4Q3LA

Crystal structure of mgs-m2, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
SIFTYQEKDIYYEIDGTLDINSDVIVILNGIMMSTKSWDAFVENFSKNHVLLRYDMFDQGQSSKIEESYTQTIQVELLKNLLEHLGIAQANIVGISYGASIALQFAAKYPTMIKRMVVANVVAKTSPWLKDIGDGWNEVAKTGNGLAYYHITIPYIYSPQFYTLHNDWMEKRKELLVPLFSTRTFLDRMIRLTKSAETHDVIKDLPNIKTPTLIISSEEDYLTPPFEQKYLQEHLQNAELVSIPNCGHASMYEVPKTFTALVLGFFGQTKLDYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MGS-M2
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
total genus 100
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q3lA00
3D59A 1FFDA 5J3JA 3LLCA 2PU7A 5JZSA 1GT6A 4MXDA 4P93A 1MAHA 4QNNA 5C7YA 5AKLA 1XRNA 3BJRA 3LCRA 3I2JA 4FBLA 3AFIA 1FFCA 1HPLA 2UZ0A 1L7AA 3S2ZA 4I3FA 1HL7A 3STTA 2D5LA 4GEGA 3QBJA 4U2FA 2XUKA 4M0FA 1CRLA 3DOIA 4DNFA 4FTWA 4QDUA 3FVTA 5AHXA 5DTJA 2VJAA 4EBBA 4B81A 4E46A 2J3QA 4WCVA 1ZJ4A 3C6BA 3CXUA 3W05A 1AURA 4G8BA 4C88A 1LPBB 3QMMA 4U2CA 4BC1A 2Y2UA 2XUPA 3VVLA 5AI4A 4YASA 3FCYA 3PUHA 2DHDA 1XZLA 4H77A 1C4XA 3WK6A 2BGRA 3DS8A 3I2GA 4NZZA 1EDDA 1XRRA 1G66A 1QIMA 1NU6A 1B6GA 1BCRA 5LKAA 5AOCA 4JYMA 1MX9A 5LYYA 3VISA 3G7NA 4GXNA 5ALMA 4C4XA 1EHYA 4B7ZA 4C01A 5ALYA 1I6WA 4X95A 3R3XA 4A23A 4UBKA 3GA7A 1ZI6A 4X00A 1CLEA 3KOOA 4ARAA 2WKWA 1CUSA 5ALNA 2OAGA 1B41A 1GKLA 1W76A 3D0KA 1TCCA 3UUEA 4C6HA 1K4YA 5LZ9A 3OOSA 5I9IA 1IZ8A 4TGLA 2BCEA 4BZWA 4AB1A 4Q34A 4FOLA 4BZZA 1P0QA 3I1YA 4DM7A 2K2QB 2G5TA 3BL8A 3QPCA 1CPYA 3G02A 4X94A 1SOMA 4U2BA 3WJ2A 2X76A 4WY8A 3K2IA 5IVHA 2JF0A 1W75A 2WIGA 4DMHA 4QDTA 1X70A 2WQZA 3AIMA 3R41A 4AN1A 5DWDA 3QM1A 2D0DA 1E66A 2WIDA 5AM2A 3WIBA 3H2JA 2RGUA 3PI6A 4HZGA 3FVRA 4ETWA 3I6YA 1Y7IA 2PUJA 2R11A 4QLAA 2HA5A 4GLBA 1ZD5A 3RK4A 5EFZA 4N5HX 3F8SA 1GZ7A 5CT9A 5AICA 3FLEA 4RNCA 4RGYA 1X2BA 2HU5A 3H2KA 1AUOA 1N5MA 3GROA 3VJKA 1UK8A 3R3UA 3ZLVA 3IIIA 4PF1A 1E8DA 4ZGBA 4MQMA 2H7CA 4J0GA 1SCQA 4X6YA 3D2AA 1J2EA 4CI9A 3ZV7A 5CH3A 2WLSA 1UK9A 2CZQA 1F0NA 5D3ZA 1O6GA 1VKHA 1H2YA 3FNBA 2O2HA 3WK7A 3ED1A 3D3NA 3PDCA 1J07A 1J1IA 1A8UA 4MYDA 1WB5A 4H35A 3I2HA 3SWWA 3TEJA 4X91A 4UHHA 5DNUA 5CTAA 3D5EA 4CCYA 2O2GA 3ZLTA 3EF3A 3WK4A 5CT8A 2XUOA 1CUJA 4Y2RA 4BRZA 5HFAA 2XQKA 1H22A 4FMPA 3ILSA 1EDEA 1U8EA 2HA2A 5C81A 5JANA 4BP9A 1GPLA 4JYPA 1GXSA 1VXOA 3AZQA 2G4LA 5YASA 1YS1X 1QIFA 4B85A 2VATA 1S8OA 1BN6A 3IUNA 1EDBA 4OYYA 3R40A 3WA6A 3BXPA 4AX4A 1ODSA 5C8ZA 4JH0A 5HF9A 2C4HA 1XLVA 4QDOA 2B61A 5HK9A 3DQZA 3W2TA 5AOAA 3OTQA 3ESDA 1WHSA 2CMFA 3ZWQA 3G0IA 2I3DA 1BU8A 4X90A 4W9RA 4J0JA 1UFOA 2B20A 4M0MA 1XRPA 5AK4A 1P0PA 1RYYA 4WFIA 1ORWA 1UK7A 4KR0A 4Y2PA 1O6FA 1YAJA 1EI9A 1EB8A 1G5FA 1NU8A 4Q3KA 4B0PA 3FLAA 5CT4A 5JAUA 1QLWA 2JGKA 4XX1A 2X5XA 2XMDA 3BIXA 4FLEA 4RE5A 2RHWA 4J0CA 2B4KA 1WOMA 5JAOA 4QE3A 2WU4A 3B3QA 2FJPA 3QVMA 1ODCA 5AKZA 4ROTA 4WFJA 4KACA 3O4IA 2OCKA 1QOZA 5C8VA 3RARA 1A8QA 1R1DA 5LLSA 2QR5A 4PQEA 4J0IA 1MX1A 2PBLA 4RE6A 1XKLA 5AKXA 4YK7A 5SYMA 3HI4A 4UPDA 4PSDA 3A70A 4Y9SA 4L9AA 1LNSA 3NUZA 2YXPX 2Y6UA 3WYNA 1NX9A 1USWA 4MJ3A 5A7FA 4U2EA 1XLUA 5C8XA 1BEZA 5FRDA 2BGNA 3DYVA 2HL6A 5HK8A 3I2IA 4ZXFA 1L7RA 1QONA 4YPVA 3C87A 4Q05A 1CUHA 2EDAA 2V98A 2OAEA 4CG1A 3IBTA 3KSRA 2VF2A 3R3WA 1XFDA 2H7XA 4H7HA 5AK6A 4FWBA 1MAAA 1XLWA 4OSEA 1UZAA 3G0CA 3WWDA 4AO8A 3L1JA 3B5EA 4C4ZA 2HA4A 3FYUA 4H7IA 5AM1A 1C7IA 2OGSA 1E89A 5K3EA 2VA9A 2GYVA 5ALDA 2EEPA 3KWFA 1WPRA 4G8DA 3HZOA 2G5PA 1CUBA 1H23A 1MT3A 2PSDA 1WB6A 2HM7A 1JI3A 3O9VA 3GBSA 1VJ5A 2ACEA 4W63A 2HADA 3A2MA 3WK8A 1LLFA 2IITA 3HRHA 4AMYA 4F21A 1DWOA 2AXEA 5JASA 3WK9A 2WIKA 4H7DA 1XZFA 4BE4A 2OXEA 4KEAA 3LIPA 3F97A 3AIOA 5JZBA 4OB6A 1WHTA 4K6KA 4ZV9A 1ZGCA 1JJFA 1Z68A 1TIBA 3K6KA 1AZWA 1WM1A 3VXKA 5CXUA 1A8SA 4DGQA 3Q8WA 3G0DA 3IURA 4QDZA 1THTA 5JD5A 2OLEA 5DYTA 4BE9A 1EVQA 2XLBA 6YASA 2RIPA 4IQ4A 5KREA 1QIGA 4DNOA 1L7QA 1U65A 1LPMA 3ANSA 2ZYSA 4WDRA 4U2DA 4EA6A 4KAJA 5ALRA 3G0GA 1K63A 2PL5A 2QXUA 3KWJA 4W1PA 4X7BA 3CCBA 5ALUA 1MJ5A 4W1RA 4DLNA 3D7RA 4E14A 3FSGD 2JEZA 5HCUA 4DNQA 2HA6A 1XZAA 5DLPA 2BUAA 5DTIA 3UUFA 2QTBA 3WKEA 3LIIA 3M3DA 1ACJA 1THGA 2R8BA 1R3DA 4AXBA 1TQHA 4KAFA 5FKJA 5EIEA 4IH9A 1LPSA 3OPMA 1UKCA 1MTZA 2NW6A 1XZIA 2WFMA 1OXMA 4DMKA 1VOTA 2J4CA 4L72A 1JMYA 3O4JA 1XQVA 5FPQA 2ZYRA 3D2CA 5HQ3A 1BE0A 5AM0A 1X2EA 2W6CX 1H2ZA 5AK5A 2DFPA 4HTAA 5HF8A 5K3FA 2EDCA 3FOBA 2ZJ7A 1ZOIA 3L1IA 1QIHA 1BS9A 2BKLA 1DTEA 2DQZA 2XQGA 3R3ZA 5EHZA 5ALPA 2C58A 5A7GA 5K5EA 5FOQA 5LZ4A 4DTCA 1R50A 5D7BA 4BVKA 4JNCA 4PO3X 1LBTA 4UBLA 1P0IA 5AIAA 5AI9A 4HRXA 4G4GA 1DQYA 1HBJA 1VA4A 1U4NA 2CEKA 4H7EA 2WIJA 4Y2JA 3I1IA 4B9EA 3WZLA 1U2EA 2XE4A 1UXOA 2QJWA 2OCGA 5AM4A 2WUDA 1QIJA 1XZHA 4TVKA 5SYNA 2CB9A 1CUYA 3OURA 2DHCA 1YSCA 2XMZA 3DD5A 4E15A 2YYSA 2BUBA 4B80A 3WLAA 2DR0A 4IO0A 5D6OA 5AJHA 1XQWA 3D4LA 2WFLA 2WSLA 2WU3A 3A2NA 3V48A 4EY7A 2CKMA 3KDAA 5LZ8A 2XUHA 2PU5A 4L0CA 1YS2X 2ZVDA 3BE8A 1YASA 4LHEA 1JJBA 1PFQA 4BVJA 1OCEA 4H7FA 4X93A 1XROA 4XIIA 3PICA 3GUUA 1AMNA 5DYYA 3O95A 1IUPA 1CUEA 2IX9A 1BRTA 2GZRA 1WB4A 5KWJA 4X92A 2JEYA 1CUZA 1DINA 4XWGA 3BF8A 1KEZA 2Z3WA 5AIBA 4KRYA 2ECFA 1XZMA 2AJCA 3I6MA 1IZ7A 4OPMA 3MUNA 4B0OA 5IKXA 1LPPA 5A62A 4LXGA 1MN6A 4HXEB 1UKAA 4AO7A 2PPLA 3FAKA 4LXHA 4PSCA 2WHRA 1LPOA 4O08A 4LYDA 2OCIA 2QXTA 3PF9A 3C8DA 3AZPA 3QPAA 3K9BA 3G9UA 3FSGA 5ALOA 3H17A 1K5PA 1CIJA 2I03A 1QTRA 3M82A 3NGMA 4Y2TA 4WDQA 2GYWA 4ZREA 3HJUA 1OILA 3Q0TA 4QEKA 1AC5A 2WFZA 4EUSA 3WKDA 3W9BA 1M33A 3HEAA 4UBIA 3DJYA 3C45A 1GPNA 2CBGA 3HC7A 1MX5A 4N8EA 3VJMA 4UBMA 1QGED 4B82A 2WHPA 2HA0A 3W06A 4MWTA 2XMQA 5T4FA 3V1LA 1UOOA 4OD0A 5LP1A 1TCBA 3WWPA 3H19A 2PSHA 3T52A 5EIAA 3C6XA 5JALA 3WMRA 5EHQA 1UT6A 5EHXA 5BV7A 5LKRA 4X71A 1EK2A 2RAUA 4MEAA 1AGYA 1GKKA 1VXRA 2WHQA 4QA9A 5JD4A 1LPNA 1JT2A 5AM3A 3OM8A 3R3YA 5AKJA 1QIDA 1TCAA 1FFBA 1XRQA 4PSUA 2XMBA 2WG0A 4BAUA 3WIOA 1IUNA 4G9GA 2JGFA 3E3AA 3O0DA 1CR6A 3QZUA 2ZJ6A 2XUAA 2BUCA 4Q1VA 5ALLA 3PFBA 3H1BA 1JU4A 2AJ8A 1VLQA 4EY5A 2C5FA 4X6UA 4DIUA 1FFEA 1IMJA 4UUQA 3SC2A 1KU6A 5FV4A 5HZGA 4FLFA 2ZYIA 4NS4A 3CN7A 1CV2A 2CUTA 2O7RA 3RKSA 3BDVA 4F60A 4YX9A 2VQ6A 5FDFA 2Q0XA 4BYMA 4CIBA 3W04A 1TK3A 1XZGA 2WUEA 4W1SA 4Y2VA 5HFNA 2VEOA 4UHEA 1G4HA 4GDMA 1EXWA 3W9UA 2Z8XA 1K8QA 3STVA 3WI7A 4IH4A 4CCYB 2HDWA 1EH5A 4DYHA 1YR2A 3DCNA 1LZLA 4KE8A 4UHFA 3IULA 1CUGA 4B83A 4MEBA 4MQLA 3H2GA 5AKEA 3D2BA 2HA7A 4RPCA 1ZGBA 5JAHA 3T4UA 3ANTA 4LXIA 5JD6A 4L3WA 4Q3LA 2PKYX 2I78A 3WKAA 1ZICA 5AO9A 5ALQA 1CUUA 3S8YA 1IUOA 1ZIYA 4OU5A 4EY6A 5DNWA 3LP5A 1Q84A 4P92A 2XMSA 5CH8A 1MPXA 4I4CA 1LBSA 1JFRA 4X6XA 1SCKA 2XQFA 5D3KA 1XQYA 2QUBA 2JGMA 3EQ9A 2HU7A 1QO7A 5AH0A 3GFFA 2VT7A 1CVLA 3VJLA 3NOXA 3PE6A 4F0JA 4EZIA 3KXPA 3IVMA 5JZ9A 4GBGA 1XRMA 1IVYA 2PSJA 5AI6A 4HVTA 2G63A 5AM5A 2XUJA 5CXXA 1DU4A 3GELA 3DNMA 5ALKA 2JGIA 2QOEA 4ZI5A 3JYHA 3OC0A 4FNGA 1AKNA 2QUAA 4ZRDA 3STYA 1DQZA 2YH2A 3WL5A 2Z5GA 5ALFA 3G9XA 4A16A 2PSFA 1UKBA 1YA4A 4G4IA 5E4TA 3ZI7A 2YASA 5FLKA 3E4DA 4BP8A 1KU0A 3WKBA 1H2WA 2XQIA 2VAXA 4B84A 1N5RA 3H04A 2PM8A 2WJ3A 4DSZA 1LPAB 2OPHA 4CFSA 5JYCA 5DNVA 1HQDA 4HRYA 1XZBA 2FX5A 1RP1A 3I28A 4FNMA 1N1MA 1EX9A 4K2AA 1QTIA 3EIOA 5BWBA 3WWOA 5ALZA 5IVIA 3TJMA 2Y6VA 4ZWNA 1JU3A 2QRUA 3A2LA 2Z3ZA 3C6YA 3DDUA 4E11A 5CH5A 3FYUB 3P2MA 2HRRA 1VA5A 2FJ0A 3AJAA 4G1FA 4BB0A 5ALVA 1N8SA 1A7UA 2WIFA 3STUA 4BAZA 1QFMA 2XT0A 3FBWA 4GWLA 3DL4A 2C5GA 4FBMA 3M81A 3AZOA 2DSNA 3V1MA 1JJIA 4G4JA 1LZKA 2DCMA 2GBFA 4Y2QA 2WUFA 4BBZA 3WK5A 3YASA 1UOPA 1DT3A 1XZEA 4JUIA 1BROA 3SK0A 3H1AA 2J4FA 3WZMA 5ALHA 2OCLA 2RI6A 4DNPA 1SCIA 1ZIXA 3BWXA 3G8YA 2RONA 1SFRA 4G5XA 4FFVA 1RWQA 4MYSA 1EB9A 3IA2A 5FPPA 3E0XA 1UWCA 3G9TA 2JGJA 3FWHA 1R4ZA 1FJ2A 4XVCA 1CUWA 5AK3A 1E8NA 2WTNA 1XZCA 1CUCA 3IB3A 4UBOA 5ALXA 2E3JA 3MGAA 2XUFA 2Z8ZA 2AJDA 5A7HA 1YA8A 5CT5A 3QMVA 4KJXA 1HDEA 1CFJA 1CUFA 4U2GA 4NMWA 5K3BA 5A71A 2GBGA 2HU8A 4BVLA 1ZJ5A 2C7BA 1CUVA 3RLIA 3U0VA 4CIAA 2ES4A 4Y2SA 1GQSA 3DYIA 3NWOA 4TPKA 5LZ5A 2XUGA 3A6ZA 5EGNA 3B12A 4FLMA 4BC0A 3ESBA 2OG1A 1DWQA 4UFNA 4ITVA 3DKRA 1W4LA 3DL7A 3FLBA 4WY5A 4AO6A 4J7AA 2O7VA 2WUGA 2WTMA 4ZV7A 3IUQA 3KD2A 2O2IA 5HQ3B 1EVEA 1Q83A 1E3QA 4KE9A 4P08A 1AQLA 5BWCA 3WA7A 3C6ZA 2GZSA 4WJLA 5CW2A 4CG2A 2XDWA 4F5ZA 3AIKA 5K3FB 2V9ZA 3JW8A 1YCDA 1VE7A 3FCXA 5CRIA 2XLCA 4XJVA 4BAGA 2XB6A 5T4HA 1CEXA 2ZSHA 5T4EA 1MO2A 5E4JA 5AKYA 3ICWA 3WKCA 4K5QA 5IH7A 3H2HA 3DKKA 3IDAA 2CJPA 2W22A 2QVBA 2V97A 1VZ3A 1ZD4A 1T4MA 3PF8A 4HS9A 3VVMA 1Q0ZA 1Q0RA 4P9NA 4V2IA 2HA3A 1C7JA 5LZ2A 4OB7A 1ZI8A 1XKTA 2H7YA 5FXMA 5ALTA 3BF7A 3F67A 1K6EA 1E5TA 4UBJA 4Q3OA 4DMFA 3UMJA 4UHCA 1CUDA 1BCSA 1YB7A 1JMKC 2B9VA 2QM0A 3F9CA 5ALEA 2J3DA 3EBLA 3MVEA 3WL6A 1PV1A 3CCCA 2IIVA 4J0HA 2OGTA 1ISPA 2JGLA 1GPKA 3AUKA 4FHZA 2QKYA 2WFLB 4J0DA 4LKOA 1ETHA 1FSSA 4QWWA 5DJ5A 5AOBA 2XMGA 7YASA 3WL7A 1XQXA 5JADA 3I2FA 4G8CA 3JWEA 1LGYA 4Z49A 4MWSA 2JGEA 1F6WA 3MUOA 2XUIA 2DQYA 2BAGA 3V1NA 3R3VA 5JAPA 2AJBA 3C8HA 1ZD2P 5HKAA 2WM2A 2PVSA 3I6ZA 1QIKA 2VAVA 2ONCA 3AINA 2WJ6A 5AP9A 3U1TA 1XZJA 4INZA 1QFSA 4DSAA 4X3CA 4GHWA 1WPXA 4EY4A 2WG2A 2I3ZA 4AMZA 3HABA 1QIIA 1DT5A 3H18A 4PW0A 2VT6A 3WYDA 4GI1A 4BATA 1ZD3A 1MNAA 3N2ZB 5E4YA 4OU4A 4IHAA 4BDTA 3LS2A 1CQZA 2WG1A 4HAIA 4C89A 2PUHA 2HFKA 1QO9A 1TRHA 4Y2XA 2JIDA 4Y2UA 3VKFA 2VJCA 5CMLA 5ALIA 2VTVA 4QWMA 5K3DA 4OB8A 3WWCA 4GW3A 1FFAA 5CURA 2GYUA 3STWA 5ALGA 4H18A 2WHPB 3WL8A 4X85A 3L1HA 5ISMA 3M83A 2OQVA 4Y7DA 3FYTA 3C5WP 2ZSIA 3V1KA 4UFPA 4FFWA 5ALSA 1ACLA 4EB0A 5T4BA 4X97A 5KWIA 5EI5A 1XZDA 1QE3A 2QT9A 1HLGA 4GECA 4BCCA 4AN0A 5FUMA 1JKMA 4K6HA 1EINA 4FKBA 2HFJA 5JATA 1MU0A 4UHBA 4CG3A 5DYWA 4AQDA 3IUJA 4QLOA 3IUMA 5I7UA 3ZLUA 2OQIA 2AJLI 4J0KA 3C70A 3DEAA 2ZYHA 4ARBA 4BDSA 5EIHA 3F98A 2WILA 3STXA 2X8BA 4N5IX 5AKKA 2Y2VA 4JEIA 3QITA 3CN9A 2ACKA 4N8SA 3E1GA 1VE6A 2DHEA 2BFNA 4UBNA 2ZJFA 4NVRA 1E8MA 3QPDA 1QIEA 4BCDA 3N0TA 3H2IA 1R9MA 3ZPXA 5KBYA 5FP0A 3O9MA 3VDXA 4KRXA 2GBIA 3F96A 1HKHA 3H0CA 2QMQA 4AZ3A 4J3JA 1Y7HA 4PV7A 3I2KA 4B9AA 1R88A 4EY8A 2PX6A 5AKGA 1F0PA 1SC9A 1F8UA 2VSQA 4UFOA 5CT6A 3ESAA 1DX6A 1A88A 2OGZA 5HKBA 3QYJA 4I19A 3R0VA 1XRLA 4KE6A 4PNZA 5IVKA 3AILA 4W1QA 5LZ7A 2XUQA 1QZ3A 3HYSA 4LYEA 4J03A 1P0MA 4IH1A 5HF6A 3FYUC 4H7JA 3QH4A 1DX4A 3DLTA 3PFCA 5CBKA 4EHBA 2JBWA 4KYVA 4OYLA 3V9AA 1BEEA 4C87A 1CUAA 1DWPA 2HHAA 1W52X 4HXFB 4AZ0A 3O4HA 4H7KA 2HRQA 3OG9A 5A6VA 4WFKA 1TKRA 2WJ4A 3DOHA 3HSSA 5AI5A 4Q82A 1MNQA 3ICVA 4BRSA 4D9JA 1D07A 2V96A 3HXKA 3X3HA 3TRDA 2XMCA 3EQ7A 1WCYA 4FDMA 2H9YA 2VJBA 4CCWA 1R9NA 4KE7A 2Y1KA 5LIPA 1YB6A 2ROQA 1H2XA 1ZI9A 3BJMA 5AI8A 3EQ8A 4QDXA 1QJ4A 4HXGA 1GQRA 5AKIA 1ODTC 5JARA 1CUXA 1VZ2A 4C4YA 4B6GA 1G42A 2FUKA 2P8SA 4DMCA 1CUIA 1T2NA 2HIHA 4G9EA 2PSEA 3RM3A 5A2GA 5BOVA 3SX4A 4OCZA 4LIPD 3WJ1A 3HACA 1W1IA 2QZPA 4K6GA 3O4GA 5F4ZA 4BCBA 3BIWA 4OUKX 5AKHA 1YAHA 2XMRA 4BTVA 5AI0A 1AX9A 5I8PA 4KAAA 3G9ZA 2C0QA 5K3AA 2XI4A 2XUDA 1Y37A 1XZKA 1J06A 4A5SA 1W6RA 2ORYA 1BN7A 4M0EA 1GGVA 5E2IA 2VJDA 1EA5A 5H3HA 4BTLA 1UOQA 2LIPA 3C5VA 1TAHA 1EK1A 1UK6A 3C43A 1CQWA 3TGLA 2RHTA 3PUIA 5HF5A 3G0BA 5K3CA 4N8DA 1PJAA 2H1IA 2QS9A 3BDIA 4QZVA 4S0XA 3WWEA 5JIBA 3WQHA 5EHNA 2XQJA 1ORVA 5ESRA 4H0CA 5ALJA 3GZJA 2BJHA 5IVDA 5ALWA 3HLKA 3ESCA 4UHDA 4Y2YA 3QMWA 2C0PA 2QJRA 2GBCA
chains in the Genus database with same CATH superfamily
5E6UB 5H1YA 4TXJA 2CFOA 3D6JA 4PLHA 5DSZA 4KPFC 2QUZA 3FNQA 2HMVA 2AT1A 1VI2A 4OLBA 2ZPUA 5B4UA 3I32A 3TSZA 5BQXA 4NULA 3CPHA 4OOEA 1QP0A 3ET5A 2AF3C 4I6JA 3EXG1 4MXDA 1PR6A 3HLTA 4ILEA 4P93A 1MAHA 2EFCB 1O96B 2WB4A 3I09A 4FHCA 4MYHA 4OQPA 4QNNA 3ZVLA 4C7BA 4EI2A 7MDHA 1ULTA 3HP7A 3L6UA 4HADA 4MLPA 4MYUA 2W2OA 4HQKA 4JC8A 2EQBA 2E4UA 2GHQA 2XYQA 3AFIA 4FBLA 5IUJC 3JVVA 3OC6A 1VPTA 2FQYA 3GRVA 4EO7A 1ECJA 4AIRA 3S2ZA 1N8KA 5E38A 4J94A 2X8LA 2DFNA 1DXQA 4N3GA 5LVAA 3A9TA 3JALA 4YRSA 1TCUA 4D57A 4HFJA 2XSZD 3AOEA 3QQ5A 1OTXA 2J5BA 1ZGAA 3TQTA 5DEOA 2PKWA 1GNSA 2CJWB 1P17A 4Z4HA 5IDYA 3UGJA 1AH2A 1NGSA 4ARIA 2Q2OA 4NYMR 1SUEA 2ZITA 3HDVA 3ZWCA 4DNFA 3DMTA 1OSNA 4QDUA 1ONSA 3HY6A 4Z4QA 1G8HA 1ODLA 1RAIA 1TC1A 4WLEA 1PD0A 3HTXA 2ZM6B 2B2NA 1D8TA 1YIDA 4HWGA 4KUHA 2VJAA 1O1YA 3DZBA 1HYBA 4M0KA 4BNDA 3ZGNA 4EBBA 2F3PA 3RSCA 1PFWA 5L3SB 1KORA 5ITZB 2GPTA 3DPIA 3IUYA 4U7WA 3G49A 3CXUA 1JR6A 4CV2A 1C7RA 3FOZA 5JJKA 2XTZA 4TT3A 1WMAA 3WLNA 4N7JA 5L45A 5KTMA 3A9CA 3VYSB 3QMMA 2H1VA 3W5VA 4IJWA 4TN1A 4U2CA 4W7SA 1VLJA 1EE1A 4BC1A 3HKBB 2TMGA 3A8TA 5EZQA 1AQ6A 3IO5A 4YAWA 5AI4A 4YASA 1X1EA 5A6SB 4H2DA 5L8VA 2ZCJA 2DHDA 4DG8A 2O5EA 4AI6A 1I2AA 1XZLA 3EBPA 4JI5B 4AM8A 5HUQA 2PQ2A 3AVVA 4FP9A 2LKCA 1BWQA 1VHQA 3LL7A 4KMRA 3PWSA 1F8YA 4M0UA 4BWGA 3G2OA 5F3DA 3BT7A 1YB1A 3I2GA 3EGXA 3F3KA 3MD9A 4OJQA 4JUCA 4KR9A 3LCMA 3KJEA 1UF9A 4LVUA 4JDUA 4C4OA 2CXHA 1HRKA 3ZE9A 4A36A 1M34B 1E7SA 1REQA 1PZFA 3LSYA 4HXYA 4YBRA 4KAXA 3OSUA 1ESNA 1L5OA 1M2WA 1WNTA 1HMPA 2RBEA 2Z2IA 1XTBA 5LYYA 4EHDA 2HBYA 2XWJI 4IDDA 3LCCA 4BRUA 4NMXB 4ICIA 1QGAA 3OI7A 4F1WA 2RHRA 2ZJ2A 3GNSA 5ALMA 2FWMX 2R6AA 2JAOA 3R5TA 4CMCA 4DQDA 1EHYA 3AUJB 4GVPA 4OXQA 4C01A 3TOCA 3KRTA 2R8ZA 1R2QA 2VYQA 4PWYA 2DPHA 2Y1LA 4X95A 4GMXA 4PVCA 1MVNA 5IN4A 2YRFA 1FDUA 3R3XA 5BVGA 4A23A 1EXDA 4OKSA 2WHYA 2ZBRA 1D6NA 1CJSA 2VTKA 1CLEA 1Z4JA 1NNEA 3IS3A 1CS0B 2FLKA 3PL1A 4OKIA 3WGTA 4KL8S 2XDYA 1MIOA 2HWYA 4R2HA 5HA5A 5HG0A 4NQZA 4CF6A 3W1VA 2E49A 2GTPA 5H9VA 3MA0A 4Z9AA 2Y0DA 3O6VA 1GKLA 4PICA 1J33A 1XEXB 2CNOA 2FX3A 3KOUA 4XFKA 2WY2D 1OJ7A 4HNAA 2VHUA 3EZ6A 3S5UA 5HCIA 4R2IA 3CBQA 4UZEA 1LV8A 5JC1A 2B1GA 1CR4A 3HP4A 1BMDA 2AFIE 1U2GA 2Z1NA 4F2GA 4Q16A 3TX6A 2BBSA 4II3A 1XNHA 4RIIA 3MT0A 4YRKA 1M2JA 4C0JA 2O8FA 1DEHA 1GGMA 3OLWA 4TLLB 4MZXA 4I36A 3PNPA 4B3FX 1GA6A 4ZGGA 2BCEA 4GQIA 1SQ6A 3PUYA 3TAHA 4EPXA 3I9NA 5JI3E 2MHCA 1AZLA 3AL0C 3BTUA 3U40A 2IBSA 4KZKA 4Q9IA 1W5AA 5EP3A 1TJ3A 1XZ8A 4L22A 2Q2WA 1W2WB 2JAXA 4DREA 4R4JA 1P6UA 3ZU6A 2G5TA 4A27A 3R09A 5TGZA 5FV7A 3RS9A 1GU1A 3BL8A 1S01A 3HYNA 3PIRA 3SZMA 2MINA 3A4LA 1Y4SA 3EB9A 4IDCA 3EFHA 2BGKA 4I50F 3G02A 3ZHXA 4LHXA 4OHVA 5C4GB 3NJ4A 4DIFA 2Z4RA 4OQNA 1VL2A 3STHA 2WAOA 2FR8A 3L8MA 3NHZA 1R5BA 2AR7A 3FR7A 4KYTA 3N0RA 3WLMA 5IVHA 4F4FA 2CXSA 4GUDA 4C7VA 2WIGA 1JG6A 3S2SA 4E88A 3BMOA 1OWOA 1XTTA 1XVLA 2QSUA 3HCWA 4QDTA 3PSHA 3R7BA 4AN1A 3R41A 3EVFA 4DZTA 4HN4B 3QXGA 3GHYA 2WIDA 5AM2A 3ZS8A 2GZMA 4RDCA 4HZGA 4EG0A 3QUBA 4XUEA 3I6YA 1VBMA 1H3FA 4KO4S 3FTEA 1U6KA 3GMSA 4RJLA 1IK6A 4Y9TA 5DHTA 4RQTA 5CX1B 4DDUA 5BURA 5JS1A 4HJXA 3DOEA 4E2WA 2P2YA 5KNCH 1CXZA 1VG9B 2VHVA 3RK4A 3RRBA 1S2GA 2HK9A 1G8YA 5EFZA 3ZVMA 3KOMA 1BCSB 1IEXA 2QNRA 2WIBA 3F8SA 2YS6A 1GUYA 2EU8A 3UJPA 2QD2A 4DLTA 4NZMA 1RZRD 1CLUA 3L0CA 4GX5A 4M46A 4V0SA 1FDTA 3FY4A 1GZ7A 3LQYA 4TMZA 5D00A 5K2MA 4D9NA 4DBLE 3N8HA 4CGYA 4WASA 5AICA 4BWYA 4F1JA 2BKEA 5CTJA 1FRQA 1I7DA 1AU9A 1QYCA 3VJRA 5F5LA 1X2BA 3H2KA 1U99A 1QPGA 2CBZA 3OVMA 8ADHA 1YBFA 2OBFA 3GFPA 3UG6A 1J2JA 4B7CA 1PJLA 2B4RO 1N6OA 2F4NA 4NCHA 1G3RA 2DX7A 1EFVA 2CDRA 4G0YA 4MQMA 1YRAA 4N65A 5J2TF 1VHWA 3RSSA 2ZGVA 4BO2A 3PNKA 5D84A 3C6KA 4Q1CA 2ATVA 4R83A 5CUQA 4G1CA 1SCQA 3L2OB 4X6YA 3AR6A 5CB4A 5SY6A 4D74A 4CI9A 3RRZA 1DSSG 2LIVA 2ZRMA 5F7JA 1GLVA 1YL7A 2B35A 1HX7A 3E61A 2V9PA 4JBNA 4KX5A 3DP9A 1PT7A 4GZLA 3M6LA 5D3ZA 1O6GA 2Y27A 1PK7A 2XSZA 3HBAA 3O8QB 1VKHA 2BFOA 3RHTA 4DJJA 3GLHA 1JN0A 2Q3MA 3WK7A 4BQNA 1RJFA 4K9NA 1UJBA 2M6KA 2PZKA 3NVMB 2QDKA 3P2YA 5EEHA 2AQIA 2C78A 3GGJA 1BGVA 1DAPA 1RE0A 3N0XA 2YWHA 3N05A 4LC1A 3RFFA 3VPGA 1J1IA 1A8UA 1IXKA 5B58T 2LNDA 3E2PA 2YJ3A 2FFRA 3RJZA 2RH9B 2O3TA 4MYDA 2PRSA 2Q7XA 1WB5A 3QELB 3EAGA 1ZK3A 1UBNA 2WT9A 4MR7B 1U2DC 2G5GX 1MDBA 3PC4A 4BNYA 2C4TA 2EHDA 4XD2A 1Y6RA 4MAMA 5E7MA 2FPXA 2OESA 3OCCA 4UNRA 4UHHA 1SZJG 4QXMA 4RA9B 4TVOA 3VH3A 4HNUA 2QX9A 1TLTA 2X41A 3D5EA 3H9QA 1Z0KA 4D3XA 3C1AA 4QTYA 3EXAA 4I2VA 1OB5A 1X7ZB 2NO4A 1JDTA 3JQ6A 1CY2A 4QG7A 3L7BA 4OM8A 4TRMA 4WQMA 3C7AA 3SZUA 5A9SB 1GSIA 1ZL0A 4L6AA 1YDHA 5LBTA 1QVAA 3TN7A 5JPCA 4BNLA 4ZEMA 1JLHA 3ILSA 1KQNA 4BV8A 3DPSA 2B1IA 4GKAA 3OZDA 3MINB 3U7QB 2QP3A 1DKQA 4MUJA 3LRPA 1GPLA 1EWRA 1FQJA 1WKVA 4JYPA 4M49A 2JARA 3LG2A 5K1ZA 5A3JA 2C2MA 1G2QA 3LUGA 4DQUA 5KSZA 4KGVA 2X15A 3MWKA 5GINE 4JL6A 1GGKA 1H1LA 5IKOA 5A9TA 4BQFA 4K6FA 3RFCA 1N0IA 5LOVF 1GY8A 3GAAA 2G4CA 1EDBA 1OLXA 4RD3A 4WBNF 4OYYA 3WA6A 3SQLA 3EVTA 2COEA 1OPXA 4AX4A 5C8ZA 1I94B 3EFEA 4OIFA 4TQAA 1LVHA 1V16B 3ZWKA 4DJAA 3L4BA 1LDEA 1Z25A 2JFYA 4JVSB 4L4ZA 5B3JA 5JDCC 1C3LA 1RBZA 4JH0A 5HF9A 2DFKB 3UANA 4QYTA 5I3ZA 4BVBA 1E2BA 1YHZA 4DDWA 1M2KA 4L4SA 4MW5A 3TEMA 3FLMA 1T9BA 2WMDA 3PJGA 5AOAA 2X6QA 3QOYA 1NNSA 2QTWB 1MB3A 3VZSA 3LLUA 3SKYA 2VDUE 3ZCSA 1XWWA 4TWIA 2XKBA 2PJZA 3PD1A 4R8SA 3UXYA 4ML3A 3X2EA 1YT5A 1U7TA 4KSYA 2XDQB 3PQEA 5J23A 5JRZA 4DLXA 1HTBA 1NP6A 3D0RA 1HT1E 4YS6A 1ZFNA 2HV9A 2YZMA 2QUJA 4Q7JB 4QUKA 4ZVVA 4CCSA 4D1YA 2A5LA 1XRPA 3QKWA 1P0PA 4JGBA 5EAIA 4EA8A 5T5QA 2VCEA 4NFYA 3O8NA 2IQ5A 4WFIA 1P2BA 1VECA 1XCMA 2GEUA 1XDDA 3QLUA 2R60A 1JG2A 4Y2PA 3WJAA 2Q3DA 4LRYA 1H2BA 1QR2A 1ODJA 1UXHA 1XVUA 4FD2A 4IMJB 2GBLA 3LYAA 4GMFA 3VHXA 3D8BA 2A88A 2YC2C 5IJ0A 1A7KA 1WXQA 2RHHA 1FL9A 2V7QD 4WX2B 4ACAA 1V6SA 3A25A 4EBFA 1NF9A 2UKDA 4Q3KA 4GNRA 1D3AA 3EDMA 4B0PA 4QUIA 5CT4A 4YTEA 2YVAA 3Q2IA 4YJDA 4EGQA 4Y6LA 3TLMA 1QLWA 1KDTA 4JBIA 1QHHB 4WXEA 3L4EA 3MAAC 2JFVA 2XMDA 1E5VA 2VK1A 1CU1A 1NUTA 1XCGB 2XKJE 4JVOA 5JJIA 4L50A 4E5SA 1Q22A 4D99A 5BMVB 2RHWA 4K6MA 4ND6A 4M21A 3PHLA 4KFRA 3SI7A 4CE6A 4NZPA 2UUBB 1V48A 5H59A 3TSAA 5C1BA 2I54A 1IOVA 2KE5A 3CVUA 2YIDA 5KTTA 4PSVA 1NFFA 3P0FA 2FJPA 3T5GA 1NZFA 1ODCA 3T5BA 4A8PA 4Q4AB 1E59A 3EXIA 3O4IA 5A4FS 2X0IA 4LDAA 1AN9A 1AZTA 4BPBA 1DIAA 1QOZA 2M1ZA 1RJDA 2H2HA 3I92A 3L6DA 4N5LA 3LFTA 5C8VA 1WBBA 3W8EA 1NW3A 5E3JA 1UZLA 1A8QA 3TH5A 4WACA 1K5GA 2NV0A 5CA0F 4XEHA 3NEJA 4YY3B 4PQEA 4YJHA 4BVGA 3C3AA 1H5QA 2XTNA 2RGNC 3IP5A 1A2KC 2I5PO 3DDZX 3WV4A 1Q16A 2YHBA 4DPMA 3FNFA 3ITDA 4IZIA 4KIGA 221PA 1E4EB 1OZHA 3F6RA 2QYTA 3I3OA 2GTHA 2I2XB 3G13A 5HQTA 3U44B 4Z4EA 3EVDA 3G2PA 3FOCA 1A4IA 4UAVA 1F6BA 2V8OA 2LE0A 1OROA 3EDRA 3ILXA 1OJLA 2B4TO 3T6KA 4O4IA 3DCJA 2QNIA 2WE7A 3E23A 4NCNA 4TSKA 2V7TA 3SEZA 3IO3A 4DJEC 1KMHA 5A0FA 1GARA 1RXSA 1L5GB 3RSQA 1JTVA 3PC2A 5JD3A 2NAFA 5DNEA 1MQ9A 2GXQA 3N0WA 2QN3A 2DPGA 4MUXA 5IRCD 4ZQIA 5L3QB 2Z30A 5ECYA 4O63O 2HC9A 1IEWA 4NBNA 2B8NA 2DTEA 1XLUA 4U2EA 5NULA 1SC6A 3WQSB 5C8XA 4LQLA 1GD1O 1DJNA 3GVCA 1HL3A 1J25A 2RARA 4FEYA 4B8ZA 4CM3A 2C00A 3EGDA 4CUKA 1CKEA 2HL6A 2OSBA 5HK8A 5AHOA 4XWWA 3P9ZA 5HJ2A 1JIVA 3I2IA 1F7UA 4ZXFA 2QAGA 1FXUA 3L0DA 4RUKA 1B1AA 2JA2A 2VK2A 2H59A 3M49A 4MUGA 1QJCA 3MTQA 2AC2A 2GK7A 1CUHA 2P6UA 2EDAA 1ETUA 3GK3A 1G98A 1FFXB 4O25A 4US1R 3RUCA 4CDNA 2OAEA 4CG1A 3RWMB 2RC5A 3IBTA 5AW6A 3GFGA 2A30A 2QT1A 1XFDA 2H7XA 2BSXA 2OWDA 5SY9A 5LWHA 4HX5A 1EP9A 3CISA 3EOBI 3P4UA 1QLJA 3LE8A 5DM4A 3G0CA 5K8CA 2W98A 3BD8A 3D7LA 1UOEA 3ZE7A 4MI6A 3L0IB 3ETEA 3WMGA 3ZZNA 3DO8A 2Q1WA 1PJBA 2REOA 1BYUA 4QTXA 3UMYA 3TLGA 3T34A 3FD8A 1UJ4A 3QY0A 3VH1A 4BLUA 1KI3A 2DR3A 3F6EX 1RLJA 4UE2A 1YB4A 4CEIA 5AM1A 2YUIA 4UW9A 2ZP1A 1AK1A 2X22A 4LY0A 4AWXA 1Y5MA 1E9DA 3R4CA 3BRCA 16PKA 2Q5HA 5K3EA 1J09A 1I2MA 3HUFA 2YY5A 3EGWA 4M1SA 4RD2A 3CUTA 2VA9A 2VYFA 3PQ8A 3GRUA 2OXFA 4KPGA 4M9QA 1SPXA 4JYAB 5T8KA 1B8OA 1TM4E 2EAUA 2VCHA 3KWFA 3HZOA 1YRYE 1YJQA 3K5PA 3KT6A 5FNVB 3VZDA 1ZHFA 4EATA 4YAFA 3L6CA 1Z0JA 2WF7A 4X5OA 1YJCA 3KV3O 3PQDA 3GT0A 3O9VA 2QUKA 2GAFA 4TYWA 3HYTA 1DG1G 4EI7A 3UUGA 3JATB 4JVLA 1VJ5A 2FWAA 3GGCA 4PZ9A 4W63A 3RF6A 5E8RA 3B1ZA 2HADA 1M0EA 3F46A 3A2MA 1HEYA 4H3VA 5BSRA 3HRHA 5GVRA 3IT2A 2O0HA 4EELA 4A5OA 4P80A 1DWOA 5B12A 5JASA 4W7IA 2AD5A 3QHPA 1JFFA 2VDMB 1QV9A 1F3LA 3RROA 3W3AD 4A8JA 3AGPA 4NIMA 3HB4X 3S7ZA 3VOSA 4K9MA 4PIPA 2C88A 3LYLA 1Y8QB 2OXEA 5C37A 1B3BA 4PWZA 2IXAA 3AIOA 5BYJA 3I8XA 3C2QA 2FJUA 1HDYA 3V4OA 5DLDA 4BNZA 2YNMD 4FR2A 4XARA 4ARUA 1ZGCA 2F48A 1BRMA 3Q9UA 5GMOA 3A32A 1JJFA 2GASA 4Q1EA 5IYZB 1AJEA 3KUDA 3MC1A 1AZWA 2ATEA 5CXUA 2B9EA 3HDTA 4DGQA 2OLKA 4L1KA 3Q8WA 3O8RA 3FCAA 3NHYA 4KMOA 5IZCA 3G0DA 5H7XA 3ZVNA 4LSGA 1OAKA 4QDZA 2C59A 4OFBA 4N0MA 4IIXA 4RANA 2NO9A 4ZVUA 4MVXA 1XN1A 3DM5A 3K96A 1GTSA 1VIYA 4BKQA 1O57A 1EVQA 3UWOA 4ZKEA 5K0LA 4HEJA 1ICIA 3KPJA 3RC2A 4H4CA 3RYCB 4QELA 4FSXA 4I08A 4TS1A 1M2EA 3N8IA 1CF9A 2CNKA 3IBGA 1HRDA 5BRNA 1M1YB 2GR9A 2VHXA 3QU9A 1FFYA 1PYGA 4IDBA 3N2EA 1AQYA 1OXUA 3A37A 4DXDA 4M3NA 3W6ZA 3PTLA 4U6NA 2IC5A 3QU2A 4DNOA 1RPTA 4KZPA 2OCAA 3N86A 4YHHB 4TWBA 1QX3A 3ANSA 4PHFA 1VP9A 2ZYSA 2C98A 3OFNA 3PQCA 3RVJA 4N3NA 3BK7A 4Y6OA 1U7WA 1ADGA 2Q45A 1PD1A 2QX8A 1W8IA 2RGWA 2X2PA 3EGVA 5CHYA 4H4DA 2PL5A 3T4PA 1QB7A 1RHRA 3OE4A 1B15A 3I53A 2GS9A 3KWJA 3PPWA 4HQNA 2Y99A 3K0FB 3NVAA 4OQEA 4W1PA 1L8AA 4RMHA 3U4QB 4D2IA 1WZ2A 3GJ3A 1I13A 4I99A 4DC9A 3BD9A 3DE1X 3GOQA 4ASUD 1D5WA 4DLNA 1T6YA 1ZNZA 2GILA 3MN1A 4MAAA 2PCLA 2V7QA 3NASA 1R66A 2HA6A 1CG6A 3OECA 2WTUA 1XZAA 1E1MA 2XVZA 3LGXA 1O03A 5FBWB 4LNHA 1HGXA 4HDSB 1EAMA 2C0CA 1A2QA 3DTVD 3FPSA 3SXPA 1BNCA 1T5HX 1JIKA 3VU9B 1RYDA 4DIDA 1VKOA 1DZ3A 1ENZA 2IVFA 1TQHA 4UQLA 4QHTA 1GILA 3JQ8B 4B2YA 1LPSA 1Z8FA 1ZJ6A 3OPMA 2FG7C 3U5ZB 2A94A 3K53A 4W5NA 3T54A 1GCAA 1ZZGA 4MO9A 1USVA 4KVGA 5KYKA 3BFPA 4PCAA 5EIXA 1UM9B 3INRA 4G8JA 5ECDA 2GERA 2N1MA 4W5JA 2WFMA 4DIBA 1U8CB 3F6CA 3PPXA 4DMKA 1LBIA 3AB3A 1VL5A 3A9RA 3VOAA 1FS6A 1ZRNA 2X7JA 1XQVA 4Q1FA 4FC7A 1R7RA 1W0KD 3B3GA 3RRJA 1PF7E 3OJFA 3KKKA 4ZALA 3DZKA 4CLEA 2J33A 3MNFA 4HDKA 3C1OA 1BE0A 1V5IA 3R7DA 1P7CA 4A4DA 1FP4B 1B2LA 1QG2A 4LXUA 1T1IA 1OC4A 3V6LA 1Y1TA 2VJOA 3OLZA 5CFZA 1JECA 3ZVKA 2GOYA 4S1PA 1L5ZA 1LTKA 5CDFE 4Q9LA 3J7AC 2AV6A 2DFPA 2AN3A 4NH4A 4BVEA 2HNKA 2F3RA 2O0JA 1QANA 5CVVA 5K3FA 1TMKA 2D4AA 2NXJA 4OY3A 4QU5A 3GY0A 1Z6TA 4ONEA 4E13A 5KWSA 3EODA 1RPJA 1MC5A 3MWDB 2H54A 2XQGA 4H60A 3TWOA 3PEWA 1CQJA 1NN3A 1RJ9A 3L43A 5ALPA 2C58A 5A7GA 4JXJA 5FOQA 2QK4A 1RPZA 1T9HA 2D2FA 4YP7A 4DTCA 3Q6NA 1SKMA 3F2IA 1GGNA 3D9QX 3KYDB 4I4NA 2B8WA 4BVKA 1OHHD 1OX4A 2A35A 4OSPA 4ZI7F 1QF6A 4UBLA 4UM9B 3F6BX 1Z62A 1YULA 2FY8A 2FI1A 4I6EA 4GF5A 3L9XA 1JEDA 1PG2A 4IJMA 5AIAA 2XD9A 5AI9A 4D0RA 3WY9A 4Z6KA 1WKBA 1W49A 2V6IA 5EQJB 3PD7A 3I1JA 4P36A 4YQYA 3TSWA 3WMFA 3MQ4A 4Z1MD 1WW8A 3G68A 1DG3A 1DMSA 3HBMA 5DXAA 2P3OA 1JR2A 2R7LA 2ZJ0A 3P26A 5JSKA 1U4NA 5JS2A 3HGTA 3WMEA 3ZHSA 2QTVB 4XH9B 3NYQA 5KWEA 3ND9A 2NTEA 4M9SA 1MAWA 2AR0A 2VA8A 3TS1A 1UJ2A 1IZYA 4DMRA 4QT4A 1A9YA 2GCNA 3PPVA 2I8AA 5HM6A 2DULA 3JSXA 4WOBA 5AW9A 3VA7A 2Q9CA 4JB0A 4Y2JA 1T43A 4B9EA 1RHJA 4Z3OA 1U2EA 2O3SA 2XE4A 2OBYA 2TECE 1N1GA 2QJWA 2OCGA 4L4XA 5E1BA 2OR3A 1MJGA 3L8CA 3G5MA 5IBQA 3W5BA 4WSOA 4A2WA 2FQXA 2QM3A 3LWZA 2G3YA 2IHNA 1E7QA 2R1VB 5HRUA 2H4WA 4HJRA 3WLOA 2JZCA 4R05A 2WAMA 1V71A 2V59A 3C3JA 1Y1SA 4NL4H 1X13A 2ILTA 1JWBB 4QEZA 1PJ8A 4QOIA 5IFKA 4DXAA 1W85A 5MF6A 3MGBA 2CB9A 1GKYA 1FMTA 1WZUA 3GUHA 3L9WA 3OHSX 3DF7A 3M2PA 5JRJA 3K16A 1YSCA 4C03A 4DT1B 4YJ3A 2BT4A 3CZAA 3DD5A 3B51X 2YYSA 3NORA 1U1IA 2HMUA 1R6DA 4LTMA 4S2EA 2QSJA 3P0IA 2PSSA 1U3DA 4PAQA 2EW2A 3TYXA 4MGIR 3A10A 4M54A 1IK4A 5F2EA 1Z17A 1UMDB 3VQTA 1H6CA 1Z4NA 3O3MB 3G1UA 4QAQA 3MWJA 5FTMA 4GYKA 4DV5B 3OTHA 3AG5A 5JAZA 3EWAA 4M1ZA 3C41J 2AN1A 3WIEA 1Q15A 1UJCA 1WXXA 4RZ3A 4ER0A 5C8DA 2WF8A 3D6MA 5FWXB 4W9MC 2QR3A 2AOUB 2YHSA 2X9NA 1KZHA 3ICOA 3Q3CA 2D2XA 1IJKA 1T5TA 3W3AA 4HYYA 4N7MA 3S2UA 4AZWA 4AX8A 2XCOA 2KX7A 4PZ0A 4Q19A 2YQ4A 1F9EA 4OH1A 2A1UB 1BHQ1 2BCGY 2PU5A 4MV0A 3GRCA 4FDLA 3H4VA 5EYPA 3M1LA 5BSUA 2DU8A 3M6VA 1SBQA 5TSDA 3FUUA 4NE7A 1IAQA 1PKEA 2YNMA 3DFFA 3BH0A 3GG9A 4BVJA 5CEJA 4H7FA 1NOKA 4TKZA 4X8OA 3GC6A 2RHLA 4XWKA 5EUCA 1C8VB 4ZDWA 1TKBA 4RA6A 3DLBA 4ND2A 3HR4A 1Z0FA 4YRGA 4DS3A 1NQOA 3GRKA 3PICA 2VSNA 3ZWWA 5JQGB 2Q29A 1M2VB 3BRQA 4LFCB 3HG7A 2JPDA 3S2FA 2A9JA 5DHSA 2JLWA 4OJTA 1YU6A 2V1XA 1BE1A 4YRQA 3P0JA 1CUEA 1MQAA 4EG8A 2CYAA 4TT8A 5B1IA 3GBVA 1A04A 5KWJA 3BWEA 3IP3A 3BD7A 1P8JA 1X7XA 2H85A 2R85A 1MRNA 3ELUA 4XWGA 1T15A 5FBVB 5JVDB 3EPLA 1YUMA 2A5GA 4XGNA 2B83A 2Q9AA 2WWYA 3EC1A 2Z3WA 2BLLA 2GWRA 4QFCA 1P1RA 3GJ8A 1WUJS 1SCUB 2AJCA 2B6NA 2XYHA 3I6MA 3OOEA 2PA3A 4OGWA 4OPMA 4KDCA 3KT0A 2XEDA 3S29A 4B0OA 3D43A 1T2VA 4YP0A 2JBAA 5LNK6 4C6SA 3OQJA 2OXRA 4XR9A 1PUXA 4LXGA 4HXEB 4XCXA 5JTTA 1X0XA 2DUMA 3L6BA 1JLMA 1UKAA 4JJ8A 5COAA 4E21A 3NVKI 2PPLA 3FAKA 4PSCA 2WHRA 1BJTA 1LPOA 3IR7A 3PENA 3VC1A 2OCIA 1PJSA 4K6CA 1BDHA 4ZU3A 1P33A 3PQ6A 2J0EA 1N2JA 2OV1A 5J4VA 3BHMA 4NP6A 2J7KA 2JGDA 2WVAA 3LP6A 2I66A 1AT1A 4XQEA 4ASUA 5EWMA 3K35A 3UK2A 2YN4A 3LDAA 4EHAA 5AOVA 1QVVA 5HIMA 2NSYA 3G9UA 4OP2A 2WD7B 1N6HA 3H17A 3P96A 3WGKA 4CMEC 4YV2A 1CIJA 2I03A 1Z0UA 3J81k 1I24A 1QTRA 3NGMA 5J40A 1GA4A 3MUFA 3GUVA 1G9TA 2VL7A 3I2YX 4ZREA 1JALA 3NC0C 3A3PA 1XDGA 2Y1FA 3IHTA 5G41A 1OILA 3DTVA 3X1KA 4ZYZA 2UUCB 2C7RA 1EDOA 1W9MA 1XU7A 3FFBA 1MV5A 3I9JA 3M9WA 4RXMA 5TARA 4TLEA 4LSWA 4PVDA 5H3CA 1UANA 3ZWYA 4B6JA 2WFZA 3UHOA 1L4MA 3WKDA 1GRCA 4EENA 4F97A 4IQ0A 3WL4A 5FIUA 4XB2A 1M2HA 1U4SA 1E9CA 3ITNA 1ZN8A 1BU5A 2J3KA 3DJYA 3ECSA 4XYEA 3WRXA 2WJWA 4I5GA 3C45A 4FC6A 1C7FA 1GPNA 3HC7A 4ZMSA 1PLKA 1QGUB 1MX5A 1Y8CA 3KBBA 1PRYA 2YDXA 4AKTA 4OBWA 2II6A 2X0NA 5DCWA 3UMSA 2YDYA 4NFLA 3VJMA 1T6NA 1UDWA 1QGED 2FX2A 3AP2A 4MICA 4PPQA 5T3UA 4Y8VA 1T5OA 2I4OA 1W0KA 1Z33A 1KDOA 5H83A 4E94A 1YJ8A 3Q7IA 4Y6RA 3OIYA 4KRFA 5HZHA 1GM5A 1W0CA 4D43A 5CU7A 2O0LA 3GLGE 3AKYA 1YMVA 4DFDA 2F59A 1UZMA 1Z13A 2HBQA 3IV7A 4EMBA 3E9EA 1K08A 3GFRA 4NENA 3OJCA 3MTEA 4DLKA 1KEEA 4HAOA 2IQIA 1WZCA 5TNXA 1M9NA 2E6KA 2R6ZA 3HCOA 2V7EA 3QG1A 4AAYA 1Z34A 4M0PA 5LP1A 4CXMA 2YXEA 3BILA 3D6VA 2LCFA 5K03A 2FQ1A 3KYCA 2YXNA 4YAEA 3SJZA 1KBQA 2GK3A 3JPYA 3QXSA 1X9GA 5BQ5A 4Q7MB 1JG3A 4JUFA 1D09A 3SU8A 3GEPA 2O54A 1ESCA 4BNXA 5BV7A 5E4FA 5LKRA 1M6HA 1EK2A 2CXPA 2JFXA 3G1WA 4FZ5A 1QUEA 4OLJA 2NO0A 3EDOA 2OP0A 3ZWPA 2B36A 3N59A 3D8NA 4BO3A 1CCWA 3FHOA 2JCGA 4Y1GA 1OHHA 1TCVA 1Z12A 2Z83A 1RW4A 2QORA 1DIRA 3EZ7A 2BE7A 3JS5A 2QLLA 4PEVA 1MPTA 4HGOA 4L4YA 4I4IA 3IE1A 1DARA 3WADA 1SWWA 5CK5A 3WSVA 3H75A 1SKYB 4DQ0A 3KYIB 4X66B 1JYSA 1R0KA 2ODTX 4Z1MA 3VC3A 1TI7A 3NX4A 3ZTWA 2ONYA 4CLOB 1GRNA 1NSYA 5BSFA 3X2SA 2C57A 3OE7D 2YIVX 5L53A 1FFBA 1QV6A 2DHQA 2H3HA 2QVCA 3K8ZA 2OHJA 1AB6A 1YNSA 2EEZA 3KQYA 4Z5XA 3R9XB 3K1TA 2X0DA 5K0BA 3L7KA 3H8JA 1LJLA 4Q01A 4ZDKA 1FPQA 3EZYA 2XE8A 4FOPA 4NABA 1RFLA 2FFJA 4BMNA 3T5TA 8GPBA 3D0OA 3IP1A 1IUNA 1SA0B 4N0EA 3M0EA 3SYLA 5KIAA 5GM2A 3KALA 2X8JB 2DPXA 2Z9BA 2I65A 1CR6A 3QZUA 5KYYA 2A8YA 1XHFA 2A67A 2YJTD 2GVNA 4JA2A 3GP8A 3PFIA 2NN3C 4YAIA 1RIFA 1Y4DE 3LCVB 5TQ2B 2NTNA 1Q0QA 1HDXA 1U1FA 2QDXA 3PFBA 3HM2A 3DCIA 3OIWA 4OGKA 4R7GA 1KFKB 1R4MB 4EY5A 2C5FA 2ZAGA 4GZ6A 1KI6A 3RK0A 4JJAA 1FFEA 3AR2A 2ADFA 4ENUA 4U7FA 2HRDA 5CFLA 2W0SA 5KS2A 3KKPA 3UIEA 2ZRHA 3RVLA 3VRHA 3PS9A 1TDJA 4EW6A 4D6XA 1XU9A 4C4PA 1UXKA 5EN4A 3ZEAA 4KH0A 4PAOA 1ESDA 4FZJA 4NS4A 4OLHA 3TLZA 1N33B 3CN7A 5FF9A 3RKSA 1UFKA 2SBTA 1NULA 3AY7A 5FCDA 3ZLBA 2VQ6A 5FDFA 3UT0A 1NSFA 2OPBA 1SK8A 3EH2A 4I9GA 4KN9S 4WBSA 3W04A 4BYMA 1E2LA 4RWEA 2P3QA 4Q00A 5JNRA 1ECLA 4EG3A 4FUTA 5F9FA 2FOLA 3ECAA 3SHFA 3EEIA 3Q3IA 5HFNA 2R0QC 1JKJB 1FYFA 2WJVA 2AWOA 3L82B 3ELYA 5IDXA 1O0CA 5TEVA 1FNDA 3PITA 2F1HA 2G83A 1ZW6A 4GDMA 1C80A 5GV8A 4OA5A 3ONVA 3LUAA 1JLSA 1W5EA 5E6RB 5BSKA 2HDWA 3FTNA 4OHFA 5CB0A 1EH5A 2G0NA 1NX6A 4NV0A 4DYHA 4YDRA 1YR2A 3WGMA 2AJTA 1E3EA 1K8XB 1MOZA 5TMDA 3DCNA 4GMGA 1TB4A 3AKEA 3L1UA 1KSJA 3DYBA 3H5RA 4IUCS 4L8YA 2JIMA 2IEYA 4NLLA 4R9NA 4RFLA 3B7WA 2O3JA 4JLOA 5EE5B 3JQ9C 1JEOA 1SBZA 5G0UA 1JHQA 1NNUA 1VE5A 1YBMA 2ET6A 2IYXA 3BXFA 5LD2C 4U8GA 4UUNA 3D2BA 2HA7A 4QBGB 2PLAA 5JE8A 4J90A 4YMHA 5HPYB 3MJ4A 3OZVA 4RPCA 1ZGBA 3I73A 4LWOA 5JAHA 2KI5A 4KQ9A 2E6UX 4U3JA 2A84A 3RGWS 4FYIA 3CHYA 5FH9A 1Y5IA 3OY2A 4QVIA 3CR3C 2JIQA 4DLRA 5BV2P 2Z5FA 5CHEA 5CB8A 2PKYX 2I78A 4H08A 5HOEA 1HYEA 4RKFA 4QQKA 1TD1A 3WKAA 1Q3HA 2E55A 5AO9A 4GL4A 5ALQA 4G25A 1IUOA 1VRVA 2CJXA 3U9SA 5A02A 1WIWA 2ONKA 1KGDA 3LQRA 1RQ2A 1D2CA 1YB2A 4IGAA 2C5AA 4IIVA 3AH8A 4MKHA 3ZE0B 2PTGA 3ETCA 2ZR9A 3WDMA 5JPDA 1FX0B 2XRYA 4WCFC 3HBLA 5DYGA 2J6HA 2MSDB 3QX7A 3KB8A 4KDRA 2WAAA 3ACBA 3EW9A 5CH8A 3UJ6A 5BV8A 3U13A 1MPXA 2WKQA 1JEJA 1LVUA 4FN5A 1YRQA 1E77A 4R54A 2P4HX 2V54A 1NE7A 2ZBVA 3D3WB 1GN9A 1T8WA 1ZISA 4IILA 4TTRA 3MTGA 4JQCA 3WQQA 4JT2A 4X6XA 3HN6A 1R0LA 3FRIA 2XQFA 2AD1A 1T10A 2IV7A 4LYJA 4URUR 4BMCA 1YU9A 2HU7A 2CVPA 3FSJX 3O1IC 1P7VA 1K66A 4WE3A 3GT7A 4YJGB 2HNBA 2DH6A 4G0XA 1VJ1A 4LBWA 2Q4EA 3HU2A 4CM8B 4S24A 4URZR 1RQGA 4YN3A 3VPXA 2VQDA 3PR2B 4WKOA 5JH7A 4HOYA 4UZFA 4HHEA 1Q7TA 2R65A 2IELA 4XIYA 5DMXA 4CKYA 3BPSA 3EAQA 3IP9A 3K6SA 5JLJA 4ZA2A 4FKZA 2ZRDA 4B2IA 4WXMA 2NUPB 5JLAA 4Y0AA 4Z2AA 4WCFA 1E94E 3TOSA 2F9LA 3FDZA 2J3HA 4YUWA 2XUJA 2A0UA 3GD7A 4IIFA 2HR1A 3NCTA 3RUDA 4MWDA 2WP8J 1BWRA 2FPIA 2ZDHA 2OHXA 3EVZA 1N2OA 3GELA 5AVVA 1EXVA 3THSA 3T1TA 4ZCSA 1AKQA 3OIUA 4XIJA 2XCRB 3AEQA 5FR1A 4OXNA 5K7SA 1IHYA 3FYCA 3IHKA 1L4UA 3SMQA 2IE0A 1Z5GA 3O94A 3RU9A 3T3IA 4JFAA 1J56A 2CCJA 2QOEA 2ZJ1A 3B6ZA 1YUNA 4O2LA 4ZI5A 2CLFB 3TLKA 3JYHA 5IABA 1MVOA 3UAOA 4C0HA 4KODA 3H5IA 1NJ2A 4ILKA 1IATA 1B6RA 5AQEA 2I2WA 4ZRDA 4GYYA 5GZ3A 2C2OA 1AGNA 4GPIB 3F3YA 1WOYA 4FOTA 5BNWA 2OZLB 4V39A 3QRWA 4KNYA 1RI2A 2XF2A 1P81A 3DTYA 3KUCA 3VHQA 2A4MA 1M0WA 3OPYB 3GZ4A 3ZCQA 4R1MA 3KHSA 4UPVA 4ZT3A 1VE9A 5CG2A 2JD2A 3KEFA 4G4IA 3Q8KA 1ECPA 2QX4A 3B5JA 2YASA 5DCUA 4A15A 4BP8A 3N7AA 3F8TA 3D0QA 4N39A 2XQIA 3REQB 1JH8A 1W4CA 5A0TA 2RHBA 4B84A 3KZMA 3OX1A 1N5RA 3L0OA 1TJ4A 2J9RA 2PM8A 1BS2A 4J43A 4QRIA 4R5HA 4ZODA 3GEHA 2EG9A 4HR7A 3RT7A 1RC8A 1YE3A 5ELLA 3OE7A 3RVPA 4F5WA 4BASA 1WRBA 4DSZA 5IAJA 2Q9UA 2G8LA 3BMNB 3ZJUA 4MYRA 1N5IA 3CLHA 4GGOA 3LUPA 4HPXB 2AI1A 1J42A 1I8TA 1KI4A 2EKZA 4Y2HA 4B2LA 1R0RE 3BXHA 3DE5X 4YGXB 1ZONA 1HQDA 1PGQA 4RVOA 3GP5A 1ZM3A 4MR9B 2N75A 1NF3A 4H3HB 4CF7A 3RU7A 2BJVA 2AMVA 2JJ1D 3OX2A 4HRYA 4WN9B 4EJSB 5FWYA 2HREA 5HVNA 1L4GA 4LEIA 5IBCA 2SKDA 4POAA 1II8A 1CTQA 2H1HA 1N1MA 3ADPA 2MT9A 2BMJA 5CCXA 2L42A 4M1WA 1EVYA 3ZZMA 1E32A 5BWBA 1PTJC 3F5FA 3WWOA 3UF0A 5IVIA 2Y6VA 1KOFA 4ZWNA 2ETVA 5EPEA 4RSMA 2ZJ3A 3DDUA 4P4SA 1KBZA 3JVDA 1C1DA 1G2IA 4EJ0A 2HRRA 1L2TA 2NU9A 2X2FA 3K5WA 1PNOA 2VF8A 5DP1A 4LS3A 3SYTA 1C3VA 1KZ7B 1LS1A 3GRRA 2Q9BA 2I22A 3AR5A 4GVXA 1OFTA 4JOCA 4NEQA 4Q12A 2ZUTA 3TW8A 3U4AA 1P31A 4LE0A 4N0PA 3OLQA 1CP3A 1W4ZA 2YKGA 1Y4AE 5IEBA 2XEXA 3STUA 3SXUB 4HGPA 3OKAA 4RCZA 4R40A 2INGX 2NSHA 3F5QA 5CM2Z 2AB0A 1B0ZA 1VDMA 4LVCA 4R2JA 3N9IA 3I9V1 4H3SA 4DANA 2EYUA 5IJWA 3FVWA 5JNWA 1RRCA 3ZDDA 4W7HA 3HUTA 1V9LA 2C5GA 3D3KA 1NVDA 1CIVA 4IHJA 1PT8A 3BKXA 2X3YA 3CW8X 3W6UA 1UAGA 1XTQA 1QYWA 3LBHA 5K6AA 2P8JA 1ISRA 3AVQA 2ZLBA 4RH3A 5A4DA 1A5TA 1C9KA 4M7OA 3V1YA 3LY5A 3FFTA 4DCPA 4I8DA 2X14A 1A8IA 1Z37A 3GFSA 1XZEA 5KI6A 1VJDA 1KO7A 4JV5B 5JEEA 1EUCA 1OA1A 4A2CA 3H1AA 5EP1A 4ZZ3A 2J4FA 2JJQA 2ZWPA 4TMVA 5D1NA 2W8BB 3TZHA 3U0BA 4MH0R 1O96A 4AF7A 5KJCA 2D5IA 2RI6A 2ZWIA 3KSZO 3U26A 4DNPA 1HUQA 3KL2A 3BWXA 3CNQS 4NV1A 1WXEA 4DLUA 3ZCXA 1DVRA 1VLZA 2HYDA 2JFOA 2NQ8A 1A27A 3EIUA 3ZXSA 4AN4A 5KPJA 1B93A 3WE7A 4G5XA 3ZGYA 4Z7QB 3C3MA 5U9CA 5F3RA 5HDQA 3A1DA 1V5WA 4O2AB 4ND3A 5E9WA 4OHKA 1UDCA 2Y1XA 1KDVA 4A6DA 5KX5A 2FSIA 2NU6B 5B1EA 3LM8A 1L7OA 1PR5A 2R6JA 5E3IA 1ZU5A 4P98A 4EHIA 4YCNA 1MZPA 3P9CA 2YFKA 3IA2A 4NU8X 2CJWA 1K0FA 3K8YA 2VJYA 3G9TA 2I6XA 3B1JA 1N0HA 5CNKA 5L4LA 1GYPA 2Q5QA 5EXDA 1Z38A 5CK4A 5CGQB 2OK7A 1YE5A 3V4ZA 4Y98A 2EX4A 1T29A 2BH2A 5B7NA 7GPBA 2O8EB 1R6AA 3F5DA 2FQQA 4EZBA 1BA2A 1UC8A 4ZPJA 5H4GA 1HOTA 4R1OA 1XZCA 5ITZA 4RX1A 1C30A 5B7GA 5TF0A 2H63A 3W5DA 3AI3A 2CDNA 3LQ2A 5ALXA 3SBEA 3MGAA 1OX5A 2BHTA 2VHWA 2Z8ZA 2HUNA 3L06A 2AJDA 3MRTA 4O4HF 4QUJA 4L78A 4D79A 1I7PA 3C3KA 4JLWA 4DE5A 3KU4A 3AKDA 1YA8A 4IKEA 3ZW7A 5K0TA 3HJHA 1U8XX 3HY3A 4RY9A 1UMKA 3HKBA 4KJXA 4YI3A 4UDXX 2CE2X 4CM7A 2G9VA 1B8VA 1T0BA 2HF2A 4G1BA 3IC5A 1QFYA 4DIMA 3K0BA 3NM4A 5A6SA 3FNEA 1SXJB 1RTTA 4N0DA 4FM9A 5EXEA 1CUFA 1O3YA 4EZEA 4YV1A 1PL8A 4A91A 4YT2A 1Z2CA 4BNHA 2QPLA 4B7XA 4MHTA 1E92A 3ZDEA 5BPHA 5A2QA 4IUBS 4PC7A 1VIMA 1ZJ5A 4Y1RB 2C7BA 2CVFA 3RLIA 3ZHCA 1GZSA 5IAGA 2YR0A 3CEJA 1V1RB 3LXXA 4BQPA 1QGDA 5DISB 1M34A 2GO1A 2HWUA 2J85A 3HQ4O 3FCEA 4MRVA 1LWOA 4PNPA 2H00A 3A6ZA 4IIJA 3F4KA 1VYVA 2BOVA 3MS4A 2VPTA 2R5NA 1CP2A 1ZH2A 5BORA 3HBFA 1ZUNA 3HWX1 1Q1EA 3L49A 4ITVA 4D9EA 3DKRA 4MX8A 3M4JA 5EJ7A 2GXAA 3FLBA 1T3HA 3DL7A 1E98A 1KXZA 4AO6A 2WYUA 4BNTA 3LX8A 3PJFA 1P4GA 3T12A 1W44A 1FYEA 1WVMA 2WTMA 1V3VA 4J1SA 4QBTA 1C9MA 5CA1A 4ZV7A 3CUKA 3C14C 4S2UA 3JD1A 3W1EA 1AE1A 1MBZA 1NVUQ 5FO0A 1E6MA 3EVAA 2B7BA 3UB3A 3FYSA 1QB8A 1CS0A 4AUMA 5HZMA 3H9CA 4BO0A 1Q91A 2GPYA 1QE0A 1A9QA 1QTNA 1X15A 2R5FA 1T9GS 1XEXA 3UVEA 2OV2A 4PYQA 5EKXA 3PGJA 2GZSA 2WDZA 1YR1A 3QLJA 3KKQA 1I1HA 1WXWA 2HQRA 1U0SY 1OBOA 1ZH4A 2P9FA 1EE9A 4RY2A 4TTTS 1L5FA 2ZI5A 1TF5A 3WB9A 2IY8A 4MRSA 1H2FA 2FDXA 3F6PA 2YQZA 1Z83A 4TRNA 4V0KA 2V9ZA 4PIMA 1YMQA 4LMPA 1V8ZA 4M88A 4XGQA 1H42A 2XA2A 3FCXA 1SUCA 5IM4F 1ZSNA 2KJQA 2CXOA 1HYQA 1KP9A 2H1RA 5CRIA 1WCIB 5DNCA 5BVHB 3GLTA 3FOAA 4MS3B 4N5DA 2H1CA 4XJVA 4BAGA 5B7PA 3HU1A 1UBKS 1M1NB 2JIPA 4LOAA 5G3ZA 2V5AA 5EKDA 1U6IA 5T4EA 1MO2A 4IDPA 1IG0A 4XCVA 5EMJA 3UY4A 2Q28A 1WKCA 2O2SA 2REXB 4J0EA 1G0NA 4W9NA 1P2VA 3WLPA 4YR9A 2D3WA 1G7SA 4B32A 1N2CA 1HNNA 5FHQA 3FRJA 1WSDA 2MOKA 3GJSA 3T3HA 1TZCA 1TPYA 2WABA 2XECA 1L7VC 1FEZA 3DVQX 4IV0A 4CDRA 5CM9C 2ORVA 1FBNA 1KYTA 1EZ4A 2JJ1A 3WGVA 5DWVA 4CUJA 1U5BA 2AHOA 5MHTA 1ZD4A 5D86A 5DHAA 3V8BA 3VR6H 4R1SA 4W5RA 1T4MA 3KNZA 3B85A 4JD5A 2DPYA 1R8XA 4D26A 5DHRA 3BE6A 4QJ5A 3WBKA 1Q0ZA 1X38A 2R8XA 4QGHA 2GAAA 3GVIA 1HDIA 4FEAA 1R9JA 4C7MA 5SZIA 4DQKA 5GV7A 4G0NA 3LSTA 2VNSA 2B3DA 5EJ4A 1ZGJA 3MT7A 1YJXA 5H81A 2FF7A 4EDFA 5LZ2A 5BMOA 2FZ4A 4C06A 1GPBA 1UJNA 1X19A 2A0YA 3OLXA 4M1TA 5ALTA 4Z2YA 4R71A 1NPDA 4MP3A 3FNRA 1Q1GA 4YMVA 1XN4A 4MV6A 4TKVA 3I5AA 3WWYA 1QG4A 5CX1A 1QBKC 3VI3B 4TV8B 1QRAA 3MWYW 4MVJH 4EVRA 2J7PD 2ZAMA 4UBJA 4TTQA 3QVUA 1HE5A 1L5QA 3D54D 4YRJA 4QXAA 2AFRA 4UHCA 5ICCA 3KJFA 2PT9A 1CZKA 1BCSA 2FMUA 1JMKC 4A10A 1U2QA 2AE1A 2QM0A 3EDCA 3F9CA 3OIGA 2G1AA 2X1LA 3K1YA 3KXKA 2H08A 4QICA 5ALEA 4JR0A 3VTKA 3ZWOA 1PFGA 4GBJA 8ABPA 3O1HB 4IFEA 4F3NA 3D6FA 4ZAGA 1KRWA 1RI5A 2ZJBA 1R0BA 3A1SA 3V3TA 4X7MA 1UMCB 3ROMA 3UK0A 3KUKA 5REQB 3V8NA 4A03A 5BNTA 5DM70 4FHZA 2QKYA 2WFLB 1SBNE 2ZCUA 3I05A 2HMTA 1UPFA 2RIRA 4MCIA 4BTEA 2MYPA 5DJ5A 4E12A 2JLXA 3PXXA 3PTAA 4GOJA 3OA0A 5ABPA 2OFWA 2FN7A 1RM3A 1KE1A 3SC4A 1I32A 2HGZA 4E07A 4GR9A 3ONNA 5EMKA 2ZR7A 3U49A 1G38A 3I9V6 3AV0B 4EHKA 3TKAA 4QULA 2FE4A 2H17A 2RHCA 3LY8A 5CYGA 2QMHA 3DE6X 5EZYA 4C2UA 2Q62A 4XGIA 3WOVA 3ZWBA 2YCBA 3V42A 5C5DA 1XK7A 2I7XA 3OUZA 4DA9A 2PAFA 3CURA 4RTNA 5LU9A 1SM4A 1MABB 4LGCA 1G5PA 3V4FA 2W6QA 4DUYB 2AYXA 1XHLA 3MUOA 3MJEA 4QASA 3V5NA 3WLJA 1HZZC 4WOPA 3SQXA 3O8QA 2FEPA 3JYLA 5BQ3A 4NE9A 1T8YA 5H4HA 1FUEA 5LBIA 2AJBA 2G7MC 5HKAA 3IPLA 1V37A 3L0YA 2IWHA 2ZZMA 4XE5A 1BJKA 2PVSA 4L8LA 3WGIA 4FB4A 3EIWA 3I6ZA 3QVTA 3TMKA 1QIKA 3JAKB 4F9EA 2WF5A 3DXZA 1M8GA 2DY0A 5KQGA 1CEQA 3RUIA 3UC9A 1XHEA 2E85A 3QELA 3F3SA 4M22A 3R7WB 3ETHA 3ESRA 3NI2A 4M9CA 4MR7A 3S70A 5BWOA 9MHTA 3DOUA 2Z2YA 4CEHB 2PLRA 1Z2OX 1XZJA 2Q6KA 3DC7A 3OE5A 4JA0A 3NHJA 4GSYA 4Q37A 4QGGA 5DLYA 1TIPA 4AIIA 2Q0SA 3LPLA 4EG6A 4DSAA 4GHWA 1CDDA 4QYIA 4RDXA 4N47A 4RA9A 1GRQA 4K0KB 1PFKA 3Q0EA 4JT4A 4NBWA 5CM8B 4EY4A 1KZ9A 2WG2A 3S1AB 3U3XA 4AMZA 4B3CA 1YDMA 4GE0A 3CJQA 3ODGA 1K8ZB 5B57C 3C7TA 3UG7A 4FFPA 1E1CB 4B3DA 1DT5A 1LTQA 4XRGA 5A9SA 4PW0A 5TT1A 1A5BB 1SUDA 2QLMA 5FTWA 4TQ9A 1M6WA 4E70A 1BVUA 3BBPA 5LQNA 1HTTA 3A9WA 3D8HA 3EYWA 2BLNA 3CF6R 2HT1A 3BFKA 4KWEA 3MINA 3U7QA 2YZ2A 4LGVA 1H93A 2F8LA 4IHAA 3KE9A 3LS2A 4OU4A 1QMPA 1V43A 4UNPA 1K27A 2WG1A 1N57A 4UEWA 5E9JA 4C89A 4EYSA 1DHRA 4HQRA 1CY6A 1WJGA 2ZUDA 1N2EA 4UVDA 1YACA 3D02A 1QO0A 2HFKA 3BD6A 5J2UF 4P84A 2C2YA 1LUAA 1LA2A 4UE3S 3AR9A 5K3OA 1RXWA 1F4LA 2GKOA 3I58A 4ZOLF 2P11A 3L7OA 3SBDA 3UQZA 3WIVA 4F3YA 1YQDA 1QHFA 1LD3A 3C3XA 2AFIB 1TTHA 3TXXA 1FMLA 1A5ZA 4EO9A 1T3GA 1V16A 5CMLA 3FB4A 4A2PA 5K05A 3A1FA 4R3NA 1S2OA 1EKXA 4DJTA 4KMMA 1A5SB 2XCUA 3GA0A 3EF0A 4Q4LA 4QWMA 1UR5A 1WXGA 3KFVA 4J4HA 4AJ1A 1W36B 2D5BA 2XE6A 1ULUA 3B3JA 3DT8A 1PGJA 1M3SA 3WWCA 4WRRA 4ZO6A 2I1QA 2GYUA 4LNAA 5EJ5A 2OP1A 5GGYA 4C0WA 5KB3A 5HMLA 4NBRA 4MUYA 5ALGA 3STWA 3QFCA 3KKZA 1T0JB 4OHPA 3SP1A 3GCGA 3F6SA 3EGCA 2TSYB 5ISMA 2FUG1 3JTEA 1XAGA 3PLAE 3DZHA 5KNBD 3OZTA 2QI9C 3HNOA 2VT2A 5I7AA 2QV7A 2XDQA 1U9JA 2C8KA 3FPAA 4W4TA 2EHJA 2H5IA 3LAWA 5J4HA 1WD7A 5DMHA 3Q85A 2XA1A 5TS3A 4D82A 4K2HA 5IJAA 2ZG6A 4UFPA 1I4WA 1ACLA 1NBEA 2ADOA 5L4SA 4M6WB 4EB0A 1AQJA 3F49S 5T4BA 5M5BA 1ZNWA 2JL1A 4JR1A 4GXRA 2IHVA 4X97A 3VNVA 4WFQA 3VUFA 2BI4A 1XZDA 3MJRA 4RORA 4UUBA 5FTJA 3ONFA 2BGLA 1Z88A 2V0NA 2D1QA 5CXSA 2O7SA 3GCWA 2FW9A 2DSTA 3EH1A 2B6HA 1IBSA 4QQRA 1V35A 4ISBA 4YMLA 2UDPA 3EZ9A 3GIDA 4F9FA 5FUMA 1NYTA 4JDPA 4AN0A 5JMWA 1FU7A 4I55F 2CSXA 4QVGA 5FUVA 2RGXA 4NCKA 1EINA 3G6KA 2GKSA 5LB2A 3TMYA 4UTNA 1QHHA 5TS2A 3WXMA 3A4MA 3NANA 4I8IA 1S7CA 1R64A 1RYBA 5GONA 5BMVA 2EZ8A 5IANA 4AQDA 3IUJA 3CLSC 2L18A 4QPZA 2W2PA 2F1RA 2Z1DA 3AHHA 4JITA 4PSAA 3SLKA 1Q44A 1XTJA 2XVAA 3GMIA 3IUMA 2J87A 1AK9A 3A2KA 4K9SA 2JLCA 5LXTF 1WP9A 1ORRA 5CFNA 1UPAA 4GICA 3TUIC 1E2QA 3JR3A 3DEAA 1UFQA 3OKFA 3O7WA 2ZYHA 2GN9A 1GZVA 2XYPA 4DIKA 3BX1A 5B2EA 2W93A 4Q4AA 1Z6XA 4QPJC 3QKSA 4NCJA 1XE3A 4WVLA 3M5DA 1H85A 2FGJA 4N5IX 5IKEA 1DJMA 3HFJA 1L5MA 3PUXA 3ZCRA 4NJMB 3OBIA 5HX7A 1OWLA 1FE8A 2R4TA 1UJ6A 3FPEA 5DBFA 4J4TA 5COBA 4UAGA 1YVUA 1N7JA 2FR0A 2J07A 1AS3A 2EBFX 3OFVA 5C3UA 1APBA 5LA6F 2IS4A 1E4EA 3BE5A 4KXNA 3DB2A 5FFNA 1KTVA 4F91B 3A36A 3U44A 2BFNA 4UBNA 1LDNA 3N2IA 1Q0TA 2PUGA 3ABQB 1SXQA 1U3GA 4GSKA 2J7PA 4YJ2B 4JBXA 2B4QA 1E3WB 1WZEA 3OWOA 4EHHA 3I01M 4CETA 3SC2B 1IZ0A 3K0AB 4ZCQA 1HYGA 4B71A 1LBHA 3IOMA 4IICA 4R2WA 5JECA 5JXGA 2IRWA 1AGPA 1F5SA 2QSZA 2WB2A 2V7BA 3ENWA 3F1LA 1H2EA 4WUVA 5I4BA 1E64A 4D9GA 5C0OE 3ZPXA 3ZCUA 2R84A 3G5LA 5FP0A 5L3QA 4LDZA 4OHZA 2J9GA 2FPPB 3E5MA 3ORRA 2PE5A 1CULC 3NTXA 4COKA 3ZLJA 1LNZA 2Y9MB 4PG7A 4RZSA 3GT4A 4MV8A 4ZRNA 5ARCA 3GGSA 2YYZA 2ZIUB 3TD6A 1XMJA 1N6LA 1HSZA 1YIOA 3Q3HA 4MVJM 1SHLA 1ONPA 1QP7A 1V9SA 2IH2A 1QVWA 2ZJZA 3ZYCA 5HKKD 4LJ7A 4HFRA 3O75A 4J3JA 3TLYA 4A82A 3OIDA 1GQOA 1MOPA 1OFVA 3P27A 1DEXA 3PGA1 1N34B 2YW2A 3F9IA 3WICA 3ZCVA 3K0CC 1FFXA 1HDRA 1C9EA 1SULA 1WMFA 3I2KA 1DO8A 4RPLA 3OTIA 1NYQA 4XWTA 4AFNA 2HZBA 4ESVA 2P68A 1D8AA 4H6WA 4AZSA 4EY8A 2IP2A 1TFRA 4C2TA 3PQ2A 4RHCA 2IUYA 1OC2A 2A9QA 3JQDA 2F8SA 2HF9A 2MYUA 3DV0B 2FLWA 3JPWA 5BUQA 5B1HA 5DBIA 3TIIA 5KEIA 5EGNA 3DVSX 3FGNA 2YV4A 5EQDA 3FPBA 3O8DA 2VSQA 5CT6A 1PEKE 3MCUA 2Q5LA 3K1AB 3OCXA 4EKDA 4S3MA 3GA5A 1US8B 3L6OO 4EW1A 3CEPB 3PNSA 3OD1A 3UKOA 4PGGA 3W3AH 3EY4A 2VQSA 4JC5A 2DRIA 1UKYA 3CFYA 1AGXA 2BFAA 2OBXA 2R00C 3PDIB 4IP0A 1AM4D 3V7WA 1BKDR 1I4LD 2OO5A 1QGYA 1VPLA 3MG9A 3QTBA 4I19A 3CLTC 2EKLA 1FTWA 4K9KA 2ZBGA 4UUAA 1FP7A 1A9SA 1O6CA 4V0MA 4KLRA 4U1RA 4ARZB 4HMQA 1EJBA 3SYMA 3MCAA 1OIXA 5FNVA 3LP8A 3HYSA 3LQKA 4C3ZA 121PA 1XOIA 1AQIA 2VYVD 3N3BC 3ORFA 1QG0A 2JJ8A 2J5QA 4PRLA 3FYUC 4YEDA 5BW4A 3JATA 2COKA 1GZ5A 3E22A 1UIRA 4N3CA 2Q99A 5E9AA 3EGOA 3DLTA 3L8FA 2BR3A 3AFNA 3M1YA 4R6XA 4YRLA 4KYVA 1ZKDA 2QTGA 4RF4A 3SHOA 4DB2A 4G0OA 1BEEA 1O97D 4QQ8A 3R0XA 1GNLA 3Q87B 4P53A 4Y0NA 4ECEA 3QSYA 3V2UA 4KFTA 2CLEB 2JI4A 2VXYA 1DQSA 1RDFA 4P33A 1L5LA 2W4MA 1N6IA 2WZCA 2PG3A 4HXFB 4LPSA 4M83A 2GN0A 1Y8QA 2X4IA 4LC0A 4RWZA 3VH2A 6REQB 4YUYA 2OXTA 4M8LA 1GNQA 1ZINA 2JS7A 3GCDA 4BNUA 4PNHA 1TKRA 3F0TA 1KSHA 1ZUIA 2WJ4A 5I9MA 4CR7A 4EHFA 1D4FA 2HQBA 5IYZA 5D5PA 2JRCA 3VOTA 5CFPA 5K8IA 2YRXA 1ABBA 2WQ6A 2X7HA 4GOLD 3ZGOA 1KAEA 1DV2A 4CIXA 4HUJA 2X9LA 5EJMA 2VSFA 3QUSA 1SC3A 1A1SA 1SC1A 1X1RA 5DCYA 1TQ2A 3W5HA 3OEHD 3K9WA 2ZWOA 3CEMA 4FDMA 3EEOA 4GOOD 3RYCA 4NG4A 4CCWA 3GEEA 1WEKA 3VO2A 3VZPA 4C1BA 3DO5A 1QCZA 3LDHA 3GDOA 1M1YA 1XTSA 1L4YA 2ZI3A 1K1EA 2GTIA 3BJMA 2GJAA 1U9ZA 3R6TA 5DASA 2A7QA 1YS7A 2GEFA 2UYYA 1QHEA 2O48X 1P1IA 5KNBA 3B36A 3D4PA 4B6FA 5EP4A 1H66A 1R00A 3PQ4A 5BR8B 4YRZA 3ZXXA 5BN4B 4C4YA 4QHYA 2C7OA 1GPDG 4BE7B 1M5UA 1G42A 1ZN7A 5KYVA 7REQB 1F2UB 1L8QA 2FUKA 2Q2NA 3RYIA 2P8SA 4ZO4A 1U1CA 4Q7KA 3QYFA 1TVMA 3CWCA 3U4QA 2P65A 4ZO9A 3PLRA 5EHGA 4CKWB 5JEDA 5ADUS 4UC0A 5A2GA 3MLAA 2HXYA 3ON5A 1Z74A 4IIBA 4LIPD 1YB5A 3HACA 4OCZA 3F4LA 4NOKA 4TVSA 1W1IA 3SPXA 4BFUA 4K6GA 1XC7A 2ZIZA 2QTHA 2X0JA 3FWNA 3H0KA 3TW4A 4RVDA 2DFVA 1KP2A 2Q3BA 3CH6A 1P61B 1KJYA 2ZB2A 3SEFA 5DGCA 3P20A 2HN9A 1XZNA 2V6GA 4OUKX 3VU9A 1T8UA 1W0JD 2PO5A 3NRCA 2ZUEA 1M5TA 1O8CA 4LRTB 3QI7A 2AMYA 4FT4A 4HRVA 4LRXA 1R37A 3H9UA 3JQ8A 3B60A 3JVEA 2AMJA 2W6ID 2XUDA 4TLAA 1SVWA 1WP4A 2CNBA 2YHUA 2W90A 2ZW9A 1P4AA 2ZBPA 2MMCA 2ZS7A 4ZQHA 4ATNA 2C4KA 5BSEA 2Z2ZA 3VSCA 4CV3A 1XAIA 2D1RA 1VG0B 4MPTA 3SMVA 1BN7A 2DE0X 5LQAA 1VB3A 2QUIA 3HDHA 3I6QA 2A5FA 1VGQA 3TD9A 2P7HA 4IGEA 1CNEA 3P9YA 2GDZA 4KBFA 4RAQA 1RXCA 4V0RA 5EFOA 5HGXA 1RYFA 5HNKA 2FMFA 1XO1A 2VRNA 4Y2GA 2Q7DA 1RKXA 1BQEA 3DV2A 5TT0A