZIA 3ZZUA 5FBVB 3NDPA 4XTRA 2V6JA 4PHGA 5GJCA 3IDQA 5GJBA 1OE0A 3GJ6A 1KGDA 2G88A 1IAQA 5C18A 4U7DA 3FTQA 3AF2A 1UBEA 2XITA 2V8OA 3K0SA 4M22A 1NY5A 2YJTD 4G5OA 4R2HA 2PJRA 3NBXX 4TYNA 1EFRD 3X1WA 2GVZC 4TSFA 2VO1A 3EPLA 4IFEA 1WXQA 1ZU5A 1N6RA 4WZ6A 4MA4A 2XZLA 1E2DA 2ZANA 4M4SA 3AKCA 4HB4A 4RZ3A 1FL9A 4GRAA 1OF1A 4TLCA 5EXTA 2WHXA 2ZXUA 1K5DA 4V0ME 3OEED 4LJ4A 1SKYB 4FINA 4TYPA 2WTUA 5K8IA 2R2AA 1AS0A 3KFXA 4XWAA 3KUDA 5FL7D 3AF0A 4WIAA 5FOUA 3THWB 4C9BA 3GFTA 4TT3D 1CJVC 2H16A 2OCAA 2IYUA 1ZVQA 3DHWC 5EE5B 2REBA 4PC3A 4O0MA 4ACBA 4P4SB 2FNAA 2GJSA 4Q03A 3I73A 2ZYWX 1OB2A 4PXAA 3GLFB 3KDSE 2FG5A 4DLWA 4K46A 2GWHA 4DHEA 2FSIA 1DAHA 3RS4A 1Z47A 4HAXA 3QG1A 2IYWA 4US2R 5KDOA 4CEIB 1LB1B 3K70C 2QMEA 2G1KA 2QORA 2NPFA 2NZJA 1KI9A 1NL3A 4LHXA 1T5LA 3UATA 4BE7B 1R8QA 3AEZA 1Z6YA 4EPXA 1AN0A 2CE7A 1YZKA 1R5NA 1NKTA 1Z0IA 2ZI3A 2A9KA 3GEHA 4ASUD 4DDWA 3BWDD 1GRNA 1KO4A 2GETA 1P60A 3OAAD 4XD7D 1DAKA 1KI7A 3RSOA 3TAHA 3EPHA 1A5TA 2QMHA 4C30A 4LBVA 4JYCA 2A5YB 2IYTA 4B43A 5J5CA 3LQRA 3RC8A 3M4YA 1KY3A 1G3RA 2ODBA 1QF9A 5LBIA 1E0SA 4KVGA 4TYYA 4LJ5A 4WBSA 3AVYA 4CF7A 4QHYA 2VP5A 1GL9B 1RZ3A 3N2EA 4P0TA 4D2IA 1D9XA 2ZEJA 4FMCB 2PX0A 4TSFD 4ZI2A 1KK1A 2VSFA 2P67A 1QHNA 1HE8B 2CL7X 4NYMR 4BEJA 5EJEA 2QN6A 3KKPA 4GZMA 4B74A 3AH8A 4G5GA 3THXB 1Y3AA 1R5OA 3FHCB 2IS2A 5HR5A 4JLDA 4B6EA 5HE9A 3BERA 3FMIA 2XSZA 2OESA 3FYHA 3Q7PA 2R6FA 5H1YA 3WYGA 3SBDA 2BKEA 2HLDA 1N0VC 3LX8A 4M1KA 2GNOA 2UZIR 1Q22A 5CK4A 4ZCIA 1FX0A 4LHVA 1Z6GA 3D6TB 2EFEB 1JPNA 2GBLA 3MWYW 2AWOA 3K9HA 1XDBA 1W46A 3QVUA 4WA7A 1J90A 3UIEA 3CRQA 4Q9HA 2IYZA 4MRNA 1OIXA 4EFLA 3M1IA 1GWNA 4XH9B 1SXJE 1JEDA 2GJKA 3C41J 1T91A 1WP9A 3U6BA 1B23P 3Q7QA 2GZAA 1VYUA 3EIEA 3W3AA 4M1SA 3E1SA 3A4NA 1OIWA 3CIOA 2NTYC 4DLSA 2WWWA 4YC7A 4TZ6A 2RGNA 2J7PA 4MYTA 5JJLA 2J1LA 1PLLA 3GFOA 3BIFA 4RCYA 4D25A 5DSZA 1N6LA 3ZYCA 1NP6A 1R7RA 1HE1C 4HB0A 2ZAOA 3LNCA 1G3MA 4PC1A 2NO7A 3PIRA 1X8JA 4B32A 2R62A 4EJSB 1GZSA 3RVBA 5C4MA 1UKYA 4E07A 3KX2A 2B92A 3C8UA 1YZGA 5FTKA 4DDVA 4FIDA 3AB3A 2QP3A 2FE4A 3W6PA 1G4UR 3K1JA 4D0GA 2OAQ1 1GNRA 2GA8A 1Z6XA 2HXSA 3SHFA 4QKQA 1X1RA 2A5JA 2H7VA 3W34A 2ZE7A 2ZI5A 4QXAA 4Q9LA 4UNRA 1XTRA 5FBLB 3FMPB 2BWJA 3WRXC 4Y0VA 4FMDB 1QHGA 2D06A 2IXFA 1P72A 4V0NA 1H8EA 4LX0A 2XSZD 5TARA 3THWA 2ORIA 3KKOA 1JPJA 2GZHA 3UANA 3A58B 3QSYA 2HLDD 4KFTA 1COWD 4U00A 1FNNA 2QQ0A 3GLGE 1YR9A 3BH0A 3Q3JB 4IDPA 3NBZC 4M0LA 2GRJA 3OZXA 4P4SA 1FQJA 2W6IA 1PLJA 3EPKA 4XWKA 3TGPA 2YOHA 3A1VA 3GLFA 3BFXA 5JCPA 3HPRA 3NKVA 4BEBA 3U61B 3CRVA 3HYRA 3P1JA 1QDEA 2CLDX 2EWWA 3FFAA 4MYCA 4TMZA 5FTMA 4PSVA 3QY0A 4A8JC 4CEIA 2NOAA 4IVRA 3FKSA 3PXGA 3ZZ0A 3B6EA 4B3XA 1UBFA 1W0JA 2GCOB 1KSHA 4URYR 3HR8A 4Q4LA 5G3YA 4ERNA 3EPJA 2D2EA 2REXB 1IN4A 1KMQA 3K0CC 3O47A 4G3XA 1T0JB 2IYXA 2J7PD 1DTSA 1ESMA 1LFDB 2P6NA 4B3BA 3ZJYA 3I32A 4GL2A 4L5BA 1UEJA 2HT6A 3DL0A 4B76A 1TQDA 2QT0A 4RKEA 1HY3A 3ETLA 1N3BA 2QU8A 5AJWA 1G19A 1KO1A 1ZINA 3ZIAA 4H1UA 4B33A 3I5YA 5JZVA 3EAQA 5TXGA 1SQ5A 3IPYA 2QAGC 4E22A 1CJMA 1GVNB 1QBKC 4NL4H 5UKDA 1UDXA 2RHDA 4LHYA 2DWPA 1HT2E 5BQ5A 3U7FB 1Z08A 1DVRA 4A0RA 4ON9A 2RGAA 4OYHA 5DHAA 1CF4A 5EP4A 1N6PA 3WHLA 3ZD6A 1OT3A 4RCZA 5FBQB 2W6JA 1W5TA 4FWIB 2UZ3A 3THXA 4Q7LA 1G5PA 5J4LA 2IA5A 5TY0A 1W47A 1EWRA 1KAGA 2QTFA 5AUPB 4X8MA 4N1AA 5C4GB 3TR5A 5LB4A 1RRFA 3U6KA 4EQ6B 2UVQA 1YKSA 2PMKA 4BWYA 2WMNB 4NP6A 1SVKA 2KBEA 4IDHA 4GP7A 4KLNA 5HTKA 1XEWY 3D7MA 1W49A 4N3NA 3OIVA 1MOZA 3BC1A 3LVRE 4BFVA 1NMXA 1N25A 3CF2A 4OQFA 3NG1A 2W6ID 1I4LD 1G1MA 3BH6A 1OHHA 4AURA 4BLSA 3EC1A 4JKYA 3SR0A 1GRRA 2G1JA 3I8XA 4U02A 1FZQA 2KI5A 3WXMA 1J2JA 5JLJA 2LWIA 5FUVA 2J3EA 1W0JD 4XIGS 3KJEA 4OQLA 5F98A 3CRRA 5EUQB 3R20A 5TVKA 2AHOA 3E70C 5AJXA 1WF3A 5AUOB 4DRZA 3GJ0A 1N5JA 2D7CA 2XJ9A 4TLDA 3UKDA 1SXJC 1KI6B 2JEOA 2D3WA 2ZROA 3TK1A 2RB4A 5J47A 2P6RA 2NG1A 1U9IC 2NQ2C 3FFBA 2WWFA 4KBFA 1QHSA 4NYJR 4PX9A 3X1YA 5KSYA 2HT1A 2BCGY 2QY9A 4PSAA 3T1OA 4DDTA 3FE2A 1OYYA 2ZI6A 4LY6A 4EPTA 3PUWA 1O87A 2IK8A 3THYB 1VHLA 3GMTA 4LZZA 3IUYA 3KKNA 3OIWA 1TADA 1YR8A 5FTJA 3HYTA 4EJSA 5JWRA 4BFXA 3R8FA 4PPNA 3FOZA 1RKBA 3K70B 2O0JA 2VPPA 5DN6A 2VHCA 2ZTSA 4F91B 4RZXA 3D8BA 1G21E 2B8TA 4KLZA 3ND8A 3EWSA 4M9ZA 4JZKA 1S96A 1S1MA 1G18A 1E3MA 2W6JD 4RFVA 5FTNA 4P4TA 4AKIA 4CEHB 2F55A 1T3SA 3C16C 3E2IA 4BZXA 1JECA 1UKZA 5KDDA 1U2RA 2HF8A 2R65A 4D4MA 3JVUA 2J0QA 4JJKA 4PO1A 2JJ2A 1UEIA 3B2EA 1IXZA 2RMKA 3BB1A 3B8HA 3DZDA 3KUCA 3MAAC 5FI1B 4AK9A 1Z22A 2J5XA 4QBFA 5DISB 2D4HA 3TVTA 3RHFA 4MRPA 4PPFA 5SZJA 3CRW1 1NN5A 1QHYA 1OHHD 3QXSA 2AK3A 2IF0A 2IW3A 3UK6A 4P4UA 1XF9A 4HUTA 1A7JA 2VTKA 4OK5A 1TF7A 4AG6A 2GCOA 1NJGA 1FP6A 4GZLA 2OLKA 2VYFA 4G5RA 4TQAA 2BMDA 4DLZA 2ZJ2A 1ZUIA 2QPTA 4MYHA 4LPKA 1G8HA 2WAYA 2B7BA 3QXCA 1GTVA 1A82A 1QVAA 1KKMA 4Z54A 4PR0A 3RSLA 1YVDA 2WBLC 4JIMA 2IUUA 1GL6A 2HF9A 1X8KA 3OFNA 2ZRLA 2O8BB 4A0FA 4DWJA 2ZRIA 4BFUA 1KI4A 3SDZA 3UXMA 4FD2A 2IYQA 1AKEA 4LC0A 2V7QA 2Q21A 1U8AA 3AKEA 1LS1A 4XSGA 2OCPA 4PC7A 2YZ2A 4KFRA 4LGMA 3FMOB 3P4YA 4TMWA 2DR3A 2QENA 3AP3A 4US1R 2ZRGA 1A2KC 3FHTA 2AK2A 4D81A 4QM6A 5DN6D 2FZ4A 3GLHB 1G8YA 1S9DA 2JLUA 3ADDA 2ANCA 2WICA 2WIAA 1XZQA 2LKDA 2OG2A 1P2TA 1RVDA 1Z0AA 2ZRDA 1G20E 5L3RA 4XWOA 1JQJC 1Q1ZA 1R4AA 3DOFA 3C14C 1XB2A 2Q0HA 3RC3A 4JLPA 2IYYA 5CIQA 4EQ6A 4A92A 1DS6A 4QC2A 4WOPA 2B6HA 4R9UC 4DBLC 4ZI3A 1II8B 1DADA 3B60A 2ZRPA 3CZQA 1VIAA 4C0LA 1EESA 2JJ2D 2JASA 3SJCA 2IX3A 5F9FA 3T12A 1ZCAA 1E2LA 3MWKA 1T8TA 2XTMA 1R0XA 5HKKA 1KK0A 3ZS8A 3QOFA 4LJ7A 4P31A 4RY2A 3PUVA 2OZEA 2WWHA 5FH9A 3AVXA 4KO8A 2IL1A 2JDIA 5KSOA 1TNDA 4YXWD 4TTPA 1RIFA 2BMJA 2A5GA 2TMKA 1IHUA 3QKRB 1E99A 4U5XA 4C0BA 4CEJB 3KQLA 4JSYA 1AM4D 2BVNA 4HAZA 3GJ5A 5SZIA 3U3RA 3X1ZA 3ICQB 5DHFA 1S3SA 4IEEA 3TMKA 2WKQA 4B2IA 2E1RA 2YWFA 4PAQA 4M1OA 2WWGA 4RSGA 2EU8A 3W8RA 3I62A 1XTSA 2VH5R 3WMFA 1KI6A 3HPQA 2NO0A 1II9A 1HQCA 3OFND 2QSZA 4M2LA 4AYWA 1KI8A 4QHTA 2JLXA 4PO8A 2CMKA 4IDNA 3JVVA 1ZC3A 3SOPA 2VL7A 4GOXA 1SVOA 1DG1G 3RABA 3PEYA 1OLOA 3KQKA 4CW7A 5IK2A 4GOJA 4D6PA 3THYA 4LYAA 4BFZA 4A8JB 1E32A 4A9AA 1KKLA 3SFVA 4POAA 3ASZA 3KJGA 3U3KA 5GVSA 5J40A 5F3WB 4DSOA 5JWHA 4TL9A 4C0SA 4II7A 4TN1A 4TMXA 3ECCA 2N46A 2REOA 4JMPA 1E2MA 4Q1BA 5AJZA 4C4PA 1JALA 1QG2A 2ATXA 3AUXA 2OO7A 4Q7JB 1L8QA 4B35A 3AVVA 1JXOA 4H9GA 4JS0A 4CEHA 1NVVQ 1HQYE 1NBME 1DG3A 1Q44A 3RLFA 2FJUA 2IYSA 4Q02A 5C1BA 3T34A 1N0WA 3CX8A 4RD6A 3VR2A 4BFTA 3QQ5A 4AYXA 5J4YA 4LBZA 2PT5A 1X1SA 4X8HA 5AUNB 1VMAA 2QUZA 2QAGB 4PQFA 4NH0A 3L0IB 1DOAA 4B3FX 2QL6A 1E2EA 5SZHB 1KK3A 3GJXC 5HKKD 1D2EA 3ICEA 1UPTA 2ZIAA 2A5DA 1S1CA 3LLUA 3TSOA 3FWYA 3LAWA 2QP9X 4M9XA 4QM7A 5FPTA 1TL7C 2FOLA 1DELA 4Q18A 3ZDQA 2GJ9A 3CO5A 1VG8A 3NVAA 1AGRA 1FW6A 3OIYA 4ZCLA 2G9NA 1TMKA 2AD1A 1UM8A 3RRZA 3MJHA 3CWQA 2F3TA 2I1VB 3P26A 2Z0MA 2GZDA 1Z0JA 2GAOA 1IJFA 2O52A 1PUIA 1XCGB 3WBJA 5GADl 4OKSA 2O8BA 3RS0A 1I2MA 1T4GA 5CYPA 1DO0A 1JJVA 4LJAA 4DCNA 4BLPA 1ZNXA 5JRZA 4WVFA 3SI7A 4A6PA 2NPIA 1II0A 2J0UB 1U0JA 1N5IA 5JWOA 5M04A 1TU4A 1RJ9B 3D31A 4MQBA 1NJFA 5FUWA 4C0QC 1HA3A 2OT3B 3K70D 2ZYUX 4G1UC 4Q21A 1W36D 3GLHA 5G53C 3LLMA 4RJLA 1VDZA 2EFCB 5BXQC 4ZIRB 4UNQA 1YR7A 2O0HA 4TQUS 2IF2A 2J59A 1AKYA 1I4DD 1P9RA 1WRBA 1ZIPA 2Q6TA 1UFQA 3A1SA 3A4MA 5BYJA 2YKGA 5JS7A 3PFIA 1SXJB 1VG1A 4E5UA 4B47A 2Z6VA 3KXKA 4OJKA 4TTRA 4D0NA 1E94E 2ECKA 1PLKA 3B82A 3LV8A 4KCGA 2ZR7A 1II8A 4IJMA 4S2EA 5CM8B 5FOVA 5B64A 3DZ8A 5K8UA 4MKHA 4IXMA 2ODNA 1M74A 2GDJA 2WJVA 5JEDA 2KSQA 2FPKA 2C78A 1FUUA 4YMUA 1XX6A 4QGGA 5JMTA 2V1UA 1KZGB 2A5FA 1G7CA 3QE0A 3VX4A 2ZRFA 3ZGXA 3L0OA 4LYHA 1UDWA 2YWEA 3QKRA 3C15C 4NDZA 4I81A 4Z1MD 2IWHA 5CDFE 4CEJA 2ZE8A 4NTZA 3ZVNA 4C0KA 4JJZA 1K5GA 1OFIA 4D4JA 1D2NA 1ZAKA 2DB3A 4A82A 3R7WB 1G8PA 1NRJB 1E79A 1OJLA 4O2LA 1FNMA 5DE3A 2D74A 1MKYA 2VP6A 5KUTA 3RWMB 1TEXA 2A3RA 2CVHA 3ZQJA 4Y0AA 2D2FA 3CPEA 4FW9A 3Q5DA 2AD5A 2QQEA 2G0TA 4RD4A 1KSJA 2F1IA 3EC2A 3RANA 1T0HB 2IS1A 2WMOB 4NYIQ 2D62A 4JLOA 3UG6A 3FKQA 1KO8A 2NO1A 4LWZA 4A8JA 5JS8A 4TYQA 4FCTA 2IS4A 1N6KA 3DOEA 5L3QB 3K09C 3QKUA 3VR1A 1W0KA 1G7RA 3TRFA 1MO5A 3R7WA 2ZS9A 2QPAA 3J81k 3GEIA 3MWLA 1ZBDA 3H86A 4P3YA 2BBOA 2XTZA 3K0CA 3EA5A 3HWSA 3FGNA 4NONA 4JT2A 1L4YA 1U0HC 1NF3A 1SULA 3TNFA 1Q1EA 1ZU4A 1ELOA 1NVWQ 1Z29A 2QNRA 1IY1A 5FI0B 2OHFA 5KPJA 1OXUA 4L15A 2JAQA 3GJ4A 4PC2A 2EYUA 4B2PA 1AA9A 2CVFA 1E9DA 2FFHA 1MABB 3MCAA 4NYIR 4P33A 4NYMQ 1Z28A 1KDRA 3DEFA 3QF4B 2QAGA 1FOEB 5JHGB 3DVLA 1M2OB 1NMYA 1L7VC 1LVGA 1PZNA 2Q3MA 3LA6A 2JLZA 1T3LA 1TF5A 2CDNA 3NTUA 1KAOA 3IIJA 1NN0A 3I8SA 4PSKA 1FQKA 2C5LA 4YDHB 3CNOA 2K5UA 3IHLA 4OK6A 3B1WA 3U7EB 2CLSA 3WNBA 1QG4A 1JB1A 1OH8A 4QGFA 2A78A 2ERYA 3EZ2A 3QNUA 1AGPA 1XXHB 2A30A 2XNSA 1XD9A 1FUKA 4V02A 4LPSA 1P9NA 1VIYA 1FTSA 2ZSFA 3I92A 2I3BA 1W4RA 4LBWA 5TDHA 1G7TA 2GJ8A 3GJ8A 4MDEA 2O8CB 3WMGA 3PITA 1UADA 4PQYA 1IQPA 1M7BA 2J0UA 2DFLA 4A2QA 5EP3A 1D9ZA 1IOZA 1RJ9A 3C7KA 1U98A 1YE8A 2WPDA 4UNNA 4HI0E 1DAIA 1W0KD 1EX7A 1Y63A 1YZNA 2SHKA 1ZNWA 4ZIRA 1CS4C 3W6OA 1CEEA 3T15A 3LH5A 4B73A 4TMTA 4G5QA 2A2ZA 4YONB 1F6BA 2KE5A 1SXJA 1EFUA 1JNYA 2E87A 4PPQA 2GK6A 1U9IA 5FBWB 2V3CC 5EQTA 4JVLA 4HLUC 1P75A 1Z63A 1WBDA 2ZRKA 5HCNA 1NKSA 2OLJA 2YC2C 2AL7A 1M6NA 2FA9A 2OUKA 4CYMA 4PANA 1P73A 3H84A 3G5UA 3WNDA 3SZRA 2ZRNA 3CNLA 1R2QA 1Z6AA 4LJ8A 5B58C 3KQHA 3L82B 4EUNA 3I72A 4RVCA 3SYLA 2GXSA 2ZM5A 1KMHB 2ZRBA 3CM0A 1JR6A 2JLYA 2X77A 5E7MA 2C99A 5JJKA 4PZZA 1XEXB 2PZGA 2CHVA 2QSYA 4HAYA 2XNDA 4OHXA 1ZC4A 1W4CA 1I2DA 1OFUX 2F43B 2J7KA 2ZYVX 2AN9A 3KJIA 3B7GA 1DARA 3KZ1E 3ONWA 4KAXA 3AVWA 4DB2A 3GJ3A 4DLYA 1Z8FA 1X6VA 4W9MC 3EZ9A 1ZUNB 1SKQA 2FFQA 1RRPA 1HTWA 1U8YA 4MYUA 4OHZA 4B6FA 5KOYA 2BHRA 3KXIA 1NG1A 1Z3IX 2EWVA 4BLQA 3GLIE 2CE2X 2Q3FA 1ONBA 2WV9A 4MGYR 3SYKA 4A2WA 5HZHA 5FR2A 1ZCBA 2IWRA 4A0HA 5AJVB 4O25A 3R9IA 5H70A 5KNCA 3QPVA 4EPVA 1T8UA 2EFGA 3LBNA 3SHWA 4LHZA 2BC9A 2FFBA 1FFHA 2OM2A 2QGNA 1XPRA 1VHTA 2RGCA 3KKMA 1S2MA 3HU3A 4LHWA 1GSIA 3PQCA 5L3QA 2PMDA 3DO6A 5FR1A 1PJRA 2OCYC 2WPDD 3PENA 4HUQB 4LRWA 1OH6A 2FN4A 2X8AA 3S1AB 3ZVLA 4QGHA 1IN7A 4F93B 5D3QA 2W2VA 1UKVY 1SKYE 1YQTA 3WYFA 4KITB 4J0QA 3X2SA 4IW3B 3NBYC 2PT7A 1XMSA 1OXSC 2GKSA 5LB2A 1Z83A 1N5LA 5CB8A 821PA 1MR3F 1N6IA 1JJ7A 1MABA 1T9HA 3P20A 1Q20A 4PHTA 1LY1A 3LXXA 5E7IA 3QF4A 4HDCA 2G6BA 2O5VA 4C0JA 2QE7A 1NN3A 4YLGA 4YQFA 3I61A 1V5WA 3HP1A 3NH6A 3GLFE 1E1QA 3AP1A 2ZRCA 4ARZB 3VNUA 3ZVRA 1XMVA 4MGIR 1MO4A 2OEPA 3WNCA 3KQNA 2VF7A 2XZPA 5DYGA 2BM0A 2FH5B 3V4RA 1ZMXA 4OI4A 2QRNA 4DLVA 4K81B 3RYTC 2XGJA 3RDPA 4KFUA 5H8WA 4M1YA 3H0KA 2XNDD 1SHZA 2C95A 2RKOA 1TQ4A 2W0MA 2YC4C 1D2MA 4URZR 4QJ3A 5JEEA 2ZSDA 1GAJA 2KWIA 4LJYA 2OBLA 1CR2A 5A5GA 3O8RA 3QEOA 1P9WA 1K8RA 3LBIA 5KNDA 1XXHA 2Q3HA 2O8EB 3WMEA 3NEJA 1AS2A 1NLFA 1KYIA 1VCNA 4OI1A 4ESHA 2X2FA 2OE2A 2XXAA 1ZUHA 4UNSA 3TSZA 2CL6X 1VCMA 4LK2A 3NDBB 2O8CA 2JIZA 4TL7A 4BLOA 1VYVA 4DEXA 1H8ED 1E4YA 2Q9CA 3MMPA 2QM7A 3ZZTA 2ZI4A 5FUXA 4F4JA 1BMFA 2ZUCA 4K8OA 4D26A 3DM5A 2VSOA 3FDIA 3K0EA 2PEZA 1XNJA 2GHIA 4IOMA 4Z8YA 5EZ5A 4NYJQ 4KVAA 5C46F 1UJ2A 4W7SA 1C4OA 5B57C 1ZM7A 4B3GA 2CCJA 4JLMA 3U3JA 1MH1A 4QNMA 1ZD1A 3EA0A 1KI2A 2C77A 2VLIA 3T1TA 3FKSD 4C2TA 2FSFA 2HYDA 1NLYA 1OW3B 3PJRA 4OQXA 4W5JA 2JJ8A 3PG5A 2B7CA 1MRSA 2ATVA 3BE4A 1G17A 5TMPA 4KODA 1PUJA 4NBSA 1E2NA 4Q47A 4A0GA 3K53A 4WZAE 3M6AA 1E2KA 2IBMA 4JBYA 1ANKA 4JLKA 1Q21A 1G3UA 3U7HB 1XTKA 3K8YA 2CHGA 2QE7D 2PL3A 1G3IA 2ZRMA 5DI9A 1F2UB 1IONA 4B44A 1DE0A 3EARA 1XZPA 1KZ7B 1W5SA 1N6HA 1KMHA 2RGGA 2RGEA 5KPDA 1EWQA 3O8DA 1DAEA 1HYQA 2QPOA 3IGFA 3ZIAD 4A15A 5HCIA 1XEXA 2P65A 5DYIA 2F43A 2DCUA 5DO9A 1IXSB 1NSFA 4HB2A 1BO6A 1W44A 2FPMA 3LD9A 4AKGA 3ZH9B 2C2HA 2HV8A 3W6NA 3P32A 3PUYA 2EYQA 1G5TA 1RYHA 4JSTA 4E03A 2QAJA 5IRCD 2ZQ5A 2VHUA 1TF2A 3JZAA 2V9PA 4PZYA 3BB4A 1NIJA 2YNMA 4GBMA 3BRWD 1KI3A 3NEYA 1OH7A 2HCJB 3IKJA 2P5TB 1R5BA 1F5NA 2XZOA 4JLBA 2XB4A 3B9PA 4XVUA 3WP1B 2V54A 1Z5ZA 4L16A 1ZM3A 2QTVB 5DNYB 1J8YF 3AVTA 1H8HA 3R8CA 3VMFA 4Q9IA 2JIZD 4BFYA 4BZPA 1OH5A 2DWQA 4WZBE 5P21A 2BBTA 1RE0A 4PHFA 5EXSA 5A0FA 5CJ2A 1VCOA 1GG2A 2QMUA 3IO5A 4X8LA 4HUQA 4OQMA 1XPOA 2ZUBA 4QHSA 4QJ5A 5FFMA 4UJ5A 3S1AA 4QRHA 1J7KA 4KYUA 3TW8B 5KDLA 1E69A 1EG7A 3RS5A 1HT1E 3PEUA 1CR0A 4URUR 1SVSA 1HEIA 1TU3A 3WRYC 1UKEA 4M53A 2I1QA 1U8ZA 1HUQA 2QMOA 1H65A 4V0LA 3EW9A 1SVIA 3QBTA 4EPYA 3FHOA 1M7HA 1IM2A 3Q5EA 4ABYA 4YDSA 4BPBA 1P3JA 4DT1B 2R6DA 4Q19A 2DWOA 4ARZA 3WP0A 4Q66C 1RW4A 2OBMA 2OCBA 4OJQA 1FTNA 1VKJA 4ZKEA 3T35A 1BS1A 4LYJA 3UMRA 2WM9B 3VKWA 2F9LA 3BJIC 1LNZA 4FI3C 1XJ0A 2RCNA 2HEIA 2MSDB 3LW7A 1XEWX 4OHWA 5J4KA 2VHJA 5DGXA 1EFCA 1W1WA 3BH7A 3RS2A 4GT1A 2W58A 5FBRB 3WY9A 2ONKA 3V9PA 3KQUA 1KSFX 2O8EA 1UBCA 1ZW6A 4ZCMA 1SZPA 2FZLA 4I4LA 1GM5A 3LBHA 4AD8A 4NCJA 4TL8A 2PH1A 5FOXA 3L0PA 2YYZA 1LF0A 1N6NA 3ADKA 1R0WA 3REFA 3L2OB 4ZKDA 1CR1A 2IHBA 3CX6A 2AXNA 3QI2A 2Z5FA 1D5CA 1JI0A 2UKDA 3KL4A 2GXAA 1H8HD 221PA 2FFAA 3TUJC 3CX7A 2FV8A 1FMJA 2PLFA 1E2JA 2CNWA 4Q4HB 4PZLA 3AF1A 3VKHA 1EFHA 4DXAA 4NE2A 1KSGA 3A1UA 3B9QA 3QVVA 2DFNA 3SQWA 4A36A 4YMWA 5FUYA 2NO6A 1U94A 5AJYA 4FCVA 1NVXQ 3K0AB 4EFNA 2ZU6A 3X1DA 2H5EA 3BS4A 3CF0A
chains in the Genus database with same CATH superfamily
2GJ4A 3GFPA 3FLAA 4C4RA 3MRVA 5FUBA 3UJ6A 2V3VA 4DV4B 1GKUB 4K9KA 3WTCA 1QZXA 1RFLA 2G25A 1R0ZA 2H54A 5DI3B 3R3SA 1RKXA 3ILYA 2V96A 2R7NA 2ZKIA 1Q14A 3K09A 3PHBE 3PI7A 2HA6A 4MB2A 3SS8A 2VH1A 4CTKA 4CIWA 1YZUA 5G3YA 1UBSB 2OGZA 1MAWA 4KQ9A 3RTCA 2IHTA 1S8NA 3WV5A 1QH0A 1S2DA 4YAJA 3T5TA 4AIIA 3PNLA 1EGVB 4IO0A 1WSWA 2IT1A 3KUXA 2J45A 1B0UA 2PNFA 3DE3X 3LO5A 2R2GA 1YWGO 2ZVPX 1BWPA 4H1TA 2HGZA 2YY6A 3KP1A 3LPAA 5GJVC 2YWHA 2GUGA 1VG0B 3S2IA 3W9BA 3S2ZA 1HFEL 1JR3A 4UFNA 4BMOB 2RH8A 2XOKA 3DV0A 3A2KA 4PRKA 1C7FA 5AW2A 3WGMA 1VPLA 3WIUA 5CFOA 4ODIA 4NS4A 3HDTA 2J9FA 2BJWA 2HWKA 1EXMA 4DA0A 4D4KA 4LE0A 2Z2YA 1KDYA 4CIXA 3CLSC 5KBYA 1P77A 3WADA 5KQMA 1CYDA 4I5IA 2L19A 2ORYA 1Z16A 2QTVA 1NMQA 3KZMA 3M6MD 4U2DA 5LD2C 4WBXC 4BO5A 4BEVA 1V6CA 3VFDA 4GPTA 2RGBA 2W00A 2I3DA 3MRSA 4RQTA 3AUAA 5EXXA 3CZRA 3PC3A 2ZBFA 2CCGA 3GARA 2GCNA 3BYZA 1D04A 2WAMA 2VEDA 4AQ7A 1F06A 1ZM2A 4B2YA 3EZFA 4JXJA 1FF9A 3TW8A 3WYBA 4UPVA 1UBNA 5TPWA 2C8LA 1KXZA 2E4XA 2YDYA 1CS0A 1UIRA 3H2KA 4M9SA 4MW9A 3LCMA 2JFNA 3N0XA 4MUBA 1TPYA 1AQJA 2ZSIA 1QIHA 1NSTA 1ODJA 3B6IA 3E4DA 3DFKA 2V45A 4IOKA 5I51A 2QUIA 4S3MA 4BNHA 3PEVA 4H0NA 1CJUC 2Q5OA 4JT4A 1C4WA 1AHHA 4MUGA 2XGGA 1EFTA 1V1MA 3LCRA 1R16A 4TL6A 1ZGCA 4C78A 1GN9A 3OF5A 3TVDA 1X3LA 2XKBA 4JYBA 4L27A 4NE7A 1GITA 3EN0A 4DT1A 1PV4A 3PQDA 2IBSA 1ZCJA 3OOHA 3KIPA 1U2GC 4N12A 1SCQA 4G63A 4MS1B 3IR7A 3V4PB 1DHTA 5BRJA 6Q21A 3W1EA 4JI3B 5DNCA 1E6WA 2ISCA 1SAYA 2WQ7A 2YQ4A 1PF7E 3JZMA 5ALRA 2DJIA 1ZVKA 2YMLA 3TIVA 2GERA 1O6GA 1P5JA 4JBNA 2MYUA 4RTRA 2JLCA 4NICA 1U28C 2MYPA 4CL8A 5ILOA 4UOEA 4QYMA 1H4TA 4LNUA 3GT0A 3IP1A 3DNPA 3IEKA 2VWPA 4HLUA 2ZYSA 5DM4A 4F5ZA 3HWRA 1MUUA 4LUCA 2WJ4A 3AF4A 1P19A 5E6SA 5DASA 2YR0A 4XIFA 1JDVA 3QEJA 5CT6A 4Q37A 4D6YA 2NU7A 3HKDB 1O0CA 2VHQA 1NUQA 3HMKA 4ZO8A 4L3VA 1RM5A 1UBHS 3LXRA 4MQLA 3U7RA 1Y4AE 3HU1A 2QW8A 4WA8A 3HUFA 2XX3A 1YNSA 4M7RA 4KV9A 1OPRA 5D51S 1GGNA 3GAMA 2FAXA 3GVHA 3G8DA 1A1VA 1BX3A 3R5SA 2OXRA 4IIFA 2BJVA 1ZG3A 4ID9A 4RIFA 2HM7A 1LI5A 1QXSA 3KTAB 3TECE 3S3TA 4MVJG 3RS3A 2G76A 3F5FA 3QLJA 3WLFA 3MG9A 3RRJA 2PUEA 1GQ2A 4D74A 3NHAA 5G1PA 3KU1A 1Q91A 3JY6A 3P71T 4AC9A 5L4LA 5EIXA 5MFZA 5E0KB 2CXHA 2GPTA 5F77A 2O5CA 2BT4A 1MORA 1IN8A 1R8XA 4HLDA 1A9XB 3A1WA 5BN3B 3INRA 5K03A 5DIZA 3EXIA 4L02A 5C8DA 4F9EA 3W0LB 4K8RB 2Y76A 4EDHA 4G41A 3PJDA 2JFYA 4I55A 4XVQA 5IJAA 2KS6A 3ELBA 4LWQA 1IEXA 2Q6VA 5B53A 4J94A 5E1OA 5TV2A 3T1VA 1BA2A 2BY4A 2XKAA 1EQUA 3O8OA 4OOEA 4BVKA 4F71A 2PL9A 5KNLA 1JH8A 1LQTA 1SXQA 3HWX1 3NT5A 3B20A 3ONEA 1ECGA 2ZG6A 2BE7A 2I7DA 2NZVG 1B0PA 2P7HA 3GFRA 1XMPA 2BBSA 3DMHA 3EQ8A 3LU1A 3MSXA 1YJAA 3O84A 3USCS 4V03A 5F2EA 5FNVF 1JVSA 1CUWA 1ZIDA 2EF0A 4Q4AB 1E7RA 4V0MA 2XNJA 3SE7A 1HDZA 1P2UA 3PDIA 2E9SA 5KO2A 1G291 1YQWA 3QXXA 3GN1A 2OB1A 2CFCA 3ZW7A 1J70A 3E9QA 2VH2A 1ZEJA 2O8VA 3IPRA 4NMMA 1ULSA 2J0VA 4DLXA 3LPCA 4D56A 1LZKA 3NPAA 4E21A 2QG9A 2CXXA 3GLGB 5DLPA 3JYLA 3QEMA 3WX0A 1SELA 1W4AA 4MCAA 4KU4A 4EY7A 4KRYA 1WB6A 1CNMA 1OFVA 2ERXA 2Y27A 1O97D 3FNHA 3TAUA 3DEHA 3CU5A 3E8SA 3NJ4A 3PWZA 2QIPA 1FYXA 6PFKA 5CA0B 4V2IA 4XAQA 1RQRA 3NT4A 5KTOA 1P80A 1DIBA 3DTTA 4RDHA 3KSAC 3SJZA 4MVJF 1YB6A 1C8VB 4HH3C 1WPRA 2EX4A 2XYGA 3NP7A 4LDJA 3BD8A 421PA 4FKBA 4FPXA 5A03A 2GN6A 3B2QA 3BE6A 3CWZA 1HH4A 3WAGA 4B9EA 1NBAA 3IP8A 1JMKC 2ODPA 3UWDA 1X8LA 3AEQA 1DQPA 1VYHA 1NIPA 3UMBA 1QHIA 3DZGA 5JISA 4GPEA 1H9BA 1RYDA 4PRYA 1LNSA 4QFDA 2J85A 3RUEA 3OHMA 4IRXA 4NCNA 5ELXA 1IN1A 3NNNA 5KU1A 2DBZA 2IEZA 1XZFA 2IYAA 4RJTA 1G41A 3GYGA 5KSZA 4HZUA 1GRQA 5FWAA 1Y8QB 4MV5A 3W2FA 3PRKE 1CZKA 2NTEA 2GAIA 5G3ZA 1IZ9A 4OQDA 3GELA 4WKNA 1PJAA 5FWYA 1U2QA 2J0EA 3GR6A 4ECEA 2P4SA 1GGHA 2IE0A 2X2OA 2QRVB 1E3QA 3DKPA 5C35A 1C7JA 2OUIA 2XRYA 2TS1A 2V6MA 3WL4A 1DO8A 4AKTA 3HJNA 1RQNA 2V7VA 1ZS9A 4Y2UA 2A92A 4EIWA 4I50A 4Q4LA 3VJLA 2EBHX 4NMXB 5E2BA 1R4ZA 5DHTA 4ZVVA 2EF1A 5L7YA 1XRLA 2F48A 2PIAA 4M86A 3OPVA 5I9SA 1D4FA 3WNZA 2GD6A 1Z06A 2SBTA 2RGXA 3NXSA 1YRAA 2IOFK 4IMRA 2VHWA 2WDPA 1F4LA 1B8NA 2AFVA 3OPQA 4TT8A 5KS2A 3OCWA 1CP2A 4R2LA 5FORA 5A2QA 3IJEB 1YJXA 3IPXA 1NW4A 2VK8A 1TVMA 2NW6A 1VE6A 4WXPA 2H85A 1UPCA 2I4IA 3PVCA 2VBGA 5BV2P 3TGLA 1L1QA 3MT8A 4M21A 3LP8A 1I2CA 1W6RA 1Z12A 1N0UA 1PFGA 3V1TC 1S2OA 3DDNA 2VZ8A 4FOTA 3WL3A 1ZKMA 2GLUA 4PZCA 3KKQA 3UAOA 2ZJ5A 1DX9A 3I4CA 4BC1A 4OXNA 4GMXA 1Y7HA 1YZVA 2H11A 4C3ZA 1MQ9A 1JU9A 3HFRA 4LBYA 4YBZA 5FJIA 3K9WA 4CI9A 5B2FA 2CF5A 2NSJA 1LDMA 2ZJZA 5DNVA 5T67A 1YHYA 2WKWA 5HZKA 5JAHA 1HDYA 5GONB 5EIWA 3WYDA 1TGVA 1E9BA 3RIGA 1K4KA 4UHFA 1TM2A 4HGNA 3TZLA 1P4RA 4ER5A 4IH4A 2GJAA 5BYKA 1DDIA 4CKCB 1ZXXA 5DTJA 1UWCA 2K2QB 4MGEA 3X3HA 4AUNA 4YT2A 2V0GA 1MVNA 2NYRA 3FOAA 3KALA 1Q74A 2J9XB 2QTRA 5D3MB 2AX3A 5ENZA 3U9SA 4DUGA 5KQGA 3EZ7A 3NKLA 1SVLA 3BD6A 3IKTA 1UINA 2VP9A 4HNQA 4I9FA 4JQSA 3TEFA 5HUQA 3C5HA 4WXYB 2TECE 3B85A 2C9YA 3SM9A 1U0BB 4X93A 4XDHA 2QA5A 3GPIA 3PNOA 5BN4A 5JCZA 5AK4A 2R7MA 3G8YA 4IG9A 4KSCA 3ZEAA 3ZQ6A 1YBVA 1NY6A 3IAEA 5K3CA 4A8PA 4IOJA 2GAJA 2AKEA 2NAFA 1TZBA 4PZ0A 2E0IA 1CB7A 4EG8A 4OV6B 5FWXB 1YZHA 1QP7A 1RI3A 4QJIA 3MFYA 4ENRA 1RC8A 5HFNA 2ZAGA 5EPUA 2H48A 2YV1A 5LZ8A 4C0WA 2AG0A 3NRBA 1G5HA 1QRDA 1F8XA 1B0AA 1ND6A 2A0FA 2Z9DA 2FPLA 2P4QA 3HFGA 3OQIA 4FGUA 2BSXA 3M4XA 4XFKA 2FP3A 3UF0A 4ZCRA 2AX4A 2XEXA 3GLIA 2O3JA 1XVUA 4ZZ3A 3EOZA 4R05A 1ZESA 3QX8A 4NOMA 1CYEA 2KW5A 4RLSA 1ONSA 5FADA 3CRZA 3H7AA 3FI0A 3RRFA 3RIMA 2VSYA 4P32A 2AGVA 2I8AA 5D85A 1VPVA 2RI1A 3K0FB 1Z4NA 3UMCA 3X1KA 3LWBA 4ZRNA 3IP3A 2JGNA 1KDPA 1Z36A 1TM1E 1N6OA 2NVOA 3BVPA 4XQCA 2N1BA 4R8VA 1NYLA 2XDWA 3IYLW 2WJHA 2FW0A 4OAOA 3WRYA 4TTQA 1NAIA 1E6KA 3M81A 5A6VA 4ZJZA 1KZ1A 4ONEA 1JU3A 2NV0A 1EP2B 4IYJA 4E2FA 1QC5A 1XPRA 4Q1DA 2ONYA 3WK8A 2PG3A 2UZ1A 5LLTA 4HJXA 1ECBA 3OP4A 4QXPA 2EZTA 3B3AA 2Z5GA 4KSBA 4BX3A 1V7ZA 1ML4A 3K1AB 4J0IA 3MS2A 4ED9A 1CQPA 4XRGA 4N9WA 4GI7A 2Z58A 2P3OA 2DUJA 2QAIA 3CH7A 3CTPA 4HTFA 1UBOS 5TQVA 2BLNA 2BEKA 3L6DA 4BECA 4IX1A 1GA6A 5CNIA 4UMEA 1IBMB 2R84A 4H4DA 1CU1A 3AEKA 4IXWA 4AW9A 4PHHA 3JRNA 1H1TA 1ZY2A 1E96A 3UVEA 3TFQA 4FX2A 3NCHA 3TF5A 1JBEA 4NJMB 2Y0BA 3IILA 4YYEA 3T9BA 4NAVA 1A7UA 4BZWA 4ZOBA 3H6HA 3EBPA 3CLRD 2CWWA 4G0WA 1TUIA 2W93A 1FDRA 4UJ3A 4ZVRA 1TYCA 2H92A 3NBAA 4KH1A 1ZI8A 5T4FA 1H93A 1PFVA 4CL3A 2ZULA 1BN6A 2IYPA 4PQGA 3NV9A 4CM8A 3EVTA 5BUSA 1R4NB 3I1IA 3RO7A 1RZVA 3G2PA 1IJBA 2N0SA 3VPDA 3OEHA 5JSYA 7MDHA 1PK7A 2B1RA 1GU0A 4OHUA 2WG2A 1H9AA 5MDHA 3RUHA 2ZRAA 1UZAA 1U8TA 1Q11A 2CKMA 2GBIA 3G1UA 4LJLA 4NAHA 4P08A 4A27A 1XHFA 2GNPA 3BB3A 3LSTA 4P3OA 1T6ZA 5CK5A 5IM4F 1KNQA 3DO8A 3C6MA 1EGHA 1RRVA 1GQSA 1CNEA 1XN1A 2J33A 3MUFA 3NBFA 3ONDA 1FMCA 2YVQA 1S5PA 3HY4A 2VNHA 4MHSA 4FEYA 1DRKA 3VO9A 3ZXUB 1Z07A 1PNRA 2IHKA 1JG6A 1XPUA 3LT4A 3OQOA 2PPVA 2Q4RA 2VI5A 1EFVA 2EZUA 3DVQX 4MUHA 3OLXA 5KI6A 4LC9A 4X92A 3QHAA 5IBRA 3U4AA 4EY5A 3DOCA 2ZWAA 2IBTA 2XCLA 1FPMA 1CRLA 4QUIA 4X0EA 3RRYA 2QLMA 2C59A 3PP8A 1H2BA 4D79A 3NCTA 1ZM9A 3WLRA 3WISA 1O6BA 4Q3KA 2I7TA 3MQFA 4CUJA 4PV7A 3U4QB 2O2DA 3CO0S 3IO3A 1U8UA 1G2QA 2WZQA 3T7JA 2Z6AA 5AXAA 5IXJA 3LQQA 4Q3EA 3EVGA 4DBLE 5K8LA 1XCMA 1JJFA 3WGHA 5KMGB 3IDFA 2LPMA 4P3KA 4ZU6X 2FZCA 2XOXA 4WK4B 1LQ2A 4EMSA 3CVJA 2VCHA 4RKQA 4DCJA 5JZBA 3F90A 2EKDA 1OFHA 3V3TA 4R0MA 3G5AA 1ZITA 4KMMA 1U1EA 1XC7A 4KO3S 1CQJB 4EG3A 2JGKA 4RNCA 5BVHB 4MLZA 5EUMA 3R7AA 1M10A 4WBNB 1XLTC 2Z3VA 2C9BA 4R40A 5SICE 1A3CA 1CUFA 1JDUA 4NBKA 4BU0A 2R11A 4N0EA 1F4PA 3I4FA 1FVHA 3HCRA 2HRDA 4I4NA 1V2HE 3A6GA 1TQ2A 2J09A 4CDMA 3GVXA 3GO4A 3U0BA 4AO6A 2COKA 3HVRA 3IEVA 3LQ1A 2COUA 1SCUB 3H0CA 3VAZA 5I4BA 1KTIA 4OYYA 4CNBA 3VZRA 3QG5A 2BOVA 3LGSA 3I6IA 2O3TA 1EINA 1UFVA 1W2GA 2EHDA 3QVJA 4KYTA 5F52A 1Y1PA 1YOVB 4C4YA 4BUJA 3ENWA 5A06A 2HY7A 1CIJA 2V7GA 1N9ZA 4OXRA 4S35A 4ER3A 5ECWA 4BNZA 4W5WA 3RRXA 4X7BA 4NBRA 2CUNA 4K1LA 3AUSA 2YUTA 4WCFA 3N7TA 2AN1A 1Q15A 1JB9A 2GEVA 1S8FA 2RK3A 3VR4H 3WFIA 4PNEA 1KYWA 4X65B 4D42A 1B1AA 1J20A 2YDXA 3MGCA 2DJ5A 4BRUA 3W2TA 5KVSA 4GX5A 4EKEA 4GPAA 1KXJA 3UAYA 2ECOA 1ZD5A 3L7JA 3TL2A 1QBGA 2XECA 1EH5A 1G5QA 1XVAA 3LC2O 3AL0C 2W0SA 4Y6OA 3QUTA 4V0OA 1AQLA 2BEVB 1M7GA 4IKEA 2RGNC 4IRMA 3OE7D 4Z9FA 3X1MA 1TTTA 3LYHA 1OWPA 1SBYA 2P3QA 1F20A 1U2TA 2FZGA 2ISQA 2HWXA 5NULA 1AZTA 3OTQA 1ORVA 3GH1A 5F1YA 3BICA 3DMYA 3O3NB 4WZBA 4PNHA 4RTPA 3GJQA 4CDGA 3MJTA 1Y6JA 3G9TA 1BMFD 2P4UA 2OENG 2JNWA 3Q88A 4X6LA 4WFIA 5AHOA 5IAKA 5BWBA 2NQTA 3HO1A 2BFEA 2QDKA 1NNLA 3MCWA 2IC5A 2ZI7A 3OJCA 2J41A 3C39A 2HK6A 2I80A 4PYOA 4RJJA 3GX1A 1CDEA 2J32A 3A6PC 4BAGA 2I29A 1D0IA 1FXWA 4JUAA 1NUTA 4CQMB 2F17A 2Z83A 4M6WB 1GT91 1J0AA 2WTAA 4OHBA 2XVAA 1OBHA 2YJ4A 1XEAA 1NC3A 1PV1A 2X0KA 3ACCA 1RI1A 1HQKA 3GG9A 2IUTA 1LLQA 3P9YA 5B1YA 1E2GA 1U0LA 1FS5A 4NDAA 4F04A 3E5MA 1Z2DA 2G4VA 1SIOA 3UH0A 3R5HA 2I6XA 4IBOA 3SQOA 1KJWA 2PKQP 3DD1A 5TIIA 2XVMA 3KE9A 1KMMA 3OKPA 4LYGA 2AR7A 3D6FA 2IPOA 3GWGA 1RXIA 4LSGA 4YXWA 3ZE1B 2BP7A 2O8DA 1PT6A 3T7DA 1F3OA 4CLHA 2GBPA 2HMAA 5E7QA 4JXXA 3LC7O 4JMLA 4YP0A 4Y6PA 3JVIA 2PGLA 3T9AA 3MT9A 1P1RA 3G82C 5EEHA 2H2FA 1U3UA 3ASUA 3QTBA 3UXEA 1GPNA 2WF5A 4JKIA 5FEUA 1O94D 2KLHA 5FHQA 3GBVA 1QZ3A 2B36A 2MMGA 3BE8A 3PYLA 4M8NE 2GPBA 1SUEA 1INLA 2XDYA 4B3MB 1F2TB 3NALA 3LM8A 3RTBA 4D4LA 1ULHA 1T15A 1DAFA 1OA1A 1JILA 1XQ6A 1J42A 4NCHA 4JBWA 3OZGA 2QTMA 1KP3A 3C3WA 2GK7A 4CR7A 1Y3FE 4G01B 4HYYA 1TAHA 1QAOA 1OVMA 2C4VA 1YB7A 2QT9A 4FFNA 2H18A 4G56A 4HGPA 1NXWA 4BLTA 4DIKA 5K8VA 4QYWA 3HXMA 1QB7A 5LCXA 3GDGA 3IEXA 3OT5A 3AJAA 1ADYA 3CINA 3ETJA 1XQ9A 4URXR 3D02A 3N05A 4LVNA 2GYYA 3U13A 5HILA 1G5RA 3KXLA 2FPOA 4WECA 4AN0A 4GX2A 2QMYA 4KQGA 2VRWA 3DHEA 4JNCA 1HBJA 1YQXA 2KHZA 2PRZA 3KK0A 1F1JA 3L6BA 1UFKA 3NAQA 1T25A 3C1UA 5AOCA 2Q3BA 3IBGA 4Q9JA 2P9EA 4F60A 1V3VA 2O1XA 3LMKA 2BDEA 3B78A 2R6HA 2JGJA 2JH9A 1IZ8A 4GZ3A 5DK6A 4GDFA 3FCSB 4ZC1A 5EE3A 2XEDA 5DX8A 1USGA 3DMRA 3UICA 4HAUA 2R00C 3IUBA 3AVQA 3JYOA 2G7MC 5IH3A 3T9DA 1GYRA 1FLNA 1EUZA 4I6GA 2PLWA 3IQZA 4NKRA 4QDKA 3KLMX 4I0WB 4CKYA 1T13A 5JG7A 4JODA 3DOOA 2QB5A 3VOSA 2XUHA 2CB0A 4EGJA 4LE1A 4K6OA 1O9BA 2AR0A 2BCJQ 4CGZA 2QUKA 1VXOA 1OSNA 3ABSB 4RABA 2ROQA 3BF8A 3IE1A 1G6HA 2XA9A 2YFQA 4KL8S 5DLQC 2PGXA 3ZV5A 4HLNA 2X2PA 4J49A 2YS6A 4NU0A 3CZ5A 4R8KA 1J21A 3VHLB 1DWUA 5JADA 4KR0A 2VJMA 1T3TA 4ZQEA 2CJYA 2HRQA 1QCYA 1RDFA 3I3OA 5AJTA 2WSSA 4ZC8A 621PA 1ZOLA 1FRVA 2AJ8A 1H6CA 4AZ3A 3FOBA 4IVQA 3O8QA 4PFQA 2I4OA 2X0NA 4JXKA 1RHKA 4LYDA 2BGGA 4RL4A 1CULC 3QKSA 4XWWA 3SQNA 4HRAA 2BKAA 1WZUA 4ROTA 2EV9A 3R0ZA 1DIRA 3WKEA 3DEJA 4WNAB 3WLLA 2O48X 3JVDA 1MJ5A 2Q8PA 4DCPA 3ZU4A 1T35A 4X1YB 5JSHA 2RD2A 4QGAA 1NLUA 2XA2A 4IGAA 1U90A 4ALMA 4DA8A 5KHOC 1JHYA 2FRVA 2NYUA 1UOOA 5EG5A 1VFNA 2JJ1D 2E4YA 3NIDB 1JLLA 1LI4A 3H42B 3IPLA 2CBZA 4CFSA 2FQWA 1JKFA 5MGBA 1QX4A 4IZHA 2A7QA 3EQ9A 4E2ZA 1ATZA 1AZWA 5B2EA 3FN4A 1XE3A 5K0BA 1HSZA 3AR4A 1PZEA 2RH5A 4NZMA 3V1NA 1JR3E 4REOA 3QBDA 4K86A 5C2JB 2HUPA 4DE5A 3W3ZB 1HNWB 1KERA 1TUBA 3T5DA 1F0PA 3TIIA 3VR5A 1ZRSA 3EQ7A 4QL3A 4V39A 1EU1A 1R4MA 4UBOA 3KFLA 3DGEC 3OWXA 4UXHA 3ZEIA 5CT9A 4RCVA 3ML1A 2CNBA 5TGTA 1TEVA 4A4DA 2D3TA 4UPEA 3JVEA 1L5MA 2GN9A 2VAMA 2ECFA 4J0FA 4C4XA 3L7YA 3TLGA 1SQGA 1Q2XA 1GJRA 1K8QA 2O8NA 3N7AA 3LFHA 1YCGA 5ICFA 5I5GA 2Q1WA 4QXOA 3UT5B 3I1YA 3C97A 3EW7A 4EKYA 4LMPA 1N1EA 4MMYB 4KDFA 2QK4A 3ZV6A 4BDSA 2ZAMA 1Y9ZA 3I2FA 4TKUA 4BRZA 2WU1A 1MNAA 4AJ4A 5FTLA 5KNBH 4OSPA 3VOTA 2RFLA 1J99A 2BZSA 2V55B 2B83A 1Z25A 2QKYA 1QHFA 2V1XA 1NMZA 3QRWA 2PUBA 2LZ0A 2FQ1A 2RE8A 1B42A 1CUGA 1UANA 3HA2A 4KNVA 1NN1A 4DLRA 2DFDA 1UAYA 1WHSB 3CUSA 3MBOA 4R51A 3ROEA 4M38A 4ROSA 4L7VA 4RV5A 5TF0A 2E5LB 1UBRS 4BY9E 4OHYA 1SO8A 2X6TA 3TZ6A 4GM0A 5JI2E 3IMEA 1G9TA 3A04A 4RD3A 1OREA 4DQ0A 3LO8A 5AI4A 1EFRA 5LYJB 1K63A 1NI5A 1G7SA 1OKKD 3EIQA 3I0MA 5BNTA 1RXVA 2I5PO 4OVKA 2GZ1A 3VZQA 2IYVA 1T5HX 2HIHA 1XAHA 4YUZA 2CNOA 2Q3CA 5IZ4A 2XVXA 1L7BA 6YASA 5CCDA 3W5IA 5AXBA 2V4ZA 1UAAA 1DDGA 2WKPA 3CSUA 1YJQA 3BCSA 1WDMA 2VAXA 2WG0A 4UOQA 4ZOEA 5ALSA 2P35A 4DCSA 3FA2A 4Q3OA 5JC8A 1VL1A 3EVZA 3UZUA 2BM1A 5EMLA 3U4CA 3ZBUA 1RRCA 1KZ6A 1K68A 5IPFA 2BAGA 2N42A 2HN9A 2ZVDA 4N7JA 4AB1A 4HVCA 1M66A 3I9MA 3KZNA 3Q5GA 4K2AA 2CYCA 3RS9A 1IG3A 4OQPA 1Y1KE 1KHTA 5GY7A 1LJ8A 5CT8A 4CT5A 4N4AA 4XVCA 3KHTA 4AI6A 5FULA 5TQ2A 3QX7A 1NTOA 3NC1C 4U6NA 4AMZA 2Z6QA 5U4XA 4FFPA 2JK1A 5FOSA 4BNWA 2VP4A 2V7XA 3CB2A 2WJZB 2NSYA 4MGKR 3BWVA 1MP0A 2X0FA 4DJTA 1S3FA 4TXMA 3BXFA 3JASB 2QN8A 3JWIA 1NPYA 1MIOA 3JCZA 1Z4MA 4FHDA 1Z33A 5H4HA 2OILA 3ZDEA 3MJRA 1TJ3A 2C03A 4C4OA 2I4TA 1YI0A 2CHFA 2Q3EA 3KTFA 3HCEA 1NWHA 4XPZA 4B6PA 2F7SA 5BW8A 1Y48E 5HX7A 3BA1A 3EXFB 5ED0A 1ENYA 3H17A 1WXHA 4V2UA 3PRHA 3EIHA 4DMKA 2WWTA 2WUDA 5FYQA 1BC5A 5D2CA 1ISIA 1CSEE 2FEWB 1J8MF 5JE8A 1P6XA 2JD2A 4HZIA 3IJ5A 1N7JA 3I42A 2V6JA 3AY6A 3NDPA 2W42A 1TA0A 3IQFA 5K4HA 3HLTA 1JSRA 2PGDA 3SC2A 1NUPA 1GPWB 3O6VA 4MEAA 2WUFA 4PLYA 5CDUA 1V11B 4WMLA 3L05A 3SIRA 4M22A 2YJTD 1TCUA 4P4NA 1TCBA 4GI2A 3FNGA 4XDZA 4YPFA 1IB6A 4ND1A 1WXQA 1P6QA 3H2BA 1TVKA 1N6RA 3G85A 2W2NA 2JGDB 4MA4A 4LVOA 1E2DA 2ZANA 4BNMA 3ANNA 2G1UA 5CVEA 1PJQA 3IDOA 1ZGHA 3A05A 4HB4A 1E20A 3DTNA 3MYRA 2PUJA 1J0EA 2EIHA 4FE4A 1FL9A 4GRAA 3NHPA 3OCJA 2HU2A 3L40A 3R3XA 4Z7OB 4W5NA 1TK3A 4ZCSA 2B8EA 2WYOA 3AZQA 4YJHA 1GDTA 4V0ME 1ZD3A 1ZLYA 2GPWA 4KQKA 1K92A 6ADHA 3E2MA 4N03A 3KFXA 4J8PA 5FL7D 4RVOA 3GV0A 2FPXA 1USIA 4TT3D 5KOHB 2OMKA 2OCAA 1TJNA 3HHEA 1E5QA 1ZVQA 3DHWC 3RODA 4PC3A 4O0MA 3IDSA 1QB8A 4P4SB 2P6PA 4Q03A 3SBOA 5JFTA 2ZYWX 3G1WA 3VJMA 1OB2A 3K31A 3ZCPA 3KDSE 1KYVA 3DF9A 3GLFB 4DLWA 1CVIA 4K46A 3OLZA 2FSIA 4NV1A 4R4JA 2HBZA 2PKCA 4RSRA 4C4ZA 4G5FA 4HAXA 3AR8A 2OHHA 4UTVA 1B93A 1Q0ZA 4FYVA 3NO4A 3K70C 2JF0A 4PICA 1KVSA 2NZJA 3VBCA 2B30A 1T5LA 3K4HA 2IRWA 1R8QA 2HNAA 4BN4A 5B12A 3V8EA 2EBFX 2CE7A 3KR9A 1OLUB 1FB5A 1Z0IA 2PZLA 2ZI3A 3OU6A 4I9NA 4MDHA 3RVDA 1PEKE 3FZNA 3ZK8A 1W85B 2JFGA 1P60A 5JZMA 4XD7D 2FQQA 2IFTA 3TAHA 3EPHA 1VGQA 1EI9A 1SCDA 2RBKA 4FIZA 1O57A 4JYCA 4F3RA 2IYTA 3KSBC 1R6XA 4QUJA 4D1YA 4R3UC 1SY7A 2GVNA 5AVZA 1G3RA 5F2KA 3M82A 3GA0A 4A1OA 3IAFA 4KVGA 3ZE0B 4LJ5A 3AVYA 1LD3A 2VP5A 3EXHA 3PUIA 1GL9B 1NE2A 1RZ3A 1V25A 3OJWA 4ZTZB 4D2IA 1X19A 3M3PA 5K4GA 1D9XA 3R3ZA 2VSFA 3S27A 4DQDA 1JHDA 3KKPA 1IHDA 4GZMA 1W4LA 4B74A 3NIWA 2NUAA 5DGIA 5JDIA 4JI8B 3WSWA 5ECDA 1O6ZA 1V8PA 1Y3AA 3F4BA 4MB6A 3FHCB 4YJ3A 4BKQA 2O23A 1PS8A 5HMMA 2B20A 3BERA 3ROZA 2VUHB 5IC5A 4J4BA 2OESA 3KJNA 1BH6A 2R6FA 3PWKA 4HNRA 2AE1A 2JVJA 3QVWA 4H7KA 3SBDA 3ZQ4A 1OAOA 2GNOA 3V46A 1FX0A 4CV1A 3CGWA 2OQVA 1JPNA 4BB9A 2PD4A 2H6EA 1ZH2A 3PHLA 4IHJA 4U1RA 3QVUA 1YMUA 3UV7A 4WA7A 2CDBA 3SNKA 5JAIA 3AIOA 1AHIA 4OUDB 3CRQA 3NW9A 4ZI5A 3FAKA 1WWKA 5LOVF 4C5CA 4L4YA 2H1IA 16PKA 3M1IA 4XH9B 5T57A 1KEWA 1JEDA 2CZQA 2GJKA 2WUEA 1J25A 3I12A 1WNFA 1WP9A 3VI3B 3DLPX 1O97C 2VS1A 3EIEA 3G5MA 3D2BA 2R86A 3H8SA 3PF9A 3W3AA 4ES6A 5EJGA 4ZWNA 1L5QA 1T36A 5D1HA 2BE9A 3FUCA 2XW6A 4X7RA 3OQHA 5B3KA 2PX4A 3AESB 4CLRB 4TZ6A 1UK6A 1FJ2A 2GD1O 5KJCA 1MHPA 1PLLA 3AR5A 2YFKA 3EIUA 4OHPA 3C1AA 4RCYA 4Q3AA 3PPXA 2PXAA 2I6TA 3BGOS 3ED5A 4IKOA 1JS1X 1PWXA 3BULA 4CM9D 3DXYA 3E48A 4YRZA 2OHJA 4O4HF 1OY1A 5CH8A 1NP6A 2AEJA 2E6UX 2D0OB 3V4VB 5C8YF 4RU1A 3CBGA 3HE3A 2F64A 3LNCA 3RKSA 2YWXA 1G3MA 1GLNA 1U9ZA 2W90A 3AEYA 4PC1A 1LPPA 5THXA 1PFKA 1K88A 1TMYA 1REQB 2Y1WA 1E3JA 2GN8A 1X8JA 2YN4A 4B32A 2F1OA 2R62A 4D3SA 2Q5IA 4EJSB 3RVBA 1MC8A 1N9KA 1K6EA 2PZMA 4L5AA 4JH0A 3WA6A 4XIYA 1UOQA 3TRDA 3OCVA 4ZGBA 2JFBA 3FI9A 2O2YA 2Q2VA 1HPLA 2QP3A 3WJ7A 2X3YA 3K1JA 4Z0TA 1SR8A 5FUMA 1DFIA 3WV4A 2GA8A 1TZCA 5KWSA 3QEBZ 2EZ4A 2WFZA 3E9NA 2C5FA 1EZZA 3NDJA 2H7VA 1UC9A 4WOBA 1ICEA 2ZI5A 3EY4A 4S0XA 5HF9A 3W34A 4QPJC 3FMPB 4Z9AA 3UOAB 1DC4A 2VRBA 3EXG2 1IMOA 3WRXC 3O93A 1EXWA 2NADA 4DLBA 1P72A 1JPVA 2VJAA 3DAPA 3I23A 1SBCA 1DUIA 3E84A 3THWA 1IBLB 4MW0A 3GLVA 1RJFA 3QSYA 2HLDD 3MERA 4CCYB 4E11A 2H4HA 1YR9A 2VPXA 2WG1A 4L2IB 4IDPA 4PYQA 4E5VA 2CV2A 2I4NA 4OHRA 1FQJA 3LGAA 1PLJA 1XAJA 5HMLA 5BSEA 4J2TA 2DC1A 3F98A 4X20B 3K9CA 3A2MA 4BEBA 2ZZKA 3AOEA 3N1UA 3I5UA 1ECCA 3U56A 4DRYA 2VXYA 3DBRA 4OU4A 2YTZA 4C5AA 4PSVA 3NJ8A 2ZJ3A 2NOAA 3ZZ0A 3FKSA 3G0GA 2REQB 1NFRA 1FDOA 1YDWA 2GCOB 1VJ5A 4DA9A 2NZXA 1N2JA 4OXXA 4ERNA 3RVSA 3CTMA 3MGAA 1JPUA 3KXDA 2JGAA 3GPDG 3OOYA 5J2UF 1J2TA 1QIDA 3IUJA 4OA8A 3K0CC 5JZSA 5COAA 1RTTA 2ODTX 4IJQA 4LTDA 1DTSA 1ESMA 1LFDB 2CF6A 2P6NA 5H7XA 3ROXA 1Y34E 2INGX 5IXSA 1LLFA 3I32A 4NAUA 2VAPA 3JQEA 3TOCA 1YMVA 5HOEA 4GL2A 1VLLA 4MUMA 2HT6A 2PN1A 4X90A 5DNWA 5FO0A 4GLOA 4D97A 2QT0A 3DQZA 1HY3A 1ZXLA 3ETLA 2JVIA 3FBGA 4RKEA 4X97A 4AY3A 4S1OA 1N3BA 1VPEA 1SHJA 2CGEA 2OBBA 3ZIAA 1ZINA 4H1UA 5TT1A 3I5YA 1A76A 1KHHA 5TXGA 1SQ5A 1G5FA 3BD7A 1YV9A 2HUNA 4YAFA 5UKDA 1N2EA 5A9SB 1G2OA 2JFUA 2RHDA 5E1MA 3K73O 2DWPA 1SUSA 1Z0UA 4QLAA 2B9EA 3GRRA 4Y9UA 5BQ5A 3HB0A 4QNNA 1GRCA 3DE6X 4NC9A 4ON9A 4I3GA 4OYHA 4TS4A 5T4EA 3OJOA 5EP4A 3KOWA 3FOEC 3PT5A 4TXNA 1DG9A 4JI4B 4RCZA 3H2IA 5FBQB 1QLJA 3HH8A 3N3AC 4GOLD 4CE6A 1THMA 2UZ3A 3C4QA 1DWOA 3HA7A 5BSHA 5CDSA 2I2XB 1KAGA 5LN1A 2QTFA 3EGOA 4GE3A 1SC6A 1RXYA 3QVSA 1LC0A 4PW0A 2D4AA 1DZ3A 2HFKA 1T0PA 5C4GB 5K6TA 2I9KA 3TR5A 5BOSB 2ZB3A 5FLYA 1AKWA 4JIGA 1Y0BA 1NQTA 3ZNOA 1WB4A 4YI5A 2XRMA 1SVKA 2EJTA 4ZRDA 3A6HA 1ZISA 3FBWA 3GEBA 3LLCA 5JDIC 4P5DA 3Q40A 3QMVA 3D7MA 3E4CA 2CUTA 4N3NA 1UEXC 1HDXA 3V7UA 1NMXA 4CMKA 3CF2A 3P7MA 4ZO6A 3OI7A 1PFQA 2VA9A 1I4LD 3JQPA 3BH6A 3OE5A 3TLKA 2EL9A 4EHFA 1XCOA 4CFZA 4EB6B 4JJIA 3SQMA 2DBRA 2OY0A 3F5QA 1GRRA 2G1JA 3IDZA 1U2DA 3IIIA 1JHUA 1A96A 2KI5A 4YLEA 2ZIXA 4MRMA 1J2JA 4D02A 4IDAA 2O4UX 3FW1A 5C8XA 3HB9A 2M1XA 5EI5A 3V8VA 3L06A 1W0JD 1QZUA 3KJEA 3L18A 4YV2A 3JS5A 3PXEA 4K9SA 3WZMA 4TM8A 1HDGO 4DM7A 2CDCA 5F98A 1M8GA 2AHOA 1T2FA 5AJXA 2H9AA 4DRZA 3MBIA 3CSSA 3GJ0A 2YVKA 1SU6A 4OL9A 4HNTA 3G2MA 3D8HA 3AIKA 1N5JA 2D7CA 1E66A 2XJ9A 1Z39A 1KI6B 2JEOA 2D3WA 2OXEA 1JA9A 1T4BA 3EFOB 2P6RA 4BB6A