4Q3LA

Crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
b'SIFTYQEKDIYYEIDGTLDINSDVIVILNGIMMSTKSWDAFVENFSKNHVLLRYDMFDQGQSSKIEESYTQTIQVELLKNLLEHLGIAQANIVGISYGASIALQFAAKYPTMIKRMVVANVVAKTSPWLKDIGDGWNEVAKTGNGLAYYHITIPYIYSPQFYTLHNDWMEKRKELLVPLFSTRTFLDRMIRLTKSAETHDVIKDLPNIKTPTLIISSEEDYLTPPFEQKYLQEHLQNAELVSIPNCGHASMYEVPKTFTALVLGFFGQTKLDYQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGS-M2
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 100
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q3lA00
2LIPA 2OLEA 3FCYA 1A8QA 4IQ4A 4L0CA 1XZBA 2BKLA 4FMPA 2BJHA 1R88A 2HA7A 5AM2A 1E8MA 4WFJA 3DJYA 1SOMA 3I1YA 4ZXFA 2G4LA 2HDWA 2OXEA 3STXA 3S8YA 1XRRA 3QM1A 3FBWA 2J4FA 3RM3A 3IULA 4J0JA 1CUXA 5AKYA 3DYVA 2PPLA 4N8EA 4S0XA 3C70A 1DT3A 2OCIA 4LYDA 1CLEA 4BATA 5HKAA 4EY8A 1WB6A 1VA4A 4BZWA 4AMZA 2WFLB 4K2AA 4G8DA 5FPQA 3O4HA 3DL4A 2QT9A 2Z8XA 1XLUA 5AM3A 3UUEA 2R11A 2DHCA 3BJRA 4KE7A 4RPCA 4BCBA 1XRMA 4UFNA 3SX4A 4UFPA 2XDWA 3LCRA 3FYTA 3SC2A 5CH5A 3FSGD 2C5FA 1AGYA 3WK7A 3TEJA 4UBIA 4QDUA 3AIMA 3H17A 4BTLA 4C01A 1N5MA 1EK2A 4I4CA 4AO6A 5HFAA 2DHEA 3KXPA 1G5FA 4B83A 4GLBA 3I6YA 1UK7A 3VJKA 1MN6A 2Y1KA 4PSDA 4BCCA 3V1KA 2XUIA 5T4HA 1IZ7A 4FLFA 4N8DA 2XUGA 2DFPA 1VLQA 4IH9A 2XUAA 2ZJ6A 1UT6A 3G9XA 4MJ3A 4N8SA 1ZI9A 3QPCA 5AM1A 5IVDA 4B85A 2JGEA 3HXKA 3R40A 3G9UA 3DOIA 1W76A 2WU4A 5D7BA 3PI6A 3AZOA 4MQMA 2XMBA 1JJIA 3FYUC 1CUCA 4L3WA 1XZAA 4KYVA 4DMFA 5ALZA 1E89A 1HL7A 1GKKA 4X6YA 3MVEA 2FJPA 2Z5GA 5AOCA 3STWA 2VATA 3DNMA 4EZIA 4X00A 2W6CX 1QLWA 4C4ZA 4PQEA 3N2ZB 5LZ9A 1IUPA 1FFAA 3K9BA 2WFLA 1DX6A 1AMNA 3KDAA 3ICWA 2JF0A 2XT0A 4OUKX 3ANTA 4X93A 3FYUB 3IA2A 5CTAA 3MUOA 4ARBA 3D2CA 1IUOA 5IVKA 2GYWA 4HXGA 4MXDA 3C45A 3C8HA 5AM4A 1T4MA 5DTJA 2PVSA 1U8EA 3I6ZA 3AFIA 4NVRA 2FJ0A 3MGAA 1BROA 5H3HA 2QUBA 3ZPXA 5JZ9A 2RAUA 4HAIA 2Y2VA 1SFRA 4XIIA 2XUFA 2WUDA 4B7ZA 1Q0RA 2WUEA 5EIHA 3O95A 1CUAA 2QTBA 2YASA 3I2GA 4X71A 4Z49A 3E0XA 2HFKA 2HA4A 3SK0A 3KWJA 3ILSA 3EQ7A 5A7HA 4QEKA 5ALEA 3NWOA 2B9VA 3PF9A 3A2MA 3FLAA 2XUPA 2RIPA 5AIBA 1JI3A 1QIIA 1XZIA 2XUJA 2RHWA 2CJPA 4A23A 2HA3A 2X8BA 1F8UA 4AB1A 4DNPA 1CVLA 3L1IA 4OPMA 4KRYA 2DR0A 1TCCA 2B20A 3ED1A 2AJ8A 2RGUA 5T4EA 3KSRA 1BE0A 4BE4A 5LZ5A 1E8NA 5CXUA 1DQYA 1MX9A 2J3QA 4FBMA 4NS4A 4MEAA 3R3YA 4LHEA 2Y6UA 5EHXA 5AOBA 5AM0A 3PDCA 3V48A 3DL7A 4Q3OA 4OB7A 3R41A 5AI8A 3DKKA 4F21A 4ZREA 2H7XA 3HABA 5ALRA 3FYUA 5HF5A 1JMYA 1EINA 3H0CA 1C4XA 4HRXA 4FLEA 5K3FA 1UFOA 5ALXA 2JGKA 3G0IA 1AZWA 2HRQA 4JYPA 1P0IA 4LKOA 2I03A 5AKLA 4CIBA 3JWEA 4LYEA 4J3JA 1XKTA 1GGVA 5AKJA 2XQFA 4BC0A 3B3QA 2VA9A 4MEBA 1YAJA 1NU6A 4J0KA 4X90A 2GBGA 2QS9A 4DMCA 2VTVA 3W06A 2XQGA 2OAEA 2WG1A 5E2IA 3E1GA 1GQSA 3F98A 4UHFA 2FX5A 2W22A 4WFIA 3TJMA 5A7GA 3H2HA 2XMDA 3JW8A 1OCEA 4Y2QA 1EK1A 1CQZA 3ICVA 1QIKA 1W75A 1CEXA 1UOPA 4C87A 4MWSA 2OGSA 1BN6A 4ZV9A 1AURA 4KE9A 1KU0A 4X7BA 3D5EA 2ZYRA 4TVKA 1F0PA 4N5IX 4DNOA 1BEZA 5EHZA 3ZLVA 1JKMA 2IITA 4OD0A 3HRHA 4UFOA 5JAHA 1FSSA 4B0PA 1CUDA 3BWXA 1LPAB 4AO7A 2EEPA 2XUHA 1QIDA 3L1JA 4H0CA 5FPPA 3ESAA 1PJAA 2QVBA 3WJ1A 5LZ8A 4OB6A 1D07A 3W9BA 1EB9A 4WCVA 2C5GA 1FFCA 3GFFA 3BXPA 1THTA 2XUQA 1XLVA 4UBJA 1QIHA 3DYIA 3DCNA 5AKHA 3KD2A 3EIOA 5AK4A 3PUHA 3G9TA 3I28A 1BU8A 4LIPD 3C87A 1ZI8A 3TRDA 1X2BA 5LLSA 4X3CA 2WIDA 4GXNA 4P08A 4Y9SA 1E5TA 4K6HA 2H1IA 2RI6A 4DMKA 2QMQA 4C89A 4UHCA 4D9JA 3QH4A 4J7AA 5HKBA 1WHSA 4V2IA 3VJLA 2QOEA 4U2CA 1CQWA 3F97A 4BYMA 4DTCA 3WKCA 4Y2YA 1K63A 3VISA 2EDCA 4BRSA 1UK9A 3MUNA 3HC7A 5DLPA 3CN9A 3ZWQA 3OURA 2D0DA 1R1DA 1ZGBA 3IBTA 4F5ZA 1EA5A 3WIBA 4XJVA 4H18A 1XZEA 5D6OA 2WQZA 5CBKA 4WDRA 4Y2SA 2VEOA 3STTA 3WWCA 5K3CA 5ALOA 1OILA 2XMRA 4CCYB 3ZLUA 1CUYA 2O2IA 3WWPA 1ACLA 1OXMA 1AQLA 2JEYA 4PSCA 1YCDA 4X97A 4EY4A 3M82A 3W2TA 4FDMA 5DJ5A 4UBLA 1QO7A 4W1QA 4GI1A 3DDUA 5FKJA 1K8QA 3RARA 3WL6A 2VT6A 3FOBA 2J3DA 1BEEA 1HLGA 2QKYA 2GZRA 1W4LA 4G8CA 1H2YA 1A8SA 3O0DA 4ROTA 5ALPA 2R8BA 2CZQA 4G4IA 2H7CA 4YASA 3R3UA 1TCBA 1EXWA 1QIFA 3E4DA 3FWHA 3HYSA 5ALFA 3F67A 4Q82A 4BDTA 4UBKA 3K6KA 4AN1A 2OCLA 1K5PA 4QWMA 4DNFA 3WKAA 5DNWA 1QIJA 2JEZA 2OCGA 4FTWA 5K3EA 1A88A 1XZDA 4G1FA 4IO0A 3WJ2A 3IUMA 2I3DA 3KOOA 4H7DA 1ORVA 3EQ8A 2V96A 1TCAA 2XMCA 5C8ZA 3G0DA 5AI4A 4U2FA 5JYCA 1P0MA 4P92A 4KAFA 1NX9A 4LXGA 4J0DA 2DSNA 5SYNA 3WI7A 5EIAA 4B81A 2VAXA 2Z3ZA 2ZJ7A 4RE6A 2JGFA 2PUHA 3D59A 3T4UA 2HFJA 3H18A 5T4FA 3GA7A 4CCYA 3EBLA 4B84A 1U4NA 2NW6A 2ZYIA 1QIGA 2PSFA 4XVCA 1CUWA 1LPPA 4AZ0A 3I6MA 4BZZA 1LPNA 3RKSA 1JU3A 4AQDA 1DU4A 4W1RA 5ALLA 1XLWA 1MU0A 1P0QA 2YH2A 4PW0A 2XMQA 5A7FA 2FUKA 5D3KA 3BF8A 2YXPX 1XZHA 4DGQA 3A2LA 4KRXA 5AI9A 4QDTA 1XZLA 2IX9A 1EVQA 2G5TA 3LS2A 4O08A 2ACKA 4B0OA 4FNMA 1BS9A 4UHBA 3G0BA 2QZPA 3BIXA 3WWDA 1QGED 5JADA 1R9MA 3P2MA 1UK8A 4NZZA 5C8XA 5CMLA 1LZKA 1XRNA 2CMFA 1LPSA 5AKIA 3ESCA 3D2BA 1AUOA 4M0FA 3GELA 5C8VA 5F4ZA 3GBSA 4MYSA 2V97A 2JGJA 1RWQA 1E8DA 5ALUA 2WLSA 5E4JA 1U65A 5BV7A 1W52X 3ANSA 2HA0A 3M81A 1CUJA 2XE4A 5CW2A 2WUFA 2JIDA 2BUBA 3CCBA 1ZD3A 1LLFA 3AIOA 3IUNA 1VOTA 3R3XA 3WK8A 1ZOIA 2ZSHA 5JD4A 3WYDA 4WFKA 3FCXA 2VJDA 3HZOA 2H9YA 4YPVA 1QFSA 2QRUA 4DMHA 1UKBA 1R50A 1L7RA 2O2HA 4Q34A 4BTVA 3DKRA 3STVA 3RLIA 4AX4A 4BVKA 4H35A 5JARA 3I2IA 2CKMA 2OCKA 3BDIA 4PV7A 4EBBA 2ZYSA 5LZ2A 3HSSA 2B61A 3DOHA 2I3ZA 3PE6A 5HK8A 2QJWA 1CUIA 3AZPA 2IIVA 1IMJA 3H2IA 1TAHA 1W6RA 3C6ZA 1EB8A 5BWBA 2WFMA 3OM8A 4G9EA 5AKZA 3WK9A 3E3AA 5ALWA 4OB8A 4ITVA 2VT7A 1CUUA 3WWEA 2HU7A 4BBZA 5AK6A 5JZBA 1EI9A 4NMWA 3U1TA 2GYUA 4C4XA 2VJCA 4Y2VA 4P9NA 4UUQA 1PFQA 5AK3A 4ZI5A 4MWTA 1YAHA 5FP0A 1QO9A 5AKKA 4B9EA 4BE9A 1MX1A 4QNNA 2BAGA 1THGA 2PSDA 2QJRA 2GBFA 5HFNA 1MPXA 4L72A 1WOMA 4CCWA 2QXUA 5IVHA 2HHAA 3IUJA 1WM1A 1DWQA 3G0GA 2XLBA 3R3VA 2ZJFA 5FRDA 3QMWA 3OOSA 4Q3KA 4FHZA 4INZA 4H7EA 5AM5A 4E11A 4H7HA 4AZ3A 4Q05A 5ALMA 2B4KA 5AHXA 1GPLA 5AKXA 5HCUA 4YX9A 3V9AA 4OSEA 4Q3LA 3WK4A 2ACEA 1SCKA 5AO9A 5K3DA 4AN0A 1XRLA 2C0PA 4X6UA 3PICA 3QMVA 5ALKA 1H22A 3K2IA 3H04A 3QITA 4X94A 5JZSA 3HACA 4ZWNA 4H7JA 4B80A 3PFBA 4EY5A 4QE3A 5JANA 1RP1A 1AKNA 3V1LA 1XRPA 2WJ6A 4G8BA 4XX1A 4A16A 2AJBA 2P8SA 4GBGA 1ODTC 3AINA 1XROA 1CRLA 1ODCA 1QONA 4PSUA 1ZJ4A 1GKLA 2WTNA 2WIGA 1EDDA 1ZI6A 4OYLA 4OU4A 4KEAA 4FFVA 3NGMA 2D5LA 4AMYA 3PUIA 4UHEA 2AJDA 3QBJA 1ZJ5A 1MNAA 5LZ7A 1WPRA 4JEIA 5HK9A 4B82A 1USWA 2PKYX 4K5QA 1XZKA 2V98A 3FVTA 2XMZA 5FLKA 1A8UA 2GYVA 1IZ8A 2PUJA 3YASA 4IH4A 4DYHA 5A62A 1YS1X 1QFMA 1LBTA 1UWCA 2PSHA 5C81A 1EDEA 3H1AA 4Y2TA 2XUDA 5CT6A 1MAAA 4GHWA 1XZGA 2AXEA 1ACJA 1XQWA 4EUSA 4G4GA 2H7YA 1J2EA 4C88A 5ALIA 3IDAA 3ZI7A 4QZVA 1ISPA 1SC9A 3FVRA 2WUGA 2PBLA 1LNSA 1CUBA 3L1HA 4BP8A 2VJAA 3G7NA 2WJ4A 2WHRA 1Q0ZA 2G63A 1F0NA 5AH0A 1H2XA 2DQZA 1YS2X 5EHQA 3G8YA 2XLCA 1FJ2A 3O4IA 5ALJA 4BRZA 1KEZA 5IVIA 5JALA 3HI4A 3ZV7A 1X70A 2ZSIA 4CI9A 1QJ4A 2OQIA 1TQHA 4QLAA 5EFZA 3WL8A 3G02A 2PM8A 1KU6A 2BCEA 1MX5A 3WMRA 2QXTA 3C5VA 1UOOA 4W9RA 5JAUA 2DCMA 4M0EA 5CRIA 4HZGA 5ALGA 4EB0A 4KE6A 4FOLA 3WZLA 1UKAA 2E3JA 3F8SA 5EI5A 5CT5A 3AUKA 1FFEA 1W1IA 3GZJA 4I19A 2O2GA 1U2EA 2BFNA 4X6XA 5KREA 2C4HA 3WKDA 3ESBA 1VXRA 2PL5A 4XWGA 2YYSA 1CUGA 5DYYA 5JD5A 1QIEA 4H7FA 3D7RA 1SCQA 3V1MA 3SWWA 1UKCA 2I78A 4W1PA 4J0GA 2AJLI 1N5RA 1MAHA 5CT8A 1DX4A 1E3QA 1ZGCA 2XMSA 4UHDA 5DYWA 4A5SA 1TKRA 3H2JA 1K6EA 2Y2UA 1EH5A 5JASA 5LP1A 1XKLA 2C0QA 4Y2PA 4E15A 1Q84A 5D3ZA 1HPLA 3IURA 3BL8A 4K6KA 5ALYA 3STUA 3WA6A 1EHYA 2JGLA 1VZ2A 4CG3A 5K5EA 3IUQA 5DNUA 2O7VA 3OPMA 4JNCA 3FAKA 3V1NA 3BF7A 1CIJA 3QMMA 3D3NA 5LYYA 1JT2A 1CV2A 2OG1A 3CXUA 5FUMA 3DEAA 2ZYHA 2X76A 2DQYA 3IB3A 1EDBA 1X2EA 4BAZA 2JGMA 3Q0TA 3M83A 3QPAA 4KR0A 1GZ7A 5AIAA 5HF6A 3WKBA 1ZIYA 3WL7A 5K3BA 1LPOA 4JUIA 2HIHA 4AO8A 4U2DA 2C58A 5DYTA 1CFJA 5YASA 2ZVDA 1BCRA 3AJAA 3GUUA 4AXBA 4DIUA 2DHDA 4HRYA 4B9AA 3O4GA 1ZD4A 3B12A 5I9IA 2ES4A 5FDFA 1XQYA 5ESRA 4Y2JA 4LXHA 4HS9A 1MNQA 1J07A 1JJBA 2GBIA 3DQZA 2CBGA 2WU3A 2Y6VA 4FFWA 3VJMA 1B6GA 2ONCA 2XB6A 5EIEA 4B6GA 1ETHA 1LPMA 2O7RA 1QTIA 1XZMA 2PU7A 5CURA 2ORYA 3H1BA 1DWOA 1CUHA 3OTQA 2WG2A 4GECA 4KE8A 2HRRA 1NU8A 4KACA 2JBWA 1QOZA 1LBSA 5AI5A 2HU5A 4IHAA 1B41A 2WSLA 3DD5A 3CN7A 5KBYA 4Y2UA 1XZCA 2EDAA 2QM0A 4OYYA 5BOVA 1AX9A 4RNCA 1H2WA 2J4CA 5AJHA 3VDXA 3GROA 3OG9A 3VVMA 4RGYA 1G4HA 3AZQA 2HU8A 2PSEA 4CFSA 5AI0A 5LKAA 4F0JA 2ROQA 4LXIA 4J0IA 2BGRA 4WJLA 4JH0A 4IH1A 3WK6A 4UHHA 2OGZA 1DT5A 5T4BA 2QR5A 4J0HA 5AKGA 1WPXA 5A2GA 4FBLA 4FLMA 1XZFA 1FFBA 1CR6A 1Y37A 2UZ0A 3D4LA 4HXFB 4EA6A 1LPBB 3DLTA 2CUTA 3C6BA 2ECFA 1UOQA 4QDOA 3I1IA 3I2JA 1HKHA 3HEAA 5DNVA 1ZICA 7YASA 3CCCA 4X85A 5SYMA 1GT6A 1GPNA 2CB9A 3PF8A 5HF8A 1VXOA 4Y2RA 1DQZA 1HQDA 1ZD2P 4EY6A 1AC5A 5AI6A 4PF1A 4CIAA 2XQIA 1GQRA 4WDQA 1XFDA 2WIJA 1BRTA 3WK5A 1CUZA 3VKFA 1WB4A 2WJ3A 3H19A 5JAPA 2Z3WA 5BWCA 4HVTA 3W04A 4BCDA 4DLNA 1ORWA 3U0VA 5FOQA 3A6ZA 3W9UA 4K6GA 4W63A 2XQJA 2Z8ZA 5ALSA 1JJFA 3C5WP 5LZ4A 4HTAA 5K3AA 5K3FB 4BAGA 4U2GA 4QLOA 3H2KA 4I3FA 1ZIXA 4Y7DA 1SCIA 4OU5A 4BVJA 1R9NA 1EVEA 2RONA 4X95A 1GPKA 1HBJA 3ZLTA 1R4ZA 4EHBA 4WY8A 4C6HA 1JU4A 5ALQA 3D2AA 4E46A 1ODSA 1H23A 3HJUA 1QZ3A 4HXEB 4J03A 1N8SA 3FNBA 3Q8WA 3WIOA 4DM7A 5AKEA 5JD6A 1FFDA 1XZJA 1N1MA 3R0VA 2GZSA 1UXOA 4J0CA 4EY7A 3H2GA 3O9MA 4P93A 2GBCA 5J3JA 3NUZA 1MT3A 4MYDA 4CG2A 5ISMA 2C7BA 3PFCA 2WIKA 3WWOA 3X3HA 4ETWA 4GEGA 2WHPB 4CG1A 5HQ3B 4W1SA 4BP9A 1VA5A 5DWDA 1G66A 1UZAA 5FXMA 1VJ5A 3DS8A 2VQ6A 2BUCA 1M33A 1Z68A 2V9ZA 5JAOA 3I2KA 5KWJA 2VSQA 1RYYA 3KWFA 5CH8A 3EF3A 3C6XA 1LGYA 5CT4A 4E14A 3AIKA 5E4YA 3RK4A 1VZ3A 2PX6A 4UPDA 1L7QA 1CUSA 1C7IA 3LLCA 3A2NA 1JMKC 3F96A 4ZGBA 3G9ZA 3QYJA 5FV4A 1F6WA 1DWPA 2WKWA 4UBNA 3WA7A 3FLBA 4H77A 3LP5A 5I7UA 1K4YA 1P0PA 1GXSA 3W05A 4ZV7A 1CPYA 3M3DA 3IIIA 3BIWA 4FWBA 1S8OA 4KAAA 5A71A 5ALDA 2HM7A 2OQVA 1ZD5A 3R3WA 4WY5A 4YK7A 4TPKA 1EX9A 4PO3X 4ARAA 2WM2A 1O6GA 1YSCA 2BUAA 5LIPA 3TGLA 1XRQA 2PU5A 5ALTA 3UUFA 1T2NA 3G0CA 4QDZA 1IVYA 5CXXA 2WG0A 1MTZA 3WL5A 1JFRA 1G42A 1VKHA 4Y2XA 1VE7A 1H2ZA 2X5XA 2QUAA 3JYHA 3C6YA 4QA9A 4G9GA 4F60A 3UMJA 4X92A 1UK6A 4Q1VA 2WHPA 2XQKA 1YASA 3O4JA 2RHTA 5HQ3A 2Q0XA 3A70A 2HADA 5KWIA 4U2BA 1Y7IA 4X91A 3VVLA 1WB5A 5DTIA 5HZGA 3HLKA 3LIPA 3NOXA 5AK5A 2HA5A 2XUOA 5AP9A 2XI4A 3WKEA 3B5EA 3BE8A 3C43A 2HA6A 3D0KA 3WQHA 3EQ9A 5LKRA 2JGIA 4GWLA 1YA4A 4H7KA 4QDXA 1MO2A 1QE3A 1WCYA 3C8DA 4BB0A 4BDSA 3STYA 1CUFA 1CUEA 4BAUA 3ESDA 1DINA 6YASA 3QPDA 5IH7A 3S2ZA 2OAGA 4U2EA 4KAJA 3WYNA 3FSGA 5JATA 2WILA 4PNZA 2WTMA 1Y7HA 3LIIA 3VXKA 4FNGA 3I2FA 1Q83A 5AOAA 5A6VA 5ALVA 5IKXA 1HDEA 2AJCA 4BC1A 4L9AA 1LZLA 5HF9A 4G5XA 3I2HA 4UBMA 1TIBA 3R3ZA 2VAVA 4RE5A 2VJBA 5CH3A 1TRHA 1O6FA 1QIMA 2VF2A 4DSAA 5CT9A 1J1IA 1YB7A 2XUKA 3F9CA 1PV1A 1I6WA 4H7IA 3QZUA 3O9VA 4FKBA 1J06A 1XQXA 5AICA 4UBOA 3IVMA 5E4TA 4TGLA 4G4JA 2HL6A 4GDMA 3WLAA 4N5HX 1YB6A 1CUVA 5ALNA 2WIFA 3BJMA 1IUNA 1MJ5A 1VE6A 1A7UA 3WZMA 4QWWA 5EGNA 4JYMA 1YR2A 1R3DA 1BN7A 4M0MA 1C7JA 1QTRA 5EHNA 1L7AA 3T52A 4ZRDA 1YA8A 2XMGA 1TK3A 2CEKA 4MQLA 1E66A 5C7YA 2HA2A 4KJXA 5JIBA 3FLEA 4GW3A 2OPHA 4DSZA 5I8PA 2WFZA 2PSJA 3AILA 5ALHA 2K2QB 3OC0A 1BCSA 4OCZA 1XQVA 4C4YA 1DTEA 2G5PA 3QVMA 4DNQA 1WHTA 3BDVA 2OGTA 4BVLA 2WHQA 2BGNA 3N0TA
chains in the Genus database with same CATH superfamily
1S2NA 2LIPA 2V7GA 4LBYA 4DWOA 1A8QA 1NW6A 1U7OA 5DEIA 3WSWA 3UJ7A 1MO6A 1JEEA 3FYHA 4LUCA 1HDOA 1XZBA 4G9BA 3GX1A 1C1DB 2J45A 2JNWA 4NCJA 4S1PA 5JWHA 4AKTA 2YJTD 1KZ6A 5L9AA 3LI2A 4P58A 3UYKA 2XVZA 3HM2A 3E3OA 3K9QO 4QGFA 4KBYA 2O1XA 2PVPA 3ET4A 2PR7A 1J8MF 2VZ8A 2G4VA 1N78A 3IEXA 4I8XA 1SU6A 3IX7A 1R88A 4Q9NA 2QTLA 1TYCA 3F3SA 4LTMA 2WVJA 3S40A 4NH0A 2OEPA 2IH2A 4R05A 4ZXFA 1A7AA 1XU7A 1RW4A 2GJ9A 4PQYA 5IH3A 4CIDA 2WYVA 2HDWA 3RIGA 1P8JA 2GO1A 1TUGA 4LJ6A 4EJ0A 4CKZA 3IP1A 2XOXA 4QICA 5C1PA 3OFVA 4JVNA 2Q8NA 2CDAA 4TKZA 1X9IA 4BB5A 1XRRA 2GK3A 3GH1A 4POOA 1F60A 5L3RA 1D2HA 3E0QA 4KXVA 1EFKA 2R8EA 1B26A 2FOIA 5B4UA 2OSBA 3OEHA 3TRJA 1N9GB 2ISCA 2ZYUX 2QN6A 3H13A 4RDCA 3UTDA 4RTNA 4OA8A 4OHKA 2QTVA 1NMYA 5GZ1A 5EHIA 1XDGA 1M6HA 5KSYA 5LDHA 5DBEX 1SN7A 3ZWYA 3LXRA 1YB1A 2IP2A 1IM8A 2OCIA 4JUAA 1V11A 5IJAA 4D3SA 1QK4A 5CXQA 2DFNA 4PCUA 4WIAA 4LYDA 4Q18A 4PX9A 1PNRA 4ZJUA 3PHLA 3Q7SA 2CMKA 4PCAA 3BFJA 2X77A 4O2AA 1WB6A 1X0XA 3L8GA 4LYYA 2IEIA 3HVHA 2C97A 2R1UA 1BZYA 1CF4A 4NBLA 4AMZA 4IVRA 3VNUA 4Q1DA 2NX2A 4MJ7A 3MPOA 4K2AA 2FCAA 2W90A 1V96A 3CPEA 4HD8A 5EZYA 4DLXA 3BMCB 4G8DA 4A15A 2FRDA 2QR3A 3K5PA 4AG5A 2J0SA 1HFWA 1X8KA 3GB9A 2WDPA 1NUPA 2BD0A 5J4LA 4UCWA 2F9LA 5H59A 2HJSA 2PKQP 4YCSA 1RJ9B 4BQOA 1XLUA 5AM3A 1JVSA 2J85A 1CHNA 1SUAA 4KUHA 3BJRA 4Q4LA 3N2NA 4AP6A 3IXLA 5CVEA 3A4IA 1LD3A 3COYA 3PEEA 3DKVA 1MUUA 5HEKA 2GQ0A 4A91A 1YHNA 3B60A 3WYAA 3FRJA 4AJNA 5FTJA 3HTXA 5KJ1A 2BTQA 1TE2A 3LCRA 4BMYA 4Y6QA 3V8RA 2W5UA 1Z5VA 3E3MA 2W2TA 4HN4B 4CKEA 1E1MA 4I9NA 5U4XA 1HDIA 3INTA 1DC8A 1YK0A 3G5UA 4F2GA 2C5FA 5TVKA 1PJ2A 3ABRB 2NUBA 4C6RA 4CETA 4FSDA 4C4TA 4G0PA 3UMMA 3EB9A 1E7SA 4DQDA 2RGNA 1GZUA 2ILTA 4Q3NA 1A82A 1LCIA 2NU6B 3DMTC 4UBIA 3R7SA 4AZVA 4B73A 4HB2A 5KU1A 1RMYA 3R7NA 3EC7A 1FVFA 2UZ1B 2JLYA 1EK2A 2VOJA 4TS4A 2C2MA 4C76A 1OUMA 2G17A 3OJWA 2E6UX 1XA4A 2Q21A 4JJ4A 4DLVA 2X86A 4FYKA 4ZQBA 4KWTA 3W9SA 2QRQA 4CLOA 1JWAB 2J0VA 4UEQA 5E4FA 5HFAA 4GBJA 3VC2A 4RSHA 5KJFA 3AI2A 2QR2A 3PNYA 3ZDAA 2EJTA 4PU0A 4WKOA 3GLIE 1P1FA 4WLFA 4JI7B 4IFEA 3GD7A 4JU9A 3VJKA 5GV7A 1QKKA 1VFPA 4Q9IA 4BLRA 2IOFA 3BMQA 1ZHOA 1RIFA 2MYNA 4BMDA 4DLTA 2Y1KA 4GBED 3TZEA 2XUIA 5T4HA 1JKJA 1K7CA 4L2IA 2FW7A 1JAIA 2OTCA 3HZRA 4OXKA 5F51A 2XUGA 3GVPA 5CITA 1Z18A 4RBNA 3AEKB 2QAJA 5CVJA 4M9QA 4CV3A 2VPTA 4IH9A 3WGGA 2EHJA 2PDAA 3EY9A 2BSQA 2ADOA 2ZJ6A 1LDMA 4EHNA 1QF7A 2ZB7A 1UT6A 3MJTA 2C5AA 1RPJA 5AM1A 2FV8A 1DPFA 3MTJA 2JGEA 4M46A 3KQNA 1OREA 2ZAOA 1RLOA 1RC0A 2ZIEA 2ZXUA 3MWYW 1I51A 5A6VA 1W76A 2XZOA 3H1FA 1TQ6A 1W0JA 2P9FA 1QTNA 3D6MA 2ZANA 2BF4A 3OX3A 4HLUC 4LXXA 3BGWA 1OYVA 4KH0A 1OWMA 1F17A 1JIUA 4IF4A 2LR0A 1EJ6A 2O3JA 2RHCA 3P19A 4QU8A 3VU9B 3W6UA 1FE8A 5IFKA 5JV5A 1D2MA 3KJHA 4DMFA 4IUYA 3HEMA 5AVXA 3R3SA 3B85A 5JDCA 1YONA 1QYRA 3D0RA 1LLCA 3EGDA 4TWZA 1THMA 5I9BA 3D6VA 3E7WA 3SBDA 2IEAA 3CC8A 3W4JA 4K03A 3DDZX 3SXJA 1GZVA 1JFSA 1Z4LA 2QZ9A 2H07A 3IKTA 4Q39A 3SKVA 5AOCA 3BCRA 3V7WA 5ENZA 3MCUA 2P69A 1CS0A 4Z7OB 1PP4A 1M0TA 1KWKA 3W5UA 1F6DA 5AW0A 4HPJB 1GA1A 2W6CX 1WBBA 1NKTA 3RJZA 3N8IA 2ZI9A 4CMEC 5JWRA 4B7CA 4PQEA 2O8VA 1FFAA 1E4EA 1EESA 4OL9A 1GHTA 3INGA 3JATA 4L8WB 2C1XA 3U3RA 1WUKS 3K9BA 4DABA 4MIOA 5KNCA 2GD0A 3VKVA 2J3IA 4HNAA 2GILA 4N5MA 2O8DB 3SVTA 2WM8A 2DUJA 2XT0A 4D96A 3G5LA 2Z8YA 5TQ0B 1WZUA 2GBLA 1N1DA 2VBGA 1KETA 3FCAA 1RADA 3P27A 4W7HA 4XQ0A 4RDIA 2LW7A 3ETDA 2DT8A 5CTAA 1OOEA 3CV3A 3CF6R 3ZVKA 3BTVA 3B6KA 1FSGA 3L0IB 3N5CA 1MQ9A 1BX0A 1QGDA 3N2EA 1U7PA 4RVHA 3DV0A 4TTVA 5DI9A 4I0WB 2YIVX 4FGKA 3ZY3A 1KI4A 4BFSA 1AF7A 1RYHA 3CY6A 2BL4A 1AHIA 2ATIA 4HEHA 2PZKA 1I30A 1J70A 1N0VC 1V7ZA 2OCPA 2PVSA 4FT2A 1W5BA 2A30A 4ZOCA 3L6BA 3UGTA 5B1YA 2PX2A 1U8EA 2J9XB 2OUKA 3AFIA 3I6ZA 4NVRA 5H83A 3R75A 1ZK2A 2IV2X 2QUBA 1PR9A 2CYAA 3AUJB 3GLQA 2IELA 3CNHA 3MMZA 2SKCA 2WF5A 3RC3A 3HDYA 3UGJA 1CTQA 2G80A 3HPQA 1VECA 1EJBA 4JJFA 4JI1B 2R8PA 1JECA 1Z25A 1UL1X 1FS6A 4QKQA 3LQFA 3PB3A 3KCNA 2WUDA 4HB0A 3DAYA 5ER6A 5H3LA 1ZCJA 1ARZA 2G09A 1Y34E 3A06A 1Y6GA 5I7RA 3EVAA 3CUSA 3OE1A 3F5SA 4PCVA 3UJ6A 4N01A 1MKYA 2QTBA 4OQEA 3I2GA 2XEXA 4IUBS 4CF7A 1XN1A 4FE3A 3E0XA 1G63A 3RYIB 2HA4A 1CJMA 3GRKA 3GRAA 1GNQA 4BV3A 4ND3A 1GG5A 3IBGA 3PR1A 2C7PA 3GPIA 1N2CB 4NTZA 5C3UA 4IAOA 2UUBB 1FF9A 3B1ZA 1YO6A 2A9OA 1M73E 4HADA 4PLCA 1L5SA 3J7AC 4JT2A 3WAGA 1RI3A 3W5HA 3ADCA 1KFEB 3F6EX 3O2JA 3L5OA 4EEKA 3L77A 4EP1A 3G0HA 3EWIA 3DB1A 2QE7A 3IAM1 4CKWB 1P2UA 4R8VA 3EVZA 4IWYA 3T7KA 2RH5A 3UMRA 1N6NA 3WQSB 4F38A 3KQLA 4BO4A 1L4EA 3EFHA 1X13A 3ODGA 4KOAA 2HV8A 2O57A 3BRWD 4PZ9A 4IZOA 4WK2B 3URKA 2C5SA 4DRYA 3R6TA 4YAEA 3QU9A 2RHWA 2NNWB 1Z5NA 2GB4A 3MTIA 4L6AA 3PBKA 4NAUA 1C5KA 1T3ZA 2GCIA 3ICPA 2BFAA 3GPDG 1UPXA 3ECSA 5KAMA 3GPCA 1CXZA 3IXQA 1CVLA 1W93A 4Q21A 4AB1A 5CFLA 3B9QA 3TOCA 3D6TB 4KRYA 3W2HA 5C2JB 1UJ6A 1NW5A 3JQEA 3PZRA 4MI6A 2IS6A 1TCCA 1JHUA 3N8NA 2Q2QA 1FX1A 3MCTA 4LXYA 4ZIRA 1PZNA 4EMBA 3T5DA 5JMTA 4FVTA 1V25A 3J81A 1OI2A 5H4HA 2JIPA 3O8OB 5T4EA 3TGWA 5DV9A 3B9RA 4BE4A 1Q17A 2QQEA 2Y77A 3GRPA 4RK0A 2XA9A 1T9GS 2O59A 3DH0A 5L7TA 1BQEA 1GNVA 1RI1A 5BUZA 1P73A 3ACDA 1Y9DA 4QODA 1NF3A 4M4SA 5CXUA 1DQYA 1DAPA 1ORHA 3FUVA 3GT0A 4MWOA 2X13A 2XTZA 5IJZA 2XSZD 4TYMA 3RG2A 1WS6A 1GKIA 4JFRA 4E5KA 2FNAA 3Q72A 3D9QX 3I8XA 1U7XA 2P8JA 4AW9A 2WJVA 4HDNB 1LQUA 5AXAA 4Y6OA 4I5DA 1NUSA 3HNOA 3IVAA 2ZRMA 2RGGA 3HM9A 4FNOA 5AM0A 2FXVA 3PDCA 2IYUA 3F47A 5T3YA 3V48A 3TB4A 3PLAE 2FUG6 3M5CA 1FMLA 2WY2D 1E3MA 5AI8A 2BEWB 1GAWA 1CJBA 4JI0B 4UUOA 2L19A 4P5PA 4ER7A 2XJ4A 3ZI0A 3BHIA 5F98A 4Z54A 4XPIB 4DLAA 5B55A 4ZREA 3EZYA 2H7XA 2R00A 3HABA 2NXEA 2OESA 2QG9A 3F4BA 4OBBA 1RRKA 5KTMA 2F4NA 5A0VA 3TQTA 1NR5A 2EP8A 1EINA 2R47A 5H0IA 3TVTA 3N5KA 3KM0A 4PY2A 4PBSA 4GMXA 3NHKA 1QCCA 3PDWA 3SYLA 4B1FA 4N0DA 3OHMA 2GBPA 3ACCA 3DCJA 4WZBA 5THXA 4F3NA 1PQPA 1DQRA 3RS7A 1NXPA 3W8DA 4YRCA 1BEUB 1L5FA 1YBHA 2ZAYA 3FHCB 3ZDYB 5F2KA 4E2XA 3R5KA 5KTKA 2OSVA 4L9SA 2IXTA 5EESA 3G8BA 3KSUA 4E5DA 1E3IA 2PRYA 2GF2A 2YWRA 1IBSA 1RBMA 2YC2C 2I03A 4GVLA 4NYIQ 2FUEA 3T1VA 3IBCA 3GNSA 3RS0A 4P84A 4LYEA 1U1DA 1XKTA 4HYQA 3AF0A 1T9GR 5HMMA 3VYRB 5C52B 1NNEA 5M7EA 4A0RA 3L84A 2JI6A 4M0KA 5FNVF 1W9MA 1S8FA 3B3QA 1SEPA 5LOVF 3NDBB 2G9RA 2CDBA 4EHFA 4BJHB 4J0EA 1YAJA 3P2KA 3PCXA 3B13B 3DBLB 3GVIA 3WRYA 3EGXB 1G21B 1VPTA 2BFFB 4J0KA 4J4BA 4A4DA 1KI6B 1WU8A 3EXHC 4FC6A 3UUWA 4F8EA 1FJXA 4GZ6A 3WGOA 4EZEA 3PNBA 3TTSA 4KK3A 4LXUA 3EG9A 3BREA 1KIAA 3AIIA 4NP6A 4Y3UA 1CR2A 1GFWA 3U81A 1C30B 4DV3B 1NE7A 4HBGA 4J7XA 3BXOA 1X80B 1W0JD 2GNPA 4B3XA 3E1GA 5K05A 1GQSA 4OAQA 2Q5OA 2BOVA 3BD8A 3F98A 4ARZB 4EGCB 2ZROA 1UT5A 3KVRA 1PF7E 3W9YA 9ABPA 5H02A 3THYA 2J8ZA 4IMIB 1DC7A 4GYYA 4MCHA 3RHFA 1CZKA 3RWBA 5J5AA 4QPJC 3TQHA 1UPCA 5JS6A 4GR4A 4QSHA 2FXIA 4N12A 2XMDA 1F12A 1UQUA 3GRVA 5LLTA 1KPGA 1VHTA 2J46A 1Z5OA 3IUEA 3JW8A 5F52A 1UODA 4EF5A 1TDJA 1E4VA 4MRPA 5IBCA 5KSZA 4DRXB 5ICMA 3Q3IA 2OKCA 1QIKA 2V5AA 2WB4A 1PZEA 1JA1A 1N4AA 1Y4AE 1WL8A 4QQ8A 2QL7A 2DGDA 1Y4ZA 1YR6A 1M6WA 4K88A 4JENA 4QVIA 3NEJA 1PS8A 4LF4B 1C3OB 2F1RA 4HNVA 1FFXA 1HE2A 3EXHB 1GPDG 1VLHA 2QTGA 2YRXA 3P0RA 4LJ5A 4DCJA 3I8OA 4BQFA 5FWNA 4C0BA 4IVPA 3R7LA 1U5BA 3NHSA 4JBYA 3CNQS 2YZNA 1NTOA 4KQ9A 2R5WA 2A67A 5KNCD 2V5VA 1YB5A 1A8IA 4B17A 2AUMA 2GR9A 2ZRJA 1JG3A 4MRNA 1KR2A 3SN6A 1AKEA 1W8IA 3LCJA 3SX0A 2O5EA 4DQLA 3EPRA 1C0LA 4PIVA 3GLUA 4MGKR 4CQLB 4UMFA 1WP4A 1X1AA 5IAKA 3KXDA 2A33A 1UJNA 4BL5A 3BWXA 4JVOA 3OMLA 4LW8A 4ID3A 3W8FA 3WGYA 4AO7A 1JHZA 4ZCRA 2EEPA 5J43A 4RACA 3T5GA 3EF1A 1OTYA 3FUWA 2XUHA 3JQ7A 3ZU2A 4KDRA 5L4NA 5C1OA 4IKOA 2B1IA 1W88A 3CWZA 4U8HA 1IK4A 3I3SR 3GLVA 4JCCA 1OIXA 4ND1A 4H0CA 4RMIA 3M5WA 5FPPA 3U49A 4ATNA 1L1RA 2AF4C 1DKUA 2A0XA 1BWRA 1YDFA 1VCNA 3ZHCA 3Q2OA 3A1NA 1A4UA 1D07A 1IHXA 4OB6A 2H2GA 4XSGA 1YZ3A 3ZLBA 3Q8MA 3PXBA 3QSYA 2B4YA 3CKKA 3FPHA 3GFFA 1THTA 2E4UA 3AGQA 3ZE8A 2RFLA 4UBJA 1LBEA 3VVCA 1JV2B 4WV3A 3ZVRA 1JE1A 2PKRA 3ZU6A 5A6SA 1YBAA 3L1KA 1KZGB 3OKPA 5AK4A 1Z8NA 2HBZA 2IOQA 3I28A 2PX3A 1ISRA 4MUMA 4KKVA 4QJ4A 3LL7A 3C87A 4RH0A 3MS2A 1F2TB 1QR2A 1R6TA 2GCPA 3DE5X 3NTLA 3ZGOA 1H1LB 5FD8A 4H6WA 4GXNA 3CTPA 1Y3AA 4G84A 2H1VA 4KFSA 2V7UA 2F3QA 4Z5XA 1RZRD 2AOUA 5TDHA 4XX0A 1E5TA 1H2EA 2ZTLA 4P33A 1RFLA 5ES3A 1VB3A 2HUPA 1H1TA 5FPSA 4HAZA 3VU3A 1XLTA 1M8KA 1TUEA 3K32A 2JJ2A 3H11A 5FJIA 4TMVA 3CVOA 4KR7A 4DBVO 2H7VA 3AVUA 3A6PC 1K97A 2AFIA 2HPAA 3NC1C 1XNQB 2R6AA 5CD1A 4J7AA 4PXSA 1P3Y1 2P6RA 2JLAA 3FDFA 1IM2A 3NBQA 2VHYA 1WHSA 3TSAA 1S3IA 5BW4A 3HS3A 1H5QA 3C7TA 1M8PA 4QXQA 1TLFA 2JZOA 5J5CA 3HJCA 5KKNB 2LRHA 4O63O 3V80A 1O97D 1CEQA 2QI9F 4AN4A 4BYMA 2C92A 4DTCA 4PNHA 1V3QE 2TS1A 1NUTA 4Y2YA 4ZXPA 2EDCA 2W6PA 2BBOA 2C1ZA 5GVRA 3TXAA 4DBZA 4KQ2A 2BW0A 1RLUA 1DEXA 1P72A 3CE6A 3DO6A 5C8YF 2JARA 1H94A 2DLDA 3HC7A 2H2HA 1HR0B 2MYUA 1B6SA 4NOJA 3CN9A 3A3NA 3BQ9A 1XK7A 2C2ZA 4TSFA 1G3MA 1DOZA 1I9CA 3TNJA 2FG5A 1X9HA 3MMSA 3B6JA 3AONB 3RRZA 5A4FS 2DXIA 2BFDB 4H18A 4WKCA 1Y3BE 3CW2A 3OPYI 4EHIA 4C06A 2WA2A 1FSFA 1PJSA 1UIRA 4XIFA 5LQAA 3MCAA 3SZ3A 5A0FA 1XTPA 1ZCBA 1KZYC 2WWFA 3CX4A 4Q3CA 4MQEA 3ZDQA 3K8ZA 2ZULA 4GMDA 2PZ8A 4TWIA 3OETA 4D7AA 2GZ1A 1ZOLA 4WDRA 4Y2SA 3STTA 3U9SA 5JI2E 5K3CA 1E2PA 4U6SA 3GJYA 4ZJPA 4M38A 2XMRA 1SCNE 2QZZA 3GJ3A 3LDUA 3ZLUA 1CUYA 2R60A 3GFSA 3L0PA 3RTBA 1PEAA 4XGQA 3ZHBA 1JVBA 4RV4A 1HTTA 3WWPA 5IT4A 3N59A 3DC2A 3WMGA 4W6QA 3NPAA 4PSCA 4X61A 4D41A 4REQB 1Z75A 4AZ0B 4C5AA 4FOSA 3KQKA 1PQYA 4IHQA 4RYLA 4X97A 3SCZA 3UHOA 1ND5A 1U81A 3MS4A 3OP1A 3E7XA 1JR6A 1T9BA 4FDMA 3MWLA 2JC3A 3WB2A 4MW5A 2BP7A 3DBHA 3IEUA 3CH7A 4DLPA 3K6SA 4XWAA 2FN3A 3DZKA 1P9NA 4ALMA 1NV9A 5REQB 1OA0A 1VMIA 2OHGA 4MUFA 5CXSA 4ZT7A 5TY0A 4ZJYA 1MA0A 1N3IA 3MOSA 5E7MA 1FB5A 3HNRA 1DC3A 1BXZA 1QHFA 1SKAA 3E58A 4GMFA 5EWJA 3LLVA 3BG5A 5EP2A 5I45A 2VDQB 2X5JO 1N6HA 2XGMA 4UTRA 2CLLB 4ZO7A 2EF0A 3B51X 1E2MA 2VUIB 4IRUB 5FLEX 3Q40A 5AW5A 3F0TA 3TD6A 4TMKA 2P9CA 3K2BA 4RSGA 3WL3A 4ZYXA 3SQOA 4WOJA 5F7JA 1SUDA 1PTKA 1EM6A 1P2TA 4ARUA 1FTSA 3DHYA 4H31A 3O4VA 5ALPA 2PIDA 3C8ZA 4HQRA 2CZQA 2VS1A 4HSGA 3QOFA 4G4IA 1YTLA 2OXFA 1ZSYA 2H2AA 3SSMA 3VR3A 3WB1A 4YCLA 1H4TA 2NZJA 5DRTA 1E0JA 2AWOA 3QX7A 5SY9A 4BTEA 5CEEA 9LDBA 3AF1A 3R5HA 2I7CA 4IDHA 2H4ZA 2E5LB 1PJCA 1T4BA 1UBRS 2OP1A 3FWHA 3H65A 3PC3A 4JOBA 3ES9A 2PEYA 1ZD1A 1PL8A 4C43A 4EOGA 2BFCA 2J5BA 2N1MA 1QQ5A 4M9XA 4Q82A 1V5GA 5CBPB 3PE3A 3B1FA 2WBLC 3P71T 1UAAA 1GAJA 1LWNA 1XUOA 2H2FA 1NKSA 4RZUA 1L4GA 3ZH9B 1HYEA 2Z6AA 1VYTA 5JCJD 3BDAA 4NPCA 3O3NB 1Y5NA 1MO3A 4X8LA 4QTTB 1TK9A 1CJTC 1OKKD 5IYZF 2R3SA 4DJTA 1DBRA 1AU9A 2GEUA 3KWMA 4WERA 2LKCA 2O07A 1MORA 2H29A 3WKAA 5DNWA 4WXEA 2JEZA 5CFRA 5ERGB 4F46A 4GQBA 4EA7A 4OQXA 1W2HA 1DRKA 1MOQA 2DWUA 1W19A 3JAWB 3MJDA 5NULA 3OSUA 5JSKA 2DC1A 4NK5A 5AD1A 3NASA 3FWYA 3C3WA 3BQMB 1VQ1A 3AY0A 5I3CA 1EFPB 2BMJA 2I3DA 3JQ9C 5B7NA 2UYCA 4ZHSA 1KI3A 2ZRKA 4D4HA 4H7DA 2JJ1D 3P52A 4J2OA 1ORVA 2BI4A 1XPRA 1TGYA 5JSQA 4FKMA 4F9GA 1MB0A 4MQFB 1PIWA 4R9UC 2WDZA 4FR2A 2JI4A 5C1DA 2GF0A 2NUPA 1JAZA 1RVV1 2HY7A 3N76A 4BN0A 5JYCA 1QKIA 1Y7PA 1P0MA 3IPAA 3OTWA 3EA4A 4ZVOA 4R8MA 4HAVA 1D2GA 1IWBB 1I7PA 2Q50A 1DMSA 1NX9A 3RYFA 3RS2A 3ZHUA 4EX7A 3AVWA 4MDEA 1YI0A 3T15A 4RZQA 2IGBA 1HG0A 3FMGA 4ZMSA 3WI7A 1NURA 2IEZA 2NO7A 3I52A 3JRNA 3N87A 4TV9A 2P75A 2UUPA 4KDEA 4R2JA 3EJWA 1P9WA 3SU8A 3ZHTA 3C6QA 4BPRA 5IULC 1NMQA 1WKBA 2H4FA 3D3KA 3ICOA 3I0ZA 2YBEA 3W4KA 3DE4X 1XKQA 2IIQA 4Z3DA 1SHLA 3GJTA 4FW9A 1E7MA 3IUPA 3GDGA 1WULS 1N9KA 2NZXA 3L7MA 4XVUA 1LH0A 1SURA 2R6ZA 2R1ZA 5L3QA 2F55A 3G9QA 1SCBA 4ZVMA 3UJBA 1IOVA 2NQ2C 4M0UA 2XA1A 5EKDA 1EQ2A 1J23A 1WNTA 1M54A 3U4HA 4YMTA 2A5GA 1O1YA 2HFJA 4OHCA 4YWHA 3WHPA 1NV8A 4HNRA 4NMHA 3COWA 1NVUQ 3ET5A 5T4FA 2RH4A 3MRXA 1JZTA 2MJLA 3WGIA 2J67A 4COKA 1SJ9A 2QY6A 4Q37A 4M7WA 5F73A 2ZYIA 1QIGA 1RWVA 3K2QA 1Y48E 3L6EA 3OQJA 1O97C 4TKVA 4PGMA 5FWXB 1U9CA 1CUWA 4XVCA 1IHPA 2V6FA 1D8AA 3HCEA 2XE6A 3Q9NA 1DJQA 4C0AC 1HUQA 2W2LA 2WTAA 2WT8A 4CEHA 2LP4Y 3LOUA 3M6LA 4DZRA 3LH5A 3ZTWA 1OD6A 2I6XA 2YFKA 2Q1TA 3O73A 3FB1A 2VH1A 4AQDA 2B5VA 2IKSA 1DU4A 2JAXA 2JLCA 3C41J 4YQEA 5CVVA 1PVVA 3ZY2A 5JZOA 3DVLA 4ZANA 1BDHA 1YXMA 1P0QA 2YFHA 5A5FA 2N46A 1SG9A 5C31A 1ECJA 1JKFA 1UBLS 2C29D 5KVVA 4GX1A 1RQRA 2FUKA 1KJIA 1P17A 3RU9A 3P0HA 3Q85A 3UK6A 1QH1A 2P9GA 4F8YA 3SDZA 3A2LA 2ZUUA 4CKXA 4MPRA 1FOEB 3PEFA 3U4MA 4EWLA 3L9XA 4KLRA 1P62B 1PK9A 2BV3A 2J41A 3MZ0A 4EECA 2D3WA 4DA9A 4O08A 1QPZA 1N5LA 1QH0A 2ACKA 3M2TA 1CYDA 1XQ6A 3MUFA 5T57A 2QZPA 2YX1A 3CR8A 4COOA 5KYGA 4JY7A 1V1RB 2XF2A 1AB6A 2H4YA 2Y4OA 4MRRA 1BAPA 4TM7A 3ZNPA 3PQDA 1QGAA 3FGPA 2P35A 2X7XA 3RSFA 2QP4A 3HDVA 1RWKA 2JLBA 4NZZA 4WA8A 5C8XA 5K8VA 1VSUA 3KNZA 3E2PA 3HFGA 2JGDA 1LPSA 3RE1A 4FZ3A 3RVOA 3ESCA 2JLUA 2C7OA 3D2BA 4UDYX 1C9JA 1G8JA 2TSYB 1V2HE 5HBGA 2YN0A 2DU8A 1GG9A 3IC5A 2O8NA 2JAWA 4G0NA 5I5GA 2NMVA 2C83A 2Z58A 1WMDA 4JSRA 2QORA 5HQJA 3DFKA 2WLSA 3OCYA 1U65A 3IL2A 3BTSA 3A58B 3RIYA 4IXMA 1YRWA 1Z13A 4DSOA 4DAOA 4XM1A 3X43A 2B92A 5CW2A 2PQ2A 2UVPB 3FPKA 1DCMA 4L3VA 1W4BA 1ZGHA 1Y8QB 4RD6A 2WF9A 1II8A 4R1QA 3AP3A 3URMA 3DEFA 4ZN6A 1MGOA 3CCBA 4LJKA 4KPEC 2EGUA 3AIOA 1U3UA 2YOHA 1E4OA 3KT0A 5IHPA 1R0SA 4FI3F 1TLLA 2WJJA 3BL5A 4ZT4A 2I22A 1MENA 2IPOA 4P4LA 2XE8A 4O2BB 1W4ZA 2J6HA 1ECCA 2ZSHA 4Q7QA 4HGOA 4TUYB 3S55A 1YCHA 3CBGA 1ZX1A 4TKUB 5B2EA 4NEGA 1XOIA 3U48A 5CA0B 5CDYA 5G2OA 1YFZA 4NYJQ 3HWX1 4RY0A 1Z34A 1ISSA 1Z0SA 2D5CA 3HKEA 2YYYA 3L4BA 3ND8A 3UWDA 4DQVA 2P4QA 5GOZA 3EMVA 2WWRA 3TR0A 2HWKA 2QVZX 5IJ0A 3GCZA 1VCIA 3K4HA 4I1YA 4J0QA 3GMDA 4GKJB 2W11A 4YJ2B 4PZUA 4PNPA 4Q34A 4ZVLA 3OCJA 4Q9DA 3OQ6A 5BYKA 4N9WA 3A1VA 3P7MA 1KJYA 4Q4HB 2QN2A 1BYIA 2QVGA 2D5BA 2FPUA 2E37A 4JNKA 4XJXA 4AX4A 4YIKA 5TSDA 5L7WA 1GTMA 3BWMA 3I2IA 4M1WA 2GHRA 1QRSA 1I1HA 2FWIA 4IINA 1XD9A 2Q9UA 2ZYSA 5DDIP 5JALA 4JXXA 3OLCX 2VLBA 4AS3A 1Z88A 1IY1A 3GGGA 1PT9A 3IAEA 1I80A 3CZ4A 3CS3A 2J5XA 1SNYA 4G4SP 4J43A 1RAEA 2Y1XA 3E5HA 3UB3A 3KKNA 2QJWA 4X8MA 2FPWA 3WGLA 3N7TA 5HIJA 1D2RA 2IU4A 3S81A 2VQ3A 2JA2A 1FCJA 1P1KA 1DXQA 4C4RA 1A5ZA 1SXPA 5KX5A 1W6RA 1XVIA 3KV1A 2VYVA 3MAAC 4DR2B 3OUTA 1ZOOA 4BUCA 1GNTA 4X64B 3BHJA 1Y3FE 2FMFA 5AKZA 2AG1A 4Z4CA 1E58A 3IUSA 4LGMA 5CJ2A 4B6SA 1Y5IA 2P1RA 4G1UC 3D64A 1ZY2A 2BGMA 5L4SA 4EQ6B 4G25A 4YRFA 4TVOA 5BT9A 2VT7A 5KWEA 4FPXA 1L0BA 3B78A 5EQJB 4IQ0A 5E3HA 1TECE 5IW8A 4ICIA 1T26A 3HGMA 3AR3A 1JJAA 4DUGA 2NTYC 3IP9A 2EL9A 4NMWA 4R2KA 3D8TA 1BIFA 3PYXA 5H81A 5ICFA 2WSSA 1W2WB 2GYUA 2OO5C 2JBAA 3NRJA 4OXIA 4C22A 2BEUB 2VJCA 3KZOA 3UKOA 2ATEA 4EG4A 1RXEA 2VXBA 2YWEA 3SIRA 1V7PC 1FDWA 4RADA 1M7BA 3HCNA 1UKYA 3PWTA 1SC3A 1P6XA 3V8EA 1SBYA 1W35A 4KXYA 5AK3A 2FA9A 5K6AA 1QCDA 4QU0A 4UDXX 3BE4A 4A2WA 4C6TB 3DMTA 1Z7WA 1YAHA 5FP0A 1ZEJA 2KBEA 4MHSA 3M1AA 4BE9A 4PC6A 4KBFA 2J3LA 3W77A 3AVPA 4JP1A 2XB2A 2V0GA 3ZNQA 1W30A 4X6LA 3DO5A 4BNIA 4FCWA 2J9RA 2DTDA 1NYTA 2QJRA 2NYUA 2EBFX 2QTRA 3CUVA 1WXGA 3F3YA 3KDPA 2EG5A 3PGJA 3U3KA 3FOEC 5I4KA 2AHRA 3K16A 4RD3A 2BHNA 2ECOA 4XB2A 3JQDA 4PVDA 2OZLB 1WOMA 2M1XA 3DDNA 1LU9A 2GLTA 5IJ9B 2FCRA 3GFVA 5L7YA 2F1JA 1UPFA 1KEKA 1GUFA 1ECGA 4M86A 1KZ9A 4M8KA 4HDMB 1WM1A 2H4XA 1NVGA 4R7ZA 2W58A 2Z1MA 1OSNA 1I6LA 2XLBA 4EUKA 3VHXB 1HQKA 4D1YA 1EFHA 5JEDA 1PJRA 3ORSA 1FTGA 3HXLA 1P7ZA 4QRDA 3UXEA 2GA8A 3VAYA 3ZE1B 1PX0A 1YV9A 4ZK6A 1R4NB 1W0KA 1GR0A 3TSWA 3NR2A 3H6GA 2JCBA 4QIHA 1MG5A 2J7KA 2KYRA 2QPTA 3E9YA 3K0CC 4OGFA 5L4LA 2DQ4A 4ARCA 2F9MA 3B48A 4CU2A 5D84A 1PGJA 4J4HA 2X0DA 2GN9A 3WK4A 3SFZA 4F1KA 1D6SA 1UXIA 1CRZA 4LJ9A 2Y1EA 3RBAA 4AUKA 5C53B 1BHSA 4HLUA 4AN0A 5CLLA 5LXTB 1P3DA 4X6UA 2E4XA 3PICA 3PRYA 1WCWA 2H57A 3KDSE 3PDUA 3GZNA 5JSFA 2XIQA 2OBFA 4XM0A 4Q48A 3SE7A 3UK2A 1GNRA 1SVOA 3A8TA 3AM4A 5E95A 4H7JA 4E5SA 3WMFA 3G1WA 2IP4A 5IEBA 5JRDS 3WLRA 4D8YA 2Y1WA 2X6TA 4QRIA 3WXMA 1PJ3A 3O1JC 3T4PA 1HKUA 3X1WA 4FMDF 1KYZA 4LHYA 4TQGA 4TROA 4XTCS 1XRPA 2WJ6A 2X2PA 3D4NA 3IDFA 5FBKA 1K98A 2MU1A 2R9VA 3ESRA 4CMEA 4CIWA 1ZBDA 4IO1A 3ZX4A 1Y8ZA 1ML3A 2AJBA 3QLVC 4NHEA 2P8SA 4BLOA 3P9QA 4CVNA 4URYR 4EHDA 1ODTC 3FVVA 2F64A 3JWHA 1XROA 2K87A 4IJKA 4OQYA 1R5BA 2FK7A 5FHRA 3IBFA 3T95A 4F3TA 1QONA 1ZJ4A 2AI2A 4XWKA 1RAIA 1BC5A 4US1R 4PYKA 2GK6A 3EULA 2BSXA 5CX4A 3VAAA 1EDDA 4OP3A 1KEVA 3PJRA 1IN6A 2PVCA 1JR3E 3EVNA 3AOEC 5MN5A 1AQIA 1M9NA 1E5VA 2REBA 4LWOA 1IVSA 1I4LD 1ZL0A 4AMYA 4A8HA 4B6RA 4JC8A 4QG3A 3T4XA 2JLWA 4KUGA 3TBKA 3DUWA 3UWMA 1E5XA 1PFVA 2AJDA 5F1YA 4ZU6X 1TU0A 4GMGA 1EE2A 4YUWA 2X2OA 3AY7A 2CUKA 2F9FA 4FGZA 4O59O 5D3MB 5IN5A 4KFCA 4DR5B 4FEAA 2IYEA 5IASA 2A9JA 1MH1A 4R69A 1KQOA 1U3DA 2I4RA 4MV4A 2R0QC 4HWGA 4H15A 4Y6RA 1C9EA 2DQKA 1HFJA 3D4OA 2HNBA 2PRSA 3SXUB 4BLSA 4DM3A 1M6YA 3RIXA 3VJRA 3DFMA 4XI9A 4EELA 1XZKA 1TU4A 4JKYA 2FRXA 2G7ZA 3HVUA 3FMOB 3GVCA 1M2EA 4ZD6A 4UAVA 3UW3A 4DOMA 2ONZA 1TCUA 1V4VA 3FVTA 4BKQA 3EBPA 4AWBA 3PU6A 2ZE6A 5LU8A 2GYVA 3P4YA 3G2NA 1EVLA 4P5DA 3WFZA 1E9VA 2ECPA 4Q9AA 5FBVB 5A5VA 3A3OA 5K0EA 1XWIA 2PUJA 5E8RA 3GA5A 5B37A 4A92A 3WP0A 1SGWA 3YASA 3DUFA 2AG0A 4QDJA 2CXRA 8GPBA 1ZN8A 2V6GA 5A62A 1XFAA 1S96A 2C9BA 3GRZA 4I66A 3VR0A 1Z6QA 2W6QA 3NBMA 2P78A 1UBTS 1AF4A 1UWCA 1ATIA 2ATVA 3HP4A 3NTUA 3NALA 4B43A 3KJFA 3EUFA 3IIMA 2AYYA 2G82A 3EIWA 4N7BA 3RV4A 4ZMRA 2FF5A 1WA5A 3FDIA 3H1AA 1LXCA 3LO8A 4V0OA 2QL9A 1ZU4A 3NNDA 4YCDA 1KSFX 3TINA 3F6RA 4EJSC 1RAGA 2PWPA 1SULA 3U4GA 5ESXA 1OX4A 3KB2A 5JMPA 1MAAA 2BT4A 4RPHA 5A9SB 4RWZA 3I30X 2QVLA 4AJOA 1XQWA 3T12A 1JW9B 5JS8A 2G1UA 4HDNA 4M1EA 2JFUA 3JQCA 5FL7D 5DI3A 5ALIA 3RV3A 1YHZA 1ESMA 3NHRA 4JLUA 1QHXA 2SHKA 5ER9A 3OCWA 5IDVA 4JYBA 3TD9A 3VO1A 4AUEA 2BSAA 3L6RA 3LW8A 1NOJA 2IXGA 3UXHA 3HMKA 1CUBA 1UANA 2AC2A 4XUDA 3L1HA 5AVZA 2MCFA 3PWKA 4UE3S 3GK3A 1GU0A 4RAOA 1H2XA 2X41A 2C3MA 3ISJA 3PVSA 2CZCA 1ULHA 2EF1A 4QYXA 4RFLA 3DBIA 2VFAA 1FIUA 1C7FA 1YS2X 1U1EA 4U7PB 3OMXA 4NICA 4XWOA 2B35A 4L50A 1UFKA 4B87A 3IB6A 5FLXA 1WWKA 4NHOA 3SIXA 3Q5GA 4BRZA 1UMDA 2IPAB 4MULA 5L51A 4K1LA 4MI9A 5FUYA 5HW0A 3PFWO 1G8YA 1SXHA 5AW2A 5JS1A 4TV8A 4EJSB 3EGOA 1CZLA 4M8LA 3ZV7A 1X70A 1KPIA 1NQAO 1S3GA 4J76A 4DS3A 1VI5A 2F62A 3KL2A 4LHWA 4F7WA 1QJ4A 3A6GA 1TQHA 3LUAA 1JQLB 1USKA 2A9QA 3DULA 3HA3A 2PD6A 2QMUA 4EW6A 2EAUA 4DJEC 4GUAA 3L1UA 3G02A 2R8OA 5FA8A 4HB3A 1JLSA 2IYZA 1JYFA 2WAXA 2IYPA 3ABSB 3FOZA 2JZCA 1BXRA 1YR3A 3L07A 1TEHA 3HMQA 1ZM2A 1MX5A 3NXKA 5BRNA 2IHBA 2VWHA 3AUFA 3GGCA 3LQYA 2O8BA 2WSSD 2PJDA 1JEDA 1AG9A 1O6ZA 3CR7A 3F9RA 4X1YB 1U0LA 1ZN2A 4DR1B 2VQDA 4FOOA 3PFIA 3LK6A 1F20A 1EWKA 4F5WA 3GLGE 2IZ6A 3WBBA 2PANA 4M0EA 2DLCX 3GAAA 5JY1A 3WGUA 1HLDA 3THWB 4PPNA 1YFLA 1RYZA 3LNCA 3T6KA 3ZX5A 4M87A 4FFRA 4I6EA 3FNIA 2ZCJA 4RD1A 2VDJA 1FVXA 2D0OB 1Z2DA 3E81A 2WVGA 3UM9A 3V2GA 4Y6SA 1YB4A 5CT5A 4E3ZA 1EX6A 1E9CA 1RHQA 4GICA 4Z2AA 4II3A 3GZJA 2AH5A 2AK2A 3GEGA 4YHBA 2AL7A 4YMUA 3IUYA 4YY3B 1U2EA 4R7GA 5SICE 1O9GA 1V8DA 2BFNA 1Q1NA 1VJ0A 1Z29A 2BFBA 2C4HA 2GDZA 2ZI4A 4Y1RA 4B8YA 1L8OA 1I3LA 2GJKA 1QORA 2ASVA 3I64A 1YIDA 2Z30A 2H5EA 4X63A 5LL6P 1JEYA 3TAUA 3ITEA 2CLKB 2RIRA 1NJ1A 3Q6IA 2C2XA 5DN6A 1V5EA 2R97A 3WQQA 5I7HA 5IRCD 3IFSA 4XGIA 2CY0A 1JFTA 4TT3A 1QG6A 1TYAE 1CUGA 1P7WA 2PZBA 3BE6A 3GJ4A 5DYYA 3W90A 1QIEA 2Z5FA 2I7TA 4GF5A 3TW6A 3NIFB 3M4JA 1U0NA 4CV1A 2WLTA 2W6NA 3OOWA 4RMNA 4E12A 3SWWA 5GJWC 1KJ8A 4OTZA 1DG9A 2AFVA 3A1EA 1E0AA 1CY1A 1GPJA 3CRW1 3IV6A 3QE3A 1AQJA 4DDVA 1W0KD 3KIPA 4HAUA 2WNIA 1Y4DE 2JHGA 3U6KA 3JZFA 1G9XA 2J3HA 4JIGA 3EXHA 1H8EA 4KN5A 3QQ5A 3NP9A 3OM1A 1FYFA 4FGUA 2PPVA 2H8KA 3KJEA 3RU2A 4DR3B 4A5SA 4WGGA 1WUIS 1K6EA 4FQ7A 2DFVA 2R68A 2Y2UA 3G59A 4Y67A 3VI3B 4WBXC 1CP2A 3HCPA 1XKLA 2L0XA 4RCYA 4KZPA 4EKEA 3BGDA 2PGOA 4E15A 4EPVA 1KAOA 4UVEA 5D3ZA 1HPLA 3TIIA 3ASYA 1SKYE 4K6KA 5CCDA 1HC7A 3QX9A 3STUA 4NDAA 3ZU5A 3ZOKA 4QPDA 4F5EA 1Z8DA 1NNSA 4DV7B 1PVOA 5C46F 3F2IA 5K03A 3BB3A 3KZXA 5DM70 5I9NA 1N6PA 2IZOA 3RUFA 4W6ZA 4XVHA 5E38A 2OV2A 1YOBA 1C9DB 3OPMA 4UNNA 1JH8A 3AETA 1ZH8A 3V1NA 3WLNA 1NXTA 3ZH2A 3TLBA 4FMCB 2UU9B 4RJKA 3SFTA 1GKYA 1YQGA 3IQFA 5GTDA 1JSRA 1ZGAA 2CGEA 4G1VA 4HZUA 4FHGA 2ORIA 4FK8A 4G0XA 4Y18A 2Q4TA 2Q4DA 3QVGB 4G09A 2AW5A 5CBPA 1WSWA 2ZYHA 3E9MA 4H08A 2DQYA 2Q28A 4L8FA 2IUTA 4YJHA 5C4MA 2G77B 3DF9A 3NU1A 6ADHA 3EXG1 2FJUA 4D5EA 1L8XA 4Z4IA 4BE7B 3DHWC 1GV0A 2YJ4A 3VPSA 3DBVO 3F4LA 4IEFB 5KVQA 4DEYA 1EDBA 4C4PA 5EIBD 4Q4AB 3LC1O 4BAZA 4ESEA 2JGMA 1U7UA 3DHEA 4HX2A 1NG9A 2PFKA 4AM8A 1DAKA 1G2PA 5LJIA 3JQBC 3M83A 3H4TA 1TF7A 4FZJA 4GPD1 3T5CA 3UATA 4YECA 2FSIA 3R6WA 4K86A 4B79A 1FUIA 2OV8A 1Z7YA 3HKBA 1GZ7A 4S35A 4K9QA 5AIAA 4U8GA 2CZGA 3QFRA 4MPDA 3GGSA 4NECA 1B1AA 2FQXA 2PO7A 2AXPA 4IGEA 3VHRA 1ONOA 2PX8A 3R7BA 3N7AA 4D74A 2VJMA 1GZDA 2P40A 1E1RD 2RGYA 1ZA1A 3G1TA 4I55B 1LPOA 4P4NA 4R1NA 3TZLA 4JUIA 3LYAA 5A4DA 3GP5A 2OD2A 3E5MA 1EE1A 1Z2OX 5L40A 1ZZEA 1FP6A 2JAPA 2C58A 2ZBGA 5DYTA 4FS8A 3O6VA 5YASA 3GJ7A 1BCRA 1PL7A 4EGSA 1H0RA 1I6MA 3GUUA 3HU5A 3LO5A 5CAEA 3LBFA 4DIUA 1BDIA 2D0IA 1DBIA 3H5IA 2YV4A 1K08A 4BEVA 3I09A 4UVGA 2XWSA 4R2XA 4UCQA 4WW0A 1PKEA 4LZJA 4A2PA 2BHRA 2PCJA 1ZD4A 3O4GA 4MWCA 5DLQC 5K4AA 5F33A 3V32A 1QAMA 1I0IA 2ES4A 2CXUA 3N2LA 4RXUA 4XYGA 3OQPA 3OWOA 3VC3A 3V8VA 4ZT3A 1XQYA 5IZCC 2PBFA 4NEHB 3T3OA 5ESRA 3QI2A 4J16C 4ERNA 1HZZC 5FT9A 3TAXA 1GCAA 1EFUA 1V26A 4U0JA 3OLWA 3DOJA 4LXHA 3NHUA 1XDSA 2KLHA 3M1YA 4O2AF 2ZI5A 1ST2A 2CBGA 3DQZA 3ASZA 4OL0A 1ZH4A 2BONA 3UO8B 1IAQA 3VJMA 2XX3A 3AP2A 2PS0A 3L7OA 4ZPJA 2PKXA 2W2PA 2BFDA 4TTIA 5AVOA 4IXNA 2ZBFA 1QX3A 3OQMA 4B6GA 1GCUA 1IB6A 1PG0A 4NZNA 1LPMA 3I5YA 1WTCA 2O7RA 4O3FA 1QTIA 1XZMA 2RGAA 2PU7A 3M4NA 5JNTA 2AV6A 4UJ3A 3GDWA 5CURA 5E0KB 3RNOA 2R7KA 3EZLA 4Q4JA 1RAAA 1DWOA 4KXNA 3MWKA 2WU8A 3FKQA 4D97A 3HP1A 1FXWA 1WSAA 3UPUA 2Y0DA 1EP2B 1Y89A 3HDQA 4KE8A 3HU1A 3SFVA 3OMWA 4UAGA 4MQ4A 4QUJA 4XOIA 4YPFA 1NXOA 4LQCA 3PFGA 5CCXA 3CRMA 3EG5A 1ZNYA 2BI8A 2IZ1A 4KACA 3VPFA 4TLMB 2XCTB 5AI5A 2AKYA 4TQUS 1ZW6A 4NESA 4IHAA 1KKMA 4N4AA 1N57A 5JAZA 2HH9A 3WYGA 2CLOB 3OA0A 3B3FA 2JKYA 5DM1A 3CN7A 4CDRA 3NHWA 3TXXA 5JW6A 4UE2A 4D99A 5KBYA 4X1IA 4J7CA 2EKLA 2QM0A 4OYYA 4Y2UA 1CZHA 3CINA 4ZQFA 3RIEA 3ZNNA 5J4HA 1DAHA 1UEXC 1DXHA 4I46A 3IOYA 4TLBA 5REQA 3QKUA 1V16A 3NGXA 4DCTA 1M8FA 5HDBB 1H2WA 2J4CA 3O9ZA 4JB8A 5AJHA 1AKTA 1YUBA 3PXAA 3VDXA 3QFSA 3X1KA 3H5RA 3JQPA 1KEWA 4PINA 1P45A 2OQ2A 1FNSA 4URWR 4WKBA 1PFWA 2B8NA 3GEDA 4OBWA 5T6BA 5BSGA 5KIAA 1EVYA 5AW6A 4L5JA 3RTDA 4EM6A 1Z6AA 5JVDF 3UMBA 3VOAA 2ZRNA 3I76A 2HU8A 1KPHA 4TXNA 4O4JB 1QU3A 5AI0A 4ZC1A 4RV5A 2RK3A 3EN0A 1KYYA 4JC0A 2JFFA 1J8VA 421PA 3LC0A 3WO0A 3A9TA 5EEHA 3MQ4A 2ROQA 4DLRA 4LXIA 1NNI1 3BMNA 4U39A 5K0LA 3D3QA 1B0ZA 2W98A 3KT3A 3R1IA 4H3KB 2PS9A 4JL6A 3WGVA 4WJLA 2RK6A 1UJCA 5JH7A 3CLHA 3JSXA 3QKSB 4UHHA 3RVNA 3G17A 4BX9A 4N48A 1OAOC 1IWPB 3R23A 1L5RA 4RF2A 2WAOA 2B9EA 3GJZA 3H7IA 1LI5A 2P1DA 3TI7A 4NJMB 3NCHA 5J2UA 4OJYA 5TQ2B 1XL0A 1KARA 2Q1YA 1AQ6A 3ZNOA 3VTKA 2YXEA 4ENTA 1XZFA 3A6KA 3DVAA 1SQ5A 3JR7A 2JFQA 4Z8YA 4LTDA 5HQTA 2JL1A 4QBFA 4MR8A 5BNTA 3IQEA 4EA6A 3T1TA 4OREX 4B3TB 3WBFA 4R31A 4L07A 3GOHA 5FBZA 5IBPA 2VKTA 1SG0A 3KEGA 5F2OA 1KVQA 3TZHA 3C1TA 4F6CA 4QTUB 5DN6D 4BMVA 1ZICA 2CBXA 3VOBA 3ORQA 1V9LA 1QH8B 1XEAA 1G3QA 1Y8RA 4GGOA 1OI3A 4F12A 4BY9E 1JIXA 2ZJZA 3CG0A 3EIUA 4YO7A 4YP9A 2XCLA 4M9CA 4X85A 1YC5A 5JI3E 4B4KA 1Z0UA 2E4YA 1E2KA 1GPNA 4CM4B 3RVBA 3M2PA 3V4VB 4C5BA 1G4AE 1PGNA 5HF8A 4ENUA 2I91A 3C74A 4HGZA 4Y0AA 4BNGA 5JS7A 4D8TA 3PQ3A 4NMXB 5FBLB 4DE5A 5CDFE 1DQZA 2FEKA 3ZD8A 4RK6A 2CV2A 2Y1CA 1Y80A 2X8JA 4ZRMA 2FDCA 4OLAA 4YP0A 2P90A 1RZ3A 1RI5A 1GSHA 2XQIA 2OYRA 3R4CA 4XAQA 1O03A 1M34A 1UADA 2FPRA 2G9QA 4D42A 1PJQA 1F51E 3VBEA 1DLJA 1OZ0A 1GQRA 1JLHA 2Q2NA 4G0YA 4LFAB 3KRTA 3KB8A 4JLJA 1U11A 2WIJA 3S44A 2IHJA 3SJZA 1W5SA 3FPCA 4I5GA 3BFVA 3S28A 3FJ1A 3DT8A 4K6CA 4AS2A 4D9FA 1O95D 2GCOB 3DDCA 4EMTA 5C5IA 1CUZA 2WSIA 3CX7A 3A6LA 4R41A 4E1VA 2Z3WA 3OI7A 4RABA 3S2GA 2JJMA 1GU1A 4LYFA 5DGHA 4HVTA 4DLNA 1IFXA 2WM9B 3UG7A 1ORWA 4M8SA 821PA 4FD2A 3A6ZA 5FOQA 1NJ6A 4ND5A 1XAJA 1UJ5A 2P7HA 2PRJA 1KFJB 3NVAA 4N40A 2VF8A 1Y33E 3SZMA 1Q20A 1D9ZA 2Z8ZA 2R96A 3EZ7A 3OZVA 4EA8A 2FEOA 5ALSA 5DHPA 2X0EA 4BJ3A 2FZWA 4KIUA 2J6CA 5K3AA 3Q0EA 1JSXA 3RTCA 5DOZA 5ILOA 3FX2A 2HGSA 4BAGA 4TN1A 3QTBA 2WJGA 5AVSA 2NNLD 1SCIA 3GN2A 2IZ5A 1ULSA 3OZSA 2DFDA 1EVEA 2GPBA 5FYQA 2VBIA 2H2WA 3G2KA 5EWLB 4LDQA 2NU9B 3W5IA 5AVYA 5LQNA 1ZUNB 2VAPA 4X95A 1HBJA 1NUHA 1T8PA 2B8WA 2HCJB 4PRKA 4G56A 1CQJB 3TE6A 5TLSA 1Z4NA 1GR1A 1R4ZA 1Z6YA 4EPXA 5M3BA 1JR3D 2X0NA 1VMAA 2V0NA 4JXKA 4PAWA 2G1JA 3MWEA 4E0BA 1FDUA 4NABA 3ZXUB 1Q7TA 4OHRA 3CZPA 4M37A 2ZWPA 3D2AA 3WO1A 2C4KA 4LWPA 2BM9A 3HV0A 2FUCA 4O4IB 4P4TA 4V0QA 4DPMA 4F3CA 5KTYA 3PP8A 3AXSA 3FNBA 3A4VA 3Q8WA 4RTOA 3V5NA 4IFBA 2J9GA 1UBNA 3P9PA 4K28A 1K3TA 3L82B 1T5LA 4DXHA 3ONFA 2V6MA 4UEOA 2YINC 4I2VA 2P4SA 2PH3A 3R0JA 2O23A 3L8HA 4W9NA 2E4VA 4IZIA 1ZJJA 3R0VA 2DR3A 2YCBA 1QVAA 1B3BA 4L5BA 4YLEA 1UXOA 4J0CA 4EY7A 1Z5ZA 5HMLA 3CEMA 1HYGA 2BKAA 1J39A 4P93A 2GBCA 1MDBA 4DV5B 5J3JA 2G4CA 1RMQA 2P30A 3BCSA 3PNSA 1QVWA 3T94A 5BN3B 3NUZA 1MT3A 2HLDD 4N6GA 5ISMA 3GJSA 4BO3A 2O2XA 3UBTA 1SBNE 2BR5A 1CP3A 3LFTA 2J0QA 1YQDA 4D4KA 4LVOA 1RJEA 4U7TB 2GD6A 1E1QD 1J8FA 1V95A 2Y9PB 4ETWA 4MV3A 4CQMA 1GTG1 5KUTA 3TTVA 2F2TA 2JIZA 4RDHA 3UG6A 1T35A 4W4TA 4V1CI 5HQ3B 1JB1A 5KSPA 2FFAA 2H6EA 5FBQB 2PGLA 1W4CA 2VRNA 4P3KA 4BJ6A 1G66A 1MC5A 1UZAA 3SDBA 3SKYA 2PXCA 1NVMB 1RWPA 3LMKA 2PYDA 3E6AA 4I9FA 1DEOA 1Q2XA 1DAGA 3FZNA 1FMJA 4OGGA 3JWGA 3DOFA 3OESA 4FHCA 5IBRA 3RIMA 1QRRA 2VH5R 3TLGB 2V9ZA 3EXIB 3UV6A 4RCVA 2H63A 3BEOA 3FJYA 5KVCA 3KWFA 2CYBA 3EF3A 3LM8A 5JSZA 3CRVA 1E7RA 4RVFA 2P65A 3H5WA 2H1FA 4MW1A 4KXUA 2OFFA 5IAOA 2AT1A 5I4BA 4WK4B 3AIKA 2DSTA 5FR1A 5B4TA 1WW2A 2V4MA 3G6WA 3HWWA 1T4GA 3OOJA 1VZ3A 4MDYA 5LP6C 3KQUA 2QN8A 4XWYA 1VBKA 4A0SA 3KOZA 3E9NA 1T5SA 1VSTA 3K9FC 1UEIA 2CNKA 3ZDZB 2MSNA 2REQA 2Q4RA 4DIBA 4ZVSA 3AM5A 4D9CA 3QUSA 4I8IA 2VRBA 2G40A 4CXMA 4LRYA 4DR4B 3IRVA 1X92A 4Q4HA 1LS6A 1HSZA 2WTBA 1NNUA 3F96A 3JWPA 3RVJA 2W8BB 3NJ8A 1QAOA 1ATZA 5DW0A 2YXLA 3NDIA 4ZVPA 4CE6A 1DBSA 1LW6E 3V34A 5LMCA 3HU2A 4QTXA 2UUAB 1DWPA 4BBPA 1PFKA 1OT5A 3OTOB 4DT1B 1PT6A 2Q2OA 4QPZA 1IN4A 4OQLA 3VUEA 2GEDA 1BMFA 3LP5A 4IIGA 1RXWA 4LZOA 2BDUA 1GAEO 2DCUA 2PRIA 1GV1A 2X4DA 1KDOA 3NBFA 3PVZA 4JQCA 4KVFA 2C2GA 2VF4X 3A10A 2BGIA 1LUAA 3DE1X 3DZHA 3R8XA 3JQRA 5BMVB 1RQNA 3ROQA 1O96A 5LP6B 3DL0A 4H3VA 1RWBA 4PC1A 5GOTA 2HSJA 3K0FB 3GEIA 4UDNA 4ZCSA 4CM8A 5IKPA 3IEKA 1CW2B 4LV6A 5J58A 4KAAA 4R54A 3LG2A 2KLBA 5BQ5A 1JLMA 3M3HA 5F3DA 2PT7A 1ZD5A 3ETEA 4EQ6A 4QXOA 2ID9A 3S29A 4FJ0A 5LA6F 3PITA 1T1JA 4I50B 4TPKA 3VDQA 4MV8A 2WM2A 4QUHA 3WC4A 2WUVA 5E1OA 2R62A 4D02A 4NOMA 5JAMA 5BV0A 1AGXA 4RMHA 4CM5A 2ONKA 2V8BA 2VUHB 3EC1A 3I5MA 3OPQA 4JB0A 5EMLA 3TI9A 1TK2A 4YCMA 2QL5A 1AQNA 2VHZA 4JBNA 1JDTA 1M2OA 4P31A 1RYBA 3CO5A 5FWAA 2C61A 4O4LF 5KYTA 2B4RO 2J9YB 3UQYS 2VDLB 4AIIA 4XVQA 1IVYA 1YCFA 3PFFA 1Z6TA 4PVCA 1MJFA 2I8LA 5FPHA 4BJ1A 1YVPA 1MTZA 3WL5A 2V7QA 1G291 4PPGA 2HQSA 5FO1A 4RTPA 2IEDA 4IIVA 5A0TA 2RARA 3NM6B 3C3AA 4MUNA 4M1QA 1SMKA 3QLUC 1EIZA 3JQFA 3JYHA 3C6YA 3M1IA 1G5HA 2NVUA 3R9KA 4ZCMA 1VG9B 1XX6A 2C2HA 2WHEA 1DAEA 3IAXA 4MV1A 5EJ8A 1TD9A 2K7ZA 4LJAA 2WHPA 4FEGA 5IZ4A 1YASA 2JFYA 3KJGA 3RTAA 5LJLA 5B30A 2RHTA 3HDGA 4RTSA 4UPEA 2HADA 1HNNA 4U2BA 4X91A 1DXOA 1JIIA 1PT7A 4MCIA 5LM3A 4RULA 2OO5A 5KOHB 1D3AA 1E1NA 2XDYA 1AD2A 1E5DA 2PZMA 3IDOA 2BE9A 1PGOA 1Y42X 2QU8A 3HLKA 3HXPA 3ZCXA 3Q87B 4MP6A 4MVJF 3WWYA 3K71B 1E62A 5IM4F 1Q19A 2XGGA 2ZEJA 1C14A 3K0KA 2CL6X 2GKSA 2XUOA 3BFPA 1IXSB 3N9IA 3AESB 3MD0A 1R4NA 5DMHA 1D0VA 4TMFA 4JVSB 2I2CA 1JKXA 4QC2A 5DLEA 1COWD 2BFWA 5TMDA 1GYRA 2VJOA 4DUYB 3C43A 2HA6A 3ZK8A 2BMWA 3EQ9A 3OLVA 3K3PA 2C4MA 1ZCFA 1P2GA 2EJCA 2XODA 4S2EA 1TKAA 1OFHA 1MO2A 5C80A 2RKBA 4JJ6A 3DM9B 4BLQA 3DSRA 4RJTA 3O84A 3DR3A 1EBUA 1KGDA 1WHTB 1Y1SA 3T7IA 4NENA 3ZDDA 1F9EA 5JJLA 2P0YA 3NV7A 1OI7A 3KLBA 3KYDB 4M22A 3HO8A 1K7XB 3LBYA 1JHAA 1FP4A 5ITZB 4AG6A 1D5CA 2PYIA 3DZFA 3A36A 2OAGA 4GGPA 2RHHA 5CFQA 1PHPA 3ZDXB 4Q16A 4U3JA 2UZ4A 3FSGA 2G9VA 3KTFA 4HEA1 4PNZA 3UJHA 1ZJYA 4IOKA 4N18A 1PW5A 3VXKA 1ZINA 2O3QA 4ALLA 4NZOA 4FNGA 3D2LA 4LSWA 4H1WA 5JXHA 3VHQA 1Q83A 3LY5A 3HA5A 2ZB8A 2XCUA 3DWEX 1G18A 1QAQA 3TD2A 4PX5A 3RTGA 4WBNB 2NACA 3S27A 5IKXA 3W1EA 1Z4OA 1BD4A 2A84A 3SBXA 1HE5A 3VYTB 1TZKA 3KYBA 4GPEA 4MA0A 4BLTA 3I2HA 5HE8A 5KTSA 4XFDA 3OQNA 2HCFA 3WRWA 3K0CA 4RLQA 1HOTA 2O1WA 2XITA 3SYMA 4PSAA 2VAVA 3RRNA 1KORA 1PZHA 2OAQ1 3P32A 4EPTA 1CY0A 1Q6YA 2QZSA 4RE5A 2VJBA 4RHEA 2E55A 1KO4A 5CYGA 2P4EA 3FTEA 3EPKA 1FK8A 3NIGB 2VP4A 5EXPA 5JE8A 1QIMA 4PTZA 4YQYA 2C5EA 5FTLA 2VF2A 1GRRA 1K5HA 3IQDB 3U7QB 1BGXT 4QPCA 1PKXA 1XZQA 2B3TA 2VXYA 2GUWA 4PS0A 1YB7A 4JGBA 2RGEA 2AKEA 1NW3A 4MZXA 3R9XB 4R1TA 4C4AA 2P2GA 3UGKA 2RBKA 1I6WA 2F1HA 2WW8A 1J06A 5EEGA 2GN1A 1L3IA 1UFQA 3WGNA 4YVFA 4BEBA 4GRDA 1CT9A 3FHJA 5WRFA 2VNHA 4MAAA 4N6NA 3F5FA 3F49S 2Q0SA 1ZH2A 4CQMD 3OF2A 4TGLA 1GRQA 2ZJOA 1P4GA 4BFTA 2HL6A 3GDOA 4R71A 4P0QB 1YZTA 4HGRA 1U63A 5AUPB 1QC5A 1TJ5A 1DOHA 2Z09A 3K7EA 4UVHA 3QWHA 4FOPA 4N5HX 2G76A 4OI2A 3WLAA 4F3RA 2OO7A 5GONF 1P2SA 1MP0A 5ALNA 1ZOPA 5HNKA 2P3QA 2R7LA 1J0BA 1E2HA 1NBHA 1XP8A 1W36D 1P9OA 2DECA 1SU7A 3I9NA 4UD2A 5I9TA 5A3SA 1YR9A 2VJKA 1U0FA 5E9QA 3GLGB 4NYMR 1MJ5A 2VTDA 3BT7A 1VLMA 5FULA 1XXLA 3O5AA 2ODAA 1SR8A 4UTNA 1WETA 3DB2A 1T4CA 2WVAA 4YJ3F 4JYMA 2MINA 3QUTA 4LZAA 1EHIA 3QEOA 2GZHA 2GNAA 2CL0X 1F5SA 1RABA 5HCIA 1X1BA 3K1ZA 2QY9A 3AY6A 5KYWB 5CFPA 3PA8A 2AUNA 2PS1A 4EW3A 4FXOA 1L7AA 3DFZA 2YZGA 1PR2A 3B20A 4DA4A 2YQ4A 1OA1A 2DEUA 2GD1O 3UMYA 2XMGA 3MMXA 3SNHA 2BYTA 1RVDA 1YKSA 4FIZA 4QARA 5K8JB 4UCXA 3PTLA 5A9SA 1IQPA 3DOEA 1E2JA 3F71A 2W70A 3RVPA 3OQIB 1GLGA 4QTZA 1ZM3A 3MINA 1J1ZA 3Q3VA 1RT9A 1O87A 3QF4B 3ANMA 4R9VA 1L7NA