4ZZ3A

Human gar transformylase in complex with gar and pemetrexed
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title 6-Substituted Pyrrolo[2,3-d]pyrimidine Thienoyl Regioisomers as Targeted Antifolates for Folate Receptor alpha and the Proton-Coupled Folate Transporter in Human Tumors.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zz3A00
4ZYYA 4NV1A 2GARA 4TT8A 1RBZA 4EW3A 4IQFA 1ZLXA 1RBYA 1C3EA 3O1LA 1CDEA 2YWRA 4ZYXA 4TS4A 5J63A 2BW0A 4QPCA 4EW2A 3W7BA 4R8VA 3KCQA 3P9XA 4ZZ1A 4ZYVA 4ZZ2A 1YRWA 1MEJA 3TQQA 4ZYUA 4ZZ3A 1ZLYA 1RC0A 2CFIA 1FMTA 1CDDA 3NRBA 1NJSA 3LOUA 3AUFA 4YFVA 4ZYTA 2FMTA 4ZZ0A 1GARA 1RBQA 1MEOA 4PZUA 3R8XA 1C2TA 2BLNA 4DS3A 4Q12A 1JKXA 3GARA 1RC1A 5J9FA 4QPDA 1GRCA 1MENA 3N0VA 4YFYA 1RBMA 3Q0IA 3DCJA 3AV3A 5CJJA 1ZGHA 1S3IA 3OBIA 4TTSA 3TQRA 4EW1A 4ZYZA 4S1NA 4ZYWA 3DA8A
chains in the Genus database with same CATH superfamily
5KB3A 3PXAA 2AYXA 1FU7A 3LBIA 1MB9A 2ZRQA 3NGXA 1J09A 3ROFA 3S7ZA 1QIDA 2XNHA 4RTQA 2AFRA 2GR9A 4XJSA 2GZSA 4TVOA 3GY0A 2HQSA 1IBRA 1CZLA 1NYLA 2IZZA 2DHEA 3KZCA 1KI9A 3O8QA 1IHDA 1OKKD 5TJHA 1R10A 1OXSC 5KVCA 3ER9A 1PK7A 1UPUA 5CT9A 4RDCA 5AYVA 4BBJA 2QM7A 1WY7A 2HL6A 2ZKLA 3NM5A 5CB4A 3A7DA 2NXCA 3HCCA 3JD0A 1QQTA 5CYFA 5IWCA 3U4QA 3ZDDA 4L5BA 4B3IA 3OZEA 4G36A 2QI9C 4JY7A 3GFPA 1K5HA 5C4GB 1V4NA 3I76A 1W9MA 1KJYA 2ZT8A 2OZKA 2LZ0A 5H70A 2OGZA 5DGIA 5LNK6 5LIRA 4QGAA 4H6VA 4C0QC 4G4SP 2C9BA 3FI0A 5G1PA 1DX9A 2WYWA 1XMXA 3DKPA 1SK9A 4Q18A 4U7WA 1FDUA 1R8YA 1TQ6A 4J1NA 1ZJJA 1N3LA 2ZIWB 4C4RA 1RE1A 5AXAA 5JCJA 4DMKA 3QA9A 4M98A 1J25A 3WRXA 1NJFA 2XMQA 3KE9A 1TVKA 2FJPA 1F1BA 3M34A 1HE3A 2IPLA 2WUWE 2YR0A 2NO1A 3G0CA 5ADUS 2IEZA 2HBZA 1XALA 3ZVMA 3ETEA 4NAVA 3UW3A 4CKZA 1OU4A 4G1UC 1AHHA 2EWVA 4HNQA 5HF6A 5JAOA 3SDBA 2YWXA 1TLFA 4EA7A 3JD1A 3LHDA 2B1GA 1RC0A 3U16A 2OESA 2ZQZA 5BR4A 1YDHA 1E3SA 1GY8A 3N2NA 4B7CA 2AHRA 3F6EX 1Y6JA 4M9XA 1QLHA 4IP0A 4LC1A 4XUEA 5F21A 4EPVA 1UK9A 5JC1A 2RAVA 5LXTF 3FZNA 5LXTB 3RSCA 3A6EA 2CVFA 3OURA 3SDZA 4XYMA 5TMDA 2WJ3A 1O03A 1XKTA 2VRBA 2WUEA 2PRJA 2GBFA 2JGKA 1DQNA 1Y4UA 4L9WA 3B6MA 4MVJF 4NMMA 4B33A 2Q2VA 4OX9B 2RD2A 4AQYB 4GDFA 2GCOB 1UL1X 4M8SA 5A62A 5IZCC 3ZKWA 2IHBA 2P0AA 3ZXUB 4BO5A 2J08A 1D8TA 4D3ZA 3WLQA 3ENWA 4EPYA 1YVUA 4J2TA 5KYKA 3BT7A 3LS2A 1E1RD 1X7YA 3K2QA 3LX5A 4M38A 2CL5A 5ENVA 2WF7A 3QHQA 5ECWA 4EB8A 5J5AA 5KVVA 5KBYA 1JG1A 2YZKA 1FRFS 2HA6A 1TTQB 4OATA 1FJXA 2VQSA 3C48A 4GMDA 4OFWA 1MUUA 1M0EA 3AWIA 3D0RA 2C9YA 1OC2A 3P2YA 1EAMA 4WFJA 4BN0A 5B3JA 3V9PA 3EPKA 2W8BB 3LT2A 5DULA 3IP6A 1XLWA 2XECA 3BL6A 3ZU2A 4FT2A 4TPKA 4ZAWA 1TJNA 1UOOA 2VUIB 3NI2A 3WP1B 4D6YA 2Q7DA 4YH1A 3KB8A 3WGHA 4BQIA 3D3WB 1WDKA 3D6MA 1T8TA 4Q00A 2B82A 2WVGA 1FLVA 4RESA 3BRCA 4DCVA 3AEXA 1L3IA 3EIXA 5DMXA 1VCHA 5K51A 1M8KA 3HBLA 1XZAA 4U7PB 4RYLA 3SEZA 2PR2A 5DPMA 2IU3A 3BMQA 1W4RA 2WU0A 5EQJB 3SR3A 3STTA 1JHPA 3OPMA 1XZCA 4CCYA 3ZS9A 1W96A 2A78A 5TRTA 5JSHA 3FOZA 1XG5A 5F23A 1GR1A 3T3HA 1YULA 3S6JA 3HZOA 2IV3A 2VBCA 1ZINA 4PLWA 1LBQA 1NE2A 2VQDA 2Z1MA 1AK9A 2OA0A 4AN0A 4DEYA 5IH3A 2UYYA 4RCVA 1QX4A 3E6AA 5L53A 3LQFA 4TX1A 1J9GA 1A98A 4X61A 4AUNA 3DLTA 2IH2A 2VIIA 4F85A 3QVJA 3Q3IA 2B5OA 2PWZA 1WQ3A 1T6XA 2JARA 2Q50A 5T4FA 1EX7A 2AS0A 1DKRA 1L4KA 2GTHA 3QE3A 4I4NA 4MWSA 4PC7A 4TWAA 3VISA 5JARA 4PN3A 4RTNA 2H7VA 3T34A 2X0DA 1QK3A 5CDFA 1KF0A 4GWGA 3S40A 2I76A 5E2IA 1QRAA 2EARA 2Q7OE 1TZBA 2VSOA 2YYSA 1TJ5A 16PKA 1PYDA 2DTEA 2HEIA 2ZJ7A 1FMLA 2TMDA 3E9ZA 4KGDA 4ZVNA 5FOQA 4Z8YA 2VDVE 3JQDA 2MSEB 3HM9A 1YRWA 3PGMA 1YDWA 4NZZA 5U4XA 4JC5A 1AM4D 1DEHA 1QIHA 4WZAB 1E3EA 1F4PA 4HDKA 1X1EA 2IYOA 4G3XA 1KFEB 1JLHA 2HPAA 2OK7A 3B1WA 4LBZA 4NJMA 2Y1WA 4JOCA 2L2QA 1O3YA 2BM9A 1UT5A 3BXZA 3QYFA 1DDGA 3IIJA 1T9GR 5HS4A 4W1QA 4UPEA 4CNQA 3RIHA 3VPXA 1BC5A 4ZPJA 4RZIA 4RY2A 2A6PA 3HY6A 1GPUA 4PZ9A 1T2EA 3RNOA 4C43A 1F2VA 1EVEA 1U04A 2IFTA 2JK0A 2XCUA 4NABA 5ELMA 5ESRA 5FPSA 3WYGA 5AVXA 5H4GA 3PC4A 5FI3A 1GZUA 1X7ZB 2V0CA 1L5SA 3KQKA 1OFGA 1QOQB 1X94A 2QMZA 4XA8A 4A6PA 1E99A 5JWRA 3CVXA 1KJ8A 2ZIUB 4LWOA 1Z62A 2V98A 3ETJA 2PXCA 1ESCA 2P6RA 2PGDA 1K8ZB 1CB7A 1DKOA 4OUDB 3GJ3A 3PFKA 2QX7A 4Q4DA 3SZMA 3OP1A 5IX8A 4M76B 5HW0A 1GG9A 2VRCD 4NMLA 3VMMA 3ABSB 5A71A 4TN1A 1VB5A 2HK8A 4Q3NA 3IAAA 3AF0A 4BP1A 3GBSA 4FYHA 2Q5IA 1QGYA 3QK7A 1DLJA 1FRNA 4BV2A 5F7OA 1OXXK 2HCBA 2JFQA 3O8CA 1QYCA 2XLBA 4BDTA 1J2TA 3TS1A 2C2OA 3MWFA 3SY8A 4DKJA 1WCXA 3Q87B 3I2GA 4R01A 2ERYA 2W2LD 2P4SA 3FGOA 4TROA 5HG0A 4Z1OA 3TOVA 2VTVA 1IVNA 4HQ0A 3C7TA 2MINB 4UQLA 2Z5GA 2ZIFA 1BYIA 3BD6A 4HXYA 5DCYA 4YV1A 2GK6A 3IODA 1MDBA 1RXUA 5FIUA 2O2HA 3A3OA 3PZBA 3IVGA 1BDIA 4RA6B 3EARA 4LDJA 2YYZA 1ZCFA 2JIDA 1SCDA 1VSTA 5FF9A 1EIWA 1WDMA 1NVKA 2IT1A 3FX2A 1ZLXA 2OECA 2V6MA 1ISIA 3HUUA 3II6X 2P6UA 3QMWA 4MW2A 4NCJA 4TTPA 2AUMA 2Q5HA 4X7MA 5JCZA 2B1QA 2IY7A 4JU8A 2ESRA 3WO1A 3NHPA 1I7PA 2AFHE 3LUFA 3NAZA 4NYMR 4WY2A 4IHJF 2ZE8A 4IHJB 5LUAA 1V6SA 3E22A 3QVMA 4JBYA 4TMZA 2HHAA 2O7QA 5EHNA 3V1NA 1YDFA 2PBRA 1PCXA 2QQFA 4G9EA 1XELA 5HZKA 5KPDA 2OCYC 1R3UA 3HJBA 4B6FA 3ZCPA 3CZAA 3UB4A 4YX9A 2F9LA 2ADOA 3ADKA 1E5LA 4FVTA 1QG0A 3EXG2 4AF7A 1GAWA 3E8XA 3FMIA 3JYPA 1TO6A 3AR8A 4BWVA 1KO4A 3PIIA 4YO8A 2O7VA 3IPAA 2WYUA 4Z54A 4QDZA 1A9XA 2M1XA 1J23A 5DI9A 1M72A 2CCJA 2WIKA 4TOIA 1ZWLA 2HCFA 3BWEA 1TCBA 1J39A 3C5WP 4GM1A 2KSQA 4KUGA 3WS7A 2P90A 4JCOA 3HC7A 3HYRA 4JA0A 4LCJA 5DCLA 2GBPA 1FFXB 5ALEA 1OI3A 4KBFA 3V2GA 5JS8A 1SQGA 5CIYA 3C3JA 4GOKA 4LISA 3KJEA 1M1NB 3CEAA 3MM4A 1H9AA 1W2WB 4YP1A 1H93A 3SR4A 1GGEA 1SD5A 2H2DA 3M5CA 1XZLA 5BWCA 4NU5A 1HNXB 1E61A 3FZQA 1JU9A 2BGTA 4QELA 3AOEC 3Q7TA 4C7MA 1NJ8A 4JJEA 4UPDA 3GYBA 2J6BA 5JBQA 1GYRA 1P1CA 5ICCA 2VJDA 3JD4A 2IWHA 3WRYA 1X39A 2HN9A 1C0IA 1S9HA 3GLFE 3GP3A 3DONA 3PTLA 1G2OA 4LPSA 1SJ9A 3X1DA 3JRXA 3Q5DA 5F64A 1SKBA 1CY8A 4AS3A 4AZ3A 4C14A 4D0LB 4OB8A 4PZUA 3GWZA 3BIJA 3DV2A 3T4XA 4B32A 3RC7A 2ZJ4A 2IGBA 3PPWA 4Y2QA 5D3KA 2H1HA 2VYFA 4OYYA 1L1QA 4Q12A 1ZKMA 4D9MA 3CG0A 2N42A 1K6XA 2PAAA 4A4DA 3KZMA 1QG4A 2JHPA 4FWBA 2KQUA 4KQ9A 1YKSA 2FJ0A 4J3FA 2XUAA 3I37X 4E5SA 4HOYA 4CLEA 3COYA 3KQOA 5CLJA 1S8FA 1E5TA 2A5FA 2IOFK 4PE5B 4ZCMA 4Y18A 3INTA 4RGVA 4XI9A 4N76A 2NVUB 1U63A 3BE5A 2C04A 1JEOA 3LL4A 2P5YA 5KMGA 2XCLA 3Q0IA 2B83A 2YZ2A 4J07A 5FBLB 1ZA1A 4JXKA 3KLOA 4OI4A 3EG9A 3HKEB 2E37A 3RIYA 4H7FA 3W5AA 3C8UA 1PGPA 1OH5A 5M04A 3LO8A 4PONA 4HPXB 5JY6A 2QYOA 2QF7A 3G2JA 5AK3A 1A7KA 1QV9A 3EDYA 3K5WA 3TZHA 1RJGA 3TL3A 1D0VA 1GCUA 2VP6A 1JSZA 2YQZA 3OKFA 4BQSA 1V1RB 2VF4X 3HB1A 4LEIA 1Y3BE 1DRVA 2PFSA 1K7SN 2QTHA 4MQLA 4UVGA 4FB5A 4EJ2A 4BPBA 1HC7A 2GHIA 5A3JA 6ADHA 2DCUA 3I5AA 5IM4A 3IBYA 2XE7A 4BQFA 4E0BA 2Z9CA 4XCVA 3HKBA 2P30A 3LY5A 1JFVA 3LPAA 4C7VA 5CDYA 1GAJA 1IE3A 3FLEA 4ACAA 2X2EA 4M49A 1E4YA 5DXAA 2CFTA 4IYRA 4JJKA 1BX1A 2CCKA 3PE3A 4X1YA 1QH8B 2ZFUA 3SOPA 4AKTA 1PEAA 1ZJYA 3FPCA 4PANA 2HZBA 4FEYA 1L4EA 1CNMA 2AN9A 3LW7A 1T3SA 4EA8A 2WJIA 1GFSA 3LGSA 1KU0A 1RLJA 4JAVC 1EA5A 4QZVA 3ZVNA 2ID9A 4S24A 1CUAA 2OV6A 5CVTA 4WKOA 1PVVA 2CHUA 2IKQA 3G6WA 5B7NA 2VYCA 3QELB 4BVBA 3KO8A 4MWTA 3M1AA 5E7MA 2OV4A 1RPTA 1R8SA 3KZXA 3WX0A 2EFGA 1OHHD 5CT6A 5CDUA 4P3KA 4TSFA 1D7OA 4GRIA 5FDFA 4CM3A 3B82A 3OMWA 1F12A 2G17A 2NO7A 4V02A 4UCFA 4Q1DA 2YN2A 3ECSA 3GDGA 4RQAA 1YBAA 2NAFA 1J7JA 1Z4LA 2WKQA 2HDWA 4OA8A 3TLKA 2VNIA 3T4UA 1QRUA 4HNHA 4A5SA 4BB6A 3MJFA 1DBWA 3LVRE 4QA9A 1XQ1A 1JLLA 1I32A 4RORA 4AAYA 4ZKDA 4X60A 5AKHA 3AUUA 4XM1A 1E6WA 5FO1A 5A9SA 4P83A 5BQOA 4D43A 4YT2A 1Y81A 4YP7A 3ZV7A 1FMFA 4O2RA 5DSZA 3QLEA 5LZ7A 1E1CA 3RAFC 1ZLYA 2CHGA 1V8OA 2L42A 4CN9A 1PUIA 1QKKA 3I53A 2ZE5A 1N8TA 1XFDA 1SBIA 2VYQA 1OBCA 3ND9A 4U7JA 2IITA 3UF0A 3FR7A 2HJHA 4DIMA 5B30A 3THWB 1DIGA 1E9EA 2I5PO 3DFKA 2VKQA 5IDXA 4FQ8A 4G1VA 2C31A 1PNTA 2PLWA 4LHZA 4IX1A 4Y3UA 1CQPA 4N0MA 4BGIA 2RGRA 2XTNA 1T36B 1U3WA 1WKBA 2JD0A 1II8A 4P92A 5F2EA 4L8WB 4PCUA 5KQSA 1AKNA 5EQFA 2EERA 3ER8A 3DF7A 4RV5A 4ASUD 1JKIA 3FH0A 4CTKA 1E6CA 3JWEA 1U98A 4W9MC 1U3VA 3I2FA 3VDMA 1LQ2A 1TTTA 1QU2A 1RPNA 2I0FA 1GKLA 4P8RA 4QT0A 1JFFA 1E4OA 1OSNA 1EM8A 4UHKA 4B3XA 3CLSD 2CFRA 4BMXA 2BEVB 2DKFA 5B4VA 2FEAA 2BFEB 4WKPA 3A26A 1B8VA 1TO1E 2A5LA 4KGVA 1BDMA 3CW9A 2VHXA 3GOQA 1VBMA 2BJWA 2V7VA 4OB6A 3TSZA 4LBWA 4UHFA 3X2SA 1J5XA 1RKXA 1LVGA 4NYIQ 1R7RA 2PT6A 4AG6A 4V24A 4BVHA 1R6TA 4EVIA 3PLAE 2O48X 5CJJA 3DR3A 1IVYA 4PSCA 3H2JA 1TK3A 1P19A 1S3IA 1YDMA 1R0SA 3L0OA 4MWCA 1VOTA 5G0UA 3EGXB 3L6DA 3USZA 1XPRA 5JYDA 2R2AA 3C3AA 4F4FA 2X7XA 1JSCA 5F51A 5FWYB 3AUSA 3TMYA 4JUIA 2EKPA 4A8HA 4GLOA 4QU8A 2NU7B 2QL5A 1YCHA 1BMFA 1E7QA 2YJ5A 3Q4GA 3GF4A 1EJ6A 1KI6A 1YRHA 2AN4A 5A7GA 3UM9A 4XUDA 3S2ZA 1SURA 3P94A 4Q21A 3T0GA 2HO4A 1Z2NX 3EXFB 4JVMA 3QG1A 3OE1A 1P60A 5JJCA 1JZSA 3T5GA 3BMCB 4D80A 4RFSB 5L3QB 5IJ0B 3JWGA 3B3GA 2GKGA 5G0WA 4AMVA 2B8NA 5FCDA 2P68A 1RYMA 4YS6A 1V26A 2CNWD 3T5DA 3BKXA 4N12A 4R6WA 1RAGA 3UT0A 1Z37A 3GPIA 3T54A 1GO2A 2CFOA 1Y7TA 1KO7A 1O94C 5TPZD 2WSLA 4ARAA 1PW5A 2P65A 2RK4A 3G5MA 1Z7WA 4F46A 4ENSA 4BZPA 1T2UA 2P8JA 1KEEA 1C5KA 4KMRA 4CGZA 3PFIA 2HMYB 4RXMA 5JAQA 3MRTA 2OHVA 4Q1AA 2GYUA 4U7DA 1JQLB 1NQUA 1GFZA 3A04A 3L46A 2PGXA 4X1OA 1EDBA 4DV4B 2AOTB 4KNWA 2AFVA 4Y2SA 2BW0A 2FZLA 1I6LA 2JFPA 1DKPA 2PZGA 3R41A 1RWQA 1O0BA 1JWAB 4IQ0A 2I1LA 2UZ1A 4REQB 3SIPA 2UZ0A 1YR8A 2J7PD 4NCIA 1NLUA 3RFUA 5LQUA 1EXVA 3FOWA 1YI8A 2XPCA 1FXUA 2DRIA 3TMAA 3KUDA 2D2XA 1JG4A 5EVJA 3TLJA 4BFCA 2HHHB 2PGLA 1VPWA 2H31A 4PC2A 4X91A 4YHBA 3DHYA 2R7MA 1N7IA 3N9IA 1C1XB 3P9NA 4RBNA 1WXQA 2AOUA 1L7XA 4IIXA 1W6UA 2F7SA 4HX9A 1N4DA 3D1LA 4GE3A 4ENWA 4CLRB 4DUPA 4G0OA 5G3YA 5BQPA 4DKXA 1GGJA 4JB0A 2PL9A 1Q3KA 4DCNA 1Z29A 3LQ4A 2OLKA 1E89A 4GQIA 4W1SA 3CNHA 3CNEA 4E4TA 3FNQA 2C99A 3FSJX 4G5QA 5HZGA 4J0JA 1CBUA 1T8SA 4YCJA 4G26A 4HZIA 3RFFA 3THRA 1A4UA 3RUCA 3ZXSA 4MYHA 3AVVA 1X74A 4NX2A 1C7ZA 2QD3A 8AT1A 1Y1RA 2RHOA 4F8JA 1H2WA 2I4IA 2F3PA 1Y9ZA 2FCAA 1K3TA 4N3AA 4Y1GA 2ZETA 3VSAA 3DV9A 4HH4A 3G9UA 4N3NA 4UTVA 4Z7OB 4J75A 1O8BA 4LI0A 4E94A 2VHVA 3CT6A 2FMKA 4DF3A 1W88B 1VE5A 1XXLA 3AY6A 2CVQA 1V96A 2WM8A 3Q2IA 1OTHA 1J0CA 2GK4A 1YHYA 1V1MB 3LHIA 2AN3A 1SEPA 3O2JA 1JJAA 3O4VA 1QGDA 2GQ0A 4KIFA 4KQ2A 3S55A 4BQEA 1LWNA 3N0VA 4LXTA 2FOXA 4JC4A 3B3JA 3CZ9A 3EZGA 3GJZA 4CDGA 1JE1A 1GGFA 1EX6A 2FMHA 1NV9A 2XI4A 1Q3TA 3RAGA 3ZH9B 3DZIA 3I2KA 1GTRA 2ASVA 3DGFC 4R2XA 2HLNA 4R81A 1FUKA 2JCGA 3JQCA 2C3MA 3MLBA 3PENA 3HTXA 3RYFB 3QMMA 4RA9B 1NP7A 4CDNA 3I23A 3JWHA 1ZVJA 1N6RA 1RJDA 2PA0A 3KTFA 4MW1A 4BO6A 1ULHA 5KINB 2HA0A 5CNJA 1DC6A 3PVCA 1C4OA 4PX5A 4X62B 2C0CA 4QQ8A 3MUFA 1SUIA 1GN8A 2NSDA 1ZHOA 1A9QA 2XW6A 4GQAA 5EXTA 4E4YA 4QOIA 5CA1F 1E3IA 5CA1B 1JLMA 1FLDA 2DULA 2VL7A 4GVLA 5KDOA 2LCIA 1KC1A 2UUOA 1HY3A 4Q66C 3B6JA 2WI8A 4GP7A 5EINA 2JFGA 3RG8A 3ULKA 1SUFA 5COBA 4J03A 4WPGA 2CV0A 2GO1A 2EQ5A 3EIFA 2FN3A 3NKVA 4NATA 1QYDA 1XZDA 3P0IA 3K35A 3SKYA 1XMOB 3TQCA 3H3JA 2ZSEA 1QK4A 3LDFA 2R6CA 1U0OC 3IQEA 1LW7A 2B0CA 1JR3A 1C2YA 1SZCA 2GEVA 3F5MA 4YP0A 4CMGA 3VX4A 4ZEVA 5BYKA 1G9XA 4IQ8A 5DM4A 4JIGA 3VR4H 3DT9A 2FEMA 2A86A 2PBFA 1AY0A 1T2NA 3OQVA 4HB4A 5ALPA 1Z6YA 5IBPA 1GR0A 2ZKIA 4OQPA 2VPYA 2O5EA 1YRYE 5HJ2A 2J41A 3HCBA 5KJFA 1FP4B 2F8TA 1KZ4A 1QMPA 3Q2KA 3DULA 4TXHA 2WRZA 1PS8A 5REQA 1PJRA 1LS6A 4MUJA 2AKYA 3QOFA 3WAKA 3JPWA 6ABPA 2O8DB 3ZGOA 5AVTA 1OV4A 2VCHA 4V39A 1AGPA 3N0WA 1Q74A 2FQWA 3E5RA 3UKDA 3PLNA 3M7IA 2ZSDA 1U7OA 1DXQA 2C59A 1RYYA 2C54A 2H7XA 2EJTA 2O52A 1IJBA 2V7QD 4FYIA 4WMLA 3NWJA 3V8PA 2HYIC 3ANXA 4IUBS 4YMUA 5M29A 4H77A 4N0DA 1EXDA 2VK2A 3BJIC 1BWPA 4L5YA 2ZI6A 3SJUA 3LX4A 4PIPA 4F3RA 1BJRE 4MW4A 4MKZA 3TPFA 3KDPA 5ILOA 3WDLA 4ERNA 4KN8A 3P5SA 3M4NA 4M21A 3RW9A 4YWJA 3TUJC 2GBCA 2H2AA 3CF4A 5A0FA 4E5PA 3FPGA 3ZV4A 4JR1A 5JBNA 4MDEA 1V47A 4I5FA 4AP6A 5CXQA 3GEMA 2P1DA 3BS4A 1JX6A 2GOYA 5ECDA 3FNIA 3F2VA 3MTGA 3QFSA 2I4LA 3C43A 3K9BA 4MXDA 4PM4A 4ANFA 2XD9A 4HY3A 1L7EA 5KOHB 2J8ZA 1ZMXA 3VOTA 5CT5A 4TQUS 3UV7A 3PHIA 3LECA 3U61B 3FDZB 4D9EA 3U7EB 4A36A 2HBYA 2HX1A 4P38A 2E3JA 1JG6A 1BE1A 4NPHA 1BMTA 2OFXA 2P9TA 3BWCA 3OT4A 3PE4A 1AKMA 2H2FA 2RMKA 1NU8A 1PZFA 3DXYA 4AP9A 1IXRC 5CHYA 1RPZA 5E0KB 1YJXA 4OXYA 3G0DA 4FMDB 1JJVA 1O94A 1XD2B 3LWDA 4FMDF 4BDSA 1NNI1 4UKDA 5AIAA 2P69A 4HGNA 1YNOA 4QULA 4EF6A 2OLEA 5CVUA 4BL5A 1PYOA 3E7PA 3WLLA 5DNUA 1N2ZA 4UNQA 1R5NA 2P67A 4QLOA 4HYQA 4UE3S 1G5RA 3Q1KA 4WFQA 2I8CA 4FMPA 1XJWA 4L0QA 1KH3A 1QGOA 1HDEA 1T1GA 2F8LA 2GN2A 5DM0A 1PJQA 1T9KA 2PZLA 2A30A 2J0QA 1RQ7A 3I8SA 1OLOA 2H00A 2V54A 4XD7A 4PN7A 1KE1A 3WKBA 1F9EA 1FEZA 4CUJA 2HJSA 4IIEA 2A5DA 5AJXA 5IT4A 1CRZA 3F7MA 3LWZA 3SBDA 3P96A 6NULA 3V1LA 1HFEL 2GM4A 3SS7X 2BUCA 2PN1A 3CSDA 4OYLA 3QPCA 4L51A 2WT4A 2J45A 1W49A 4FEAA 2J9YB 2IYXA 4D0NA 4YPOA 4P5DA 3LT1A 4BIIA 4I9UA 5TMEA 1P9RA 2C8JA 4B3MB 4K9PA 4BGUA 3HVRA 1CQXA 2B4QA 5CLHA 1YIDA 5LXTA 1CIJA 1HDYA 2EFEB 1YDGA 4MV8A 5F35A 5H82A 5KTSA 4R5MA 1QUFA 1GSHA 2CCGA 3A7EA 3GUCA 1C3EA 2PKQO 2DWOA 1ZGBA 4MVJA 1C1DB 5EIOA 3C2QA 1SXJB 2GCOA 3KSDO 4BMPB 4BV8A 1P1HA 2JH3A 1B41A 2IE8A 3NHUA 3NHBA 1WXDA 4BUJA 5JNUA 4K6GA 3UV3A 4YMHA 2WAYA 1GUDA 1IBSA 1TKAA 1WSWA 3AYXB 3FLMA 4MUYA 2LP4Y 1YI1A 4QNRA 4RYDA 5MN6A 2BYTA 3SE7A 2ODAA 3IB6A 2BM0A 3D59A 1E5DA 3TSWA 2EAUA 4ZVVA 4B8ZA 5LLTA 5EYPB 5TQJA 4YK7A 1P1JA 3RM3A 2FG5A 2QMHA 2WINI 4DQKA 2C3PA 3FUTA 3STYA 4DJDC 1T4DA 4FKMA 2J85A 2P75A 2QV0A 1N7JA 1L5KA 5M7EA 1L1FA 2W8BA 2C2KA 4GLLA 3H4IA 2V7WA 3VU9B 4X8MA 3AIKA 4ILEA 5CEFA 4QEKA 3FUCA 4RLQA 1NR5A 2I8AA 2QA5A 1K89A 1K8RA 1P0FA 3VR6A 3C41J 3QITA 1F0KA 3KQVA 1CJBA 3D3WA 5HILA 4XGIA 1KQFA 1N6NA 1SVLA 4RKRA 3I9V6 1EVIA 2OHIA 1PEDA 1X1SA 3W34A 3BSWA 4YRTA 1X70A 1P4GA 4HQLA 4GLJA 5IJXA 1PHPA 3GVHA 4KRXA 1ZD2P 2QSUA 5AESA 4OK6A 4CW7A 3WFJA 2OCXA 2KBEA 5YASA 4OB7A 3S1LA 4EYEA 1C9MA 2NUPB 3VAAA 4OJMX 1XPUA 1REQB 4XEUA 3WLKX 1M1UA 3B36A 4UDXX 3ZWWA 1E9DA 4G4SO 1K66A 2HK6A 4KVGA 1EAYA 1VPLA 3OJWA 1J49A 1YQQA 1ISHA 1CF9A 2H4HA 3ESDA 3LDAA 3WNQA 2ZWAA 4OHYA 2QZPA 2VDMB 1Z5NA 1WEKA 5B7GA 3EZLA 3L84A 2I3BA 4LY6A 1PSWA 4LF4B 3STXA 3V33A 1IBKB 4O25A 4LF5B 2D0PB 5BV2P 4MROA 2ZUEA 4UNNA 4M1MA 1HXHA 2B25A 2ZRDA 4PPQA 4BN5A 1PR1A 3ZG6A 1W4CA 3T3NA 5CVDA 4U9HS 3P0EA 1M83A 3TBFA 1HTTA 2WTXA 1JA9A 1HEIA 1LDBA 2VH2A 5JIBA 3B60A 2N1MA 3IE0A 2QJRA 4C5AA 1N6LA 4I6EA 5HJ7A 2FW7A 1KQNA 4OBEA 4LS3A 4QQNA 4BVLA 4P7GA 1XF1A 5MGBA 3K4PA 3KVNA 3LSTA 4WDRA 5F2OA 1F0PA 5AHRA 1OFTA 3N07A 3R23A 3OZBA 2O7NA 3FSGA 2JL1A 4N3CA 4G0WA 4ZYZA 1Y1LA 4TTQA 3UHPA 3UJHA 4WZAA 3ZD6A 3RQSA 3DPSA 3DA8A 1K98A 3NUQA 4HEA6 5A9TA 2CLKB 3LYAA 4TXLA 1KRHA 4UBKA 4C2TA 1WXHA 5DYNA 1XKXA 3KKKA 4OP3A 4KH0A 4JLUA 5DLDA 4E09A 2XB9A 2QLNA 2RG1A 2Y05A 1XD8A 2QR2A 2YRWA 2V3CC 1U8CB 3K0CC 3UXHA 1PGOA 1NBWB 3K0KA 1HNWB 2I4OA 5JJ5A 2MSDB 1EUYA 3KQMA 2MIIA 1LI4A 4UJ5A 5I8ZA 5JPDA 5LYJF 2RGDA 5HEKA 1Z5WA 1E8MA 2PH7A 4HDMB 2PFGA 1O95D 1X7ZA 2XA1A 4I4IA 4OJNA 4D42A 4DB2A 4B71A 1P4SA 1XZNA 1WPGA 1DU4A 3KQQA 1M8JA 2QVGA 5LQCA 2CGEA 3KAQA 2H29A 1TAUA 1Y5RA 2ZRJA 4W9NA 4ETIA 4G0QA 1DJPA 3FNHA 2R97A 4YUXA 5A02A 3TB4A 1K7EB 1RVDA 2VTBB 2EP8A 3L1UA 4OUDA 4XYEA 1B0AA 4KHPB 1ZW1A 1E2GA 3O8OB 3EAGA 4KXLA 4E32A 1ESMA 5BR7A 3KQUA 1G7RA 1PX2A 4O63O 5IUKC 1Y5MA 3H5OA 5DFAA 4FBLA 2CL0X 1WA5A 1HR0B 4KTTE 3RAJA 2WFZA 3M0EA 4C7BA 4P4UA 3U6BA 3CZPA 3KTDA 2F1JA 1LCIA 2J9GA 1RKBA 3ERCA 1JR6A 3FHOA 3RRZA 1CVLA 5HE8A 1FP7A 3SZRA 5K2MA 3ENZA 4MINA 3QYPA 1G66A 2O50A 2KS6A 1NX9A 1TLLA 3K96A 3M49A 1O9HA 3OLWA 4FWTA 5ED0A 4IOKA 5HQTA 4FKBA 3L7IA 4PZCA 5DTJA 4OHPA 1KK1A 3JZMA 2Z58A 3MJRA 2BCJQ 3F0TA 3I73A 4E3WA 3K2IA 3ROQA 4UMDA 4BRSA 1Q83A 3H8JA 3QVLA 5BOSB 1LRLA 1ICIA 1ECCA 4GVXA 5CH3A 3V8EA 4D8UA 3C16C 3E4CA 3U3JA 5JS7A 3QBVA 1UZLA 1Y42X 2X5OA 3PWKA 4RA6A 3G0BA 2I2WA 2OWEA 4GWLA 2DFKB 3MCAA 3FOFC 2M6SA 4D9FA 4YJ2F 4YJ2B 5CHEA 4BEBA 3KM0A 1ARZA 1WXFA 1GNTA 1XN1A 1FPQA 1NHWA 3MJHA 4IKOA 4V0MA 1KWGA 4G0UA 4BRUA 1ZD8A 1SIOA 3BM5A 2CXPA 2BI4A 4FWIB 4IHJA 2GA9A 4L74A 1P8AA 2NT4A 4D5EA 3WYFA 1PS0A 4E5YA 3ZDFA 2QUZA 2F2TA 1V45E 1IULA 2FFJA 3OEYA 4UD6A 3CVUA 4IVNA 3URMA 3FPBA 3I0NA 3CZ4A 3VOBA 4N5NA 1PFQA 4UTRA 1Z0JA 2NZ2A 2R6AA 5DN6A 1K3FA 4JT8A 2RE8A 2JKZA 4YASA 2XADA 3E61A 1FFAA 3GRFA 4OXXA 3SHQA 5CLGA 3FYUC 4B0OA 1ZGHA 5G0VA 5KQLA 3Q7EA 5JWOA 3HUFA 4P7BA 2O2XA 3EZYA 4XB1A 4BO7A 3ONDA 3L06A 3DO6A 3GG2A 2DQYA 3B1ZA 1E20A 3IJ5A 2GEJA 5I4KA 1M1NA 2EQBA 1V4BA 3GRAA 3KRTA 3BG5A 5KKNB 3IOMA 1PDOA 4KREA 3RKSA 3P9ZA 3UN1A 4AN1A 3E5MA 3PQ4A 1RBZA 3D6JA 4RTLA 4G63A 3AT1A 4CEIA 1F2DA 3NHAA 4NYIR 3W8DA 3N8NA 5AW2A 5IAOA 3JRNA 4WAUA 4DSZA 2OAEA 1BJKA 1X8LA 1HX7A 2DX7A 3B7PA 4NBUA 3VKWA 2F90A 5CDHA 4L8VA 4RMGA 2Z2ZA 1XN4A 2Q6LA 4HH1A 3BYZA 1Y37A 2IWRA 2VHZA 4BQPA 4FIDA 3N2KB 2ANCA 1GNVA 1F8FA 4O02B 3AR5A 5KDDA 4UEQA 5BNWA 5J47A 1Q84A 5FA5A 3X43A 4M60A 3T41A 5I7EA 3ZZNA 3OFSA 4UBLA 1W19A 5AK5A 1GZ6A 2PBLA 4XWTA 3EMBA 4F38A 4JBNA 1YL6A 3E9NA 1TVEA 2IYEA 1E8DA 2J9FB 5LWQA 1NT2A 2BGRA 2WP8J 3FNGA 4HDQB 4P81A 2B9EA 2NVUA 5D01A 2ZTHA 3CF2A 2Z8YA 2QY6A 5HIIA 1S5PA 4CZ2A 1XPOA 1KI2A 2QTMA 4H15A 3AMVA 3UY4A 2VRNA 2YWJA 3TSCA 3HKEA 2NO9A 3VHRA 3ZZTA 4FFSA 1AG9A 1FDWA 3KHTA 4DXAA 3KJHA 4JXZA 2YW9A 4QJ4A 2H1CA 3NHMA 3NUZA 1M5RA 1ZL0A 2UXCB 1L5GB 2CY0A 4I1UA 4LRSB 2EZUA 4O59O 4N5IX 4YQZA 5AXBA 2DB3A 3X1YA 4JOSA 3ZD9A 4URXR 1JA0A 4YRMA 1JTVA 1Z08A 3EJ6A 3FWHA 1VBFA 3OLXA 4CWAA 5A1JA 1RQRA 3C74A 4QBGB 2FDCA 1PN3A 3DEJA 1V1RA 5IDWA 2PZFA 1AS3A 1I3NA 2JBHA 2JIOA 3A3NA 3JVUA 4YJGB 4MGEA 4WTOA 2C5EA 5A5EA 1VHWA 1GZ4A 3ZGXA 4OXQA 3ITDA 1XMSA 3CH7A 4BAUA 3WYNA 4BLWA 3NALA 4X94A 2CHFA 3NC4A 1YTUA 2ZCVA 4EB6B 5M34A 3FTNA 4BNIA 3E82A 3FFXA 1K0FA 3GPDG 4N6NA 1QH8A 3M6VA 3R8FA 4LV5B 1UJMA 1YC5A 4FYJA 1GQFA 3UC9A 2CB0A 3PNVA 2QT1A 2DFPA 3CLTC 3E35A 4YJKA 4WUVA 3UA4A 5IJWA 4HXFB 4WNAB 1NVVQ 1UJ2A 5AH0A 1E59A 2QN2A 1M0WA 1NOIA 4R1UA 5ILGA 2Q8NA 2JRLA 5B4TA 2QRMA 4ZVLA 2F3RA 3ESXA 4CT4B 1R6AA 3K3PA 3CRQA 1D9ZA 2V7EA 1PL6A 4RM3A 1W36B 2BHRA 3MLAA 3OPYA 1DBVO 2DKOA 2B2XA 2F3UA 4YYZA 3DE1X 3TQSA 2CZGA 4C4PA 1KSFX 1GM5A 5JY1A 5CK5A 1P4JA 1U5BB 3GCXA 5J4KA 2R5WA 4LDQA 4MMYB 1W75A 4N03A 2A1TR 3SF0A 3WI7A 4Z86A 4MKIA 1ZC4A 1ISPA 3E15A 4MWBA 5JH7A 4N4AA 1CZKA 1F60A 2Z56A 1H4TA 3L77A 4OEHA 5AK0A 3WBKA 2NTEA 4YRSA 2F9FA 2B6HA 3PFWO 5C8XA 1AC5A 2D3WA 2IPNA 1QWOA 3KLNA 4D8VA 2ONZA 4DRZA 3IUJA 1Z3IX 2BTQB 5C1BA 4B48A 1UZMA 2ZYIA 4LOKA 3UWMA 4B46A 3GLHE 3IUYA 4JFRA 4CFZA 3OO0A 1YZVA 3NTXA 4CI9A 5HPYB 3FGZA 2OAP1 4FZRA 2MSLA 4MQ6A 3FFBA 3LWNA 1BVUA 1Q0HA 2CUTA 4PXSA 3H1TA 4LPKA 1GZ3A 1TJPB 2XDQB 3ZBPA 4UU8A 1QP8A 3ZQKA 4B6OA 3U44A 3DXFA 5FLYA 5C81A 4KJZA 2PZBA 1NMSA 3T5BA 4UBIA 5AUQA 4BE7B 3DC7A 3TDMA 2IYUA 2UXBB 3NPMA 3U09A 3IS3A 2EOAA 3DLBA 1T3HA 4OFXA 4WGGA 3GRVA 1T8UA 1VJ5A 1BN7A 2NV2B 3K9QO 4ADSG 2BEVA 3TGLA 2BFEA 5AXCA 2O0LA 2IDJA 2QSYA 3E1SA 1I4OA 2JBWA 2HGZA 4P0PB 1IRIA 1BCRB 3MC1A 1L9XA 3GVXA 4F5DA 1PWZA 2I55A 3G02A 3AEYA 3OIDA 3OQ1A 5EA2A 2DOKA 1IC6A 2FVYA 2PGOA 2FX2A 1D03A 1RLMA 1T9ZA 1NVTA 3G2OA 1EXMA 4NICA 4DMHA 1EWTA 1H1LB 2YCLA 2WIFA 1F8UA 1TPZA 3O4HA 5SZJA 4JU9A 3GLGB 2ORVA 1P6QA 4Q48A 2CV2A 1N33B 3WOVA 1P0IA 3EGXA 4A15A 1XQXA 4RTOA 3CISA 3UYKA 1HSZA 5FWYA 3OOEA 1FDTA 4KSCA 5TQ2B 3REOA 3UWKA 4LJ6A 5I01A 2E0IA 2NU7A 3C7KA 4EAAA 3FPHA 1MG5A 3OJ0A 3HJGA 4ZQIA 4DZTA 5GTDA 2FY8A 821PA 1Y9EA 3NYWA 3RYHB 3RLFA 2W7TA 1UEXC 1WEHA 3ETNA 1ZNXA 3BHNA 3EXFA 4HDSB 2NG1A 3PEEA 4ZQBA 2FMTA 1WP4A 3BMCA 4IVQA 2OG1A 4RFSA 5AKLA 5EIHA 4EY8A 1FL9A 5IJ0A 2AW3A 5L3QA 1B7GO 3WHLA 1E1DA 3GGCA 2QUBA 2CWDA 1MJHA 2FW8A 2WU1A 4RTKA 1LK5A 4X85A 4E33A 4JBGA 4IIUA 3VR5H 4D8TA 4JLNA 1NRIA 1NW4A 2C61A 2Q46A 2WJJA 3EWNA 3NV9A 4J16A 1H2EA 3E3LA 1SVNA 4HPJB 1KETA 2ZDHA 1LNQA 1YNSA 2OMEA 3V4VB 3VDQA 2PUFA 3GAAA 5ALLA 4DA0A 1M2EA 4BEVA 4N3BA 3OIVA 2NU9B 1GZSA 4IDOA 3LL7A 1Y0BA 1G59A 4QECA 3N70A 2A33A 2OVBA 2WE8A 3COSA 1RI4A 3KEMA 3LBAA 2AOTA 2KI5A 2YVKA 1MO2A 3CNQS 3IP3A 4PEVA 1E92A 4H1WA 5ICMA 3DQZA 1IY2A 4ZTUB 3OZTA 3HZHA 5A4AA 3M3DA 4V0NA 5SY9A 3WGUA 4D4IA 5ALSA 3TLBA 4OQDA 5EIBD 1NQ5A 4UHDA 1RXVA 1U3TA 2OD9A 1K2WA 5LFAA 3GRRA 3IR6A 1XPJA 1U90A 4AI6A 2IYRA 3MTBA 1DNPA 4A16A 1VSBA 1C1XA 2RBKA 3H75A 1JXAA 2YUTA 3V9AA 3HP1A 5E8RA 1I1HA 1E79D 1VA4A 3RKUA 3I5UA 1LPSA 4GEKA 4ARZA 1DT5A 3DV0B 3SG0A 4F72A 5DNDA 5CU7A 2GZMA 5ALTA 4N8SA 1P5ZB 1H0RA 3UH0A 3CTMA 1BU8A 1G60A 4C1NA 1XHEA 2ROQA 3ICCA 4OHMA 5AK6A 3VNSA 1SXJC 2DF8A 3MB8A 5CFPA 1Q11A 2H48A 3H2SA 3LP8A 5HYVA 5LVAA 2QLJA 3W05A 5LP6F 2VP2A 5LP6B 1YR2A 1PJZA 1WUYA 5WRFA 1GGMA 2JJQA 3CVYA 3V4OA 4MYRA 3RNLA 4MZDA 2BONA 3EFEA 4N6OA 3O1LA 4EG7A 1VMIA 3GLKA 1GPAA 2IYSA 3DTVD 1EZ1A 2JJMA 3ASUA 1XCLA 2VSYA 4JNKA 3RV3A 4M3NA 5ETJA 2W5UA 4AJNA 3MT7A 2JD2A 4H17A 3A6JA 3ANNA 1KSJA 2H7YA 2QR3A 3RUEA 1KJWA 1W88A 1PAUA 1TFUA 4JYBA 4KPYA 4NXNB 3QSYA 4OLAA 1V1MA 1V7QA 2FPGA 4WQMA 1OVMA 4WK4B 4JLPA 3U1TA 3UK0A 3E84A 2FMXA 1IB6A 3V7UA 2ADMA 1MAWA 5P21A 2W6ID 2O8VA 3TAXA 3W90A 3W8NA 1GWNA 2JW5A 4G67A 4RZQA 4E3ZA 5HQ3B 5GIOE 2AE1A 4GPAA 4LKRA 3WMWA 4I9HA 2IW1A 3R0ZA 3ZW9A 4DABA 3CKYA 1L7VC 4URZR 3RTGA 3W3ZB 3KVRA 4MKFA 4HZGA 2Y0DA 1C0PA 1YZUA 4YT8A 1EG2A 4RA9A 1KZHA 2REXB 2QN7A 4AW9A 3U56A 2XUOA 6Q21A 1IMJA 1QVRA 4JEHA 4INAA 3L0PA 2HSEA 4L72A 5DXJA 4Z4HA 1DHTA 2H65A 3EPLA 5CFZA 1XQ6A 3NG1A 1QCCA 4LYAA 1RLTA 1LZLA 1ONNA 4F9GA 5B55A 5CA1A 5C4IA 1Q1AA 3BL8A 3F7NA 3LA6A 1II9A 4Q9AA 1MQ8B 5HM8A 5J2TF 5J2TB 2NU6B 2A7QA 2XNDD 1OXBB 3FAKA 1TTHA 4WCDA 5DGXA 3CX6A 3BOSA 3TRIA 2VJYA 3OU2A 1D2AA 2IEAA 3HUEA 5KNDD 5PGMA 2QVCA 4IMRA 2ZXUA 1SCUA 2QTAA 4F4JA 1W7AA 2YXBA 4L5CA 2AR9A 4DA8A 3VTKA 4QASA 2BF7A 3O03A 4RTMA 2P6PA 3V48A 2GJKA 3EVGA 5H68A 4WEOA 3GQBB 3BZUA 4II3A 5KKCA 4FFNA 2D0DA 2OEPA 4PAWA 3N58A 3PKIA 4M0KA 3TLYA 3BRWD 3YASA 4PW0A 3C24A 2ZBVA 4GOOD 3U9SA 4MMXB 1KBZA 4TTAA 1M5TA 1JA1A 2RARA 5A4IS 4FM9A 3P27A 1ZM7A 1F3OA 2D00A 1IHUA 3NFYA 2NACA 4PQFA 4WK0B 1YJQA 1C7EA 1HT1E 2PX0A 1KS9A 3B8EA 1N9KA 2VPZA 4UUOA 4R51A 5DWQA 4OMFG 5LBUA 3UK6A 1FP4A 3AZPA 2XRYA 1PSDA 1RM3A 3JQ9C 4UNIA 1JHDA 4IMPA 1NXOA 3I58A 1P0MA 1QHXA 2O8DA 3N8GA 2CBXA 3VKVA 4M22A 1IZ7A 3IQDB 2VDOB 3UWSA 4AM8A 1ZOSA 2PQ2A 1KIMA 4J3NA 4A10A 4C3UA 2ZSJA 2W6ZA 4PC1A 2VBIA 4DWJA 2L19A 4MICA 4OJTA 5B1DA 5HXAA 5JD5A 1SHJA 3A6GA 5A3RA 3QLVC 1R6UA 1I01A 1RU3A 4KVAA 5DZSA 1P81A 5EJ4A 3CX3A 3O4JA 3ZLBA 4A8TA 5I7WA 4TTIA 4AJJA 3N39C 1IDOA 3F6PA 4XX0B 2VJCA 3SHVA 4GGPA 1NW5A 3IKJA 4IMIB 1FDOA 1EBUA 4MQBA 3VYTB 2P4EA 4PPYA 5CD9A 3F73A 5KOHA 1XCPA 3FKSA 4K6MA 3E70C 4Z9AA 3ZE1B 4JBWA 3BUSA 1ZZGA 1TYAE 2GFIA 1SAYA 3TUIC 5KNBH 3FPEA 3FY4A 1N2EA 4F4IA 1RQ2A 4FHZA 4RWEA 4E14A 4CIYA 3A9RA 3DD1A 3EPRA 4MUFA 4CCAA 3JQFA 4BOYA 1UUFA 3Q12A 4NV3A 2VUHB 1QHIA 1JVBA 3IKVA 5B1IA 1DJOA 2LDXA 2CYBA 3X1KA 1XD2A 1O54A 2OQ2A 3L0SA 3OEHD 4ZMRA 2OXCA 1E7WA 3G8BA 4RH1A 1ADBA 2VLIA 1V9SA 3MYYA 4JSTA 4ICIA 3ZOKA 4O1HA 1TK2A 2ODTX 3NRCA 3OX3A 4HAUA 4WN3A 3V55A 1PR2A 1KYYA 2HUPA 1GG2A 1VJGA 2ILTA 3E8SA 3GFFA 5ELXA 4B3FX 3OPQA 1I2DA 4F3NA 1VG0B 4X90A 5A2QA 2XQKA 1IHYA 2E48A 2P6OA 4HTFB 4FGKA 4NC9A 4RK5A 5AK4A 4E11A 4MI3A 4HNVA 5BNTA 3K6JA 4DR5B 1UCFA 3BKWA 2FE4A 4A0HA 3GUZA 5DNCA 3GPLA 1G5QA 1ZK0A 3TPCA 1J2JA 1KQOA 3KZOA 1P74A 4LZWA 1NFFA 4ZXFA 2D0OB 4LVOA 1O5OA 2A94A 3C3XA 3ASYA 4I99A 5HUHA 3ICWA 1RAFA 5ERYA 1X0XA 4DV1B 4AY5A 3S2FA 1Z45A 3QKRB 5CCXA 2PY6A 2ODWA 1SPXA 5FLKA 2BFBB 3WLMA 4ALNA 2ZR7A 2EJVA 3NWBA 1DTEA 1NR7A 4CQMD 3S2EA 3LPLA 3VPSA 1V16B 1OASA 2CJPA 4BNLA 4DVGA 1FJGB 3I05A 4UC0A 1A7AA 4C0SA 3W5CA 3D5EA 3HY4A 5K5EA 3VV2A 3IDAA 4EYGA 4EYKA 1PGQA 5KQPA 1HEUA 1AQNA 1C1DA 1E2JA 2P40A 1SXJA 2PU5A 5BVGA 3EEYA 2IP2A 2DWPA 2GVDC 2IA5A 4F84A 1TYEB 3IT2A 1QYRA 2YMQA 4M83A 2J3HA 3ICEA 5HRUA 4WD3A 1W8DA 3KYCB 2Q9AA 2X86A 4XASA 5EJFA 2D6FA 1CU1A 1UPCA 2A0WA 2P9GA 3CHYA 3HR7A 2UZ3A 4IFEA 5EYPA 1JW9B 4ZJUA 1X8KA 2GZRA 3I30X 5I9LA 4XFKA 1EFCA 2Q1XA 1R74A 3EXEB 5EWLA 1DEOA 2WIDA 2Z6VA 3RVLA 2X1VA 1T4BA 3A1TA 4ZDJA 4ZVOA 3VU9A 2AZMA 3BSYA 4A0FA 1ZR2A 2L17A 5FOTA 4INPA 1XAGA 3RARA 4DJTA 4YROA 1DC8A 2H5EA 2UV8A 5JCJD 2BFWA 4YDHB 3KKQA 2OE2A 3P2JA 3TIIA 4ZK6A 2QPLA 2RKBA 5A9RA 1I2ZA 4IDHA 1C3OB 4J49A 4LNUA 4QFMA 3GJXC 3S1SA 1ONSA 1P45A 3CIFA 3BCHA 3BXXA 3D7SA 3PC2A 4HYYA 3WQQA 1JSLA 1KEVA 2C3OA 1LK7A 1N57A 1U0LA 2CXXA 4KN6A 2I3AA 2XCIA 1NXPA 2OO7A 3AF2A 2CL6X 2XX3A 3R9XB 2NUPA 3O38A 1REQA 4RZ2A 4NYJQ 3SYNA 2I65A 2I80A 4JUDX 4XTCS 2XB8A 5IVIA 2R84A 3AFGA 4EMBA 3DVQX 3WG9A 2B1RA 2Y0BA 1U1CA 5DM70 4BRZA 5K7SA 4PYIA 5B2ZA 4NHOA 1NQXA 4I5EA 2EZ4A 2IQ5A 2C2HA 1BJTA 3BXOA 4J0QA 2HI0A 2HF9A 2C88A 4HEHA 5BSRA 5KS2A 1KAEA 1VFNA 3NMUF 3MAJA 2D4AA 5TF0A 1YQGA 1G8HA 4HL6A 1DPFA 4Q3KA 1P7YA 4S2UA 4KNYA 2PRKA 1J9EA 3AB8A 3R5FA 5MHTA 2EWWA 1Y98A 2C96A 4TYWA 4F7WA 5ALFA 4FC6A 4GRDA 5JZVA 2N3ZA 1JL3A 4CG0A 1RWWA 3MBIA 1VQ1A 2CDAA 4JQSA 3M82A 5SYNA 1UBTS 3QVUA 1ZH8A 4M88A 1OREA 2NQ2C 1Z0IA 2WG1A 3TNJA 1STOA 3ZHSA 4GE0A 1D4ZA 4NZ9A 3B1KA 3GLUA 3A4LA 2ORED 2PPVA 3EGDB 3PNQA 4KMSA 3GNQA 4CKEB 5A1TA 1YK1A 2BEUB 2XEDA 3BFVA 1MJ5A 5LWHA 5LJIA 2NSHA 4ESHA 4RF5A 1P18A 1ZA2A 4JP3A 5JCPA 2ILVA 2HTEA 4TKVB 5E4YA 3JQ9A 1PBNA 1G21E 2M2IA 3DDZX 3F6CA 4L5JA 3O90A 3ZOZA 2CHQA 3EOBI 3GFOA 3KUXA 421PA 1VL0A 3WLNA 4Y67A 2P0YA 1ISFA 1GKKA 2R6HA 1BCSB 3DH0A 4GICA 5JNLA 2DXIA 4L73A 1J2YA 2TYSB 1OIVA 1PR0A 4GFDA 2Z5FA 4LWZA 1TEHA 3BPSA 5G3ZA 5B3AA 5LYJA 1YZFA 2HF2A 2J5RA 3L1IA 3QLVA 4HDMA 1JQ5A 1J06A 1WDTA 4D3XA 4YMTA 2QGNA 3HDVA 4KR0A 3UWOA 4AYXA 4UOZA 1O96A 2ZJYA 3F4KA 3Q9SA 3R3WA 1L8QA 4KAXA 4MDHA 4RY8A 2Q6IA 2JLUA 4UE6A 4DCJA 2J3KA 3VU0A 2ZJOA 4RTJA 2P2NA 2VTBA 3VKGA 3WIOA 2XB2A 3IAM1 3ZHVA 3O8OA 5EMNA 4DVJA 1QO7A 4Q05A 4UFPA 4UQPA 1U7XA 2O9JA 4JA2A 1A2KC 2JEOA 3GDWA 4U1RA 4L7QA 1KI1A 5FWXB 1DC3A 4Q3DA 5T6MA 4U02A 2Y27A 2PUHA 1DG9A 1OBVA 1LLDA 2YFHA 3RIXA 4J4TA 4OLBA 1E3TA 1DKMA 1UKCA 1Z2PX 4D0GA 2C4VA 2P78A 3N59A 2PJDA 3BH6A 1NPDA 1VG1A 4BJ5A 2ZXEA 3Q88A 2B7BA 4JR0A 1IZ8A 2X5JO 1M6NA 1EA7A 3B53X 3DMPA 4NMHA 1AB6A 2AJLI 2I3ZA 1NM5C 4CHGA 1AUVA 1AUPA 5K6TA 4P82A 4U7HA 4ZEMA 1Q2UA 1C3XA 5BOSA 5DN9A 5H3CA 2ZWPA 3ZNPA 5EP4A 2HF8A 3VTZA 3F98A 1VJCA 2TECE 5CP8A 1VHDA 1Z2EA 1Z4OA 2R5FA 1CZUA 3NONA 4CMJA 4LSMA 8MHTA 3BFPA 4TLDA 3ZVLA 2AEFA 1P2UA 2IUEA 2H4WA 3W2HA 4CM8B 1JEEA 2R4TA 1GPDG 4GPIB 3KV1A 1W48A 4PFSA 4DDHA 3T6KA 5JZSA 1EX1A 3R3SA 3ETLA 4WESB 5KAPA 3RTCA 4YJ2A 4ARCA 2H17A 2GF0A 1Q91A 1SU7A 3S44A 2CKMA 3M1IA 3RS9A 3E18A 1E3JA 3KK0A 1DRUA 5HFNA 3SNHA 3UT5B 4DWWA 1WBJB 1CT9A 3P19A 4BFWA 4RZSA 3TM5A 2MU1A 1WVGA 1JZTA 2WYVA 1P7PA 4UBOA 5F3RA 3UMGA 3V8QA 3WK4A 4BNMA 4KYTA 2GS9A 1QANA 4F1WA 4RTSA 2MCFA 1Z17A 3KDAA 4W5WA 1KY4A 2H2IA 1QZZA 2YXDA 3ILVA 1M76A 3J7TA 1UBCA 3K9FC 1ZXBA 2WZQA 5D1HA 2XKJE 1FUEA 4N82A 3HSSA 3H2KA 2BM1A 1BZYA 2ZAOA 2COKA 4GUAA 3Q8MA 2VC2B 4YECA 3E23A 4DJAA 2R2GA 4J1TC 4OGLA 4OIFA 1MEJA 1I51A 3VJLA 1IAQA 1QX3A 2ZREA 3UUGA 3UV6A 1A1VA 3Q9NA 4G41A 1S2OA 1NWCA 1QR6A 1VXRA 3KDSE 1TM5E 4PF1A 6REQB 1EDZA 1U2QA 1YH3A 5K3OA 5D3ZA 1MZPA 3EOAI 2G9RA 3AF3A 1N3BA 3PUZA 3KB1A 3F7TA 3ZBQA 4L78A 3AO0B 4LOJA 4QATA 1FNMA 4CRWB 1AGYA 3EF0A 3O93A 2I2FA 5EHIA 4EHHA 2GX6A 3CIOA 4JJFA 2D5BA 3DMHA 4QHSA 2K5UA 1IHOA 1JPJA 4PINA 1OWLA 3SSAA 1NW6A 4RKYA 3QTTA 1BH6A 2ZT5A 5IJAA 3SLKA 1JHYA 1XCMA 3A1SA 4QQFA 3MJVA 1VYHA 1QGED 3IP5A 1Y5IA 1XDSA 4NL4H 4RE6A 2OQVA 3RYCB 4DLXA 3G9XA 3PJDA 1DRKA 1T9AA 1PT6A 5FPTA 3GBVA 2DT8A 3ORHA 2X1LA 2Z08A 4LVUA 4MQFB 3J80A 4PFKA 3N2KA 3Q6MA 1ECGA 1FUYB 2YY6A 1YASA 4LYGA 3U4IA 5ECYA 3ESQA 3O92A 4M8KA 1PZGA 1LDGA 4LY3A 3STUA 3TQOA 1CUJA 2IJGX 1J0EA 4OSEA 4O1IA 2PPLA 1U8ZA 3PJFA 4G1CA 4OJYA 4UHBA 1X6VA 4EQZA 5CB0A 1DDOA 2B7LA 2CLOB 1DZ3A 1JPVA 1UFOA 2QU8A 1ULSA 4IGFA 2XQVA 3IMGA 2O5RA 4MIEA 4ZCLA 1IBCA 4LOIA 4RS4A 3DNFA 4YCAA 4DCGA 5BSFA 3UXEA 4E51A 1NBAA 3H42B 5E9JA 2J9FA 1HOTA 3RSLA 1V95A 1YTLA 4F5EA 5DOZA 3UAZA 1AQIA 1KFJB 1U0FA 5FEMA 7MDHA 1PJSA 5CA0F 1RHMA 4JI1B 5CA0B 1JMYA 4FDMA 3TD9A 2OGUA 3HBFA 5C80A 2BP7B 3L07A 4WZ6A 2I6QA 3OU7A 3RJMA 4JI4B 1I4EB 2KLHA 3O94A 1LFDB 1HFWA 5EXDA 1ORHA 4CUZA 4GHWA 4AJ2A 4PLGA 1VL2A 4DQXA 1E1LA 2G09A 2PL3A 2JFZA 5BMOA 4YJGA 1X1TA 4DWVA 1GTMA 4GP6A 1K7FB 1OIWA 4IZIA 1ZU4A 4ROTA 3L8FA 1PRYA 1TK9A 4RSGA 4TMYA 1SBTA 2I7TA 3FWZA 2E6KA 2ZCUA 3SM9A 1QQAA 2NXJA 4QRHA 4UZEA 2ZCJA 2NN3C 4EB6A 3KXDA 1VIDA 2R1TA 3REGA 3B9QA 5D5QA 3S2GA 3ZU3A 5E8JA 4DY6A 1ZNWA 3H9EO 2JCXA 3UOWA 2FFRA 3JZFA 4KGZA 5JATA 2RH9B 1DRJA 3IUSA 3KCNA 4UFOA 4WNAA 2G1AA 2NO5A 3DLHA 5CFMA 1JSRA 5DHTA 2NAPA 4IKPA 3PDUA 1XKLA 1XQWA 4B3TB 1GHTA 3IOCA 2CLMB 1R0WA 4NF2A 3NTRA 1BQ3A 2VJPA 5HMMA 2CBZA 1BAPA 3EB9A 4GIBA 5FJJA 3U3DA 4LTNA 5BV7A 1C3JA 3GI1A 1K4YA 5ENZA 2JASA 1ZYUA 1U5BA 4B3DA 4N6GA 1MH1A 3STHA 1KMCA 1B1AA 1U94A 1GFIA 1Y34E 3LIIA 4HC4A 4HQNA 4P4TA 4YAIA 5BWBA 4DGQA 4ZOBA 5B37A 1JFSA 4JV5B 2G3YA 4HNAB 3D7NA 3K2EA 1RYBA 2WWGA 4NBLA 4COOA 2N46A 3N7AA 1F2UB 2X19A 1SIBE 5K8TA 4WGFA 3K6SA 4Q7KA 4R0NA 4I46A 1POXA 4H35A 3IMKA 2XCQA 3AHCA 3GGDA 4Z53A 1Z39A 2V59A 3EC2A 2BTQA 2ZAMA 1W34A 2JHAA 4IG9A 3C3DA 4IKEA 4GRAA 4OHUA 2CVHA 4DBLE 1R4MB 5AKKA 1AURA 2ID4A 3A1UA 2ACEA 1A4IA 1EBFA 1UWVA 1U1DA 1FTGA 5IAKA 5E95A 3H99A 1TM4E 3CF0A 3D5TA 4D4GA 1GGKA 2XDQA 3AFMA 1U2EA 2AG1A 2GB4A 3EEQA 3GJYA 5FOVA 3T7AA 4DZZA 4MHTA 1M33A 1YRQA 1CJVC 1ZRHA 2IYZA 2LRHA 3QHAA 4BZXA 1K8XB 3FKQA 1LSOA 3RU9A 1R8JA 1ZGJA 3ONFA 3E3AA 3ID6C 3CJTA 4WKNA 1G4UR 4QBFA 3SLRA 4FGUA 4FK8A 3ZHCA 3F8TA 2KE5A 3MYRA 2C4NA 3K1JA 1GL6A 1Z5OA 4I08A 4IWXA 1BCRA 1T15A 4DG5A 3HU1A 3SYMA 4NBRA 1Y6ZA 3WSWA 1W47A 1E2QA 5AVVA 2CL7X 2R8BA 3KWJA 3T0IA 1H1LA 2QJTA 1BKYA 1N3YA 1Q1QA 2H9YA 2QGZA 2QNRA 4RMIA 3GLGA 2GWHA 2EX1A 4BLRA 1GXSB 1CQIB 4YRCA 3FE2A 4P3PA 5D3QA 4XR4A 3L79A 2N1BA 4MB6A 3RABA 4BFUA 4TSFD 2NO6A 5H3HA 3ELYA 2JGRA 3KFVA 2DJ5A 1OXVA 3FWKA 3A3PA 2QM8A 4MRMB 2FJUA 2AW5A 3WGLA 4FHGA 3M4YA 5TQ2A 3W7AA 4F3CA 3SE0A 3AL3A 3W6OA 5BPFA 3C7DB 1PP4A 2COEA 5H1YA 1Q1EA 3MCUA 1DUSA 4QX6A 3PV0A 3MK31 1H6CA 3GB9A 4XB6B 3RYHA 2GM9A 3P0FA 4J1TA 2GDJA 3RS0A 1UPTA 5EQDA 5B7QA 1BTOA 1NY5A 1Z4PX 4HDSA 1P3JA 3NFRA 3AM3A 4NLLA 5GY7A 1HDIA 1P91A 2I7DA 3UB2A 4BZZA 2UXDB 3WWDA 2LNDA 1C7FA 3FCXA 4H16A 4R31A 3QXGA 3HWRA 1CXZA 3RT1A 3CLVA 3EHEA 1B0ZA 3LI2A 2VK4A 1YE5A 4BNDB 5JAHA 3UBMA 3FHJA 1O97D 2NVBA 2Q4OA 4RVCA 2QP3A 1BQ4A 1ORRA 5D5PA 1PL0A 4FKZA 1GLNA 1TYZA 3UUWA 3CW2A 4V0LA 3CM0A 5DYIA 2VBGA 1RI2A 4LHWA 4XX1A 5CH8A 3D4NA 4BFLA 1SIWA 1V3VA 2W11A 3I52A 1PJ3A 4HB2A 3EYAA 4I1VA 3L02A 3LX6A 2NU9A 1FFSA 1QPGA 2PG3A 2FZGA 1CY2A 3PNLA 5A4KA 5JDIC 1UDAA 3MWKA 3WLTA 5I3CA 4G5YA 4QDUA 5ALZA 5CFOA 2Z4RA 1LQUA 4RGBA 2QRUA 2P2DA 4UZFA 1C30B 3GZNB 3KHSA 5EWJB 4RXUA 2FLVA 5G2OA 4BNJA 5BWLA 1J8YF 1JXOA 2AMFA 4IOJA 2EW2A 2IUYA 3RUPA 3S2SA 3T9FA 3T9AA 1ZXXA 1Z38A 4G25A 3NETA 4I7EA 4Z9XA 5AOCA 2I99A 5LNK1 3E3MA 4PNHA 1P2VA 2ZOSA 2AXQA 4ZANA 5K4AA 3QQ5A 4UHHA 1TF7A 2Y2UA 1SOAA 2CC2A 1FXSA 1CLEA 1M67A 2D1YA 3G8YA 4L8YA 4OYRA 4CEHB 1KDRA 1X3LA 4Q6WA 2APJA 2BT4A 2Y1LA 5JQWA 3WGKA 4XUCA 4HVTA 4R16A 5KWVA 1NQVA 1ZONA 3CO5A 3FWYA 2CV1A 3P0JA 4D56A 5LQJA 4Q9NA 2Z5LA 1XNQB 2P3SA 2RI6A 3I1IA 5FX2A 1N0UA 2I6XA 2QNBA 1BMFD 1TJ4A 5G1OA 1TVCA 2BMAA 3KOWA 4JHLA 4WINA 1TMGE 2AR0A 4G5OA 5LP6A 2WNIA 2X41A 3BMXA 1ZIDA 5FWDA 4BGVA 2NZVG 1PR6A 2PL1A 4RADA 3VOAA 1V43A 3D3EA 3QI7A 3HFSA 3LYUA 4AKEA 5B6PA 1UOPA 2P9ZA 4UU0A 1H3EA 1JKXA 1QDEA 5HQJA 3RFXA 2WA2A 3AKEA 2O1SA 4IY1A 5FTWA 5DM60 1A50B 3H16A 1N9ZA 1IHPA 1SBZA 1V2HE 3BERA 3K6KA 2CDBA 2DPLA 1RJ9A 4FP9A 3N2ZB 4FB4A 1XNHA 4JSRA 5H9VA 3RADC 4HAIA 4AKIA 1G55A 1US8B 5KYXB 1QP7A 2PX8A 4Z99A 4M0LA 5HA5A 1NF3A 3DDWA 2ZIGA 7ABPA 1Y4ZA 5ICFA 1QIGA 2E87A 1S8OA 4B4WA 5HQ3A 3Q7SA 3L7MA 2HJWA 5FV7A 3TI9A 3EN0A 3QOWA 4GOMD 2ZWOA 2IELA 1DJNA 4KUHA 3UYLA 1N5LA 4DV6B 3LT4A 3AM4A 3AFOA 4QO7A 1GQRA 1OC4A 1H65A 3NWEA 3GMIA 3S7TA 2AUTA 4C88A 1Z2OX 121PA 2EFDB 3HFRA 2HDHA 2UZ4A 1TRKA 3CEPB 4B34A 3BH7A 4H18A 4P08A 2UDPA 3IHKA 2ECFA 5LD2B 5EMHA 5CH5A 5A3QA 4I4LA 3ZGNA 3EGCA 2VK8A 3T7EA 3L05A 1NNUA 2NU6A 1NJ6A 3P1JA 5J2TA 1TW2A 1ZWKA 4RHUA 4D4MA 5LDDC 4ZQFA 4E13A 2VYNA 3JVVA 1DWOA 4GXQA 2BHNA 4UHCA 3NASA 5FQNA 4DOMA 2Y71A 2KYRA 1TUBB 3NVDA 2DFDA 3EIHA 1BA3A 1G8GA 4EHDA 2YV2A 4LMPA 3ZWMA 3EH2A 1KP3A 5K3EA 4GKKB 2A9JA 3KUUA 3LE8A 5TE9A 2QAIA 4BMYA 2EBFX 2HT1A 4U6NA 4NWIA 3GQBA 2HNBA 3VO2A 1TZMA 4BMZA 2WHYA 5IAGA 5AW9A 4BVKA 2CXUA 3DE5X 3O82A 5JRDS 4ER7A 4D5GA 5FR1A 2C9CA 3CB2A 1WNFA 2YIJA 3IURA 3AFHA 2LPMA 2PKCA 3FOAA 4R8MA 2VA8A 1RR6A 4KCGA 3VI4B 2HOQA 3OEEA 2HHJA 3HJNA 1E1MA 1MVOA 1LF5A 1MC5A 4NHEA 4ZXPA 3TPZA 3NDJA 4DMGA 1KAQA 3KPYA 4FHEA 1Z6QA 3WDSA 2H1LA 3HA5A 4J0EA 1I0LA 1GPYA 2A2ZA 2OCPA 4MR7B 2IEYA 4NYJR 1W5FA 1M3SA 2RONA 4L16A 3O2QB 5HKAA 4NY1A 1ZMOA 3EIQA 4HGOA 5FADA 5D86A 1KMNA 2H8KA 2ZIZA 2R8PA 2PXHA 5J4HA 2O8BB 1KZ7B 3AWDA 4AQ7A 1CR0A 1O8CA 1S7GA 5SYAA 4JX9A 3ZCSA 3ZJTA 1HGXA 3L8HA 1IXKA 1L5QA 2GXUA 3H4VA 1OA1A 5GJVC 5AIBA 2ZVQX 1LV8A 4FLFA 4JR2A 1GAEO 3HN2A 4J8PA 4KDRA 4DV5B 3TAUA 3EDOA 2BFOA 1R0XA 1UXGA 2OORA 1N6IA 2CVPA 3IERA 4G8BA 3IP7A 1WLYA 1XDWA 2B7CA 1RBQA 4XX0A 4P7JA 1A8SA 3AX6A 4FLEA 1EX9A 4HQOA 2ES4A 2I6TA 1CYDA 1YB2A 3GJTA 1F6BA 1SRQA 4Y9RA 5EEGA 2A5GA 3A05A 4CF6A 1WMDA 2V7XA 2VDUE 4X0EA 1OZFA 1PS9A 1RXEA 2CE7A 2JJ1A 2RJOA 3G8AA 3IR5A 4WSOA 4DCSA 1JU3A 1RQLA 1EFHA 4CPDA 3U7QB 3CCFA 3A1DA 1Z74A 4D46A 1IUPA 4HQ6A 1E1KA 1JR3D 3AERB 2GTIA 1S3SA 1DIHA 1MR3F 1KARA 2CNOA 2P35A 4Y0NA 4KMOA 4F8EA 5KNDA 4AP5A 2FF7A 3DF9A 1UKVY 1XRMA 1CULC 1LTQA 2WMNB 4OTZA 3G49A 3R3UA 4PXYA 5CBPA 3N0TA 1HE4A 1XJ0A 2GYVA 4S0ZA 4XRRA 5LBTA 2IXFA 1Z7GA 2CHVA 2QX4A 3CTPA 4BLOA 4RD2A 4W7SA 2HIGA 4L5IA 2CLLB 1YONA 1W0CA 3P9KA 4OOEA 2WB2A 3ND6A 3QFCA 5A2GA 3CONA 4FNMA 1PR5A 4KEAA 1WF6A 3AZOA 2K2QB 4HTFA 1JSXA 4C0BA 4RIEA 5ANRB 4EY5A 4EUKA 4DUZB 1QNLA 2YINC 2P3OA 1ZJ6A 2AFIB 4FZJA 3A9WA 4KX3A 5HFAA 1T5LA 5DBFA 1KTIA 4C7KA 4PVCA 1AO0A 1FRVA 2VTEA 4K03A 4RKWA 1CUVA 3O5AA 4HD8A 1E5QA 4WUTA 1DJQA 1KO8A 5DNEA 3TX6A 2NO4A 5LN1A 1Y8CA 3L8DA 3QKRA 3ABIA 3AJRA 1I5EA 2BFBA 2IYWA 4TLBA 5EAIA 3OTOB 1U0EA 2IXEA 4Z9FA 3KUKA 1ZCBA 1V16A 4BO3A 3R77A 1EDDA 3EQ6A 5ALNA 4ARBA 1W94A 2I4RA 4IS2A 2JCYA 5E1OA 2HSGA 3GG9A 4RJKA 1CS4C 3ME5A 2YASA 1CS0A 1JVNA 1J42A 3NOXA 4KLAA 4UEWA 3FTPA 2W0SA 1W5SA 2WWFA 4BLUA 3MAGA 3P2OA 3VNVA 5JXWA 3D0QA 2HRCA 1RT9A 1J7KA 3M6WA 1YVPA 3UTDA 4A1OA 4NDZA 1PTKA 2Q4DA 4QUEA 1FFGA 1HURA 4AMBA 5FO0A 4YXWA 4MWDA 4WLFA 3DLPX 4TYYA 3NBFA 3MT0A 2D1QA 2ZYWX 2J4DA 1G64A 4XJTA 3ROXA 2H7CA 4OKSA 4YIKA 3Q3EA 1UP7A 2BELA 3BILA 1CG6A 5BNFA 3EXEA 4O5OA 1PT8A 4EGFA 2WTBA 4WCFB 5LZ9A 1TIPA 2OHJA 5EXEA 1P7VA 1U3GA 3AXTA 2C7PA 3B7WA 1E3WB 2OTCA 1RQXA 4S04A 2FDRA 4GOXA 1ODIA 1LPAB 2ZRHA 1BX3A 1KY2A 3NHWA 2WWVD 3SOZA 3MIIA 1WSAA 1AKTA 3PQ6A 1TT5B 3KAKA 4K9SA 3ZV6A 3IEPA 2CLIB 1C3OA 4B6EA 3H5IA 4EJSB 1G2QA 1VIVA 2H1VA 3JRWA 3ONEA 4UTOA 1Y3DE 1ECFA 5EZYF 5EZYB 5EJ8A 3RC1A 1QLWA 3OX4A 4WECA 1EFDN 1QP4A 3E27A 1NU6A 3DP7A 3R9XA 1SY7A 1MN6A 1RHUA 4UMVA 1QORA 2W2VA 3M6LA 4HAOA 3R8XA 5KCZA 1SKYE 2XJ9A 5B1HA 3DE7X 3AHJA 4EVSA 1PF7E 1X86B 1J1IA 1M1YE 1IYZA 3KLMX 3LKZA 4YREA 1MF7A 2D74A 3ZYCA 4PZEA 2WJYA 1TQ8A 2QR5A 1A96A 2G4VA 2J9ZB 1YJCA 2ZQ5A 3B5EA 3HB0A 4HUQB 4MVJD 1JDPA 5K20A 1PZEA 1E3LA 2HXGA 3VZDA 2R00C 2GPYA 1ZD9A 4AUMA 5FR2A 1MO5A 2GN1A 3AY3A 1XTKA 4G0YA 4H0NA 5DYWA 4QPJC 5ARDA 3KPJA 2IZ6A 1AV6A 1QTIA 2JGNA 1HFKA 1U28C 2GPBA 3NTUA 2ZP1A 4FW8A 1TTPB 1HKHA 2Q3MA 5K0CA 1M2OB 4DYHA 2GLXA 5I9IA 1ZCAA 5EKSA 3NJ4A 4CKEA 3EGDA 1NN1A 2W2KB 4GXNA 3ECCA 3TM4A 1EIZA 3HVJA 4EITA 2BEUA 2WBLC 3IIKA 1NLMA 1QJCA 3C3PA 2W4MA 2NM0A 4KQKA 3DOJA 4HB0A 2FZEA 3EDCA 3LUPA 3VKFA 4OQYA 4V03A 1MG0A 1XP5A 2FPUA 3OJOA 4TKVA 1QQ6A 1YHNA 3LDGA 1TAGA 4WZBE 3F78A 2RHCA 4HAVA 3FRJA 4E2FA 3KYJB 4PNEA 3STVA 1P1FA 3W3AA 4V1CI 4BLQA 3VR6D 1G5IA 4LMBA 1P9WA 2PT5A 5EEHA 3GEPA 4NSNA 1DXHA 1FTNA 1TA4A 2FWAA 2GN9A 1XMQB 3DWGA 1BCSA 3N1UA 4HXGA 1JI0A 1UP6A 3DAFA 1NBHA 4QXQA 2WIGA 3DW3X 4TZ6A 5CLQA 4PVDA 2HQOA 5F1KA 1D4OA 1LKZA 2RGYA 3L18A 2Q6OA 1FF9A 1XD9A 2Y0PA 3TTSA 3V4FA 1AA6A 2PJUA 1KBQA 5K8CA 5KQRA 1W30A 4DHEA 2VT3A 1K6MA 3HI4A 3TE6A 4MEAA 3HWX1 2LBPA 3OO1A 4N5HX 4B4UA 3ZTTA 3TK1A 2YXNA 1Z6AA 1KXZA 2N75A 2HDNB 1UKAA 3K5HA 5AJZA 6GPBA 4H1UA 5A7FA 2ZS7A 1OH6A 3TYXA 4EHFA 4QICA 4KRYA 4C7OB 1EWVA 3OZXA 2GI4A 3L9XA 4YI5A 4J0FA 1E5XA 2O1WA 1IU9A 4CR7A 4MDYA 5FWXA 1R6BX 5FD8A 2ACKA 1ISRA 1FDIA 4MV4A 4MEBA 4JELA 4E5KA 4O1MA 4WNIA 2EIXA 3AONB 3OETA 4ZT7A 2AG5A 2O3QA 3OFNA 1Z6ZA 4NAUA 4A8JB 1R4NB 2EC5A 2FAXA 5F2NA 2I91A 3OKAA 2XWQA 4MUAA 1Q5PA 1V8DA 4YCBA 2IYPA 3IX7A 1VE7A 1JMVA 3C6XA 5LDGA 5K6AC 1DWQA 3LOPA 2K2WA 2PUDA 3BVPA 4M7OA 2ADFA 1G3MA 2HHLA 3RRBA 4A7PA 2AE2A 4C0LA 1XC7A 1JYSA 3L8YA 1USIA 1S02A 1FJHA 2WJVA 1H0KA 5EN4A 1KRXA 2SNIE 1BA2A 3DEHA 3FSGD 3IE1A 5CPBA 1UWKA 4CG1A 2ZI5A 4XWYA 4XAQA 3S2YA 1BWQA 1FX1A 5EUQB 5JT1A 1VFPA 1ZICA 1G20E 1PWEA 2II6A 4CM8A 1IBMB 1VI6A 2V45A 4KYUA 4PNZA 3WV4A 3PCTA 3FSRA 4WESA 1P5RA 1C9JA 3PF8A 5T4BA 1O6FA 1KU6A 3IDQA 3G68A 4TSRA 4A6DA 4K6KA 1RC1A 1M2GA 1THZA 3OEWA 1Y8QB 4LUCA 3UT5A 4C07A 1I7NA 1G2PA 1P4HA 1KVTA 2QRHA 3NHYA 2IEIA 1D6SA 3EHDA 5E2AA 1PWHA 4PSVA 4TQ9A 3VGJA 4LQCA 4RF3A 2X14A 2FZ4A 2ZLBA 4PO8A 3SSMA 5C32A 4CQNA 4IJ6A 1ZDMA 3RVQA 1ISGA 3RTBA 4BE4A 5T8KC 1GA1A 1T2VA 4ZJPA 5IHPA 2DPMA 1GZHB 4FSDA 3RVBA 4EI7A 3VYSB 3VTAA 3K4QA 4XFDA 1UC5B 2V5UA 2JJYA 1Y3HA 2DR3A 2G77B 2Y67A 3GT7A 1AU9A 1R4ZA 4K9NA 3DZDA 1QV6A 1XO1A 4QBHA 5GVSA 3R0JA 2P9CA 1A9OA 5K4GA 4G0VA 1YS9A 2PLRA 3TQIA 4EX7A 1S2LA 1YFKA 3BQNB 2Y99A 4Q1VA 4QTTB 2AXNA 3FMGA 5B4UA 1TZCA 4X24A 1NVMB 5JJKA 4PS0A 3R6DA 4AB1A 4C76A 6REQA 4LRWA 2O14A 3RGGA 3ZE0B 3JAKB 4A3SA 3ZJ5A 5FTKA 1EHCA 4DCTA 3DS8A 4R2MA 2X3UA 3BD8A 3D8TA 3TD6A 3LY9A 1FX0B 1YBVA 1VPEA 3OTGA 2WHXA 1CHDA 2PAFA 3LHSA 4ITUA 1LNSA 3TW0A 1P1RA 1TC1A 2BFAA 3VZBA 4MH0R 1SQSA 3EZ6A 4A26A 4DBZA 4E4RA 3AU8A 4N8DA 2OB2A 1QMGA 3CR8A 4ILKA 4I19A 1C80A 1ETHA 1Z6GA 4YCCA 5C1PA 3JQBC 4MLCA 2P41A 1NFRA 2VHYA 3DOUA 1FYVA 3SIXA 2HV9A 3GLIB 4MQFA 1DLIA 1XT6A 2I87A 4CR8A 3BHMA 1FCJA 2Y4OA 4A6EA 5C5EA 1X1QA 5EHZA 3CKLA 4CV0A 3PNSA 1VJ0A 1TECE 2AZDA 3SQOA 3QEBZ 3MB5A 2O2IA 4N39A 2B4YA 1O0CA 2PV0A 2FUG6 2VP3A 4KLZA 4ZDKA 4IDQA 5GOZA 1N78A 3QE4A 1VCIA 1H8HA 4YO7A 2BGLA 2OHXA 3QUAA 2AJCA 2VP4A 3GEBA 4ISCA 1ADYA 2OR3A 1Z12A 4LJSA 5GV8A 1HYGA 3MTJA 4ZVTA 3UG7A 4Z3OA 2FSSA 5BNZA 1FE8A 4IIYA 1XROA 4YGYA 2QT0A 1TD1A 5JTUA 2VDJA 1DAKA 1ORTA 1RZUA 1HLDA 3LZCA 3E2IA 5CA0A 1XLTC 1DBRA 2A58A 3MS7A 3TQQA 3T7JA 2PH3A 2BP7A 2HREA 1Y9JA 3Q41A 4F5ZA 2E4XA 3AY0A 1CV2A 2JIBA 5AJHA 2ZTVA 2OCIA 2JS7A 4UDYX 3MWLA 4R2JA 1Z4KA 1K9VF 1UBRS 2BM8A 3GZJA 1S2MA 4OGKA 2O2ZA 3GC6A 4YRJA 2P2ZA 4J91A 4LYJA 1U28A 4X65B 2A8YA 1JDUA 3K8QA 3NOVA 1K3UB 1SU4A 2FFHA 2H1IA 2YHBA 3MPOA 4HEJA 4JP5A 4MGIR 5L6LB 5CD1A 2PZJA 4RHYA 1HDZA 3NZEA 1JGTA 5EFZA 5LKAA 3WXBA 1GL3A 1ZIYA 2E82A 2R44A 3FETA 2PUAA 4X20B 2OM6A 3MW8A 3G23A 4PRKA 2WM3A 1XB2A 5INTA 4GOLD 1JFLA 4OL9A 5TEWA 4S12A 1XTTA 3HJAA 4A0QA 3TRHA 1XJCA 1UMCB 1S4MA 2FPPB 4Y6GB 1FNNA 1CUHA 1YZNA 2ODEA 3E1KA 1Y80A 2D1FA 2PRZA 3CCBA 3DDSA 3K0EA 1JJIA 3OTWA 3SQWA 4JJ6A 3CEJA 3NU1A 1FW8A 5HZHA 2BVNA 1ZUNB 1QYIA 1RMYA 3K53A 4DBVO 1E6UA 1MKYA 1WV0A 3LP5A 2IPAB 1W9HA 3PXGA 4ZAFA 2C1EA 4KXFB 3NWPA 4PSKA 5HKLA 4QYWA 4Y7DA 4OSOA 3MNFA 5A5VA 3U7HB 1XTPA 1BXGB 4YP9A 2DPXA 5KYYB 4NCAA 2GVNA 3KOYA 5ISMA 2BD0A 3G1UA 4UCQA 2JB9A 5DP1A 4HLUA 2IBTA 4RUKA 4B3RB 4DQ0A 2B35A 1O89A 2GJSA 3H4TA 4KO3S 3WYAA 2YL2A 3V34A 3WQBA 3SZ3A 1SIUA 1XEWX 3HFGA 2XVZA 2C3UA 2G5GX 4Z1MA 5AW8A 1XEWY 4S1NA 1POWA 4HNAA 2FLKA 2R79A 3LUJA 1JXQA 1J22A 1A76A 1SXPA 4KITB 2P2GA 5CFNA 4XDGA 3EE6A 1DFGA 2Q3DA 4U5XA 1RWPA 1DGQA 2KPOA 2PUBA 1GTL1 1W44A 1Z0ZA 3LDHA 4X7PA 1ACJA 1RFLA 4OH7A 1Q22A 2F9MA 4NCXA 1TGYA 1T1SA 2EKBA 3TEFA 1VCMA 4B6JA 1R4MA 4BVAA 3D6UA 4CMIB 5B1YA 5JSZB 2WQ7A 2ZBFA 3L7AA 2QL9A 1BXRB 2QTBA 4MAAA 5K6AA 3OUUA 1Y1TA 3H1GA 1HM5A 1CR2A 1M73E 1P2GA 1GOTA 2J3DA 3I1JA 1JPUA 4FGJA 1DO0A 1RWXA 4BV3A 1IM8A 1M6HA 3NVKI 2Q21A 3G59A 2HB6A 3OZIA 2JD1A 2NNLD 3IRVA 3ODGA 2IODA 4I2NA 5IDVA 3FI9A 3IAUA 5LP1A 2PKXA 2HSDA 1PG2A 4JN6B 1EK1A 3AB7A 4L4RA 2VDNB 1ADJA 3KKOA 3V46A 2HQ1A 4RVUA 1ZI9A 2ZITA 2I2BA 4RK6A 3FN4A 1NI4A 4UARA 1U2ZA 3ZZ1A 4DY4A 3GBPA 1S1MA 3V1UA 4CE6A 1TVMA 4ZO4A 3OZUA 4UXIA 4P80A 1A5ZA 2G04A 3H9BA 4C3OB 3IOBA 4AY2A 4V3CA 3UK1A 5BSVA 2FV8A 1YOBA 3BK7A 3UUEA 4IJUA 1VHQA 1CFZA 1YACA 1C4KA 4P3XA 1QQBA 3LRTA 1JS1X 3EASA 3HO6A 4QUAA 2YWCA 1CRLA 5EMLA 4DYVA 4X8HA 3DWFA 5EJMA 3OH8A 2AZ4A 2YJ6A 1KI7A 2WYOA 3LUGA 2IYYA 1PQ4A 1GXSA 3RHFA 3MN1A 5DNAA 4U7FA 3IIEA 4FS8A 1DEAA 2MYUA 2H1FA 2EKLA 1DQYA 2NUAB 3PWZA 3FVTA 4MRMA 5FI0B 3LG2A 2F67A 1U0SY 4JLMA 4AJHA 4IG4A 2W2XA 3T8YA 2D59A 4QWMA 3LRXA 2OPHA 4BYMA 5L7TA 2L69A 2XR1A 1WVIA 2QE7A 3LK6A 3QM1A 2Z43A 4S0XA 3V5NA 2JLSA 2AJDA 4H7KA 3T5CA 2IS1A 4D6XA 3BMOB 4G5HA 5JDCA 4MW5A 1IZYA 2CHEA 2WU8A 4RTPA 1H4VB 1A7JA 4CQJA 1K6JA 3QBEA 2PWBA 1FSPA 4YC7A 2HMVA 5TSDA 4IGKA 4LVNA 4BNDA 2IYVA 3UFXB 3GROA 5EXSA 5DWVA 2YHAA 2ASEA 2JAUA 3NLLA 4PYLA 1FDRA 2WMDA 5FL3A 3ZZMA </