4ZZ3A

Human gar transformylase in complex with gar and pemetrexed
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 6-Substituted Pyrrolo[2,3-d]pyrimidine Thienoyl Regioisomers as Targeted Antifolates for Folate Receptor alpha and the Proton-Coupled Folate Transporter in Human Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 58
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zz3A00
1GRCA 3GARA 2GARA 3DA8A 2BW0A 3DCJA 1JKXA 4ZYXA 4ZYVA 1ZLXA 4ZZ0A 1MENA 5J63A 1RBZA 1MEJA 3AUFA 3OBIA 4YFVA 3W7BA 1ZLYA 4QPCA 4ZZ1A 1S3IA 4PZUA 4Q12A 2FMTA 4QPDA 1YRWA 1RC0A 4YFYA 4EW1A 4R8VA 1CDEA 3TQQA 4S1NA 3Q0IA 4ZYWA 5J9FA 4ZYZA 4EW2A 4DS3A 1GARA 1RBMA 4TT8A 1ZGHA 3R8XA 2YWRA 1C2TA 4IQFA 3N0VA 4ZYYA 1RBQA 3O1LA 1RBYA 3P9XA 1MEOA 3TQRA 4ZYTA 3NRBA 5CJJA 4ZZ3A 4TTSA 1C3EA 4ZZ2A 4ZYUA 1CDDA 1RC1A 2BLNA 1NJSA 2CFIA 1FMTA 4EW3A 3AV3A 4NV1A 4TS4A 3LOUA 3KCQA
chains in the Genus database with same CATH superfamily
3EXG1 3GZTB 3OKPA 4URXR 4WZ6A 1IBSA 2AFVA 3UH0A 4CFSA 3PDUA 2LW7A 1RPAA 3BWBA 3BXPA 3PR3A 1R10A 4WBXC 1XZFA 2P9CA 2Y2UA 2C1EA 2Z43A 3AOGA 3LHKA 1JLHA 3HY4A 5FUQA 4RULA 3UA3A 5LQKA 2X0IA 1OFIA 3MOGA 2R8ZA 3TNLA 2ORED 4N54A 3UJ8A 1DTWA 4JMPA 4Z5XA 1N5OX 2JFXA 3BDAA 5EMMA 4FW8A 2H1VA 3DOOA 2PZAA 4KUHA 3T5BA 1K6MA 2HD4A 1CPYA 2QAGC 4HS4A 2P40A 2JJ8A 1B7GO 4P58A 3HR8A 4F2HA 5DWVA 3UPDA 1U6IA 4O5AA 4IHJF 3V97A 4C01A 3SC2B 4EHKA 4DY6A 1CUUA 3TSAA 4KHPB 3QBDA 4P7KA 4KQMA 3V1MA 4RZIA 4WD3A 4GBED 2W6NA 1BXZA 4QUBA 5ICGA 4A4DA 1QQ6A 1K8XB 2GEVA 3RKSA 1LDEA 2J09A 3SP1A 2R3SA 1TZ2A 5KQLA 2HU7A 2O6LA 1QAOA 1WKBA 2A5JA 3DE4X 4P54A 1DXOA 1EM8A 2FQQA 2W6JD 2B8NA 4D46A 1FTSA 4LDQA 3UOWA 4DARA 1JB1A 2HBYA 3P9CA 3IAUA 3CB4A 1AB6A 2FSSA 3OE5A 1JVBA 3ZTWA 1G41A 4OXRA 4Z3KA 3PRKE 5JXJA 2BFFB 4CMEC 3PYMA 2BJVA 2A86A 4HDAA 4XGQA 1A5ZA 3NH6A 3UMJA 5DX0A 3EC1A 3SYMA 5CBPA 5JNLA 4DE5A 4LKRA 1FUUA 3JQ9C 4LGMA 1E9DA 5JO9A 1ZCFA 2W98A 2AEFA 5AW7A 4HBGA 2VNJA 4G65A 4F06A 4R8MA 4AMYA 3IEKA 1D2GA 3IKLA 2WWYA 3KPJA 4U2CA 3R3VA 1IHUA 1NP6A 3I12A 4FMDB 1VCHA 2G88A 3ZW7A 4HSEA 2KMLA 1OTHA 4RDCA 4EKYA 1TRHA 4JJ7A 3Q0IA 2H5LA 4UDOA 2BFOA 2P2GA 2O8FA 1J20A 5FBHA 2P0YA 3ET5A 1BE1A 4NDZA 5JJ5A 1GXSB 4PG6A 1TO2E 1N7HA 2OZKA 1R4NA 3UFXB 1E1QD 1FFGA 4N40A 2AOTB 3P26A 5F77A 1KNXA 2ASVA 4FBGA 5GV8A 3KFVA 1GUBA 1Z2OX 3W4JA 3U7JA 3BCSA 5B7QA 3MGGA 4URUR 1GTRA 4HDRB 1ZK3A 2BBWA 5LN1A 1A4IA 3FPSA 1SEVA 3BIXA 5EZ5A 1I01A 3QFTA 4CTKA 3ZWCA 2W43A 5BV2P 4ESEA 2PRSA 2L82A 4N8EA 5I7RA 1RACA 2L19A 2I8AA 4G8DA 4N0PA 5B7PA 1HNZB 2HL6A 2YWFA 1J56A 3HA3A 4ZDJA 3GT0A 4LNAA 1L4UA 2AFHE 1EUDB 3FUXA 5F21A 1N6RA 4DMUB 3NVAA 3FKQA 3KT3A 3F4KA 3U7EB 1OB2A 4CODB 1F4VA 5LBUA 1K8ZB 3OZEA 4F6RB 3KL4A 4IQ4A 3ZNQA 5B1YA 3NPMA 3WHKA 1SBHA 1T5OA 3WQHA 4BNNA 4MYSA 5H81A 1ZS9A 5JSHA 4J0JA 2NO7A 2GZMA 2Q62A 2J87A 1WBJB 4IM7A 3EFHA 4B84A 3VX3A 2PUEA 3NWOA 1XA0A 3MQ4A 3D8UA 3ZW9A 2R0QC 3FWNA 3PBKA 4J91A 2QF7A 3DEZA 2IU0A 2XB2A 6CHYA 5JWRA 3IUEA 4B3DA 2NO5A 3K32A 3P96A 4UMDA 3WIOA 2ANBA 2P5TB 4JLDA 4QYIA 3PHCA 4DA6A 3O2NA 4LRTB 3X1DA 4PLGA 1OXTA 4NE7A 5HBRA 4GXNA 2DKFA 3QEAZ 3HGQA 2CBGA 3L1UA 3NANA 4FCVA 1A7JA 4KQGA 2R5FA 1JDBC 4B0PA 2FLWA 3B2EA 3IMKA 4KACA 3KELA 4TUYB 1BYIA 4QO7A 3IDZA 5LOVB 4LMAA 1C3JA 2YYYA 3ONVA 2YZ2A 1LSUA 4YS6A 1RLOA 3C14C 3OWHA 3G1WA 3LUJA 2Z1NA 3G3EA 3IUBA 3I9FA 2HW8A 4DR5B 3ASVA 4HRVA 4E2WA 1VMEA 2SNIE 1XTZA 3AEXA 3NHSA 1VE1A 2R7AA 3TQOA 1M1NA 1LXCA 2AYXA 3EMBA 1TVMA 1DAMA 4CUJA 5KTPA 5T4HA 2IS4A 3R6LA 2ARKA 3PWKA 1X42A 3DTYA 1MNAA 3SLKA 5KHOC 3KYCB 2BZGA 4F04A 5EN4A 1EVYA 4HWGA 2QTMA 2B4KA 4IOMA 1AZTA 2WNHA 4LRQA 2VJMB 4PANA 4MW9A 4DDWA 4YYZA 1Q6YA 1DBQA 4JYAB 3M6IA 3CG4A 4HP8A 3LQ4A 4MA4A 2J8ZA 1ZGBA 3I64A 3QPUA 4BJ1A 2VT2A 1EUYA 1A9RA 4KR2A 4KMOA 5EE0A 1I13A 3AF0A 1SUFA 5HHTA 4G07A 3QVOA 2GPBA 1AY0A 3DNMA 2I2FA 3LPMA 3DZCA 3DZFA 2NO1A 1UDBA 3GYGA 2V45A 3QI7A 6PFKA 4PCUA 5JW6A 4IH1A 3NDBB 1ZU5A 4JI8B 3NP9A 3NASA 1MO6A 5I47A 2ZBQA 4ABTA 4UATA 1DT3A 1E8NA 2E21A 1MCZA 3RUPA 3L07A 5AT1A 1QFJA 1X70A 4CYMA 2AG5A 1BZYA 1T0IA 3G17A 3C5CA 3GN2A 1XCLA 2NU8B 2MR6A 1OWLA 3ZY4A 5TMPA 3EOAI 3IHWA 1COWD 1KJYA 4IDBA 3R0JA 3BMNB 4I50B 4YRTA 4E2ZA 2CLKB 4H17A 1VB3A 3S3TA 1C50A 2G1JA 4RTPA 2OP0A 2WICA 2DG2A 4ER6A 4F92B 5DGXA 1P7CA 3ZGXA 4BAZA 4D8VA 4BNGA 3ANYB 2IYPA 2CLLB 3SYNA 3WVNA 3TMKA 4MPPA 4ME6A 5TRTA 1LCIA 3GCZA 4G9GA 1FP1D 1GUYA 1GR0A 4FYJA 4YDQA 1SC1A 2YINC 4L4SA 5CA0A 3CVYA 3UJ6A 1CLUA 2NYUA 3PS9A 1ILWA 1AV7A 2Z08A 1DC3A 3P4YA 3D7KA 4RKYA 5BQXA 1AV6A 4A8TA 3EOBI 3R7NA 4CLEA 4DR7B 1YQ9A 2HTFA 4RK6A 3W5DA 2OGWA 3GZNA 3PKJA 5JQGF 1JJBA 3I5XA 2XAAA 2WFLB 3Q10A 3WHPA 1D1SA 3HCFA 2PS1A 3KOXA 1CDOA 1VI2A 2E0IA 2C2MA 5EMLA 2WAYA 3KU4A 4P7GA 2JHCA 3THXB 4CIBA 1JFRA 2LPMA 1Q17A 3WWDA 3OQNA 4EMSA 1H6DA 4Y2GA 1RFLA 3PXAA 1QU2A 1MW9X 1VBKA 2PVCA 2YJGA 1NP3A 2E4VA 2GZ1A 2XZDA 1NG9A 4FS3A 4M86A 1RM0A 3HU3A 1Z8DA 1N2JA 2GARA 2PM8A 4PLHA 5AHOA 3ROFA 4WY2A 5JDCC 2W4IA 1ZESA 3JWPA 1MFZA 4MQUA 1XPUA 2QSYA 4HVCA 3I2KA 5EOVA 3PDWA 1L0BA 4IDGA 1IONA 3T4EA 3KZMA 4TX1A 3SSMA 3S5UA 2QVZX 3HLYA 2BAGA 2LR0A 1BE8A 1KL7A 1THZA 1S7CA 3WDMA 1XLTA 2CYAA 2G09A 1XFDA 2WK1A 1CUGA 4UUBA 5BW6B 3ZD9A 5LQNA 3HZRA 4W5JA 3U9LA 2PRZA 4Q18A 1FX1A 4RADA 3ETCA 3D8RA 2V6GA 4AJLA 1H42A 5LQUA 3A3YA 4JGBA 1IXKA 1O3YA 1I10A 1P5JA 1Q15A 1XJ0A 1XNJA 2A57A 2HCJB 2R00A 2LTAA 2OG2A 3I4FA 3UWPA 4BQQA 1XXHA 3IT3A 4B71A 4MV9A 2GA9A 1P18A 3C97A 3QWAA 4OAOA 4P36A 4PZAA 2OB2A 2J59A 1K6EA 1U04A 4DQLA 4QKQA 2GPAA 1JPJA 2HLPA 2HPVA 1RKQA 2DJIA 4O2BF 4JXJA 2JIZD 2NUBA 3AW8A 3C98A 3WWPA 3O8BA 3BMOA 5K8CA 2IA5A 4A27A 3AF3A 3NAGA 4DRYA 2O0HA 2AW3A 2HMAA 4JUAA 1MGPA 4WDQA 4XB6B 4HLUA 3K0CA 1R0SA 1LJUA 2JLUA 4Q1EA 4JZKA 1J1UA 2C4MA 1AM4D 3PHGA 2BRUA 1R6VA 2ZJZA 2ZTHA 3HDHA 3HKCB 3VJMA 2SKDA 3N87A 4DSNA 2FRDA 5HDBB 3HBMA 4HDKB 3K2BA 3WB0A 4ZJUA 5HUJA 5JFGA 1TA9A 4DJEC 4C4SA 3SQLA 2CBZA 2RI6A 2VTBB 2FGJA 1P19A 3AFOA 5CT6A 2O52A 2Q5QA 1G7TA 1PL6A 1M2JA 1V4NA 3AOEC 4KPUB 3VOTA 3W7VA 1G9XA 4X9XA 1R0CA 4I2VA 4M55A 3CRZA 2X6QA 3RSSA 3GP8A 2CV1A 3HEMA 1JZSA 3C48A 1L5KA 5LLTA 2HCRA 2IHTA 5LL6P 1KK0A 4NV0A 1HDRA 1RHKA 4FSDA 4IOJA 4LAFA 5IC5A 4F45A 3CZAA 1XE3A 2QYTA 1KYQA 5FUBA 4MV3A 5CA1A 1NUQA 2HWKA 2I3DA 1NJGA 3M3HA 2WWXA 2DT5A 2YY5A 3G2PA 4E4RA 1YU9A 3QF4A 4MGYR 4UDXX 3ZHTA 5M34A 4K81B 3Q7EA 4CF6A 3KOUA 2QY9A 4PYOA 1W4ZA 1IG3A 4RD4A 3AVVA 3JARA 3WB1A 2KWIA 1SAYA 1T26A 2GEBA 2R8XA 3EIUA 4GPEA 5GJCA 3V1KA 2QX8A 4Y9SA 5D3KA 4EZIA 4PGAA 3E4CA 3VU8A 5HS4A 4O4LB 1WBDA 3DLBA 1F8FA 3QVMA 4MUJA 4MDFA 1IPEA 2PGIA 4B3IA 3X1WA 1GCIA 2Z2KA 4INZA 2NZ2A 5IUKC 5CFPA 2DAPA 1WPQA 2RGYA 4B73A 3GLHE 2F8TA 5L7WA 3PICA 3LRPA 2WF6A 2PLRA 4NS4A 1J9ZA 1NMSA 1C30B 1MU0A 4WKNA 2Y3IA 5LQJA 3M4XA 3TLXA 3DEYX 4NDAA 4HZIA 3BXXA 1IUNA 1WHTB 3J7AC 5IEJA 2DE0X 1CJVC 4Y98A 1KIMA 2O06A 3JPWA 1T4CA 5JWHA 3UJAA 4D4KA 4GO1A 3RIYA 3VPFA 1MC8A 4QBTA 4KLNA 4R0NA 1QM5A 3E8XA 4RY0A 3EPRA 2GKSA 4OOFA 5G41A 5CFQA 2AN1A 4D5GA 4YACA 2C4KA 5CFZA 1RWKA 5J4HA 3FE2A 1PT9A 2JJQA 4E12A 3NEYA 3TLAA 4S1PA 5L45A 3NVKI 1RP1A 1FX0A 1I2MA 1UL1X 3QEBZ 3ZXUB 4DS3A 5EJ8A 2P3LA 2E6KA 2I7VA 3OTQA 3BGOS 3F6EX 1E0KA 1NI4B 3MJHA 4DJAA 2DYKA 2J3HA 4JB8A 3Q98A 1VGQA 4JBXA 5AOCA 5FNVF 1DVRA 3UMBA 1KQ3A 1CJUC 1DT5A 2JFVA 1WCWA 1UQTA 3D7NA 1AG9A 3B5EA 5F5NA 5DDIP 3BGSA 3UMYA 5HKLA 2P79A 5K8LA 2NVWA 3ICVA 5I9MA 1GG8A 1ZIDA 4NESA 4QULA 2QR3A 2J0SA 3GLHA 4NYJQ 4BQFA 4GLJA 4B82A 2NG1A 1QGYA 4N65A 4ZEMA 4MS4A 5LVAA 1O5OA 4G1UC 1ZYUA 2FUNB 4OB8A 4TYPA 4S1VA 3S68A 4TTVA 3ROKA 3SG0A 1QLHA 3CW8X 2PUDA 4Y2RA 5TVKA 1SUEA 2CBXA 4C4TA 4GHWA 2D7JA 2DCMA 4LBZA 2QX7A 4MVJM 4MK4A 2PR2A 1W4CA 4BY9E 2BKXA 2HYDA 3S2SA 3QVSA 3EUEA 1I4EB 3ZTTA 1OXUA 4GYJA 3DBRA 4J03A 1ZZGA 4FQ5A 4Z54A 2DHDA 2CXQA 1II9A 1J1ZA 4NICA 1P5FA 2IXDA 3TPCA 2VIIA 4B87A 3BRWA 4JBLA 4IJ6A 3UA4A 2D5CA 4CMGA 1UWVA 1XGKA 2VDWA 4NC9A 4PVDA 3B3AA 3DMNA 4NULA 4W82A 5KCMA 2YMMA 1D3AA 1FRQA 1K5PA 2B2XA 2XYHA 4MWTA 5AI6A 4CG1A 4D56A 3PXCX 4KGXA 4YI3A 4TMYA 3TXYA 4L8GA 5KNBA 4HDSA 2ZB4A 1B6TA 4PX5A 2GK7A 2V0NA 3O9ZA 5F4ZA 4GGOA 5HX7A 5KJ6A 1CNMA 2NTNA 2V58A 4V0NA 3FDIA 5DWQA 1HG1A 2OXEA 3SLGA 2G9ZA 2R6CA 4LWPA 1WD5A 3DSRA 4KUEA 4II3A 4BP8A 3OAAA 2JL1A 4XJSA 2I4IA 2PTHA 1GAWA 1J07A 1RXYA 2R8YA 3GJ3A 5MN5A 4WY5A 2WTAA 5MFZA 2Q0QA 5J4VA 1XQ9A 2WC1A 5C81A 3K6SB 3EEOA 3JD1A 1HL7A 2P2CA 3NWPA 2O7SA 4GMXA 3CUVA 4I19A 3I2YX 4QAQA 5LWQA 3CLTD 4YB8A 4OHWA 3ZZUA 2Y1DA 221PA 4CIXA 3F96A 5KNCA 4HRYA 4BO0A 2A1TS 4JBHA 3EWSA 2VK4A 1P5ZB 1GU0A 2L18A 3NHLA 4LV5B 4CL2A 2HFKA 3HNOA 4J3NA 1IFXA 4LXQA 2DFPA 3GN1A 1CETA 2A4KA 4YP9A 10MHA 1VHJA 3WLFA 2WIBA 2XY4A 1RBMA 3OP4A 3G0GA 2JFUA 3FNBA 3O92A 4JYMA 2WG1A 2B21A 4MV4A 4L4XA 4DA0A 2GN6A 1A9XA 1N1DA 4MQBA 4ZRMA 5BUSA 3B1ZA 1CERA 1AKQA 3TCKA 5T6MA 4IL5A 3D8SA 2Q0XA 4ZC8A 2G72A 5B3JA 1B8NA 4RTLA 1DMSA 3KKNA 1T5LA 5CXXA 3ZK9A 5A5FA 5REQA 5FLEX 4J94A 1QVZA 3VMFA 3TNDA 3UW3A 5G1PA 4H0NA 2GXAA 3THWA 2IH5A 3AR9A 3W6UA 1U0FA 5HF6A 1CUCA 1VL8A 2WMNB 4V3CA 3T6KA 1IOWA 1HKHA 1JH9A 4AC9A 5GQSA 1YS4A 4ARVA 5HBGA 4Q4HB 1SXIA 3HP4A 8ADHA 5FFNA 1HY3A 4IRUB 4EJ2A 1LQ2A 3ZWWA 4NCBA 4R05A 3GRZA 3MTDA 1YHZA 4TZ6A 2IHBA 4TN1A 1C9YA 1K8QA 2RGNC 3BTSA 1SULA 4JJ6A 2X7XA 1VMIA 3M9XA 4MMZB 2G76A 2O8FB 3DBVO 4HMPA 4U02A 3L3BA 1MB3A 4X84A 4JX8A 1R5BA 1X6VA 2VNHA 4DDUA 1Y81A 1O94C 4XFDA 1JR2A 1KGDA 3IAFA 4ZPXA 2CNNA 3SHWA 2PFSA 1JBKA 3G88A 1W5EA 1NT2A 2ZRNA 4MRRA 3W2HA 1P9OA 3GDGA 3IIIA 4HO1X 4OREX 5LQSA 4J4BA 4B4KA 4E3ZA 5BWOA 3KLNA 3LBIA 3W2EA 5IBCA 3PNMA 5D86A 5JFOA 1TUIA 3TW8B 2QRLA 2H2GA 4PBRA 5K0EA 1DI0A 4H4DA 3H2SA 4XWWA 2VVTA 2QWXA 3PA8A 4BMNA 5LQCA 3PU6A 3GW8A 2QVYX 3SSOA 2PUVA 4DLWA 2IZ5A 1LQTA 1HC7A 4LWOA 1JHQA 5U9CA 3MELA 9LDTA 4PXAA 1ADGA 3LHFA 3FFAA 4BJHB 1BDBA 2O3UA 3D8HA 1KQNA 3LBHA 4AO7A 1FFWA 2QD3A 2QN2A 3IVGA 5KU7A 1ZW6A 4JVLA 4HMOA 3SF8A 4ND8A 1RPTA 1AA9A 1YRWA 2Z4SA 3FCAA 1AQIA 3M6XA 3SXJA 3N2GB 3OQVA 1IU9A 1XNGA 2PGNA 2NX2A 5L4NA 3IJEB 1A50B 5E2BA 4MV5A 2DPLA 2QLJA 1VLLA 4GFDA 4G56A 3WA7A 2FUG6 2H1CA 2QTAA 5ECWA 1ZH6A 2I6TA 4G1MB 4NNPA 2OOSA 5AO9A 3KVOA 1PFVA 3PX2A 2YZGA 5DLPA 4HAXA 3ITKA 3M4YA 2PX4A 2W70A 2IZOA 2ZBPA 5AW8A 4BNDB 1EP3B 1TMOA 1XTTA 5BWNA 4NHOA 4GNKA 2OO3A 4AZ0B 2QTTA 2W2MA 3LX8A 1RD4A 5KB3A 1SIWA 4IJKA 3RS4A 1ZCBA 3T4XA 1G98A 1VRWA 2E3JA 3GRYA 3PYXA 1OFGA 2F3RA 2VHJA 1L7NA 3DTNA 3G13A 2YWCA 3LCRA 2WT9A 4Q66C 1XRSB 1CE8B 4DYHA 1HT0A 3H2YA 5KX5B 4MGKR 3TF5A 2ZSKA 3W4KA 1HYBA 2G7MC 1H1LB 1FFXB 2ZR9A 4KJXA 1Z7GA 1MJGM 1VMDA 3JQ7B 1LK7A 1YS1X 1NNI1 1L7OA 3DE5X 4M9UA 3D59A 4YWHA 4W7SA 1IVSA 1GRNA 5CDFA 1FLAA 5JVDF 1ADBA 5DCYA 3OQIB 3FPGA 1WOMA 2QZ9A 5ER9A 4XCXA 3OY2A 5BV0A 3HXLA 2AI3A 1EGHA 1U1EA 3KUUA 5FOWA 3WE7A 2X0EA 4M89A 2E5FA 2YNMD 4I55F 1UWLA 5F9MA 3ZCSA 4WZZA 2YFYA 3JASB 5IZ4A 1NW3A 2B1RA 3C41J 1X7ZA 3ZHOA 4FYIA 1Q22A 5BNWA 1ORWA 4BWYA 1NSFA 4E11A 1AF4A 1ZP6A 5CAEA 1JALA 2PLWA 1IUPA 3HTXA 2NXJA 2YH2A 5G40A 3WQSB 1C9JA 3VX4A 4IIEA 5IAEA 4DIFA 1DV2A 1M8FA 2BFBB 3N8GA 3WKDA 2YOHA 2Z3WA 4O29A 1XD2A 5GOZA 4A6XA 4LX0A 1FJHA 3LXMA 4ZVKA 4WBNB 1ZRNA 1L7AA 3DHWC 4HNAA 2E82A 2D5BA 1MOZA 4IYRA 3DKVA 3BJMA 4WWHA 3T7EA 2ZR8A 1E3DA 2C5SA 1FNSA 5HJ7A 1TAGA 1YD7A 4JL6A 3P2JA 3F5FA 3S1LA 1G7SA 2HY7A 2QRMA 5MN4A 3PCTA 1M0EA 3D54D 2A9QA 3I6YA 3KVVA 4NV3A 5NULA 4EJ0A 5FUVA 1TCVA 2ZRFA 3CH4B 2GSDA 2VH2A 3EGXA 3GL9A 4R41A 4WN3A 2VPQA 1VMAA 4C1BA 1FPMA 1KYVA 4PAMA 3S2FA 1UAGA 4Z4FA 2EDAA 2Z6VA 4F5WA 4IWNA 4C0AC 2ZQZA 2ZPUA 4JLMA 5FWYB 2PKRA 1T0PA 2Z6QA 2FFBA 4RD3A 2BHRA 4TTRA 4XAQA 3VJLA 3GFPA 1T34A 3P2IA 4G4JA 1U0GA 4IG4A 4RIEA 1VGRA 1DQRA 1FZQA 3WB9A 4JMLA 1GEGA 4J0IA 4U7FA 3BXZA 4DCPA 1DBIA 1V11A 3LY7A 1P0QA 1R0WA 3V8NA 4DBLE 3OD1A 5CCDA 5AVZA 2QJTA 2R5NA 3FRJA 1DL5A 3P45A 2HLNA 5E4FA 2WFMA 4O8CA 1L4NA 4U7PB 1NVUQ 4YAFA 1HLDA 2X76A 5DNUA 4RPKA 3STHA 1EDEA 2XQJA 3AP1A 4EG4A 3D3NA 1KIFA 1W8IA 2H2DA 4I8DA 1A2KC 1P0PA 1PNOA 4Q6WA 4L78A 5CH3A 5IHPA 1F5NA 2EIXA 2G5CA 2C94A 3TAXA 5F23A 1N2EA 4NU8X 1XPJA 1Z6TA 1XHEA 2NW6A 1ZINA 3B1VA 3PQ5A 4NK4A 1PGQA 1FVXA 2IEYA 2IOFK 2J3IA 3PP8A 3KV3O 5BXQC 1ONBA 2TMGA 3GH3A 4HTFB 2YYZA 3L8GA 3O2QB 4BLWA 2HO5A 5CU7A 4RK1A 2C99A 4R6XA 1GN9A 4WCFC 5EE5B 2NT4A 1FNNA 3LT0A 5EZ6B 5LZ7A 1ZNZA 1J0CA 1D4OA 4KPYA 1OD6A 4R98A 5TIIA 2VQDA 1TUEA 3MT9A 5IVDA 4YAGA 2CL5A 3DBRB 4GKBA 4WN9A 4TL6A 3ZBTA 5EJ4A 2WF9A 2ZJ6A 5EWJB 1GSAA 1QFSA 5I51A 1XU9A 1K3FA 4EPTA 4YCSA 2JAUA 4QU8A 3NBFA 4KWTA 5LP6B 2RHRA 1N33B 3C8UA 4AJ4A 4FMPA 1ZO8A 2V98A 2QUZA 2ZUSA 4P4SA 1E9EA 3UHOA 4C3UA 1O96A 2XUQA 1KEUA 3IXQA 2HLDD 3TNYA 1TVCA 1VKHA 5FHQA 3RVMA 1D2EA 5EQDA 4RDXA 1TFRA 4K6FA 1Q1ZA 4KQWA 2QM7A 3TQRA 2DBRA 2QEQA 2B25A 1NJ1A 4LOKA 2WJWA 1MH1A 1ZZEA 3BAZA 1IH8A 1L9KA 1OXKB 4A1FA 1UM9A 3RWOA 3E3OA 5HG0A 4FPXA 2PZLA 2XMPA 4Y67A 5K3FB 2EHJA 3RUCA 1FYDA 1CS0A 2D7DA 1DBPA 3OLYA 4XD2A 4AP5A 3KJQA 3RCBA 4GP6A 4X85A 3EPKA 4O2AF 2GCNA 1BDMA 2NO4A 3H1GA 3T7DA 4DQDA 3CXUA 1UFOA 2C9ZA 3FYUA 4IFEA 3H5LA 3UHAA 3AX6A 4KTTE 3KD3A 4RQBA 3SX2A 2IPLA 1PLJA 1F0KA 2IHVA 4G23A 4HAIA 4TLAA 4YECA 1XSEA 3NMUF 1GM5A 3BFXA 2R1TA 1ZIOA 3LXRA 4HH3C 2H92A 4QEDA 3T3DA 4QYMA 2OQRA 3VPAA 4A0RA 5KDOA 5C53B 2PE5A 4E22A 1RDFA 1EZ1A 4NNJA 4AF7A 1NBEA 4F9EA 3UOAB 1NUHA 1TOAA 3A9RA 4J9UE 5A4KA 4OU5A 4U7TB 4BVLA 4JKYA 1FFBA 3U56A 2VNAA 1M2GA 4KXWA 3EW9A 1UWKA 2WSYB 4D9NA 2XNKA 4U7JA 1QJ4A 3UJDA 4F96A 2G71A 1H0RA 1HDGO 2F67A 3FZNA 1F8XA 4JVSB 4W7IA 4AS1A 3M83A 4KDFA 5IPFA 2VHYA 1NBAA 3ZJ4A 5K6AA 4K9QA 4OIMA 1G8YA 3OFJA 1RC8A 4YMSA 1EP2B 2PGLA 3IHKA 4FFBB 3LHDA 4KFUA 1KE2A 5JSKA 2HGZA 3T12A 1HYEA 5CHYA 2D1SA 3KQNA 1ZNQO 1AKRA 4Y9DA 4V0OA 3RIHA 3BMQA 5FTWA 3I32A 2O2HA 1WVGA 5ENVA 1AHNA 5E4TA 4CT4B 5JMOA 4MB6A 3PUKA 3QLEA 3ND9A 4Y2TA 1HG0A 2C9OA 3PL5A 5DK4A 2V4UA 3QEMB 4M9ZA 3Q7QA 4FINA 1CQJA 3HR7A 3OQPA 5BSVA 5BUZA 1YUMA 2A59A 5EHIA 4Q9JA 3JWJA 1K7EB 1P17A 1NVDA 3GUZA 3LYUA 1DBVO 4MCJA 5JLAA 4ZKEA 3RNOA 3FWHA 2GOYA 2QAGB 2G06A 2ZGVA 4Q01A 4UUMA 1Z0AA 1UBUS 2VYVA 4OPMA 5KTNA 3RI3A 2ADMA 3HP7A 2PV0A 3I0ZA 4X7RA 4JI0B 2PRYA 4EX6A 5TEVA 2B0CA 3LDGA 4IJWA 3T9BA 1E6WA 1Z13A 2ZBDA 3ZCXA 5K1ZA 4CPDA 2AI2A 1TVKB 2EV9A 3TEMA 2QLNA 3QJGA 1GUDA 3P0EA 5JXIA 2ZJ0A 2OXCA 2Z0MA 1W75A 3NATA 3PSAA 4L9RA 3C6KA 5IDWA 4GRIA 3FTQA 3K3PA 2QTNA 3MF4A 4RPIA 4XYLA 4MS3B 5CX4A 3GCDA 3C70A 2R9VA 2ZYDA 1ZHOA 3GVIA 1X1AA 3E53A 2Y4NA 4L73A 4ZAWA 3GXBA 4D9KA 1YBVA 3RF7A 2FPKA 3RAJA 2QT1A 2I54A 2JCGA 1SG6A 4X71A 4E0BA 4KAXA 5BUQA 1J8QA 1QZXA 3S6JA 1B1CA 3D7SA 1SH7A 2UYYA 4BX0A 1RYMA 5DSXA 3HCRA 3QUCA 5D3QA 5HKOA 1HMPA 3GUVA 1U8AA 2HJSA 4KRGA 2OBLA 4FGJA 4KITB 2Q5JA 4ZN6A 4PZPA 4ZCMA 3DZGA 1A4UA 1I80A 5E9WA 4LE1A 3QSGA 4EB6A 3VDRA 2I7TA 1K0UA 3DAPA 4FOSA 1A8UA 2C7RA 4GWGA 2B6HA 2FN7A 1TYCA 2VYQA 3H9UA 1IN6A 3Q5EA 1JKIA 4H35A 1BNCA 4REMA 4V0SA 4D96A 1N78A 5AQEA 2V5UA 5BRAA 2FUEA 5A6SB 4BP3A 1DTEA 4CV0A 3K72B 1B6SA 3HHPA 4TLLB 1KH1A 1KYXA 3I1YA 5J3JA 5H02A 3U44A 3T34A 1G9SA 3WQRA 1UDWA 4KL8S 1EYZA 4NJEA 1U9CA 1J1IA 4L6IA 4HQNA 3WTBA 2O3RA 3WY9A 1O9GA 4EMTA 5M5BA 1SKBA 3C1UA 3KZCA 3PZBA 4L75A 3ZNOA 1PR4A 2ONCA 4XQ0A 3X1YA 2D13A 1RMQA 1TYAE 2WQZA 3OM0A 4FQ7A 2ZCJA 1KO4A 1SXJB 1KZ9A 2F64A 2XIJA 1JEEA 3M6VA 1AQLA 1MO5A 4BLVA 4DDHA 4BB6A 5C1OA 3VC3A 1XL1A 2QX9A 4LMPA 2VJMA 4FX5A 1Q77A 2FSVC 1G6KA 4PG4A 1JSCA 2JGDB 3N75A 4RK5A 1N2HA 3FTPA 4TWIA 3U7QB 5JZMA 1U2DA 3MMSA 4GPAA 4GZMA 4YAJA 4RFLA 1C1DA 1R74A 3AVTA 1K08A 3K9GA 4M0MA 4P2BA 4HKTA 2V65A 1PJCA 3MTQA 4DMHA 2FWBA 2K7ZA 4MVYA 1ULUA 3O3NB 1XLUA 2FG7C 4NZZA 4R54A 3H2ZA 5C7OO 4KAJA 2YWJA 4WFQA 1W9HA 4H16A 5JG7A 1C1DB 1QHSA 1RZ3A 1NA5A 1VPDA 3A0UA 3K96A 1B76A 3CNEA 1EQAA 3VZDA 2FOIA 3ZYZA 4EHLA 1FLVA 1U7DA 1TUBB 3OT4A 3LP5A 2QPAA 2HMVA 2OAEA 4U5QA 1N9GA 2C4UA 3VZCA 3P97A 5CIWA 3M6FA 1ZX1A 2WFAA 1V7CA 3L79A 1X9IA 2OUKA 2VP9A 3WDSA 4LHWA 4OHPA 1N9KA 2E5WA 3ZEAA 4G0VA 2IHZA 1UOEA 5AMXA 1BS2A 3RYFA 2Q3FA 3OPYI 3QHPA 2QI9C 3TLGA 1JIKA 2MU1A 2YNMC 2RHLA 3IKVA 1CRLA 2HF9A 3DP7A 4W1RA 1KA9H 1NR1A 2B37A 3DBHB 1VOTA 3DYIA 5FAXA 4Q4CA 1OB5A 2OV1A 3FPKA 1IVYA 1VXOA 4ALMA 3IIJA 2GJAA 3DOIA 4Y9RA 5DGHA 1SU4A 4BVKA 4RL6A 5C1PA 1G8PA 1ZOPA 3PC3A 3ZNPA 2JBAB 2QUHA 3ORFA 4H77A 1QK5A 3IFSA 3UWMA 3IBFA 4M7RA 1JYFA 2YMLA 1G7CA 4UMVA 2H5EA 3GZJA 4U00A 5E3HA 3T4PA 3T99A 2WF8A 5FQOA 1FQWA 3ZH2A 2NQTA 4JHXA 2OE2A 1QRUA 2JK1A 4XRRA 3QHQA 5P8WA 1INLA 1C1YA 3PD7A 4IVQA 4RGVA 4J0DA 4RK0A 3BIWA 3MWKA 3OURA 4EI2A 4GGPA 3G02A 4PC1A 5B6JA 4D3SA 4PLFA 4CEIA 3M6LA 2SHKA 2X2OA 3CH6A 3K5HA 4MXDA 4CCSA 2XHZA 1W4BA 4IFTA 3UWSA 4BFCA 2Q0SA 3PXGA 5LDHA 1P1FA 3T1QA 1PVOA 5ALXA 1LA2A 1SC4A 2PKQO 3B9QA 1QO9A 3DXXA 3FCYA 3PSHA 4OHMA 3VKHA 1YB4A 2AYYA 1GTG1 1ZISA 2FH5B 4RTNA 1XX6A 1G8MA 1YDFA 2WYOA 3UT6A 2DFTA 3KZVA 2ODQA 1RBZA 2WP0A 1OI3A 2JLQA 5CEJA 5FV7A 3R74A 3UW1A 3EULA 1E7MA 4E3WA 2EAUA 3QU4A 5AR1A 3ANLA 2R87A 3FOCA 1L5HB 1JMKC 2Q3CA 5EQFA 1N4AA 3CUWA 1USIA 3BMCA 2F1KA 1OY1A 1QFXA 1P2GA 1PX0A 2IYNA 2J5XA 3PQDA 4P80A 3I4CA 1JEJA 5ECGC 1AZSC 2Y27A 3QUQA 3R20A 3WIVA 4LKOA 3EXHB 1WKCA 1QQ5A 1ZJJA 3MGKA 4MR8B 5BQ5A 1X80A 4EDFA 4RIGA 2PWYA 1DDGA 4I4IA 1XWIA 2G3YA 3OKFA 1CFZA 2W90A 3QV1A 4MV1A 4UTNA 1MA3A 2ZU0C 3B48A 2R1VB 2J3MA 1XQWA 4OP3A 3F73A 2WM3A 1Z39A 3P5SA 1HTBA 2PBZA 5FIUA 1H0SA 1TO1E 4RGYA 4TRMA 4B34A 1ZIYA 2Q21A 2X9QA 2QRPA 3PC7A 3FOAA 2O14A 3A4LA 3PI6A 4D45A 2XB8A 3WQQA 1VLZA 3G8BA 2XBUA 2PBRA 4LJAA 4LTDA 3TQCA 1E64A 2FOLA 1ZPDA 2EF0A 4BLSA 3SQXA 1OWPA 5JR3A 2RAFA 1XQ6A 3D8BA 4ZVOA 3FFBA 1GZSA 2J08A 2WD8A 1S2NA 1JHPA 3WGQA 3VNBA 4U0KA 1A5BB 3CSUA 1PR5A 2QV7A 1ZVMA 2WZBA 3GLRA 3WNCA 4B2IA 4QX6A 4BN4A 4YP5A 2GTHA 1CY6A 4CIDA 3L01A 4CKEB 5KWIA 4R1SA 1J90A 2QXYA 2ZI6A 3ODGA 5LNK1 4P5EA 3D2BA 5CB8A 1QO0D 1WM1A 2R6DA 4NU0A 1Z5VA 2D2FA 2JC3A 3BK2A 3FH0A 1J06A 4WOCA 3WO1A 3JTEA 2JH3A 5IBRA 4LZJA 2G9UA 3EQ8A 2JCVA 3K9CA 3UAXA 3BA1A 4ZEXA 1LK5A 1QIIA 1XHLA 1TZKA 4M21A 2O8CB 1GPH1 5IXYA 1TF2A 4S24A 5AVSA 1VJGA 2VDJA 3GAAA 2N9UA 2WINI 3QX3A 5HKAA 3LV8A 2I2XB 4RIFA 2XUHA 4UUQA 4K9KA 4C08A 2VF7A 4KE9A 1I6MA 2BFBA 2FZWA 3W5UA 3TL2A 2E87A 2CL0X 2BUCA 3R7WA 3U49A 5LNK6 8MHTA 1R50A 3MRXA 2G4VA 2WNIA 4NCHA 3W77A 3FR7A 4NG5A 1FNBA 1BGVA 3QVVA 3U7HB 4E33A 1MEJA 3DBLA 4KO2S 5DGTA 3ZD8A 1X7YA 2YV4A 1LGYA 4TXJA 5CM8B 4JP1A 1U6KA 1U2RA 3ILYA 2CFRA 2FW7A 4I5IA 4PXYA 3SPXA 1LPAB 2KQUA 4CV3A 1TJYA 4K9SA 1YRLA 3QYJA 5DMXA 4E07A 4EJFA 2YYAA 2WAAA 1HFKA 1T6NA 4N4AA 4Q9AA 1YTUA 5FR1A 1J5XA 3EVNA 1YVEI 5HA5A 4QTTB 3QFHA 4ND6A 5F98A 1MO4A 1WW2A 1Z33A 3SU8A 1QANA 4GE3A 3IE2A 4LDNA 2UZIR 1ZH0A 2KS6A 4QNMA 3T95A 3UCXA 3ZR4B 3D5EA 5EJIA 1ST2A 1YJBA 1T3TA 2L42A 2R00C 2WF7A 2ZSDA 5JZOA 3AHGA 4Y6GB 5BWLA 1CUSA 2ZUVA 4MYHA 1A3CA 4H7FA 3WLAA 2X19A 2A0XA 4GM1A 2I4TA 4KR0A 3OEHD 5LP6C 4V0MA 3GOHA 5DBIA 3TJMA 3AR8A 1UAYA 4KHZA 4L50A 3UTDA 4PYJA 5K0GA 5DYGA 2Q3LA 4V2UA 1K9VF 2BGLA 1A76A 1AUQA 2VF2A 3G2OA 3GEIA 4FN5A 4K2AA 4MKXA 2ZULA 4IJVA 1G2OA 2XA2A 2XUAA 4MV8A 1KF0A 5DH9A 2R25B 1S2MA 1ZY2A 1L6IA 2QQEA 3ACBA 1EUDA 4MW2A 2F4VB 1NW5A 2P4EA 4IDPA 3TCNA 4HR7A 1UBKS 2QZJA 4M54A 4TTPA 4UQPA 3L6CA 3TLZA 5AM1A 3M4JA 4PQEA 3AERB 2IOYA 1QBKC 3I1FA 1N3BA 5K8JB 3WS7A 1B42A 4P4UA 3HMKA 5FUMA 1V25A 1K6IA 1E1CB 3TE7A 2ZANA 2I1QA 1KI1A 3D3WA 1QPGA 3H6GA 3UENA 4RYDA 2QM8A 3KB6A 5C3UA 2H18A 2FN8A 5AK3A 1AGXA 1F6DA 2FE1A 5AW9A 5EHGA 4ID3A 4LJRA 1EK2A 2VWHA 5JAHA 4LMRA 4X1YA 1NF3A 3DPSA 3NHYA 4EF6A 2R47A 3LPNA 1GRQA 1G2IA 4L0MA 3JQQA 1UBHS 4DLZA 5AKYA 5LZ5A 2GFHA 3R5HA 3I76A 3LYLA 3X1MA 1RBQA 2F7SA 3SKVA 3KSUA 3PGLA 1HLGA 2DC1A 2GZ2A 1MA0A 4KR6A 2IUYA 4FNAA 1N5LA 3UWOA 4DMKA 2I2AA 1HWYA 4X45A 4DADA 5ADHA 3HBJA 1T6YA 4BNVA 2HMTA 4HT3B 4YUAA 4EG3A 2BFPA 1U9YA 2NU9A 3EAFA 2CXXA 1JQDA 4N18A 4CFYA 4W5QA 3AF6A 4TMKA 1H4SA 2Z83A 3L6DA 3LHIA 1BKYA 1EG2A 1PV2A 1W1IA 2X5NA 1WSBA 2XEXA 2ZSUA 4U6SA 4V03A 4PX3A 4AJOA 1P4GA 1SIBE 4ZFNA 4ALKA 1AURA 2OHIA 2Y1XA 3N2NA 3MYRA 4XFJA 3G2JA 1D9XA 2QMZA 1JTFA 3RBAA 2VXOA 4Y2UA 2FWRA 2MR5A 5C8DA 2JFWA 2QLMA 2IXTA 3BB4A 3QTTA 4HGRA 3NYIA 4RS3A 3H8VA 5EAIA 3HCEA 1GSIA 3Q12A 3ZQUA 4EB3A 5DN6D 2NZJA 4DC9A 1H1TA 4C9BA 5JNVA 2ZTSA 3BJIC 3NM4A 4HNAB 2WD7A 3OJXA 1IHOA 1KS9A 3C3EA 4KGZA 3C6MA 4BRWA 1B26A 2CF6A 4M7PA 2JVIA 2XZLA 3F98A 5CK5A 3NBAA 2CB9A 4ML3A 5G3YA 4HWPA 3LUCA 2C0CA 1OFTA 2R48A 2WDZA 1WXEA 1ND6A 4I8XA 4LZPA 1JSZA 3AF2A 4BNZA 4DIUA 4OK5A 1CFJA 1JKJB 1YHYA 1O8CA 3QOFA 2XRMA 1Y9JA 3P32A 1T1JA 1EX6A 3NIBA 3Q2IA 2VEOA 5KOJA 2QTVB 5EXEA 5EKDA 2D2XA 1BVRA 4RZSA 3HDQA 4RVOA 7ABPA 2W6ID 1M1YA 3S99A 2OAGA 4IIVA 4A8JC 3OFSA 4HY3A 4TT8A 1MORA 2FR1A 1ZVQA 3A9UA 1KP3A 2GUWA 3ELDA 4GDFA 1N6IA 1MPXA 4CM1A 1BMQA 4WCDA 1ITZA 1I3NA 2PGOA 3AJEA 2XWQA 4TOIA 3VAZA 1A9XB 1BEZA 3HN6A 1QOQB 3PFFA 5CD1A 4PF1A 3UG6A 4BX2A 4BQOA 1SM4A 1VSTA 1TJNA 4F85A 1CVRA 2BKAA 2UUAB 3DZIA 4BU1A 5ITSA 3NAMA 1B0UA 4XTRA 5HR5A 4PFKA 3WNBA 3O83A 4D80A 1WUIS 1P4HA 2AXNA 3DV0B 4GZLA 4RHCA 2P35A 4EH1A 3P4XA 2J33A 1KORA 4YRNA 3A3KA 4OP2A 1JHRA 1QIHA 1C7EA 5TQ2A 1SVLA 3RUIA 3LTNC 2CGEA 3TZKA 1L5SA 4LFCB 3FKSA 4UBKA 4ZD6A 2FMXA 3VR4D 2QIPA 1KDZA 3KYIB 1GV1A 1N6OA 1NW8A 4F0JA 3C8ZA 5A0FA 3NKLA 3EC2A 5EG5A 7MHTA 1RI4A 1Z07A 1GL3A 4UHJA 4UOEA 4PQYA 1Q1BA 1Z4KA 5I6DA 2ZM6B 1WEKA 5EJ6A 4HG2A 1FL9A 1E5VA 1GZ7A 2JAWA 4L3OA 3H2IA 4EGAA 3LW8A 1Z0IA 3KDSE 3BKWA 1IG0A 3I8OA 1E2MA 3MW8A 5ECDA 1XMIA 2YOGA 4GI1A 3JVIA 4KPEC 2C29D 3IL2A 4PX2A 2HHHB 4G01B 1XG5A 3PUWA 3WSVA 2XBLA 3PPVA 1RYHA 3G5UA 4EVSA 1YT5A 1GGNA 3D4PA 3HN7A 4G5QA 4R7TA 4Y6RA 3VPSA 3RV3A 4ND8B 3E35A 2O2DA 4BO7A 4NYMR 4CKCA 4D1YA 4DLAA 3LFUA 3FCOA 1NDHA 1WNFA 3L1VA 2AS0A 2G80A 2ADOA 1WZEA 3JYQA 4DR4B 3BMCB 1Z88A 2GCOB 1N5DA 4MJ3A 3E58A 3C85A 2OVBA 2WE8A 3TW8A 4BRUA 1GPWB 5D6NA 3PLNA 2JJ1A 4F3CA 2DH6A 1YZGA 3PB3A 5DM70 4J07A 4D92A 3O31A 4P32A 3EAQA 8ABPA 3LQYA 5E3IA 4I6GA 4W9NC 4V1CA 1XRQA 5JQGB 4LF7B 4LYFA 1AJEA 2QHXA 1MAUA 1R6TA 3UZUA 4RVGA 1NVGA 1TGYA 2LIVA 3KTAB 4E15A 4M49A 4I9HA 1BFKA 1CQIA 4BWVA 3ZD7A 1P4JA 4JROA 3KM0A 1E1MA 1ZD8A 1T8PA 4KMRA 4WRRA 1E4VA 3SGLA 3V4VB 4BTVA 4LF6B 4RKEA 1RYBA 4OXKA 3G0CA 4D25A 1N57A 4X00A 2BFNA 3FWYA 2Y1OA 3UC5A 2ZWAA 5EXSA 2EQAA 2ON6A 2C0PA 1W5AA 3R0IA 4C07A 1KYWA 1CQWA 1SKYB 2X1VA 1S3FA 4QLAA 3FR8A 4F2WA 2O1EA 1TM3E 4LHEA 2GRAA 1AX9A 3IT2A 2CNDA 4ZKDA 1A77A 2FF7A 3VBCA 4MVJI 1E9CA 4EB0A 3AMVA 3A1CA 5A1TA 1CZLA 1TFUA 1JVNA 1Z62A 2F43B 3H0CA 1LU9A 5EXXA 4ZZ1A 2H1RA 2MSLA 2AC2A 3SFTA 1NVXQ 1B6RA 1ZD1A 5F1YA 3SNKA 4AZ0A 4J1QA 1YB7A 3U48A 4DLPA 1VCOA 3WQBA 3PFWO 1S7GA 2R85A 1L7RA 1ZAKA 1N36B 2CFOA 2ACWA 2P9JA 4QPJC 2IY9A 2NT3A 3RVSA 3K4QA 3QE4A 3ZU3A 5JAZA 2ID7A 1I5OA 2ONKA 2VKQA 3FFWA 4PRYA 4R3NA 2JAPA 4OA8A 4DCCA 4A0GA 1O1YA 3IQZA 2PWBA 3E03A 4P1ZA 1IHXA 4R1MA 3TTYA 4BNWA 5BSKA 3M6MD 4A8JA 4EFKA 4QLBA 1M2KA 4QD3A 1ZUHA 1GTJ1 2JAOA 2VDPB 3ZNNA 1SVSA 4FDUA 1ORHA 3ESZA 3C3JA 5L6MB 2PAAA 4RD1A 4Y30A 5FI0B 3SQDA 3EISA 5KWVA 3ADCA 4NZYA 3RRBA 3WGZA 4M1YA 2A84A 4JLPA 4D9MA 4BKPA 3H1PA 1G5IA 4LYJA 4CG3A 4MR7B 1RBYA 4Q4AB 4RESA 4BKQA 2FPGB 3M33A 4NG4A 3O2JA 1TIPA 1OLUB 2OO7A 3QF4B 5SZIA 5D7NA 3WO0A 1T4MA 1S2LA 4EEKA 4ETIA 1PLKA 4R3WA 2G36A 2PMWB 3ZUGA 1JW9B 2Q3BA 3PUIA 2B4QA 1NPDA 3I5AA 1ZSYA 2BSQA 4OCZA 3M7IA 4HEQA 5J4LA 2O07A 4J8PA 2JIRA 3GVPA 1ZJ5A 1UJNA 5FJIA 1XMSA 1ZEJA 2ZCVA 5DW0A 3ZJVA 4J6EA 2JI8A 1V5IA 3HVRA 1IBLB 2JLZA 4TPKA 2JZCA 3CLUD 3QSYA 1EI9A 3OFVA 1RVDA 1G1MA 4S0XA 5TQ0B 3ZVNA 3QW2A 4D2IA 2C2HA 3FWPA 3FGOA 3NVDA 1O0BA 4D4HA 2ZQYA 3SDBA 4Y2PA 2OLEA 1NYLA 2IWRA 5A4JA 1L7PA 1TAHA 1FFAA 3ST7A 1HH4A 1HSZA 2AUMA 3GDFA 3VSEA 1E79D 3FNFA 4O4LF 2NV2B 3SIWA 3ZVRA 4D99A 3S70A 2PFGA 4TV9A 4F9TA 3GJYA 1W88A 1Y4ZA 5WRFA 4KC0A 3GFTA 2NNWB 4FLEA 3K6KA 2GZAA 3C6XA 4YDRA 1X7XA 1U5CA 2R8OA 3D4OA 3LM8A 4YK7A 1LSSA 1E2FA 5K0TA 3KEOA 4RBNA 1IPHA 3I53A 3QUSA 3DV2A 1EQ2A 2PH7A 4GD3Q 3V1LA 4G1EB 3I6IA 3REQA 3QU7A 3X44A 3MQFA 1B8VA 4TM7A 1DJLA 1Y9EA 1CEYA 1G3QA 1BCRA 1T6XA 1OTYA 2PZ8A 4GW3A 5KKAA 3RYTC 1OF1A 2GAOA 4RFSB 3VRHA 2RC6A 3TBKA 1U7HA 3OCWA 4XSGA 4ZT2A 3WKBA 2CFTA 2DF8A 1NF9A 1OX4B 2HDOA 1U94A 2WHYA 4KVZA 4NAUA 1I4LD 1YCDA 2G7ZA 2I8LA 3GRCA 5HIMA 5EHZA 2ZUEA 4CEIB 5B30A 1CVIA 2A3RA 3RAFC 4UM8B 4DKJA 4J76A 2IY8A 4IIHA 4D6YA 3EIWA 1SCDA 4YAKA 2BKLA 3EOZA 3LAWA 2UXDB 1BHJA 1A27A 1G5PA 3OZIA 3EDRA 4K6OA 5K4GA 4YFYA 1QO7A 4X24A 4R2HA 1ODTC 5F7ZA 5H4GA 1DC8A 1CJSA 3HH8A 4NEQA 2UXCB 3AETB 3IDOA 3A37A 4RJKA 1E63A 3K6RA 4BC0A 2WU4A 4UU7A 3DE6X 4XKJA 4QZVA 1TJPB 5ENDA 1WA5A 3T41A 1MQSA 3N86A 2FXIA 3RTCA 3C3CA 2XECA 5BYBA 5JBQA 4W5HA 3TTSA 1L4YA 3ROPA 5HNKA 1YFJA 1NUPA 1YRQA 2FSFA 3EB9A 1JIVA 1D4ZA 5E9JA 1XXHB 3OEWA 4EYKA 3WJAA 3LOPA 1D09A 1DP4A 1UJ6A 1RQ2A 1X3SA 1ESNA 3UUEA 2CLIB 4BNDA 1ZJ6A 2Z3VA 3EVTA 4EJ6A 1ZXBA 3K9WA 4WA7A 1NOIA 4R81A 2R65A 3T5AA 1ZI6A 3H84A 4Y2YA 1YCFA 3I37X 1WPGA 3VR4H 5D5QA 5KPDA 3T9FA 2ZE5A 3SMVA 4TV9F 1L8LA 4RPGA 2GERA 1A72A 1E6KA 2I2CA 1W0KA 2VYFA 3KCNA 4P4GA 2XMBA 4P92A 4YQYA 5GADl 4GLFA 5FR2A 2X5JO 3GI1A 1AKYA 1XQVA 3EGVA 3DDSA 2A78A 3LKVA 4FGLA 4UHFA 3C6BA 1SHTX 3ZV6A 3H9EO 4GOKA 3PFGA 2G08A 4AG5A 1FFDA 4R83A 2HSJA 3RK1A 3O0DA 4RZQA 5AVYA 5JSZA 4UHKA 1VSVA 3WL5A 2R1TB 2AR7A 1FYVA 3TD2A 1YDWA 1AHIA 2EGUA 3D0QA 2H17A 3AFIA 3R7DA 4CL3A 3RVQA 1AQJA 5A3SA 4JC4A 3AB8A 4IXDA 4TSKA 2QMHA 3H7AA 2PD4A 2I2BA 5KTRA 4DA7A 4N12A 2NPFA 1F8UA 2OVFA 1PQPA 3OC6A 3UEOA 1N2GA 3ELUA 5EWLB 4KIWA 4BVAA 1QZZA 1YE3A 2X5OA 4GZ6A 4Y3UA 2XNDA 1WHSA 2NGRA 4DYVA 4P9NA 4AZVA 1GGHA 4YALA 5HFNA 3G2NA 3WL8A 3IPLA 3M4ZA 2YNMA 3CNNA 1JA0A 1HEYA 1FPQA 1FS4A 1Z5WA 1TMYA 1WMBA 3N2YA 4ER5A 1SCIA 2F1JA 4ZAGA 4DT1A 3HYLA 1IOVA 3LQFA 1FQKA 4B2LA 4C6TA 1MJNA 1Q0QA 1QZTA 4LA4A 4AO6A 3INNA 4FOOA 1HKUA 1Z4PX 4F97A 2HX1A 4AJ9A 3I30X 4I50A 2VPIA 5A5VA 4Z4QA 3R2JA 4LE2A 2PEZA 4FW9A 4ETWA 2GK6A 5CYGA 5HCUA 3ZWNA 1C7RA 1RYYA 1O54A 3HEBA 3FGPA 3L8HA 3PNSA 1SA0B 4L2IA 1VCMA 3L7IA 2W11A 2C84A 1HDEA 2LP4Y 2CV0A 2P2LA 3BGIA 3I9JA 3FVQA 4LY3A 3UWKA 3WNDA 4YLEA 1GPYA 3OH8A 1EXVA 1R8SA 3MSCA 4JUBA 1HX7A 1IOLA 2AE1A 3EFOA 4JH0A 3RF6A 5M7EA 1JR3E 4JSRA 3KYDA 3CSDA 3OZAA 4Z9FA 3LBFA 3A06A 3M8KA 2W0SA 1RYNA 1WMEA 4TT3A 3AR3A 4O4HA 2P4QA 2V7XA 4ZDWA 3P9SA 4YVFA 2GVDC 3K35A 4CF3A 4XM2A 5T4BA 1V0JA 4UTOA 1XJ5A 3TCXB 4LXHA 3GEPA 1J2TA 2UKDA 3LZCA 2FP4A 1A69A 2VQ6A 2ZRDA 4RTKA 1H4QA 1ZD3A 3F7OA 3QMVA 1NHGA 3GLIE 1XTRA 2IY7A 3KTAA 1R6DA 1SFRA 3SBOA 3EZGA 1R0BA 2ZWMA 3KR9A 1A98A 1WB5A 4EZEA 2OA0A 3IUMA 5GP1A 3U7IA 5C8VA 5E4YA 3CZCA 1FEZA 3L43A 4TQ9A 4XYMA 7REQB 3FMGA 1JILA 1AD2A 1OROA 3ON5A 4HATA 3SYRA 3TZEA 4EYSA 3AVOA 5A6SA 2CCJA 3R3SA 4FFPA 5EINA 1TLLA 3HKBB 4KDCA 4JCCA 4WCVA 4IAOA 1WMDA 1E5TA 4INOA 4OQQA 4TQUS 3UF0A 1GGKA 3AJ8A 3KLBA 3OTWA 4G4SO 4OBXA 2A33A 3Q9LA 1Y5NA 2PLNA 2QN1A 5FJJA 5LA6A 3LPCA 1CUWA 1PK7A 3JYNA 1PHRA 3VKFA 2PRIA 4YONB 1IQRA 1SUSA 3EPJA 4LBWA 3HJGA 1GRRA 1S2IA 3RRNA 4JEUA 4D98A 4DAEA 3P27A 4WJKB 2YV2A 1HBJA 4L08A 3I61A 2WG2A 1PHPA 1U0LA 2IE8A 3KYCA 3H0KA 1A8HA 1JB9A 1D03A 1MJ5A 1A2BA 1J70A 1GPAA 1WS6A 1XEXB 2DFKB 4IO1A 4MZDA 4WLFA 3AKCA 5H70A 1VECA 3RU2A 4C6SA 4AWXA 2ZLBA 3S8EA 3L06A 4I3HA 3GLQA 4FKZA 1NRXA 1VI5A 4GKKB 4ITUA 1E0JA 2DECA 1EAYA 2D0IA 5A1JA 3DAGA 2GB4A 2XCIA 1N0HA 4UNSA 2QRZA 3S2ZA 1T3LA 2OM6A 3S0JA 1II0A 3WLQA 4M53A 3MCWA 4CF5A 3ESYA 2DSNA 3AIMA 4IKOA 3QLVA 5LUAA 5IKOA 4YT4A 1JWBB 4BMSA 1DQSA 1GA4A 5ARBA 2O2ZA 2VTVA 3SJAA 5KMGB 1EDOA 3HYNA 1J8YF 3BTOA 4YJ2A 3I01M 4HV4A 3EZ6A 2GHTA 4KBYA 3W5IA 1TW2A 2C4NA 2G67A 4X93A 1V5GA 2VDOB 3HCOA 4IOLA 3TXXA 1JDSA 1ZITA 3BCUA 1X9GA 2IYFA 2PMKA 4FONA 3CF6R 5FKJA 1JT9A 4Q12A 4RF5A 3WG9A 3CW9A 3FDJA 2P1DA 1FP6A 3DF9A 1R4AA 3O91A 3VPHA 3TUJC 2WAOA 1H1DA 1VZ3A 2VZEA 2H48A 3Q3EA 4QUJA 4M38A 1QYVA 3CHYA 1E2KA 3AI2A 2Z6AA 1QE3A 4NFLA 3N2IA 4BU0A 2XE8A 3QEKA 3LWBA 5LC1A 4TM8A 1T2FA 1KSGA 3ZGYA 4WXMA 2RGXA 4BTLA 3BWXA 4Q00A 2ORWA 2GNAA 3OUZA 1LUAA 4OK3A 1NRIA 5BVHA 4MVJF 2WDPA 4OOEA 1FVFA 5EUMA 1N8SA 3A7DA 1AUXA 1J25A 3HABA 5EESA 2QUBA 1JQAA 3JS5A 5DYIA 5BSEA 2YC4C 5FUWA 2VCYA 1G55A 4OQMA 5GZ1A 2DBQA 5H9VA 1JHYA 4WNIA 2EL7A 3TXAA 3PD0A 4AD8A 4RSRA 2IDJA 3D6FA 2UZ1B 5DXFA 4ZGGA 4XOIA 4KV7A 2HSWA 3VC1A 5K8UA 4TYYA 5DHUA 3DWIA 1Q0HA 4R4JA 3MWDA 1M72A 3KHUA 3NHUA 4OJQA 5TVGA 5DWDA 3CURA 2ISCA 1WSWA 5DTEA 2LCIA 2I1WA 2NZVG 3JD0A 3E9NA 2RGEA 1CWUA 1DIAA 4O5OA 3VR6A 1AH2A 4ZTUB 2BR3A 3OICA 3HZOA 3RK4A 4CE6A 2VBFA 1QCYA 4YIHA 4PAOA 2ZK7A 3SIPA 4GMGA 5EGSA 1H9AA 2HIGA 2OSBA 2QUIA 3HCBA 3I9OA 4HUTA 4B5LA 4LCJA 4Q6BA 3PEEA 2P9HA 1D6SA 1OH6A 3PGA1 4BMCA 1PEYA 1SG0A 3OEHA 2VCHA 4ZCPA 1OFHA 5B2ZA 4MB2A 1U7UA 1QH8A 4L9AA 1XTBA 3PEYA 1IZ9A 3F1LA 3QP9A 1SD2A 4NDNE 1M66A 1QC5B 2GPWA 2O48X 3E81A 3PPXA 2AJBA 1HI9A 2R96A 4FZJA 4Y2XA 5AW6A 4I0WB 3GFQA 1J0BA 3MCUA 2QY6A 5LMZA 2PQ6A 2OCLA 4UNNA 4ZYUA 4L4RA 3UMCA 3E27A 1SOUA 4UPVA 2ZROA 3ROEA 5KDLA 3L6BA 3E48A 1E62A 5THXA 5AW5A 3ZDAA 3UVEA 2VLIA 4DEVA 1X80B 2B5VA 1ZJYA 3ADKA 1CE8A 1OGIA 2BGMA 3PWTA 2ZSIA 3IOEA 4LJ7A 1CP3A 4CEHA 1OVMA 4RVHA 1YNSA 1DXQA 1U02A 3H4VA 4UMFA 2J5KA 3A6LA 2GI4A 3LY5A 3PA6A 2QV0A 3A8TA 2PZEA 5IK2A 1H2AS 1YOVA 4DVJA 2CC2A 3UCFA 1AQUA 2HF2A 2P78A 1LVUA 4ZT3A 4BFUA 3BUSA 4QPNA 5ICMA 4NAHA 4J4TA 4PSCA 2OO5A 4IH9A 1BW9B 5K20A 4B3RB 4E1VA 1RMYA 3H8JA 5JSFA 1PGNA 3MWYW 5GJWC 2B6NA 3GVXA 5CTAA 2BKUA 4LV6A 5KAMA 3ZOKA 4DQKA 3U5TA 5BPHA 2YCBA 4BO1A 3G0IA 4KXMA 1V1RA 2ZP1A 3O1HB 5B4TA 4QRIA 1NQXA 3RB8A 3GYBA 4DLVA 1C3OB 3PIRA 2WWRA 2EHDA 1MV8A 1HTTA 1KI7A 3K94A 1WDKA 5D6OA 5KTOA 2A1UB 2WUEA 1EUCA 3A11A 4KBFA 2Q1YA 4L7QA 4W5OA 1GZ4A 5DISB 3TZLA 4XOUA 3UMMA 1VM6A 1BROA 1DEOA 2AHRA 2CK3A 4ZEWA 3ROGA 1AO0A 4JJ4A 4IEIA 5J1TB 1X0VA 3WGKA 2CXHA 3U81A 3H2BA 4YAOA 4DCTA 4NCNA 1YB1A 5ERXA 4B44A 1QXSA 3H9BA 4JCOA 3PNOA 1DFIA 1L5LA 4JWTA 3S4YA 4YHHB 1RKXA 3ABSB 1FLNA 1RAEA 4GOOD 3VYRB 1E9VA 3AXTA 3R75A 1GG2A 3B3FA 4LQLA 1HTWA 5G0WA 2RCYA 5KKCA 1SC3A 1OBOA 1Y3HA 2M6RA 3LFHA 4GXQA 1J0XO 4AZSA 1LPBB 4KYVA 3RBZA 4NZ9A 5H4HA 1J39A 1H4TA 4O4IF 3OX1A 1YZ3A 3N59A 1QCZA 1NX6A 3QA9A 2VQEB 1KOFA 2O23A 4GICA 3D5TA 2G5PA 2W2LA 3PJFA 1RPZA 4FVTA 4UDYX 2E55A 1FE8A 3TEJA 1SK9A 3VPGA 3MFYA 5H9WA 2UYHA 4BGDA 2C31A 1IBMB 1CJKC 4C6TB 1U9ZA 2GYVA 2H9YA 1TQ4A 1P1CA 2ZVDA 1SU7A 3A6JA 1YO6A 3GJRA 4YJKA 4URFA 1Q0LA 4B3JA 3EDMA 2MDTA 1ML4A 2O50A 4LYAA 3WKEA 3BICA 1W2WB 4JVNA 3DL7A 3JRNA 1SUDA 3VKVA 4E31A 4IR7A 1XRLA 2EJWA 1ZAYA 2RH8A 4YJ3A 1B15A 4Z1MA 4US1R 4LNUB 3CNOA 3DDZX 2I91A 2K87A 4EY7A 4EA9A 4OVKA 4RTQA 4F93B 2I0FA 3CZPA 1VJCA 1UBRS 3OZSA 3L6RA 2YWBA 1UKCA 3OOHA 4V2IA 4WZBB 5AW1A 3ZDQA 1RJDA 4ZV9A 3C1OA 1HEUA 3MXTA 1NLZA 1C1XB 1E2EA 1E0DA 3LKDA 4Q4HA 4Z0TA 2Y1GA 1YQTA 2C9CA 1VPTA 4WNAB 1E7WA 3G9UA 2AOWA 2Q2NA 3BORA 3WJ2A 5B2EA 4PLTA 2YWRA 3OIYA 4L57A 3F9IA 4M6WB 3SEQA 4BO4A 1Q84A 4KWHA 4TLMB 4CNBA 4EQ6B 1KC3A 2NUTA 3U62A 4DLRA 2CDRA 5EVJA 5E6RA 3UXEA 2IHJA 2AYZA 2VF4X 1S9HA 1IY8A 2J3DA 1UT5A 1VSQA 3GR6A 5GY7A 3KSRA 4E5UA 4WLEA 1P80A 3FWZA 1GNQA 3LBNA 4FMDF 2H08A 1PJAA 3EGDB 4K7JA 4MVJP 1KVRA 4RD6A 3E7XA 3VPBA 4OQ4A 4EK9A 3JQ9A 2Z8XA 2E4ZA 1V48A 2PH1A 4L3VA 2VL7A 4DWVA 5HS6A 3I62A 3GLIA 4ARZA 1T8UA 2B99A 4X94A 4Q4DA 1CR4A 5CHEA 4RV9A 3M4NA 1YA4A 3AY7A 4ITVA 1P77A 4IDAA 4BDSA 2ZYRA 1TEHA 4GLLA 1EHCA 2XD9A 1NLYA 4FFOA 1KEZA 4HLNA 3ZDXB 5IT0A 1NP7A 1W0JD 1ESZA 4L5JA 4NCKA 4OH7A 4QXMA 4COOA 4LXXA 5IJ0A 2JCBA 1VE5A 4UTPA 2YW9A 4NJEB 3KLMX 4GVXA 4PIPA 3OO1A 3TLEA 4YCDA 3CRW1 3ZHUA 4EGFA 1AC5A 2PWPA 2ZDHA 1P7PA 1PZMA 2ALJA 2BISA 2FDRA 1Z7BA 3LQ2A 3PGJA 5EJFA 5GGYA 3TRIA 2FW9A 4X3CA 3ICWA 1F6WA 1R12A 1NMYA 2GK3A 4IV8A 5AJZA 5ALWA 1IY0A 2RJNA 3L8CA 3NIGB 5F33A 3BMXA 2WOJA 3RROA 1M1ZA 4B74A 4B81A 1B6GA 3E05A 3O2SB 1U8FO 3DFMA 3EXIB 1JYEA 4YJGA 5CW1A 4TLEA 4JT8A 2EBWA 2G5TA 3E3AA 1SCUA 1ZRMA 1UKVY 3BXGA 4I99A 4IDDA 4MR8A 4ZWNA 4UNRA 4LDAA 3C0KA 2PUAA 1M6EX 5J5AA 1VG0B 1R5OA 4WJZA 3T1HB 4XWKA 2RH9B 2PYZA 2HSEA 1P1BA 3IUNA 2CHEA 2OCBA 4H0CA 1XWFA 1MB0A 1VYUA 2OBNA 5I8ZA 2WSLA 1ETUA 4ZVNA 4DIMA 1IOZA 1OQAA 2R1UA 3IQDB 4NBNA 5HUQA 3AUSA 2HF7A 5HTOA 3DWEX 1GZDA 2ONJA 1H3NA 2JLCA 1NN3A 2GGSA 3CY6A 1QKIA 3S1AA 4U7HA 1IBCA 1A9SA 3NNSA 4AUEA 3KSAC 1T25A 4UXJA 4R8RA 2JEOA 3NWJA 5JAUA 4JXXA 5ADUS 5EGNA 2FU5C 3JQFC 4NPAA 2MCFA 1E58A 1CZKA 4RHFA 3RYFB 2BTEA 1N2SA 5KEIA 4HJXA 2PXHA 2PRKA 1PBTA 4BB0A 1RZRA 2ZYGA 1LTHR 4HPJB 1K63A 3M34A 3EG5A 2G9NA 1IWOA 2QJRA 2MMGA 2ZWOA 5DLYA 3WFIA 2EX1A 4NE2A 2RGUA 3VU9B 1XNQB 2CFCA 1ID8A 3ZTYA 4ZOLB 2DLNA 2GAFA 3BWEA 3A31A 3PLRA 1DWUA 1Z06A 3ENVA 1Q19A 4FYWA 4AJIA 3L92A 3VKWA 1NRWA 4ZQIA 3NTRA 3RIMA 3RH0A 3TO5A 3ZY3A 4BFLA 5KNLA 2HR1A 2P4HX 4ILKA 4EA6A 2E85A 1LWNA 3CZ5A 1EGAA 3FYDA 2QBYA 3KAQA 3KIPA 3OOEA 4GC5A 4H4CA 1YL5A 4MJ7A 4MZXA 1Q1NA 3CUEF 1H22A 3M6WA 3AFNA 1Q20A 4KMMA 4PG5A 3NBYC 4TS9A 1I1NA 4TTSA 3WB2A 3ZV4A 4P0TA 6Q21A 2ZXUA 3THWB 4KEAA 2GN4A 2D1RA 2HA6A 4BO5A 1AK1A 4EPVA 2BZ0A 2OSVA 4CM5A 1DKQA 1RMTA 1ZN2A 2XZPA 3QG1A 1KWKA 2QE6A 2ZUUA 2FPIA 3GLFE 3OIWA 5ICEA 1G0NA 4GAEA 4GIBA 1XNRB 4MUBA 2OHJA 1S4QA 2O9JA 1KYTA 3EIHA 4I50F 2GQ0A 4IKEA 4PLCA 1LNSA 1EA5A 1MBZA 1B00A 2WUFA 3D1JA 3DLCA 3L0BA 4RKRA 4LXGA 4K40A 4Z9AA 3ZWPA 1EVKA 2JASA 2FX2A 4R2WA 3TAHA 2AT1A 2BHTA 1C0PA 3IMCA 1X8LA 4KRYA 5F1PA 4LOHA 1CG6A 2DWPA 3DT6A 3KJHA 4B2YA 4CLOB 4ZYTA 3COJA 2BTQA 3ESCA 5DO9A 1ECCA 1XUOA 1K1EA 5JY6A 2P9GA 1H0HA 2UDPA 4M1OA 2WU8A 1XTJA 3R6TA 4MRAA 1YRHA 3NEJA 3SE0A 5YASA 3U4HA 3ZDBA 3HKEB 1DOAA 2B7CA 3C3PA 3CKKA 2EZTA 3FPAA 3EYAA 1KVUA 1VBFA 1KOGA 4UHHA 1C80A 3NBMA 3QVUA 2AKEA 1N3YA 1WZCA 3BH6A 2HJWA 3ANXA 3K70D 5DBEX 1VL2A 3G7NA 4R2IA 1L7DA 3AIOA 1DKNA 3R5FA 3DLTA 5EFZA 4MB0A 4YP1A 5B1IA 3TAUA 4ARSA 4DM7A 2YZ7A 2Q9AA 2QMYA 4B32A 3NTOA 4YQFA 2VC2B 4HH0A 3V32A 3N70A 1UADA 2A0WA 2BP7B 2GEJA 4EJSB 1U28C 4OGFA 1MZVA 1XVTA 3L8ZA 2GZRA 4RORA 3TZCA 3FWKA 1Z29A 3HU2A 4JEHA 4PHGA 4OEHA 3DDOA 3FPEA 4Y2QA 3FUVA 3W6NA 1SELA 5L3ZA 4KP7A 1W6RA 4KB5A 4B4VA 1AKEA 1KH3A 3VOSA 5AVXA 5F9FA 4FHEA 3TDKA 4QRHA 1VKJA 3SZGA 4BJ5A 2YRWA 3RODA 2GDJA 3UMSA 1HE1C 1SXJE 3WMXA 2M1ZA 2QJWA 2XHEA 3RBVA 3VTAA 3BXHA 4IGAA 3RRXA 4J9VA 4I9UA 5EC8A 3GPLA 3TNJA 2M6LA 4G5XA 3RANA 2P2ZA 1T2NA 1BX0A 2B92A 3AESA 1ZRSA 4I5EA 1DWPA 1J33A 5E6UB 2O2XA 4NL4H 3DAYA 4G2NA 1UFRA 5KYYA 1D4AA 3O4VA 4EYQA 1MABA 3FNEA 2YS7A 1JT2A 4N8SA 1GITA 4QXOA 4CM4A 3WGLA 1K66A 1G5HA 1X1TA 2FB9A 5JYDA 2HT6A 1AUVA 3IQFA 4EF4A 3T0FA 5FPYA 3RKRA 4AN4A 4BWFB 3Q3CA 3L4EA 1SIUA 1BEEA 2DQSA 5IDYA 4L02A 4ZIRA 3L8EA 3P9RA 3WLSA 1GR1A 3O8RA 2HHJA 1IB6A 4CQLB 1R6BX 5HRUA 2X0KA 3QI2A 3F2VA 5FTJA 3HYRA 3H5AA 1E2HA 1FLDA 2IIQA 1RLMA 3C1TA 4CM7A 3LE8A 3O8NA 1DPFA 4A6PA 1DJPA 2IUTA 2PKQP 3FF1A 3E7PA 5D2CA 5H83A 3ANTA 4QWWA 3R5SA 3DVRX 1U2QA 1HLPA 2NSJA 3QM1A 1I3OA 3KSBC 1J8MF 3QPWA 1SQGA 2IJGX 4C7MA 3N8HA 5HEKA 3WLPA 4K46A 3N0WA 1QOPB 1K5DA 1D07A 1UBNA 4BIMA 3B38A 2B1QA 4JLBA 3RTEA 5I7UA 5IN4A 4TRRA 5IVIA 4YUYA 4Q03A 1DKOA 4E6PA 3I04A 2VAVA 3GDWA 3F8SA 5TQ2B 2H31A 4JJ8A 1T0UA 3A6EA 4BO6A 4DNQA 1K8YB 4CEJB 1DINA 1V47A 3SEZA 1THGA 4LK2A 2RC5A 1T2VA 3SYKA 4EYGA 2BF4A 2JFZA 3T7KA 5LZ9A 2QA5A 3UGKA 1XZMA 4G0PA 2Y1KA 1CIPA 4QGFA 4V0KA 1T8TA 2VFAA 1TEXA 2WKPA 4B7XA 4LYDA 4OI4A 3CKLA 4K2HA 3FBTA 2AZ4A 2V96A 3MOSA 4AT1A 5HJ2A 4PWYA 4LDRA 3OLXA 3V8RA 1NAHA 4PCAA 2Q4RA 3JD3A 3STTA 1TTTA 2X5KO 3ZKWB 3OOJA 3VO9A 4BBJA 2C5LA 1V6SA 1RQLA 2YIJA 5F7OA 4CU5A 1L1QA 3N8NA 6REQA 2CVOA 8ATCA 1IEXA 4AJPA 1BMTA 1MOQA 3N6XA 1TQ8A 5A7HA 1RWWA 1BMFD 1KO1A 2QD4A 3RWMB 1U8ZA 2NUPA 2W4QA 4P7FA 4RD2A 3VR6H 2HMUA 3ONEA 2GM5A 2AN9A 3ZZMA 4E1BA 2CW5A 4A82A 1Q7BA 2XSZD 4DMGA 3K9FC 1Y8ZA 4ZVPA 2N75A 3BM5A 2ZI3A 2XKJE 4RANA 4WOKA 1XCPA 4PGMA 1L1FA 2FTKE 5JCPA 3C3BA 3QVGB 2A5DA 2IODA 3SY8A 4EWLA 5AKJA 1OFVA 1U2SA 1NFFA 1VJTA 3Q6NA 4QFMA 2HRQA 3RU7A 1VJ5A 4EJSA 1OX4A 3GA0A 1R8QA 5AOBA 5KJEA 5K3EA 2BT4A 3EA4A 5THKA 4ZZIA 3LWNA 5K03A 3GJTA 5BXYA 4E88A 1ZMXA 4IDQA 2BMWA 1NC1A 2XVXA 2FE4A 2W00A 2YJTD 4HUJA 2EKZA 2QVCA 3V42A 4RQAA 4MICA 1P8JA 3HPQA 3TOCA 3ZHCA 2IVFA 3R76A 3LGSA 1ICEA 3V8QA 4YY3B 2NOAA 3AIKA 4KVGA 2RE8A 2HADA 1U3VA 1G8JA 2P1RA 4NOLA 3VYTB 3U1VA 1UMKA 1FB5A 1WPXA 3CEHA 4OM8A 4W1QA 2UUPA 4RTMA 3LWDA 4N82A 5AD1A 1JFFA 1VGVA 2I7CA 4HNHA 4WKPA 3EJWA 1YBHA 1JA9A 1PWHA 1X7GA 3DL4A 3FYUB 4R1PA 3P0HA 5KNDD 2O59A 2ZJAA 2M32A 4KXQA 2IYUA 1DXYA 4JJFA 1VFPA 3ZZNA 4NSNA 3U26A 1U9IA 2CJWB 3COVA 1KQPA 2BOVA 4JLVA 1JQEA 3X1JA 3ECAA 2HMYB 1UPCA 3L4SO 1YRAA 5DHPA 5DGIA 2PS3A 1U0SY 4RA6B 3WGMA 3H9GA 3M1AA 1EUCB 1V8FA 2FR8A 1Q91A 2QTWB 4FGKA 3T06B 2HYIC 1QB7A 2G77B 2JJ1D 4ZZ2A 4RKQA 1G5FA 4KCGA 2PGXA 4EW3A 1RSZA 2XVMA 4RO0A 5JD5A 1MAHA 1SUCA 2BGKA 3X2FA 1KAQA 3KWLA 4YRAA 5CFRA 3EQZA 2EFEB 4K3UA 2RIPA 2WTNA 1EJ6A 4KXNA 3Q87B 5CJ2A 3WWEA 5CLLA 4H7JA 5I9BA 5JNRA 4WZAB 3I39X 3CS3A 3D0OA 1SUBA 4ARIA 3N2KB 4NZOA 5KKNB 2W2OA 3J7TA 3FLAA 4JGGA 3BGVA 3HNRA 2QRQA 2JGAA 3VUFA 1HDZA 5EQJB 1W93A 2UV8A 3K0AA 3P0FA 5TGTA 3L82B 4FT2A 1AKMA 5DZSA 3AR6A 1KDPA 2G5GX 2WILA 3WMFA 5BRJA 4GOND 3C3YA 4O63O 3S8YA 2QVBA 2ZVPX 1Q7RA 3MWJA 1P4SA 3WRXA 5A2GA 1NXSA 1E5DA 4R0VA 3ODPA 4O2AA 3SOZA 4QQRA 4QTZA 4B76A 3EPLA 1RLUA 3EGEA 3NLLA 2HRCA 4IBOA 5CFMA 3TECE 4C7VA 2TMKA 1EK1A 1M34A 5FV4A 2VYNA 4IF4A 4L1KA 2NU7B 2XB6A 3N05A 5EYPB 4QU5A 1UK8A 4X5OA 3AEKA 4YC7A 3KU1A 3QFSA 1TL7C 4OQDA 3TQQA 2C5BA 1EEXB 5CT4A 1YIOA 2ZT7A 3V80A 1XD9A 4I55A 5AVRA 1XMQB 2ZU6A 2PKXA 4HYEA 4JS0A 4QDZA 5AJUA 1ZGGA 2VZ8A 1FF9A 1MIHA 3A1DA 1UMBB 3ORRA 4EATA 4G9EA 4EG5A 3DJFA 3CLTC 5JHHB 2VXBA 5IJAA 2IITA 3Q88A 4CCYA 1JEYA 3D2LA 3DLAA 4IVPA 3IO5A 2PSJA 4B4DA 2JGIA 1XXHE 1I9GA 3BXEA 3T9DA 1II8A 4CMHA 1CD5A 1E6LA 5KSYA 4WHMA 4LQCA 4Q9NA 1RAGA 2WWHA 2D6FA 1PKEA 1WMFA 1NVMB 1Y5LA 2VHUA 4F91B 1W94A 2BMDA 3EQ6A 4MGIR 1E96A 3DOFA 1KEEB 2AZMA 4X8OA 5AVOA 2CNWA 1VA4A 5CGZA 1EMDA 3VQTA 4RK4A 2JJMA 1OZAA 1K89A 1WV0A 3RS8A 1KY5A 2FRVA 5FI5A 4ZALA 4ROSA 4Y2SA 1XCJA 3FSJX 4I6JA 1J9EA 3E3MA 4MPDA 3K1YA 4YASA 2F59A 5C8YA 3EH2A 3G8DA 3SBEA 2Q8QA 3VNSA 2YBDA 3FROA 5EZSA 4O08A 1DV1A 1OW3B 3O8DA 3NT4A 3OCYA 2AOVA 4NYIR 2FVXA 3WK9A 5F1KA 2XVYA 3H5WA 2IUSA 4B3CA 1BWRA 2B8JA 3AUYA 1KAOA 1KJJA 2CLFB 4XQCA 1PDVA 1UM8A 3GHHA 5T4FA 5C8YF 2V7QD 4EA7A 1JXAA 1VL1A 3R1IA 1P6UA 1RLTA 1ZUIA 4MO2A 1RJFA 1QZ3A 3FMPB 5KDDA 1H1LA 1VG8A 4MYTA 4N5MA 1T2UA 4FSHA 3JQ7A 5TF0A 3T61A 4LV8B 1QGDA 2NLOA 3ZZ0A 4A6EA 4L9SA 3FDZB 4GU5A 4KNVA 4CDNA 2QLTA 3IPRA 3U4IA 1RP7A 2OC4A 1JIJA 3OJ0A 3IEVA 2ECFA 2PWAA 3A4VA 4PGHA 5C4GB 1HDYA 1STOA 4X91A 4F5ZA 4V1CB 3GPBA 1PVVA 4L85A 1TADA 1K5GA 3PX7A 1RIFA 4M8KA 1ZXLA 4MYRA 1SBQA 1RCFA 1N0VC 4OQNA 4NENB 1X8XA 3OTGA 3QWBA 1XRRA 4FMCF 1JUDA 1PR1A 1N1EA 1R15A 5F1OA 2ZVQX 1RU3A 2JCSA 2BFDB 3U17A 5JEEA 2V7BA 4JA2A 5KUTA 3SSAA 3VZQA 3M0EA 3IQIX 4AURA 1JAXA 4HX2A 3OQOA 2ZXFA 3QIAA 1K2WA 2O05A 5I4BA 3FGNA 3K70C 3OUUA 5AI0A 4H1TA 3KUXA 5CCEA 1DIRA 3F0TA 3T3HA 3L1KA 4XD7D 1QHEA 1P2TA 5KPJA 3GARA 4OHXA 1EXMA 1CK4A 1NMZA 2O7NA 2JZOA 3LQKA 2GTIA 5EUQB 1M73E 1VI6A 2XNJA 4M0DA 4D0LB 1SEPA 3U09A 4HN4B 4R9VA 2BI7A 4N76A 3SLRA 5KX5F 3AUFA 1ULZA 1VHQA 2GYWA 3DT8A 2Y0BA 1KTIA 1LBSA 1O6GA 3BVPA 5SY6A 4G84A 4C5CA 1G38A 5JDIC 3EGOA 1CKEA 3JR7A 3MB8A 3GFSA 5F35A 3WC4A 1WDMA 3IAEA 2PYDA 2CVQA 2JANA 4F7DA 2ZYUX 4E5VA 4ZARA 1Z26A 3AY6A 3WZLA 3VNQA 4CM8A 1W34A 3WK6A 3R44A 5DM60 4YHBA 1TM4E 5ITWA 3KZ1E 1T36B 5KS2A 3BIOA 4ZVUA 1AE1A 3PT9A 4EHFA 4I55B 1IIRA 1T5TA 3QLUC 4I8IA 1FSGA 2JZNA 3DS8A 5F5LA 3SZRA 1NI5A 3KDAA 4BLOA 4CHGA 4DLBA 2ZSJA 5HMLA 1CZUA 5KCZA 2RHGB 1WHTA 4UFNA 5BNFA 1L4EA 5TXGA 1L5QA 2JIDA 4WFIA 2VPXA 3NHRA 3L7LA 1ZM3A 1QP8A 2GS9A 2H1WA 1L3IA 3LA6A 4LZOA 3KK0A 3ZWOA 5I7VA 1HZZC 2FSPA 2GMWA 4M9QA 1G8HA 1I1QB 2H0RA 3KXIA 4PYLA 2VPYA 4RGBA 1ZD4A 3IPCA 4RXUA 5T41A 4WBNF 3BJRA 3CVWA 5DYYA 2JHFA 4O2AB 3Q4GA 3G68A 4DL9A 4RA9A 3OX3A 2QGFA 1U0BB 1TKCA 2ZJ7A 2EJCA 4PQRA 4AXBA 1AUPA 2RBGA 5COQA 1NJSA 3GB9A 3KTOA 2PX6A 3ITEA 3ORYA 3TJZA 3VGJA 2QZSA 3QUAA 1PUXA 4QHTA 5FBWB 1QNLA 4YDSA 4RF4A 3N5KA 2EP5A 4IDNA 1L5ZA 4C04A 4DRXA 3OTHA 2P4SA 1EXWA 3U1BA 2JA2A 3QPDA 1L3CA 1OSNA 4QYXA 2EFCB 1XMJA 4FXOA 2BIFA 5SZJA 1BD3A 2ZT6A 3DGEC 4D4GA 3K1AB 3VZSA 1W46A 2CMKA 4KSCA 4RXMA 4GWLA 1QORA 5EWMA 3KQHA 2VHWA 2WPNA 4PCLA 2P9EA 4N49A 4JU8A 4J2TA 3VUEA 4QM7A 5EXDA 2HK9A 2XLBA 2J46A 2X4GA 1U5BB 4P81A 1E3JA 4ZI3A 3RABA 3G5TA 4AYWA 2P8JA 2W2KA 5C52B 2AC4A 2OENG 5BN5B 1U0NA 5JNWA 1F4PA 2I65A 4LJ5A 3D3WB 3M1IA 4EDHA 3T5MA 1G8KA 3D6TB 3P94A 2I87A 3U4CA 1FX0B 3COPA 4W8HA 2VDQB 4RY9A 1XA3A 3HA7A 3JQRA 4MEAA 2DTXA 1GNRA 2PK3A 3MWEB 4RNCA 3AJDA 4TMWA 4WY8A 5EZYB 5KVSA 1DKPA 2HDHA 3Q8KA 5B2FA 1E59A 1SRRA 1HE4A 1RZVA 5LYJA 2ZPAA 4RTOA 1BHQ1 5T8KC 3AKZA 4ZT4A 3RYCA 1RHQA 1I0LA 1KVTA 2GTPA 3UAGA 1U3DA 4TRNA 1I4OA 5BOSA 1XFAA 4KO1S 1RS0A 3M3PA 3CJQA 4F5YA 3NDIA 5TS2A 3C8HA 3NALA 4DJDC 1FJXA 2ZZKA 4LCEA 3EY4A 1PYOA 3H83A 2ZT8A 1QIMA 4QBFA 4W8GA 3TTUA 2PZBA 3MPUA 5JD4A 2VATA 1SN7A 3CX4A 3KTFA 3MMXA 3PIIA 4YO8A 3M5PA 4X65B 5I3CA 2BFCA 1UBJS 3OM1A 3C1AA 5CJPA 4WXHA 1MENA 4A1OA 5PGMA 3KWJA 4NH4A 1XO1A 4CM4B 2OTCA 3L7NA 3R8CA 2XUOA 4AL4A 3KZNA 2C2WA 4PZLA 4WQMA 3E2IA 3WYCA 5FL7A 1I7QB 1JFTA 5U1PA 2I3ZA 1YRYE 1X19A 2DU8A 5CLJA 6AT1A 3ISTA 5JI2E 4PNPA 4UJ5A 2OMKA 1IDN1 1JFLA 3NRCA 5FWXA 3V7UA 3ER9A