2D06A

Human sult1a1 complexed with pap and estradiol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title The structure of human SULT1A1 crystallized with estradiol. An insight into active site plasticity and substrate inhibition with multi-ring substrates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d06A00
1R0YA 2HXSA 4JSTA 2Z83A 3MSXA 3NHAA 2GCPA 2R8RA 5DYIA 4A2WA 4DSOA 5BN4A 2ZVQX 3UIEA 4UNPA 5B58C 1VG0B 2C99A 4N3NA 1ZUIA 1FQKA 2ZRNA 1KMHB 4PPFA 1DARA 1MO3A 2HUPA 2W0MA 1IN8A 2A3RA 4AD8A 2OM2A 3F0TA 2Q9BA 2GEVA 1IY0A 1E1RA 1KSJA 4QRHA 3TIFA 2BCJQ 1I4LD 2AX4A 3WYAA 5L3QB 2EFGA 2ANBA 5AUQA 2XEXA 1W48A 2V7QA 3UMFA 5HZKA 1BOFA 1CXZA 1G5PA 5EP4A 1M34E 2R2AA 3MFYA 4A8JA 2GA8A 3T35A 1T6NA 1ZM4A 4WAUA 4C0BA 3AQ4A 3LV8A 3CUEF 3K70D 2K5UA 2FN4A 2VYFA 3AP1A 1IJFA 2J45A 1NMXA 2OFOA 2BHRA 3GLFA 2AFIE 2XTZA 3GJ5A 3PUZA 1YKSA 2P0EA 1IN4A 2C96A 1TUEA 2CBZA 2CL6X 5HTKA 3LW8A 3D6TB 1CRQA 1E2EA 1OF1A 5JRJA 1SHKA 2B8WA 2OG2A 2ZS9A 5CLQA 1NY6A 2ZE6A 2X2FA 1JNYA 1XTJA 4RKEA 1Q1ZA 4UNSA 2R44A 1ZC3A 4FD2A 4Q4AA 4BFWA 4LBYA 4DVGA 3Q9LA 5DO9A 4PC3A 4UXHA 3VR2A 1SULA 2BIFA 3MWJA 1CTQA 2Z43A 1E94E 5FTJA 3AF2A 4G5SA 2VHTA 4Y0VA 1RW4A 3FFBA 3JZAA 5K8TA 5J5CA 4QOSA 4GPTA 2RGDA 3CZPA 1RRCA 3NEJA 5DI3B 2OUKA 2WMNB 2C95A 4RZXA 1H8ED 1VCIA 4X8HA 1AIPA 2QPOA 3OESA 4Z1MA 2ZIAA 3BH7A 4L15A 4Q4HA 5BW8A 3TW8B 3WNDA 4TYNA 4LJ7A 2ZE7A 1NMYA 4FMDF 5CJ2A 1A2KC 2F1HA 4KVGA 1G8YA 2ZI4A 2KB0A 4YLGA 5J47A 3NBFA 2OAP1 5P21A 1G3UA 3RC3A 3EG5A 4P4SA 2IHBA 2IS6A 1N25A 4PC2A 4N1AA 1OHHD 2OBMA 2NO6A 5DNYB 3NXSA 5GJVC 1SXJD 2VQSA 1T91A 4Q1AA 4MUBA 1H8EA 1KJZA 3Q3JB 1T0HB 1UEJA 1DO2A 2G6BA 1GUAA 1TX4B 2D74A 1OFUX 1SVOA 3HU3A 4BLQA 3ZVLA 3FWYA 3LLMA 4PPNA 1Z0AA 3UWOA 4EPWA 1KNXA 4MGKR 4RFSA 1EX7A 4MH0R 4M22A 3SFZA 3TGPA 3D31A 4L4UA 2IA5A 4GZMA 3K0AA 3NH6A 2WTUA 2ZROA 4B2IA 3JVUA 4Q9JA 3CRQA 2F1IA 1GP2A 2QMEA 4QJ5A 1Z07A 3TSOA 3RWMB 4B43A 2BMEA 2P5SA 1VG9B 3RRYA 4NE2A 4QFMA 4ZDIA 4TLBA 3ZLJA 1SXJA 3MWYW 2ZE5A 5DHFA 4CRWB 1G7TA 3WHLA 1XWIA 1Z6YA 4TYWA 5FBWB 3U4QB 2ZANA 1E9RA 1N6HA 2PZFA 2I3BA 5AJZA 3CNNA 3NIBA 4OQMA 1IM2A 4MRVA 4JLDA 3VFDA 4B6EA 2OBNA 2QL6A 2BBOA 2CXXA 2GZHA 3H2YA 1TPZA 4IRUB 4P3YA 2IK8A 4MRNA 1E1QD 4OI1A 2J5XA 4JBXA 3U2QA 4DLSA 2GZAA 3CH5A 1E0KA 8OHMA 2REOA 4XVQA 5CYOA 2NMVA 221PA 1IXSB 4U5XA 1CU1A 1RJ9B 1ZMXA 2G77B 5HPYB 3TSZA 4XTRA 2A5DA 5JJKA 1KMHA 1TQ4A 2DBYA 5EE1A 4C0JA 5HZHA 3I32A 4NYJQ 2ZU6A 4BPBA 5KHOC 4M2LA 4IFEA 3U7FB 5H70A 1OYWA 3RABA 4BFUA 2DB3A 3K9GA 1HUQA 2WJYA 1E0JA 5L3QA 3HU2A 2REXB 1RRGA 5L3RA 1FP6A 3GCGA 3HJNA 2VP9A 3KUCA 2RGCA 1DG3A 1K5GA 1E1QA 2Z4SA 4DB2A 4NCJA 3KZ1E 3K9NA 3Q8XB 4V02A 1TEXA 5FOVA 2OCPA 3ZQ6A 4XWKA 3LQRA 1HEIA 1MO6A 2F3RA 1J8MF 2QA5A 1JAIA 1KOFA 1EFHA 1NG9A 2R6FA 2FPLA 1Z63A 4MDFA 4Z54A 2J0UB 1Z0JA 2ZJZA 4CT5A 1BIFA 1S96A 3FKSA 3HPQA 3Q85A 2O8EB 2JA1A 2B6HA 4Z8XA 3CRMA 2H7VA 1QHSA 2CHQA 1VTKA 4US1R 4TTQA 1OV4A 4Q7MB 1J8YF 2G1KA 2ONKA 2VBCA 421PA 4ESHA 4ZCLA 4TL9A 5KPJA 4PTLA 1X3SA 4D25A 3KQNA 4BEJA 3EZFA 3CX7A 3OEED 3NH9A 2IYWA 1X1SA 1PUJA 3DO6A 3KXKA 5TVKA 3VKHA 4M1KA 1OFTA 2L0XA 1EK0A 1K5DA 1UKVY 1UPTA 2YNMA 4LPKA 1ONBA 4OYHA 5K8LA 4DZZA 3GP8A 3SE0A 1KO8A 2ZRPA 5H68A 2A30A 3U3OA 4OBEA 3BS4A 4JIMA 2ZI5A 3WYGA 1CS4C 1O3YA 4PAMA 4LJ9A 4UKDA 2ZJBA 3VR5A 4ZDKA 3QPVA 4LBVA 3RS2A 1W1WA 1DOAA 1W7AA 3DOFA 3OEEA 1YR7A 2XXAA 2H1LA 2VPPA 1ZM3A 2QE7D 3EWSA 5UKDA 4JMPA 4O3MA 1OSNA 2D06A 3HWSA 3NVAA 2P2LA 4JLPA 4B3BA 4F38A 1ESNA 2ZRFA 3G82C 4DEXA 5HR5A 1JR3D 4LPSA 3TK1A 3KFVA 4JBWA 3O8BA 2O52A 4M1SA 4YC7A 4A1FA 2D3WA 4OK3A 1NLFA 1QHIA 5FOXA 5FTLA 3O47A 3WHKA 3DEFA 4DRZA 5TXGA 4UJ3A 1TL7C 3RRMA 3AGQA 1ZU4A 4WZAE 1JB1A 4ZDWA 1W36C 3I92A 3EIHA 4HLUC 5FFMA 4CW7A 1E32A 1GL6A 1E9BA 1P60A 3KFXA 3U3MA 3MG9A 4F4JA 2ZSBA 2BC9A 5FBRB 3UMRA 5GJCA 3OE7A 2IX3A 3ICQB 1E9AA 1J99A 1MH1A 3EAQA 4ACAA 4D26A 3OIUA 1OXTA 2IS1A 3AKCA 2Z0MA 3TSWA 4B48A 1Z83A 1T4GA 4EUNA 2BCGY 5JBQA 1JR3A 2AD1A 3AB3A 4KFSA 4A6XA 2ZUCA 1S9DA 2PMDA 1Q0UA 1KKMA 2YWFA 1UAAA 1ZNXA 3VR3A 4BFSA 2GK6A 2BMDA 2V9PA 3QQ5A 4D2IA 3U4QA 1ZUHA 2QT0A 4U7DA 5M04A 1DAHA 5FUXA 2ZUBA 1ZRHA 2W6JD 4HAXA 4NP6A 1D2MA 1EG7A 1P2TA 2VP0A 4NYMQ 4QM7A 2CNWD 5AUPB 2BKEA 4W5HA 1VPLA 3RAPR 1COWD 2F1RA 1EXMA 2MSDB 3SBEA 4Q1BA 1EWRA 1YZTA 2OBLA 1MABB 1Q20A 1QHYA 2Q0HA 1RJ9A 4ABYA 1R5BA 2RCNA 3GLGE 4WVFA 2MMGA 2F9MA 3ZGXA 2GJ8A 2IXFA 4WIAA 1NJGA 4KCGA 5SZKB 4L5BA 3T15A 1I4TD 4HZUB 2V1UA 1U9IC 3HYRA 3UG7A 3GD7A 4TMZA 1L4UA 4PO1A 2W6JA 5BYKA 5F9HA 5JMTA 1DAMA 1N5KA 2CNWA 2V4ZA 1QVRA 3A1UA 1COWA 1LF5A 5C18A 4AG6A 4GMDA 3TQCA 2KBFA 3WNCA 4HLCA 3GJ8A 4E09A 2A2ZA 1A2BA 2CMKA 2OAQ1 4HUQB 4B73A 2J9RA 3PUVA 2IS4A 4AIIA 1KDTA 3LO5A 1X8KA 1DAEA 4BRUA 2X19A 3I5YA 3C15C 4DCVA 1XTKA 3IIJA 4IDPA 2CLCX 2OCBA 4PHFA 4PPQA 3K70C 1R10A 2NZJA 4DLVA 2J0UA 2IYTA 2OFXA 2HXYA 3BBPA 4PQFA 3I8XA 1Q1QA 1KTVA 2W6IA 1ZW6A 2ZS8A 3ZJYA 4OQXA 5DE3A 2O0JA 2WOJA 3SEAA 2PX0A 2RGBA 2WZQA 4QBHA 4B33A 1N6OA 2EFEB 4ZI2A 1P61B 4U00A 2H17A 1E2MA 1NBME 1NY5A 2QMHA 2R65A 1LY1A 1AM4D 3EZ6A 4XD7D 3T34A 2ZRJA 2OE2A 1VG8A 2DFLA 3PEUA 4JVLA 1OXXK 4Q1EA 4GP7A 4B3CA 3IBYA 1YQTA 5J4KA 1G41A 1ZM9A 5KDLA 2YYZA 4QGFA 2FDCA 1NVXQ 4YMUA 3AF0A 3GJ4A 4BFTA 1Z6AA 2H18A 3A58B 2EQBA 4XJXA 3WP0A 1IONA 1R5OA 2YC2C 4G3XA 1YR8A 2ATXA 5EXXA 4DB4A 5GVRA 5BN5A 2BBWA 1IY2A 4MKFA 1G4AE 4LSGA 4EKDA 1HTWA 1M7GA 4JLNA 4NMMA 2RB4A 1Z06A 1XNJA 5AUOB 1EFCA 2IYUA 3SHFA 3DMDA 4PFSA 2G3YA 4XD7A 1SQ5A 2AN9A 4IVRA 1JQJC 4MITA 1XU4A 4LJYA 1UKZA 3KXIA 4OI2A 4ILEA 1GRNA 1N5JA 4Z51A 3CKLA 2X2EA 4HLQB 5ANRB 3TH5A 5DGXA 2WAYA 3SHWA 5JZVA 1XTSA 1FP7A 2O8DB 2ZYTX 1US8B 3LY5A 2VP6A 1GRRA 5TB5A 1ZC4A 2AHOA 2IXGA 3CX8A 4OHXA 2HT1A 1W36B 4Q00A 1JAHA 2QP9X 1OH7A 1LFDB 2CL7X 3ZH9B 3ZYCA 4B44A 1KJYA 1ODFA 1W4BA 2A5JA 2OLKA 5C46F 621PA 2F7SA 3IPYA 3ZIAD 4IDQA 3A1WA 5C4GB 5TARA 1RVDA 2FJUA 4DJTA 2GCOB 3CWQA 3I61A 4MYTA 5JJIA 2OCYC 1TNDA 4X8LA 2ZVPX 1Z28A 5E4FA 4JVSB 1RYFA 1OJLA 3B1XA 2J7KA 3QY0A 4P0TA 3EZ2A 1OXUA 1FUUA 3DMNA 4DLRA 1T0JB 1R4AA 3QXCA 3GLIB 1ZD1A 2ZI9A 1K8RA 1NVVQ 3EA0A 4OI4A 1E9DA 1E9SA 1JBKA 4DCSA 3E1SA 4GSYA 1TMKA 1DPFA 1G18A 1OIWA 2QMUA 3A36A 1WCV1 1G17A 4JLKA 1NN1A 1NSTA 4RCZA 3AVVA 1PJRA 3ZIAA 2ZRIA 4LJ5A 1YZGA 2I1QA 1NJFA 2ZI7A 1FQJA 1VHLA 1MABA 1W5TA 5C1BA 3DKVA 1MOZA 3K53A 2R9VA 2WVJA 3B9QA 4PR0A 5L3VA 1P72A 3EPLA 1EWQA 3V4RA 3A4MA 4V0ME 1CEEA 3QF4B 1D2EA 5IHPA 1P2SA 4CEJB 1KAOA 4HATA 1KO5A 4H1UA 2ZAMA 2XZLA 3RHFA 4HZUA 3C5HA 4O0MA 1EFRA 1S4QA 1S9HA 3MUFA 4KYUA 3VHLB 4DWJA 2NQ2C 3RS0A 4G5OA 4CZ2A 3ZD7A 3U3RA 5JHGB 4IKEA 4DDTA 1F2UB 5CB6A 1IXZA 3B6EA 2R6GA 3KB1A 2DYKA 4QBFA 4XWOA 1SKYE 2BMJA 2QRNA 3CPJB 1UM8A 2PLRA 3MAAC 2PJRA 1LW7A 2J0SA 4Q02A 2YZ2A 1E2FA 4OJKA 4GT1A 1AZSC 4C3ZA 4PZLA 2WIBA 1U8ZA 4N0EA 1DS6A 1NNEA 5FI1B 3NTUA 3THOA 5IT5A 2DR3A 3D3QA 4FINA 2VH5R 5KNBA 3K70B 3K09C 4URWR 4Q4AB 1N0WA 2C77A 4EPYA 3U60B 1AQUA 3SYLA 2HF8A 1OLOA 4LZZA 5FL7D 1TQDA 2GDJA 3L82B 3OAAD 3ZZ0A 3QSYA 3KL4A 2P3SA 3C16C 2H92A 1C9KA 1KI2A 2JEOA 4RD1A 3T5GA 4TTRA 2ZPTX 1VCOA 1BYIA 1TF7A 3CONA 2IF0A 4DLUA 3BK7A 4IOMA 4MYHA 3UXMA 3DL0A 2QGNA 3VNVA 1VKJA 2F6RA 2XSZD 1C4OA 2JIZD 3NBXX 2PLFA 1G6OA 2FPMA 5FPYA 1BH2A 4P4SB 5FL7A 3KJHA 3RSOA 5A0FA 2GEDA 3KB2A 3OAAA 1I4DD 1SGWA 2CL0X 2ZRKA 1DTSA 3WMFA 3OIWA 1W4RA 2BVNA 2G83A 1W36D 3KX2A 4DLZA 3VR1A 2D62A 3X1XA 3H0KA 3ZS8A 1A7JA 1GNPA 4JVNA 4C9BA 2ZSAA 4FIDA 1SVIA 2F55A 1FUKA 3QBTA 4LC1A 4LC0A 1E2JA 3X1ZA 4UJ5A 3EIQA 3ZQJA 3FMOB 4JLAA 5CDFA 1LTQA 2JIZA 3DZ8A 3QKSA 4MUAA 5JEEA 2ZE8A 5DIFA 4GOXA 2O8DA 4D4JA 2ZJYA 1US8A 2ZTSA 1LF0A 2IEZA 3AF3A 5FTMA 1ELOA 1XEXB 4TLCA 4RZ3A 1G3MA 3GLFE 2WJVA 2ZR9A 3QE0A 4RZUA 5JFGA 1B23P 2FEOA 3CW2A 5CLLA 3TLXA 3RLFA 2C8VA 2QQEA 2AL7A 1KI9A 4QGGA 3P32A 3MRSA 3IPXA 4TYPA 4M1WA 1XJ0A 1NP6A 1WXQA 3TUJC 3U5ZB 4F92B 2AWNA 4OHZA 3SR0A 2FPKA 2QAGA 4KU4A 2WWYA 3CB4A 2QSYA 3B85A 4KI0A 3ZVNA 3P26A 4MKIA 4AYTA 1LV7A 4O25A 4ZV4A 3ZDQA 2FE4A 5JWHA 1G16A 3GLIA 2N46A 1NVUQ 5B2ZA 3Q72A 4AWXA 5CYPA 1DE0A 2FG5A 3EZ7A 3AVXA 3IO3A 3W3ZB 1IOZA 5FBVB 4LCBA 4TL6A 2RHDA 4R71A 1KI6A 4HEJA 3REFA 4NH0A 1QG2A 2GNOA 3G5UA 1K6MA 4Q18A 3HYTA 1R5NA 3UKDA 4EPXA 3T06B 4B2PA 4V0NA 1Z2AA 5B57C 3ICEA 3QF4A 1RIFA 1ZUNB 4CEJA 2B92A 2XJ9A 2CVFA 2OFWA 3A8TA 1XB2A 3PUWA 1U9IA 2VEDA 3CZQA 4JVMA 1J7KA 1RKBA 3WRXC 1N5LA 1GIAA 3CNOA 4FW9A 1F2UA 1IN6A 3I8SA 4NPHA 4PZZA 3VHXA 5G40A 6Q21A 2P65A 1GITA 2QROA 2BEJA 4II7A 1AK2A 1Q44A 3AVOA 3FKQA 3QEJA 3IIKA 5K8UA 2YOFA 4V0OA 1KI7A 3VR4A 4QHSA 4LJ6A 4GL2A 2ZU0C 3QNUA 4WA7A 1WBDA 3ASZA 2E1RA 1UBEA 1H8HD 5HE8A 1AGRA 5E3HA 4KLNA 3P4YA 5F98A 1NLZA 4PO9A 3MGCA 1VG1A 3KJGA 4M1MA 4TLAA 4D4KA 2NG1A 3AP2A 5L8VA 4Q21A 2BM1A 2GBLA 4TQUS 1SXJE 3RS3A 2YWHA 3LFUA 4BFXA 1Y3AA 1QHGA 3ND8A 1R0WA 1QZXA 4DLTA 4JLMA 2GAOA 2DWQA 2PT7A 2YHSA 4I1UA 5FOWA 1WRBA 3I73A 1OH6A 1KKLA 1GSIA 3GLHB 3H86A 3RANA 2PBRA 2ZJOA 4LHVA 3F3YA 3F5FA 4C0SA 3I72A 2D7CA 3E70C 3RC8A 4KYIB 1H8HA 3AH8A 1T9HA 3SJZA 1GOTA 2XXAB 4IDOA 3CIOA 5FR1A 3A37A 4US0R 2XNDD 4DBLC 1ZINA 4F91B 3CWZA 5DSZA 1SHZA 4YMWA 4PAQA 1N6PA 3P20A 4MA4A 4KSCA 1Z08A 5BN3A 1MO5A 1Z6GA 4JBYA 1OW3B 3D7MA 1ZNZA 2C2HA 5HE9A 2Q6TA 2R6DA 2JLQA 1JXOA 2FZLA 1PLJA 3ZS9A 4A0RA 4AKHA 2Q3MA 4A15A 4DLWA 1CJTC 4DCTA 2D4HA 4S2EA 2VLIA 4YONB 3P1JA 2FGKA 1JI0A 2QP4A 3GJ3A 2WWWA 3SS8A 3A4NA 5HKKD 2O0HA 2KE5A 2GKSA 2A5FA 3GEEA 2XNDA 3AKEA 2VHJA 3AEZA 4M9SA 2WOOA 3TMKA 3U6KA 4Q66C 3C14C 2BJVA 4C4PA 4NKRA 1KDRA 4KODA 3VNUA 2ZI6A 3B8HA 2QENA 5B64A 4H9GA 1F5NA 1E2KA 1XEXA 1OHHA 1ZD9A 2B8TA 4J0QA 3BC1A 3LQQA 3T12A 2ECKA 4JKIA 1TQ6A 4MQBA 1D9ZA 4L8GA 5SZIA 1II8B 2OILA 2ZR0A 4JL8A 821PA 4UNNA 4FMCF 5H8WA 4FMBB 2QMOA 2WKPA 4G5GA 4IW3B 5HKKA 4FCWA 1T8TA 1AJEA 1E9FA 4IDNA 3TR5A 3I1FA 1WE2A 5LB4A 4Q01A 2QI9C 5KOYA 2C98A 1NN0A 1TAGA 1LS6A 3BB1A 1CIPA 2SHKA 4GMXA 4BQSA 2GZDA 1RE0A 1XJQA 1S3SA 3E5HA 3DVLA 4MYCA 3WMEA 1A5TA 5CIWA 3KUDA 2LWIA 5JLJA 3IDQA 3AUXA 1WMSA 5E7JA 1UDWA 3LXXA 3LAWA 1M8PA 4WOPA 3ZVRA 5AUNB 4Q9LA 3VMFA 4TL7A 3LX8A 2JGNA 1P75A 4ZCMA 1KJWA 1UFQA 4F7WA 5J4YA 2A78A 2Z6VA 1XDBA 3PR1A 4WBSA 4KHZA 3B60A 2Q21A 4I99A 3L2OB 4CYMA 1G8FA 3VTKA 1AZTA 1U0HC 4ZCIA 3I4LA 1Q21A 2XJ4A 1WP9A 4ASUD 4LOAA 2AKYA 2DY1A 2ODNA 2J7PD 2Q9AA 3L8YA 5KSYA 3B82A 3K9HA 3OIYA 4FMDB 2ZSEA 3C8UA 5AWFC 2VSOA 2ZQ5A 4URYR 1M6NA 2O8CB 5BYJA 3BH0A 1Q3HA 1WF3A 4I1OA 2JLVA 4DXAA 1U2RA 2A5YB 4OJQA 5KU1A 4URUR 3PEYA 1IBRA 1XD8A 3HR8A 1AA9A 1ZBDA 4JL6A 1F6BA 2NO1A 4YDHB 1CF4A 3MWLA 3TVDA 4ERNA 4ZIRA 3DDCA 1FTSA 2ZRLA 3PXGA 1CR2A 3NG1A 3GFTA 1LS1A 4NCHA 1P6XA 1JR3E 1AKYA 3SI7A 4O2LA 2V6IA 5IRCD 1IQPA 3K09A 4TZ0A 1Q1BA 2ZRCA 1UBCA 1GWNA 4M0LA 3T61A 2CCJA 1RRPA 2UZ3A 2H5EA 4LK2A 1P9RA 1IHUA 2QAJA 3RVBA 2J3EA 1W5SA 1J2JA 3GLHA 5KO2A 4RZ2A 2HYIC 5B30A 3HDTA 2EW1A 3CF0A 3LD9A 1KK0A 1FW6A 2G9NA 4DUGD 1D8TA 4Q9IA 2HLDD 1TF5A 5FOTA 1GRQA 2OZEA 2QSZA 3ZVMA 4M4SA 2GF0A 1SKQA 1XMVA 4DT1B 2C78A 3QBVA 2CK3D 1NIJA 2QN6A 4ZKDA 3OEHD 2IYYA 2P6RA 2MMCA 2HJGA 1CJVC 1G64A 1OE0A 1Z0IA 3NBYC 4A36A 5JJLA 1XEWY 2VHUA 1U98A 2VSXA 3JVVA 3QVUA 3U61B 3GQBA 2B21A 1QHNA 4RD6A 4AYXA 4DCUA 2J1LA 521PA 2ZRAA 1S3GA 3B78A 4GP6A 4KITB 1E2LA 2LCFA 3O8DA 4NYJR 1NVWQ 2WSMA 4DUGA 2GTPA 2GF9A 1M1YE 2QE7A 4PC1A 4LY6A 1EGAA 2F1JA 2HLDA 5JECA 5EZ6B 1WB9A 5CIQA 2AK3A 1WBBA 4PHTA 3N2EA 5GJWC 1W49A 1E4VA 1CJKC 2CK3A 1YHNA 3BB3A 2QAGC 3HP1A 4GZLA 2N42A 4PHHA 2IC5A 1RYHA 3OEHA 3W3AA 1P9NA 4ZPXA 1NG1A 1OT3A 4HDQB 4KVAA 4OK5A 4TWZA 4TQAA 5SZHB 3U3KA 4C0QC 1KI8A 3B7GA 4D0NA 4HI0E 2WJIA 1II8A 3EW9A 5GJBA 3PG5A 1GNRA 4BLTA 1FTNA 3H84A 2ERYA 3L0SA 3LH5A 3OZXA 3WMGA 4P32A 4TMWA 4QC2A 4M9ZA 4MDEA 2RHMA 3KXLA 2IYVA 1HURA 4M9XA 2FA9A 2E87A 3OF5A 4TLDA 3T1TA 1Q57A 1A82A 1BO6A 5FOSA 2XAUA 2X1VA 1GDDA 5IK2D 3FHOA 4IVPA 4AG5A 3EX7C 4L9WA 1E9CA 3ETLA 3B5JA 1CJUC 4TTPA 1N6IA 2JLRA 4NL4H 5EZ5A 4BUJA 1E2QA 5CITA 2NTYC 4QL3A 1CLUA 2O8FA 1XTIA 3DZDA 1J90A 1YR9A 4HDCA 4ZO4A 1E96A 4WXRA 4OK6A 3KJIA 3BORA 1M2OB 1UDXA 2EVWX 2CE7A 1G8PA 1JXMA 4C7OB 2Q9CA 1E2DA 4V0LA 2PL3A 1RRFA 1SVSA 4RCYA 4DDWA 2GETA 4EFMA 1MRNA 1DAFA 2O5VA 4QBGB 1CJMA 3UK6A 1UBGA 1PZNA 1XXHB 2YC4C 4XVRA 5IK2A 3VKGA 3LDAA 2VTKA 3GFOA 3TRFA 5FUVA 4EJSC 5EUQB 2IWRA 5DN6D 5CK4A 2HCBA 3IHWA 3LBIA 3DM5A 2ORWA 2VSFA 4A9AA 2ZRMA 1OIXA 1P2UA 2GVZC 2O8CA 4P33A 4U02A 3GJ0A 2PCLA 4NONA 1YZUA 2NO9A 1HA3A 2BDTA 2GBLC 1W2HA 3I3SR 4AKIA 3SOPA 3SJCA 4NYIQ 2XITA 1ANKA 3U7EB 2GJ9A 1YRBA 4JLJA 2PEYA 5DI9A 4I1SA 1BKDR 1P62B 3GJ6A 1OB2A 4BGDA 3KKOA 1YJ5A 4LUCA 5KNCA 4PHGA 2GVDC 2XZOA 4D80A 2ORIA 3AVYA 5DN6A 3QIAA 1D5CA 2FZ4A 5AJXA 4Q5IA 3GMTA 4TN1A 4HDOB 1JEDA 4PC6A 4IXMA 5LB2A 1JJ7A 4RVCA 4D0GA 3A4LA 5C4MA 1E2HA 3LBNA 2JLSA 2WV9A 1G291 4M9QA 4DCNA 3FE2A 2YOHA 3QUSA 4BZPA 5JS7A 2ATVA 4G5QA 2KWIA 1KI4A 1ZP6A 4X8OA 2H8KA 3B1WA 4C2TA 4TZ6A 3OHMA 5EE9A 3C5CA 1MR3F 1KSGA 4A2PA 1N3BA 1WQ1R 4HB3A 2GJAA 3N5CA 2XTNA 4GI7A 4LRWA 4OHVA 5DH9A 1GM5A 1OH8A 2FSGA 2YINC 2JASA 2ZM5A 1NSFA 2V3CC 4NYMR 3HR7A 4RKFA 1XD2A 4PXAA 1YRAA 4DT1A 2IYQA 2AD5A 3BJIC 3GJXC 4JS0A 4MRSA 4JL5A 4Q9HA 4WZ6A 1AQYA 1D6JA 3QKSB 1Q1EA 2GK7A 1HT1E 2UZIR 4QXAA 1VHTA 3Q7PA 3R9WA 1KSHA 4TL8A 3EARA 3IQWA 3CRVA 4WW0A 4EIWA 3U7GA 5ELXA 2A5GA 1G1MA 2H57A 2Y8EA 1T3LA 4MGIR 2JDID 3IILA 1XMJA 1KDPA 4RD4A 3I62A 2CE2X 2YWEA 3LNCA 2C5LA 3NHBA 4GFDA 1SKYB 1GILA 2WWGA 4TMKA 1Z2CA 2FFHA 3ADCA 3M4YA 2VF8A 5KUTA 1HY3A 4R98A 3IEVA 4DSNA 4XSHA 2QAGB 2AKAB 4AI6A 1JEEA 3SQWA 5KSZA 2JJ2D 3EC2A 5L3SB 1V43A 5KTYA 1G19A 4RFVA 1XX6A 3TUZC 1QF9A 2AWOA 2H16A 4DLYA 4JJZA 4LHYA 3QOFA 4DSTA 3BB4A 1PLKA 4MKHA 1VMAA 2NOAA 4R2HA 4YXWD 2EFCB 5JWOA 2R6CA 1SVMA 2CLDX 1KI6B 5FBQB 4QM6A 5BXQC 1KIMA 4WXPA 5FUWA 4YMTA 2IYLD 2RGEA 121PA 4D81A 1SVWA 4XTCS 5AR1A 3HPRA 2IXEA 3P27A 4LHWA 3TNFA 4Z8YA 1NMZA 5J40A 2DPXA 3KQUA 5TDHA 1AGPA 3KTAA 2JJ2A 4IDHA 1BMFD 1O87A 3T5DA 3FMFA 3V00A 4BLPA 1E2PA 3AF4A 4HAYA 5TMPA 1N5IA 2YWGA 4LBWA 3P4XA 2GAAA 1U81A 4C7OA 2ANCA 4YXWA 4EDHA 1R8QA 3X1WA 1S0UA 2WWFA 3V9PA 2KJQA 3KKQA 1FNMA 4HYYA 4TSFD 5FR2A 1XXHA 5EE3A 4W7SA 4YMVA 3BERA 4CEIA 5CDFE 4E5UA 4EJSB 4AC9A 3CR8A 2JJ1D 3GEHA 2C9YA 3SDZA 1BMFA 1SZPA 1V5WA 1R2QA 1CR0A 2G1JA 3WXMA 1KO7A 4B6FA 4BZQA 3DOEA 1W46A 1A1VA 1E3MA 1P4SA 3FPAA 2HV8A 3GFPA 4TMXA 4TYQA 4B3DA 2UVQA 5CJPA 4Q7LA 2O8BA 3KQLA 4C0KA 4XVUA 2R62A 1NF3A 3JZMA 1PV4A 2KBEA 1Z0FA 2GHIA 2GWHA 3BE4A 4JYCA 1ZU5A 2DWOA 1XMIA 4UXJA 2ERXA 1E2NA 2JLXA 1G20E 1IAQA 3QKRB 1LNZA 3W6OA 4ZI3A 3Q5DA 2IYRA 2YV5A 4IOLA 2JJ1A 1Z3IX 1EFTA 3QG5A 5HCIA 1R0XA 2ZYVX 3H1TA 3R7WB 1E2GA 4URXR 2NIPA 4KAXA 5F2EA 3MJRA 4A0HA 4LHXA 1KO4A 1E2IA 2BEKA 3IUYA 1JPJA 3KKMA 1S1CA 3M0EA 3PENA 4RD3A 3GLIE 1YZQA 4C0AC 3VX4A 4V0KA 4CGZA 5D3QA 3MMPA 5AJVB 2R6AA 4XSGA 1TEVA 2GJKA 2NGRA 2ZRGA 1G6HA 1T5IA 4NCNA 2G0TA 4AK9A 1KAGA 1Q12A 1VYVA 3UPUA 2OXRA 1HQYE 3AP3A 4QGHA 3W9YA 1G3QA 1CRPA 1CBUA 2IF2A 4Q7KA 3N70A 2QUZA 3THYB 4XOIA 1OH5A 3W6NA 2DFKB 4TYYA 4S35A 2X77A 4Q1FA 1II9A 1XBTA 2XSZA 4HAUA 1OIVA 3PUYA 1Q22A 1TF2A 4YQFA 2AR7A 4JLBA 1CP2A 2IW3A 4NTZA 4TLEA 4P31A 5CM9C 1KO1A 3EWAA 2CEAA 4LJ8A 2MSCB 2EYQA 1E69A 4P4UA 1UBFA 4Q9KA 2MSEB 4QNMA 2HEIA 2OXCA 5D3MB 2FNAA 2NPFA 4E22A 4DDUA 4KSBA 1NL3A 4UXIA 2YJTD 4NCIA 1ETUA 3FGNA 4FI3C 1GNQA 4I81A 4HAWA 3MCAA 1MRSA 1IJEA 2OO7A 4Q1CA 2WHXA 3FMIA 3TVTA 1TU4A 5BQ5A 1GVNB 2QU8A 3MD0A 2IHYA 2XOKD 2AFHE 2QM8A 1II0A 2WJJA 3SN6A 1MT0A 2DFNA 1G5TA 1L7VC 5L3SA 3F8TA 2ZR7A 3KKPA 4Q4LA 3NBZC 1UADA 2QY9A 3VU9B 3AVPA 4K81B 3RYTC 3K0CA 1NN5A 1KY2A 2BKUA 2ZAOA 3PEVA 3RSLA 3AVUA 4WZBE 5GVSA 2QPTA 1FPMA 5LBIA 3WBJA 3TAHA 2EYUA 4RY2A 3QI2A 2B7BA 5JHHB 1U94A 2ZSDA 4PO8A 3QEOA 3RDPA 2BOVA 5EE0A 2QEQA 4FWTA 3VAAA 2ZJAA 2ZJ5A 1QHXA 2XOKA 2ODWA 3T1OA 1HQCA 2BJWA 1ZIPA 4BLOA 1W0JD 1NRJB 3AF1A 4LJ4A 4TMTA 1CR4A 3PV0A 2ODBA 2QGZA 4DEYA 3R9XA 4PC7A 4HAZA 4HZIA 3BOSA 1KSFX 3K0SA 2PEZA 1P2VA 1ESMA 2JJ8A 3R20A 4ARZA 1HV8A 1XCPA 2WJHA 3U6BA 2J0QA 1UKEA 5JRZA 2RKOA 3CPHA 1JR6A 5EQTA 4A4DA 3BFVA 2FU5C 4B71A 5J4HA 4OQNA 5IDVA 1T8UA 1S2MA 3KQHA 4B32A 3FFAA 4EJSA 3NEYA 1FZQA 4ZIRB 1QBKC 1VDZA 3L43A 1DBSA 1F48A 3EA5A 4KFUA 4CEHB 4DKXA 3U44A 1W0JA 2DHRA 2P6UA 3REGA 1T5LA 3B1YA 2JLUA 3IIMA 2ZITA 2V6JA 3WNBA 2XTMA 3TJZA 1KYIA 3LXRA 3ADDA 3CNLA 2AXPA 4F4IA 5EE5B 1G5RA 1H65A 5FPSA 2GJSA 4A6PA 2UKDA 4JKYA 1Z22A 1X6VA 3R9IA 3IEUA 3QXXA 4R2IA 3THXA 4XH9B 1P5ZB 2BBSA 4Z1MD 1N2CE 1HH4A 3QKRA 3PITA 4UQOA 1G4UR 3ECCA 4ACBA 4XIGS 1KY3A 1XZQA 3K0EA 2OV2A 3OFND 3BH6A 1FFHA 1TQ2A 5K8IA 2EU8A 3R7WA 3WY9A 1AS0A 2RAPA 3B1VA 3B2EA 4Q7JB 2JLZA 3W34A 4PSKA 4DIEA 4JZKA 4V03A 2GXSA 1P7CA 4QG7A 1KNQA 4C0HA 4FCVA 2GCNA 1G21E 4EPRA 1MKYA 5FPTA 2F3TA 2RH5A 4GNKA 5FTNA 4B35A 4LX0A 4EPTA 3B1ZA 2GESA 2ZJ8A 1N6KA 4KV9A 4CT4B 1NIPA 3K0FA 3EPKA 4CIDA 2GXUA 3BWDD 3H4MA 4A0FA 4IEEA 4LV6A 2WSSD 1N6RA 4MGZR 5KPDA 3THYA 3OFNA 1VYUA 2PMKA 1KI1A 1KZ7B 4OL0A 3AUYA 3FVQA 4RD2A 4G5RA 1TUIA 3E2IA 3CX6A 4FWIB 2GRJA 2FEMA 5FTKA 3BRWD 4M1OA 4FN5A 5EXPA 2LKDA 4LDJA 4BWYA 1E4YA 2DWPA 4LI0A 4M8NE 2ONJA 4B2LA 1FMJA 2C9CA 1ZAKA 4AURA 4UNRA 2GXAA 5D3MA 3RRZA 4GRAA 2QT1A 2BM0A 1EFUA 2QQ0A 2IBMA 3C4JA 4N0DA 3W90A 1U8YA 3WBKA 1HE1C 4BECA 2N1BA 4HB4A 1Z8FA 2WSSA 4W9MC 5FH9A 4W5WA 3AVWA 4Q03A 3T1QA 5EUMA 2F9LA 4Q19A 2HJVA 5G41A 5G53C 1G3IA 2E9SA 2FF7A 2QBYB 1ZIOA 2IUSA 1OXSC 2RGGA 2D2EA 1L2TA 5CB8A 4D4LA 2IYXA 3VU9A 1D9XA 4Q1DA 1CULC 1XJCA 2O8FB 1R6BX 1ZM2A 3CO5A 2ZEJA 2QRZA 2HCJB 2NZ8A 3GLHE 4YDSA 1FNNA 1N0VC 4QHYA 3TKLA 1G7RA 4JYBA 1DO0A 3KJEA 5TV2A 1GL9B 2FFQA 3KDSE 3SBDA 5JEDA 1U99A 4ON9A 1QHHB 3VR6A 1S1MA 3LW7A 1XTRA 2TMKA 3ADBA 1XTQA 1OFIA 4OI0A 3NDBB 4MYUA 2ASEA 1X8JA 1FMLA 2ZUDA 5H1YA 1GG2A 3FKSD 4RJLA 4OKSA 4PZYA 4AKEA 2NO0A 3Q7QA 3X1DA 4BLRA 4EPVA 3A1VA 3ND9A 3Q5EA 4EFNA 1N0UA 2ZS7A 2P6NA 1IY1A 1G8GA 2G88A 1RFLA 4PAOA 2WM9B 4A0GA 3BAFA 1ZD8A 2LKCA 4B74A 2REBA 3FB4A 2FH5B 1L4YA 3W8RA 1KGDA 3CF6R 2X8AA 4CEHA 4B76A 3EASA 3KQKA 3TR0A 3UG6A 3SZRA 1NKSA 2F43B 2RGNC 4ASUA 2BV3A 4E07A 4KO8A 4QJ3A 2J7PA 2OEPA 1XPRA 5E7IA 1MO4A 1ZCAA 2VA8A 2YKGA 1R8SA 5G3ZA 3SJAA 2OLJA 4G0NA 4KJZA 4IOJA 2VP4A 3UANA 1YU9A 5J4LA 1T3SA 2J46A 5AK0A 5KNDA 1UKYA 3G0HA 4KFRA 1XPUA 4D6PA 3BD9A 3UMSA 1E98A 5KSOA 1FOEB 3QPUA 2A9KA 5CK5A 1L8QA 2ZRBA 2ZREA 3EIEA 1W0KD 5JWRA 2IYZA 4FMCB 3CRW1 3LRPA 3FTQA 3IHLA 3AGPA 2JLWA 2WAXA 1W2GA 4M53A 1XD2B 3TE6A 1EX6A 3W5JA 1X8LA 3GLGB 1VCMA 3TAUA 5DI3A 4OHYA 2VP2A 4MGYR 3PJRA 5FBLB 2ZRHA 2XX3A 1BYUA 1XMSA 3WRYC 1Y63A 4DC9A 4DIDA 1Q3TA 2OT3B 2WPDD 3SC3A 4IXNA 5JSZB 2V54A 3PEWA 2BMFA 4NBSA 3I5XA 3QENA 5EP1A 4JLVA 1KK3A 2EFHB 2QPAA 3OE7D 2WICA 5AJYA 3KKNA 5FOUA 1F3OA 2FFAA 5IF9A 5JS8A 3J81k 1W0KA 4QBIA 2WJGA 4HB2A 1MV5A 1S8FA 2RMKA 2P67A 1CR1A 3RRNA 3LX5A 3ZD6A 2CJWB 4IOKA 4ITRC 4BFYA 4KXFB 2WKRA 2Q3HA 2ZJ2A 4EAQA 3O8RA 2P5TB 3NKVA 3THWB 1G7SA 4K46A 4M1TA 3A1SA 1G8HA 2WPDA 5EXSA 4Q4JB 3CPEA 1GL7A 2WBLC 3W6PA 3K0CC 3UATA 2KSQA 4UNQA 3SJBA 2ZI3A 3WP1B 2QG6A 5KDDA 4R9UC 3DM9B 5FL3A 2FWRA 3BXZA 2IEYA 4OQFA 3BFXA 2ZSFA 4OHWA 1GKUB 4QHTA 5DISB 2QBYA 1KMQA 1N6LA 2CDNA 4A92A 4KLZA 1VIYA 1AS2A 3M1IA 4PQRA 2HDNB 4YMSA 1TU3A 3IQXA 3LVRE 2IUUA 1B0UA 3VQTA 3KTAB 4DHEA 4JLOA 5AJWA 1XZPA 3PFIA 4Y0AA 2ZRDA 4L16A 5E95A 4PPGA 1KI3A 4EFLA 3NWJA 1E6CA 1UJ2A 2V55B 4KFTA 5DYGA 2IT1A 4QKQA 1ZCBA 1HE8B 1ZNWA 3HU1A 1NN3A 1I2DA 1YZNA 3D8BA 3CR7A 3FDIA 3U3JA 3VX3A 4D0LB 5A4JA 2IS2A 1QHHA 4QNRA 2QM7A 1P73A 3LWNA 3EPHA 4BASA 2Z5FA 4PQYA 4CEIB 3GJ7A 4A8JC 1ZVQA 3QPWA 2IL1A 4Q47A 1E0AA 4LV8B 3RWOA 5F9FA 3CF2A 2IYSA 5EP2A 5GADl 4GOKA 3B13B 4MKGA 1VCNA 4DDVA 2ZYUX 3LA6A 1T3HA 2W00A 1QG4A 1U0LA 2W6ID 2XNSA 4LHZA 5HCNA 2ZXUA 3RS5A 5DLQC 2QTVB 1J70A 1E9EA 3TBKA 3K9LA 2AXNA 4HLDA 4ZDJA 2O8BB 5BWMA 3QVVA 5J4VA 3DKPA 1GKYA 2VO1A 4L9SA 1DAKA 3MWKA 3S1AB 4CF7A 2VRWA 2IUTA 1OKKD 2W83A 4US2R 2V1XA 1Z47A 2CCKA 2F43A 3AKYA 1EESA 1GZSA 4F93B 4BEBA 3RS7A 1FL9A 4PSVA 3CRRA 5KYKA 4GDFA 1BS1A 2O8EA 1Z29A 3N2IA 1U8AA 5A5GA 1Z5ZA 1F2TB 3RNLA 2WWXA 3SU8A 3SQXA 2OESA 2W2XA 4NHOA 5LD2C 1NLYA 4LYJA 4O2RA 3ZZUA 2HYDA 1XFAA 1DG1G 3BFKA 4HB0A 1XEFA 4TT3D 1W4CA 1KK2A 4MRPA 4MRRA 2I1VB 3A1TA 1G7CA 1OKKA 4BRWA 3W5IA 4AYWA 4GBMA 2C9OA 4W5JA 2ZYWX 1IN5A 2FMXA 3K1JA 4OQLA 2QNRA 2WMOB 3FHCB 2OHFA 4I1VA 1NI3A 1XCMA 2J59A 2Z4RA 4PANA 4R7ZA 1XRJA 3GLGA 2CVHA 2VF7A 2YOGA 3CH4B 1W4AA 1DAGA 2QP3A 2DFTA 3CBQA 2EWWA 3X1YA 5C2JB 3K8YA 1Z6XA 5JI2E 5JSZA 4K8OA 3AV0B 2GEUA 4TT3A 4P4TA 4URVR 4HSEA 1JALA 3C41J 3PQCA 3R8FA 3QKTA 3TQFA 1RPZA 4C30A 1W44A 2BWJA 2YVUA 1DEKA 3O8CA 2WWHA 3NDPA 1XXHE 1NBMD 1XEWX 1FX0B 4NCKA 4LYFA 4B34A 4M1YA 3RS4A 3L0OA 3UWKA 4BFVA 4BLSA 2CJWA 3PVSA 4G1UC 3R8CA 2OSBA 4KBGA 3FMPB 3PIRA 3QJYA 1YZLA 2FFBA 3TW4A 2VHQA 1C1YA 3EC1A 4IFBA 4LYAA 2XB4A 3AVQA 4FCTA 3THWA 2BBTA 3EXAA 4ZKEA 1U0JA 2ODEA 2V8OA 4LYHA 1I2MA 1SXJC 2PX3A 4BZXA 3MLEA 4Q4JA 4GOJA 3VKWA 1W47A 4JT2A 4QJ4A 4URZR 2ZETA 4PSAA 2JDIA 3SFVA 1HT2E 1OYYA 2PH1A 4NDZA 4JJKA 1UEIA 1NBMA 2VHCA 2A7QA 4A82A 4I4LA 1AKEA 3QG1A 4LJAA 4NYIR 5E7MA 1F60A 4B3FX 3DPUA 2NPIA 3NC0C 1VIAA 4CDGA 4EQ6B 4LGMA 3LLUA 3TUIC 1M7HA 1HYQA 1LVGA 1OXVA 1YE8A 1SVKA 2W2TA 4B47A 4F4CA 2GILA 3AKDA 3SYNA 3GEIA 4JSYA 5LDDC 1EFRD 3C7KA 4B3XA 4NZYA 5JCZA 1Z6TA 3IKJA 5DHAA 1GKIA 3T1VA 4POAA 2HT6A 1DAIA 4PX9A 2XZPA 2WIAA 3FOZA 4XWAA 1CKEA 2PCJA 1GAJA 2CHGA 4ARZB 3DHWC 1U90A 3ADKA 1LB1B 3W8NA 1ZNYA 2W58A 1XPOA 1AS3A 2FSIA 3PCRB 1TTTA 4TQ9A 2IWHA 4C2UA 3BGWA 1GFIA 4IJMA 3EZ9A 1JPNA 5CM8B 4X8MA 3QF7A 1OB5A 2J41A 1QDEA 5KDOA 2C04A 2QORA 2B7CA 4A8JB 2OCAA 2WWIA 1TADA 4M21A 4NU0A 4JT4A 4LBZA 4B3GA 1XD9A 2CHVA 4DLXA 3U44B 2PZGA 3ONWA 1YVDA 2W0SA 2GXQA 3GLFB 4DSUA 4D4MA 4KBFA 1JECA 3ZZTA 3FHTA 1KK1A 1JJVA 2D7DA 2W2VA 2FSFA 5EJEA 721PA 2KI5A 3QXHA 5SZJA 1ZYUA 1ZM7A 4HUQA 1M7BA 2QZ4A 4TSFA 2VL7A 3THXB 4AKGA 3S1AA 1OPXA 2G0NA 3BIFA 2EWVA 2RGAA 5EXTA 2RGNA 1E79D 2FOLA 5G3YA 3IO5A 2O0KA 5JI3E 4BE7B 1IN7A 2WKQA 4ESVA 1AN0A 2D2FA 2JAQA 1X86B 3SNHA 4HUTA 4B75A 1F2TA 2QTFA 1G3RA 2J0VA 4LWZA 3M6AA 2XB2A 1UF9A 1G9XA 4IVQA 1XP8A 2JCSA 3L0PA 5FUYA 2PT5A 4E03A 5LD2B 3AVTA 1E99A 3V4FA 3ASYA 3IGFA 1DVRA 1KDOA 3X2SA 3K0FB 3GPLA 4Q4HB 4G01B 1ZJ6A 1NVVR 1NKTA 1R0ZA 2HF9A 1P3JA 1E79A 1DELA 1Z0KA 1GTVA 3CLVA 3B9PA 5JCPA 3MJHA 4V0MA 2VIIA 4LV5B 1KZGB 4Q48A 1Z0DA 2FV8A 1D2NA 2RGXA 3OIVA 3L0IB 5FPKA 1OFHA 5TY0A 5LPNA 2VP5A 1XCGB 3LVQE 1R7RA 1PVOA 1E0SA 2CCGA 1SVLA 2CLSA 4QGAA 2C03A 4IHQA 2FSHA 4TMVA 3EPJA 3U7HB 4IEIA 2QTHA 4CVNA 1RC8A 3CM0A 5FI0B 1N6NA 5EP3A 3A6PC 1JQLB 1XF9A 3FYHA 2JLYA 1FX0A 1P9WA 2Q3FA 4AY2A 2I4IA 3NC1C 1PLLA 1PUIA 4RFSB 3L8ZA 2JATA 1WDTA 3IBGA 2J87A 2PJZA 3K0AB 1A4RA 3PUXA 2FGJA 2AK2A 2NO7A 3QXJA 4HAVA 1QRAA 2XGJA 2PZEA 3AM1A 1M74A 1SXJB 2EFDB 4HLUA 3WYFA 2FX3A 5F3WB 1KHTA 3LBHA 1DADA 4RD0A 4RSGA 3SYKA 1YZKA 5KSPA 4D82A 1X1RA 4C0LA 1WA5A 4FXPA 1E1RD 2DCUA 3QKUA 4A2QA 1IXRC 1YR6A 5FPHA 4BFZA 1RZ3A 2GCOA 1VYTA 3QXSA 4H1VA 2V7QD 1QVAA 1VECA 2ORVA 4EQ6A
chains in the Genus database with same CATH superfamily
4X9XA 4A2WA 2HWKA 3MSXA 3NHAA 2GCPA 2R8RA 3MILA 4PRLA 5IAJA 5CAEB 4G8JA 1THZA 4GOLD 5M2QA 3WK8A 2OCDA 2C99A 1RLTA 2YIDA 1ZUIA 4R3NA 5ED0A 1G1AA 1FQKA 2VZ9A 5FWDA 2ZRNA 4UUQA 3KLMX 3JQ9A 4PPFA 4Y6OA 3IB6A 1IN8A 2FWBA 4PLZA 1A7AA 1DQZA 4MINA 2E2WA 4FYVA 4FLEA 2GEVA 3LT1A 3H05A 3RAJA 1IY0A 1VGQA 2CMFA 2IELA 3DL2A 2VJQA 4NIMA 2DPGA 3H1PA 3I2HA 4OSEA 5L3QB 1I4LD 2AX4A 3F9IA 4QU5A 1MW8X 2ANBA 3B1JA 4HGQA 3NRJA 5AUQA 3AUSA 3T8YA 3BILA 3PSHA 3K6KA 1W48A 3NWOA 5HZKA 3CLTC 3ZHUA 2PIAA 3M70A 1BOFA 1CXZA 1G5PA 1XOIA 2RGRA 3FPFA 1IG3A 3ZE7A 1RYEA 2B4TO 3GCZA 4KPUB 4XB6B 4X7RA 3KR1A 4UUNA 4WKGA 4H1HA 2KM1A 3M2PA 2K5UA 2FN4A 2B35A 2DUWA 4G36A 2NN3C 5EWLA 1NMXA 1Q7CA 4S1WA 3S3TA 1KP3A 2WFLB 2ZKIA 5AW9A 4E11A 4JYAB 4RV9A 3LBYA 2UXBB 4MI1A 3X1MA 2QTNA 1EEHA 1M5RA 4O63O 1JIJA 3GJ5A 1YSCA 5FWYA 2PXHA 3F6RA 4RM3A 2CBZA 2CL6X 4EO7A 5KX5B 5EERA 2VK1A 1ID1A 5JRJA 1CNEA 2FMIA 4XR9A 5FUBA 4TUYF 1EHIA 1SHKA 2V6MA 5KWSA 4LS3A 1NZJA 4KWHA 2BGUA 3RREA 4P58A 2QS9A 4B0PA 4N40A 3L41A 2I9PA 1VFPA 2JGJA 1ESCA 5DO9A 1NKVA 1GRCA 5K3FB 2YS7A 4HDMA 2Z43A 3VR2A 2YVKA 1HDYA 2BGNA 2H00A 1KVSA 3AF2A 4Y0VA 4CUZA 4EENA 1R9JA 1ZITA 4EWLA 5K8TA 2YN4A 2OVBA 5BNZA 4QOSA 1RRCA 1RWVA 4ZVSA 5HBRA 2ZIXB 3CF4G 5FXMA 2OBXA 4Y2QA 2GFQA 3AY6A 1I14A 4D0SA 2QPOA 2Q6OA 3IE0A 3KKLA 2JGIA 2JGLA 3Q0TA 4G1VA 3U49A 2N9UA 4L15A 4ZAFA 3BJZA 4RKYA 2GYUA 3B3FA 3CGGA 2ZE7A 4OKIA 1PZGA 1Y37A 5AESA 1MP0A 1A2KC 1X42A 5LQNA 3RC9A 1WUTA 2F1HA 1GZ7A 4KVGA 2F9FA 2ZI4A 1SWWA 5BO5A 3WQRA 3NBFA 4KG7A 1RMTA 3CRZA 3RC3A 1ADGA 2IHBA 2BR5A 3RJTA 4N1AA 1U2GA 1VKRA 5IC6A 1KH3A 1YCDA 3QHPA 2XYGA 3L7BA 3SF8A 5GJVC 1SG6A 2BFAA 3C1TA 1H8EA 1KFCB 2C5HA 3MTDA 2R48A 3PL1A 4MUBA 3W5HA 3ROMA 1R37A 1GUAA 5TC4A 3KPJA 1LW6E 4BEWA 4WKCA 5KU7A 2GPTA 1OFUX 2B37A 2QKYA 4MYDA 3FWYA 1QX3A 4PPNA 3HM9A 2C9BA 3HABA 4P35A 2W6MA 4YJHA 4W1QA 3B6KA 3V55A 3HCAA 4K3UA 3RVDA 2YZ7A 2QRKA 2Q6LA 2Q2VA 4B2IA 2BYTA 3JVUA 4EKGA 1GP2A 3CZMA 1IDOA 3JQGB 4FQ8A 4QJ5A 2D7JA 3KZCA 2P2DA 3EIWA 3RWMB 4EHFA 2P5SA 1IM5A 4NE2A 4ZDIA 1KR2A 2J3LA 3LKZA 1Z6PA 4EKIA 1TYCA 2R8XA 2XHZA 3CH6A 1YR3A 1AHIA 4K9PA 4KLRA 4LA4A 2ZANA 3U4QB 4TYWA 4QO7A 3AFMA 2DETA 5KYXA 3OZGA 3CNNA 5AJZA 4MQEB 3WKDA 1EXVA 3IUQA 1IM2A 1U2DA 1VSTA 3EBLA 4MRVA 1BW9B 4U6NA 3ANLA 4AZVA 4B6EA 5FD8A 2CXXA 3SZMA 2ZYRA 4PYOA 1TPZA 4MRNA 2CLKB 1E1QD 1EGQA 3RYFB 4JBXA 2HPAA 2YH2A 5EJFA 2DMRA 4I9GA 5JJ5A 1E0KA 8OHMA 4XVQA 5CYOA 5ILOA 221PA 3HFJA 4I9FA 1IXSB 1ZSYA 3BIOA 1VBNA 3DTVB 3QKWA 2G77B 3C3KA 3PHJA 4LZPA 4YCSA 5HPYB 4HYEA 1C7JA 1A8HA 2PYZA 1I36A 1KMHA 1TQ4A 3BSWA 5CYFA 4JBNA 3HVUA 1KF0A 1W8IA 2GA9A 5HZHA 3GCXA 4DJJA 2AOVA 1SVNA 4B4WA 3ZDRA 2HHAA 3RABA 3W04A 2DB3A 1CHDA 3K9GA 5FO0A 2PNFA 2KS6A 1E0JA 2Q3LA 2VHWA 3QEAZ 2GM9A 1FP6A 2D0PB 2J9ZB 4FEAA 5DBEX 2BFOA 2GF2A 3DEIA 4O4HA 3ZLTA 1IXKA 2MYNA 2Z4SA 3H8VA 3O7MA 3PI6A 4GR5A 4L7QA 4XJVA 4ZD6A 3T3OA 3K9NA 1IULA 1AXRA 1Z6QA 1VPEA 4V02A 3UFBA 3FNEA 2DP4E 1NNUA 3ZQ6A 1B2LA 4XWKA 1HEIA 4OJNA 2VPWA 3ISJA 1LBQA 1EP3B 1BDJA 1E3SA 4PXSA 4CJXA 1V0JA 4I55A 1J8MF 1T4MA 2FSVC 1M54A 2BMAA 2QA5A 1KOFA 3GJRA 3RIEA 4B3IA 1EFHA 3AYZB 2O48X 1O94C 4BB5A 2FPLA 4LNUA 1I3OA 4HMOA 1W93A 4O2AF 5BYBA 1UBKS 2X0FA 2J0UB 3WL3A 4X6UA 1E1CA 1E4EB 1JQDA 2QI9F 3IOBA 4UD2A 4D4IA 3NNNA 2JA1A 2Q7DA 2VRCA 3DBRB 1QHSA 1C3JA 1KP9A 2Z5GA 2BGWA 3K35A 3RFCA 5L4LA 2PS9A 4NQRA 5ESWA 2G1KA 4UHKA 5B1DA 4ESHA 3AYXB 1X3SA 2JGRA 3A6LA 3D1VA 3HN7A 3PJEA 5HBGA 4ZYYA 1D07A 1M5UA 2OC9A 3NH9A 3NHMA 1SR8A 1X1SA 1PUJA 3DO6A 3VKHA 3SDSA 5I9TA 1SURA 4TWAA 1FMCA 2WM2A 4WSOA 2L0XA 2JLAA 4LPKA 2W2KB 4UBKA 4JU8A 1YDHA 3GP8A 5BXYA 2X0EA 4XWWA 1V37A 1IC6A 1FFDA 3HO6A 2ZSIA 1YF3A 1KO8A 1ORHA 1F7UA 3UCEA 2O23A 5H68A 1SBIA 1M6WA 3U3OA 1OCEA 2E21A 4LHEA 3ZK9A 1DDGA 3WYGA 1CS4C 3DE4X 1OAOC 3CBGA 3OZIA 5H7XA 3WLLA 4UKDA 3DT9A 2YJNA 1RTTA 5BN5B 3WOHA 3VR5A 3RVPA 3NM6B 4ZDKA 5ADHA 3RS2A 5TPZA 4ALIA 3QX9A 1W7AA 3KVOA 4MVWA 4ETMA 1YR7A 1JWAB 5HUJA 3D5QA 1E61A 3OWXA 4KXQA 3EWSA 4JMPA 2A6PA 1Z7YA 1GPYA 3VU1A 4KEAA 2EJWA 2D06A 2VYQA 1ULZA 1ZLYA 4AY4A 3OPXA 2PLAA 3IVRA 3G82C 3O90A 5I7RA 1U02A 2QTCA 5EFZA 1N57A 1OU0A 4MSUA 3O8BA 2O52A 5HIAA 3S7ZA 3KT8A 3ZNNA 1NLFA 1QHIA 3DXZA 3GFRA 2Q45A 3WHKA 5T41A 4AWBA 3HJUA 4DRZA 3PD1A 1WXIA 5DBIA 3VR3D 4Z1OA 2IZOA 1PEYA 1UPFA 1PR0A 3AGQA 3C1OA 3RRMA 1SQSA 2B3DA 4LY0A 4IO0A 2OCKA 5KQPA 3FSRA 1J2UA 3K0HA 3EIHA 1W36C 1MH9A 4HLUC 2R6R1 1Y5NA 3LLVA 4CW7A 1DWOA 5AQEA 3DUFA 2CB9A 1P60A 4X20B 1PWXA 4Q9AA 2DFDA 3U3MA 1DOHA 1GNVA 2ZSBA 3HA2A 2VPXA 3I53A 3OE7A 3ICQB 2O4CA 2L82A 1DC4A 1PZMA 1QPBA 3TAXA 4LF8B 3D3KA 1TJNA 5LNK1 1A5AB 1J0DA 2P62A 4NBTA 3GRUA 4QPCA 1JR3A 4MR9B 1FUYB 4D9HA 3HB9A 2C2YA 4J07A 1S9DA 5EXEA 2PMDA 2XYQA 5JSYA 4A6XA 5CBPB 3TS1A 1KKMA 2YWFA 3HCEA 1ZNXA 2MU1A 1I13A 3N2KA 2V9PA 5K0CA 5JANA 4K3VA 4I50B 1SCUB 3MTGA 4Y9RA 4BDSA 2IXTA 4KYTA 1K88A 2HQRA 1AMOA 5FUXA 2DR2A 3GJYA 3RBAA 1ZRHA 2W6JD 3ZDDA 4MPDA 1X0XA 3UAVA 1EG7A 5D01A 1QKIA 2HREA 4N5DA 3FVTA 1OBHA 2HCTA 3RAPR 4LSMA 4F9TA 4Q3AA 3OCCA 1GNSA 2H4YA 2P9FA 4JWKA 4CM4B 3KVNA 2B3TA 2MSDB 5HZMA 4XYGA 1EWRA 4OBWA 3FNRA 5DGCA 5FLKA 3FPBA 1S2LA 3GCWA 1R0BA 2WFMA 5T8KA 1X80B 3SIXA 1RJ9A 1V5GA 3WGVA 4ABYA 4L76A 3IPLA 4LX8A 3ZCXA 3HEAA 2GJ8A 2V9CA 4Q12A 1XHEA 2OCLA 4EUKA 2Y0BA 4ND7A 4PSUA 3L7YA 3T5TA 8ATCA 1YQ9A 1XO1A 3AZQA 1K9SA 1L4UA 5F21A 3HDVA 5BYKA 2HIHA 2CMGA 1DTWB 1YR2A 5TT0A 3SOZA 3B2QA 5CFQA 5JMTA 2XPCA 2XWJI 3A1DA 3FPHA 1PK9A 4GLBA 1NNLA 4KPGA 3TQQA 3NAZA 3A3KA 2KLBA 4HK4A 2IYFA 4L50A 3HBMA 2BTQB 3TQCA 2KBFA 2HZ7A 3GJ8A 2ZR8A 2AQIA 4E4TA 5I51A 4B73A 2OAQ1 1A9YA 3WJ1A 2IS4A 3EZYA 3C7DB 2E5WA 4WERA 4UCXA 2O57A 1U8FO 2D1SA 2QLJA 3H99A 4XYMA 1MQ8B 2Y1WA 2Y1EA 5AVXA 2HTEA 4HFJA 3G2MA 4ZT4A 4IDPA 4PHFA 2QVCA 2ZATA 4E2XA 4G4JA 5D1NA 1R10A 3LO8A 4DLVA 4L73A 1OFUA 3OHPA 3I8XA 1DIRA 1KTVA 5WRFA 2ZS8A 3SYRA 3VR0A 2XNKA 1SHUX 2PMBA 3AJEA 3BJRA 3CFYA 3E5NA 5BSUA 1QOQB 3T9CA 4DC0A 3C24A 4WGFA 1BU5A 3HV2A 1TVKA 4QD3A 4MIKA 3OEYA 2O2ZA 3RAFC 1NBME 1NY5A 2R65A 1LY1A 1AM4D 2RH9B 2XZDA 3T34A 2RK4A 3M34A 1VG8A 1FFCA 2PM8A 2GPYA 2RK3A 3COPA 3PEUA 1I7SB 3AL0C 2ZYDA 1ETHA 4B3CA 1QNLA 1JPUA 1NGSA 1A69A 3IBYA 1QU3A 1JEAA 1IB0A 1ZM9A 3OOHA 1SBTA 1NX6A 4QGFA 3VYWA 3WOVA 5IKPA 2FDCA 5DK6A 3HFGA 3DDSA 2QTGA 2XUIA 2VS1A 1MVLA 4GW3A 2PWZA 3WP0A 1U7DA 2HRQA 2YJ6A 4CL0A 1GSAA 4DB4A 2GZSA 5H81A 5EXXA 2ATXA 5BOSB 1UK8A 4LQDA 4D25A 1CDEA 2CLLB 3ZY6A 1EJBA 2LP4Y 4MKFA 2FZEA 5FA6A 1QR2A 1DJNA 3OCWA 4NI5A 1SO8A 1Z06A 1V8PA 2VTBA 2CVPA 3WGLA 2UUOA 2XECA 1KOJA 1JG2A 1ENZA 1YQWA 3DNFA 5D6OA 3KLNA 3G7SA 3BUSA 4BNTA 1NUAA 2G3YA 4G5XA 5CT4A 3HKCB 5LXTB 4IVRA 3EUFA 1S02A 4MITA 1XU4A 2LCIA 4LJYA 4ZO9A 3QFRA 5DRYA 4ILEA 4PNPA 4EDFA 1KYYA 4MW5A 4YQEA 4HLQB 5LA6A 2JFWA 3C43A 4MROA 4GUDA 1ZR2A 3L7MA 4DR4B 1E59A 3ANMA 1XTSA 1FP7A 2QDKA 5TT1A 3LY5A 4F84A 1R66A 2O8DB 2OUIA 5BSVA 3BK2A 4TS9A 1EUCA 4LSWA 3MBKA 1KXZA 3UM9A 3L4SO 3NJRA 3PRHA 2C20A 2B36A 4H3KB 3AB7A 1PBNA 3R5KA 1T9BA 1ZHFA 2HF2A 1JAHA 3BBLA 4FCCA 3WYCA 5ERYA 1E60A 2ZG6A 4J4BA 3IAHA 4CFSA 2COUA 1U3CA 4OU4A 4B44A 5H0IA 2I67A 2OLKA 3CIFA 1C7QA 3H6HA 4RM2A 3SD7A 5ELLA 4D8YA 4ENQA 3IPYA 4YAUA 2I4LA 3QU7A 3M5CA 3G8CA 1Y8CA 3E53A 1KMMA 3L7DA 2OCYC 4X8LA 4GICA 4PEVA 3A4VA 2BR3A 4JVSB 1HFKA 2XMQA 3B9BA 2Y0EA 4OQZA 2G63A 1M2NA 3UHFA 3A6DA 3EZ2A 4TGLA 5CXUA 5F2NA 3IP1A 2FUCA 5BN4B 1FUUA 3DMNA 4BNXA 2ISSD 4OIMA 4DLRA 3PA6A 2IEGA 1R4AA 2VBGA 3JARB 2AOTA 1GCUA 2PVSA 3QXCA 4GLOA 3DZHA 4EKYA 2ZTUA 3WL7A 2ZI9A 1K8RA 5AKEA 4YREA 1E9DA 1CUBA 1JBKA 1WXDA 4DCSA 4E2YA 3E1SA 5DM2A 3IXLA 4RJIA 5I9BA 1TMKA 1V1MA 1UDCA 1G18A 1WCXA 4HHEA 3IMCA 2QMUA 4WN9A 4RULA 1G17A 3QPBA 4M89A 1TO1E 2DPYA 4DY4A 3N0WA 1VPWA 4DC1A 2G7MC 4K28A 1E6KA 3P2OA 2ZI7A 3EYWA 3Q7RA 1W5TA 4QEDA 1J24A 4XA8A 3HCDA 1YMVA 2YHBA 4YP7A 5K3BA 1HE2A 1P72A 2L18A 3DZGA 4FB5A 3V4RA 3QF4B 3SQDA 3MTQA 1P1RA 5DOZA 5CFLA 2ZIZA 3P5SA 1J9ZA 2OBFA 3HSKA 1KO5A 2CVOA 4HGRA 4JI7B 2XZLA 3RHFA 2Q6VA 1BSVA 1HYBA 4HZUA 3WK6A 3OOWA 1NE2A 3AI1A 3DQPA 4DWJA 4KYUA 3UJNA 4Y2UA 4GI3A 1USGA 2FDXA 2IKQA 1Z3CA 1M2OA 2NQ2C 3C0KA 3LM8A 4G5OA 5E0OA 3ZD7A 1SOWA 4MW1A 2ARKA 3LE8A 2DQSA 4QLOA 2WB4A 3FOAA 2WSIA 3V1NA 3B6EA 2R6GA 4NNPA 4NZMA 3IDSA 4FYWA 4F2HA 1K3FA 1GQRA 4QBFA 3OA2A 1RVV1 1SKYE 3NGXA 1N7IA 3CWCA 1SQGA 4P36A 1GXSB 1X7WA 2YZ2A 4FKMA 4Q02A 4FR0A 1NDHA 1WLSA 1Y6RA 3C2QA 4JLSA 4OJKA 2IDKA 3K5WA 2RHWA 3I6QA 1AA6A 1CNFA 3F96A 3SZOA 5L7YA 3ZOZA 9MHTA 2GEJA 3ZJ4A 3H1GA 5FI1B 2QG4A 3NTUA 3AUJB 4EUHA 5FOQA 5HHTA 5JFOA 1FFAA 3IVMA 1HLPA 1IEVA 2DULA 2AFHB 2VH5R 3MIIA 4P8RA 4DXHA 3DE3X 4UOEA 3K70B 3D4OA 2C77A 3V7WA 4YV0A 2H11A 1WY5A 2GK4A 4LZZA 2PT9A 1U9ZA 1XQ6A 2PGOA 3L82B 3OAAD 3R3JA 3ZZ0A 3ANTA 3CH7A 2VQDA 3C16C 2BJHA 3OQHA 3RU2A 2TSYB 5A6SB 1C9KA 2VAMA 4OMDA 4XDYA 5CG2A 1ZAYA 4RD1A 1ZVVA 4P5PA 2OZLA 1PVDA 4OYYA 2W2MA 4U9IS 4Q3LA 1XLWA 2K4MA 2XE8A 3O75A 3PGA1 4DLAA 3PNSA 3MWGA 4FFSA 3BK7A 1U3DA 4IOMA 3IBSA 3DL0A 2QGNA 3PKJA 2IIVA 4KXNA 1XMQB 5JQGA 4LE0A 3M33A 2ZWIA 5DYTA 3BCSA 2JBAB 3U1VA 1N3IA 2XW6A 1C4OA 1N2JA 2JIZD 2BFFB 2PLFA 1G6OA 3DBHB 2I5PO 1D0IA 2FPMA 4ITUA 5FPYA 4CKWB 3HHPA 1AE1A 4ZVRA 2XE7A 4UULA 2R4QA 5A0FA 5ES4B 1OAOA 1GQYA 1T6BY 4P98A 1VBFA 4BAZA 4E08A 1KFJB 1DTSA 3OQOA 3SFTA 4B7AA 4AP6A 3GGDA 4TV8B 4O3FA 3UTDA 3M83A 4KAAA 3H0KA 3ZS8A 1A7JA 1YZVA 4C9BA 2ZSAA 1JXQA 4FIDA 1SVIA 1TW2A 1BA3A 2GWRA 1T2EA 5GWXA 1I6KA 2CB0A 5TMBA 1T5HX 4LC1A 3ICCA 3SXPA 4ABTA 1E2JA 3N6XA 4X62B 4N01A 5KVCA 4UJ5A 1SBHA 3EIQA 3ZQJA 3DL4A 3FMOB 5CDFA 3RUDA 5C8VA 4F0JA 1RI1A 3WYDA 3QTTA 3NR2A 1L8AA 2VKTA 1GU0A 4GOXA 5DIFA 3TMYA 4ANFA 4D4JA 1K8XB 3ZCQA 2OD9A 2ZTSA 4F5DA 1LF0A 2GH1A 2IEZA 3AF3A 1ELOA 5FTMA 1FSGA 1G3MA 3C87A 3GLFE 3H87A 5INTA 4RZUA 3UMBA 4BNGA 5JFGA 1JDBC 1MXHA 1B23P 4IJ5A 1JZSA 4HNGA 5DM1A 3DULA 3HKEB 4I6EA 3DKRA 1Q15A 3RLFA 2O5RA 1R9MA 2QQEA 3R44A 2WU4A 3O2JA 4BC0A 3VR6H 5KCMA 2UYQA 3D3WA 3KPVA 4JZYA 1W87A 3HRHA 4M1WA 4MV1A 2JHCA 3KOUA 1NP6A 4ISBA 4ZVNA 1G20A 3I9FA 5JTUA 3DP9A 5JH7B 3ACBA 1EVJA 2AXQA 4LOLA 1KIAA 3EZLA 2MINA 4KU4A 2WWYA 3P0JA 2CUZA 3V2HA 1JFTA 1X15A 3ZVNA 3BMCA 5IDWA 2HJSA 3L84A 5EG5A 4PLVA 3GLIA 3TOCA 2N46A 4JEUA 3HB7A 4IG9A 2QVLA 3RYIB 4EUFA 1Q19A 3WWOA 1DE0A 2FG5A 4EJ6A 3IO3A 3ABZA 4XGIA 5KYUA 3RRFA 1F8FA 3QITA 3IV9A 4IZIA 2OKCA 3AUFA 4NNJA 5IC4A 5C51B 4R71A 4W63A 1CC1S 1RXEA 3GX1A 2UZ1A 1OI2A 1NFRA 2YQZA 3C39A 3L0DA 4P3KA 4QPNA 5EIBD 3CU5A 3HLYA 3REFA 3G5UA 4OXXA 4E13A 2GKGA 3G2NA 1R5NA 3DMRA 4GI5A 2BR4A 3UFXB 3UKDA 5LQMA 4XB2A 3T7IA 2ET6A 1NRWA 4G4GA 3IVAA 4HF7A 3B6JA 3ICEA 1QGAA 2SKDA 1DU4A 2W11A 3H3JA 4RSRA 4CEJA 4OXKA 5K6TA 1PFYA 2CVFA 3ITEA 3ZHVA 3WB1A 2B4QA 3ESYA 4CMBA 1IE3A 1UPUA 1JX6A 2Q5LA 3H2GA 2Z8YA 3GPIA 3KFLA 3Q9SA 2VHYA 2EQ5A 4I9UA 4Y6GB 5DP1A 2IZ0A 3VZSA 2OM6A 1RKBA 2Z57A 4OYRA 1U1GA 1V8BA 2O2SA 3MCUA 4HGOA 1DBPA 1PQPA 2ENUA 1OFVA 1AKQA 2QYTA 3CZ4A 5G40A 2P65A 3VHXA 1MDFA 3ZXSA 4FLMA 3IIKA 4TWRA 4YR9A 2BGLA 3O1HB 1D2RA 3VR4A 5I7HA 4XDZA 1SBYA 4WA7A 1WBDA 4H1TA 3ASZA 2E1RA 4RZSA 1WD7A 3N2GB 1P31A 4PYMA 1AGRA 5E3HA 5JSUA 1F8XA 1QV6A 1NLZA 3GVCA 4ZAVA 1GVHA 2Q5OA 3SR3A 4TLAA 3OI7A 4YAKA 2NG1A 3AP2A 3KJQA 1EUYA 4C7BA 3R7BA 2PGAA 4KIUA 4C5CA 2QHXA 4YP1A 1L9KA 3BXHA 4TQUS 3RS3A 4LXIA 2JIOA 4C3UA 5IH7A 3TZ6A 1LWNA 4ENRA 5A3JA 1SY7A 1TIKA 3G7UA 3ND8A 1R0WA 2Z6UA 4OLBA 1QZXA 3PA8A 4DLTA 1IUKA 2FPWA 1F4LA 1T6ZA 2GAOA 2GHRA 2DWQA 2HHCA 3C7AA 1NLMA 3D1LA 4JLMA 4LXGA 1WRBA 3VPAA 2W37A 1KKLA 4PINA 2AQ8A 5BPFA 5AVYA 1OH6A 1VPVA 4UBMA 5IDQA 2ZJOA 2Q3EA 3MTBA 2ZPAA 5AXCA 3F3YA 3PHIA 2P30A 1WHSB 1L5ZA 3I72A 2D7CA 4H0CA 3E70C 3O94A 3LS2A 4HNAB 4KGZA 2DFPA 4KYIB 4LOKA 1R8YA 3JAKA 4QOHA 3SJZA 1T9HA 1B7GO 4IDOA 3P9KA 2PFKA 3AIOA 2AZMA 1XK7A 4H7EA 4LTDA 4BL5A 1NQXA 2Z2YA 4FE4A 3IOEA 3K2IA 1FXWF 4DBLC 3PFCA 2HJWA 4YMWA 5KI6A 1RXCA 3HXLA 4PAQA 3P20A 5SY6A 1Z08A 1QHFA 1U7XA 3K96A 4JBYA 5BN3A 1WDMA 3GBVA 4S3MA 4BATA 2C2HA 2R6DA 3E7PA 4RIGA 4IDGA 1HQKA 2BFWA 1XDGA 1EIWA 3H7IA 1TK2A 1CJTC 1RPAA 1YKGA 3GQBB 3VBCA 4DCTA 2C5FA 2ZWPA 1RQ7A 3EF0A 3O2SB 3FCSB 2WUGA 2FGKA 3D1JA 4J0KA 1JI0A 3GJ3A 4HDKB 4YA6A 4JI1B 2JFVA 2O2XA 2V7WA 2D5BA 3E3OA 1VMDA 2NNWB 4YJ3B 1A9XA 1GLGA 4Z9FA 5C5EA 2A1TS 4YLYA 1RBQA 3ANNA 1DQPA 1VRCA 5ERGB 3ZUGA 2E55A 5ADUS 2CBGA 1B0ZA 3WWCA 2VHJA 5AM3A 4N41A 4NU6A 2BJVA 2VTDA 3U7QA 3IFSA 1KDRA 2QJWA 3E48A 4KODA 2ZI6A 5CPFA 3ROTA 1N2ZA 3EB9A 1XEXA 1B0AA 2VFAA 1K6JA 1NJ5A 7MHTA 3BC1A 3LQQA 1L5QA 4JKIA 5JDIA 1D9ZA 1UP6A 1NW5A 1BE0A 1PD1A 3A4IA 1VKOA 3E82A 3SZGA 5FFFA 3VC3A 2OO5C 2Y1CA 3BMXA 3Q3GE 1WKBA 3NUGA 4N5MA 821PA 1LVHA 3V34A 1N33B 2Q3DA 2FOXA 3DMTC 4WNAB 2WKPA 4QUGA 2XB6A 3LDUA 1N2CA 4OLFA 4MWDA 1Q92A 3SX2A 2B5WA 3N1UA 1Y3BE 4LE2A 4AZ3A 1DEAA 1TAGA 5JARA 3BB1A 1F5SA 2SHKA 3L8HA 4CDMA 4RHCA 1SJ9A 4ZHQA 4B4OA 2ZT6A 5IFKA 3RIGA 3WMEA 2OG1A 1SC9A 2FCRA 1BA2A 3C8MA 3PXXA 3WHIA 4F45A 1YOVB 2QW0X 3IDQA 1D2HA 1V6CA 2B8JA 4UFPA 2VHVA 1WMSA 2V7EA 4ZPJA 5E7JA 5HQTA 3CZ5A 2EKQA 4J4HA 1RSZA 2VDUE 3KK0A 1JV2B 3IUBA 4MQ5A 3VYUB 4JNCA 2RD2A 3REQB 4EA7A 4J91A 3V7NA 1F9AA 3IR6A 4ZVOA 3I42A 3VJKA 4XCQA 5AUNB 4F3TA 2HRBA 2FP4A 2IOQA 4N8EA 3UNXA 4TL7A 1PUXA 1LLCA 5AVJA 1NQ5A 5I5EA 1U3WA 1UZLA 1WB4A 1KJWA 3VNSA 3EPPA 4ZCMA 5KBYA 3DE2X 5J4YA 1WWKA 1Q5PA 4LNAA 4P1ZA 3GO4A 4UOQA 4WBSA 2RC5A 4BYGA 4KR6A 5G1NA 1ECCA 2AN1A 3COWA 1W19A 2PUDA 3CLRD 3AJRA 3VO1A 3VTKA 1ZUNA 1U0HC 1KJJA 4GVLA 4CLRA 4JJ8A 5IM4F 4ZCIA 1UANA 2XJ4A 5KOHA 1G8AA 1TYZA 2H63A 4N7RA 1HFWA 2C3MA 2QUKA 2Q4TA 3ZDEA 1I24A 1GG8A 2AKYA 3L8YA 3AB8A 4V2IA 4FMDB 1E3EA 3B7WA 3L4BC 3ZU4A 3IJPA 1M6NA 1W25A 4I1OA 3PQ3A 1U2RA 4ZVTA 5BR7A 5BVHA 1I3MA 1GLVA 3J81A 3PDUA 1INLA 2GKOA 1LNSA 1XD8A 2Y6VA 2AN3A 3HR8A 4LISA 3HCNA 3L4EA 5J9FA 4CMGA 3KU4A 4YDHB 1WS6A 5DBHX 5FEMA 1MIOA 3L46A 5FBZA 1AD2A 3G5MA 4H18A 1WF6A 4HQ6A 6PFKA 1T1GA 3C6XA 4YAJA 4CIXA 4UE2A 5MHTA 2GTIA 1GHTA 2CUNA 2ZRLA 1CR2A 1FQWA 4I5EA 2GO1A 2PQMA 4YK7A 4B3SB 2JCGA 1AKYA 1V5FA 4MKZA 2A4MA 4B4KA 2VWGA 1OWPA 3BXPA 5AHRA 1QPZA 4WD3A 1UBCA 1VLZA 4OTZA 1GWNA 1LPOA 4U6SA 3T61A 4G56A 3ZBPA 2HPHA 3A1FA 2W93A 3Q6NA 2Z2IA 1RRPA 1HE3A 2PL5A 3VU3A 2H5EA 3T9AA 3ZJ5A 1Q0TA 2PUCA 3I2KA 4Z2AA 1P9RA 5AW7A 4P54A 3ZYZA 5C52B 3BTUA 2JB9A 1J2YA 3RVBA 1N32B 2ATEA 3S2GA 4RMIA 1B8NA 1WVIA 2CF5A 3C6QA 2RK6A 2Y9MB 2Z8ZA 2XNJA 3LPLA 3HS3A 3RR2A 4MZDA 3LD9A 1IB6A 1H0KA 5JTTA 3PC2A 1QAOA 1FW6A 2EERA 3B3JA 4K87A 2HK9A 3CCBA 1TF5A 5IJAA 4EY4A 1GRQA 4C5BA 1H22A 1OR8A 1H4TA 4GD3Q 1BCSB 1V1JA 4KWEA 5IYZF 2I2DA 1E58A 1ND5A 3I01M 3PTZA 3RI3A 2IEDA 1JYEA 1XMVA 5CRIA 3SBDA 3SQNA 3QBVA 4W9NC 4BLWA 3LTNC 2I4MA 2Q49A 5HQ3B 2GAFA 2QN6A 1U11A 2O14A 1DJLA 2IYYA 4HKTA 3R3WA 3V1LA 1G64A 1Z0IA 1KQNA 5B2FA 2P6RA 1NU8A 4L5AA 1XEWY 2HPVA 1U98A 3U61B 4XM1A 3TMAA 1CR6A 2AZXA 2HM7A 1QHNA 3L7JA 4OQ4A 4WCFA 4W6QA 1ZQ9A 4GP6A 1V7ZA 2HFKA 4GYYA 3ED1A 2WSMA 4NYJR 2VPIA 5A9TA 4DUGA 5G4KA 3BREA 1VJ5A 4L27A 2QE7A 3LT2A 3EQ2A 1KU6A 3WIVA 1GCGA 1UODA 3JWHA 2EZUA 1P4HA 4WX2B 4YB8A 1LK5A 3FHLA 1K27A 3UQYS 2FPIA 5LZ9A 1Z35A 5LLSA 1NHWA 3H75A 3RVLA 3GG9A 2R84A 2APJA 7MDHA 3DR3A 1W49A 3BB3A 1CJKC 2OZVA 4AJ9A 3HP1A 3SQOA 4UVDA 1RYHA 1IIRA 3W3AA 3WJ2A 1GA4A 3PF9A 4HDQB 2QTWB 4KR0A 3L1KA 4RY9A 4TWZA 3BHMA 3FBTA 1KI8A 3PPWA 2WJIA 2PH7A 3JQAD 1ECLA 1M1XB 1PBTA 5ALQA 2UYCA 3AFIA 1LI5A 1GNRA 2X7XA 3PG5A 1FTNA 3LH5A 3HVJA 3ZLVA 2AS0A 1ZFNA 4P32A 4XJSA 4QC2A 3KTFA 1VSBA 4AS2A 1VLQA 2ZDHA 3FCCA 5L9AA 4YROA 3GLTA 4DV7B 1OTYA 2XGGA 5KVQA 3TKAA 4M9XA 5AD1A 2FA9A 2D2VA 4REQA 2QXYA 4TLDA 2FN3A 1A82A 5IH3A 3USZA 2LGJA 3O4IA 3MLAA 4TV9A 4BJHB 1EFPB 1BKYA 3EEIA 3FHOA 1K8QA 4AG5A 1Q95A 3GARA 3ZHQA 3B5JA 2WAMA 3CKKA 1CJUC 3MQFA 4PZCA 4TTPA 2JLRA 5EZ5A 1HG0A 3SNKA 3ZWMA 2V9ZA 2CV1A 1R5JA 2IPMA 3EDOA 1CQJA 3DF9A 4NJEB 1YR9A 3MJEA 4JJAA 1YK0A 3A6KA 4NBLA 1JFVA 1TFUA 3WGJA 4EELA 1GPUA 2EVWX 2FQQA 4R2MA 1JXMA 1SXHA 3EDCA 1Q74A 2Q9CA 3VH1A 5LFAA 4C7OB 4V0LA 2PL3A 4RCYA 5E2AA 3RFFA 2ZZMA 2W7TA 4EFMA 1DAFA 2SKEA 4HDRB 1YA6A 1UIRA 3HUEA 4B7XA 1IFXA 1PN3A 4HNQA 1UBGA 1SCKA 3U13A 3V8PA 4GPEA 4XVRA 4EY6A 3WI7A 5DCLA 1E7SA 2VTKA 3LDAA 4K40A 2HQBA 5FUVA 4CR8A 2IWRA 5DN6D 5CK4A 1I10A 3IOYA 3C3PA 4C78A 3PLRA 3IHWA 1BE6A 1ZNQO 2ZB3A 3DM5A 4AF6A 2VSFA 3O8OB 4BP3A 4DRXA 1E9VA 2ZRMA 3F90A 4FR2A 2CF6A 2D59A 1PJ8A 2GVZC 3FTNA 3R5TA 1Q6ZA 2XB8A 4RA6B 3GOQA 3JAWA 1FJGB 4NONA 5EMKA 3F3KA 2P9TA 3NCHA 4TTAA 2X3YA 3IRVA 3I3SR 3PPYA 4AKIA 4EG8A 3SOPA 5DNEA 1FIUA 3HC7A 2AF4C 1U8CB 1CB7A 4GBJA 3QW4B 1O8CA 1USWA 4ZYVA 4DZRA 5DI9A 1U7TA 1VL6A 1WDKA 3KYBA 3KKOA 1YJ5A 4LUCA 4MS1B 3UHPA 4PGMA 2FRDC 4PHGA 5FAXA 5J43A 2BZGA 3BXGA 3GAZA 1QNFA 2J9XB 3QRWA 4YJDA 1L5HA 5KAPA 4C7JA 4D80A 3PXDA 4MLCA 4E2WA 4JJ4A 3GBPA 4CMKA 4E21A 3MMNA 3AVYA 4RS4A 3W8EA 3QIAA 5AJXA 3UC9A 3H1BA 2JFZA 3K3PA 2SCUA 4LYYA 4PC6A 4KUEA 5KTKA 3K6SB 2YX1A 3BDVA 4RVCA 3ZY2A 2YY7A 4FPXA 2YV1A 3QUQA 3SK0A 1KBQA 1GPAA 3BSFA 4PZ9A 2G1AA 4M9QA 4DCNA 2BFEA 2JKVA 2YOHA 3FE2A 3QUSA 4X6XA 4MX8A 4BZPA 2G82A 2AYXA 4FFRA 4YP6A 4JR1A 4BNMA 2B8EA 4DJFC 5LQAA 2QD4A 3M1AA 4GI7A 4EITA 2GN6A 3NTRA 5CDHA 4JGGA 4NNOA 2A9FA 4TN5A 3WFJA 5GOTA 2YFKA 3KSBC 4NXMB 5IVKA 1VMKA 2E7ZA 3TG8A 2IOHA 2HHJA 4OY3A 2D5IA 1OVMA 3HR7A 4R1MA 1XD2A 4RKFA 3AR3A 4FYHA 2AOUB 1YRAA 4H77A 2YDYA 5H9VA 2AD5A 3BJIC 3F97A 1NXPA 1EGVB 1H5NA 4HWTA 4PZAA 1AQYA 2REQB 1GSOA 2V6FA 4JNKA 4D3ZA 4R2XA 4CMAA 1IPHA 3ZV5A 2ZJFA 4BX8A 4QXAA 4LOIA 1BCRA 3KYDA 3R9WA 2QUIA 4RVDA 3R74A 1DXHA 1R6TA 3N8GA 2RB5A 3IQWA 1E5DA 4TL8A 1YUNA 1CQZA 4KQMA 2L42A 5ELXA 1TO2E 3HDJA 4G1EB 2CC2A 2YYAA 4ZCSA 3G0OA 2P9ZA 4JI2B 4MGIR 2JDID 2WV7A 1KDPA 2VNKA 1RLIA 5CNIA 2CE2X 1ZVKA 5LDHA 3FTFA 1UJCA 3NHBA 3IP3A 1L5WA 4ZQGA 3KHUA 1RQPA 1Z4LA 5KTPA 2FFHA 2V5UA 5KZMB 1K8YB 4FZVA 4ZCQA 1FYVA 1QHEA 4ZI5A 1YBAA 3OFJA 4QAQA 4NS4A 5J2TF 3IUMA 3FWZA 1SK9A 1V47A 2HU8A 1AUVA 5LP6A 1QGED 2H4XA 3AL3A 4RGQA 1GD1O 2Q1WA 4N8DA 4EEKA 2QAGB 2XCTB 4KXWA 4Z6KA 3W4KA 2FF5A 1ABFA 3UY4A 5KTYA 1G19A 2CD7A 3TFWA 3MWDA 3SX4A 3A2MA