5JECA

Apo-structure of humanised rada-mutant humrada33f
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
228
structure length
226
Chain Sequence
IGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTEGTFRPERLLEIAQNRGLSGSDVLDNVAYARAFNSNHQMLLVQQASDMMVELLNTDRPYKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANHILAHSATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
total genus 85
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jecA00
4WAUA 3B13B 4RFVA 2KB0A 2YKGA 4MGZR 2VRWA 1NG9A 2JCSA 2O5VA 3IPXA 1SQ5A 3EWSA 5HTKA 2RHMA 2V7QD 4B43A 3VU9B 4Q03A 1FPMA 4M1SA 4M53A 3CUEF 1G4AE 2ZE6A 3SDZA 4IVPA 3CWQA 4ZI2A 4F4CA 1KYIA 5F9HA 1RVDA 4KVAA 2NG1A 3VNVA 2OHFA 2CCJA 5DI3A 1N5LA 1XEWY 1U81A 5IK2A 1Q44A 1VYTA 1SXJC 1K5DA 3K8YA 1DE0A 1U0HC 2GVZC 5C4MA 1HEIA 5FOUA 3NBZC 1KAGA 4BLPA 3NHAA 2IS4A 2SHKA 1YZQA 1P6XA 4FCVA 2PMDA 4RD4A 1OXSC 1BH2A 3U3RA 1NF3A 4KSBA 3TR0A 1WP9A 2RH5A 5CDFE 4KJZA 5BYJA 3B6EA 3WBKA 2BWJA 4JVMA 1RJ9B 1VECA 1JALA 1F2TB 3B2EA 2BEKA 3R7WB 3KQKA 2VP2A 1ZCAA 3BWDD 1IY2A 3M4YA 2PL3A 4GI7A 1KIMA 3SQXA 2GZHA 4ZI3A 1FTSA 2FMXA 3AVPA 1FTNA 1OH6A 1XZQA 4C0JA 1HE1C 3P27A 1JNYA 3Q85A 4C0AC 2P5TB 5JS8A 5KSYA 2XXAB 2IXEA 3P4YA 4TZ6A 5EUMA 2P6NA 5KYKA 4Q47A 2JASA 5FR2A 4Q48A 1R8SA 5AK0A 5CB8A 1SVWA 4UXJA 1OXUA 4II7A 4P0TA 4TL8A 1GWNA 2RKOA 3U3JA 4YMWA 5KDLA 1OIWA 5IDVA 4C4PA 1LNZA 1WRBA 3LO5A 2MMCA 4PHTA 3BORA 4ZDKA 1MRSA 4GL2A 1N2CE 3ADDA 2A5JA 2FZ4A 2ANCA 4KSCA 1JQLB 1K5GA 1COWA 4EJSA 1DPFA 2QZ4A 3U7GA 4HEJA 1GNQA 3FB4A 2CE7A 4G5RA 1NSTA 3L0IB 3O8DA 1N5JA 2GJ8A 1R0YA 2WJIA 3WMEA 2X77A 3TSOA 1XMVA 1AZSC 1KHTA 1KSHA 1E2FA 3BB4A 3K09A 3B8HA 3H2YA 3RNLA 4RVCA 3OE7D 3KB2A 1D2NA 1ZYUA 1KO8A 2DCUA 4JBYA 4GOXA 3MUFA 3ZJYA 5K8IA 4OQMA 4Z1MA 2ZI6A 2OM2A 2QENA 2FV8A 3U60B 4W9MC 3SQWA 4N3NA 1OIXA 3IBYA 3WP0A 3B9QA 2HF8A 3QXCA 4NDZA 4C0HA 2V3CC 5JRZA 3CRRA 1A7JA 4HLCA 4IVRA 4NONA 4HAWA 1KI8A 1KDOA 3A1TA 1U8ZA 1JR6A 2G0TA 3GLHE 1Z47A 4UXHA 2Q3FA 5BWMA 4LJ5A 2BKUA 1R0WA 1R5BA 3NBFA 1ANKA 1NIJA 1W4AA 1XF9A 3TAUA 5KTYA 3U6BA 4M9ZA 2CMKA 3VTKA 4RKEA 4BECA 5AR1A 4DLSA 2QT0A 3QXHA 3DMNA 4MRNA 4QJ5A 4HDOB 4AWXA 2FJUA 4M21A 4MUAA 1A4RA 4JLKA 3W5IA 4KV9A 4Z54A 1WXQA 4L5BA 3NH6A 1X1RA 2ZTSA 4EPWA 2QT1A 1XFAA 2EFEB 2ZITA 4QXAA 2RCNA 2ZI7A 4DSTA 4QC2A 3IGFA 2R2AA 5JSZA 1KI6B 2QTFA 4QOSA 3UKDA 3BERA 3WYAA 3AP3A 4MGIR 3W3ZB 1IY1A 3B78A 2JEOA 1FNNA 2ZRHA 3I73A 4D81A 3M1IA 1G4UR 4HZUA 3NHBA 3NEYA 4KODA 1Z5ZA 1IONA 2FX3A 4WZBE 2QM8A 3IDQA 5UKDA 1U2RA 3LW7A 2CNWA 4M1TA 2G77B 4NCJA 5CDFA 3JVUA 1NY6A 3QSYA 3KJIA 1M7GA 2FA9A 2GRJA 4QHYA 5JWOA 4D4LA 4M9QA 3K70D 2AR7A 2K5UA 1D9XA 1KNQA 4M1KA 2NO6A 4PQRA 2GJSA 3T5GA 4ZCMA 3WNCA 2HLDA 4OHZA 1BYIA 2OCPA 5CIQA 4ZO4A 1E2GA 1G19A 5SZIA 4E22A 1Z0FA 1S1MA 1JEDA 1PLJA 2AK2A 2HEIA 1SVIA 4GFDA 3A6PC 2EFHB 4U7DA 5TY0A 1NNEA 1O87A 2R6AA 2YJTD 3RS0A 1Z0JA 3OIVA 4YMSA 4A0FA 1W5TA 3ZVNA 2PH1A 2G1KA 1E2HA 2O52A 2GEVA 4P33A 3IIKA 2Q21A 4OI2A 2JATA 2OXCA 3ASZA 1AGRA 2QU8A 4B3DA 1H8ED 3UMRA 3ZQ6A 1Z07A 2A5YB 3S1AA 4B3GA 3PUWA 2V9PA 2IW3A 2FG5A 4KFRA 4OL0A 1T3LA 1P4SA 3RS3A 3ZVMA 4I81A 2QP4A 4MQBA 5IHPA 1M7BA 4CDGA 1GIAA 4F91B 3I62A 1XBTA 3RS7A 4LBWA 3SU8A 1V5WA 4V0NA 5TXGA 2PLFA 4JLOA 2ERXA 4B75A 4Q4JB 1G5TA 5SZKB 5JEDA 1SXJA 5AJXA 2CJWA 4DLRA 1QDEA 2H8KA 4XD7A 2YC4C 4PC3A 2JLVA 1IJEA 2VP6A 3U4QA 1AGPA 2J7PD 3BC1A 1GM5A 2QSZA 5TDHA 3IO5A 4DIDA 2WKQA 3THYB 1I4TD 3TQFA 1Z29A 4BFXA 4DUGD 1HUQA 1IXZA 2JLSA 3ZIAD 3EPHA 4M1WA 1DAFA 3FVQA 4YXWA 4TLEA 5LDDC 5GJCA 1XXHB 2O0JA 1QHGA 2DWQA 1OF1A 5JFGA 1MT0A 2YWHA 4Q7KA 3QKUA 1XTRA 1GKUB 3SHWA 2XNDD 3W6PA 3ADCA 1LS1A 3QF4A 2C98A 5TVKA 4G5OA 1C1YA 3GCGA 1JECA 2O8EA 2EVWX 4LHZA 1RIFA 1U90A 2VLIA 3B1XA 1QHYA 4BASA 3SFZA 5JECA 1G7CA 4BRWA 4HDCA 3D6TB 4JLBA 1KDRA 3R8FA 4K46A 2XZPA 1OE0A 2XTMA 2ZRCA 4DRZA 5H8WA 2XJ9A 2AWNA 3EZFA 2I1QA 4ACAA 2OLJA 1OH7A 2QSYA 1F2UB 4HB3A 3KQNA 5C46F 1EESA 1PZNA 4NKRA 4R9UC 1U98A 2VO1A 2C04A 4QHTA 4OI1A 1QBKC 1G5PA 3FGNA 4JJKA 4Q21A 3VU9A 2WWXA 5E7MA 2ZI9A 2OFOA 5AUPB 2PJRA 1W4CA 3EZ7A 3LFUA 1TF5A 3QNUA 3QXXA 3SR0A 4RFSA 4UQOA 3EZ9A 4NBSA 4ZDWA 2REOA 2VHCA 1W47A 3HU1A 5G3ZA 2XX3A 3QKTA 5FI0B 3TQCA 1G3MA 1VCNA 2BIFA 1N6PA 3EG5A 4PSKA 3R8CA 1E1QA 4DC9A 2ZSFA 2CDNA 3K53A 1A1VA 4C0QC 1DS6A 3QKRA 1JBKA 1R4AA 1M6NA 2YHSA 1BS1A 2ZYVX 3T35A 4KYIB 5LPNA 2EWVA 3BH6A 4GZLA 2AN9A 1WQ1R 4NCNA 4U02A 4GP7A 3KXIA 4Q66C 1G6HA 2UZ3A 2Z4RA 1KGDA 3C7KA 5J4KA 1F6BA 4ERNA 1F2TA 4U00A 3R7WA 1KY2A 2QPTA 3KX2A 5LD2B 4EUNA 2PZEA 2REBA 2CK3A 2QGZA 4D4KA 5HZHA 3GLGE 3SJAA 1XCGB 3VKHA 1G64A 3N70A 5HKKD 4Q4AB 4WBSA 2XXAA 4AK9A 4S35A 1XRJA 4L8GA 4RZ3A 3U7FB 2QRNA 4TQ9A 1FZQA 4GSYA 4H9GA 1DEKA 1OFUX 2WMOB 3EAQA 4QHSA 2JGNA 3CPJB 1U9IC 4I99A 4DCTA 1N6NA 2OSBA 5EJEA 4AG6A 1VG1A 3HR8A 3ZH9B 2ZJ5A 4LYHA 5DNYB 1BMFA 1AJEA 2IF2A 1ZNZA 2ODNA 1CEEA 1S96A 5DI3B 2BMDA 3FKSA 4BEJA 2FPLA 2ERYA 2AKYA 3WBJA 1G20E 3LAWA 5J4LA 4TT3D 2Z0MA 1X8JA 2GXQA 1Q1EA 3PIRA 4FMBB 3QEJA 3AVUA 4TTQA 1OXXK 1S1CA 4TYPA 1A2BA 1L2TA 3DM5A 1OPXA 3TK1A 1D2EA 4EKDA 5HZKA 2ZJ2A 3IO3A 1W48A 4M22A 3CRW1 1GNRA 1WDTA 1VPLA 1OYYA 1RKBA 1XU4A 2J0UA 2B8WA 2NO9A 1G9XA 2QMUA 2D74A 3PEUA 2Q3HA 2QPAA 1VHLA 4HAZA 4ZIRB 1SKYB 1XPRA 5KNBA 2QORA 3UMSA 4JSTA 3WNDA 5GVRA 2WPDA 2G88A 4LV8B 3U7EB 3OIUA 4TZ0A 3BH0A 3T1QA 2XNSA 1TAGA 3FKQA 2GESA 2W6JD 3KUCA 5DHFA 3T34A 1N0UA 4RJLA 2IYZA 4A9AA 5FBRB 4EPRA 4QBGB 2H92A 3B1ZA 3AF1A 4Q1BA 3AF4A 3FFBA 1W7AA 1NVUQ 3UIEA 4C30A 4K8OA 1XTSA 2ZS7A 1WCV1 2PT5A 3B82A 3MAAC 1N6RA 3L82B 1OV4A 3MG9A 4JKIA 2ONJA 4TSFD 2NPFA 3VKWA 4YDSA 3EX7C 4TYNA 2AL7A 3ND9A 3SJBA 4M8NE 1N0WA 1U8YA 1GUAA 4KLZA 2ZE8A 2B92A 3LWNA 1N3BA 4OQNA 2ZYUX 1E9AA 1QVRA 3BAFA 3IILA 4QJ4A 2H16A 1KI6A 4JJZA 4ZKEA 2RB4A 3GEHA 3KUDA 3Q5DA 3MFYA 4L9WA 3PQCA 1W36C 4O3MA 1E94E 2W6IA 4UXIA 2GF0A 5GADl 5EP2A 1TEVA 1JAHA 1R5OA 3ETLA 4LJ8A 4O2RA 1EX6A 2ZSEA 2IYYA 1GVNB 521PA 2F1IA 1J99A 5JJKA 4PC1A 1ESNA 2BKEA 1UF9A 2ZR9A 4MA4A 3GFTA 5FL3A 1IBRA 4LPSA 1OHHA 1XEWX 1T5IA 3LLUA 2NO0A 2ZSDA 2IWHA 1G5RA 2JLYA 2O8DB 1A2KC 4W5JA 5L3QB 1GTVA 1ETUA 1N6IA 3BK7A 3OZXA 3AB3A 2OBLA 3HDTA 1DTSA 2ZRKA 5K8LA 5FOXA 2C8VA 1KI2A 1XEXA 4NL4H 4MRRA 1N5IA 1H8HA 4TMZA 3D3QA 5SZJA 821PA 2CVHA 2IUSA 3VFDA 1OT3A 2XOKA 1W2GA 2HJGA 2QY9A 2VSOA 2QTVB 3B1WA 4LV5B 1S9DA 5J40A 1RRPA 2FSFA 4ESHA 1JXOA 1U99A 4C0BA 4BQSA 1XTKA 3H1TA 4OKSA 4V0KA 3UXMA 1UFQA 5TB5A 2B21A 4P32A 5FTKA 1BYUA 1NVWQ 2DR3A 2WAXA 1CR4A 5F2EA 2WJVA 4NYMQ 3MWLA 4I4LA 3VR5A 2AXPA 2FPKA 1CBUA 5JSZB 3FPAA 5KUTA 3O8RA 1R10A 4CEJA 4ZDJA 1CLUA 2XEXA 4PC2A 3UANA 4ZKDA 5DYIA 2YOHA 1QHXA 1YR6A 4AYXA 2BM1A 4QG7A 1L7VC 1XP8A 3QOFA 1R6BX 2ONKA 1X6VA 2ZRNA 2A78A 3KL4A 1UKYA 1HQYE 2IA5A 3LW8A 1JI0A 2FGKA 3ZDQA 4EJSC 5DN6D 1PJRA 3THYA 1RRGA 3GJ4A 4LGMA 3EPJA 1Z6XA 5JS7A 4MRSA 2DPXA 2ZROA 4QM6A 3HYTA 3OEHD 4LRWA 3A4NA 4XVQA 4B2IA 1ZD8A 4IEIA 1YKSA 4L9SA 1S4QA 1XXHA 3K09C 1IM2A 3KQLA 4OK3A 2IL1A 3PENA 1MABB 4RD6A 2R62A 1KJZA 3WRXC 4P4SA 1I4LD 4LHXA 1E9CA 4L4UA 4BZQA 1Z6GA 4IHQA 3DEFA 2AKAB 3MWKA 1VG8A 2F43B 3O8CA 1Z63A 2CLCX 4OQFA 2WIAA 1TQ2A 2IEYA 2PJZA 3QIAA 4RZUA 1T0HB 4F92B 2BMEA 2ZRLA 3A58B 2AD5A 3S1AB 4BFVA 2QBYB 5BQ5A 3IEVA 1TEXA 3RC3A 1DELA 1MOZA 5HCIA 1CKEA 2CLSA 2ZUBA 3GLIE 4PZYA 3CWZA 3A1WA 1W2HA 1T8UA 4LY6A 3FHTA 2DB3A 5L3VA 4LYFA 3SJCA 2HUPA 4EFLA 1F2UA 4ACBA 1IOZA 5DHAA 5FPSA 3CLVA 1EFRD 3DKPA 4TWZA 1P7CA 1Q22A 3LA6A 1XEFA 5FPHA 2IYLD 2JIZA 3OAAD 3A36A 1EFTA 2VBCA 4UNQA 1N6HA 3TJZA 2O8FB 1EK0A 3C41J 1IHUA 221PA 4LCBA 4LYJA 5AWFC 4EPVA 2C95A 2EYQA 2W58A 1E2KA 3FYHA 3NIBA 4US0R 4B6EA 2CE2X 4JYCA 4CEIB 2AWOA 3GD7A 3EC1A 3GLHB 1KSJA 2G83A 4Z8XA 1W46A 4Q02A 4NCKA 3MCAA 2R44A 1S2MA 2IK8A 1NMZA 4Q01A 1UM8A 5HE9A 2CEAA 3QF4B 3WNBA 2VA8A 1SVMA 1AQUA 3GLFB 1Q21A 2CLDX 4A1FA 1CJKC 1T91A 2QE7A 1FP6A 3DPUA 5HE8A 4MKFA 5FL7D 1XCPA 2RGGA 4LC0A 2Q6TA 3UATA 3KB1A 4QFMA 3T15A 3D7MA 4OI0A 4RD1A 1PUJA 4ASUD 2IS2A 1P2VA 2HCJB 4BLTA 4HATA 1CXZA 3K0CA 5K8TA 3BE4A 4B32A 2IX3A 2IBMA 1ONBA 3F3YA 4LSGA 1KK2A 2QRZA 3WYGA 2XITA 2AHOA 4Q4AA 3WP1B 3I8SA 2WSSA 3B60A 4GNKA 4LI0A 3MSXA 1NMYA 2GVDC 2JDID 5IRCD 4DLVA 4UJ3A 2DY1A 1YR7A 1ZVQA 2JJ1D 3TNFA 4XTRA 4RFSB 2ATVA 1N25A 3ZZUA 1TNDA 1AA9A 3J81k 3NXSA 4US2R 5BW8A 2KBFA 1FUUA 1F5NA 2GHIA 1US8B 1NBMD 1JPJA 2TMKA 2XZOA 3BXZA 4HB4A 4Q19A 1CRQA 2QMHA 4TLCA 3RANA 5FI1B 3QKRB 4KFUA 4LV6A 1VMAA 2P67A 5KPJA 2A3RA 1IAQA 2NOAA 1J90A 4CW7A 5CYPA 1CP2A 4DSNA 1AKYA 2XSZA 4OJKA 2GILA 2V6IA 3P4XA 4M9SA 4A0HA 5BN4A 2AFIE 3FOZA 3B9PA 4HB2A 4QNMA 4ZIRA 1S3GA 1YZKA 4UKDA 1GRNA 3I1FA 5B64A 4D4JA 2WVJA 4IKEA 5KPDA 4Q4HB 3CH5A 3K9GA 2J0QA 4LJ9A 2GWHA 5A0FA 2D7DA 1UBCA 2D2EA 4IFBA 1L8QA 2QMEA 3LXRA 5EZ5A 2OAP1 2C99A 1FW6A 2C9YA 4N1AA 1YQTA 5FOWA 3K0AA 3RS4A 2V54A 4TL9A 1I2MA 2HYDA 1NLFA 3CF0A 1KI4A 1LFDB 3LD9A 2FFHA 3C5CA 4Y0VA 4F4JA 4BWYA 3U7HB 5EZ6B 2HT6A 1FFHA 1UPTA 1G291 1UBGA 3IPYA 3QE0A 5CJPA 5JLJA 1QHIA 2KSQA 1YZTA 2VEDA 1XWIA 4PHFA 1E0JA 5AJWA 3C14C 2ZI4A 4GOKA 5A5GA 2FSGA 2JLZA 2X2EA 1W0JA 1GP2A 2BJVA 1EFUA 1D2MA 2J3EA 3LX8A 1P61B 3QBVA 4TL7A 2KJQA 2Z43A 5DISB 5HCNA 3K1JA 5FOTA 5AJYA 1P62B 5JZVA 4QL3A 1Z2CA 4CVNA 2F9LA 4NE2A 3L8ZA 1JB1A 2N1BA 2MSDB 4URUR 3RRZA 4N0DA 4OYHA 1FX0A 2I1VB 4PO1A 2J45A 2A5FA 1Y3AA 4F4IA 2JJ2A 2W0MA 2OZEA 1N6LA 2WWFA 2X1VA 2J0UB 2ZQ5A 1ZBDA 2BOVA 2DFNA 2FSIA 4H1VA 3WHKA 4TL6A 4MDEA 3IIMA 3QPUA 4Q9JA 3G0HA 1DAHA 2BEJA 3FDIA 1II9A 2O8DA 3OIYA 3BRWD 4KI0A 2PCLA 4EAQA 4GP6A 5L3QA 1N0VC 1XZPA 3R9XA 5H68A 4G5SA 1D9ZA 1UEJA 4F7WA 3HR7A 3LQQA 2IS6A 5KSOA 4TQUS 2GKSA 2WSMA 2YVUA 1P73A 1OXTA 4QM7A 3O47A 4OI4A 3PUVA 2DBYA 3PFIA 3JZMA 4Y0AA 2ZRMA 3GLFE 3VR6A 4A0GA 3ZLJA 1RPZA 2GAAA 4IEEA 4FMCB 2GJKA 1E32A 1MO5A 2GA8A 4GOJA 3NDPA 1E69A 3T1VA 4GDFA 3AKCA 3Q3JB 4JLPA 2ATXA 5CK5A 4BLQA 2CCGA 5D3QA 3ZYCA 4IVQA 5DH9A 3ASYA 1LB1B 5CM8B 4PPQA 3NWJA 5E3HA 3NDBB 3TW8B 1P9NA 1J70A 4PQFA 4V03A 4LK2A 3ZGXA 4B3FX 2ZR0A 3DKVA 2IYRA 4CZ2A 4ESVA 3I32A 4JVSB 1JR3E 1ZUIA 3BFXA 5CM9C 3VKGA 4D6PA 2OLKA 1T0JB 3NTUA 5FUXA 1KNXA 1E96A 3CX8A 4URWR 4DWJA 2BVNA 1II0A 3DHWC 2VSFA 3GLGB 3OEEA 3C8UA 1KO7A 5A4JA 5EE3A 4RZXA 3G82C 4D0GA 3SE0A 3I72A 1MABA 4D25A 1XEXB 4DSUA 1NG1A 2WOOA 2V1UA 5FR1A 2VQSA 2OCAA 4O0MA 4NPHA 5ANRB 1UJ2A 3CX7A 2F43A 4B71A 3CPEA 1LW7A 1ZRHA 3GPLA 1ELOA 3I61A 4MRPA 1F3OA 4Q7LA 2P3SA 4F93B 1U0JA 2ZYWX 4MITA 5KNDA 2QBYA 3GJ6A 1E9EA 4KO8A 1WB9A 3BBPA 2BBSA 3Q8XB 1E2DA 2E9SA 3GEEA 1II8A 1Q57A 1L4UA 2J41A 2WTUA 4KU4A 4KXFB 1ZMXA 4DJTA 4UNRA 4PANA 3IBGA 3VR1A 5GVSA 2QNRA 4DB2A 1YZNA 1NJGA 4CEJB 1YU9A 3AGQA 2RGAA 3K0EA 1DARA 5CLQA 5B2ZA 4C0KA 4F38A 5J4HA 1E9FA 5CYOA 4FWTA 4IRUB 3I8XA 5TARA 3B1VA 4EPTA 2QGNA 3UPUA 4MYCA 1F60A 3LRPA 2BCGY 1KY3A 1TMKA 2H18A 3Q7QA 2ZJBA 3KJEA 4B34A 4QRHA 3JVVA 2ZI5A 1CJVC 4LBVA 4IDNA 4JL6A 4MGYR 5H1YA 2O8FA 3TBKA 4JYBA 4G5QA 4BFWA 2GK6A 2QAGA 1P5ZB 2HV8A 2WKPA 2WWWA 4W5HA 4XJXA 5FUVA 4L15A 4FINA 2OCYC 5BN3A 4LJYA 1Z06A 3W34A 1E99A 1QZXA 3AM1A 1GRQA 1NN0A 1AM4D 5JHHB 4CEIA 5DIFA 3KJGA 4OHYA 2QG6A 3HJNA 3GLHA 1ZP6A 4R98A 1VCMA 4P4SB 1BIFA 1G8PA 1YJ5A 4RZ2A 3QKSA 4JT4A 4GMXA 3BH7A 2N46A 1ZNWA 3RVBA 3SS8A 4UNSA 3ND8A 3BJIC 5L8VA 5DLQC 3GJ5A 2C9CA 1EGAA 3GLFA 1RW4A 1ZM3A 3VHLB 2Z5FA 5E7JA 3OFND 2OFWA 4NCIA 4TMWA 2HT1A 3WRYC 4JLVA 4WIAA 1NN3A 3W9YA 3QVUA 4DBLC 2JJ8A 2KE5A 1HURA 4FCTA 4JS0A 3SZRA 5BYKA 2WWYA 4CEHB 4TMXA 3QVVA 4A2WA 3EARA 4HLDA 1OKKA 1D6JA 2OV2A 4XWAA 1XMSA 5FPKA 5AUNB 4DT1B 2YZ2A 2F1HA 4S2EA 1AQYA 3GFOA 1JEEA 4Q1AA 1EXMA 2WM9B 3W6NA 3JZAA 3H84A 2C78A 2ZETA 2QUZA 2RGXA 2ZRFA 3AP2A 3IHWA 5KSPA 4HUTA 4BLSA 1E2EA 4URZR 1Q0UA 3PVSA 5KDOA 3HWSA 3W8NA 3C4JA 1JR3A 2QP3A 3BB1A 3BIFA 3CM0A 4PZZA 3RRYA 1XB2A 4FIDA 1CS4C 1I4DD 1P75A 3RAPR 3VR3A 2WAYA 5GJWC 5KNCA 1E79D 1Q12A 2ZUDA 2IUUA 2FWRA 4XVRA 2BC9A 3EZ6A 4FMDB 1QVAA 1US8A 3B1YA 2J1LA 3L0SA 4JZKA 3RS2A 2L0XA 4L16A 3QENA 1M1YE 4KVGA 2IYWA 1TF7A 5LB4A 1GITA 3BB3A 4RCYA 1J8MF 2G1JA 1AIPA 1P9WA 2ZUCA 3HU3A 4E5UA 1G3QA 4FN5A 2FOLA 2GZDA 3C16C 3GJ3A 1TU4A 2RGEA 4TQAA 1KDPA 1WE2A 4AI6A 2JLWA 4TYYA 1CR2A 3IEUA 4B3XA 4Q4HA 3T12A 1RZ3A 5CIWA 1W36D 2ZR7A 3AF2A 1A5TA 2PX0A 3EASA 4LWZA 2V7QA 2FF7A 4A6PA 4IOKA 1NVVQ 2W2TA 2H1LA 1SVSA 3GJ0A 4MRVA 1ZIPA 4FW9A 5IK2D 1PV4A 2Q3MA 1U8AA 1UBEA 1KI9A 1Z83A 4PSVA 1KJWA 4RSGA 4BFYA 1OIVA 2KWIA 4A2QA 1GL7A 3QF7A 1G17A 2EQBA 2KBEA 1NVXQ 3IUYA 5J5CA 4TTPA 1CIPA 2QL6A 4HLUA 5FUWA 1XJ0A 3PR1A 2IEZA 3DO6A 2QMOA 2YOGA 1RYHA 2UVQA 1NP6A 4BEBA 2XTNA 1YZLA 3CONA 2ORIA 2ODEA 4IOJA 2DFTA 5GJVC 1KMQA 1Y63A 2WMNB 4NYJQ 1GKIA 3SN6A 4EQ6B 4C7OA 2MSCB 1KSFX 2AXNA 1FQJA 4Q5IA 5FFMA 3WXMA 4DB4A 2ZE7A 1XMJA 1AS3A 1G1MA 1RYFA 2R6CA 3I5YA 3P32A 3THXB 5CJ2A 2D7CA 1Q3TA 2LKDA 1E2NA 5DSZA 2J9RA 5G53C 1JXMA 1ZCBA 3T06B 2PCJA 2CHVA 1NKTA 4MKIA 5KOYA 3A1UA 4B73A 4A8JA 1SVKA 5FTLA 1QHHB 2XAUA 3KKOA 3M0EA 3EWAA 4TTRA 5C1BA 2C5LA 2P6UA 3ZVRA 2J87A 3NG1A 2F3RA 5J4VA 3GLIB 3PEVA 1XTIA 3R20A 3DOEA 1DAGA 1LF5A 5AUQA 2ZS9A 1HTWA 2ZSAA 5CB6A 2XTZA 2OT3B 4BPBA 3X2SA 3I3SR 4IDOA 3TRFA 4M1YA 3K0AB 2KI5A 1COWD 1UEIA 4V0ME 2ZREA 5IT5A 1J2JA 3N2IA 4PZLA 2J7KA 1R5NA 2EW1A 1CR1A 2WJHA 3ADKA 4HYYA 5CK4A 2QAJA 5LD2C 3DL0A 4JLMA 3ICQB 4N0EA 4TLAA 3K0CC 4XSGA 2W2VA 4D4MA 2IYUA 4G01B 2JLQA 2NO7A 2EFDB 2OE2A 3KKPA 4IJMA 1X8LA 2XB4A 3RRNA 4DVGA 3PEWA 4K81B 4Q1FA 3LBHA 5KO2A 1CU1A 2WICA 3EPLA 1G7TA 4Z1MD 1KO5A 1OW3B 2PZGA 2PX3A 4BFZA 3R9IA 3MD0A 3OE7A 4DLWA 2ECKA 4GRAA 1OSNA 1XNJA 4QGGA 3AF0A 3I5XA 3AUYA 1FX0B 5KU1A 3X1ZA 2J59A 4FXPA 4URVR 2ZM5A 4PXAA 1G3IA 3DMDA 4O25A 3NVAA 4Q7JB 1K8RA 1MH1A 2WKRA 1T8TA 3LBNA 4JKYA 3G5UA 2H17A 1IQPA 4NCHA 5L3SB 4HZIA 3EXAA 1T3SA 1XDBA 4EPYA 621PA 1KI7A 4IOMA 2P2LA 1NN1A 1P60A 2F1JA 5FTMA 3GLGA 3FTQA 1MO4A 2WJGA 2ASEA 2ORVA 3IHLA 3AUXA 3M6AA 1Z6YA 1SZPA 2A5DA 1P2TA 2A30A 2WJJA 2EFGA 2X2FA 3L0OA 1CTQA 4B2LA 1TF2A 4PPGA 1E4YA 1V43A 1XD8A 4R71A 1XD2B 3EZ2A 1E2LA 3U5ZB 3K9HA 1ZUNB 3LQRA 1ODFA 4A2PA 3RS5A 5EXTA 3B85A 2ZVQX 3BFVA 1G3UA 4DIEA 1IN7A 1EX7A 3SBEA 4DHEA 4KITB 3W8RA 1MRNA 2PBRA 2VYFA 5CLLA 3BD9A 3EIEA 2ZRBA 1NIPA 2CNWD 1QRAA 3PUXA 4B44A 2ANBA 4G1UC 2ZANA 5FBQB 4O2LA 1XCMA 4LHWA 2NZ8A 3EA0A 2FFBA 3QQ5A 3F5FA 2IF0A 5HPYB 1Z3IX 5C4GB 5EE1A 3DZ8A 2HLDD 4DKXA 3CF6R 1VG9B 3FMPB 3TH5A 3DDCA 1WBDA 2VL7A 4PQYA 1OH8A 2ZRAA 1ZC3A 2JLUA 6Q21A 2GCOA 3VMFA 1UBFA 2ZJ8A 3GJ8A 1HT1E 4Q9HA 1SGWA 5EXSA 4BE7B 3PEYA 1FMLA 4RD0A 2D62A 3OF5A 4LJ6A 2J46A 3CRMA 3LH5A 4M9XA 4H1UA 1EWRA 4HUQB 4RD2A 1OB5A 3AVXA 3BS4A 2P5SA 1DAEA 2GXAA 3TVTA 1W0KA 1KK3A 4KBGA 2O0HA 2RGCA 4BZXA 5B58C 3SC3A 1MV5A 1H8EA 2PT7A 4V0MA 3CZPA 3WY9A 4IXNA 3T1OA 4DCSA 2G6BA 1N5KA 3TSZA 1YHNA 4M0LA 1PLKA 1OJLA 4Q9LA 1E0SA 4EPXA 1SXJD 1ZINA 1RRCA 1VYVA 4Q7MB 2UKDA 2FN4A 4XD7D 4YLGA 4D2IA 3KQHA 4M2LA 5DGXA 1CRPA 1U94A 1Q1QA 1KI1A 2YC2C 3SYNA 1DG1G 1KOFA 2C2HA 1II8B 1L4YA 2YWEA 4CEHA 3AP1A 5JJLA 4URXR 2W0SA 4LJAA 2O8CB 4IW3B 4FMCF 1P3JA 2GCPA 2GXUA 3NC1C 3KJHA 1E9RA 4YXWD 2H7VA 2J7PA 4DT1A 1Q1ZA 2VPPA 1QHNA 4BZPA 1UKVY 1NY5A 4BGDA 1Z0IA 4DUGA 5FTNA 3ZIAA 4Q1CA 1Z6AA 3KTAA 3P1JA 4LX0A 1TQDA 1G18A 3MRSA 4QGAA 3THOA 3W5JA 1ZW6A 3GJXC 3MGCA 3E5HA 4NH0A 4XH9B 3QPVA 4OHXA 4OHWA 1J8YF 5FPTA 2QAGB 4DXAA 2R8RA 2WJYA 3KQUA 4KFTA 2FDCA 2A2ZA 2XNDA 4MKGA 4GMDA 4OJQA 3DZDA 3I4LA 2WIBA 1NL3A 2IYTA 2IYVA 1SVLA 5JRJA 4XWKA 4LPKA 3GP8A 4AY2A 5KDDA 4E03A 1IJFA 1G8FA 2IHBA 3B7GA 3IQXA 1GZSA 3L2OB 3U3KA 3QKSB 4A6XA 3VX4A 1ESMA 1IN6A 3SBDA 2FE4A 4NP6A 3T61A 1TUEA 4A4DA 1X3SA 2D4HA 4X8LA 1TQ4A 3QI2A 3HPRA 2VH5R 4JL5A 3AVQA 4XSHA 4MKHA 4WW0A 4B3BA 1Z0KA 2GBLA 4IFEA 1KMHB 3U2QA 5J47A 3K9LA 1UAAA 3PV0A 4Q1EA 2ZJZA 3RWOA 1JJVA 5J4YA 3U3OA 2RMKA 2IC5A 2FNAA 1SHKA 2F6RA 3LVQE 2OXRA 1E1QD 1S0UA 2CHGA 2ZJYA 2PLRA 3DM9B 4JLAA 1SULA 1AZTA 3UG6A 1N6KA 1ZU4A 4QBFA 1E3MA 3FMFA 5JJIA 3MWJA 1P2UA 3GQBA 4Q9KA 2VSXA 1YR8A 2QA5A 1RFLA 3TR5A 4EQ6A 4EFMA 4AYTA 4XOIA 1OXVA 3RABA 3SNHA 2V55B 2CK3D 2JA1A 4Q1DA 3THXA 2IS1A 2PMKA 2QAGC 2BHRA 2VTKA 3AEZA 3KDSE 3W3AA 5C18A 5FBLB 1UKZA 1W4BA 4OQXA 3QBTA 3X1XA 5HR5A 2XZLA 4PSAA 2CCKA 1TQ6A 4POAA 1NKSA 3QY0A 4BLRA 1E2MA 1AK2A 3CZQA 4CYMA 4Z51A 5DO9A 1QHHA 3N2EA 4FD2A 4NYMR 1Z2AA 3Q5EA 5HKKA 3FMIA 4B35A 2PEZA 4P4TA 3GLIA 3K0FB 5B57C 3KFVA 1BMFD 5EQTA 1M8PA 4JVNA 1CJMA 3KKMA 4AURA 2WWGA 2MMGA 3FKSD 4A82A 3VNUA 2B6HA 1NLZA 4PO9A 2VHJA 1GAJA 3NH9A 3CKLA 1GDDA 4DEYA 2GEDA 2FZLA 1DG3A 4YMVA 3P20A 4TT3A 1DADA 2IUTA 4UNPA 1G8HA 1NMXA 4MDFA 3PUZA 2AK3A 2P65A 3CW2A 3V4FA 1QF9A 3ICEA 5FPYA 4C7OB 4WOPA 4DDWA 121PA 2QQ0A 2ZAMA 1E2PA 1AS2A 2WPDD 1K6MA 1ZM4A 2RGBA 3NBXX 4B6FA 2XJ4A 4ZCIA 5E4FA 1Z08A 4FMDF 4JIMA 1PUIA 5IF9A 4D80A 4PX9A 4M1MA 1GRRA 2QTHA 4W7SA 1BO6A 4C0SA 4IDPA 2VF8A 2WBLC 4X8HA 1T5LA 2OUKA 1KO1A 5ELXA 2B7BA 4KAXA 3AH8A 1LTQA 4OHVA 4D82A 4P4UA 1CJTC 1E9BA 3FWYA 2W6JA 2QN6A 4A8JB 3ZZ0A 5L3SA 5D3MB 4V0LA 5TV2A 5KSZA 4E09A 1G16A 2EYUA 3VX3A 1W1WA 4B2PA 4CIDA 4KYUA 3CRVA 4PAMA 1ZNYA 2QP9X 3TE6A 2F9MA 1PLLA 3D8BA 2OAQ1 1QG2A 3VAAA 2QPOA 4A36A 5F9FA 4JMPA 1YVDA 5DI9A 5EXXA 1SXJE 2C96A 3TUZC 4TSFA 1XD2A 1LVGA 8OHMA 1NI3A 4KBFA 4YQFA 3U44B 1LF0A 1ZIOA 2W6ID 4C3ZA 4TMVA 3SFVA 3TUIC 4NZYA 3RC8A 5F3WB 4DLTA 4P31A 5FBVB 1CF4A 1F48A 2Z6VA 1E6CA 3CNLA 5E95A 1ZAKA 5H70A 1OHHD 2ZE5A 1EG7A 4MGKR 2Q9AA 2F3TA 2F1RA 4AKEA 1MO6A 3H86A 4HLUC 1E1RA 2DWPA 3AV0B 3CBQA 4NHOA 1BOFA 4I1VA 4YDHB 1P72A 2J0VA 4QKQA 4QBIA 4B48A 1DAMA 1H8HD 4OQLA 1G7SA 3THWB 2XOKD 4LHVA 4BFTA 4EIWA 1TL7C 3TSWA 4A92A 4LZZA 1IN8A 1G41A 4HSEA 1YZUA 4ZPXA 3A1VA 3E1SA 4HUQA 1T4GA 1IN4A 2BV3A 3FHOA 5FOSA 5L3RA 3RHFA 4QJ3A 1HQCA 3RWMB 4YONB 2IXGA 3REGA 1Q3HA 3BFKA 4NMMA 3ECCA 3AVVA 2CVFA 1KSGA 4CT4B 2FH5B 2GK7A 2ZEJA 4A8JC 4PTLA 1TX4B 3MJRA 4ZCLA 1QHSA 1UDXA 2Q9CA 4B76A 2BBTA 1KKMA 1XPUA 3PUYA 1R0XA 3CH4B 4MYHA 1Z28A 2RGNA 1YZGA 4DDUA 2XB2A 2FEMA 3ZQJA 2EWWA 2R6GA 4URYR 1SVOA 1GNPA 4JSYA 4ARZA 1HT2E 3ZD7A 1B0UA 3TLXA 3A4LA 3ONWA 4HAYA 3SYKA 2W00A 4DCUA 2CL7X 1G8YA 1VIAA 5G3YA 3AQ4A 2ZI3A 2O8CA 1Z0AA 1N6OA 2FEOA 3F8TA 5JHGB 1NN5A 3OHMA 2OO7A 4HB0A 3GJ7A 4JT2A 2DWOA 2PEYA 3MLEA 4EDHA 1W0KD 2NO1A 2HCBA 2NTYC 2GCNA 2E1RA 3EIHA 4PC6A 5DN6A 3K70B 2IT1A 2O8BB 4C2TA 3AVOA 1IXSB 4IDQA 2GCOB 5G40A 5JWRA 1OB2A 3OEHA 5LB2A 1NBME 1GILA 5DYGA 4PFSA 1VCOA 1VKJA 2MSEB 4HAXA 1W4RA 1AS0A 2G3YA 2PZFA 3NEJA 3AVWA 4KFSA 2EFCB 1GG2A 5JCZA 3ZS9A 4HDQB 3RSLA 1HY3A 2V4ZA 4US1R 4G0NA 4XVUA 2G9NA 4GZMA 4GBMA 1JJ7A 1UKEA 2OBNA 5B30A 3AKDA 3L8YA 1TU3A 4C0LA 2HYIC 1NRJB 2ZRDA 1X1SA 3CIOA 3FMOB 5JWHA 4DDVA 3K9NA 3QXJA 4JLDA 1Q20A 4Q00A 2FFAA 1OH5A 1FOEB 3O8BA 4TN1A 3LLMA 4X8MA 4KCGA 3V00A 4UNNA 1E9DA 4LJ4A 1KK0A 2JIZD 1OFIA 5EUQB 4GPTA 3TKLA 2ZIAA 1MKYA 1T9HA 1Z6TA 3GFPA 3FFAA 1GKYA 3Q9LA 4OK6A 4LBYA 3VQTA 4R2IA 1EFRA 4DZZA 4CGZA 1KMHA 1IN5A 1G8GA 1NLYA 2OFXA 2QI9C 1Q1BA 3AKEA 3E70C 2OESA 3CX6A 4PPFA 2GEUA 4DSOA 1HE8B 3QUSA 1ZM2A 4NYIQ 3OAAA 4AG5A 2ZXUA 1LY1A 2CXXA 3TGPA 1A82A 5FUYA 1DAIA 3WMFA 2D3WA 5EP4A 4OK5A 2BMFA 2OG2A 3EW9A 3H0KA 2GF9A 1FUKA 2D06A 5EXPA 1S8FA 1VG0B 2UZIR 3KTAB 1S9HA 3VHXA 2YWFA 2ZSBA 3TMKA 2A9KA 4TLBA 2QE7D 2GAOA 4LBZA 3FE2A 3K70C 1TPZA 3NKVA 4AYWA 3LNCA 3C15C 4GT1A 4NTZA 4DLZA 3QG5A 2WHXA 4PAQA 5JEEA 2W83A 3IKJA 1W44A 4LUCA 4DDTA 2WOJA 2QQEA 1YR9A 1XJQA 4RD3A 3A37A 4WXPA 5FL7A 1KO4A 3W6OA 4AC9A 3U6KA 4A0RA 3EIQA 1FNMA 3I92A 3RDPA 3DVLA 3GMTA 2OBMA 3C5HA 4PHHA 1G6OA 1HA3A 1M34E 2HXYA 2QROA 2WSSD 3HP1A 1ZJ6A 5AJVB 3RRMA 3LDAA 4ASUA 4B74A 3ADBA 2NMVA 3CR8A 1XTJA 3LXXA 3V4RA 5TMPA 5FH9A 3A8TA 2AD1A 4QNRA 2CL0X 2YWGA 4I1OA 4QGHA 1G21E 3UMFA 1VTKA 2BBOA 3K0FA 3QEOA 5G41A 2JDIA 2A7QA 3WMGA 3EPKA 2B8TA 4HAUA 1R0ZA 1WA5A 2JJ1A 2OCBA 2GJAA 1U0LA 3IIJA 2ODWA 5F98A 1E0AA 3A4MA 3U3MA 1ZNXA 3U61B 4AKGA 1C4OA 2IHYA 3TIFA 2XGJA 1H65A 4C9BA 3MWYW 2X8AA 2V1XA 4PR0A 5FTJA 1NBMA 1RJ9A 3ZZTA 2QM7A 4R7ZA 2LKCA 2IWRA 2XSZD 2C9OA 4P3YA 4BFUA 3QPWA 1IY0A 4DEXA 3RLFA 4X8OA 1X86B 1ZM9A 1LS6A 4XIGS 1E4VA 3UWKA 4CRWB 1T6NA 5AJZA 1AKEA 1KDTA 2W2XA 2YYZA 2GTPA 3TAHA 4XTCS 2FFQA 3AGPA 3H4MA 1XMIA 3SEAA 3T1TA 4NU0A 4RY2A 4G5GA 5EE9A 1XX6A 4B33A 2IYQA 4BRUA 1W36B 1R8QA 4HLQB 4LYAA 3LVRE 1DOAA 1LV7A 4I1SA 2R6DA 3AF3A 1Z8FA 5FOVA 4WZ6A 2OEPA 5D3MA 4LHYA 5EE0A 4DCVA 2WZQA 3LBIA 1QG4A 2WWHA 1E2QA 1FL9A 2CL6X 2BM0A 5EE5B 1HV8A 2E87A 2Y8EA 4AIIA 3ZD6A 5P21A 1W0JD 3CF2A 1R7RA 2VP5A 4KHZA 1TADA 4MYTA 2FPMA 2YINC 3HPQA 4RKFA 3K0SA 4TMTA 3U44A 2ZRPA 3E2IA 1GL6A 1RRFA 2H57A 2GBLC 2JAQA 4LDJA 3NBYC 2VHUA 2QEQA 1FQKA 1KTVA 3VR2A 3Q72A 2FSHA 2GXSA 2JJ2D 4TMKA 2DHRA 4V02A 2VF7A 2BMJA 2ODBA 4ILEA 1XXHE 2GNOA 5LBIA 3FHCB 4Q4LA 2CHQA 2LWIA 3AVTA 2ZU0C 2F55A 3CB4A 1WBBA 1TTTA 1DO0A 4JLNA 5DE3A 4LC1A 3SI7A 3KZ1E 3ZVLA 4C2UA 3RYTC 4D26A 4RCZA 2FU5C 4D0NA 1JAIA 2BCJQ 2RHDA 2ZS8A 4MH0R 1MO3A 4ON9A 4AD8A 5JMTA 4DLUA 1E2JA 3P26A 4FCWA 3THWA 3D31A 4ZV4A 4HI0E 2AFHE 4MUBA 1J7KA 2RGDA 1P2SA 2HJVA 1KK1A 1VIYA 1D5CA 4CT5A 2WWIA 4PC7A 1CJUC 2DYKA 4EJSB 4NYIR 1B23P 1IXRC 2NPIA 2O0KA 1RC8A 2VHTA 1GSIA 3TUJC 1EFCA 2J5XA 3GEIA 1EWQA 4Q9IA 4IDHA 5JBQA 2VP4A 2Q0HA 3NC0C 2GDJA 2R9VA 3MMPA 4QBHA 4R2HA 5SZHB 1E1RD 1AN0A 4AKIA 1OLOA 2ORWA 4E07A 2OILA 4YMTA 2GJ9A 1RE0A 2I3BA 1KAOA 1OFHA 4TYQA 4TYWA 2NGRA 4ITRC 2GZAA 2C77A 5K8UA 2GETA 3DOFA 3L43A 1PVOA 3X1WA 3CO5A 4BLOA 421PA 4B47A 2I4IA 2NIPA 1TUIA 2DFKB 1FMJA 1W49A 2BDTA 3UK6A 4IXMA 3OEED 1R2QA 2G0NA 4AKHA 2P6RA 5C2JB 2O8BA 3REFA 3SHFA 1SKQA 5KHOC 2X19A 2LCFA 1ZUHA 1DVRA 4WA7A 1C9KA 3X1DA 3PCRB 3CNNA 1Z22A 4FWIB 2HF9A 4DLYA 2ZJOA 3CPHA 3KFXA 1DBSA 1BKDR 2V8OA 1GOTA 4ABYA 1OFTA 4JBXA 4EFNA 4WVFA 2A5GA 1XJCA 4WZAE 5BXQC 3PJRA 3QXSA 5FBWB 2YV5A 2ZAOA 1G7RA 2ZVPX 1NVVR 1ZU5A 1M74A 1KKLA 2AX4A 3CR7A 2DFLA 1VYUA 4JL8A 1XTQA 3BOSA 5JCPA 4G3XA 2BJWA 5EP3A 3WHLA 1E98A 2YOFA 3BGWA 3TW4A 1YE8A 4Q4JA 4HZUB 1VHTA 4BFSA 1HH4A 3SJZA 3AKYA 3LY5A 3QJYA 2P0EA 2WV9A 4JLJA 1M2OB 1KJYA 1M7HA 1ZC4A 2FGJA 4U5XA 1CR0A 5GJBA 1O3YA 2NZJA 5CITA 1ZD9A 4ZDIA 5M04A 3AVYA 1D8TA 1Z0DA 2ZRIA 3EA5A 3IQWA 1YRBA 4ARZB 1P9RA 4NYJR 4D0LB 1W5SA 2B7CA 2IYSA 4YMUA 3MJHA 4LOAA 1I2DA 2VHQA 3T5DA 3EC2A 1E0KA 2ZRJA 4HAVA 4A15A 1DO2A 1EFHA 3UWOA 3R9WA 4LJ7A 1KZGB 1CULC 3ZS8A 1T3HA 2ZYTX 4M4SA 3CNOA 4W5WA 1UADA 1VDZA 4Q18A 2RAPA 1VCIA 1KZ7B 4CF7A 1SKYE 2N42A 4DCNA 2HDNB 1FP7A 3QG1A 3HU2A 1E2IA 1OYWA 3OIWA 4PPNA 2JLXA 4OBEA 1U9IA 3LV8A 3KXKA 2VP9A 1HYQA 1NJFA 4PAOA 5JI3E 2ZU6A 3CRQA 4Z8YA 2VP0A 1ZM7A 4J0QA 4PHGA 1WF3A 1NSFA 2D2FA 5JI2E 4B3CA 1YRAA 2YNMA 4M1OA 4YC7A 1X8KA 3W90A 4IOLA 3PG5A 4KLNA 4JBWA 2Z83A 3SYLA 2Q9BA 1SXJB 1UDWA 2VIIA 3A1SA 2CJWB 3OFNA 4QGFA 3X1YA 3Q7PA 1GFIA 2NQ2C 2ZJAA 1OKKD 5EP1A 3RSOA 3U4QB 2J0SA 2R65A 3TVDA 3SOPA 1G3RA 2HXSA 4MYUA 3N5CA 4BUJA 3L0PA 2JLRA 1ZD1A 1MR3F 3KXLA 2V6JA 2Z4SA 3LX5A 5BN5A 2BBWA 1SHZA 3F0TA 1E9SA 1JR3D 2H5EA 3HYRA 1KI3A 3V9PA 1JPNA 3UG7A 4TLDA 1XD9A 4UJ5A 3KKNA 721PA 3WYFA 2F7SA 2EU8A 4PO8A 4I1UA 2RGNC 3PXGA 3KKQA 4V0OA 4DLXA 1S3SA 2ZRGA 2R6FA 1WMSA 2C03A 2IYXA 5AUOB 1GL9B 3VR4A 2O8EB 2REXB 4XWOA 1E79A 5E7IA 1DAKA 1JQJC 2ZPTX 3PITA 4JVLA 4WXRA 3B5JA 4FI3C 2CBZA 3OESA 1XPOA 2IXFA
chains in the Genus database with same CATH superfamily
5K7SA 2P6MA 3T4XA 1Z5WA 4RFVA 1IJKA 1Y4AE 2VTDA 4YWHA 2DHEA 2PKXA 3DZGA 2V3WA 3EVNA 4KQFA 2WAAA 4BO0A 1KBZA 2DR2A 1KXJA 5B55A 3VVLA 1FVFA 2DQZA 3IPXA 1SQ5A 1BC5A 2RHMA 1LBQA 1T9CA 1GCGA 1VL8A 2PKWA 1SU7A 3EW7A 1BXRB 1KEWA 3HLYA 3OQOA 1FRNA 2GPWA 4LE0A 4R8RA 4BJ1A 4U0KA 1O4WA 4K8RB 4IVPA 4HS9A 1W4LA 2NSDA 4IHJA 4A2CA 1KYIA 3ONVA 1RKQA 2HO5A 3DWIA 3AU9A 3INYA 3O3MB 3VNVA 3KUKA 3PLAE 3CSUA 2VHEA 3W9UA 5IS2A 5CGZA 2VQDA 4FC6A 2R87A 5IK2A 1S2GA 1TLFA 1CZKA 1SXJC 4YJ3B 2NXNA 5LQMA 1CUCA 4DQUA 2DAPA 2PV0A 2CKDA 3ZE2B 2UYCA 1T3TA 1B42A 1NFQA 1FC0A 4EO9A 3EJWA 1CY1A 1UINA 2H07A 4NULA 1HEIA 3RVDA 5LU9A 2ZT5A 3NBZC 1MJGA 1BDBA 3D0KA 4IYRA 1GY8A 4IG9A 2JHFA 3BWEA 5BQOA 2IHTA 4MMZB 1RXWA 4N5HX 3DD5A 3G59A 2BHNA 2JRCA 3A9WA 4P5PA 4B4KA 3TR0A 4YV1A 5CDFE 5DMHA 2COUA 4KJZA 1T3ZA 5EHZA 5HUHA 1P1RA 3DAYA 2ZJ1A 3WICA 4ZOLF 1RJ9B 3O2JA 4WKCA 3R7WB 7GPBA 2VP2A 2XT0A 3PUIA 5CP8A 1R27A 2EWMA 1IY2A 1WY7A 2PL3A 3LXMA 4GI7A 3TIVA 1QLWA 4RF4A 4BMXA 4CQMD 3DR5A 3TRHA 1C3EA 2GZHA 3AC0A 3BWXA 5JG7A 4CQLB 8ADHA 1T5OA 4RIGA 4D9KA 4DIFA 1N75A 1NUSA 1FTNA 3HDQA 3KIPA 3PF8A 1OH6A 2ZJ6A 5C5EA 3Q85A 1GUBA 4KFCA 2P5TB 5FV7A 4D43A 3C6ZA 2XXAB 3TEMA 3TQTA 1ZPDA 2V0CA 4U9IS 1F17A 1X7WB 4B17A 1CUYA 4X71A 1YKFA 1V8BA 5AK0A 3JQ9C 4U6QA 4E2FA 4UXJA 4YHHB 3PNBA 1L7BA 1SIWA 2PO5A 4WKNA 1NVAA 3ENWA 4Z86A 3SQLA 1GWNA 2I2FA 2WT9A 3AIKA 5B58T 4YMWA 2FUKA 3QUBA 4GLFA 3K35A 4MI9A 1UP6A 2VFAA 4R84A 1IFXA 4PHTA 3S2ZA 1W25A 1Y1KE 2BF7A 1R00A 1WCYA 4LQDA 2X6QA 4BMCA 1N2CE 4GL2A 3KXPA 2FZ4A 4O33A 4BLVA 2ONCA 4MEAA 4EJSA 3MMXA 1GA6A 3C5VA 2WKSA 1GUZA 3GRPA 4HEJA 5ALLA 4HPWA 2HR1A 4G5RA 4F4DA 1E4OA 5LOVA 2YXLA 2GSWA 2B8EA 3FYSA 2ROQA 2SCUA 3WMEA 3OQMA 1YQGA 3TSOA 2P69A 3M5WA 1AZSC 1KHTA 2X0EA 3BB4A 3K09A 2Q29A 3B8HA 4GXTA 3UC9A 4BQEA 1U2DA 1F7UA 2QTWB 3AJDA 4DCCA 3WRXA 3GLRA 2RG1A 2OQIA 4MR9B 2DCUA 4JBYA 2FW6A 1GGFA 4I1YA 3MUFA 1FBNA 4I4CA 3EWNA 4D9NA 4O2BF 2AOVA 2IEDA 3ITEA 1PHRA 4Z1MA 3UOAB 3VSBA 4CR6A 2ID9A 2KLBA 2XDYA 3DMFA 2Z09A 2V7VA 3IBYA 4N3NA 3B9QA 4QOEA 3WP0A 3B5EA 5CHYA 5EZQA 4C0HA 5IF3A 2BEVA 1KFBB 1A7JA 4HLCA 1WPGA 1QCZA 3GVXA 4HAWA 1IRXA 1R3DA 3EK2A 4QECA 1AK1A 4UUPA 4F3CA 1OI4A 4NCAA 1ISGA 3GLHE 5ICFA 2J3QA 2BKUA 4DZRA 4EB0A 4OQQA 2YRWA 2H2WA 1XF9A 2ID8A 1RWNA 1AH2A 3U6BA 4BYMA 1GTL1 4X6XA 4HNGA 4DCGA 3RV3A 3F6EX 4XWTA 3PB3A 4XYGA 4PCLA 4YAEA 4ID3A 2J9FB 5DHRA 4ECEA 5FTLA 3ZHUA 4QJ5A 5LUAA 5ELMA 4KWCA 4MUAA 1A4RA 1HG0A 1X2EA 2PMBA 3F47A 5KTKA 3DTTA 4CM3A 4EPWA 5HRCA 1XFAA 1ZKMA 1MC1A 4O4IF 4WOBA 2BGRA 5LLSA 4CKCB 1SC1A 3E1GA 3NUZA 1F6WA 2XRYA 1U80A 1WXIA 3VOTA 2R7NA 2IV2X 3UKDA 3G2MA 4XOUA 2A59A 3UHAA 1IY1A 4H6PA 3ELUA 4HGNA 2ZRHA 1AO0A 2XQJA 4HZUA 1BA2A 3GCWA 2YMQA 1R16A 1PN3A 4KODA 2FX3A 4PGAA 3AM5A 5IZ4A 3N8NA 3I28A 4LF4B 2AOXA 3GT0A 4YAOA 3SZ3A 1IWBB 5BSMA 4EZEA 1ESDA 1UUFA 2PY6A 2AYXA 2F8MA 2VXCA 1NY6A 3R6TA 3KJIA 3PXAA 4QHYA 1M1NA 2GRJA 3RG8A 4C76A 4M9QA 5JWOA 3K70D 2AR7A 3DVAB 5JDCC 4M1KA 1JPUA 2QX4A 5ALEA 3T5GA 3IXLA 4CFSA 2P9EA 3BREA 3WMWA 4BTEA 2EJBA 2IY7A 3BFJA 3E84A 4QODA 4A23A 4FEYA 4L72A 4RS3A 5AJTA 5I4BA 2C8KA 1Z0FA 2AK2A 1PLJA 1SVIA 2HMTA 1BWQA 5FWAA 2EFHB 1ZH2A 5TY0A 3H5LA 2A86A 2EZ8A 2HFJA 5E0OA 1BVHA 5G4LA 4H4CA 1NNUA 3RS0A 1Z0JA 3L5OA 2IYOA 2GUGA 1XZLA 2HKIA 1KZ9A 2GEVA 4MP6A 3ZGLA 2W6NA 3A1DA 3C98A 2CFIA 5IDXA 2XCUA 4LF9B 4P2GA 3X3HA 1FYEA 3ASZA 4GR5A 1I32A 1JS1X 3C70A 4CCAA 4NMHA 3WL8A 4EUSA 4HH4A 4P3OA 4YRRA 4I8DA 3WQRA 1Z07A 3S1AA 3VKFA 5AVTA 5F1KA 4B3GA 3C1OA 4JUCA 2IW3A 2FG5A 2ZRQA 3FVWA 3NLLA 4PIVA 1HR0B 1A8UA 3G0GA 1T3LA 4GGPA 4OL0A 1P4SA 4YQYA 5I8ZA 3RS3A 3ZVMA 4PBRA 4I81A 2QP4A 3NVDA 1M2KA 1VFPA 1M7BA 1F2DA 1U0NA 1VMDA 3S1LA 3RWBA 3A2KA 3UNXA 3O73A 4YROA 4P5DA 1Y6QA 5ECGC 4QO8A 3FOWA 2I0FA 3KDPA 2J33A 2ODTX 4YIKA 1G5TA 1LDMA 5KTSA 3EMVA 3MQ2A 1SCJA 1GT6A 1UFRA 2VK1A 2FDXA 5ENZA 5KSWB 2XCRB 1XWFA 1IJEA 1U02A 3KM0A 1CY6A 3DO8A 3MGGA 1AGPA 2PL9A 3OF2A 2WJWA 3CXUA 5A71A 1GM5A 2F8TA 3CINA 2QSZA 4FDMA 4CR7A 3GDWA 2X0IA 1UDRA 2FLWA 5FUBA 3THYB 5JAZA 3VPAA 1DCKA 1SXHA 2QVGA 3FUWA 3BIOA 4DM4A 1U63A 1GU1A 2QSJA 3FI9A 1WS6A 2C2ZA 5TQ2A 1OBOA 2XF2A 5KOJA 3D8NA 2XUFA 2PUDA 3EVZA 4QJBA 4R3NA 1XMOB 3KYDB 5AW6A 1ODCA 1B3RA 1GQYA 2QVBA 1OF1A 2B2XA 1WP4A 2WWTA 3I9V6 3P0IA 2D7JA 5D85A 1NPYA 2WA2A 2Q2WA 3DDSA 4HTFA 4Q7KA 4EG7A 1W5FA 4K26A 1OWLA 3ZHBA 2Z8YA 4B7AA 2OBYA 1GNTA 2C98A 8GPBA 4G5OA 5CA0B 3AHFA 3GPDG 1GUYA 4DVJA 4OXIA 4B83A 1NVMB 4AN1A 1OX4B 4TZKA 3SFZA 2HJHA 3PI7A 1RC1A 4QNNA 3DBLA 1GTZA 3DXXA 3UHPA 3RUAA 1B43A 3DMTC 1N9KA 1Z7GA 2Q1YA 3GAAA 3KQYA 3MILA 4HDCA 3HACA 4K46A 5TSDA 5CW1A 4WV3A 3JU3A 3IE1A 4GKKB 5H8WA 4WFIA 1V8OA 4I50B 1CUZA 1LTKA 2AWNA 4ZCTA 1O8CA 2V7TA 2I1QA 4FFOA 4KQHA 3ENKA 4ACAA 5AIAA 2IDKA 3UAGA 2OLJA 5IJAA 3B2NA 3IKMB 3KVNA 2FOIA 5JH7B 3VDRA 3VDQA 2O8VA 4E3ZA 1JEAA 3ID6C 2H4ZA 3Q98A 2VBFA 4QHTA 2X4LA 3CH6A 1CDOA 4F5WA 3S70A 5M29A 2CLFB 3G02A 4ZCRA 3U4MA 2WWXA 3EIFA 3L06A 2ALJA 2Y66A 1R12A 2DTEA 2ZI9A 3OD5A 1SUWA 2D5CA 1NNLA 2OFOA 1RI3A 1QRSA 4PRZA 3PGJA 1W4CA 3EZ7A 3LFUA 3O8OB 4TKUA 3FNRA 3P9PA 3W9BA 5K0CA 2XRFA 4TM7A 3QX3A 4NBSA 3PNLA 2X1MA 1KR5A 1PKEA 2REOA 2HMSA 1AE1A 3OZAA 2A4MA 3RVKA 3DNFA 3TIXB 3TTSA 1LJLA 2C1XA 4WMLA 3A9CA 2B1GA 2BFEB 5G3ZA 1P9LA 1QKKA 3AUSA 3ZH2A 4BB0A 3OOJA 2BIFA 3OP1A 4C05A 5JBIA 3BL8A 5KYWA 3NNSA 1T8WA 3OLWA 5AQEA 2WIJA 3BTUA 4K5QA 3TG8A 1J06A 2YHSA 2F17A 3LQYA 2X13A 5D6NA 3T35A 1XT6A 1H5NA 1L4HA 3TLGB 5LPNA 3BH6A 1DC6A 3JD1A 4QEZA 2BMVA 5TPWA 2BDEA 2RG7A 3DCIA 1G6HA 2UZ3A 3BCUA 1KDYA 4IIXA 3C7KA 3SIWA 1A9YA 3P9KA 2H2FA 3JXEA 3V8VA 1F2TA 4ERNA 1KY2A 5TEVA 3AR2A 4WZAB 2I55A 4LWQA 2EX4A 4HAOA 1PBNA 1XV5A 2QGZA 3ZC3A 4D4KA 3GLGE 4ZWNA 3E5NA 5GM2A 3RFXA 1WAMA 1ISIA 5I45A 1OR8A 1XTTA 3CRNA 4WBSA 4QTXA 4CMGA 4S35A 4L8GA 4NS1A 3TLKA 2I4TA 4MB6A 3U7FB 4PO3X 3LRTA 2EJWA 3EUEA 4GSYA 4H9GA 2QM3A 2O3SA 3LG2A 3NVMB 4YRBA 4WN3A 1OZAA 5A9SB 4G1CA 1CIJA 5DP1A 1DSSG 1ML3A 5EJEA 1SQSA 2OSVA 4QUDA 2YIMA 4FGLA 4DA8A 5J63A 5JANA 5DNYB 1BMFA 5DPMA 2IF2A 1R1DA 4AAYA 2J6IA 4YAIA 4H6WA 2ERYA 1XZBA 2AKYA 2VTVA 3H0EA 3WBJA 2PANA 1G20E 3KT6A 5KJEA 3R6GA 4UQLA 1SZJG 4W9RA 4X66B 2Z0MA 3CGGA 4ZYWA 1Q1EA 3QELA 1CETA 4FMBB 1N5RA 4TTQA 3A6HA 2IELA 3N7AA 4TYPA 1OPXA 2XUDA 3C45A 2ZZKA 2QTNA 4MS1A 3OZFA 4EKDA 1FXWA 5HZKA 3IO3A 3AESB 3LHDA 4Y6LA 1I01A 2XZTA 3CRW1 5JC8A 3JR7A 1RKBA 1XU4A 1TYZA 2DBQA 2J0UA 2X5XA 3HC7A 2B8WA 4JVOA 4DYHA 2NO9A 1M54A 1YOBA 1K7EB 2QMUA 2D74A 3MINA 2EERA 2QPAA 3P9XA 4FDUA 4HAZA 2VBGA 1W93A 4M0EA 5MN4A 1XPRA 4G2TA 2HWKA 2HCRA 3OTQA 4R7TA 2I33A 5CH3A 4MW2A 3UMSA 3VR5H 2RH8A 3WNDA 4B9AA 1F14A 1MQAA 5CDSA 3QOWA 5AXAA 2X0DA 1V5GA 3TBFA 3Q7IA 1JHRA 1GXSB 1C9MA 5JS2A 4A3SA 1AQIA 3BH0A 4P83A 5AXCA 2PQ0A 1JA9A 3FKQA 2GESA 1LTHR 1N0UA 3PCTA 2IYZA 4RJLA 3Q2OA 4EFDA 1R9JA 4EPRA 2UUAB 1P0FA 3A1CA 2H92A 4O4JA 2JG3A 1YC5A 3AF1A 2XGOA 1ABFA 2QQ5A 4UAVA 3LUGA 3M5CA 4FQ8A 4EG6A 2ARKA 4HEQA 2E4AA 4RLSA 3PDIB 4QXRA 5AM2A 4CIWA 1JA0A 1NVUQ 2JD0A 2OK7A 4FGJA 4C30A 3KOUA 1XTSA 2ZS7A 3B82A 3M5DA 3RSCA 1N6RA 3L82B 4YP6A 4JKIA 3FBGA 2ONJA 3V1YA 3EX7C 3WADA 4AROA 5J1SB 1WHTA 1U8YA 1GUAA 2QJTA 4KLZA 4NZPA 3U40A 3LWNA 3C8ZA 4OQNA 4WT7A 5A4AA 2IOFK 4OIMA 5JNUA 1IPFA 1E9AA 1YWGO 4OTZA 1K7YA 2B4YA 3C3AA 3S1SA 1WZEA 4ZKEA 3EVDA 3KEMA 3Q5DA 4R1SA 4L9WA 3RBAA 5F1PA 3N05A 5JATA 4I1IA 1C4KA 4EARA 5GADl 2W6IA 1SQFA 5EP2A 1EBBA 5IM5A 3WLNA 3U1BA 3C87A 1EVKA 4ZXPA 2ZSEA 1L5GB 1EJ0A 3VO2A 3AYZB 4ND1A 3BRQA 521PA 2F1IA 1FX1A 1QWSA 4D8WA 3WLIA 1ESNA 2Q3LA 1UF9A 1E6UA 1JWAB 1RXYA 2BKLA 3P19A 4LRUA 1EX9A 4JIGA 2PAAA 5DNWA 4DCMA 3QA9A 1TCVA 3E7XA 3LLUA 1O97D 3EXFA 2E85A 5K8JB 1A1SA 4PIPA 1NT4A 2BLNA 3NUGA 3UF0A 4UBMA 1WX1A 3OCUA 3R9XB 1VI5A 1S5PA 1N6IA 5DCLA 3AB3A 5IG2A 3BXOA 2BR5A 1XQWA 1GGNA 1SCIA 3L6RA 4OP2A 1L5FA 4NL4H 1J2UA 3CTPA 3ZBUA 1H8HA 5SZJA 2CVHA 3I1JA 5EIFA 3BN3A 2NPOA 4QOIA 1OT3A 3SZOA 4BX0A 4ZP1A 2HJGA 2QY9A 1A9QA 4LV5B 2O48X 1K8QA 5JCOC 2OV8A 2GZ1A 2UZ1A 1AURA 1N2BA 1U99A 3AUUA 3HYLA 4OP3A 3SBOA 1XTKA 4BQSA 3MK31 2R1VB 2W2LD 2DQ4A 4OKSA 1WMDA 5TB5A 3N7UA 1PNVA 2B21A 1ZRMA 4P32A 5FTKA 1ZKDA 1IZZA 1NVWQ 4X7BA 1CR4A 1HE3A 1QOZA 1L6IA 1M1UA 1Z25A 4I4LA 3IDOA 3G8YA 3OJFA 4W9NC 4WNCA 5EMHA 3VR5A 2O20A 4ZQHA 1K6IA 1SB8A 3FPAA 1XK6A 4CEJA 4OU4A 5K51A 3W5HA 1BRMA 1K63A 1N9GB 3MT7A 4PC2A 4DPMA 5DYIA 2YOHA 1U65A 1XP8A 3QOFA 2EJUA 5NLLA 2QN8A 1IG0A 5ALIA 2ONKA 2NZWA 2WJ6A 1UR5A 2P9FA 1O4VA 4L9AA 2JEZA 3PKIA 3BRSA 4NBWA 4TS9A 5GONA 4BN4A 5FOQA 2OPBA 1GGKA 4RWEA 4GM1A 1C30B 1KAQA 3EPJA 4BKPA 5JS7A 5IAEA 1FFXB 5I7EA 3OEHD 3TWOA 1ZD8A 4B2IA 4JDUA 4L9SA 1I6MA 5IZCA 2XGMA 1ZWKA 1IM2A 3CLKA 3KQLA 3W78A 4XB2A 5CNKA 3GO4A 2Z2ZA 4KX5A 3N5KA 5EMNA 4LHXA 3RTAA 3ZGVA 4D45A 5HQ3B 1E9CA 3NIDB 3LUPA 4XRRA 4IHQA 3INNA 4M9CA 2Z04A 3O8CA 4LGVA 2CLCX 4EZBA 3PFBA 4F92B 3F6CA 3CLRC 4OGKA 4ITVA 1XZDA 3HB9A 5EPUA 3EPRA 2BMEA 4P2BA 3FIUA 1VM6A 3KALA 3M6VA 5I3CA 2P0AA 1E5VA 1YT5A 5KMGA 2VDWA 1EFPA 1K4YA 2IFTA 3M3HA 4R8SA 1VKRA 1CKEA 3HVUA 5HCIA 5CAEA 5K9ZA 4PZYA 1AF7A 3AFOA 4BQNA 4BX8A 3EEOA 2IH2A 4EF5A 2Q7OE 4LY6A 1Q2UA 2PXXA 1YQXA 5I48A 2JZOA 2L42A 1QB7A 4BO2A 3QGMA 3HQ4O 2BGUA 2C2GA 4FM9A 4FYYA 5FPSA 1W34A 5COQA 3CLVA 3V32A 2QX7A 1JIIA 3ZD8A 4D9MA 1IUPA 1Q22A 1VSVA 1Z4OA 2CDAA 3LA6A 1XEFA 2JAWA 1NFFA 2IYLD 4M7OA 2B4TO 3A36A 1ENZA 3DJFA 1OLXB 2MU1A 4UNQA 5DGCA 3SR4A 3CE9A 4DR2B 5JADA 2QBYB 2H3EA 4CL3A 1U1CA 3RKUA 2V4UA 4YFYA 2FTKE 3RARA 2EYQA 1WIWA 3NGLA 1RAGA 1CR6A 1K5PA 3DCYA 2SKCA 1JG7A 2QIOA 3L9WA 3I5AA 3WLEA 1U2TA 3DBRB 1E3EA 1ZK2A 3F5QA 2VJPA 2ZM6B 4LTNA 4Y7DA 3CVYA 2Q6VA 5HIKA 2FZEA 1Y6FA 2YZNA 4FLEA 2FRXA 2I3AA 3D6UA 4UU7A 2N1MA 4RJ2A 3UZUA 3WNBA 4E12A 1XUOA 2YHUA 1Q21A 2X5JO 1XZJA 4Y9TA 1CJKC 1L4NA 1R3UA 2I4MA 1UWLA 2QE7A 3ADOA 5GIOE 4MKFA 1DC7A 3OPYB 1RXUA 2V6BA 4X1IB 2XLCA 1H4TA 4TLMB 3K20A 4KBYA 4OAPA 1CUBA 4C6TB 1RRMA 3KB1A 3GY0A 3RAGA 4Z4IA 3D7MA 2B4QA 1WU8A 1P2VA 2BKAA 4ZZ2A 5AW5A 4ARAA 3FWHA 1CXZA 3K0CA 3MBOA 4F1WA 4B32A 2UYHA 2IX3A 4WN9A 4LSGA 2QRZA 1Y1TA 3GLQA 2C7QA 1RLMA 2AHOA 3KXDA 4P86A 2OCGA 3CJTA 4CG3A 4PYRA 4QQ8A 2IUEA 3T5MA 3B60A 2I54A 5EJ6A 4WZBB 2CGEA 2XXAA 3BE8A 1JTFA 1O95C 2OCKA 3E9DA 1EM8A 1FW8A 2IOYA 3SHQA 3CW9A 3PC8C 1DT5A 5GGXA 3H2IA 1Y4DE 5DX1A 2LIPA 3T38A 1R6VA 4AF7A 5KZMB 1R4NB 3TS1A 2C07A 4HX9A 4BATA 3TKYA 1ND5A 3KWFA 1R18A 4RFSB 1N25A 3NTRA 2OENG 3ZZUA 1AKUA 1QDUA 3KAJA 4YRCA 3ZI4A 5K3BA 1UMDA 1NTOA 2G8LA 2RH9B 3KD3A 3A1EA 2XZOA 4WY8A 3LT0A 1CRQA 2HADA 3H5WA 5EI5A 4EKYA 4CKYA 1MU0A 3OWXA 5DHUA 5FI1B 3S8EA 1OBFO 3OQBA 1A4XA 1HDEA 2YYSA 3FCYA 3IR5A 4LV6A 1O94D 3AQIA 1IAQA 1PNOA 1J90A 4Z0NA 2GS9A 3FNBA 3CT4A 1QMGA 3VTAA 4D41A 4DSNA 4EYEA 5KWIA 2GILA 2VR1A 4M9SA 1Q16A 5BN4A 5LXTB 3GOHA 1QIEA 4QNMA 2YDYA 4NATA 1MT3A 2GCGA 2WLSA 4LDPA 4G2NA 2AJTA 1GRNA 4TTVA 4XGQA 4D4JA 1UK7A 1PS0A 4IKEA 1KH3A 1MEOA 2YHAA 4G4IA 4TRNA 3WFZA 4IY1A 2XYQA 5A0FA 3W2GA 4EG0A 2J0QA 5U1PA 1UBCA 1SPXA 2AYZA 3CW8X 5EZ5A 3VO8A 3USES 2UUPA 2Q8PA 1TRHA 3D4IA 1DX9A 1U8TA 1YFZA 2AF3C 2C99A 2QRVB 3VVMA 4N1AA 3SDBA 4F72A 1FW6A 2XKJE 1OQAA 1RLUA 1VA5A 4I5EA 3RS4A 3K0AA 1RQ2A 4W99A 2AJBA 4MUXA 1NAHA 3GDHA 4PYOA 2O54A 1O1YA 1Q19A 1AGNA 5HWSA 4C6RA 1I1HA 3U7HB 4L3VA 4UVHA 1FFHA 3VI4B 3WXBA 2Q2OA 4Z4EA 2ZYDA 3KV3O 1QHIA 3PDJA 4X91A 3WVNA 1YZTA 5LZ7A 1D6NA 1A9TA 3JQ7A 3EZLA 4MV4A 5JY6A 4G0WA 3CHYA 1LZLA 4GWLA 3OQNA 5DK6A 1EE1A 3B6ZA 1GP2A 4CF6A 1KQOA 2FEXA 5HCNA 4AZ0A 1J0CA 2KJQA 1RWBA 2TMYA 2IOQA 5JZVA 1FTGA 3EAFA 3ES9A 3COPA 3O95A 1V35A 1CDZA 4CVNA 4F04A 2LUOA 1TI7A 3TIGA 4INZA 5AKJA 5EKUA 2O5CA 1NX6A 2AUTA 2MSDB 3O4VA 3FCAA 3P2OA 3R5FA 4HFNA 4RV4A 5J2UA 2X3YA 5H3CA 1FX0A 1WKBA 1RPJA 3QLTA 4EGSA 2VHZA 3LX4A 1W52X 1IUOA 3G0DA 4F4IA 1BVYF 2A88A 4KZPA 4NSNA 2OZEA 2X1VA 3TE7A 4UHKA 2QXYA 2ZQ5A 4ZGGA 1ISPA 2Y9MB 4QBTA 4ZPJA 1N32B 1SBTA 1MTZA 3BWBA 4M98A 4BNNA 1LSJA 5I9TA 1QK5A 3G0HA 4JH0A 3PL1A 4OUDA 4G0ZA 2O8DA 1FDWA 2PS9A 4KI0A 1KVQA 5ADVA 3OD1A 1QANA 2YJ5A 5THQA 2A9QA 4GP6A 1YBFA 2XDWA 5C5IA 1H2EA 1KY4A 1PWHA 1UEJA 4RFLA 3VC1A 3WOHA 5JO9A 4RTMA 1BQ3A 1QJCA 4XIJA 2WSMA 4CM6A 3NBAA 2I6TA 4DNFA 1DIAA 3QBDA 2YVAA 4RGVA 3U4AA 3VYSB 1P73A 1R4MB 2EC5A 1T5TA 3E2MA 3PUVA 3FR7A 4G9EA 1N0IA 1OYOA 1JHPA 1MJGM 2CNBA 1NPTO 4TV8F 3RFVA 3ABRB 4R9RA 4E6EA 4Y6PA 1Y5NA 3QVSA 1NLMA 4OLAA 1UODA 2I62A 4CKZA 5DTQA 4EYOA 4OVKA 4A0GA 1RPZA 4E33A 4IEEA 3O82A 4ZC8A 1FNBA 4LZPA 2IVZA 4EHKA 2GJKA 2A94A 2QD2A 1Y89A 4RIEA 3NDPA 3MB5A 4JEMA 3Q3JB 4YMIA 2ECPA 4H7JA 4TSKA 3EXIB 1ZUD1 1GN9A 2Z2KA 5CK5A 1RNLA 4I4NA 3JASB 2Z2YA 3NHSA 1YJ8A 2XWPA 4HN4B 3N2YA 3QEAZ 1XYYA 1PO7A 2WU8A 3SBXA 4MLZA 3E5RA 4B4DA 4CLEA 1JDUA 3JAWB 3VPCA 2EQAA 4YECA 4BCBA 3QWHA 4FB4A 1H5UA 3JWPA 2VLBA 1I24A 1QZUA 3WSWA 2XVAA 3NWJA 1XPJA 4F3YA 5MN6A 5BOSB 3IKTA 3B6MA 4PQFA 4K88A 4FR2A 1VE9A 3ZGXA 4B3FX 5IKXA 3PP8A 1X7XA 4G0OA 2BM9A 3AR6A 4CZ2A 2BZ0A 1YZFA 3MTQA 2W8BA 1DRWA 3C6YA 3BFXA 3H18A 3KR9A 3M7IA 3PHCA 3G6WA 3H8WA 3HV2A 4XUEA 2JCXA 1X74A 4LMPA 3LNTA 4TROA 1KNXA 3TCKA 2NZXA 1II0A 4PG6A 2VSFA 1RJDA 4Q39A 1R4ZA 1KO7A 1LA2A 3C8UA 4IZOA 5A4JA 5LP6A 4M8LA 3V2IA 3KYCB 1IEXA 2GPTA 2NXCA 4H08A 4W1QA 3T8YA 4D25A 1GTSA 4ZGWA 3K92A 1NASA 2V1UA 1CUIA 2VQSA 2OL4A 3GEBA 4B71A 1UJ2A 4K86A 1LW7A 1ZRHA 1ELOA 3C8HA 2AEEA 2HB6A 3IOMA 5CB4A 4G85A 3BXFA 4WY5A 3EIUA 2ISCA 3NM5A 2QBYA 3LDHA 3HJBA 1S2NA 2QMQA 5KIAA 3A6GA 3F6YA 2IEAA 1PGJA 1XTZA 3QUCA 2H5LA 4MR8B 4ERXA 2WHQA 3AEQA 2WTUA 3DYBA 4UNRA 3IYLW 1IIBA 1WABA 2F9FA 1SHJA 4PANA 3IBGA 3NEAA 5DOVA 1OLUA 1YZNA 3KR1A 5JW6A 1JDVA 3AGQA 2RSLA 3K0EA 4C0KA 1I4WA 1W85B 5J4HA 4FWTA 1ACLA 3UYKA 3HUEA 3CFYA 3FVTA 3QPCA 3L4JA 2R1ZA 4MYCA 1JIJA 3IP6A 3V8QA 1ZL0A 3KJEA 5K99A 4B34A 1J8QA 1K1EA 4RL6A 5DHPA 1ZIXA 4MGYR 2O8FA 3TBKA 3U7QB 1Q92A 4Z4QA 3S6JA 3FD8A 1GARA 1RM5A 1P5ZB 2GK6A 2IEBA 2QAGA 2YWDA 4LY3A 2EJVA 4RA6B 5JASA 3OHPA 1P0PA 2CD9A 4K03A 2QR2A 5REQB 4U7PB 1G5QA 3C1UA 4FYHA 4WY2A 5G0VA 3W34A 1MMFB 5FJIA 3LP8A 1NN0A 3A2LA 2JD2A 3GT3A 5FORA 3U31A 1PL7A 1HO3A 1ZMOA 3H16A 3KJGA 2EZ9A 4FGKA 1UJ6A 1C1XB 2PQMA 2JAXA 5DXFA 1N78A 3D02A 4EO7A 1GZDA 1CE8A 2YVQA 4P4SB 2A9RA 1UPXA 2GFQA 3KZMA 2JGDA 2W4MA 1EZZA 3QKSA 4GMXA 4JT4A 3WLHA 1ZJZA 2VP3A 1ZNWA 3RVBA 3SS8A 1I7PA 3ND8A 1AKMA 4H3HB 4ZU6X 5HDBB 4R8MA 1J1ZA 1RQGA 1FFBA 2PSJA 2YNMD 2YIVX 3GJ5A 4QXMA 1OC4A 2QLNA 1ZM3A 3DV9A 3FPKA 3MJFA 2NZ2A 3JWHA 2YY6A 1NUAA 4I9NA 4QE3A 4RY0A 3NKFA 4HRXA 5E7JA 3HGTA 4PTYA 4TMWA 1CG6A 3WRYC 2EGHA 3BZWA 1SUCA 2RI0A 1ZJYA 5LWQA 3CVJA 3QVUA 1UBLS 4MSUA 3KCNA 4X61A 4YCBA 2IXAA 2MYTA 3FTNA 2ZXFA 4RKYA 4FCTA 5K4GA 4X24A 3PNPA 4HYEA 4XJSA 1H2XA 3I76A 4XASA 5BYKA 1MAVA 4TMXA 3IALA 4R9VA 3MS2A 3WWOA 4LXYA 4A2WA 1OBHA 3LQ1A 2OY0A 1CQXA 3C97A 3DEJA 2E0IA 2KM1A 4GI2A 3ZV7A 3PQFA 4HGZA 5A3RA 5FPKA 5E1OA 4DT1B 2F1HA 4S2EA 4E11A 1C9YA 3P0HA 1YJBA 4UM5A 4Q1AA 1EXMA 4CN8A 1FYVA 1R15A 2Q6LA 2WM9B 1MCZA 3CS3A 3D6MA 2IV7A 2HBRA 4DQDA 1H69A 3AP2A 5JZMA 4ZVTA 1XR3A 3JY6A 4BLSA 4V1CI 4CQNA 3OH8A 3PVSA 4BX2A 5KDOA 3ZDCA 2G8NA 1AGXA 1GPUA 2CFCA 2K7ZA 3CIFA 3I6YA 3K6RA 3K9QO 3KWLA 3THSA 1KFCB 3G85A 4K1XA 1JW9B 1PX2A 1ZR4A 1I4DD 4DSZA 2WAYA 4L5CA 1G9SA 4LNUB 1XXLA 1XELA 2IUFA 4KXVA 2FWRA 3G2IA 3II6X 4XVRA 4L6AA 1QVAA 1US8A 3E3MA 1O9GA 3B1YA 2I2BA 2J1LA 3UBMA 2R84A 3L0SA 4RK0A 4U2GA 4JZKA 5D8DA 2QZSA 3SIRA 3U62A 2PDAA 1JP7A 2X0FA 1VPEA 3MJSA 3NP7A 3ZDAA 2NYVA 2NYUA 1U8XX 4RCYA 4EEKA 1J8MF 1AIPA 3JZDA 3EZYA 3TDMA 4BVFA 4DMCA 3ISTA 4IGKA 1G3QA 5LJIA 4S1VA 2PWYA 3C16C 1TU4A 1BGXT 3MCZA 5EFZA 2PV7A 1KDPA 1VRWA 1F5SA 1WE2A 1PT8A 2A5LA 1U3DA 1VMIA 4U3JB 1FSZA 2EF1A 4UDYX 1MEEA 4Q4HA 5KQPA 3OMXA 4BVEA 2ZR7A 3AF2A 1A5TA 2PX0A 1KVTA 4EVSA 3GEPA 4OSEA 4PXSA 1DEAA 1KA9H 2V7QA 5G0UA 1RAAA 3WKEA 5LKRA 3UK1A 1AXGA 4Q82A 4N48A 1VBKA 2WF5A 3HY4A 3MERA 2W2TA 2H1LA 4K9PA 2CJFA 4Y2PA 3KQTA 3OQIB 1T25A 2W71A 4JI3B 4F2PA 1PV4A 1UBEA 4DARA 4KIWA 2EGGA 4CG0A 2JI9A 2LRHA 2PGNA 1B0ZA 3CZCA 4IGIA 5CU7A 4BJHB 5FA5A 3PKJA 4A2QA 4JYZA 1GL7A 4R1QA 4KVFA 3GRFA 5KOHB 1Y1SA 2KBEA 5J5CA 4UMVA 4YRMA 1H2WA 1S7GA 3DT6A 1SWWA 1CUWA 1XJ0A 4KOAA 4ZO7A 5FUWA 3SC6A 5AHKA 4E15A 5ETJA 1RYHA 2UVQA 4BEBA 3DDZX 4PCVA 1YZLA 3CONA 5FNVA 4ZZ3A 2ORIA 4BO6A 4KH1A 1GZ5A 2ODEA 4NIMA 5GJVC 1L5SA 1Y63A 2ZB8A 2WMNB 4J1TC 1GKIA 1LVUA 1QNLA 4MCIA 4NI5A 1I3LA 1O6FA 1PVVA 1SIUA 2MSCB 3EG9A 2PKQO 3OZCA 1FQJA 5DRYA 5KKAA 4XCVA 1MH9A 4HRAA 5EEGA 2KHZA 2J9ZB 3S27A 4DB4A 1O6CA 5IBRA 2WSBA 1Q0HA 1AS3A 2Z3WA 1G1MA 2B3DA 3I5YA 3GFVA 3P32A 3WJ1A 4YY3B 3THXB 3L8GA 1Q3TA 4JQZA 1NV9A 2B2CA 1BMDA 1R0BA 1LKZA 1YOVB 1T4CA 5DSZA 2AUMA 2H54A 1JXMA 1RPAA 3EVBA 5G53C 3UUEA 3QVMA 2CHVA 3KZCA 1W73A 2IDZA 2VNHA 2X9LA 3ABOB 4U7HA 2OFFA 2ZDQA 1MOSA 3RBXA 4U2BA 3GA0A 4EHIA 3EDMA 4A8JA 1SVKA 2IX9A 2PR2A 3KKOA 2CZQA 2YZKA 1J39A 2Y1WA 3DE6X 5HG0A 2P6UA 1B26A 2Q6OA 2PD6A 1F0NA 2J87A 5HMLA 2XUAA 1DQPA 3OSZA 3LUKA 3GLIB 5AUQA 3R20A 4PZAA 1LF5A 4JI5B 4BGVA 5LZ2A 1JDPA 2RHHA 1PEYA 3A6JA 3OLZA 3RROA 1FTQA 2BFCB 1VLVA 2OT3B 4BPBA 2Z58A 1IAVA 3WWYA 3X2SA 4KLCA 1O96A 2H5JA 4KWEA 4M1YA 4BXOB 4O4HB 1X15A 4PS0A 4YBZA 1JLLA 3D43A 1UEIA 4V0ME 1ZCJA 1QGDA 3N2IA 4PYIA 4CF4A 5IT5A 2HEGA 4QOFA 3WA6A 3DWEX 4RVFA 5FI3A 4FFMA 1U9ZA 1K6JA 1NM5A 4U7GA 3HJTA 1P1JA 1DBVO 4E5KA 2QK4A 4TLAA 1M8KA 2W2VA 2IYUA 4QUAA 5CVJA 4G01B 2JLQA 1MAHA 2DSTA 2NO7A 1Y42X 4KIFA 5T64A 1G0NA 3HV0A 2XB4A 3RRNA 5ES3A 4HFMA 4WDRA 4DVGA 3PEWA 2CMFA 3AB8A 4HMPA 3N86A 4K81B 1CU1A 3DEIA 4Q1FA 3U56A 1G7TA 3VNBA 4B3JA 4IHAA 5C8ZA 2E18A 1MQSA 1Z7BA 3G23A 2Q8QA 2ST1A 3DTVA 5K3AA 1JQKA 2PX3A 3RT7A 1A8SA 3MD0A 1SOAA 5IEBA 1M1YA 3SKXA 4DLWA 5JTUA 3ZY4A 3FMGA 1F2VA 3IIEA 1EUDA 4QGGA 3TDNA 2HMYB 1DUIA 2HCTA 5DYWA 3I5XA 2WM2A 2JKZA 3E23A 4PXAA 2ZM5A 4U8HA 1G3IA 3C3CA 4O25A 3NVAA 5HIJA 1YSCA 3ZU4A 2WKRA 1T8TA 1JFVA 3IOCA 5KB3A 3I6QA 1P17A 4JKYA 4BP3A 4MZXA 4MUFA 3HJFA 2WILA 5L3SB 2C58A 1NQVA 3EXAA 1T3SA 621PA 2A1TR 4LW8A 1KI7A 3ONEA 3M1LA 3U3DA 1SUPA 1TKCA 3HJRA 2G9VA 2GRAA 2F1JA 2I03A 2FX5A 4R81A 3AL0C 3OSUA 1PK7A 4HDKB 1DX6A 3AUXA 3IHLA 4QARA