5JECA

Apo-structure of humanised rada-mutant humrada33f
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
228
structure length
226
Chain Sequence
IGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTEGTFRPERLLEIAQNRGLSGSDVLDNVAYARAFNSNHQMLLVQQASDMMVELLNTDRPYKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
total genus 85
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jecA00
2GEDA 2OM2A 4CT5A 4TQUS 2I4IA 3IO3A 2GKSA 3FMIA 3MUFA 4PC3A 1XXHA 4PAMA 1OXTA 2ZRFA 3PIRA 3QPUA 3U3KA 4HZUB 1HTWA 2VL7A 5FTKA 3Q5EA 5EP1A 4LV6A 4DEXA 3A1TA 5F9HA 3K70D 4BWYA 1E1RD 1Z29A 4WZ6A 2X8AA 1G291 2GAAA 1VG9B 2IT1A 4IHQA 4TMTA 1PZNA 3MJHA 2C77A 5L3SA 4L8GA 3NH9A 1XF9A 3GFTA 1Z2CA 2V6JA 2ODBA 4NYJQ 1YU9A 3R8FA 3Q72A 2Q9BA 1R4AA 4HEJA 1RC8A 3E1SA 2YINC 2YC4C 1RJ9A 2FSIA 1FX0B 2G77B 2ZM5A 2IEYA 1X8LA 1N5IA 2O52A 4HZUA 1GL6A 4M4SA 4P4SB 5HTKA 1W0KA 3L43A 1GUAA 1XMJA 3AQ4A 4JT2A 4LBYA 4R98A 2Z43A 3A1WA 1E99A 5EXPA 1SVMA 2HDNB 4LC0A 4FCTA 2EWVA 2CE2X 4X8LA 1DVRA 3B9PA 1FNMA 3I5XA 3GPLA 3KUDA 4JVMA 4I81A 1MV5A 2P6NA 4QGGA 5KSZA 1E9SA 3FMOB 4RD6A 1VPLA 2J59A 3L0SA 4BLPA 5DHFA 5A4JA 3QEOA 2ZJZA 3TSOA 1DAMA 5DO9A 5JCPA 2FA9A 3CH4B 4KHZA 1FX0A 2WKQA 3OE7A 4HAXA 3ZJYA 3PFIA 5JS7A 2OFWA 3SFVA 3EIQA 2Z0MA 3EA0A 4EPVA 2ZRGA 3VNUA 2A5GA 2GZAA 1DS6A 5IK2D 1UDXA 3OE7D 4XVQA 2GCPA 4JL5A 4HI0E 1D9ZA 2QN6A 1T9HA 3GEHA 4RD2A 2WIBA 1G1MA 5IRCD 5HPYB 4URUR 3GLGE 1G8FA 2JGNA 2D06A 2GETA 1P73A 3W34A 3BK7A 2ZE6A 3ZVNA 3LQRA 3ZVMA 1KJYA 4US1R 2PZEA 2PX0A 3SR0A 3T61A 4PTLA 5CB6A 2GCNA 2ZSDA 5FOSA 2WOOA 4JLKA 4QGAA 2VBCA 2JDIA 3W8RA 4TLEA 1TNDA 3BIFA 4B6FA 2E1RA 3TAHA 1TQDA 3NBZC 1E2MA 5K8LA 1RPZA 1DO2A 4A8JC 1J8YF 3FMFA 3QENA 3BRWD 4C0KA 3Q7PA 1JJVA 2ERXA 1C1YA 4YONB 1KSGA 2J5XA 1KO8A 5KUTA 4Q47A 3AVPA 1GWNA 1G3UA 2N42A 4ZCLA 3FKQA 3F8TA 1E6CA 3LXXA 5JWRA 2CNWD 5KYKA 5K8TA 3WNBA 4JJKA 2ZI3A 2P6UA 3OAAA 1SXJB 2KB0A 3U6BA 3GLHB 3BC1A 4GMXA 4MGZR 5DGXA 4M1KA 1NMYA 4LWZA 5EP2A 3V4FA 2C99A 2QEQA 2QP4A 4WVFA 2QPAA 2VYFA 2D74A 3GLFB 1DAFA 2PH1A 3A6PC 3Q9LA 1G3RA 1LW7A 5JLJA 2W6ID 1Q22A 1OT3A 2F1RA 4URXR 3ICEA 1D2MA 4MGKR 1N6LA 3IQWA 4F7WA 2AFIE 3LLUA 4LJAA 1XWIA 1U8AA 1SHKA 2D62A 3LA6A 3ADBA 2GBLA 2XX3A 3GJ0A 4YLGA 2YOGA 1RYHA 4TN1A 3TQFA 2ODNA 3D7MA 1OIXA 3ONWA 1SXJA 1OSNA 2XITA 2VF8A 3QG1A 2EU8A 3GD7A 1VCOA 3O8BA 4IDPA 3R9XA 4NHOA 2ZSBA 1QG2A 2O0JA 2OFOA 1DE0A 3KJEA 5IDVA 4G0NA 2IYSA 4KYIB 1N5LA 1LS6A 3SBEA 4D80A 2V55B 2XXAB 2J87A 1W36D 1W44A 1ZM2A 1T8UA 3H0KA 4PO8A 4PSVA 1SGWA 2W00A 1IOZA 4LUCA 2UVQA 821PA 3ZZTA 2XJ9A 2BIFA 4HATA 3ZS9A 4PO9A 3CNOA 4MGIR 4HB4A 3SYNA 3KJHA 4IRUB 1XMSA 1KMHB 2G3YA 1J90A 2QNRA 2KE5A 1RYFA 2V54A 4TYWA 5FBVB 3LH5A 2PMDA 3AF3A 4QJ4A 2ZRLA 3VU9B 5IF9A 2CLDX 2C04A 2ZRNA 4UNQA 1IN4A 2K5UA 2RKOA 2C95A 1F60A 2XXAA 3H84A 4YMTA 1JB1A 4DLWA 4F92B 2HYIC 1RKBA 4TLDA 2QQEA 2QE7A 2RHMA 1YKSA 3QVVA 3QXHA 5GVRA 1ZUHA 4BFSA 4RD4A 3C14C 1OJLA 4GL2A 1OIVA 3ASZA 4AKEA 2R6FA 1Q1EA 2LKCA 3THYB 3GCGA 4KSBA 1KMHA 4ZDKA 3W6PA 4L9WA 4C0SA 4B35A 1P7CA 4ZPXA 4F4JA 3DM9B 3VU9A 3B1WA 2JIZA 3BB4A 3SBDA 5UKDA 5KPDA 4KSCA 4WZAE 5AUPB 2GJAA 2GRJA 2ASEA 1R2QA 4MKGA 3FFAA 1VG8A 4JJZA 1KO1A 1P72A 2BBTA 2QTHA 4US0R 4KITB 3ZIAA 4R2IA 4TYNA 2QMUA 4NYJR 4EQ6B 2FFAA 4B3FX 2G9NA 2ZJ5A 4EFLA 4Z1MD 2YHSA 1T91A 5EXTA 4B75A 5CYOA 4WA7A 2GTPA 1ZIOA 1DEKA 3T1VA 4IVPA 3TW4A 3G5UA 4L9SA 3BE4A 2AX4A 1ZBDA 3GJ4A 2GESA 2F55A 2FFQA 1E2GA 1KI7A 1EK0A 3PJRA 2VA8A 2O8FB 4L15A 1VCIA 1AN0A 3NG1A 1L4UA 3M1IA 4TMZA 4KJZA 5FR2A 2GCOA 4BLOA 1F2TB 4ACBA 4Q9LA 1II8B 3A4NA 1LVGA 5FPTA 2VQSA 3QVUA 4HLUC 4YDHB 2BM1A 1IN6A 1OB2A 2UZIR 1VHTA 1XNJA 3MWYW 1E0SA 1SULA 2IF2A 2VEDA 1RRFA 2G1KA 3IIMA 4M22A 2Z6VA 4H1VA 1DELA 1NN5A 1Z8FA 4D81A 1DADA 2IHBA 3SQWA 2V1UA 2AKAB 1U8YA 2XSZA 1NVVR 3ZVLA 2BJVA 2XB4A 5EXSA 3PEYA 1GITA 2FSFA 1TQ6A 2CHGA 3B60A 3HJNA 4PPQA 4EJSA 1OHHD 2J0UB 4TT3A 1LNZA 2G83A 2O8FA 4DDTA 1QHXA 1F2TA 3EZ2A 2YV5A 2G0TA 3W6NA 1II8A 2A30A 4HB0A 4Z51A 3H86A 1T4GA 1BMFA 3P26A 4QBFA 2HXSA 2BCGY 1AS3A 5C2JB 4ILEA 5BWMA 3VKWA 4Q1AA 5HKKA 5JCZA 1OH8A 1CXZA 1Q44A 2AXNA 4IXNA 3AKEA 1W5TA 1RE0A 1TU4A 3UK6A 3LX5A 4V02A 1S96A 1XTRA 3CW2A 3DKVA 2RHDA 5CYPA 2ZI6A 1TAGA 3DMNA 2IWHA 2J0UA 3ZH9B 4N3NA 1JAHA 4Q1BA 1OXSC 1NSFA 1NN1A 1CKEA 4TQAA 1NBMD 2Q3HA 2EWWA 2WMNB 4MGYR 5FTNA 2PCLA 5HCIA 1ZINA 2NO7A 2R6GA 2IYTA 1Y3AA 3EA5A 2I1VB 3A4MA 2CVFA 4PAQA 3TK1A 3RVBA 3Q8XB 4BRWA 4AY2A 4MRNA 1GRQA 1N6OA 4FINA 3SHWA 2H18A 1N5KA 2GZHA 3JVVA 1NG1A 4NE2A 3VR2A 4TYYA 5KNCA 4AWXA 2J9RA 5DNYB 4NONA 3U44B 5DLQC 3A4LA 2VIIA 3QPWA 4AIIA 3ZD7A 2VP5A 1MO5A 1T6NA 1X3SA 5TDHA 2OBMA 1NLZA 2QAJA 3K9HA 2BMJA 4LV5B 1JPJA 2B21A 1ZUNB 2RH5A 4GBMA 4BUJA 4AKIA 3WYGA 2ORIA 4C0BA 3K1JA 3C7KA 1GM5A 2XEXA 1Q21A 3SZRA 1Z2AA 3CPEA 4IKEA 1V43A 1KDPA 4FMDF 1E2JA 3UWKA 1ZM9A 4PO1A 1MO4A 3I3SR 2PZFA 1YZLA 4U7DA 4LC1A 1FMLA 2GILA 5B30A 5JJKA 2IL1A 1M7BA 3LW8A 5DH9A 2OZEA 3U44A 2ZPTX 1UKYA 4U02A 4AG5A 2J7PD 3AGQA 4WW0A 2J46A 1YRBA 2ZETA 1L4YA 2VLIA 3SYLA 4A0GA 1KKMA 2XGJA 3W3ZB 4ASUA 4BFWA 2ZRHA 2BBSA 2GA8A 2V4ZA 2EVWX 1M34E 5EE3A 2NGRA 4XJXA 1QHHB 2Q3MA 3W8NA 2XOKD 3EX7C 2BEKA 2R44A 3AUXA 4QXAA 1KI9A 1K6MA 1I4TD 3UMSA 2QSZA 2JLZA 3RRMA 1U99A 3K9GA 4TTPA 1JEDA 1Z63A 1A7JA 3QPVA 5AWFC 4KU4A 5GADl 1WB9A 1WP9A 1GL9B 2GXSA 3AEZA 3QF7A 4PFSA 4RD1A 1AM4D 1X6VA 1D2NA 4IXMA 4Q1EA 1HH4A 4MYUA 4TWZA 1T0HB 4XWKA 1T3LA 621PA 5SZJA 1D6JA 4GNKA 4M0LA 2YVUA 1G5RA 4V0MA 4LHZA 1JQJC 2V6IA 4DLSA 4YQFA 1KDOA 4P32A 4C2TA 1QHHA 1QZXA 2R62A 4M53A 1MRSA 1IBRA 4G3XA 2RGAA 4XWAA 5FL7D 3TQCA 2WSSA 5D3QA 3UATA 2B7CA 2W2XA 4FI3C 4KBGA 3LRPA 2F1IA 3IHWA 1N3BA 3HU2A 3EZ9A 4Q9IA 2FPKA 4D0LB 4DSOA 3RRYA 2WSSD 4LJ9A 4R71A 2A5JA 4QHTA 3TSZA 4X8HA 1UFQA 2BC9A 3PUXA 2OEPA 3N2IA 3CNNA 2BCJQ 2N46A 3MMPA 2J1LA 3K0AA 5JEEA 4ZIRB 3BWDD 3WXMA 3KJIA 1O3YA 5J5CA 3AP1A 3MWKA 1NN0A 2V1XA 2VH5R 4G5RA 1YZNA 3A8TA 4NYMQ 3EC2A 5CDFA 3RC3A 1J7KA 3UG6A 2HCJB 5F3WB 3H2YA 1UBGA 4B3BA 1RVDA 4JL8A 5AJYA 3T34A 2J3EA 5E95A 4EUNA 1AGPA 5GJVC 2IX3A 3GLIB 5FPSA 1VCMA 1BYIA 2MSEB 1G4UR 3PV0A 2D3WA 3RDPA 4ZKEA 3EPLA 2F43A 2DBYA 4ZDJA 2A5YB 3RSLA 3PITA 1R0YA 4ZIRA 2CHVA 1HYQA 3K0EA 4PR0A 1G9XA 4Q48A 2CL0X 3VQTA 1OXUA 4WAUA 3B78A 5J4VA 5LB2A 1N6RA 1Q57A 1ZM7A 4IDNA 2OXCA 2UZ3A 2OXRA 3CX8A 4W5JA 2ZIAA 1OKKA 3FKSA 1YZTA 2FSGA 4GZMA 3ZDQA 2RAPA 4V0LA 1XJCA 121PA 1W2GA 3EIHA 1CTQA 3LVQE 4C2UA 4OHYA 1P2VA 1X1RA 221PA 3SN6A 1G16A 2FOLA 3VKGA 1SKYB 2ZJBA 2G88A 1P62B 2GJSA 3HP1A 1Z83A 2VRWA 3B7GA 1P9WA 1RRCA 2KWIA 4DEYA 4NYIQ 4BFXA 1CS4C 1Q20A 3G0HA 1AQYA 3C4JA 5AUOB 2FZLA 2FGJA 1E2FA 4BRUA 1U0HC 4MYHA 1T3HA 5C4GB 1A2KC 1NMXA 1ZNWA 1FTSA 2PL3A 2H8KA 2EFEB 2ZREA 4MRPA 1GNPA 4PSKA 3PUZA 2F9MA 5FBQB 3I62A 1FFHA 1M6NA 4M9SA 3PUVA 4LK2A 3EC1A 4LX0A 4LYAA 1MOZA 1XMVA 2C9OA 1ELOA 4OQFA 1JALA 4QRHA 2X2FA 4UQOA 4DCSA 2CVHA 4H1UA 2WBLC 3VR3A 1QF9A 1XD8A 2F3TA 3IKJA 3RABA 1HT2E 2V7QD 2JJ1A 4RJLA 3KQKA 4Q4LA 2L0XA 4ZV4A 4GOXA 4JL6A 1KDTA 4QNRA 1G8HA 2CDNA 4LZZA 1G5TA 5KHOC 3JZMA 3MAAC 4CEIB 2CJWB 2JJ8A 2P3SA 2H57A 5B57C 3T35A 1DOAA 2GZDA 3CR7A 4M9ZA 2WPDD 2FF7A 3PEWA 4CT4B 1Z6XA 5E4FA 4N0DA 1A1VA 1ZD9A 1R5NA 1N0WA 1CJMA 5DN6D 3B1XA 1E9CA 4E07A 5BYKA 1KHTA 2JLSA 4DBLC 1CJVC 3I1FA 1UKEA 5KNDA 3H1TA 1RW4A 1LF0A 3EASA 4OI1A 3BERA 4MQBA 2NO1A 1OFTA 3D8BA 4AYXA 2ZJYA 4JYBA 3RS3A 3CRVA 3T1TA 3EAQA 2XZOA 2HLDD 2Z4RA 4KFTA 2HXYA 2AK3A 1VYTA 2ZRPA 4HLUA 4CEIA 2CJWA 2ZUCA 1P2TA 3CF2A 1IONA 1XXHB 1U9IC 1G4AE 2GXUA 4FMCB 5G53C 2ZITA 4JLVA 3TMKA 5L3QB 1E4YA 1W0JA 2EYQA 3LQQA 1MT0A 4MKIA 3ADDA 2EQBA 3DO6A 1FPMA 1Z0AA 4G5SA 4LHYA 1EFRA 2PBRA 2ZE7A 2A78A 2IXGA 2ATXA 2C96A 2GEUA 4C30A 3OFNA 4MKHA 4Q1DA 4DSUA 3KQNA 4IDOA 4WBSA 4WXPA 1XPRA 1CP2A 1G7TA 1JXMA 3L8YA 3BB1A 3NC1C 5CJPA 2RMKA 3IDQA 3PEUA 4TSFD 3OFND 1ZU5A 1FP6A 1WE2A 2D2EA 3QG5A 2JATA 1TQ4A 1NIPA 1E96A 1XFAA 4OQMA 3ZQ6A 5L3QA 1RJ9B 5SZHB 4IEIA 3TIFA 1Q12A 4I99A 4YMVA 3DVLA 2JJ2A 4D0GA 3PENA 4ZKDA 2WJGA 1D8TA 2HV8A 2MSCB 4UJ5A 1XCPA 2YWFA 1IM2A 3KKQA 3HWSA 2FE4A 1NVUQ 1NSTA 4B76A 1ZNXA 4QM6A 1XTQA 3KB2A 5DHAA 4LPSA 4JMPA 4HAZA 1V5WA 1XEXB 5JMTA 3WP1B 4GI7A 2QY9A 4DRZA 1OPXA 1WCV1 3KDSE 3EPHA 1E2PA 1VYVA 5FR1A 3F5FA 2CLSA 3HPRA 1KDRA 3T1OA 5GVSA 2LWIA 1K8RA 1QHNA 2FV8A 1N6HA 2WAXA 4JLBA 4N0EA 3TVTA 4Q1FA 2GXQA 3ND9A 3MD0A 3R7WB 1W5SA 4S35A 3RNLA 4HSEA 1MO6A 4AK9A 1AQUA 1W0KD 4PPFA 2XNDA 1P61B 4DLUA 3SYKA 1S8FA 2HCBA 4EPXA 1DAKA 2IUSA 1GZSA 1XBTA 3LXRA 4TLBA 1W7AA 3U7FB 1R0WA 1D5CA 1LY1A 2ZVQX 2IUUA 1EXMA 1QHGA 1XEXA 2XNDD 4C0AC 4LBZA 3QXCA 2XZPA 2ODWA 1NI3A 5AJVB 1SQ5A 1OFHA 3A58B 1KI3A 4FMDB 2YNMA 2KJQA 4OK5A 1M2OB 2WJJA 2WZQA 2CXXA 4OKSA 4UNPA 4URWR 1MABA 5E7JA 2IYRA 2RGNC 2VHUA 2H7VA 4PC2A 2IYVA 3R7WA 3AV0B 1WF3A 3KUCA 4XOIA 1DG1G 5EUQB 4RZUA 1CU1A 3AF2A 4W5WA 4I1SA 2A9KA 4I1OA 4YXWA 3UMFA 1ETUA 3B1ZA 4ARZA 4B71A 2B6HA 2R6CA 1HY3A 2C5LA 2NO0A 2XNSA 5FUWA 3K09C 1ZW6A 2BHRA 2XAUA 4P31A 1G8YA 5J4LA 1HQYE 2QU8A 4QL3A 2NZ8A 2ZANA 4NH0A 4QNMA 1HURA 2ODEA 4MDEA 3PEVA 3QQ5A 2Q9CA 1A82A 1CR2A 4WIAA 3FE2A 5HZKA 3QNUA 1LTQA 1MH1A 2JDID 2ZU6A 1ZMXA 2QP9X 1AK2A 4EFNA 1RIFA 2QSYA 2VO1A 4GOKA 2R9VA 3PUYA 4M9QA 4A2QA 3RWOA 3U3RA 4KO8A 1E9FA 3NBYC 3RS5A 3EXAA 1HT1E 4FD2A 1KO5A 3RRZA 4DB4A 4CGZA 1P3JA 4NYIR 4LJ5A 1QHSA 1XRJA 1SZPA 1QBKC 2VP9A 4JT4A 4RVCA 3K0FB 2VPPA 3RRNA 4E5UA 3QKRB 1WRBA 4P4UA 2FFBA 2P65A 4NBSA 4TLAA 4BZXA 2ZRDA 4QBHA 5IT5A 4DVGA 1D2EA 1NJFA 3BAFA 3LV8A 4HLCA 3GLGA 1XDBA 3IBYA 4A0HA 5L8VA 2GF0A 2QM8A 1X8JA 3OAAD 4PQYA 4S2EA 3THWA 1ONBA 2ZYVX 3GLHE 3SOPA 4JZKA 1L8QA 3QSYA 1X8KA 4IOLA 3VNVA 1UBEA 4RCZA 3WYFA 2IS4A 4AI6A 3T1QA 3WRYC 4KBFA 1P2SA 8OHMA 3KKPA 1NVWQ 3FOZA 2QGZA 4A36A 3C16C 3GLFE 1DTSA 2YOHA 4OHWA 1QHIA 2YKGA 3K0FA 3SJAA 4PSAA 1TUEA 3CLVA 3QKRA 1AS2A 4LBWA 3QBVA 1DBSA 2KBEA 2FJUA 2VSOA 1L2TA 3I92A 1GSIA 3KL4A 3BBPA 1UKZA 2VP0A 3ZZ0A 5JEDA 4MUAA 5AUNB 4Q9JA 3SC3A 1SXJD 5FTJA 5ANRB 1VKJA 1FNNA 1R8QA 4MUBA 4OI2A 1K5GA 3MWLA 3CWQA 5CIQA 2VSFA 2GJKA 2IYQA 4C0LA 2Q6TA 1FQKA 1GKUB 1Z0IA 2NMVA 3RHFA 2OCAA 2MMGA 1S0UA 4B43A 1KI6B 1HUQA 1KAOA 1HV8A 1ANKA 4DIEA 3NH6A 3QKSB 1GDDA 3NXSA 1IN7A 1TF2A 1W48A 4HAWA 1ZM3A 2ZYUX 4TYQA 1OYYA 1BO6A 3OIWA 2EFCB 3P32A 1DAIA 3QXXA 3UWOA 3TLXA 4XD7A 1YR7A 2QAGC 2ZTSA 4C0QC 5AJZA 4Y0VA 1Z22A 1COWA 3CX7A 4KV9A 2NO9A 2HJGA 5KDLA 3P27A 2P0EA 3ZD6A 1FP7A 3X1WA 1I2MA 1NY6A 1COWD 4A0RA 1AZTA 1CR0A 1E9EA 1KI6A 2J0QA 5KSPA 3KKMA 1UKVY 2C8VA 1GVNB 5FUYA 3QKSA 1P2UA 2QE7D 4E09A 1NP6A 4BFTA 1WQ1R 4Q00A 5EE1A 4A0FA 4HZIA 1LS1A 1WXQA 3R9WA 2N1BA 3CRMA 4DLYA 1XCMA 1NNEA 3MGCA 1S2MA 2F1HA 1HA3A 1KTVA 1TL7C 4G5QA 5KDOA 4HYYA 1WBBA 1EFCA 1ZCBA 2DPXA 2H17A 4KAXA 2GCOB 2QT1A 2ZR9A 2D2FA 4B2LA 2VF7A 3PG5A 3N5CA 1NF3A 1AIPA 4IOKA 4M1WA 2HF9A 1G3MA 2Q9AA 2J45A 2JIZD 3SI7A 2HUPA 3QOFA 1U2RA 4M1YA 4YMWA 5TXGA 4DHEA 3OEEA 2ZJAA 4QJ3A 1W49A 3V9PA 5FPHA 3ZIAD 2AFHE 2W83A 5JJIA 3AVQA 2WICA 4JBXA 2C78A 3AF0A 4PZLA 3BB3A 3TBKA 4EJSB 5JHGB 3OF5A 1II0A 3QKUA 5FH9A 2C9CA 2KI5A 3FHCB 4Q7MB 2IS2A 4CW7A 1H8HA 2O0HA 2WV9A 1ZU4A 5C4MA 1U0LA 3IPXA 3NBFA 2WKRA 1ZC4A 3QKTA 3U60B 3FB4A 3OESA 1H8HD 2ZI9A 4LJ4A 5BN5A 3RS4A 3AP3A 3VAAA 1Z5ZA 3FPAA 2JASA 4B2PA 4C7OA 3P4XA 3I5YA 4PANA 1UEIA 1U9IA 2AWOA 4HAYA 3DHWC 1PLJA 4QM7A 1M7HA 2GWHA 2BVNA 5A0FA 2IXFA 4NCIA 1A5TA 5L3RA 2XSZD 2QM7A 3X1DA 1KI4A 1IY0A 5JSZB 1F48A 2IEZA 4CEJA 2IYWA 4P3YA 1NBME 3LBIA 4AYTA 4TT3D 2BV3A 3NWJA 1OYWA 1R7RA 3FDIA 5EQTA 2ZRMA 4D4KA 4N1AA 4QC2A 4Q4AA 1CEEA 2WIAA 3ZQJA 3M4YA 1TX4B 3AVXA 1BMFD 4KVGA 5HE8A 2PEYA 2RGXA 3B82A 3HDTA 5HKKD 1XJ0A 1TU3A 1KYIA 3BH0A 2ZRAA 5AJXA 1S9DA 4RZ2A 4TMVA 3SEAA 3KTAB 4P0TA 2ZYTX 1W47A 1PUJA 2EFGA 2BMDA 4EDHA 3PCRB 1CULC 2IF0A 5JSZA 5D3MB 1Z0FA 4CF7A 2GXAA 3T06B 4BPBA 2Q0HA 2CBZA 3A1SA 2H92A 4LHVA 1E0KA 3QXJA 3K70C 4OI4A 1IHUA 3LO5A 1EESA 1VECA 3REFA 3VR4A 1DO0A 2X19A 3IIJA 3U3JA 3I61A 4LCBA 1E2HA 4P33A 2WJIA 3THXB 5B64A 1UDWA 4GMDA 1SVOA 1JR3A 2REOA 3VMFA 3K8YA 5BQ5A 2IUTA 5AUQA 5P21A 4MA4A 3KTAA 3NDBB 3AVYA 1KGDA 2X2EA 1C4OA 1JR3D 2DFKB 1YJ5A 1TTTA 1Z28A 2FNAA 3BXZA 4PHHA 5D3MA 1GL7A 3KB1A 4Q9KA 2OV2A 2JLXA 3C41J 3IEVA 2H1LA 1M7GA 2ZR7A 3EWSA 1VTKA 3KFVA 3KX2A 5JFGA 1HQCA 2WSMA 3D3QA 4QBIA 1KNXA 4XWOA 3DZDA 2JLYA 4DSTA 3THXA 2G6BA 5K8UA 4V0KA 1RRPA 2XZLA 4OK6A 4NCKA 2ANCA 1R0ZA 4KLZA 5DYIA 4DCUA 3WMFA 3MWJA 2NQ2C 1OFIA 2F3RA 1W4RA 3GEEA 5G41A 4Q4JB 4ABYA 4G1UC 3TNFA 4D25A 1GKIA 4A8JB 2RGNA 4D0NA 2IYZA 3IEUA 3BJIC 2QT0A 1CLUA 1E2NA 3IHLA 1O87A 3TUIC 3P4YA 2YWGA 1HE1C 3S1AB 5KSOA 2HF8A 4DLZA 4ESVA 3HPQA 1E9DA 1T5IA 1X86B 1KZGB 2RB4A 3QE0A 3QUSA 1GNQA 1OF1A 4IW3B 1FL9A 1JJ7A 1T3SA 1XMIA 4UJ3A 4ASUD 4BE7B 4BGDA 4LYHA 2OFXA 3AGPA 4M1SA 4POAA 1TQ2A 5G3YA 2ZUBA 2W2VA 3K09A 4ZI3A 2P6RA 3RS7A 3LBNA 2OE2A 3J81k 3ASYA 5BXQC 1XCGB 3HR7A 1N0UA 4Q4JA 2Z4SA 3K0AB 1MRNA 1QHYA 3K53A 2CK3A 4JKIA 4A8JA 2OHFA 4PAOA 1II9A 1S1CA 3FHOA 4HB3A 4Z54A 4OHVA 2VP6A 1AA9A 1VIAA 3S1AA 4DLRA 3NDPA 3L0IB 2DFTA 5AR1A 1NKSA 4M21A 2I1QA 5EE0A 5J4YA 2ZJOA 2D7DA 1VMAA 2YJTD 2ZAMA 4Q66C 4HAVA 3DZ8A 4A2PA 3AVTA 2ZS7A 3U6KA 3TUZC 1UADA 2CMKA 1XB2A 2OAP1 2CL6X 2GJ9A 3DOFA 5J40A 1NKTA 1PV4A 2W6JA 4BEJA 2F43B 2OILA 3LAWA 2QBYA 2FSHA 2ZRBA 4Q01A 4V03A 2QGNA 2IYYA 2IBMA 5J47A 2ZR0A 3DDCA 1KK0A 1OXXK 2GEVA 4O0MA 5TVKA 4O3MA 1ZD8A 2W6JD 2OLJA 3NBXX 2QZ4A 2IK8A 3OEHA 1OH7A 2AWNA 4YDSA 3AM1A 3M6AA 2EFDB 1TUIA 3WMEA 1QRAA 2EFHB 1P5ZB 5C46F 3ZGXA 2QMOA 2VHTA 4UXHA 3OEHD 4Q7JB 1FUKA 2PZGA 3KZ1E 5FL3A 2YWHA 4NL4H 1G20E 2ZAOA 4DUGA 1E2KA 4DC9A 1TMKA 5HE9A 1JR6A 1ESNA 1IJEA 1SVLA 1KSFX 2AD1A 1CJUC 3KXKA 4Y0AA 1YR9A 3G82C 4OQXA 4I1VA 1SHZA 3GLIE 1PVOA 3L2OB 3CH5A 1F5NA 4RSGA 2QAGB 1DAHA 2FZ4A 4IDHA 2V8OA 1OV4A 3QXSA 1G8GA 4XTCS 2VHQA 2F7SA 1Q3TA 2YOFA 4TL6A 4LV8B 721PA 4XIGS 4O25A 1GRRA 3B9QA 3CR8A 2A5DA 3PXGA 4GT1A 1W36C 2AR7A 2FH5B 3Q85A 3ECCA 3L82B 3BOSA 3R9IA 4D6PA 3OZXA 3LBHA 3DEFA 1Q0UA 3LNCA 2PMKA 1A4RA 3B6EA 1E98A 4DXAA 4PHGA 1OKKD 3FKSD 4BECA 5L3VA 4FMBB 1G8PA 2QPTA 4M1MA 2B7BA 3GFOA 4JLJA 4JLNA 2C9YA 5IHPA 2BWJA 1LB1B 1J8MF 4A92A 5E3HA 2BM0A 4HDQB 3DOEA 2PLFA 5FPKA 2QAGA 4EFMA 1SVKA 1E0AA 4RD3A 1SKYE 2ZE5A 4V0OA 1SVIA 2D7CA 1F2UA 3BFKA 4FIDA 4B47A 2WJHA 4NCHA 2DWPA 2PEZA 4G5GA 2P5SA 4JBWA 2P5TB 2XB2A 4UXJA 1BYUA 3I32A 1XJQA 2QG6A 1S3SA 3A1VA 1Q3HA 4O2LA 3SU8A 5EJEA 3E70C 1I4DD 5FOWA 4WZBE 4ESHA 5H8WA 1GRNA 4UNSA 3AVOA 2AXPA 2DFLA 4JS0A 1AGRA 5LBIA 4OK3A 2O8CB 3UIEA 1QG4A 3D6TB 5K8IA 4D4JA 3ADCA 3VR5A 2A2ZA 1GG2A 1KJZA 4YMUA 1EWRA 1WBDA 1W2HA 4LGMA 5BN4A 5CB8A 2WWWA 1CIPA 4D82A 2DB3A 4LJ7A 2GK6A 1R5OA 4D26A 3AKDA 1EX6A 1G64A 2JJ1D 3C8UA 3NHAA 1B0UA 4XSHA 1FOEB 3U7HB 1G6HA 2QA5A 4QG7A 4JLDA 4D2IA 3B5JA 1OIWA 1W4AA 5JRJA 3X1ZA 3HR8A 3SJBA 4JSYA 3QY0A 4GRAA 3AVVA 2BBWA 1KI2A 3U7GA 2VP4A 1XPUA 1OE0A 1E94E 1RZ3A 3KXIA 3U4QA 5KO2A 3TVDA 2O8CA 2DFNA 4ZCMA 2VSXA 3QF4B 1FW6A 3FTQA 3MRSA 4B2IA 4GOJA 3TAUA 3WHLA 2WTUA 2RGEA 1LFDB 2YZ2A 1TEXA 1TEVA 3FYHA 5TMPA 1L7VC 3KJGA 5H1YA 2P2LA 4AG6A 1XEWY 1XD2B 4HLQB 5FBLB 5TV2A 3WBKA 2JLUA 1KOFA 4W7SA 3CBQA 1T0JB 2ZXUA 1ZM4A 4A15A 1UBCA 2ONJA 3CKLA 3T15A 1CJKC 3SHFA 5TB5A 1MO3A 2UKDA 1N2CE 4IDQA 1P6XA 1ESMA 1ZIPA 2PT5A 1G5PA 1P9RA 1XXHE 2FEMA 5C1BA 1US8B 2FG5A 1CJTC 1W0JD 2CCKA 3QF4A 4QFMA 1VCNA 1NRJB 5CIWA 1G6OA 5KNBA 4Q9HA 1D9XA 3TW8B 3VHXA 3WY9A 4TZ0A 1EFRD 6Q21A 4F38A 3B2EA 3IGFA 2YYZA 2C98A 2QORA 3K70B 1XD2A 2O0KA 3GFPA 4Z8YA 2HYDA 4HDCA 1U94A 2Y8EA 4PQFA 5F2EA 1UM8A 4GPTA 3GMTA 2B8WA 3MCAA 2ZJ2A 1U8ZA 3C5CA 2AL7A 4A4DA 4BFYA 1CBUA 1KKLA 1NIJA 4EPRA 4GP6A 4NP6A 1US8A 1JEEA 3QI2A 1A2BA 3K0CC 3CWZA 4ITRC 3HYTA 3AH8A 3AB3A 3RS2A 3ZYCA 2GNOA 3WHKA 2QUZA 2JJ2D 5KPJA 1G17A 2XTNA 2ZUDA 2W2TA 4OHXA 4PPGA 4B32A 1E3MA 3U61B 1IY1A 5FTMA 4UXIA 3QEJA 1AKYA 1T5LA 1E1RA 2DWOA 4Q03A 1OW3B 4JLMA 3O8CA 4K46A 4KXFB 4DDUA 3T12A 2FPMA 3I8SA 3I73A 1N6PA 5FOXA 3RSOA 4R9UC 1MABB 3V00A 3UG7A 3CUEF 2BOVA 4BZQA 5BN3A 1E2DA 1JBKA 5KDDA 2IS1A 4JLOA 5A5GA 4FCWA 3WNDA 3TRFA 3PVSA 1G7SA 5FFMA 1DAEA 4IFEA 3LD9A 4EPTA 2GJ8A 4B48A 3Q3JB 5M04A 1Z0KA 2JLRA 2ZSEA 2EYUA 3I8XA 4NYMR 1F6BA 4M1OA 4ARZB 1TF7A 5LD2C 1PUIA 4DKXA 1VHLA 1YQTA 4HB2A 1EFTA 1KO7A 4IOJA 3NIBA 1WDTA 1AS0A 4Q02A 5FOTA 3DMDA 3CM0A 4NPHA 2XTZA 3THOA 5DIFA 2WVJA 5FOUA 2C2HA 4B3XA 2IC5A 2W58A 2DHRA 4MRVA 3SDZA 2FEOA 4C0HA 4NKRA 3KQHA 3KXLA 1FMJA 2BBOA 1FTNA 1G41A 1XPOA 2HT1A 2WWGA 4DCVA 3FFBA 2BDTA 4NU0A 4LJ8A 5EZ5A 2AHOA 3WP0A 1NVVQ 3W90A 3A37A 2ZU0C 5DE3A 3IUYA 2B8TA 2AN9A 2JEOA 4LOAA 4WXRA 5IK2A 4US2R 4LJYA 1YZQA 4R7ZA 1NLFA 3GJ8A 2CL7X 4P4SA 4YXWD 2PT7A 3GLGB 5H70A 2IYUA 4W5HA 1IN8A 4YMSA 2HJVA 5EUMA 3E2IA 4Q4HB 1XTIA 1PLKA 4PC1A 2WWIA 3THWB 5DYGA 1IQPA 3SE0A 1Z6TA 1KIMA 1Y63A 2W0MA 4H9GA 3CIOA 2VHJA 1EWQA 2ZROA 1NG9A 3QJYA 4OHZA 4TL7A 1W1WA 2XJ4A 4LI0A 1OH5A 2HEIA 2OCBA 1E2EA 2QQ0A 3AP2A 1NVXQ 3U5ZB 5E7IA 3FGNA 4YC7A 4HDOB 5FBRB 3EZFA 1UBFA 3GEIA 1AKEA 3KFXA 1NJGA 1J70A 1C9KA 5TY0A 1CR4A 4Q4HA 2CNWA 1SXJE 4A1FA 1GILA 1ZNYA 4OI0A 3O47A 2VTKA 2WJVA 5EZ6B 3WMGA 1E1QA 2GHIA 4A6PA 3R8CA 5SZKB 1ZD1A 1OLOA 4FWTA 4TMWA 4Q7LA 4LRWA 4GFDA 4MYTA 4D4LA 4LHWA 5CITA 2IW3A 5GJBA 1M8PA 1R6BX 1E1QD 5JI3E 1E2QA 5CK5A 4QJ5A 3HU1A 1Z3IX 3UKDA 3NC0C 3FWYA 1CR1A 3DM5A 1W36B 2GDJA 1U0JA 4DZZA 2W0SA 5CM8B 4TTRA 4D4MA 2W6IA 4RFSB 2O8BB 3EZ7A 3VKHA 1P75A 4F93B 5BYJA 3UXMA 4ZDIA 4QHSA 4O2RA 4NZYA 4FW9A 1KZ7B 3SFZA 3RC8A 4OQLA 1XZPA 4TTQA 1NLYA 1KMQA 2ORVA 4PC7A 4LSGA 2ONKA 3ND8A 2ZRKA 2Z5FA 3MLEA 3V4RA 3B8HA 4MYCA 3T5DA 1GNRA 4C4PA 2E87A 2FGKA 4ZCIA 5KSYA 1SVWA 4PPNA 2JLVA 4RD0A 3GLHA 4F4IA 1U90A 2WWFA 2QPOA 2ZVPX 3LW7A 4RFSA 5EXXA 2O8BA 1EG7A 4PZYA 4A6XA 3TJZA 1YZGA 2FFHA 4OJKA 1NY5A 3F0TA 3CPJB 3GLFA 1M74A 3L0PA 1N6IA 4JSTA 1FQJA 2RGDA 3T5GA 4BQSA 1UF9A 2JA1A 4NMMA 4L4UA 4XD7D 4EAQA 3QIAA 5HR5A 2NZJA 4GDFA 1I2DA 4C0JA 3CONA 4C9BA 2DYKA 3RWMB 3FMPB 2OG2A 2FU5C 3PR1A 1JI0A 3I72A 2NIPA 1CRQA 4II7A 4TYPA 4XH9B 4IFBA 2ZSFA 4BLRA 3CRQA 3HU3A 2IA5A 3EIEA 4AYWA 1IY2A 1E0JA 3RS0A 2C03A 4QHYA 1K5DA 5FI1B 4ON9A 2H5EA 2JLWA 2ZJ8A 5CJ2A 4DSNA 2QROA 2QENA 1Z0DA 4JKYA 3ETLA 3NKVA 2AK2A 1S9HA 1H65A 2GVDC 3OIYA 4QBGB 1NMZA 3SQXA 4NCNA 2MSDB 3TGPA 1E79A 2R8RA 2OAQ1 3TR5A 1KK3A 3OIVA 4URVR 3BH6A 4G5OA 4GZLA 4BASA 4C7OB 1P9NA 1CRPA 1E79D 1TADA 3OEED 4WOPA 5F9FA 2RGBA 4URZR 2P67A 2F6RA 4CEHB 4AKGA 1E2LA 1JXOA 1KY3A 1GIAA 1WMSA 4KODA 4TMKA 4Z1MA 5JZVA 1R5BA 5FI0B 3VX3A 4CEJB 5J4KA 1U98A 4IVRA 4LHXA 2FWRA 2CCGA 4PHTA 2BJWA 4K8OA 1EGAA 2PJZA 1VG1A 3VFDA 3ZS8A 4Q4AB 2QRZA 3A36A 4IOMA 3GQBA 1Z47A 3DKPA 1E69A 3THYA 3EPKA 3NEYA 3GJ5A 4JVNA 2REXB 2E9SA 3EWAA 2OCPA 2ZI5A 1BOFA 2G1JA 1SKQA 2H16A 2OLKA 3GJ7A 3KKNA 4RKEA 5CLQA 4XVUA 2CLCX 4V0NA 3NEJA 3BGWA 2PX3A 2V3CC 2B92A 2WJYA 1KNQA 1G18A 5KTYA 4CEHA 3CPHA 3UMRA 2LCFA 3AUYA 1KI8A 2ZRJA 3E5HA 4PX9A 3W5JA 2F9LA 1YR6A 4FMCF 4JVLA 1ZYUA 1XTKA 2IS6A 4EQ6A 3NVAA 2WHXA 2ZSAA 4R2HA 2DWQA 2A7QA 2A5FA 2Z83A 2ZS8A 1G21E 1OHHA 1P60A 3CZQA 3EARA 5EP3A 5TARA 2NPFA 2R6AA 4ZI2A 2NO6A 1M1YE 2J7KA 1KJWA 4BZPA 5CM9C 1CF4A 2Q3FA 1TF5A 4I1UA 4JBYA 1YVDA 2WKPA 2ZS9A 1VIYA 4OBEA 4PHFA 4U5XA 4CVNA 1YRAA 4A82A 1PLLA 1N5JA 2ATVA 1RFLA 3AF4A 3EZ6A 4TQ9A 1NL3A 4MITA 3AVWA 1JR3E 3CX6A 1S4QA 3K0CA 2QMEA 1J99A 2RGCA 521PA 3K9LA 4HLDA 5AK0A 1KO4A 5JI2E 5G40A 1B23P 1ODFA 5FUXA 2ZI4A 2WM9B 3WBJA 4UNRA 4W9MC 2HT6A 3AVUA 2A3RA 1F3OA 1KSHA 3CRW1 1NBMA 4TL9A 5LD2B 3MSXA 4E03A 4MRRA 1EX7A 4URYR 1IXSB 3U2QA 2O5VA 4IVQA 5E7MA 3JZAA 5B58C 3GP8A 1R8SA 5JECA 5ELXA 1Z06A 1VYUA 4LBVA 2CCJA 1KI1A 1G3QA 2BKEA 4OYHA 3I4LA 4UKDA 4C3ZA 3WRXC 1ZP6A 2KBFA 2O8EB 1ZNZA 4OQNA 4ACAA 4BFUA 2NTYC 2DY1A 4TZ6A 2MMCA 3LX8A 1QVAA 3KQUA 1JECA 4QGFA 2CHQA 5DISB 4B44A 1XEWX 4XSGA 4FWIB 3CF0A 1IXRC 2BKUA 5EE9A 5JWHA 2DCUA 4A9AA 5LPNA 1LF5A 3SNHA 2G0NA 4DJTA 5JWOA 1MKYA 1ZAKA 3BH7A 4Z8XA 4ZO4A 1G7RA 1GFIA 1E9RA 4U00A 1Q1QA 2RCNA 3BD9A 1GTVA 5JRZA 3RYTC 1BIFA 4XVRA 2OBNA 4OJQA 3ICQB 1EFUA 2IHYA 4CIDA 1G7CA 2QP3A 2O8EA 5FTLA 3ZLJA 1PJRA 5SZIA 3U7EB 4B6EA 4JYCA 3C15C 2J0SA 4TLCA 1ZCAA 4GP7A 2RGGA 1AZSC 3BFVA 3TR0A 4DCNA 3VR6A 2J7PA 3X1YA 5H68A 4AD8A 4V0ME 4MDFA 2ZE8A 3CNLA 1I4LD 4Q18A 3LLMA 3BFXA 1KSJA 1OXVA 2JLQA 5AJWA 1AJEA 1Z08A 5JJLA 2QBYB 2XOKA 3D31A 5G3ZA 3RLFA 3B1YA 2JCSA 3K0SA 1QDEA 1X1SA 4DIDA 2ZQ5A 1FZQA 2WAYA 3CO5A 1XTJA 4Q21A 3DL0A 2ZRIA 4HUTA 1P4SA 2OO7A 3X2SA 4BEBA 1W4CA 1YHNA 2CK3D 2BMFA 3PUWA 4IJMA 3CF6R 1IAQA 3TE6A 2PCJA 1KAGA 1DARA 4B3CA 3EPJA 4B34A 2R2AA 2V9PA 3U3OA 3VR1A 5CDFE 2IYLD 2D4HA 3IBGA 1IN5A 3L0OA 1Z07A 3CRRA 3R20A 1XX6A 1ZVQA 1XU4A 2AD5A 2QL6A 4DB2A 1G3IA 1JPNA 1OFUX 1NN3A 4QOSA 5FL7A 4CYMA 4RZ3A 4HAUA 5JS8A 2XTMA 3ADKA 2BEJA 3GJ6A 5DI9A 3EW9A 4FXPA 1RRGA 1JNYA 4KYUA 4QGHA 3MJRA 4ERNA 2GVZC 3NHBA 1N0VC 4I4LA 3BORA 4PQRA 2QTFA 3MG9A 3P1JA 2IWRA 4FN5A 2OSBA 4KCGA 4QKQA 1OH6A 2CEAA 2EW1A 2IXEA 1KY2A 3B13B 4B3GA 1WA5A 5B2ZA 4Q1CA 1EFHA 3IO5A 1BH2A 2GAOA 2X77A 4KI0A 3TUJC 1UPTA 2VHCA 5KOYA 4Q19A 2ZRCA 3EG5A 3W5IA 2ANBA 2WWXA 1VDZA 1MR3F 3L8ZA 1QVRA 1KK2A 5FUVA 5LB4A 2BMEA 4DUGD 4M2LA 4B33A 2WWHA 4LDJA 1JAIA 5GJCA 2NPIA 2FPLA 4HUQB 4JVSB 1XTSA 1Z0JA 2ERYA 2WOJA 3B1VA 4EKDA 1N6NA 1E32A 1DPFA 4KFUA 3TH5A 1BS1A 2GBLC 2NOAA 3AKYA 4DLXA 4DDWA 1F2UB 1ZJ6A 4NDZA 1Z6GA 1R10A 3FHTA 1LV7A 1SXJC 5CK4A 1DG3A 2F1JA 2ZYWX 4X8OA 3P20A 4BFZA 2J0VA 2R65A 2I3BA 3RAPR 3GJ3A 4JIMA 3SJCA 421PA 1Q1ZA 3NTUA 1YZUA 3IILA 4P4TA 3O8RA 4BLQA 4CDGA 2YC2C 3H4MA 1N25A 4KFRA 1N6KA 3TKLA 3A1UA 4PZZA 1U81A 4HUQA 3AF1A 5FOVA 4F91B 3WNCA 3O8DA 1E4VA 4BLTA 2NG1A 4NTZA 1H8EA 2FX3A 3B85A 3RANA 3QBTA 4PC6A 3MFYA 3GLIA 3OIUA 1H8ED 4LPKA 3U3MA 5FPYA 4BLSA 3W3AA 3REGA 3UPUA 3X1XA 3GJXC 4UNNA 5JHHB 3C5HA 3M0EA 2VP2A 2QI9C 3Q7QA 1YE8A 4RFVA 4AURA 5DI3B 5HZHA 4OL0A 4M8NE 1E9BA 3U4QB 1JQLB 2CE7A 4RKFA 2ZI7A 3W6OA 4B73A 2Q21A 2DR3A 3VTKA 1ZC3A 1XEFA 4LYFA 3W9YA 2PLRA 3VX4A 3K9NA 2ECKA 2PJRA 4AKHA 4GSYA 2OESA 1Q1BA 2TMKA 4EIWA 2JAQA 4NCJA 4M1TA 3LVRE 4BFVA 3OHMA 2ORWA 4RZXA 1XD9A 4EPYA 5BW8A 1ZRHA 1Z6AA 4B3DA 5LDDC 1UJ2A 2QTVB 2V7QA 3PQCA 4FCVA 5GJWC 1OB5A 2LKDA 2X1VA 1ZUIA 3HYRA 3CZPA 5JBQA 5DI3A 3CB4A 3IQXA 5HCNA 2O8DB 3UANA 4DLVA 2KSQA 2OCYC 4LJ6A 3WYAA 3FVQA 1S3GA 1W4BA 2WPDA 4CRWB 4RY2A 4KFSA 4AC9A 1UEJA 2FN4A 2QMHA 5J4HA 1R0XA 4EPWA 5DN6A 4X8MA 2QRNA 2WMOB 4PXAA 1HE8B 1HEIA 1GOTA 4ZDWA 1GP2A 2SHKA 3LY5A 4M9XA 2WWYA 4KVAA 2OT3B 3ZVRA 1XZQA 4Q7KA 4L5BA 3TSWA 3Q5DA 3N70A 2ZEJA 2HLDA 5KU1A 1YR8A 4IEEA 3VHLB 3F3YA 4LY6A 4XTRA 3ZZUA 3KQLA 2GF9A 1W46A 2O8DA 4MKFA 4L16A 4JLAA 5EE5B 1DAGA 1KK1A 2FMXA 4DT1B 4JLPA 3LDAA 4G01B 5DSZA 1G19A 4A2WA 4RCYA 3SS8A 1XP8A 4MH0R 4CZ2A 3AKCA 2AKYA 4DCTA 5CLLA 4DLTA 1T8TA 1FUUA 1TPZA 3SJZA 4MRSA 1IJFA 1YZKA 4EJSC 2GK7A 1GAJA 2FDCA 4LYJA 1VG0B 1SVSA 4TMXA 3LFUA 2J41A 4TL8A 3DPUA 4F4CA 4E22A 4TSFA 4B74A 3KKOA 4DDVA 2IYXA 1Z6YA 3IIKA 5EP4A 5L3SB 5FBWB 4K81B 1BKDR 2REBA 3JVUA 1E9AA 2OUKA 1J2JA 2OBLA 2YWEA 1GKYA 3IPYA 3LWNA 5F98A 1IXZA 4KLNA 4J0QA 4DT1A 5C18A 4Q5IA 3N2EA 1UAAA 1E2IA 3BS4A 4DWJA 2R6DA 1S1MA
chains in the Genus database with same CATH superfamily
3WLEA 4CT5A 1VB5A 4TQUS 2BR3A 3IO3A 3EGXB 1PTJA 3FMIA 3TKAA 4BNWA 3LS2A 1FMCA 1XXHA 1DC7A 1NXTA 1B41A 1OXTA 1NBAA 2C5GA 2FRDA 3DMPA 3GT0A 3K5IA 3KD2A 4IIUA 4R1TA 4IMIB 3ETHA 3KD3A 1O6CA 2V6MA 4RYLA 1DEXA 3FDZB 3W04A 5GTDA 4ENTA 5A4DA 3QEAZ 3NYRA 2VFAA 4OGWA 3K70D 4BWYA 1E1RD 4YRGA 2X8AA 4H18A 3T3HA 1G291 5HWSA 1VG9B 4G5XA 1PZNA 2W5UA 3OT1A 5FBHA 3URMA 4D5EA 1C9DB 1XF9A 4U0JA 3W2IA 3FUVA 3KEFA 2ODBA 4FDUA 2DGDA 2RARA 4EKYA 4QDKA 4OATA 3EVDA 4ZALA 2YYAA 4HQKA 2VR1A 5LXTB 3U1TA 1Y4AE 1R4AA 2CMDA 3K6SA 3HG7A 1IK4A 4RX1A 1RJ9A 2YWCA 3EGCA 2FSIA 2G77B 5CT5A 3KQPA 4HZUA 4XYBA 4ZAGA 4ZZIA 4P4SB 1FLAA 1NUSA 5HTKA 4I4IA 4H3KB 4R5HA 2NV2B 1H2HA 1Z2EA 2WKSA 4XFJA 2EG9A 1P17A 1EUZA 3AQ4A 4J03A 1IPFA 5J43A 3NP7A 1T8YA 4LW8A 4QA9A 3FNHA 1SVMA 4U7TB 4LC0A 4LVNA 1R4NB 2EWVA 4L4YA 3I04M 3GPLA 3KUDA 2JGFA 1MV5A 7MHTA 2BFDB 1DV2A 4AY5A 2XGSA 1VPLA 4WK4B 3IVMA 4JQCA 2NU9B 4BVLA 5BOSB 5K45A 2EBUA 3PYMA 3QEOA 5I9SA 3GRCA 3O1IC 3CJRA 5DHRA 5BVHB 1SVNA 3PSHA 4RK0A 5JCPA 5DCLA 3GUUA 4BB9A 1FX0A 3OE7A 4GEGA 4HAXA 2RB5A 1W94A 4PLWA 4UFOA 3PQEA 5JS7A 4CN9A 4DLBA 2VQEB 1WZ2A 1QKKA 16PKA 1ORIA 3PLAE 3NWPA 2DKNA 4JMLA 1UDXA 3H97A 1H94A 4OXQA 1A5ZA 3SF0A 4UVDA 1ULAA 1LKZA 4RUKA 1UM9A 1XE3A 4JL5A 2QJTA 3MWDB 4ZC8A 1QWSA 1PZEA 2GAIA 4HI0E 4R3WA 1D9ZA 4NU5A 2R00A 3OA0A 5HIKA 4JWKA 2HJHA 5IRCD 3GLGE 2V6FA 3JARB 2ENWA 2D06A 1T13A 3HUEA 3K9WA 4O4HF 3UJAA 1Y8RB 3W34A 3TQHA 4B3IA 4D98A 1IK6A 3ZVMA 4AJ2A 2BFFB 2BEWB 4Z9YA 2QKYA 3SR0A 2MYTA 3P97A 4M0MA 4BJ3A 5JCXA 4C89A 4ZHQF 4ND5A 4D9JA 4DQ0A 1EA5A 4RKRA 3BIFA 4B6FA 3I9JA 3QEMA 2B4KA 3NBZC 3LPAA 2B34A 4PAWA 3MMNA 4OIMA 4C0KA 1VE3A 4Z4QA 3B89A 2DR2A 3ESXA 1QNFA 3NETA 3F96A 4IDAA 2WJ3A 2H7YA 2ERXA 3DMYA 4TXNA 3D3WA 4UDXX 1C50A 1BE1A 1C9YA 1KO8A 2RBGA 3CKMA 4UAVA 1L1RA 4R81A 3H9BA 2EF0A 2N42A 4RFLA 3CBGA 3P9ZA 3BTSA 1Q84A 3BDVA 5JY6A 3F8TA 5L95A 2P5UA 1KVRA 3M3HA 1RHMA 3QUCA 2HJ9A 2BGJA 3IOCA 1NYLA 4I55B 1MAHA 3F6BX 3UNXA 2PLAA 3ZKWA 4X5OA 5K8TA 2RBKA 1J8VA 4DAEA 1XMQB 2P6UA 3UUWA 1SXJB 4UD6A 3GLHB 3O93A 5BPFA 4MGZR 2HMWA 1V4VA 2B9EA 3S27A 4DRXB 3NEAA 1SQFA 1AG9A 1V6SA 1OROA 3LCUA 3L5KA 1YONA 2QP4A 1R50A 1MW9X 2D1TA 3LFHA 4OSPA 4WVFA 1HT0A 3JQEA 4H77A 4O1HA 1DRJA 2D74A 3GLFB 3L41A 1DAFA 1V37A 2PH1A 3ABSB 3Q9LA 4NIMA 1LW7A 2C84A 2W6ID 4NQZA 5ARCA 5MF6A 3LL4A 1TZCA 2IELA 3IR5A 3VOSA 4B0PA 2XQFA 3B6JA 4FGKA 1I5RA 4KQGA 1X7WA 4F7WA 3MNFA 3PHHA 1O96B 1C8BA 5TR9A 2QN2A 4N5LA 1G2QA 1V96A 1GNTA 2GBLA 4PVDA 3TQFA 3C3MA 3HKDB 3QWBA 1IE3A 4Q3DA 3ONWA 1RWVA 2IIPA 4YJGB 3W3AH 1XTZA 4IDPA 1H42A 5JQGF 1QG2A 4RIHA 1K7XB 1DE0A 2OFOA 2GA9A 3KJEA 2E4AA 5JAQA 2ZWOA 4KYIB 3VMMA 4B31A 1X87A 3LZDA 1NFQA 1NM5C 3L1VA 4MDHA 2AQ8A 3AYZB 4FOPA 5AM3A 3KKKA 4ARSA 2F4VB 4G89A 3H0KA 2XUQA 3LXMA 4PSVA 4XX1A 1SGWA 2WG0A 1IOZA 3HYNA 3OQBA 2UVQA 2X9GA 3NIGB 4LUCA 4YAFA 4DEVA 2JAWA 2JCGA 3H99A 4XIYA 2DHEA 2PBZA 4PO9A 4ZQEA 4ZVKA 5JNVA 2P7HA 3GU3A 5EVCA 3FTDA 4HB4A 4UCFA 5JO9A 2K6GA 3SYNA 5JPIA 1E5VA 1IHYA 1YJQA 2NVOA 1KMHB 1YVEI 4FFLA 3PFCA 4RL4A 3UT5A 1VM6A 1XZGA 3L05A 1NOKA 2V54A 5FBVB 2ZBDA 3OCYA 1T4CA 3N2YA 3FPFA 1QQAA 3U31A 2E4YA 2PWZA 2CLDX 2CXNA 3GRVA 4I3GA 4RANA 4W5QA 1XGKA 1IN4A 1JDBC 4UNQA 2RKOA 3WLSA 5JAUA 1K3TA 5A7GA 2HREA 3HH8A 1V2GA 3UHFA 1OWMA 2XXAA 1CF2O 2F17A 1TJNA 3IXMA 1JB1A 4HFMA 2I6SA 1DU4A 4F92B 3KSBC 4I5GA 3ZJVA 4K5QA 4TLDA 4GLJA 3QVVA 1JT9A 2RHMA 3DZGA 1KZHA 4COOA 2QV7A 4CF5A 4Z7OB 1YL5A 3P2MA 3WGIA 4AKEA 1KF0A 4D3DA 1IVNA 4FNAA 2GPYA 5GV7A 1X7YA 4E7PA 3A1EA 4N39A 3THYB 1CYDA 2FFRA 4I1RA 4M88A 4LOLA 1QGUB 4ZDKA 4L9WA 4C0SA 5FWNA 4GC9A 4M87A 2C3UA 1KEKA 2R8YA 4YIHA 3DM9B 2GD0A 1FQOA 1IAVA 1LTHR 2BP7B 2PY6A 2QRJA 4O1MA 4TTSA 3M6LA 1PGOA 1F51E 2D5CA 5DNUA 3BB4A 1LC3A 1FS6A 5FIUA 4CLRB 1QGOA 4I6EA 4KXXA 1JTEA 3H2JA 4FCCA 2EKQA 4KSCA 4D6XA 5AUPB 5IJ0B 5AM4A 1R18A 2ASEA 1E6WA 3FZQA 4MKGA 1VG8A 4NV1A 4AF6A 5AKEA 4KITB 3ZIAA 2V6GA 1DQRA 2AEMA 2C4NA 2QMUA 2VDNB 2Y0EA 4DMRA 1VRCA 3GGDA 4TVKA 2G9NA 4BP1A 4EFLA 2W90A 6AT1A 3Q8MA 3ZGZA 5EXTA 4B75A 5CYOA 2DVMA 4BMDA 4CR8A 3PCXA 1SG0A 3TW4A 1BG6A 1GEGA 1YJ8A 3BE4A 4L9SA 2AX4A 4AMYA 1RAEA 1F4LA 4LYGA 4YJ3F 1T6XA 2FXIA 1E2GA 3H2GA 3LE8A 2BL4A 1XIVA 3C43A 2XVMA 3TFQA 4MV5A 3VNAA 3HNOA 5FR2A 4CM3A 1L4UA 2C07A 2O0MA 3PQ6A 4OSOA 3RS9A 4I46A 2YMPA 2EX0A 3TNJA 1XZMA 1C7EA 3PEEA 4UUPA 3NHSA 5FPTA 4GOMD 3RBAA 2PZMA 2OC4A 1YC2A 1DBWA 3OZIA 3MERA 4YDHB 4YBRA 1UBHS 4E5MA 2P7IA 3MWYW 2XMRA 1SULA 2BGWA 2IF2A 2GN0A 2VEDA 2G1KA 3BMCA 4H1VA 1JTFA 3A10A 4I1PA 1ISIA 5A9TA 2R7KA 1QOQB 1YB4A 1NVVR 3KZNA 4BBPA 1JMYA 1JHXA 3IUNA 3LSYA 1FSSA 1TQ6A 3G68A 3HJNA 1NJ8A 4D1YA 2K2QB 2Z8YA 3BICA 3ACCA 1S5PA 4PPQA 4WDQA 3KJQA 2O8FA 1UT8A 3FSGD 2PRJA 2F4NA 4LDQA 2GR9A 3NAMA 3OJCA 1U2DA 1OAKA 2QXYA 2DX7A 4DV0B 1QHXA 3FUTA 1F2TA 3EZ2A 2G0TA 3UAGA 3F49S 4IZ6A 4RNCA 1II8A 3ESQA 2O5EA 1T4GA 3NHPA 3B5EA 2VJKA 3LZ6A 1BMFA 4N5MA 4CHTA 5EIXA 2HXSA 1AS3A 2O4CA 4ILEA 4QFDA 4Y2UA 5BWMA 2RHOA 2RSLA 4Q1AA 1OH8A 5KWIA 2W6PA 4G0VA 3AKEA 3HCPA 3MIZA 2JBAA 4CCAA 1RE0A 3UK6A 1RXCA 3VYVA 3G2MA 3FJOA 3LX5A 4NPAA 3V7UA 2PKWA 2Z08A 2ZCJA 2BUAA 4C7VA 3CW2A 4CCYB 4TUYF 2P5YA 3QFSA 3VYSB 1AN9A 2WYOA 4ZOLF 4LY0A 3SXJA 4EZBA 1YBFA 3GJSA 1BJTA 2WF6A 4GX1A 3RREA 4B8WA 4Q1BA 5IT4A 1TA4A 4CIVA 1G21A 2GS9A 4LOHA 4Y98A 2GLTA 2AJ8A 4JP2A 4H59A 2I4MA 1HKHA 3VKUA 1VB3A 4INJA 1KOGA 3F2IA 3H4IA 1ZINA 5DNCA 5LQJA 3EA5A 3UJ7A 2SCUA 2NVBA 1NE7A 4GPAA 4RIGA 3RTGA 1YB2A 1UKAA 3Q8XB 4L75A 5COBA 4BRWA 4EBFA 5EJ9A 3EMBA 1EVYA 2AZXA 1BCSB 1R88A 4RQTA 1GRQA 3EGEA 4DABA 3T3PB 1K27A 1WULS 5KKNB 2H18A 4M7PA 5IM4F 1WSDA 5J2UB 5JV5A 2WWRA 2WFLB 5C4IA 4A26A 2J9RA 4M60A 3D6AA 4D3XA 5KNCA 4NONA 2M1XA 2Y27A 5DLQC 3UMCA 1G0NA 2OV4A 4KE8A 4RTLA 2YY7A 1ZXLA 1I7DA 1EYZA 5I7HA 5TDHA 2RJOA 4HRVA 2H5IA 5HW0A 2Z3VA 1NLZA 1A4UA 1L9XA 1ORTA 2B21A 5F1PA 2C9ZA 2RH5A 3PRYA 5EKUA 1ML4A 4NY1A 1ZKMA 2R4UA 3LCCA 5C3MA 1Y7HA 3OQOA 3K1JA 1E4OA 2GNAA 4IKEA 1T35A 4ND8B 5JD3A 1WDKA 4FMDF 1E2JA 1NAHA 2Q1YA 2QX7A 3BGDA 3T3GA 4BNLA 1MO4A 3BE6A 2JW5A 4LC1A 1FMLA 4KXYA 4EH1A 2HK8A 2QTZA 1OBOA 1ZCZA 3NOXA 4P38A 1PQ4A 1QK3A 1PJQA 2IL1A 4Q9NA 4CL3A 2QVGA 4D3ZA 2OZEA 4LGCA 1YQEA 3ZCXA 4BX3A 1UKYA 3G0GA 4U02A 2ORYA 4FFDA 3ZJTA 3PTLA 1Z73A 4AFNA 3T9CA 5KYTA 1YK1A 1YRBA 2FX5A 4JR0A 5K3BA 2XGJA 1KKMA 3G8DA 3TRHA 1CZHA 3AEQB 5CCDA 5JRDS 2EVWX 4YNBA 4F2DA 1DBVO 1QGYA 4CM9A 4XJXA 4MUIA 3VGJA 4AX4A 4C87A 4E5DA 4EY8A 4FI3F 2Q6IA 3FUUA 3RO7A 4C0XA 3LXUX 2BDUA 4KXMA 2RHGB 5CVVA 3T1NA 1QR6A 3PHCA 3ADOA 4JD5A 1I4TD 2ZBRA 4BCCA 3JU3A 4HQRA 3RGGA 1MIOA 4QEKA 4ERXA 3RRMA 4D9HA 1U99A 3G2LA 1PVDA 1JEDA 2ZBFA 1J0XO 2I55A 3GT4A 3QPVA 3I2GA 1GVHA 1M2HA 3PP8A 5M2QA 1WB9A 5C8ZA 4C4SA 3INYA 3QF7A 4X7RA 5G0VA 5KYGA 1X6VA 4IXMA 621PA 5KHLB 4P92A 4TWZA 1ADGA 2I99A 5TQVA 3NO4A 1PFQA 4QO7A 1D6JA 3UHOA 4F4DA 1BROA 1Q11A 4P93A 4RWEA 1G5RA 1ODJA 1SCIA 3DVQX 4V0MA 4Y6SA 1J49A 1QBGA 4YAIA 1JLKA 1PV2A 4P32A 4YQFA 1AA6A 4NZNA 3AW8A 4AJHA 2WILA 2DWCA 3HYSA 1RHJA 5DNEA 1YB1A 1VC2A 4G3XA 2C1EA 2RGAA 1XHLA 3ZCTA 2QVXX 1Y1RA 4EX7A 1Y42X 5H4GA 3Q1LA 3HUUA 3MGGA 4KQCA 1EK6A 2AMVA 4KBGA 3LRPA 4O4HA 2ZSUA 1E18A 3SICE 4ZJYA 1YI0A 2FPKA 2WSSD 3WWYA 2CEKA 5IFKA 1LVHA 4X8HA 2BC9A 2UVPA 1WP4A 2XUOA 3PUXA 3N2IA 4NMLA 2ET6A 5EGSA 3SXUA 4AG3A 4ZHQA 3UB4A 2GCGA 2WD9A 2WJAA 4XIJA 5JEEA 3DZHA 4XA8A 1R3UA 2NSLA 2H11A 5EINA 1SBHA 3WXMA 3U44B 3FOBA 2PS9A 4M98A 1KIFA 1UJ6A 5CH5A 4Q3LA 2A59A 1XL0A 2EZ8A 2PYZA 3AL3A 4ER0A 2I4RA 2F8TA 3KXPA 2AG8A 3D02A 3H6KA 2GZ3A 4B3BA 1RVDA 6ABPA 4GGMX 3NKLA 1YZ3A 3GVPA 3PWSA 4G6ZA 3BA6A 4L5AA 4FFOA 3SIWA 1DRVA 3AOEA 3V9AA 4DMLA 3GLIB 5I7SA 1VCMA 4BKUA 4J2OA 2F3SA 4DJ5X 3PV0A 1Z4PX 4ZKEA 4ETIA 2A5LA 4YY3B 1SCUB 3I6MA 4HEHA 2PKQP 1DGQA 1DX4A 4LVUA 4RJTA 1GU7A 2A5YB 2Z1NA 4H6VA 3RSLA 3L7JA 2B7LA 1ZL0A 2OHGA 4ZVMA 4EHKA 5A9SA 3Q8WA 2GPNA 2DLNA 2HU5A 4MVCA 4Q48A 5BSUA 4WBNF 4R3NA 1J25A 3KVVA 2A9VA 3MW8A 1CV2A 4P1ZA 3VQTA 5B4VA 1G20A 1WJGA 5LB2A 4CDMA 1Q57A 1P7ZA 1ZM7A 1X2BA 4L51A 4UPEA 1ZSYA 5EPOA 2ZIAA 2V59A 5E4TA 1RIIA 1TAHA 2ACKA 5ICGA 4XKJA 4RV9A 4YRNA 1PWXA 3C3BA 1L7RA 1VRVA 1XJCA 4B4OA 121PA 4GXTA 4RXMA 3JSXA 3ZU3A 1P2VA 1DQNA 4PXYA 3UH1A 1X1RA 221PA 2M32A 2FOLA 1VMIA 5F78A 4EGQA 2JH9A 4ISBA 1P62B 2B1GA 3IA7A 3PD1A 4DFDA 1QRDA 2VRWA 2HR1A 1QFZA 1P9WA 4WKCA 2KWIA 5KYXB 5FA6A 1D0VA 5BNFA 3FTEA 2XEDA 3FVWA 4JY7A 3OE4A 1WKBA 5JQGA 2A9JA 1LSOA 1DRWA 1AQYA 1Q20A 4MUGA 3V8MA 3DFFA 2FZLA 1B3BA 4JYMA 1FSFA 4MYHA 4M8LA 2E55A 1KOLA 1SKBA 5C4GB 1AGYA 2WSYB 1NMXA 1I6LA 3TD2A 2H8KA 4MRPA 1Q0SA 3PUZA 1M6NA 4IO1A 1UXHA 2ZG6A 1Y5IA 3IH5A 4FHFA 4M9SA 3C3PA 3MUEA 4ONEA 1SAYA 2IYFA 3OZUA 4HNHA 3M5PA 4LYAA 1XMVA 3LHSA 2XODA 3F6YA 4YECA 5F4BA 5IMBA 5MN5A 5L4NA 4UQOA 2WBLC 1YQ9A 5K51A 3D4PA 5SY6A 1JH9A 3C4VA 4YUYA 1QQ5A 2Q3BA 3ULKA 2FCRA 3QLJA 1CR6A 1P7WA 2O2HA 2RH9B 2WG1A 1UPUA 2IHUA 4GOXA 5IAGA 3PXUA 2F1KA 1KDTA 1OV6A 1G8HA 2PR2A 3NANA 4LZZA 4E51A 4FB4A 3DBRB 4HDMB 4NZZA 4CEIB 2CJWB 4M38A 1QP4A 2P3SA 3DVSX 3KLMX 4QECA 5B57C 1YQUA 2DG2A 2GZDA 3ZH2A 3CR7A 3DAPA 3OX2A 4M9ZA 3KVOA 1ADFA 2FF7A 2P8JA 2WPDD 3ABQB 1E1DA 4FYJA 4ZVRA 5LZ7A 4OUDA 1UAYA 1R5NA 1WR8A 2QMYA 1XRSB 1H2RS 3VKVA 4BNXA 4W5NA 3H5NA 3WJ7A 1CJMA 1FY2A 5DN6D 3RYHB 1I0ZA 2O07A 4CV3A 3P0EA 1KHTA 1ZWKA 1EAYA 5BT8A 1DC4A 1RW4A 2X13A 2XVXA 2UV8A 3EASA 4MR7B 3BERA 1DJNA 2JVIA 1RHRA 1FUEA 2FK8A 1NNUA 5EL0A 2J9GA 1XJWA 2B4QA 1NQTA 1J09A 4L6CA 3CRVA 1FVXA 3B9BA 2HLDD 1X77A 2HXYA 2PU7A 2XH8A 3DG9A 3C3WA 4HLUA 3U3ZA 2ZUCA 2DR0A 1P2TA 1H1LA 1IONA 1XXHB 2VDOB 2GXUA 2PSHA 3TMKA 5EFZA 4CV1A 2GH1A 3LQQA 2YL2A 3OP1A 1JDTA 4MKIA 3TMAA 1U2PA 4LWQA 4ER7A 3PIDA 3DO6A 1MQ9A 1Z0AA 3PD7A 4LHYA 5LP1A 2PBRA 2QN3A 2ZE7A 4YRPA 3U9LA 5IJ9A 1Y9AA 5IC5A 2C96A 2FW6A 3IV9A 3OFNA 2VRBA 4O29A 4C30A 3L4EA 4YJ3A 2DU8A 3D43A 1G7TA 1IZYA 1JXMA 3NC1C 3ZX5A 2RMKA 3IDQA 1KA9H 1KFCB 1X1TA 3PEUA 2O3JA 1JMKC 4TSFD 2ZATA 4TTVA 4BNUA 4BQRA 4IO0A 1COZA 1B2RA 4CKWA 3U3DA 3QG5A 3EDRA 4LNAA 1STOA 3UTDA 2JG3A 2JATA 4ZFNA 3QE2A 4W9NC 5H80A 3LBYA 4F21A 1RNLA 3UOWA 3U4IA 2O2IA 4Y2RA 1SBZA 3VUFA 4G67A 1LDNA 1RJ9B 8ATCA 3N0TA 1KETA 3OZBA 4UCWA 3SF8A 1YVUA 4BNDA 1N5OX 3O3NB 3P9NA 3DL7A 3M1AA 1ZGZA 1Q12A 3OUZA 1JFLA 4IF4A 3NZEA 4XFKA 3PQ3A 4D0GA 1U8UA 1JU3A 2P40A 5ALUA 2C5HA 4YAOA 3CC8A 3TE7A 1XCPA 4JA2A 3VZSA 2NT4A 2OKCA 1RYNA 4YDQA 3HWSA 2K4MA 5LBUA 2FE4A 3GBVA 4LF4B 1NSTA 4B83A 3HL0A 2EKPA 4MIYA 1ZUD1 4LZAA 1YR2A 4HPWA 4JMPA 4KAAA 4QT0A 3V8NA 5AI4A 1TM4E 1NBOA 2IPXA 3AR4A 3G23A 3A1NA 5JMTA 4AY3A 4KO4S 2QY9A 1NJ5A 2Z30A 4UZEA 4AQ7A 2K7ZA 2TRSB 1U9CA 3RYFA 2XHZA 2YTZA 3ABZA 3KDSE 4FHDA 3EEOA 2E37A 2YXPX 3LC0A 3ROZA 2IHVA 2CLSA 2PGOA 5JH7A 2DH6A 2JHGA 2DLCX 4OQZA 4RKYA 5ALNA 2WAXA 4DBZA 4DCGA 4Q1FA 3ND9A 3P9CA 3HZZA 3ZHCA 3NONA 1JHUA 2P9QA 5HQ3B 3BTVA 3GI1A 3BIOA 1T0PA 3RB8A 4TUYA 3H5VA 3PNOA 1AQUA 1KQNA 1ZOLA 1W0KD 2HRCA 2QL5A 3MF4A 4YRQA 4ZP1A 1FDVA 4DLUA 4ZOLA 3SYKA 3G8BA 7GPBA 2VHVA 4BVHA 4EPXA 2IUSA 5KYUB 1XBTA 1H66A 1JYSA 1F4VA 4ZU3A 1TK3A 1XLTA 1W7AA 3UK1A 4LXTA 1N2OA 5BQFA 2XNDD 4LBZA 2QJRA 3TWOA 3LFTA 4TTAA 4WLVA 3WGLA 1SQ5A 1KQFA 1L4BA 4K1XA 3H0EA 1M2OB 4JBIA 2CXXA 4KKVA 1BS9A 2X0NA 4URWR 2YFQA 1RE1A 2H52A 3H11A 5EI5A 2VYNA 4P53A 2EG5A 2PUVA 4DMGA 2VT3A 3DPIA 1QLJA 3S5UA 2AKEA 3N87A 3OFVA 3NRBA 2WU4A 2XA1A 1NYQA 5IM4A 3AV0B 3I2JA 3KUCA 5ENVA 1DG1G 1I1NA 1VSUA 1CU1A 4RZUA 3T3EA 3D3WB 1JEAA 1WVGA 1D0SA 3AF2A 2D8MA 4QUGA 2G06A 4M0FA 1ZRSA 4I1OA 2GOYA 1L7PA 3HJFA 4ZVVA 3QV2A 3NNNA 5B12A 2WWTA 1K3UB 1DV1A 4ARZA 3HB5X 1LJUA 4B71A 4QXOA 2XNSA 1F0NA 1JVSA 3AR9A 5FUWA 2VPQA 2G5TA 3R7BA 2K2WA 2QRVA 1ZW6A 2C5BA 2MSNA 5C8YF 1WTCA 4AJ4A 2QU8A 2WVAA 2AJTA 5K3FA 2NZ8A 3UAZA 4NH0A 4CM8A 1ESCA 4MDEA 3AU8A 5FUMA 1MOQA 3NQ41 5EESA 1T4MA 2CT8A 1SU4A 1C8KA 2G8NA 2Q9CA 4FYIA 3JQ9C 4RLHA 2JZOA 1Y3HA 5HZKA 1IZ0A 1DIRA 1MH1A 1H6CA 1OX6A 3NIDB 4LSMA 4ARBA 1YOVB 1JPVA 4U9IS 2Q7XA 1VLJA 4PX2A 1ESZA 2QSYA 3I3OA 2C9BA 4E12A 1Z56C 3U3RA 4KO8A 4LXIA 1HT1E 3BTOA 2MINB 1QP8A 4RF5A 3MB8A 3RM3A 4D9IA 3Q8KA 4CGZA 1UWCA 1X7WB 5K99A 2P11A 1QHSA 1K66A 3HSKA 2VP9A 1V8PA 3JSAA 2O1EA 4KQXA 1RLIA 2OQVA 1C14A 3DC7A 2QX4A 2VPPA 4RJIA 2RHRA 2W37A 2Y67A 4TLAA 4BZXA 4B0OA 1BEZA 2ZRDA 1DRUA 4HTFA 5FB3A 4Y2YA 3SC4A 3VI3B 5IT5A 2I4TA 1TW3A 3DR5A 3PE6A 2I1WA 5U1PA 1R0CA 4U7PB 4ZYTA 1AF4A 2Q3LA 1U2SA 4KOAA 1X8JA 4S2EA 3THWA 1LLFA 3ASVA 3GLHE 5JFTA 3CA8A 4KUGA 1L8QA 3GPCA 5ECWA 1X8KA 1J07A 3HADA 3M6FA 4N3CA 1ZH0A 4HDSB 2FHPA 4WY8A 1JL3A 5FUQA 8OHMA 3N8NA 4N8EA 1M67A 3KKPA 2QGZA 3ZWQA 4L7QA 3GLFE 1JH8A 4OHWA 1QHIA 4J4HA 1R66A 1TUEA 1MMFB 5E7QA 3QKRA 4DR4B 3RVPA 4FFNA 4NJOA 4KRGA 1W88B 4ETNA 4S0ZA 3HYLA 3C7DB 2QB5A 3V7FA 3BBPA 3HBLA 4ZI7B 3ZZ0A 2XGMA 5JEDA 4JI2B 4PHCA 2O48X 4Q9JA 2EERA 5AKJA 4U8HA 3QUAA 5HHTA 4FHGA 5LNK6 1XPJA 3ZDCA 3D7NA 4JYAB 3ZNOA 4X6LA 2PA3A 2Q29A 3NRCA 4MUBA 3MWLA 2BFWA 3CWQA 2XCQA 3U7QA 4UTNA 1JVBA 1XRRA 1GKUB 1L8XA 1Z0IA 1VZ2A 3FETA 1J33A 1EJBA 2D4AA 2OCAA 3FWNA 1L3IA 4GLOA 1S0UA 4B43A 3LIPA 1ATZA 1T2DA 3R0VA 3JTMA 2O2JA 5EZYF 1JG7A 2XUFA 4Z4CA 2PJUA 4G9EA 1T24A 5FYQA 3CVOA 2A4KA 1TF2A 3F1LA 3ZXXA 4HAWA 5IXYA 2ISCA 1HT3A 4IH9A 4LRXA 4TYQA 1ZR4A 4S1TA 1OYYA 4WN3A 4Z4IA 2EFCB 3P32A 4WLUA 2H1RA 1NATA 3UWOA 4WGFA 4OYYA 1MXFA 3EF3A 4XD7A 3SVTA 4GYYA 3PHBE 5U9CA 4MVJI 2J30A 5LC1A 4D3SA 1M2FA 5H3CA 4NICA 5C1DA 2HQRA 1Z22A 1COWA 1SUPA 3I05A 5K09A 1L5HA 2AV6A 5F76A 3TG8A 4J0HA 3KNZA 3PPWA 2ZOSA 1EBUA 5LSAA 2QVLA 3X1WA 1I2MA 3QOXA 5LP6C 1NY6A 1IBLB 1GUDA 2BGTA 3MGBA 1OY1A 2FPIA 3HDQA 4BEVA 3H2HA 4WBNA 1XQ6A 5JMOA 1AKTA 1KI6A 3W9SA 1SBQA 3WZLA 2J0QA 3KKMA 3TLKA 3WGOA 4NI5A 5I51A 3C97A 5FUYA 2QE7D 3MINB 1LXCA 2CMHA 1MBZA 2C5SA 4Y0NA 4UULA 3W78A 1E8NA 4FC6A 4A0FA 4XUCA 1C9EA 4DLYA 1GN9A 1XCMA 1S2MA 1W581 4RVGA 1F14A 1MVLA 2WYUA 4G5QA 1WBBA 2JI9A 4HWOA 1K6EA 2XWQA 3KSMA 4KAXA 1BVUA 2QT1A 5CDYA 2D2FA 2E4UA 2VF7A 1E92A 2H59A 3OTIA 5I4KA 4IOKA 1NF3A 2EKBA 1MX1A 1YB5A 2V98A 4DMHA 4QQRA 1MB0A 1U2RA 1RI4A 4JGIA 1SOAA 1YKGA 2L18A 1CS0A 1K6JA 4Q9DA 5ALTA 5ALFA 4DHEA 3BMCB 1TRHA 3UHPA 2P9HA 1DDIA 1FDSA 4QJ3A 1W49A 3O83A 4EHLA 1O9GA 2GBIA 4JC5A 1G0OA 3BL8A 2OYCA 3VU0A 2AT1A 1Y1TA 3ND7A 4MMYB 3ZE7A 4IIJF 3AF0A 2PANA 1U9ZA 3R44A 4LVCA 1HYBA 3BTUA 2A1IA 1VSQA 4Q6WA 2PV0A 3TBKA 5BQ3A 4Q15A 3Q9UA 3OF5A 4DL9A 1II0A 5FH9A 2UUBB 3E82A 1WU8A 3GDOA 4KGZA 1WZIA 2OQRA 4Q7MB 3PDJA 3ZHYA 3R75A 3VPBA 2V5VA 2I03A 3B1JA 4AJNA 1R5JA 1VL5A 3RK0A 1U0LA 2J4FA 1X1EA 4NC9A 1JKJA 3CZ4A 3IUSA 3QKTA 4N7BA 1NFRA 2FQYA 3AWIA 2RCYA 4F96A 1DJLA 1H8HD 1NFFA 4QPZA 4RK5A 1ZXXA 4B8YA 2NV6A 2P2ZA 4NJMA 3TYXA 3AZQA 3DVAB 3IS3A 4OU5A 3VAAA 5CFLA 3FF4A 4OREX 2I3DA 1VOTA 2WF8A 4B2PA 4WZAA 4HD8A 2ZZKA 3P4XA 1EXVA 2DETA 4PANA 1CW2B 1U9IA 1UEIA 2AZMA 3I2FA 4HAYA 3UJCA 2UXDB 2X4GA 1M7HA 1RYZA 2GWHA 4RQAA 1SKUA 2I7TA 3NJRA 3WWPA 2Z6AA 4NCIA 1IVYA 3A1CA 2Q0SA 1GGVA 1X13A 3ABOB 1Z13A 3DEIA 3IALA 1TOAA 3JVDA 5K6AA 1G21B 2E7ZA 1E3LA 4P3YA 1NBME 2YN2A 4AYTA 1KJJA 2HJRA 1W5FA 2CYAA 2FEXA 1OYWA 1R7RA 4JUCA 3ZCPA 4LE1A 5AI5A 4HYEA 4BTLA 3FDIA 5EQTA 3CUUA 2R6HA 1FA9A 2ZRMA 4HX2A 4N9WA 2BW0A 3DHNA 3KR2A 2QWXA 4MJXA 1LLUA 2JFUA 3OTWA 4NBNA 4NR0A 2FB9A 3DKIA 3RBVA 5G1PA 4RHCA 1TECE 3ZQJA 2JLAA 2NU6A 5IEBA 1UZUA 3OY7A 4EI9A 3AVXA 4AX8A 4HNUA 2MT9A 2G5PA 3H65A 3I2YX 5ITZA 5KTSA 5DGCA 3B82A 5HKKD 1SB8A 3H2KA 5B6JA 1KYIA 3BH0A 4HWGA 3PHJA 4EHFA 1MHTA 5BYBA 5M3BA 3SEAA 4Y2HA 4MQ6A 2QNBA 1MPXA 1V16B 2ZYTX 3KAPA 5KJ1A 2ST1A 5L6MB 1S8AA 1LH0A 4EDHA 5PNTA 4P4NA 5DP2A 1C4XA 1HDEA 1T6BY 4B80A 3T06B 4CF7A 3GFBA 2PS0A 2CBZA 2H92A 3J7AC 3EQ9A 4C7JA 2FRDC 4CTMA 4PZPA 1IHUA 3SHQA 3TVYA 5HK9A 5BNTA 1Y4ZA 3LY9A 4IH1A 1VECA 1G5QA 2JF0A 2OY0A 4RPHA 1EFPA 5AK6A 1RYEA 2YVKA 3P9SA 3IIJA 4BNTA 3Q3EA 4F1WA 2OZVA 1FNDA 3H3XA 4K6MA 4P33A 3RTDA 3JQPA 1N9GA 1NZFA 2DZDA 5CB4F 1E1LA 5B3JA 3WGZA 2REOA 4W63A 3VMFA 3K8YA 5AUQA 2G70A 5P21A 2A1TS 2MIIA 3PLNA 5EJIA 4NENA 4F3CA 2FKNA 2UUPA 3D7LA 1OA0A 3EEIA 3I23A 4IV0A 4MA4A 3RK1A 4RPJA 2PGDA 1C4OA 5T5QA 1A9XA 2DFKB 3F5SA 4GX5A 1VHWA 3B51X 1DBQA 3BXZA 1V8FA 1GL7A 3I58A 2VBIA 4E11A 4L9AA 1U6JA 2JLXA 3TRIA 3R2JA 3SSAA 3BXPA 4Q05A 2HMVA 2ZR7A 2G1PA 1R4MA 3EWSA 4FYYA 1C7IA 1CQJB 5JFGA 3KDAA 4I19A 2H1FA 2O7NA 3MRVA 1MIOB 1IG3A 1W85A 3G8YA 4GKVA 3QJ5A 4DSTA 3R3HA 2BHNA 3HJCA 4V0KA 4BUZA 5DP1A 4JFAA 1JQ3A 3GD5A 4LY9A 1R0ZA 4MS1A 3MQFA 5KVCA 2LXNA 1VHJA 2NQ2C 3GEEA 3LT5A 4QOIA 3X0DA 1OI4A 3DUFA 4MW0A 3OQIB 1R0RE 1GKIA 1WB6A 2YWDA 3RR2A 4A8JB 2RGNA 4HH3C 4D0NA 1I1HA 1HDZA 4B2YA 3FZNA 4U2CA 4M1QA 5CG2A 1CLUA 4ADSG 1PJAA 2WD8A 4U7GA 3SP1A 1AF7A 2DBVO 5AO9A 5C31A 3S1AB 5KSOA 3LPLA 4ESVA 4E21A 4IW3B 2RB4A 1KZGB 3QUSA 1MB9A 4UJ3A 1PEDA 1XL1A 3P9KA 1C3VA 1GPYA 2W8BB 3QLUC 4LYHA 4UE3S 5E9AA 4POAA 2XY4A 3T5AA 5KQRA 1C7FA 4H6XA 4BYMA 4IIXA 3U4AA 3QMPA 4KOEC 1M0SA 4A03A 2Q5OA 1YTLA 4HXGA 2C7RA 3RPEA 1WVMA 1EJ2A 4BIMA 2JAXA 3ROPA 2PMCA 3Q6IA 1SCBA 4UPVA 3ASYA 4AS3A 2DUWA 3LCVB 1M6VB 1XCGB 1VJ0A 1FFAA 2UVPB 2VDMB 3JR3A 3L8DA 1N0UA 3UWPA 4Q4JA 4D8WA 4MI6A 2C54A 3FOWA 2QL9A 5KMGB 1J0CA 3IERA 1II9A 3LTEA 4GBJA 4OOEA 4Z54A 3HLYA 3PX2A 4OHVA 4W6ZA 2FPWA 3OC6A 3DXFA 4PNZA 2V7TA 3A11A 3K1AA 5A5DA 2I1QA 4HYQA 2XB9A 2ZJOA 4KVZA 2FUG6 2D7DA 1CT9A 1X14A 1QH0A 2VAXA 2YJTD 1ISRA 2ZAMA 2ZJ4A 2E4WA 3DZ8A 3HRHA 5EHGA 5I48A 1JIIA 1G2IA 2IIBA 1N9ZA 4HN2A 1H9CA 2I2WA 2CL6X 3DOFA 2J85A 1RM0A 5JXGA 2W6JA 2JHAA 3KU1A 3ZK7A 4LGVA 3LAWA 5JC1A 5AT1A 1SR8A 1X9HA 3T5PA 4PGAA 2QBYA 4FDLA 3X3HA 1M1NA 3IAS6 3OFJA 4P54A 2IYYA 3DDCA 1SELA 1H22A 3H5RA 2IU4A 5BSRA 1HWYA 1ZD8A 3M34A 1MLDA 1PFYA 3NBXX 3RJ5A 3ZWMA 1OH7A 4RTRA 4H0FA 2CVZA 4RORA 1HC7A 2YJZA 1CZLA 1CUDA 1WABA 2EFHB 3GRFA 3LZCA 4LC9A 4P81A 3TFWA 4YRAA 2YFHA 1VE7A 4Y9UA 3ZGXA 4UXHA 2B99A 4QLBA 4ECEA 4Q7JB 4WKBA 5BYAA 4HNTA 3HBFA 1ZOOA 3KZ1E 2OK7A 2X3FA 2YWHA 2IYAA 1Q50A 1KZYC 1TVKB 2ZAOA 4DUGA 2CV0A 4BRSA 4MYSA 3K9FC 1WHSA 2GZ2A 3BZBA 3ZWXA 1L5VA 3NYQA 3ES9A 5EWLA 1CQIA 1ESNA 1OC2A 5F77A 4YUWA 1FQWA 1KSFX 3HWRA 4RU1A 4OQXA 4OJMX 1RXEA 3GLIE 1PVOA 4A6DA 3ZNPA