5JECA

Apo-structure of humanised rada-mutant humrada33f
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
228
structure length
226
Chain Sequence
IGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTEGTFRPERLLEIAQNRGLSGSDVLDNVAYARAFNSNHQMLLVQQASDMMVELLNTDRPYKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
total genus 85
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jecA00
3B82A 4M9ZA 5C4MA 1NNEA 4XVRA 1T91A 1DEKA 4MRPA 1N2CE 3A1TA 4HDQB 3BH6A 1N5JA 2F6RA 4PO1A 3QXCA 1Z47A 4M0LA 4MKHA 4Z1MA 3WHLA 2KB0A 1G8HA 4A15A 3CKLA 4BPBA 5GJBA 2ECKA 2ZJYA 1HE1C 1LW7A 3RRMA 4LJ4A 1SGWA 1E79A 4UKDA 4LYAA 4YDHB 1L4UA 2XJ4A 3ZZ0A 1TUIA 2FFQA 1K5GA 5HTKA 2AFIE 1ZD9A 1CR1A 3THYA 2GHIA 3TVDA 3Q5DA 1PUIA 1O87A 3HWSA 3R9IA 1MO6A 4ESVA 1PV4A 4EJSB 1RRGA 4D2IA 1FFHA 2R9VA 1QG2A 2F55A 3DOFA 1NBME 4MKFA 2IYQA 2PBRA 2WPDA 2VPPA 3CR8A 3IQWA 3UATA 2WKRA 4MYTA 2RHDA 2HLDA 2JIZA 4PO8A 4KHZA 4URVR 5L3QB 1DTSA 3CX6A 2W6JA 4QNMA 4HLQB 3ZVRA 2ZS7A 3CF0A 4JIMA 4JL8A 3AVTA 3HR8A 2FFBA 2XNDD 4LV8B 1F2TA 3B9QA 2V8OA 1Z5ZA 1T5IA 2IYSA 1DBSA 4M1YA 3CNLA 3AF3A 1N6OA 3JVUA 3IBGA 4LCBA 5LB2A 721PA 2GXUA 1G20E 3KZ1E 1E9FA 1IXRC 2KBFA 3IKJA 3ADDA 3O8CA 3EWAA 3QNUA 2EFHB 2BKEA 1XZPA 2OXCA 1E2MA 2WKQA 3OIUA 1E69A 4WZAE 3T34A 4B6FA 2PCLA 1Z06A 4NP6A 3TJZA 5AJYA 4ZDJA 2PEYA 1KI7A 1VHTA 4NCHA 1ZC4A 4RZXA 4IRUB 1KSJA 1VIAA 3I8XA 5B2ZA 4NYMR 1X8JA 4JLVA 5JECA 1VG0B 2G83A 4DLTA 4B3DA 1KJYA 3AGQA 1G7TA 3O8BA 2I3BA 2REOA 4LHXA 1E9RA 3L8YA 3KQHA 1KMQA 3UXMA 5L3SA 1A4RA 3P4YA 4D4MA 1E2KA 3VU9B 2NO6A 2ZRGA 5JJIA 2P5SA 4O2LA 2AD5A 3UG6A 3C4JA 1VG9B 1GUAA 2A5JA 4GMXA 2JATA 5BXQC 1Z08A 4MGIR 3KQUA 3VR3A 1XTQA 4ERNA 2CVHA 4B74A 3CW2A 1M7HA 1P5ZB 1DAIA 4DLYA 2XSZA 3OZXA 3PIRA 3KJGA 3EZ2A 1GNQA 1GWNA 3IO5A 3IBYA 1E32A 2QQEA 4TLAA 4AWXA 2FSIA 4RKFA 1FP6A 3U4QA 3SHWA 4Q4JB 1G3MA 3QKTA 3EZ7A 3WP1B 4B75A 1RFLA 4JLOA 3PUYA 4UNRA 1T3LA 4G0NA 4BRWA 4NYIQ 2ZE6A 1ZVQA 2RHMA 1XTJA 3BH0A 1R5BA 3EXAA 5J4HA 1HQYE 1UEJA 3FHOA 2CHQA 2V7QD 3SYLA 2F1JA 4ZDKA 2X2EA 3FHTA 3UWKA 3B1YA 3QPWA 2EW1A 4JBYA 2F7SA 2OFOA 2VTKA 1YRAA 2XOKA 4I1OA 5DISB 4Q1FA 3I32A 3ND9A 4MRVA 2JJ2D 2D2FA 2OE2A 1II0A 4LJAA 3W5IA 1W2GA 4CIDA 2VP5A 2QPAA 1ZM9A 3C5CA 4QBIA 2QENA 3QPUA 2J0SA 4BLSA 4GOKA 8OHMA 5IRCD 5JSZB 1G1MA 4G01B 4XIGS 3I1FA 1W49A 2F1RA 4ACAA 2QN6A 1XMIA 4N3NA 3KTAB 2O8EA 3B8HA 2RGEA 1KTVA 1US8B 4PQRA 3UG7A 2CHVA 2EWWA 2HCJB 1UDWA 2FGJA 1LNZA 3P26A 1A2BA 4DVGA 3FDIA 4LBWA 5EXXA 3KXIA 1G6OA 1G19A 2KJQA 1QDEA 4D82A 3B1VA 3CIOA 2W2VA 2YHSA 3FMFA 2ZJ8A 4IKEA 4JLMA 3A1VA 4TLEA 3KQKA 2QE7D 2YOHA 2QMEA 4C7OA 2KBEA 2QAGB 3PEYA 1KY2A 2J45A 1XEXA 1UFQA 3AM1A 1ZC3A 2QT1A 2GAAA 4CEJB 2EU8A 2FSHA 2IS2A 3EW9A 1CJUC 1OKKD 3ASYA 3I73A 3TSZA 3GLIB 3KB1A 3CLVA 4TL9A 3K70D 1G7SA 2CVFA 3K1JA 3L0IB 4HB4A 4DEYA 3K9LA 1ZMXA 3CR7A 2GJ9A 3QKRA 3THWB 5AUPB 3OFNA 1NBMD 4PPQA 4WA7A 5L8VA 1D5CA 3DEFA 5DN6A 3BS4A 1OB2A 4BLPA 5AJZA 2FZLA 4TWZA 3R8CA 4F38A 3H0KA 1K8RA 5B57C 5CK4A 2YWHA 5KO2A 2W6IA 4A2WA 2VHCA 2O8FB 5J4YA 2VF8A 1IN7A 1M8PA 2Z5FA 5AWFC 3TUZC 2G1JA 2O0JA 3W8RA 4ZO4A 1NMXA 2YWFA 2JDID 4PAQA 2O52A 3RRYA 3BD9A 1KDRA 1LFDB 4PR0A 3UKDA 3OESA 1FNNA 4LDJA 2FA9A 3I92A 1N5IA 1TUEA 1G7CA 1D9ZA 1Z0IA 3QF4A 3DVLA 4Q48A 2WSSD 3LQQA 1PLJA 1TF5A 2YWGA 2QM7A 1BYUA 3B1WA 3MCAA 3RSLA 5JMTA 1DVRA 1FQJA 2BMFA 4B32A 2B7BA 3PFIA 4KFUA 2FPMA 2PH1A 2ZJAA 4V0KA 5IDVA 2Y8EA 2NOAA 1FTSA 4AYXA 4M53A 4OBEA 2C9CA 2EFDB 5FBQB 2OFXA 3D6TB 4DLZA 3V4FA 3AUYA 3SJCA 5L3QA 2QROA 2Z4SA 2ZRAA 1EFHA 1G8FA 1YZNA 2HYDA 4AK9A 5KU1A 4IEIA 1GKIA 1N0WA 2O5VA 2C96A 1A7JA 1ETUA 4MKIA 4TL8A 1S9DA 2UKDA 2VEDA 3HU2A 1LF0A 4DLVA 4PHGA 1GL6A 1QZXA 1CBUA 4RZ2A 3GLGA 5FBWB 3A8TA 3MWLA 5EE1A 2ZSFA 3QPVA 1DG1G 4L4UA 5D3MA 5EJEA 4IOJA 1N6HA 1YJ5A 4TMVA 1EGAA 3X1DA 2IL1A 3LNCA 4KAXA 4PC2A 5LB4A 2DPXA 4TMKA 5EE9A 3KJEA 2EWVA 3LDAA 4WAUA 1COWD 3RAPR 2GF0A 3VR2A 621PA 4CDGA 4EJSC 4DT1A 1RYHA 4BFYA 1NLYA 3LO5A 2IF2A 2JAQA 2QTVB 2ZRLA 4A2QA 4BFWA 1AS0A 1AZTA 2VHQA 1QHYA 4J0QA 2ZUDA 1TTTA 2WWIA 3BERA 2GILA 1SKYE 4QM6A 5DO9A 4ZKDA 2O8BB 3ZZTA 2V6IA 4EQ6B 2G0TA 2IBMA 4HAWA 2ANBA 1XP8A 4XOIA 1C9KA 3U6BA 2ZR0A 4CT4B 1AQUA 5C46F 3PUZA 1KGDA 1U8YA 1GRNA 1HYQA 3I8SA 2A7QA 2ZJ2A 5CDFE 4CEHA 5KHOC 3E1SA 3KKMA 1OH7A 3MUFA 4PC3A 1R8QA 1L2TA 3J81k 1Q3TA 3OIVA 1ONBA 1XRJA 3GJ0A 4N0EA 3VKHA 3NH6A 3R7WB 1G18A 1P7CA 1OHHD 1ZU5A 3OE7A 2IWRA 3Q7QA 1OH6A 4QGFA 2C98A 3MMPA 2EYUA 2OAP1 2H7VA 2AWNA 1NY6A 3K0CA 3KKOA 2LKDA 4Q47A 3ZIAD 1JB1A 2VO1A 1ZM4A 5FTLA 1AQYA 5DIFA 2BC9A 2ZI5A 3C7KA 1Z29A 2MMGA 4P32A 3AGPA 4QOSA 1P9RA 2RKOA 4JVMA 1UJ2A 1U0JA 1UKEA 2WV9A 2D3WA 4OQXA 4RCYA 5FR1A 3T06B 4A82A 1XXHA 1Z83A 5CIWA 2RGDA 3IDQA 4ARZA 3DDCA 3QXXA 5AJXA 2Q9AA 2ZI6A 1JAHA 1E2PA 3R9XA 1PUJA 2WWXA 2L0XA 1P3JA 5J40A 1XMJA 3FFBA 3LWNA 4UNQA 5CM9C 5BW8A 4ZCLA 1HEIA 2ZPTX 5CYOA 5JWOA 5L3RA 3RANA 1I4DD 3Q5EA 5P21A 1S3SA 4H9GA 2GF9A 4KVGA 1OSNA 1R5NA 2IHYA 4CW7A 4LJ8A 1P9WA 4JL5A 5FOWA 5DI9A 3C8UA 3N2EA 4Y0AA 2WWHA 4DWJA 1W0KA 1GZSA 2WBLC 5J4KA 4TQ9A 1U81A 2JGNA 4CGZA 1K6MA 2D4HA 1RC8A 4Q4AA 4RVCA 2GTPA 3B5JA 3E2IA 1SVLA 3I3SR 3I5YA 1ZJ6A 3WYFA 4P31A 3ZQJA 2E87A 4B43A 3L8ZA 4TMTA 4IDQA 4BZQA 4G3XA 3G0HA 3Q9LA 3VNUA 1AS3A 4BFXA 1TL7C 3AKCA 1II9A 2GCOB 3MWYW 1IOZA 2IWHA 2CL7X 2GVZC 1E1RD 1NKSA 1NSFA 1TU4A 4V0ME 4C0SA 4TYYA 2XX3A 3BJIC 2O8DB 1U98A 4D4LA 2RGBA 2HLDD 3FE2A 2W6JD 2RGGA 4Q1EA 4PFSA 2HJVA 1K5DA 4GSYA 2OSBA 1E6CA 1L4YA 1FX0A 3Q85A 2R6CA 2G0NA 4Q00A 1MABB 1NN1A 1IN5A 4LHWA 2GZHA 2QSYA 4JVLA 3TMKA 3T1OA 2FJUA 2MMCA 4I1VA 1T3HA 4IXMA 2XTZA 4W5JA 1E2FA 3NBYC 1YVDA 3KQNA 1NVVR 4MUAA 2F1HA 4C2UA 3FTQA 1SVMA 2H17A 3PUWA 1E2QA 2BCGY 5AK0A 1OB5A 1JR6A 1GSIA 4B3BA 1VYVA 4TT3D 4XJXA 3FKSD 4US0R 3WP0A 4BQSA 3AP2A 3H2YA 2QAGC 1KKLA 1XPRA 5TB5A 2GK6A 3RS7A 5FUXA 2IT1A 1GRRA 3PEUA 1VHLA 4GNKA 4IVRA 4Y0VA 2QGNA 1S4QA 4WZBE 1UBFA 4UQOA 2FFAA 1VCOA 2Z83A 4K46A 2QL6A 1X3SA 1N6IA 4B3GA 2XXAB 4P3YA 5JJKA 4IDOA 4RD2A 5HCNA 4BUJA 2GNOA 4Q7KA 4D25A 3TGPA 1G5RA 2R65A 1UBEA 2XSZD 4Q4HA 4UXJA 3T61A 5CK5A 1UKZA 4TLBA 2CEAA 1YZLA 2HV8A 3EARA 1N6PA 5AJWA 1NVWQ 5KNBA 3W6PA 1JAIA 5B30A 2IS6A 3FB4A 1IJEA 3UMSA 2XB4A 5B58C 1W46A 3EPLA 4DRZA 1ESMA 4B3XA 2PEZA 4E09A 3EWSA 5JHGB 1LF5A 3NBXX 3WBKA 1E2LA 5EP3A 1RRFA 1IBRA 4IOLA 3FMOB 3G82C 3OIYA 421PA 2G3YA 2X2FA 4UNSA 4NDZA 2C9OA 4QL3A 4RD3A 2FPLA 3R20A 1E99A 5JEDA 2XOKD 4QM7A 1TMKA 2H18A 4UJ3A 1Z6XA 1AKYA 2GXQA 4JYBA 5C18A 1YRBA 2Q6TA 3EC2A 1EX7A 1Q1QA 1XD2A 4GFDA 4CVNA 2ASEA 1W1WA 5DE3A 3W3ZB 1KZ7B 4PPGA 2H8KA 2WIAA 2EQBA 2O8BA 1T0HB 3A1SA 1ZIPA 2Z6VA 3QF7A 5KDOA 5FPHA 1KO1A 3B1ZA 3GEIA 1KNXA 1Q22A 1SKYB 1ZNYA 2IHBA 4ASUA 3CNOA 5J4VA 1IAQA 5FPSA 1E2GA 4DDVA 3EAQA 5GJCA 3RLFA 2G77B 3EPJA 2DCUA 2QP3A 3LBIA 4EPVA 3NEYA 1KI1A 2DFTA 3VAAA 4HZUB 3HU3A 4YMVA 2RAPA 3GLFE 3SDZA 2IYYA 4OHWA 3T15A 1RJ9B 1OIWA 1FP7A 3IEVA 1WF3A 2V3CC 4RZ3A 3ZZUA 1T8TA 2AWOA 4DDTA 5IT5A 2VHTA 2B8TA 3LVQE 4TL6A 3DM9B 3NG1A 1CLUA 1NKTA 2R44A 4BZPA 4QBHA 1ZAKA 3N5CA 2WVJA 2CL0X 2BMJA 4R7ZA 2IYXA 3F3YA 121PA 3K0SA 5C2JB 2WWWA 1TX4B 1MKYA 1P75A 2BEKA 2ZRMA 3W34A 2FWRA 2HUPA 2PT5A 1GRQA 3TIFA 2A5DA 1DELA 4U7DA 2AHOA 1II8A 5HE9A 4FMCF 4TTRA 5FOSA 4B73A 2F43B 3HR7A 5DN6D 1VDZA 4IVPA 2KWIA 4II7A 3NDPA 4PPFA 1KO7A 3GJ4A 1Z0KA 4YXWA 1AM4D 2FNAA 3H1TA 5EE5B 1I4LD 5FOTA 2W6ID 4TMXA 2B21A 2ZITA 4MGKR 1BO6A 3A58B 4N1AA 1L7VC 2NQ2C 1ZYUA 3OEHA 5GJWC 2IX3A 3LV8A 4MYHA 3KXKA 3A1WA 3B13B 4L5BA 1EFRA 3EZFA 1L8QA 3QKUA 2H5EA 1SXJD 1U8AA 3CB4A 3U3JA 5J5CA 5SZIA 3O8RA 3VHXA 1M34E 4RJLA 1SVIA 2C03A 2FV8A 3AF2A 4NU0A 4TQUS 2E1RA 1TADA 5FBVB 1QF9A 3T35A 2WOJA 4KU4A 4GP7A 1ZCAA 4P4TA 3IHLA 1G9XA 3IHWA 2QG6A 3A36A 1CKEA 1M7BA 3P20A 1E0SA 4KITB 3EA5A 1VG1A 3KKQA 4FCTA 1P2TA 4LOAA 1XTIA 2GEDA 3ZVNA 1U8ZA 2BBTA 4QHYA 3WMGA 1FUUA 2QTFA 1HTWA 3CX7A 5E3HA 4FINA 1XTSA 2CLSA 2BBSA 2GJSA 2WSMA 3QKSB 4HB3A 3L82B 3U44B 1OXSC 3P4XA 5FOXA 2O0KA 3P1JA 4YQFA 2GJAA 3VR1A 1HURA 2BOVA 3K0FB 4CEIB 3ZS8A 2ZRFA 3U7GA 1W0JA 5G41A 3A1UA 4LSGA 4KYIB 5FR2A 1U99A 2X8AA 2QMUA 4Q9IA 1UAAA 3RC8A 3KUDA 5H68A 3KB2A 1FUKA 2VBCA 3QG5A 4AG6A 1YR8A 2CJWB 2OESA 3RS4A 2QRZA 3DZDA 4RD4A 1V43A 2CNWA 5IK2A 4M2LA 2HXSA 4JJZA 4PC6A 2YNMA 2IUTA 1D8TA 4LZZA 1I2MA 3NXSA 3OAAA 4TZ6A 3RHFA 1CRQA 4W5WA 2QT0A 1J99A 4PAMA 1IXZA 3AF1A 4JBXA 1HE8B 2PZEA 3DPUA 4LHVA 1MO3A 5UKDA 4A92A 5F9FA 4X8MA 1P2SA 2OEPA 1Z6GA 1H8HA 1TF7A 2V9PA 2ZTSA 3GCGA 1KMHA 1WQ1R 2QTHA 2RGXA 4LHZA 4Q1CA 3PJRA 1Z6TA 1KI2A 4LRWA 2CLDX 4M1KA 4HAZA 4GL2A 5HKKA 1B0UA 1EWRA 4DDUA 3VX3A 1Z63A 1A2KC 1OH5A 1MH1A 2FEOA 1VMAA 1JR3E 1E9CA 3DOEA 2AN9A 2NZJA 4FWIB 2Q3FA 4KODA 4P4UA 4WIAA 3D31A 5DHAA 2AK2A 3S1AB 1TPZA 1E2JA 1CJTC 5BWMA 2ZSAA 1YZTA 1ODFA 1WA5A 1R10A 5JBQA 1QG4A 2VLIA 2ZJ5A 3W8NA 3WMFA 4NKRA 3QXSA 4C3ZA 3BFXA 4BEBA 4MDEA 1YR9A 5DLQC 1SVSA 1GNPA 5H8WA 1FL9A 3F0TA 4D81A 2ZM5A 4D80A 2FPKA 1LTQA 3U3RA 4NTZA 2NTYC 4AURA 1FNMA 2BVNA 1KI9A 1U9IC 4IFBA 2GDJA 4KLNA 4P33A 1ZD8A 4QNRA 1D2EA 3QBTA 2EFGA 3K9GA 3QEOA 2RGNA 1E3MA 1E0KA 2FU5C 3LX5A 1AZSC 1Q57A 3SQWA 2P6UA 3BIFA 3DO6A 3KKPA 1N6RA 4MRNA 4Q9JA 5DGXA 3FHCB 2WJHA 2CK3D 5HPYB 3ASZA 4JLJA 1ELOA 1AGRA 3QSYA 3AVYA 2ZSEA 4AI6A 2IYLD 5BYKA 3QQ5A 1NN5A 4AKEA 4C0QC 1SQ5A 2DBYA 2Q21A 1X1RA 1JBKA 2IXFA 1E0AA 1W47A 3NBFA 1ZUIA 2PLRA 1F48A 5GVSA 1XMSA 2QORA 1XEWY 1GVNB 3SR0A 4KLZA 3QOFA 1G291 2C95A 2HF9A 2UZIR 2ZAMA 2OLJA 1E2HA 4JLNA 4GOXA 4LV6A 2ZR9A 1W0KD 2HF8A 4C0HA 5CITA 2IYRA 2V1XA 4DBLC 3U7HB 1I4TD 2REBA 4ZV4A 2NIPA 4NE2A 3UK6A 5KSZA 2BCJQ 1RIFA 1G8PA 2ODEA 3AP3A 4JT4A 4LJ5A 4OJQA 3M6AA 2FE4A 5TMPA 3IUYA 1W4AA 3GLFB 5AUNB 1C4OA 2ZEJA 4BEJA 4LYJA 2QBYA 2NPIA 4I1UA 3LH5A 4KFTA 4WXRA 1GP2A 1LY1A 1KI6B 2FSGA 2ORIA 3ZD6A 1NVXQ 4PO9A 2FOLA 3SFVA 4GP6A 2A5GA 3CF2A 2OT3B 3DZ8A 1CULC 5FTJA 4EPRA 4A0RA 1HH4A 1VYTA 1W44A 3PEVA 1GM5A 2O8CB 2EVWX 2ZYWX 4EPYA 4EIWA 2WZQA 2WWYA 4HATA 5E95A 1N6KA 1CJKC 2FG5A 1E98A 2FX3A 2XNSA 3ZGXA 3CO5A 3SEAA 1F5NA 4E5UA 4BLRA 3CZPA 4FMBB 4L9WA 4OK6A 1BIFA 3T12A 4B3FX 2C2HA 3Q8XB 4URUR 4DXAA 4MGZR 1YHNA 2RCNA 1UF9A 3FGNA 4NMMA 4X8OA 1EG7A 3QI2A 4BRUA 1ZRHA 2VHUA 1GOTA 1RKBA 2HCBA 3E70C 3M0EA 3CRW1 4KBGA 3WMEA 4B2LA 3W3AA 3LLUA 1ZM2A 4DSOA 4U02A 3RVBA 1CP2A 5KTYA 4IOMA 3VMFA 1ZINA 3VQTA 2BBOA 4OQNA 3RS0A 3K0AA 1FZQA 1SVOA 3ADKA 2J3EA 4XD7A 4BFUA 1XD9A 3EIQA 1YQTA 4AKIA 1DAMA 2X1VA 4XSGA 1XTKA 3U3MA 1DAHA 3PQCA 5TVKA 3TK1A 5L3VA 1M7GA 3SC3A 2UZ3A 4L9SA 5JFGA 4NYMQ 4KV9A 1G3RA 4E03A 5HCIA 1XDBA 1XB2A 2HT6A 5DI3B 4A1FA 2OBMA 4D4KA 5H70A 4LYFA 1G8GA 5EE0A 3SOPA 1R8SA 3KL4A 2IC5A 4HAXA 4KBFA 2FZ4A 5CM8B 1M74A 2XZPA 4NCJA 1JXOA 2CE2X 4B3CA 3EG5A 4EJSA 4JSTA 3IIJA 5CB6A 4UNNA 2PX0A 3JZMA 4Q9HA 2QU8A 3K09C 4JLAA 2VP4A 3LLMA 5FI0B 1W36D 2K5UA 5KSOA 1JR3D 4M8NE 3WHKA 1GDDA 2Z43A 3K70B 5IHPA 1CIPA 5F9HA 1CJVC 3L2OB 4TLDA 5E4FA 3AVPA 1P2UA 4YMTA 4FD2A 2IF0A 2ANCA 2QI9C 4KCGA 4KSCA 1UADA 3CWZA 3DM5A 1R2QA 2LKCA 1E2EA 3THOA 2JA1A 2GESA 2RGCA 2NO1A 4YC7A 3W90A 4OHVA 1KJWA 1EX6A 1V5WA 1E4VA 2R8RA 4TL7A 5FBRB 2WMOB 3TR0A 2AXNA 4A8JB 5KSPA 1CS4C 4PANA 3WYAA 1TAGA 3AEZA 2OCBA 4ASUD 1XMVA 4S35A 3A37A 3PUXA 1IONA 4PSKA 5JCZA 3AVOA 1VCIA 4O2RA 5KDLA 4F4CA 4Q7LA 4EPTA 5JZVA 3IIMA 5JI3E 2ZAOA 2JLUA 1QHHB 1XD8A 2W2XA 3SZRA 4EPXA 2HEIA 5G3ZA 4ZI2A 1ZUNB 1TNDA 2JEOA 4HSEA 2CE7A 3S1AA 3M1IA 5CJPA 3VU9A 1NG9A 3ZH9B 3TUJC 1IY2A 2HYIC 3DMDA 2B7CA 4A6XA 4B33A 1IM2A 1S1CA 2GRJA 2OZEA 4PQFA 1SXJC 4JL6A 3WXMA 3LY5A 4TMWA 1JEEA 4M9QA 1YR6A 1FQKA 2H1LA 1Q1EA 2XJ9A 1LVGA 4KXFB 5CYPA 5G3YA 3L0OA 5J4LA 4GOJA 2IS1A 3FWYA 4FCVA 3LVRE 4A9AA 1XFAA 4Q4JA 4RFSB 2Q3HA 4AC9A 5DHFA 1N6NA 3NHAA 2AD1A 5KNDA 2PX3A 3X1YA 4D0GA 1Z6YA 5JRJA 4JYCA 2J7KA 2F3TA 4Q66C 1ZU4A 1R6BX 4W5HA 2A3RA 4LPSA 4DCNA 1BKDR 1UKYA 4IEEA 1ZNZA 1KAGA 3SNHA 1DO0A 4Q18A 3QVUA 4V0LA 4CYMA 3TLXA 3ZYCA 1OXXK 2W0MA 3FKQA 2JJ1D 3AH8A 1HUQA 3CX8A 4ZIRB 1G16A 4A4DA 2HJGA 1NJGA 3GJ3A 1ZM3A 3OEHD 3QG1A 2MSDB 2A30A 3LBHA 3OEED 3PITA 1GNRA 3RS5A 3L43A 2AL7A 3LA6A 4W7SA 4C0JA 4DIEA 2WJYA 2OV2A 1G4UR 4NYJR 2V55B 1EXMA 4DJTA 4US1R 4DC9A 1KJZA 2BMDA 4TSFA 5JSZA 5C1BA 2LWIA 3SFZA 2DYKA 1R0WA 1CRPA 1Z0DA 4QKQA 1GKUB 1IY1A 4LJ6A 2ZI3A 3GLFA 1KSHA 2DWQA 2TMKA 1UBGA 3BB1A 2C99A 5D3QA 2AKAB 2F9MA 4Z8XA 3KTAA 3O8DA 5AJVB 2OG2A 4UJ5A 1S9HA 1US8A 4ITRC 4Z1MD 3AQ4A 1OFUX 1QBKC 4BECA 2CBZA 4BLTA 3ZLJA 2PCJA 4BGDA 4LI0A 1C1YA 1E79D 2ZE7A 3LRPA 2JLXA 1E0JA 1E2IA 2XZOA 1AJEA 2V1UA 1GIAA 2QM8A 4TLCA 6Q21A 1B23P 4KFSA 1AN0A 1XZQA 3BGWA 1OJLA 3HPQA 1HV8A 3MFYA 4IHQA 5FTKA 3AKYA 3T1VA 2V7QA 3BBPA 4V0OA 3SHFA 2QAGA 4GT1A 1D6JA 5KNCA 4JLBA 3WRXC 1DAFA 5AR1A 1CF4A 4CEJA 3TW8B 3LD9A 2DB3A 2WPDD 4HUTA 3ZVMA 1F2UB 2ZU0C 1DADA 4YDSA 3GLIA 3R8FA 2WMNB 3VR5A 1N0VC 4P0TA 5EUMA 3CPJB 1YU9A 2JIZD 4DCUA 5LPNA 2FFHA 3AB3A 1MR3F 3GEHA 1VIYA 3FPAA 2XEXA 1W4BA 2CNWD 3U3KA 3V9PA 5IK2D 3THWA 2QMOA 1LB1B 2GCPA 1NMZA 3OAAD 1W48A 3K0AB 4DEXA 2J7PA 2ZYUX 3NDBB 3SBEA 1XTRA 2OBLA 3ZJYA 4URZR 1SXJE 4LBVA 5EE3A 2JLZA 1P2VA 2GXSA 2O8FA 5JHHB 1H8HD 2ZXUA 2C77A 1Q3HA 3TE6A 3RRZA 1J70A 4CZ2A 4AKHA 1X1SA 1YZGA 4FW9A 2OHFA 2IYTA 1BMFA 2AR7A 3MGCA 3THYB 1FPMA 3W6NA 2WAYA 4K8OA 4M21A 2A5FA 4X8HA 3Q3JB 1X86B 3TAUA 5JS8A 4RCZA 1SVWA 1FW6A 4QJ4A 3ONWA 3I4LA 4PZZA 2JLQA 1WRBA 3RYTC 2H57A 2IS4A 3NC1C 2XGJA 1W4CA 3CONA 3PVSA 1TEXA 4B6EA 3K9HA 2JLVA 2NO9A 3PUVA 5LDDC 3LW7A 4F7WA 5CLQA 5FOUA 5AUOB 1J2JA 2OBNA 2ORWA 5FFMA 1PZNA 1NBMA 4DSNA 1F2TB 1CR0A 3N70A 4FI3C 3GLGE 4WW0A 3WYGA 5JRZA 1DARA 4A2PA 1LS1A 4AG5A 1P62B 3BWDD 3LX8A 3AKDA 4MRRA 5JEEA 3D7MA 3VTKA 2J1LA 1TQ6A 1X6VA 3QXJA 1KKMA 4FMDF 4BWYA 1UKVY 1YR7A 2CCJA 4OQFA 4AIIA 1KSGA 4C9BA 1KDPA 1ESNA 1FMJA 5LD2C 3FFAA 2BDTA 4C0BA 3EX7C 4KFRA 4L16A 4PHFA 1S8FA 3CZQA 3MSXA 1D2NA 2XB2A 2GETA 2GXAA 3KFVA 2QUZA 5L3SB 3LXRA 1ZIOA 4I81A 4NYJQ 1VCNA 2YVUA 2C78A 1H65A 3MRSA 4NPHA 3QEJA 2CHGA 1IY0A 4OQMA 4EFMA 4DKXA 3RWMB 2W83A 3K70C 1G3IA 3U7FB 2ONJA 4BFZA 1AA9A 3ICQB 2GKSA 3EC1A 1E1QA 4EQ6A 2IEZA 3G5UA 1OFHA 4JLPA 4A0GA 2YYZA 5SZKB 3BFKA 5GVRA 4OYHA 2VP0A 1OXTA 2EFEB 5CB8A 1EFCA 5JCPA 3U4QB 4D4JA 3VNVA 1Z3IX 5KPDA 2OM2A 4LGMA 1NL3A 4R2HA 2FMXA 1ZNXA 1RRPA 4DZZA 3U61B 4HLDA 2VH5R 4L8GA 3SJAA 1G5PA 1VKJA 1AK2A 3GPLA 3BB4A 1JJVA 3MJRA 1AKEA 1J7KA 3PR1A 3R7WA 1Z0JA 3UMFA 4A8JC 1E94E 4PZLA 1QHNA 5DH9A 3X2SA 4EUNA 1S0UA 1CXZA 2BIFA 2ZSBA 3KKNA 4C4PA 1XCPA 3BOSA 1COWA 2QZ4A 5FUVA 1HT2E 2ZRDA 5DNYB 3LFUA 1XXHE 1ZW6A 3C16C 3P32A 4HUQB 4EKDA 1VPLA 1KOFA 3B7GA 2W00A 1KY3A 4F91B 1A5TA 2FSFA 2ORVA 1RZ3A 3CH5A 4A36A 4LBYA 3N2IA 3HYTA 1BS1A 5F3WB 2YKGA 2AFHE 2J41A 4LC1A 3OFND 4L15A 4MA4A 4TZ0A 3SI7A 2YC2C 1OV4A 3TH5A 1XCGB 1MRSA 2OLKA 3HP1A 4XD7D 1S96A 4M4SA 3DKVA 3RSOA 2YC4C 3HDTA 2OO7A 3RC3A 5CLLA 5B64A 4GDFA 4HAYA 2O8EB 2RB4A 2OAQ1 3EPHA 1CJMA 1DG3A 1JPNA 1P4SA 2GBLC 2A5YB 4NL4H 3TAHA 1NVVQ 2HDNB 1R5OA 1OFTA 4NCKA 1HQCA 3IPYA 1N0UA 3H84A 5BQ5A 3TRFA 4YMSA 5KOYA 5HZKA 2Z0MA 1A1VA 5EUQB 5KUTA 1AS2A 4M1OA 3TSOA 3ZDQA 4I1SA 4I99A 3FMIA 2WJVA 1OF1A 1WCV1 3EASA 3CRMA 1YZUA 1KYIA 2GA8A 4V02A 5CIQA 4E07A 4PPNA 1Z22A 4C7OB 3FYHA 1XPOA 3WNCA 1XEXB 4RY2A 3BB3A 3NHBA 4TN1A 3TR5A 3ZIAA 4TYPA 4D26A 4NBSA 4LUCA 4YMWA 2GCOA 1RRCA 2ZRNA 3CUEF 1JI0A 4US2R 3PEWA 3OHMA 3T1TA 2J0UB 4MYUA 2O8DA 4DB4A 3PG5A 4DDWA 1T6NA 2D06A 1Z07A 3QKRB 1RVDA 1NLZA 4NCNA 1SVKA 4LJYA 2NMVA 1G17A 2FH5B 1RYFA 1T5LA 1XJCA 4H1UA 4S2EA 2AK3A 2D2EA 1KDOA 3SU8A 1XCMA 1PLLA 3U60B 3B60A 3ZQ6A 1LV7A 1HA3A 5ELXA 4DLSA 3A6PC 1IJFA 4ZDWA 1MABA 2IUUA 5KPJA 4MUBA 2ZJOA 1H8EA 2WWGA 1NP6A 4C0KA 3KJIA 4KJZA 1P72A 1UDXA 1W4RA 3W5JA 4KI0A 4OKSA 3SE0A 2JCSA 4LX0A 4Q7JB 3MJHA 1SXJB 2DWPA 1TU3A 2CDNA 4GZMA 3TBKA 3AF4A 5BN4A 1X8LA 2Q3MA 3OIWA 2C8VA 2OCYC 2RMKA 2IYVA 4Q7MB 3QF4B 1CU1A 1Q44A 4KYUA 2YV5A 4YLGA 3GFOA 2EYQA 1U9IA 3X1WA 3RRNA 2AX4A 4G5SA 2DFKB 2YOGA 3K53A 1TQDA 2BJWA 2YZ2A 4KSBA 1E1RA 1R0ZA 2VIIA 3I62A 2D7CA 2FDCA 2XXAA 3EPKA 4ZKEA 4D6PA 4HLUC 3ICEA 5EXSA 1XEWX 1NN3A 5FUWA 4EDHA 1WMSA 3FMPB 2QY9A 3WNBA 3PENA 1YKSA 1MO4A 1TQ2A 2P5TB 1NN0A 2CCKA 1NI3A 1W5SA 3C14C 2DR3A 5FPYA 3F5FA 1KK0A 2FN4A 4JLKA 4HAUA 4QRHA 3U2QA 1OIVA 1FOEB 2REXB 3HJNA 4GMDA 4HB2A 4F93B 3GLGB 2WJGA 1Y3AA 3BXZA 3B6EA 2PMDA 3OE7D 5D3MB 5EZ5A 4Q19A 2QPOA 4I4LA 2ZIAA 3W6OA 2VSXA 4TMZA 3IO3A 4RSGA 5A5GA 3CPEA 3EA0A 4DUGA 1S2MA 4XSHA 4EAQA 1OXUA 3SN6A 2R2AA 2IYWA 4AYTA 4FMDB 4B2IA 1TEVA 3B1XA 3VHLB 5F2EA 2F3RA 2A9KA 1P9NA 2VL7A 2ATXA 3FKSA 4TT3A 4DT1B 2WM9B 4JKIA 2YINC 1JJ7A 1GILA 2XZLA 3TKLA 1SHKA 2FF7A 1KK3A 4ZI3A 2GWHA 1TQ4A 2IXGA 1WE2A 1T3SA 4Q1DA 4OQLA 2ZRJA 1NRJB 1NJFA 4A0HA 3ECCA 4TSFD 1QVRA 3TSWA 4LC0A 1PVOA 1MOZA 5FTNA 2WWFA 3UWOA 4NCIA 4URYR 1DPFA 1DAEA 4DCSA 1XF9A 5G53C 1U0HC 5HZHA 4LYHA 4C0LA 3PCRB 4CEHB 1JNYA 4AY2A 3IQXA 4O25A 3SJBA 1W7AA 1R0YA 2ZANA 4W9MC 3MLEA 4DSTA 3QBVA 4G5GA 2G88A 2OCAA 1LS6A 4HZUA 2E9SA 3IILA 3VKGA 5CDFA 5E7JA 4PX9A 1YZQA 3LXXA 4QXAA 2WJIA 1RJ9A 3CRVA 4BFTA 3CWQA 5JI2E 3AKEA 3GLHE 2ZVQX 2ZVPX 2IA5A 4PHTA 2DY1A 4XTRA 4BLQA 2ODBA 3AVVA 2IEYA 4MYCA 3RS2A 1YE8A 2CMKA 1T4GA 4IDHA 2W58A 4MDFA 4HUQA 2ZE5A 2UVQA 4DHEA 3K9NA 2IUSA 1KIMA 2ZRIA 2J5XA 1R4AA 2J0VA 1XXHB 4XH9B 2ODWA 4ARZB 4H1VA 2X77A 3EIEA 1YZKA 2F43A 2IW3A 2VYFA 4ZPXA 3T5DA 2WAXA 3RWOA 1Q1ZA 2SHKA 2J7PD 2R6GA 1JEDA 4FMCB 4JJKA 4QBFA 1KK1A 1JQLB 4RKEA 5BN5A 1EESA 2I4IA 2VHJA 2ZI9A 4GRAA 2PMKA 3NVAA 2RGNC 3DKPA 2OFWA 1JQJC 1Z8FA 4ZCMA 5DYIA 2I1QA 1CEEA 2GJ8A 4BLOA 2ZRBA 1Q21A 2J46A 2N1BA 4IDNA 5FL7A 4D0NA 3K09A 3SJZA 1E9SA 3QY0A 1W5TA 2AXPA 2QP9X 1BMFD 3KDSE 4M1SA 3W9YA 1N5KA 5BN3A 4Q4AB 4QG7A 5G40A 1NG1A 1GL9B 2YWEA 4M9XA 3B9PA 1OXVA 4PC1A 2BM0A 2BWJA 2ZE8A 2CXXA 3ADBA 1EFUA 1U90A 1QRAA 2XAUA 4IFEA 4RD1A 5FBLB 4TTQA 1IN4A 3UANA 1KO8A 2VQSA 2P65A 1JPJA 2F9LA 1SHZA 2ZS9A 1I2DA 2QNRA 2J0UA 1JXMA 2VP2A 2WHXA 3I5XA 2ZUBA 5A0FA 1HY3A 4DLUA 2G9NA 4OI1A 2ZRHA 4HAVA 3VR4A 2JLRA 2ZYTX 2BMEA 4V0MA 1DAGA 1ZD1A 4GI7A 4BE7B 5LD2B 2PT7A 3QKSA 3BFVA 1FX0B 1PLKA 5DSZA 3U44A 4Z51A 2VSOA 3A4LA 1OH8A 5C4GB 4CEIA 3K0FA 1NMYA 2BEJA 3BK7A 2W0SA 4FN5A 3BH7A 4PSAA 1HT1E 1FTNA 4R98A 2J59A 2P0EA 3C41J 1RPZA 3D3QA 4PC7A 3AP1A 4OI2A 4B47A 2LCFA 1ZCBA 4XWAA 4GBMA 4F92B 2KI5A 3AVWA 3L0PA 1SXJA 4MRSA 4ZDIA 3GP8A 1XX6A 2CJWA 4WZ6A 5KYKA 4G5RA 2J87A 3SYKA 2VF7A 5EP2A 1U94A 3TW4A 4ESHA 5BYJA 221PA 3CF6R 4B71A 4IDPA 3IEUA 3D8BA 3QJYA 2ZREA 4YMUA 1BYIA 1KO5A 4LPKA 3EZ9A 4IVQA 4LJ9A 5J47A 5K8TA 1KK2A 1ZBDA 4HI0E 1XEFA 3DL0A 3LQRA 4HEJA 4RZUA 4U00A 5EXTA 2C04A 4QGGA 4B2PA 3EIHA 2WIBA 1E1QD 2ZJBA 2NO7A 2GK7A 4Q5IA 1IN6A 2GAOA 2ZUCA 3V4RA 1KAOA 4Q1BA 4QFMA 4Q4HB 4FIDA 2WKPA 4TQAA 1BOFA 4Q9KA 3V00A 2D74A 3K0EA 3X1ZA 4B76A 2ZETA 1SULA 5TDHA 1GITA 5JWHA 4C0AC 1J8MF 1OPXA 2QQ0A 2B92A 4AYWA 4DIDA 3WY9A 1DS6A 1S1MA 3BC1A 3GFPA 4KVAA 3HYRA 2EFCB 3QENA 4PSVA 4WVFA 2OXRA 3E5HA 1JALA 3CM0A 4JSYA 2ZSDA 1T9HA 3RS3A 4DLWA 4JMPA 3AVUA 2H92A 1E4YA 1IHUA 4ABYA 1W36B 2IYZA 3MD0A 1XJQA 4CF7A 1E2NA 3WBJA 4M1WA 3VFDA 2NZ8A 1BH2A 3WRYC 4F4JA 2IXEA 5EQTA 3GJ7A 4DCTA 5FTMA 4QHSA 3TQFA 2XNDA 4X8LA 5TARA 2DHRA 4OI0A 1UM8A 5FPTA 2NPFA 3AV0B 3K8YA 3JVVA 4DB2A 4ON9A 5AUQA 4B48A 3C15C 1EFTA 3NH9A 3ETLA 1XPUA 3GFTA 2R6FA 1XD2B 2J9RA 1XJ0A 4QC2A 3A4NA 4C2TA 5TY0A 4G1UC 2J0QA 1A82A 3ZS9A 1VYUA 2CLCX 2FGKA 1WBDA 3Q7PA 4LK2A 4YXWD 4PTLA 4IXNA 2NGRA 2QSZA 3PV0A 1WXQA 2FEMA 1NIJA 4NONA 5JJLA 4GZLA 2ERYA 4XVQA 1GL7A 1WDTA 2VP9A 2OUKA 4URWR 2V4ZA 1KNQA 1Q1BA 1KO4A 1NY5A 1UEIA 2A2ZA 2BHRA 2GEVA 4JZKA 1EFRD 1Q20A 1ANKA 4DSUA 4O3MA 3F8TA 2W2TA 1NSTA 5ANRB 3MWJA 3ZD7A 4JKYA 5KSYA 2HT1A 2GZAA 4PZYA 2JJ8A 2MSCB 2D7DA 1E2DA 2JLWA 2KE5A 4OK3A 4NH0A 1KSFX 4MITA 5FI1B 4DCVA 4MH0R 4GPTA 5IF9A 1J8YF 3FOZA 4UXIA 4BFVA 2WOOA 4XWKA 4O0MA 2B6HA 3NWJA 1Q0UA 2CCGA 1OFIA 2H16A 2VP6A 2VSFA 3GLHB 3R9WA 1ZUHA 4AKGA 4A0FA 4QJ5A 4YONB 1E9AA 4QJ3A 1KI6A 4OL0A 4V0NA 3QE0A 4F4IA 5E7IA 3LW8A 5FOVA 4PHHA 3P27A 1E9BA 1II8B 2PJRA 4U5XA 3SQXA 2PLFA 3B2EA 1OLOA 3EZ6A 4Q1AA 2O8CA 2CK3A 1XBTA 1JECA 1UBCA 1RW4A 2BJVA 3H4MA 1G21E 3GEEA 2RH5A 2D62A 4ILEA 1NIPA 3ND8A 1N6LA 2Q0HA 1R0XA 1U0LA 4LV5B 2QAJA 2P67A 1W0JD 3L0SA 3QVVA 1Z0FA 2GVDC 2NO0A 4HYYA 3TQCA 1H8ED 1D9XA 4P4SB 2G6BA 4TYWA 2XTNA 3KQLA 3NIBA 3I61A 1G8YA 1GFIA 2JJ2A 4WXPA 3BE4A 4URXR 4NHOA 1FMLA 1OW3B 1AGPA 5KDDA 2ZYVX 4B34A 1CTQA 2ZQ5A 1G5TA 1NVUQ 2QP4A 3THXB 4Q9LA 3VX4A 4IOKA 2ZI4A 3K0CC 1E96A 1WP9A 3KX2A 1IXSB 3TUIC 1XU4A 2BM1A 2PZFA 2R62A 2I1VB 4XTCS 4Q21A 4CRWB 2DFNA 2IK8A 2ZI7A 2JLYA 3GMTA 3CRQA 1N25A 2PL3A 4Q01A 5M04A 5FPKA 4BASA 3OF5A 2ZRKA 1QVAA 3A4MA 4IJMA 1F3OA 2C5LA 2V54A 3IGFA 1Z6AA 5HKKD 4EFNA 3O47A 1R7RA 1NF3A 4HDOB 1F6BA 3B78A 5DI3A 1XWIA 4FWTA 1MT0A 2XTMA 2OILA 3KUCA 3LAWA 1ZNWA 4POAA 1GTVA 2GEUA 2GZDA 2ZROA 4ZCIA 1DAKA 4TYQA 2QE7A 4OHXA 1Z2AA 4Z8YA 3RNLA 1QHIA 2QRNA 4M22A 3AVQA 3GJXC 1N3BA 4MKGA 1MO5A 3SS8A 1F60A 4MGYR 1OKKA 4JLDA 4OHZA 1D2MA 3PXGA 2ODNA 1G3QA 3MG9A 821PA 1T0JB 3GJ6A 2DFLA 1M2OB 4DUGD 3AVXA 4DLRA 5TXGA 1GAJA 4IW3B 3REGA 5LBIA 5K8UA 1EK0A 1KZGB 4BZXA 3AUXA 2GJKA 3FVQA 4Z54A 1VTKA 1G64A 4FCWA 4TTPA 3JZAA 5FL3A 5HE8A 5HR5A 5JLJA 3U7EB 5FUYA 3TVTA 1E9DA 3RDPA 4BFSA 4N0DA 2BBWA 2N46A 5SZHB 1DOAA 1QHXA 3KFXA 1OYWA 1KMHB 3GJ5A 4G5OA 1AIPA 2ZJZA 4G5QA 3X1XA 1P60A 3LBNA 3MWKA 1UPTA 1IN8A 4RD6A 3T5GA 4A8JA 3M4YA 2O0HA 2Q9CA 1CR2A 1Q12A 2HXYA 2JDIA 3U5ZB 1ZP6A 1S3GA 5EZ6B 5GADl 1O3YA 4R2IA 1P6XA 1Z28A 1CR4A 4OK5A 1VG8A 5H1YA 4RD0A 1P73A 4Q02A 2P2LA 3T1QA 5F98A 3BAFA 1G41A 1QHHA 4M9SA 3UIEA 3KXLA 1KHTA 3CH4B 2WSSA 4MQBA 4ACBA 4K81B 3ZVLA 1G7RA 2V6JA 3REFA 4LY6A 3I72A 1GG2A 1JR3A 5E7MA 4DLXA 1XNJA 1ZM7A 2ATVA 4LHYA 2ERXA 3MAAC 4Q03A 5EP4A 3WNDA 1OE0A 4JS0A 1IQPA 4NZYA 2ZRCA 3NC0C 1OT3A 1EWQA 1N5LA 4FXPA 2ZR7A 1VECA 1Y63A 1W2HA 3KJHA 2A78A 1G3UA 1RE0A 4C30A 4EFLA 1G4AE 1X8KA 2ZU6A 4RFSA 2GBLA 2BKUA 4HB0A 2DWOA 1U2RA 3CRRA 1Z2CA 3TNFA 4B35A 4LBZA 2JLSA 2CL6X 2VA8A 2WJJA 2JASA 4R9UC 1OYYA 1NLFA 5FH9A 2GCNA 2Q9BA 1MRNA 1VCMA 4WOPA 4UXHA 4XVUA 5SZJA 1WB9A 521PA 1KDTA 1TF2A 4B44A 4ZIRA 4JVSB 1DO2A 4HLCA 2P6NA 3VR6A 4QGHA 3QUSA 2F1IA 5TV2A 1KI4A 3GJ8A 4XWOA 2AKYA 3NKVA 3CBQA 2OCPA 1GKYA 3BRWD 2VRWA 5FL7D 3Q72A 2YJTD 1W36C 4LJ7A 2P3SA 2QGZA 5JS7A 1M1YE 4LWZA 3UPUA 1J90A 5A4JA 2BV3A 4OI4A 3AF0A 2KSQA 5EP1A 3CNNA 3BORA 3RABA 4PXAA 4JT2A 3VKWA 3NTUA 1M6NA 4A6PA 5K8LA 2WICA 2ZS8A 4M1TA 3UMRA 3H86A 1G6HA 2QBYB 4E22A 2NG1A 3U3OA 1OIXA 2IYUA 4PQYA 2C9YA 3GLHA 2N42A 1E9EA 3SYNA 4AD8A 1WBBA 1QHGA 3HU1A 1QHSA 2B8WA 1MV5A 3DMNA 3NBZC 4EPWA 5CJ2A 3ADCA 1KI3A 1T8UA 4JVNA 4QHTA 2ZRPA 3GD7A 2RGAA 3GQBA 2QPTA 1OHHA 5K8IA 4NYIR 5EXPA 2PZGA 4V03A 1P61B 5DYGA 4D0LB 4Q4LA 1KI8A 2MSEB 3QXHA 4HZIA 2JJ1A 2P6RA 3GLIE 3DHWC 3NEJA 1DE0A 3B85A 2G1KA 5JWRA 1SKQA 2QA5A 4R71A 2PJZA 4P4SA 1PJRA 2Z4RA 2R6AA 3OEEA 2QMHA 4M1MA 4QGAA 4QBGB 4UNPA 3IPXA 4OHYA 3CPHA 4OJKA 1F2UA 4TYNA 2ONKA 3HPRA 3QIAA 4PAOA 3U6KA 1SZPA 2R6DA 2YOFA 4KO8A 4RFVA 2XITA 3C5HA 4HDCA 4HLUA 4JBWA 4CT5A 5GJVC 1Z0AA 3THXA 2X19A 2WTUA 3IIKA 4WBSA 3SBDA 2QEQA
chains in the Genus database with same CATH superfamily
3IODA 3HCEA 4JUDX 2HI0A 1IWBB 1L8AA 2CNBA 1RMQA 4MQ5A 4O2AF 3OM1A 4PRYA 1DEKA 3VPDA 2IITA 3A1TA 4HDQB 5ARDA 1E89A 4XCXA 1K6XA 4L02A 3N0XA 4QDOA 4YFVA 2GT1A 4M0LA 1AU9A 3WB9A 2O1XA 4BNFA 3U16A 5I7HA 4G4IA 1JQKA 3NNNA 3OZUA 3TIIA 4LJ4A 1E79A 4YB8A 1NQ5A 2J85A 2PS0A 1Z5PA 3UKJA 4MS4B 5FNVA 1L4UA 2OHIA 3WWEA 1HI9A 4KSYA 5GGYA 3TQIA 3SOZA 3TDNA 4OJYA 5EQJB 4I14A 1ZI8A 1MJHA 3KVYA 4GPEA 3THYA 1OFVA 3L6UA 2GHIA 1GTZA 1ULAA 2O8VA 4K28A 3HWSA 4I9FA 3RVJA 5IWCA 2J0EA 3PQ2A 4H60A 1Y9JA 5K3BA 1BXZA 3VH3A 4NVRA 4LC9A 4F2WA 4ESVA 1Y37A 4EJSB 3OZDA 3EXG2 2FW1A 1XNGA 3JQ6A 4LDPA 7MHTA 3B9BA 4MKFA 2AR0A 2WPDA 2XV1A 3CR8A 1F2DA 3IQWA 1FDOA 3D5TA 3PGA1 3BMCA 1RQRA 3RH0A 1HDIA 1U1IA 3AX6A 3H7IA 3QJ5A 1P0PA 4EUEA 1VKOA 2PVSA 5EJ2A 5L3QB 1S2IA 3FDXA 3CF0A 3OLVA 3AVTA 2H1WA 3QFFA 3E22A 4LV8B 1F2TA 4CFSA 2IYSA 1DBSA 5IN5A 2Z9BA 4EYQA 3HXOA 2Z6UA 4IS3A 3CNLA 1KOJA 1N6OA 1B6TA 1L5FA 3ZDYB 721PA 3DAGA 5JY1A 1EUQA 4QYMA 1G20E 1E9FA 1CHDA 1IXRC 4OP3A 4XKJA 3WKEA 4Y9TA 1ZZEA 2XWSA 3TNLA 4ETMA 3ERCA 1P8AA 4OMFG 2HNBA 4ZT7A 2OXCA 4YRPA 1JSXA 5JC8A 4L95C 3ZC3A 2M6LA 5LJIA 3R7FA 1KQOA 2PEYA 4R6WA 3TPZA 4RZXA 1ZC4A 4QUDA 3I2YX 4M8IA 4KG7A 2DERA 3GFGA 4N8SA 4B3DA 2DRIA 1IULA 1KJYA 3FM9A 3UTCA 3O8BA 1E20A 2JFXA 3C5EA 1RI5A 1Y1RA 3B2QA 3QBEA 5EHGA 4MKXA 1KMQA 1SG9A 1YR1A 2OHHA 4LQCA 4RM2A 4RYDA 2WYHA 3D0KA 5B58T 4HDRB 4ZQBA 3VMMA 4D4MA 5ITWA 4YI3A 1SQGA 2EQAA 5AMXA 1URPA 2HQOA 1VG9B 2IOFK 4TRMA 3A3KA 1QNLA 1K89A 2JATA 4UULA 2X76A 2Z2ZA 4MGIR 1YBHA 3I2IA 2DPLA 2O2YA 4GMGA 4B74A 2CC2A 4WLVA 4MB2A 1M7HA 1PG0A 1DAIA 3AFHA 3JW8A 3LOPA 3VKUA 4DLYA 5HS4A 1FSSA 4FW8A 3FWPA 4FXOA 4PINA 4EKYA 3EVNA 3IBYA 1D0SA 1FP6A 3EGDA 3WJAA 1JKMA 1M8KA 1XR3A 3AR6A 4BO4A 2Y92A 3OIGA 1SIOA 2ZCVA 1GADO 1E6MA 1E8MA 3PUYA 3WWCA 1DIAA 4FHDA 1NQWA 5LCXA 4KREA 2P2YA 1R0BA 2VK8A 1ENYA 4KO3S 4MVYA 4BRWA 2RHMA 2HIHA 1JDBC 1XTJA 4JI1B 4Z3OA 4AJEA 4NU6A 1R5BA 3SSAA 4IJKA 1V9SA 5A5EA 4ZVNA 3COJA 1NV8A 1KYXA 2Q2NA 5DJ5A 3C7DB 5K3EA 5DM0A 1WXHA 2X2EA 3FHTA 4I4CA 3GEDA 4PEVA 4JBYA 1ZOPA 3O4FA 3W1VA 5CTJA 3JVDA 3TTXA 4AJ9A 2YHUA 4K9KA 4HD8A 4EJMA 1CF2O 1YRAA 4H7KA 5DISB 1DT3A 4DA0A 5C32A 5CYFA 1GYRA 3ZQ4A 3ZNPA 2IQIA 3K9CA 2O2CA 1GR0A 3VR5D 1II0A 3SVTA 4X7RA 1ZM9A 3C5CA 1JBQA 4MB6A 4ARBA 2DEUA 3GVXA 4QOGA 2J0SA 4BLSA 4FE4A 1WDKA 2HSEA 2CKDA 3BEOA 4HR7A 1KARA 2QRHA 2XQJA 3GGGA 2XCIA 4QLOA 4BMCA 2CYBA 2OC4A 1ZJ4A 4YGXB 8OHMA 2QDKA 2WFMA 3FIJA 1RM3A 4N3CA 3RSZA 1Q0PA 3UA3A 4U2FA 3V8PA 3HBAA 3KOMA 1P6QA 2JI4A 2F1RA 3D43A 4EBBA 5BNTA 5CW1A 3ORYA 1M1YB 5F7ZA 3NTVA 3FUVA 2OCIA 4N3NA 2RCYA 2GZ1A 1KQFA 4PQRA 3KHTA 2CLOB 3ABRB 1QIHA 5LUBA 2WM8A 1KC1A 2ZWOA 1IOLA 1ACLA 1PEKE 5MHTA 2OVFA 3P26A 5ED0A 3VPSA 4DVGA 3C1AA 3CE9A 4IGFA 4I50A 4J9VA 1Q6ZA 5GONB 3FDIA 1G6OA 1PYDA 1WVGA 4KR6A 1QDEA 3PK0A 1P18A 3W2TA 1C29B 3H97A 2GN2A 2NO5A 1SCUB 3A9RA 4D0SA 4AJNA 5F12A 4TLEA 1IBLB 1F7UA 3H0EA 2NM0A 6AT1A 3P96A 2QL9A 3MN1A 1KY2A 2PZLA 3EW7A 3OM9A 4R7TA 5IW8A 3AM1A 2QT1A 1U02A 1GR1A 3DTVB 3PC8A 4CEJB 3PQDA 3EY9A 5CT4A 1B6SA 1H23A 5HJEA 4DA4A 2DC1A 1SXPA 1HXHA 1PTJC 1FUIA 1FDTA 4O2BF 3U4IA 3SZMA 3K70D 1G7SA 4PG4A 3FYUC 2Q1UA 3UOAB 2DBZA 5A9RA 4MV1A 1D1QA 4CGYA 1EUCB 1F0PA 3CR7A 4C4XA 2C00A 2FEAA 3P2IA 5AUPB 4UBKA 5BMOA 3N8DA 1PFQA 5KX5F 3ZDRA 2V6FA 1YAJA 2Q6LA 5JO0A 4FUQA 5AJZA 3NNDA 2OWEA 1Y6QA 4RKRA 3WIUA 3T5BA 1SD1A 5IBQA 3H0KA 5B57C 5K0LA 3CT4A 4TS1A 4KO1S 5ALZA 4A2WA 4UBJA 4QU9A 5BW4A 2ECQA 1ZH0A 1P7PA 4MGEA 1VBNA 4RSRA 3CY6A 4L3WA 2WU4A 2D2IA 5EKTA 1HYEA 1W2WB 3OJWA 5EWJB 1PR0A 4IDGA 3W8RA 3UGTA 3HYNA 4BLWA 1U0BB 4Y9SA 1TW2A 2C4NA 2IEAA 4IPTA 4E2WA 1F3LA 1Z56C 6NULA 1YJ8A 5JAMA 4CMBA 3WRYA 1FNNA 1L7DA 5FP0A 4RJIA 1UMDA 4NCXA 2BR4A 1D9ZA 1NP7A 3L4SO 3QF4A 4JJAA 3IE0A 2WSSD 3LQQA 4OXKA 2MR5A 5AOBA 4B6SA 3B1WA 3MCAA 3IEMA 1J0AA 1O6FA 1WM1A 1DVRA 2BZGA 2REQA 4XQCA 5LZ7A 4FNGA 4AJPA 4B32A 2DPGA 2A0YA 2FPMA 3U4HA 2QWXA 1CETA 2ZJAA 3CC8A 3HV0A 3HMQA 4NR0A 4V0KA 4AYXA 3AONB 5BSFA 2BGTA 4G56A 1ZH8A 2XAAA 2OFXA 3K1ZA 1R15A 4DLZA 4PONA 3IQHX 5L3QA 4B82A 3EHDA 4PCAA 1VI5A 3PFNA 5LP6A 4OLJA 1EFHA 2GSWA 4YJFB 1C41A 5E9WA 4IEIA 5EGNA 4L3OA 1ZGAA 2JFGA 4G9BA 1UXKA 2ZATA 1A7JA 1ETUA 5ED4A 3UGJA 4DLVA 2Q3LA 3D81A 4PHGA 3HFSA 4PG5A 3V46A 1YJCA 5EMLA 5LYJF 2O9JA 1CBUA 1PNTA 4IQ0A 4RZ2A 3EZYA 5A3SA 5FBWB 3UC5A 2FVYA 3A8TA 5JXWA 1FFAA 1T2AA 1A27A 3MWLA 3QU2A 1Z5OA 2ZSFA 3O26A 4ZWNA 4L4UA 1N4DA 2C97A 2GM3A 1HE2A 3E5NA 3T4EA 4AQYB 4CV3A 1YJ5A 1MN6A 4ROSA 2IL1A 1EE2A 1NW8A 3X1DA 2XYHA 3FBTA 3LNCA 2FPIA 3S2ZA 4QYIB 3KQVA 1IXYA 2HSGA 1W9HA 1YMVA 1U3WA 2VNKA 1FVHA 2YR0A 3KJEA 2JBAA 1NQUA 4WECA 3IUBA 3HO1A 4HXYA 1SB9A 4TKLA 2GF0A 1TGYA 2X8JB 4YI5A 2WVHA 2ZYDA 1OREA 3PLNA 3VR2A 2H5IA 3QTBA 4B7ZA 2XIJA 3LKZA 4CDGA 5JAUA 5A4MS 1NLYA 3FI9A 5FX2A 4Z4FA 3LO5A 2IF2A 3OO0A 3ZK9A 2ZRLA 4A2QA 4GKVA 1AS0A 4J2HA 4JUFA 1TTTA 4AJ2A 2GBCA 2ZUDA 3HWRA 4FJ2A 2WWIA 2X8BA 3BERA 3W78A 3WMXA 4DPKA 1VL6A 1DTWB 4I55B 4K86A 1T36B 5DNAA 2QXTA 4LFCB 4GQAA 1PHPA 2OCDA 4CT0A 4EQ6B 3OECA 4J0HA 4NLLA 1JT9A 3ONNA 1P8JA 3PWZA 4X94A 4AY3A 4CKYA 1IMJA 3AZOA 1NHGA 1WMFA 1S3IA 1DRJA 1ISGA 1AQUA 1XI2A 2YRWA 5EYPA 4YRKA 1KGDA 3H4IA 1HYQA 3OPYI 4WFJA 5CDFE 5EKSA 4YJ3A 4YECA 3RU3A 5KHOC 4CEHA 1O03A 3KKMA 1IE3A 1RWOA 4PC3A 3R5TA 2AZDA 2INGX 3PC6A 4HN4B 3LF1A 1L2TA 1UC5B 3OQIB 1Q3TA 2JIMA 3VPCA 5F3DA 2CLIB 1SA0A 1ONBA 2OKGA 2WKSA 1P7CA 4B3TB 1MC1A 4Y2TA 1ZU5A 1NW9B 3V4VB 1J0EA 3JQBC 1OH6A 2C59A 5JE8A 1LC0A 2DFVA 2HREA 1XL1A 2QG4A 4FYKA 1UC9A 3UWPA 2OAP1 3W8EA 1IJKA 2V0CA 1EWTA 4Q47A 4MS3A 4DV5B 1V16A 3ZIAD 2PO7A 2Z3WA 3WLJA 1DZIA 4CM8A 3A2KA 3FWZA 2D8AA 1PFUA 5BURA 1P81A 4Y6QA 3VR6H 2BC9A 4B4VA 3KVNA 2OXIA 3QYPA 2PH7A 4GGOA 1OZFA 4JD5A 4M7OA 3WQHA 1MX1A 3RUAA 3RASA 3UKOA 1EWKA 1GTG1 4MVJD 3ENWA 4B7AA 1CB7A 4IKPA 1KAEA 4RTMA 3IEXA 2RGDA 4RHCA 3E9RA 3TLBA 3IMCA 2H1HA 3O31A 4FZVA 1NURA 3PI6A 3QXXA 4KR0A 4OA5A 5GOZA 5AJXA 2Q9AA 2ZI6A 4CR7A 1BEZA 1KPIA 2W4IA 3PKIA 4NJMA 3FFBA 3LWNA 3UAWA 1MG0A 4ZCLA 1K1EA 1XQWA 2ZPTX 5K8JB 2Y0CA 3LL7A 1WMEA 2BTEA 2O3TA 4CMEA 2ZTUA 4H9GA 4PM4A 2GF9A 1GUYA 2FXVA 2HU5A 4TXLA 1OSNA 1R5NA 3F9IA 2YUIA 5KYUB 5CBPB 5DI9A 1SU4A 2IXAA 1V5GA 3N2EA 1UH5A 3RHZA 1H3EA 2QI9F 5J4KA 2ZK7A 1NDUA 2ZDGA 3EIWA 1ATIA 1M76A 5KYWA 4I4TA 1C1XA 1K6MA 2E4YA 2H1CA 3IHKA 3QVKA 3IA7A 4YUYA 1RC8A 4QWWA 3ORQA 4NMWA 4KXNA 1KR5A 5IH3A 2D0PB 5F77A 3RU2A 4BKRA 5L7WA 2GTIA 3O7MA 1YS6A 3WYFA 3G0HA 4IDQA 4G3XA 3ZDXB 1EFAA 2QF7A 1G8JA 4HNGA 3Q9LA 3STHA 1H22A 1IBMB 1AS3A 3CF4G 3JAKA 3KRTA 1W93A 4UUMA 1KVUA 4YCCA 2AOTA 2OQRA 2GVZC 3SMQA 1NKSA 1NSFA 4QXRA 3WGYA 3K8QA 4C22A 2QK4A 4IF6A 1QBGA 2JZNA 2WIGA 1VPEA 3BQMB 3FWNA 4Y67A 1BDJA 2JZOA 2RGGA 1ZIXA 5J2UB 2VJMB 2FZCA 4H08A 2IDZA 2XHEA 5B2EA 2F1OA 1K5DA 3R6TA 3KJQA 4CL0A 4X90A 1E6CA 5CDHA 1L4YA 4A1OA 5IFLA 1Z88A 1C50A 3DR3A 3I37X 3N58A 1YDMA 3CURA 2QYOA 2BUBA 3DZHA 3PTLA 4Q00A 1L4NA 3RFVA 3DMTA 2RH4A 3I34X 4B6GA 4LHWA 3HNRA 5AW1A 3ROMA 1SG6A 1Z4LA 3FR7A 2ZSJA 2VLBA 5IKXA 5JY6A 4W5JA 4J1TC 1E2FA 1YVDA 3I53A 1PJSA 3NXKA 1NVVR 1QOPB 1AQJA 4MUAA 2AC2A 1L5QA 4J0KA 3D7NA 2JGDB 3NDIA 5EWJA 2WUDA 4UTNA 4C2UA 3N2LA 3OU7A 3FBGA 1PIWA 2H1FA 4BP8A 2RIRA 4RTNA 2FWPA 4YEDA 2BCGY 4PHCA 5A0TA 2Y66A 3MGKA 1OTHA 4DBVO 1RYBA 3DCYA 4E2FA 2XQVA 2WD8A 3C48A 3FKSD 4PNHA 1NPTO 3OURA 4RIFA 4KIJA 4US0R 3DBRB 4ABTA 3BQNB 3USZA 4L72A 1ZSYA 1L9XA 2CV2A 4ZOAA 3PEUA 4Y0VA 4IVRA 4AO7A 2FZWA 1UBFA 4UQOA 3M9XA 1O9GA 1U6KA 3WMRA 3GL9A 1IVYA 4K46A 4NZMA 2XUOA 4X1OA 4EY3A 2AN4A 5ILOA 3QVMA 4P3YA 2OMEA 3OQ1A 1ECJA 2H4YA 4RD2A 2JI9A 3H3JA 2GNOA 4BUJA 1GNVA 1U5BA 3TGPA 5AK5A 2R65A 1UBEA 2XSZD 5F76A 3T61A 1ORIA 2A9QA 2EJWA 3LWBA 2CEAA 2HV8A 2P40A 3U31A 1RKVA 4DADA 5AJWA 3PQ4A 1ZD4A 4PCVA 5KNBA 1JL3A 2CXUA 2F8SA 3W6PA 1DU4A 3V4FA 1CY6A 4S1VA 3EVCA 4CTKA 4EA9A 5K8CA 2JHAA 2QD4A 4IFTA 4DRZA 3EPLA 3W5UA 3WL7A 4L4YA 4YV0A 3FNHA 3EWSA 3R2JA 1BWSA 3NBXX 1D2GA 2EW2A 3MTDA 1CEYA 4TLLB 3MCUA 1YI1A 3V3TA 4L5YA 1MD9A 3FMOB 4AMGA 2QQGA 2C82A 2X2FA 4UNSA 1B76A 4NDZA 3TIXB 3MA0A 3NOVA 2C9MA 4LZPA 1SZCA 2B25A 3E03A 4TM8A 5JEDA 3RVPA 1RM0A 2H65A 1O94D 2Z9CA 4QM7A 1XZMA 4UUBA 4EMTA 2BD0A 2H18A 4UJ3A 4BY9E 1TKAA 4DCPA 1NI4A 3IULA 1BHJA 1J7JA 2BUCA 5JDIA 3NPAA 2A57A 4MNTA 3GEPA 3LO8A 2Q6TA 1O95A 4ERXA 1EX7A 1EZ1A 2Z4TA 1XD2A 4CVNA 2QIOA 2ASEA 4ED9A 2WSLA 1S2NA 2YWBA 4C4SA 4JU8A 1U7XA 2A9RA 4GX5A 3A1SA 3QF7A 4B83A 1OTYA 3AI3A 4QPJC 4RZSA 2AG8A 3JYPA 3GEIA 5AXCA 1NNI1 1M6VA 5HP4A 4JYMA 3TTSA 1UKCA 5LQDA 2IV3A 4PWZA 5FPSA 3OX3A 5GV8A 5DV9A 2GGSA 1R0SA 3EAQA 3PF9A 4KIWA 4XB2A 3TLMA 2XQGA 5I3ZA 4UTXA 2G77B 2QP3A 3LBIA 4RZIA 3V2UA 4A10A 4RF5A 4EPVA 3VAAA 4BJ5A 4G5FA 1F51E 1MPXA 4W9RA 3C6BA 3RFCA 3ZUGA 1PJQA 3IJEB 5KQSA 4L4ZA 3GLFE 4ZVKA 2BMWA 2QUAA 4UOQA 4C6SA 1NPYA 3R5XA 1RJ9B 2UZ1B 1L4LA 1M1NA 3L7CA 3P0IA 1R6UA 4U39A 4UU7A 3VYWA 4JEUA 1NLUA 4MPTA 1EAMA 3ZE9A 3S7TA 1VA5A 4Y8VA 3GLVA 5LXTB 3NP7A 3WMWA 1K2WA 1ESEA 1JP7A 4F11A 5DK6A 5K3OA 4BN0A 4NK4A 2CXRA 4LECA 3SIXA 2Q0QA 4EHHA 1EDZA 4R54A 2WWWA 2EQ5A 3JD4A 1SVNA 2GLTA 2BP7A 4UVEA 4K88A 1A88A 3W34A 5DMXA 2HUPA 1GRQA 2MHCA 1SPBS 2A5DA 4X62B 4U7DA 3A4VA 3D6HA 5HE9A 3DT8A 1HRKA 5B7GA 3VR4D 1U8FO 1JWLA 4B73A 2F43B 3PDUA 3OU6A 4X1KA 1RPAA 1MUUA 4IVPA 2P6PA 4KIFA 1WOMA 4IICA 3GRFA 2E89A 1PWXA 1BN6A 5F5LA 3RLIA 1Z0KA 4WKCA 1F2VA 4RPLA 5IXSA 2FNAA 2XGOA 2WF9A 4DMFA 4L5CA 3L4JA 3MGAA 2Q3DA 2Z3ZA 4TMXA 3C39A 4D7AA 1KQNA 2XGMA 5DCUA 4DSZA 2NQ2C 5B4UA 1K63A 3S1LA 1FDSA 5GJWC 3HXKA 4I6EA 1C14A 3V1LA 3LV8A 3NBQA 5KYUA 4GO1A 1AK9A 2YFKA 3A1WA 3B13B 3B1JA 1U0EA 1C3OA 1GPJA 1SIUA 3FAKA 3QKUA 1L8QA 3O8RA 1AGNA 4FI3F 4HNTA 4IRMA 5BN3B 4QPZA 2APJA 1K4KA 1QGUB 4RJLA 3EAFA 4G9GA 3KZOA 1JHAA 3IUJA 1ZSVA 1SVIA 1B8VA 4HN9A 2FV8A 4AUMA 1RRMA 2PX6A 3VU3A 3ZTWA 2I2FA 3COPA 2YRXA 1TADA 5DEIA 2EG9A 4HQRA 5FBVB 2EOAA 4P4TA 4IWNA 3IHLA 1DWUA 4N6OA 5JVDF 1J97A 2FY8A 3CNHA 1ZO8A 2B1JA 1CKEA 2DF8A 1JQDA 1OVMA 3I8OA 3WOVA 1PJ2A 2ACEA 4LOAA 4LY0A 3SEQA 3ZVNA 1U8ZA 1UMCB 1V45E 2BBTA 1FUUA 2QTFA 1IQRA 5E3HA 3N76A 3DPIA 4FINA 1HTTA 3NANA 4HDMB 1QLHA 3DA8A 3TMYA 1LZLA 4L08A 3SK0A 4YCMA 1OXSC 2VNJA 2M32A 3JQ7A 3P4XA 4D97A 3HBFA 1HURA 4H59A 3M4NA 4C7KA 1MDBA 4CEIB 2C8LA 3CLUD 3U7GA 1G8MA 5G41A 1ZHFA 3L7IA 4LSGA 4GX0A 1U99A 2GARA 2Z6AA 4JELA 3OEYA 3CGWA 5HJ2A 1UBRS 2J6CA 3OPYA 2GBIA 3O82A 2FJPA 3DFIA 1XZDA 4JIGA 2W6MA 1K3TA 2AG6A 2DX7A 2W2KB 2AJLI 3DLCA 4W6QA 3CVWA 5E4YA 1IUNA 4IGIA 1RWVA 2ZBQA 4LZAA 4AG6A 3VC3A 2R96A 2V5UA 3ET4A 3ZZMA 3IUNA 4NJEB 5JDCA 2QRZA 1R37A 1LDBA 5IK2A 5AICA 1L7QA 4JJZA 4PC6A 2YNMA 4ZC8A 1D8TA 1JIXA 3WRXA 2VJOA 3WYEA 4AG3A 5IU6A 3KZKA 4K7JA 1RXSA 2AEJA 3KWJA 3CUWA 1HE8B 3DPUA 1WY7A 2LUOA 2QLNA 5UKDA 3RVSA 2J4FA 4X8MA 3WQSB 4GHWA 3ZOZA 4A92A 1H42A 1SIBE 3WLQA 3P19A 4D9FA 2JZCA 3GCGA 4HGZA 1BDHA 1KMHA 2QTHA 4Q1CA 5DM60 2VPWA 3O73A 4WZBB 4M1KA 4JT9A 3JY6A 4BTVA 4Q3DA 4INJA 2ZZMA 1TT5A 3FHLA 4GL2A 1VL2A 1WULS 1HX7A 5LQKA 5CURA 1B0UA 3HA7A 3L41A 4NBTA 1CZKA 3MQ4A 3ESXA 3U3XA 1W76A 1AKUA 1ZL0A 3FX2A 4EGAA 4G86A 3T95A 2YW9A 1I32A 1JR3E 4S1WA 2J9XB 3F2VA 3E1GA 5GPBA 4DNOA 3DOEA 3PBKA 3Q88A 5C7LO 1O0SA 3HH8A 2VSNA 3JCZA 1ND6A 1WABA 1ZJ5A 2JL1A 3O2JA 4IO0A 3S1AB 3ZKWA 3GIDA 1SQFA 1TPZA 1E2JA 3U81A 1CJTC 1XU9A 3CLKA 4EGSA 5FWDA 2J08A 5C9ZA 1U2GC 2VLIA 4FC7A 3W8NA 3KL2A 2K7ZA 5CP8A 1NUUA 3WLRA 9LDTA 4MDEA 2BFEA 3ANNA 5DLQC 1LBTA 2EDCA 1GNPA 2JEYA 5IC6A 1SBNE 2YZKA 3H9GA 2R1ZA 3WGUA 4D81A 2DWUA 3OP4A 2FPKA 1XUOA 2VHEA 4D80A 3U3RA 1Y5LA 5B12A 2W8BA 1V1MA 1K6IA 3DJYA 1KI9A 4RK7A 3NUQA 2ZAIA 4EB6B 4NFYA 3C70A 4ZOCA 4G63A 4QX6A 4EITA 3VZQA 2ETXA 3RFUA 2YY6A 4JR0A 2KPOA 3AR4A 2CZQA 1BW9A 2UUOA 3EZNA 4O4IB 1VPWA 4BX3A 1E3MA 2RGNA 3UH0A 3LUFA 2XD9A 3TZKA 5E1BA 3X1KA 4Y9UA 4CLRB 3SQWA 4H7HA 5LSAA 2QMYA 3WGHA 2HA3A 3BMQA 2VHZA 4HQLA 1RZRA 3AL0C 2AYXA 3ABZA 4JLJA 4UPVA 2R86A 1E4OA 2PKWA 2QD2A 4OMUA 4ZO6A 4BKPA 4EA7A 4H2DA 1T2VA 3BWVA 2TECE 3H2KA 1O97C 2IPLA 2Q21A 4RJ2A 2PMBA 4O33A 3FFWA 1W47A 3WV5A 4NJOA 2J33A 1F48A 2X9NA 5CPFA 1OASA 4XZ3A 5GVSA 2WVGA 1XEWY 1GVNB 3QOFA 2C95A 4KQ1A 2OLJA 2YFHA 1E2HA 2PKQO 4E0BA 4O4LB 1R16A 3QW4B 1W0KD 1QP8A 5TQ0B 3A3NA 3LPCA 5D7NA 3Q8LA 2V1XA 5IP5A 1V41E 1KGSA 5CTAA 3RHTA 1KYYA 3TLJA 4NE2A 3RS8A 2HFKA 3DZBA 3UK6A 4BO1A 1CYDA 4JT4A 1VPDA 3AOEC 3M6AA 4ZQCB 5A02A 2FE4A 3DAYA 2IELA 1DHRA 1P1BA 1X7ZB 1Z73A 3IUYA 4XEHA 5JCJD 2UUBB 3EEIA 2QS9A 1C4OA 5IF3A 5KTOA 1L5OA 2XOXA 3FOBA 3KT8A 4I1UA 2QV0A 1EVEA 4KFTA 3IESA 5K0NA 4YJGA 1FS4A 3QE2A 1KI6B 3HKDB 3B38A 4BNHA 2YMQA 1HKUA 1NVXQ 2RD2A 1T0IA 3CZAA 3HSSA 2IYOA 4NARA 3ADOA 5AW0A 4YK7A 5ITZB 1GZ5A 2A5GA 1EUDB 1ZN9A 4DPMA 4DR3B 3DZ8A 1CULC 3I5UA 4EPRA 4A0RA 5FFNA 1W44A 3PEVA 2I87A 3E2MA 5C3MA 1Z16A 1GM5A 3C3KA 1YCDA 3NYRA 3OHPA 3OF3A 5HIKA 3G7UA 3RUFA 3TAXA 2HRRA 1RLMA 2XNSA 3JASB 3CO5A 4KH1A 4KO2S 4NV3A 1F5NA 4ETWA 2IZ7A 4BLRA 3CZPA 4U1RA 3JD0A 1BIFA 3F98A 1ZUWA 4DXAA 4EO4A 4MGZR 1YTUA 3K6SB 1VKZA 4FFNA 3V1NA 3S7ZA 3X1JA 1O5IA 2I3AA 2YV3A 3FGNA 4Q39A 2ISSD 3BRWA 3LKVA 4ODIA 5CX1B 4CHTA 3OKCA 3T54A 2VHUA 2VUUA 1AY0A 4KBGA 4MK4A 3WGQA 2YN4A 3RVDA 3V8NA 4BGEA 4NWIA 2PD6A 4MW7A 2BTQB 3LHKA 3W3AA 2V96A 4J6FA 4OFWA 2Y76A 3DDWA 3G0IA 1CP2A 1U0SY 2VT7A 2QY6A 3K6KA 4L3VA 4U02A 5CA0F 2M2IA 5GM2A 4EX6A 5LU9A 2P75A 4Q7EA 3K0AA 1YRYE 2J3EA 3JWPA 4XI9A 2J6IA 2AMFA 4Z7NB 1Z26A 3HKEA 1M34B 4MQ6A 5CCDA 4R3NA 1RM4A 5B3KA 2H2HA 5LA6A 1CUVA 4WN3A 1B2LA 3EK2A 1DAMA 1K8ZB 2BE7A 3MCZA 4JU9A 4ZCTA 2P7IA 4XSGA 1RRVA 3LQ4A 4QQ8A 4RABA 1KY4A 2J5RA 1DAHA 4IIUA 1T8RA 4O2AB 3TK1A 4MHSA 3U3MA 1QFSA 3UV7A 2UZ3A 3TSYA 4V39A 5JFGA 4KRFA 4PTZA 1G3RA 2JGRA 5TPZD 2J30A 2H31A 3LGAA 4E03A 5HCIA 2QIPA 3R4VA 3WB1A 4QFCA 1XB2A 3W5SA 5DI3B 1UPBA 2CB9A 4ILKA 1KYVA 4MV8A 4D4KA 1LJUA 2NU6A 4ID9A 4ZCPA 2GZ2A 4DQDA 1OBCA 3PB3A 4P0PB 4DF3A 1ODIA 1R8SA 2OY0A 1P1HA 1XCJA 1N4AA 3T7CA 5EZSA 2CE2X 9GPBA 2AG0A 3EG5A 1Y6ZA 5CB6A 5JARA 2VC2B 1WXWA 1CX9B 2I2WA 2TMDA 2VA9A 1CY7A 4YWJA 2WHEA 1JQBA 4JLAA 1O77A 3LLMA 3T7SA 1ID1A 1JR3D 4EW3A 2PUAA 1RQGA 2RGRA 2J4DA 1EXVA 4YRRA 1H5QA 3HYLA 5AW2A 1PCXA 3I9OA 3SKXA 1XMQB 1CDEA 4AULA 3GDWA 1P9LA 4LA4A 4KCGA 1VP9A 4KSCA 5ENZA 3RC7A 3KLOA 3V3KA 4AVYA 3TRKA 3C2QA 1EWVA 5ER9A 2ZW9A 3PLAE 1K08A 4IR7A 4EHBA 3ST7A 3QWIA 2XUJA 4H6XA 2JRLA 1E2EA 2JA1A 5DTEA 1L8LA 1FBNA 3W90A 4IF4A 1D07A 1T9KA 4DQKA 2QLMA 5JXHA 1TDJA 5KS2A 2BFFB 1T1RA 1C9YA 4KC0A 1EX6A 2GD1O 3SQLA 3VSAA 1OWLA 3GARA 1U0GA 3H13A 5F35A 1Z39A 5FBRB 2O3JA 4CCAA 1QNFA 2D59A 3MXOA 2RDMA 3PGLA 4F2DA 3IMKA 3WO0A 2VT2A 2Q41A 4H4DA 3WYAA 1KVTA 2GLXA 2OCBA 1Q83A 3E5MA 3NUZA 1XMVA 3CRZA 4RF3A 3QEBZ 1PVVA 1IONA 4CDNA 2I71A 1IDOA 1T5TA 3AVOA 5DCLA 1ECCA 2X0JA 5ALXA 4ENVA 4WLNA 3AEXA 5LN1A 3OQOA 4I5EA 1V7PC 2PM8A 4Z9AA 2FRVA 2JGFA 1XD8A 1ZONA 2X0EA 2W2XA 3H1GA 3JQ8A 3SZRA 4FYVA 5CFMA 1R66A 1L8XA 1TNDA 1ZUNB 3NM6B 4YLYA 3S1AA 1RHJA 2WUGA 3NHYA 1NUTA 1PS0A 3RD5A 2Z2YA 1PP4A 2ZULA 3MM4A 4A6XA 4OGKA 1RWKA 1QUFA 2FEWB 2GRJA 2OZEA 2Y0EA 1V1RA 4KIUA 5JMOA 2PAFA 3QMWA 3UBTA 3LY5A 3IMGA 4ATNA 3GRPA 1SCQA 1SO8A 4KE8A 2OGTA 3M4JA 5E6RA 2ESRA 4J3FA 1YB1A 2PX5A 2J3KA 2QE6A 2R8ZA 4M9QA 3STWA 4BNMA 4KP7A 1FQKA 2BFDB 1N33B 2H1LA 1Q1EA 5ALPA 2XR1A 4WJZA 3H4TA 2BY4A 2BEUB 1K0FA 1O9HA 3L0OA 4WKNA 1VQ1A 2PGJA 3G1TA 3ROPA 4BKOA 3VJRA 1X0VA 2BPOA 2EARA 3LVRE 4CF6A 4OH7A 4Q4JA 2JFQA 2DHEA 3A6EA 1KIFA 4YYZA 1RCFA 3EG9A 4GOMD 1Y7LA 2AD1A 2PX3A 4HRYA 1A9TA 1E1LA 1WDLA 2ZWAA 4Y6PA 3KR9A 3X1YA 4BU0A 2J7KA 2F3TA 3Q7IA 2QGFA 2R66A 3BXXA 5T64A 4W5HA 3T0IA 3FBWA 5L95A 1Z25A 2NYVA 1YQUA 2RHOA 3I6ZA 4ZYYA 1UKYA 1CUIA 2VUHB 1ZNZA 3AZPA 4FBMA 4HEHA 1WB6A 4WXYB 3QFRA 4Q18A 1H69A 1UMBB 3MRTA 2RAUA 3FKQA 3N8KA 1QR2A 5TX7A 2ZQZA 4XDGA 1S6YA 4TV8B 1NE7A 3CX8A 4IL5A 5JXJA 3HKCB 1NW5A 5BSHA 3HNPA 4Z7QB 1CC1S 3KAKA 3MTAA 1ZM3A 3ITEA 4YXFA 3BGDA 3OEHD 2EEZA 2MSDB 2BHSA 4XD2A 4UTOA 3PITA 2DPYA 3WADA 4LG1A 1DXQA 2BELA 4J8PA 4F5ZA 1KYZA 3L43A 3LFTA 4W7SA 1W25A 4NNPA 1I3KA 4X20A 5DM2A 3HS3A 3L4EA 5H7XA 3V7YA 2OV2A 3PYXA 1NJ1A 1G4UR 5E9JA 2OWDA 4KEAA 4BO6A 3U9LA 5JYCA 3EHEA 3T3OA 4DC9A 5IJAA 3VVLA 1MA0A 3HGMA 5ALTA 1GAWA 4Q9NA 3JD3A 3L6CA 4MR9A 5CK4A 5E6SB 2ZI3A 5TPWB 1E3JA 5CB4A 4DIMA 3WFZA 5HG0A 4DW8A 4RTOA 1JKFA 3K4PA 3BB1A 2G4LA 1ZD5A 2C99A 2PNJA 5EHQA 2VDWA 4W4TA 4Z8XA 3E7FA 3KTAA 1HDEA 4F8EA 4Q12A 1S9HA 1US8A 1JE1A 2OHGA 1YJXA 3K5HA 2CBZA 1B1CA 2J07A 1ISFA 4KE9A 2IOFA 3DB1A 4BGDA 4LI0A 1E79D 1PJ4A 2ZE7A 1FP4A 2JLXA 1AJEA 4R3UC 4B2YA 1NVDA 3QH4A 3DF7A 3BIOA 2V1UA 3LCVB 3PJDA 4HEQA 4CMIB 1UOEA 4AQ7A 4QPCA 4IHQA 1OJLA 4OIFA 1HV8A 3LYHA 4RF4A 5A5FA 3AKYA 3I5AA 3Q2KA 5AI6A 4AROA 5FQNA 4UAGA 5I7EA 2QAGA 3ZE0B 4FQ5A 4GE3A 4GT1A 3HBLA 2EZ9A 5IBRA 4YO8A 3EXIB 4IIJF 3FPBA 1CF4A 3KR0A 3R3YA 4DOMA 3K6SA 2WPDD 3L7MA 4TS9A 4HUTA 2FQXA 2ZU0C 3KB6A 4IX1A 4RANA 1OROA 5DASA 2YZ7A 5LOVF 1GSAA 1DC4A 1N0VC 3D02A 1SUDA 4XLZA 5EUMA 4WFIA 1YU9A 5IDYA 4EG3A 4FHCA 4DZRA 1ORRA 2B34A 4MUMA 1MR3F 1Y80A 2WM2A 1VIYA 1Y6JA 2XEXA 3U3KA 2CNWD 1J33A 3LPNA 5LZ5A 1O8CA 4CKEA 4TV9A 4MKZA 2GCPA 1SEVA 1YH3A 4BTEA 5L45A 4RPJA 3MJTA 5DLEA 1W48A 3PT5A 4J43A 3ZWCA 1J5EB 2ZYUX 1YNOA 1NT2A 3SBEA 3WLLA 1VM6A 3ZJYA 4PX5A 4LBVA 3DE7X 5CX4A 4DHWA 2JLZA 1YGYA 4E51A 5JHHB 1H8HD 2Q4RA 3SS7X 4B31A 5K5EA 2O8FA 3KU1A 2C77A 2Z5GA 1Q3HA 3ESDA 4LQDA 3GF4A 4O2AA 5EPEA 3Q8KA 3GMIA 4CZ2A 3P94A 1N2CA 4RV4A 3F4LA 1ZGBA 2YH2A 5KJEA 2IYTA 2V7UA 3IDFA 1BMFA 4JLSA 1AZWA 4Y2RA 4L27A 2YJ6A 3CMMA 4J03A 1SK8A 1P80A 4Z7OB 2A5FA 3QYFA 4L9AA 2XCRB 2AW3A 4HTFB 1E5DA 3COSA 3EDMA 1GV1A 1ZRSA 4QJ4A 3TR6A 4B87A 2C2GA 2CNKA 3HACA 2PU7A 2IS4A 3NC1C 4DL9A 5A6SA 1N7JA 1BJKA 3CONA 1KETA 3UHPA 3LUKA 1TEXA 5EIOA 4B6EA 4DVJA 2XUAA 5DHRA 2NTJA 4F7WA 5FOUA 5ALSA 3BZUA 5C4IA 1O4VA 3NDJA 4MWTA 2C1EA 1NBMA 2PKXA 3ZWOA 3DG9A 3FF4A 2FLKA 3QFCA 1QR6A 1V5EA 4UCFA 4HGPA 1UK6A 1VIMA 4WW0A 4ZK2A 1OWOA 2CHUA 3DBVO 4M49A 4AG5A 3H75A 2NU9B 4PYJA 1N2GA 1P62B 5T4FA 3C4QA 4WCVA 4YP6A 5BW5A 5K0EA 3A1FA 3WGJA 4RDIA 4WY2A 3KV1A 4XB1A 3A7DA 1ZR4A 1JMVA 2CNOA 3QXJA 2WQZA 2Z8YA 4ZOLF