3A7EA

Crystal structure of human comt complexed with sam and 3,5-dinitrocatechol
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
212
structure length
212
Chain Sequence
DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hit to Lead: Comprehensive Strategy of de novo Scaffold Generation by FBDD. Part 1: In silico Fragments Linking and Verification of Spatial Proximity using Inter Ligand NOE Approachs
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 77
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a7eA00
2ZIEA 3DMGA 4KDCA 4QQKA 2UYCA 2VP3A 2AOWA 5EOVA 1F3LA 4DCMA 4ER5A 4C06A 5DM1A 2XBMA 5DSXA 3KPUA 2AOTB 5EMLA 3EVEA 4KWCA 5EG5A 3RODA 3GCZA 5IKMA 3S68A 1SKMA 2QY6A 1KPIA 2BH2A 2P3LA 5CM2Z 5K05A 1YFLA 2B78A 2G71A 5EEHA 1WXXA 2VZ9A 3OU7A 4XUEA 4E2XA 5KVAA 3NVMB 1AF7A 4XUCA 1EG2A 1M6EX 1NW7A 2F8LA 4GOOD 4DZRA 2CMGA 2V7EA 1RI5A 3ME5A 4OA5A 1L9KA 2YQZA 3DLIA 3LCCA 1HMYA 4FSXA 2OYRA 5BW5A 1NE2A 4P58A 3TRKA 4C03A 4M7RA 2YXLA 2IP2A 3M6UA 3I58A 1Z3CA 5DSTA 2IBTA 2ZBPA 1KHHA 2BR4A 4QPPA 3M6VA 3EEOA 3P9CA 3AWIA 1I1NA 1DL5A 4CXMA 4YUZA 1N7JA 4RVFA 2C7OA 3HP7A 1ZHFA 2WK1A 1SG9A 3LKDA 4CKEA 3GU3A 1U2ZA 5K0CA 3NMUF 3IHTA 2LD4A 1R8XA 3JWGA 5EPEA 4PYMA 2XVMA 4C4AA 4RTLA 2E5WA 5T67A 2QRVB 4H0NA 5EKXA 3NWEA 4YV1A 10MHA 1DCTA 2ZTHA 2AN3A 2YXDA 4F84A 1SQFA 4GC5A 3VC2A 1X19A 3EMBA 2P35A 2H11A 4U7PB 5DLYA 4E2YA 2NYUA 3HA3A 4CKBA 5E9QA 2YUIA 3G7UA 5C0OE 3UJAA 4FT4A 4IV8A 2P8JA 5K0EA 3KQSA 2CWWA 2ZIFA 4E31A 4V0RA 3T7SA 1KP9A 3I64A 4PCLA 1WY7A 3CGGA 3KU1A 5DTQA 5HEKA 4AX8A 3KR1A 2YTZA 4QVGA 2G1PA 2HR1A 5LR6A 3BGIA 3FPHA 5G02A 2VDUE 4FSDA 1X1BA 2IDJA 4GOND 2IGTA 5HIJA 3AY0A 2O0LA 5K0FA 3GO4A 2B2CA 2ZBQA 4JXJA 5DTMA 4BP3A 2AOUB 2DPMA 1VIDA 1XXLA 4G56A 5T64A 1NT2A 5CVUA 4U7TB 1YZ3A 3JWHA 5E1BA 1VPTA 4YUVA 4OQDA 3R9XB 5E9WA 4DQ0A 2BM8A 1QAQA 4RTOA 1M6YA 3SSMA 5C1IA 3V97A 2OB2A 3HVHA 4EKIA 4RTPA 3M6WA 4POOA 2Z6QA 3HVJA 3KQMA 3NDIA 3UJBA 1XTPA 4PIPA 5K0GA 2JHPA 2AOXA 1WZNA 4P7GA 3GRYA 5GIOE 1JQEA 3GWZA 3P2KA 4DA4A 1R18A 3GXOA 4KDRA 1YZHA 4OBWA 2JG3A 2GPYA 1XDZA 3KR9A 1FP1D 3KHKA 3THRA 3KPJA 2UYOA 2B3TA 4LECA 2NP7A 3OPNA 1VQ1A 3G5TA 4QTUB 3FPJA 2Z6AA 4FGZA 5EMMA 1QYRA 1KIAA 1JTEA 3X0DA 4ER6A 1Q0TA 5GM2A 2PLWA 1D2HA 3G5LA 4X60A 3SVZA 1EJ0A 2P40A 2AVDA 4PYIA 1X1DA 1TW3A 1NW5A 5DXJA 5EZSA 2FHPA 4F85A 3PLAE 2PX8A 3OE5A 2VS1A 1AQJA 5HIIA 2HTEA 2ZWVA 4PYNA 1ZKDA 5LQJA 1YB2A 3MQ2A 2O05A 1WS6A 3QOWA 4RTRA 2ZCJA 2GA9A 5D1HA 5DWQA 3U81A 3EMDA 5DX1A 2PX5A 4KW7A 4HGYA 1FJXA 5DX0A 2I6GA 2VDWA 1Q0SA 4HC4A 2OBFA 3MCTA 2EJUA 3P71T 2ZIGA 5BW4A 3BUSA 3T0IA 4M36A 2JJQA 5E2AA 3PS9A 1BKYA 3TKAA 4BLWA 2Z6UA 2AOTA 2UYHA 4L7VA 2YX1A 5K0BA 1Y8CA 2HMYB 3FPEA 5ICCA 2O57A 9MHTA 3NJRA 5ICFA 3E7PA 4R8RA 3G2MA 3TOSA 3CJRA 2WA1A 1R6AA 3SMQA 4QQNA 3VC1A 3EGEA 3OZSA 4MQ4A 3K0BA 4FT2A 4CTJA 3B89A 4E70A 4P7FA 5KQSA 5EMKA 5EVJA 3WSTA 1YUBA 2ZULA 4ER7A 5KS2A 3R0QA 4RYLA 5E1DA 3FPGA 2P3QA 2GB4A 3DP7A 3EVDA 3FTDA 1JSXA 5E1OA 4DM3A 3TLJA 1SQGA 2QE6A 3GRUA 5EMJA 4EVIA 3MB5A 2R3SA 3SSNA 4YUWA 3NWBA 1MJFA 5CVDA 5K01A 5MHTA 4LWPA 3FZGA 4PYOA 4Z2YA 3R6TA 5HILA 4YV2A 5BP7A 2UYQA 2GH1A 5FA5A 1YFJA 3BWBA 3FTCA 1PRYA 3UBTA 3A26A 3DULA 1G6Q1 2Y1XA 3G2PA 3TR6A 4WXHA 3ELWA 1G8SA 2DULA 3ANXA 3CCFA 5U4XA 5FUBA 2PT6A 3GRRA 3KPWA 3BWCA 3A25A 4HTFA 3I53A 3UJCA 4RVDA 4M38A 4YMGA 4MTLA 3FTEA 4PONA 2G8NA 3DUWA 3QV2A 1QAMA 5HIMA 3NTVA 3G2OA 3F4KA 3BWYA 3UJDA 5JUWA 5JR3A 3E8SA 4CTKA 3CC8A 3KPYA 3LKZA 4CKCA 3PTAA 3R3HA 4P7KA 2PVCA 2P41A 3I9FA 3GJYA 4YUYA 3MCZA 2C7QA 2EJTA 1VLMA 2PGXA 3THSA 3UWPA 5EHIA 1QANA 4E2WA 5LQRA 4RTKA 1RJDA 1DUSA 1NW3A 3CVOA 3GRZA 2P3OA 1SVUA 2ONYA 1KPGA 4HSGA 4EQZA 5ICEA 5KQRA 1O9GA 2ONZA 5EZQA 2H1RA 1VP9A 2FCAA 3LHDA 3PX2A 2FK7A 3KR2A 4BLUA 1JG1A 4A6EA 5LQKA 3TPZA 3TQSA 1RI1A 1RI3A 3ELUA 3DXYA 3UZUA 3SGLA 4BLVA 4PNEA 3BZBA 3CJTA 4RWZA 5F2KA 3NDJA 7MHTA 2OPBA 4HH4A 4QDKA 3OCJA 3HCBA 3A7DA 3EVBA 3IYLW 2C7RA 2CL5A 2XYRA 3M70A 4GOLD 2EX4A 5F2NA 3OFJA 1RJGA 1T43A 3B7PA 3P9IA 4Y2HA 3UJ6A 3IV6A 3ELYA 3FUUA 3D2LA 1R74A 3PT9A 1AQIA 3MTEA 5KYGA 8MHTA 1UIRA 5ERGB 3REOA 2ESRA 3AJDA 4C07A 5FQOA 2EG5A 3M6XA 4PWYA 5CCXA 4A6DA 1L1EA 2PXXA 2Q41A 3EVCA 1WG8A 2R6ZA 1WXWA 3V8VA 5LQNA 1NBHA 2OB1A 3B3FA 4PCAA 5EGSA 2PV0A 4QDJA 5CUQA 5FQNA 3OE4A 3EEYA 2N47A 2NXJA 3KQPA 4RVHA 4X41A 2I9KA 3O4FA 5GM1A 1INLA 1XCJA 2KW5A 3GGDA 1R8YA 4ER0A 1ZQ9A 1RJEA 3DXZA 3M33A 3UJ8A 4GUAA 3OU2A 2OZVA 3KQVA 2IFTA 3CBGA 2OO3A 3HCAA 3KQWA 3UA3A 1L3IA 4GQBA 3Q87B 5CD1A 3K6RA 5FADA 5HIKA 5FWAA 3KR0A 4BY9E 2UZ4A 3KQTA 5E8RA 3JWIA 2BR5A 3ORHA 3MERA 5DM0A 3EVAA 3P2EA 3HCFA 2PY6A 2OXTA 3PFGA 2IDKA 2ZBRA 3TMAA 2ZZMA 1I9GA 4NECA 1JG4A 1G8AA 1UWVA 1JG2A 1KYWA 5FHQA 3UJ9A 3ELDA 3LX6A 5EIWA 5K0JA 1JSZA 3KQOA 3PX3A 1RJFA 3A4TA 1ZG3A 4EK9A 5B1SA 2ADMA 5LQCA 1JTFA 3NW9A 4IKPA 3P97A 3BXOA 1VP3A 4IV0A 2IPXA 4PGHA 5D1NA 1R00A 2A14A 5GOZA 3RIEA 4CWAA 4PYLA 3ERCA 1JR4A 2FYTA 2YXEA 3PFHA 2ERCA 2XVAA 3QOXA 5DPMA 3SXJA 5K09A 3A7EA 5FHRA 3CKKA 2PSSA 3AXSA 4RVGA 1NW8A 3O7WA 1JG3A 1N2XA 3EGIA 3ER8A 3LPMA 1D2GA 3BT7A 2I62A 3NVKI 1XCLA 2V74B 2JHCA 4RX1A 2WA2A 5E8JA 2CMHA 5EIFA 1D2CA 1P1BA 3MHTA 2IH5A 4FZVA 2BM9A 2QM3A 1YF3A 1KYZA 4ISCA 3TFWA 1JQDA 1G55A 2JHAA 5K8VA 3LBFA 1XJ5A 5FWDA 3HVKA 2IBSA 2XYVA 3FRIA 3SM3A 4X63A 3UA4A 3B5IA 2ZVJA 1TW2A 3KQQA 5DRTA 4AUKA 3HNRA 3OFKA 5E9JA 3L8DA 1L3CA 4R6WA 5BXYA 4YUXA 2AR0A 1IY9A 3Q7EA 2GS9A 2PWPA 3KPVA 5FULA 3G88A 5K0LA 2GLUA 4ER3A 3MGGA 2I7CA 1ZGJA 3EVGA 2PX2A 3GNLA 4RTSA 1I4WA 3P8ZA 4HG2A 3KKZA 1G60A 1ORIA 2OY0A 2PXAA 3BKXA 3HCCA 4IWNA 1BC5A 2BZGA 4KIFA 5F2OA 2NP6A 5LQUA 1F38A 1BHJA 2NXEA 5FTWA 2VDVE 1B42A 4Y30A 4RTJA 3B3GA 5LQAA 5DRYA 4C08A 3ID6C 1KXZA 3G2QA 4MWZA 4OQEA 2AOUA 3MTIA 4OBXA 3VYWA 4PYQA 2YR0A 4HRAA 2NXCA 2P1DA 4GBED 4XCXA 3LBYA 4KIGA 4DKJA 3EVFA 3LDGA 3LL7A 3FPFA 3HM2A 2JH8A 2ZW9A 3O31A 2PX4A 1NKVA 4ZTBA 1EJ6A 2AVNA 2ZSUA 4P7JA 3TM4A 4AZSA 2FPOA 5GIPE 4HGZA 1SUSA 1P1CA 5CVEA 5IH3A 3TM5A 2ZZNA 3HTXA 5GINE 5EKUA 3FRHA 3TKYA 5HFJA 4QPNA 2NNWB 2AN4A 1PJZA 3GRVA 3EGVA 4FS8A 2C7PA 4O29A 3H2BA 2K4MA 3C3PA 4EMSA 5CVJA 2FRXA 3M4XA 4EKGA 3EVZA 1OR8A 2PKWA 4LG1A 4X61A 4C05A 1ORHA 2O07A 5H02A 3HEMA 4PGGA 1FP2A 4FR0A 5CVVA 2GAFA 3FTFA 3VSEA 3UFBA 4WVLA 1QZZA 1ZGAA 3BWMA 1FPQA 2FK8A 4RTQA 3CJQA 5HOQA 4MIKA 1H1DA 3PVCA 5EQJB 5LSAA 1XVAA 2QRVA 4FP9A 3SSOA 4DMGA 3SX0A 3DR5A 3IEIA 4X1OA 2EFJA 1KR5A 1TPYA 1V39A 5EC8A 4BP1A 2JH9A 3FUVA 4R8SA 5CIYA 2ORED 3HCDA 4RSRA 5FCDA 5M5BA 5GP1A 5K03A 4QTTB 4GOMD 2P7HA 2ZWAA 2OKCA 1P39A 3P9NA 5CCBA 1KPHA 3OZRA 4LWOA 5DXAA 5HZMA 1EAMA 1VE3A 2PXCA 3G89A 3G8BA 3LECA 4M37A 5DM2A 4RTMA 1X1AA 3G8AA 4GF5A 3LCUA 1NW6A 5DX8A 3JWJA 3RW9A 4AZTA 2H00A 1MHTA 1M0EA 4E2ZA 1RI2A 1NBIA 3C6MA 5E1MA 5E2BA 4KRGA 4OA8A 3C3YA 3GIWA 4AZWA 3MAGA 4PYKA 5EHGA 1XDUA 3HA7A 2O06A 3BKWA 4E30A 2AS0A 3BGVA 1NV9A 4PIMA 3LDUA 3R24A 3FUWA 4KVZA 5ICGA 4RTNA 3P2IA 3LCVB 2AZTA 3DH0A 5P8WA 3KQYA 1O54A 2B9EA 1X1CA 1IM8A 3DXXA 1G38A 2BR3A 5GWXA 3HA5A 1N7IA 4DCGA 3LSTA 2B25A 4R05A 4DF3A 4PYJA 3DTNA 2Y1WA 3OZTA 1FBNA 2AN5A 4GEKA 4QVKA 4GC9A 2PWYA 3DOUA 2HV9A 4MHTA 2HWKA 1SUIA 3PB3A 3DLCA 3DMFA 2YVLA 3LGAA 1VL5A 3HCEA 2PT9A 2CKDA 4YV0A 4RV9A 3AXTA 3BGDA 5FA8A 1XDSA 3ER9A 3T7RA 5DT2A 1AV6A 2QYOA 4XUDA 4YMHA 3OU6A 1IXKA 3LDFA 1JQ3A 4HTFB 5EEGA 2ZLBA 3EPPA 4OX9Y 3FYCA 3FUTA 1BOOA 1RI4A 2PBFA 3E05A 3SR4A 1L3BA 4AZVA 5DTRA 1P91A 3B3JA 4E33A 1VBFA 3P9KA 5T6BA 4ATNA 4F86A 5C9ZA 2G72A 2IIPA 4C04A 3A27A 4E32A 3FYDA 2XYQA 4K6MA 2IH2A 3C0KA 4PINA 2PJDA 5K0NA 4V0QA 2P7IA 4UOEA 1UFKA 3DMHA 2NXNA 1O9HA 2AOVA 4R6XA 3UJ7A 4B17A 2HNKA 3E23A 3T7TA 1NV8A 3HVIA 3C6KA 2ZZKA 3GDHA 3I5UA 2IH4A 1QAOA 5DM4A 1EIZA 1HNNA 1EQAA 3FUXA 2G70A 2ZFUA
chains in the Genus database with same CATH superfamily
5JZ9A 4KDCA 3H5RA 4XPIB 5EOVA 4ZIRA 1F3LA 1QCZA 2W2XA 4IVRA 3KPUA 4N0PA 3LOUA 3R75A 1NPYA 3QUBA 5LKRA 2OVFA 3GLFB 5LB4A 1RWXA 1U99A 1V43A 3A1WA 3GCZA 4YQYA 1M66A 1EGHA 1ATIA 4ZVUA 2J5XA 1VMDA 3UV7A 1SVOA 3KT6A 3L5OA 3Q11A 4H27A 3H3XA 3ZHUA 4D8YA 3V7WA 5K05A 1KAHA 3VR5A 4NABA 3AIKA 5KYKA 1E9CA 5DULA 3CB2A 4XUCA 1SUDA 3AW9A 3GLHB 4TL7A 4BU1A 4F7DA 3VKGA 2YMMA 2ETXA 3WLHA 3TDKA 1TKBA 1EP3B 2PUWA 4FX5A 5CA0B 3URKA 4J3NA 1FZQA 4P58A 2DH6A 3BMXA 2PO5A 4Z8YA 5BSTA 4F4IA 1KY3A 4IJUA 5KDDA 4GL2A 1U31A 5BOSA 2JKVA 4UW9A 2Z0MA 2JCXA 1NASA 4LY0A 3C3WA 4QSMA 4AT1A 4AKSA 3I5YA 2QTRA 4YUZA 1P6XA 2X3YA 4KWEA 4RVFA 4H16A 2XGGA 1IUKA 1YJXA 3GU3A 1RQLA 2CB9A 4B4DA 1K6EA 1CQXA 2J3MA 1A9XA 1T2DA 3JV7A 3L9XA 5EPEA 2Q2QA 3AHHA 3FFBA 1BWSA 2L0XA 3ZWXA 1L5KA 4FQ7A 2AI2A 1J0AA 1VSQA 4KPGA 1L7VC 2RB5A 1U7UA 4L8WB 3E2PA 3ND5A 5FOVA 3STWA 4B3DA 1DCTA 5FPHA 3HN2A 3UT6A 5ADWA 3C6XA 3EUWA 2EIHA 3ZTYA 4E2YA 3S3TA 1PGJA 1W5AA 3WQHA 4AULA 4DYVA 4E5KA 3Q88A 4PG4A 2QUBA 3RH0A 3ZDRA 1XZ8A 3G7UA 4K6OA 2HA6A 5AVJA 2B9VA 4M1TA 1W4AA 2XOKD 3CEAA 4MUEA 4RK5A 3UJAA 2K7FA 3TRFA 1DIHA 3WLMA 1HYGA 1MTZA 3QPBA 2HM7A 2C4HA 5HEKA 2VRNA 3MD9A 4HS9A 4W1PA 1XZCA 3INRA 5LR6A 1QDUA 4DIOA 5DFAA 3W5CA 5K3AA 5UKDA 2RJNA 2IGTA 5HIJA 1IHUA 3U6KA 1JPVA 4D3XA 3I83A 5AK3A 1JAXA 4ND3A 4I1RA 5TQ2B 5AVQA 1CTQA 3VU0A 3ZV3A 2PM8A 1IBMB 2LR0A 4L2IA 1DQRA 1ORTA 1F2UA 1X6VA 2WIBA 3T7KA 4E2FA 5MN4A 2IYUA 2VDNB 5JH7F 1GZ3A 1UAYA 2DQKA 1JIQA 1QE3A 2ZEJA 3A05A 3MIZA 4OGKA 5C46F 1Q44A 1RC0A 3GJ3A 2P9GA 2XDYA 4BNIA 3DKRA 1XTPA 3RSCA 1JR3E 4FFPA 1ZWLA 4WZBB 2AOXA 5PGMA 4IDCA 5DBFA 5IXJA 1U3CA 4MS1A 1OBCA 2XCTB 3KYCA 1QFYA 2BFDA 4TWIA 3RVDA 2Z5GA 1QFZA 3KR9A 1UZLA 5FTLA 4MDYA 2FPSA 4YV7A 2JJ1A 1D07A 3V1NA 2ATVA 1TECE 2XY4A 3IB3A 4J75A 4Y2RA 1FMFA 1UXHA 2CNOA 1H1LB 4DSUA 3L49A 1OBVA 3VU3A 1NZFA 1KIAA 2Q6OA 1K3FA 1KC3A 3HGQA 2YMLA 1TM4E 1JU9A 4HX2A 4QXOA 4U0KA 3AB7A 3W5VA 2RHDA 5CFOA 4JXZA 3P5BA 4X1KB 4BO3A 4H6PA 2NTVA 2WHPB 1D0SA 1IM5A 1H4QA 1GQFA 1AZSC 2H2HA 2NVUA 1N32B 1HQDA 2JNWA 5IK2D 2DTXA 1LDEA 2VQSA 4KGXA 4RABA 3ECSA 5BV1A 5LQJA 2ZSBA 2DT5A 3WKDA 4EYKA 4G8CA 2QD4A 1NU8A 4V0OA 1EX6A 1QQBA 3JAKA 1KK0A 4EYOA 3O8OA 5INTA 4M1SA 1FJXA 2IPOA 3UH0A 1MA3A 4LRXA 3SWWA 1NI4B 1HDYA 3UWOA 4Y6OA 1E2GA 2O5VA 3PFNA 2OUIA 1Z25A 3EQ6A 4L8VA 4R3NA 2WAAA 2PU7A 3R7WB 4QE3A 4R2KA 1WV1A 1TJPB 4BE4A 1V35A 1KR2A 3IDOA 4JOQA 4OHFA 3SS9X 4QTXA 4AS3A 5ICCA 2VC2B 4MXDA 4Q66C 4PPQA 3KC2A 1LX6A 1FNMA 1L7EA 5KTNA 4X66B 2F43A 5FOXA 1R6VA 3KXIA 1TLFA 1UFRA 2C9YA 4R1OA 2FWNA 3W04A 3QXJA 4YPVA 6YASA 3GT4A 5JOQA 4LFAB 3VC1A 1SBCA 3WOVA 1TU0A 1ZNZA 1ZSNA 2GAOA 2QZPA 2H16A 2HWUA 5EMKA 5MGBA 4H3SA 2FWAA 4MI1A 4EYQA 5C35A 2YJGA 4AZ3B 2ZIZA 5J2TF 4DLVA 1CQZA 3WK5A 4CQMD 1PHPA 3RG2A 2FEOA 4MQEB 3ZD6A 3JQFC 3QTTA 4TROA 3RAPR 3H11A 4B9AA 2WIGA 4MQ5A 1KEZA 3A3NA 5JBNA 1IWOA 3ZQUA 2F1IA 4UU0A 2IHKA 2Q3LA 1F1BA 4MNTA 3DKKA 2SKCA 3R6TA 5BP7A 3T7DA 2VZ0A 4C0XA 2DY1A 2G17A 4KK3A 3PNKA 5HRAA 1SU7A 2GRAA 3FE2A 4J0GA 1D8AA 3E5RA 4NI5A 4EAAA 5KKCA 3ANXA 5G0SA 3DW1X 2I2FA 5CMLA 1K88A 5AM0A 1EINA 3BSSA 1OH7A 2GTPA 4RS3A 4UU7A 4D46A 3CNLA 2AJ8A 4CQMA 1PDOA 3AY7A 5TARA 3P26A 3AKDA 3C4QA 3UJ3X 2QSJA 2RARA 4JI1B 1ORRA 1RAGA 5JR3A 1JU4A 2XUAA 4F3CA 1HKHA 4HDSA 4BRSA 1JAZA 1ACMA 2O3TA 3KZCA 5KYYB 2HLDA 4LJRA 1Y9JA 4Y6GB 5AVYA 2BEVA 2YOFA 4XA8A 5IHPA 4Y7DA 1U81A 2ECQA 3MLAA 4QPJC 1QF6A 2XAAA 4XKJA 2BI8A 5A5DA 5KOHA 4NR0A 1G16A 3RBXA 2FK7A 3BE5A 3M1IA 4N39A 1I7LA 3DKIA 2CLHB 5LQKA 4KC0A 1RI1A 1G66A 2G06A 1KKMA 4ZOLF 3UZUA 1PTJC 1QFXA 2IP4A 1Y0BA 2HU8A 3JTEA 4H1TA 1LU9A 1RFGE 1A8HA 2O48X 3JZFA 3CV3A 3KTDA 1M1XB 4QDKA 5C53B 4KRFA 1UKVY 3CRVA 1H2EA 2IPAB 2PXHA 3OFJA 4XLLA 1T43A 3UOGA 1TUBB 3W3ZB 3ZQ6A 3DDNA 3TIGA 5DWVA 3KE9A 4CUZA 4AY2A 4UHBA 1NUPA 1OX5A 4Y2TA 4YP7A 1MAHA 5DOZA 2ESRA 5F5LA 3D8SA 1JXOA 4PF1A 1XWFA 4PICA 1VE9A 3REQB 2RC5A 4MJXA 1U2DC 1CQIB 5AXBA 5T5QA 3HN6A 3JQBC 4CWAA 5AM1A 5JDCC 2O5EA 3IVCA 1RQXA 2GA8A 2VK1A 5B12A 3EG9B 3T3EA 3PX7A 3IXMA 1VKRA 1SNYA 3PDWA 3T5DA 1RZ3A 5AXCA 4HGOA 4UZFA 1CIJA 4WACA 1W4CA 2GZ1A 2Q0HA 2QZJA 3BEOA 4X7BA 4YMIA 5A05A 5AVXA 1RJEA 4CDMA 4MPJA 4B82A 2IHUA 4X54A 3W5HA 1O58A 2OO3A 1RZRD 2IU3A 1SBHA 2CCJA 1FXWA 3WI7A 2PAAA 1HDCA 3QI2A 5FWAA 2QZZA 5LBIA 2IV2X 2PVPA 3ICOA 1PJCA 2ZT8A 3LLCA 4UUOA 1BA2A 1AURA 2R96A 3FZYA 3JQ8B 4ZVRA 1AB5A 4DXAA 3FMPB 2ON6A 1GSIA 3BQMB 4EDHA 4DLWA 4DN6A 4H1VA 3NHBA 3MRXA 2HSJA 5EY5B 1RWVA 4HV4A 2Q3MA 1GPH1 2CVZA 1CUDA 3LVFO 4JODA 2FEAA 3U4GA 1I4TD 5E2IA 2HX1A 3PNMA 3B12A 4L57A 2J5RA 3R6GA 4REMA 4MIOA 3ISTA 5D86A 4BNDA 4DEXA 1QYVA 1WCIB 1K2WA 1SHKA 2F3PA 3KL2A 1SD2A 3PUJA 3QVVA 5CA1F 3D1VA 3OTWA 3H83A 1JUDA 1QB7A 4K8RB 1VP3A 4IV0A 5HBGA 2VQEB 1M1UA 3ZH2A 1BNCA 5DNAA 3SX4A 4UJ5A 1C14A 1EUCB 1NONA 1RNLA 2XOKA 4RAOA 5AKHA 4ALNA 5IJ9A 1J1IA 2IS1A 1B8OA 3PFHA 5K09A 3EXFB 3DF9A 2A2ZA 2PIAA 3FI9A 4LHSA 3C1UA 2YY5A 1L1QA 4U9HS 5CW1A 3K5WA 1TT5B 3S1SA 2P6OA 3HQ4O 1YIOA 1OLSA 4D0NA 4QFMA 1WRBA 2FGKA 4I9NA 2PQMA 1L7XA 1NBWB 2L69A 2WJPA 4X1YB 4RZHA 5KREA 3HKDB 4P3YA 3LD9A 4QJBA 1G3UA 1NYRA 4Q5IA 4Q4HB 2E4AA 1JJBA 4B46A 3PQ4A 1L6RA 3I52A 1I3MA 3ZX5A 2Q27A 1JIIA 1QSGA 1B7GO 5DBEX 3A70A 5E9JA 3AUSA 3Q0EA 4JIMA 4KR3A 3Q7EA 3DQPA 4CDRA 1OTXA 5K0LA 4YAUA 2GLUA 2PDAA 4TXMA 2GPTA 4FYPA 5D2CA 4OLBA 4L8FA 2QSUA 5BQFA 4I1IA 3CQ9A 2PTHA 5DTJA 3S1AA 5JADA 2E85A 3DE1X 1S8AA 4R2MA 1S96A 5ESRA 4D44A 3KKZA 1BYIA 2QX8A 1DC7A 3M6FA 2D1QA 1UDWA 3PQCA 1F38A 5I9IA 5CVTA 1QB8A 5IP5A 2X5OA 4LYDA 1UUFA 4IDFA 3SJ7A 1GFIA 2OCAA 1T4CA 4RELA 3WYCA 2ZQYA 3O93A 1OT3A 3UFXA 3W6UA 3TPFA 7ABPA 1Q84A 5REQB 3G2QA 1B93A 1Q0PA 2Z6UA 1OI4A 2QU8A 2AOUA 2MWMA 1WR8A 5DGXA 1FFWA 4EPRA 3NYQA 2CLDX 2Q9BA 4PYQA 5I9MA 3RVJA 2NXCA 4ARAA 1ZM2A 4POAA 4LCEA 4N3NA 1P61B 3ET5A 3BA6A 4RZIA 5J63A 1NKVA 3D43A 4PLTA 1K92A 4GYWA 1VSVA 3ESDA 4GQAA 3RS0A 3T7CA 4PRZA 2XYPA 3U4AA 3WG9A 2XXJA 5IH3A 3KJXA 3LRPA 3TLMA 3OUUA 5CXUA 1ICIA 4RD4A 2O7SA 3EXHC 4JT8A 5EI5A 3TKYA 4QPNA 5DYWA 1SVLA 2GFQA 3DVSX 5AHKA 4WT7A 1MO5A 1Z5ZA 3QWFA 5CVJA 4YJ2A 3H2GA 5DCYA 2JGMA 4FEYA 1I6LA 1OR8A 2VNAA 3PI6A 5D84A 3JW8A 3G6WA 4KGZA 2FA9A 3L8ZA 4HEHA 2AUNA 4BEBA 4D9JA 3N74A 5FEUA 1N0HA 1XCBA 3GZNA 1JQ5A 4MGYR 4EPTA 1ZY2A 1QZZA 1TVMA 4JKYA 1JZTA 4B3HA 1NBEA 1XVAA 3RVPA 1SOMA 2RG1A 5DLDA 5LP6F 1H2HA 1IAQA 3IXLA 4ETMA 3AK4A 1NX6A 3WL5A 4BP1A 4A1FA 3FUVA 3Q3IA 3WQSB 1AGRA 4LF4B 1R3DA 2ORED 4P36A 1UQUA 4RSRA 2R7NA 2AX3A 1AGNA 4HZUB 3B38A 3DL7A 3O4HA 2PWAA 3P9ZA 1SZJG 3U9TA 3QPUA 3V7UA 4KAAA 1FVFA 3IMGA 4RJKA 1QU3A 3BH6A 3JQGB 2HSDA 4CG3A 2QLNA 4M9QA 1V96A 3RS2A 3QZUA 3MWFA 1GG5A 1MEOA 4M22A 1M0EA 1QRUA 1OWOA 2E4XA 3O8QB 4AZWA 1HKUA 1AN0A 1NDHA 2QDKA 4MAFA 2B3DA 4RA9A 3HV2A 3AOEA 1C81A 4C0SA 3GLIE 5IXYA 3PBKA 3HA7A 5U9CA 3QPWA 5BYBA 3GUCA 1CFJA 3O9ZA 3STYA 4ERNA 2IUYA 4K03A 5B6IA 5JISA 1U6IA 3P2IA 4PFSA 1PJAA 3ACDA 4N18A 1DDGA 4AI6A 2KQUA 1H05A 2CE2X 4PLHA 2ILVA 1ZICA 5CX1B 1YBAA 3ZLJA 4RDHA 3EZNA 3GWGA 4IRMA 4W5WA 1WUTA 3WYAA 1U7ZA 3H16A 4HAUA 3MBIA 1XZEA 4QVKA 4KXYA 3MTJA 4LMRA 4PHTA 4B3XA 1UXJA 2VDWB 5DNEA 4TTVA 4CM8B 4HJXA 2ZJ8A 2QRKA 3LXMA 4F6RB 3EPJA 2QZ4A 1OI7A 1ULHA 4GKVA 3HY3A 2GKGA 3QFTA 1HYHA 1WSBA 2XDQB 4W6ZA 4YV0A 4LK3A 4YWJA 5IWCA 1YCFA 3K6JA 4ZN6A 3U9SA 2XE4A 2Z9BA 4JP1A 4QNNA 2BFEA 5GZ1A 1QDLB 3FOFC 2ODNA 3LDFA 2Y1EA 2PPLA 1I7PA 2BM0A 2CMKA 2CC2A 2VQ3A 1MORA 5FLKA 4F4CA 4ZV7A 2ZRHA 4YP9A 3FVQA 2DHRA 3VC7A 3LE8A 2H1VA 5C1PA 4UNQA 2HRZA 3MRTA 4IOJA 3MS2A 5TMPA 2IVZA 4Q7MB 1N6LA 3EW9A 4WXEA 2XYQA 2RH4A 3AW8A 1PT9A 2WJWA 2BFCA 4MR8B 3W5JA 1ZUHA 3LSYA 4V0QA 1P4SA 5ALXA 1UFKA 1STOA 2VUHB 1NV8A 1CUJA 3IILA 1BOFA 1H8ED 2G36A 4JWKA 4V39A 3VXKA 2SBTA 2CSXA 3S2IA 4PSKA 3RS7A 2CD9A 4KFSA 2VP3A 3N28A 4KV9A 2ID4A 4L9SA 1A76A 2GDZA 2C2XA 2YFHA 3KSZO 5DSXA 4EG0A 5IT5A 3EVEA 4KWCA 4Q3CA 2ZOSA 4BO5A 3NH9A 1FSPA 3QUSA 4QZVA 3E3NA 5DO9A 1YOVB 2GK7A 3GUUA 3MLEA 4LISA 2ZPTX 4XEUA 2R7LA 5A3SA 1IBSA 4ZC1A 5KVAA 4NJMB 3TW4A 2GJ9A 1QG2A 1M6EX 4A6XA 2ECPA 1G2OA 2JS7A 1PEKE 3HXLA 2B37A 1AXEA 3VTFA 1WSWA 3L82B 3AZOA 4ID9A 2NU8A 2OYRA 1R0XA 4A03A 2HO4A 3BTSA 3H5NA 4BB5A 1XWWA 4E0BA 3UY4A 2G77B 2IP2A 3R5FA 3L7CA 1VBKA 2QR2A 3I58A 5EFZA 4BMNA 1D9XA 5L3SA 4DDMA 5ERXA 5EWJA 3QELB 4EUSA 2PX3A 3N5CA 1A8UA 5K9ZA 2C7OA 2DHQA 2AMJA 5EJIA 3UO8B 1MX3A 2HMWA 4KE8A 3OOJA 3JWGA 3P0EA 4C4AA 1F7UA 4LTNA 4YTEA 1NRWA 4YMSA 2V0NA 5FOTA 2NSYA 1H66A 3VC2A 2FW1A 3KJGA 2P2CA 5JAPA 1PGNA 1Y80A 3QK7A 3RLFA 2HN9A 4ARVA 1U9YA 1Z6AA 2XQFA 1Y4ZA 5EJ2A 1GWNA 1WB9A 5HJEA 2GUGA 2EWMA 3K16A 2JEYA 2XRZA 5BMVA 3HH8A 3O8RA 2WV7A 3R3SA 1JEQB 1T1IA 4BFZA 3HI6A 2R1VB 5TF4A 5EP1A 4IXMA 1L6IA 2FZWA 4YXFA 3FYUA 4AY3A 3VZCA 1BIFA 3DBLA 4M46A 4Q01A 1BVYF 1WL8A 3CXUA 3FDXA 3GP5A 3QPCA 5K0FA 3AF6A 1Y89A 3SKYA 1C7EA 4C3VA 5T6MA 1QQAA 3ZBTA 1U9JA 2Q1XA 4IUBS 3V8NA 1YI0A 1ZK4A 4RVCA 2QJTA 1YQDA 4BRUA 4LOKA 5A02A 1OTYA 2BGUA 3G68A 4LXQA 1NVGA 3EXEB 4IIYA 4KYUA 2J3IA 3A6KA 4ZOCA 4Y9DA 3TVDA 1UBJS 5C31A 2EG9A 4F4HA 1VYVA 1B0ZA 4LYHA 1T4GA 2VKQA 1GZ4A 4A6PA 5LZ4A 3JYNA 3OHMA 4POOA 2Q3BA 2VYND 2Z6QA 1NE7A 2O4CA 5C5EA 2VBCA 1M2GA 5F1KA 1XEAA 1Q0ZA 3EAGA 3U2QA 3N8KA 3USCS 4D92A 4CF6A 4DQKA 2O3QA 3DVRX 5ALUA 3IRVA 5ECGC 1VA5A 3VZRA 4E94A 4EGFA 1WULS 2WYHA 1OWPA 1THMA 3FVRA 3K0KA 4QU9A 5EMMA 1D0IA 2ZIXB 3NGMA 4JYZA 4I2VA 3RC8A 4MZXA 2W8BA 3PNBA 2O8DB 1DKNA 3DC7A 3SVZA 1Z15A 1F17A 3Q41A 4KX5A 4D0RA 4FDUA 4OHUA 3UAXA 4O2AB 5AW1A 1XCPA 1P2SA 5HS4A 3K9QO 1PLLA 1GGMA 2XT0A 4HQRA 1IZ7A 4PYRA 3PGLA 2FSVC 1N5DA 1E60A 1AQJA 4IQ4A 1B8PA 1FUYB 3V1LA 1AMNA 1O77A 1OUMA 1PFGA 1A71A 2RH5A 3E15A 4F9TA 1QE5A 3FBWA 1RBMA 4ZVNA 2B7BA 5D1HA 3WL3A 4G0ZA 6REQB 5E0KB 2J09A 3GEIA 4HGYA 4N5LA 2VDWA 3U80A 4GLFA 1OWNA 4HC4A 3RFXA 4QQFA 3MYRA 4DC1A 1DAEA 1M2OA 1UMBA 4JB2A 4M1EA 5KVCA 4OQ4A 1OH8A 1FLDA 5DGDA 3PS9A 5DP2A 3B9RA 3AHDA 1JJFA 4M8KA 3MINA 5M34A 3T94A 3CUSA 1TJ3A 1WY5A 3EBLA 4W1RA 1OC4A 1SZDA 2W42A 4IHAA 4NZYA 3QLEA 2CZQA 2BC9A 4CEIA 3RDPA 3ZBUA 5ICFA 1DC8A 1XBTA 2YBDA 5C18A 4FLFA 4I9FA 3HCPA 4XRGA 2QUAA 2R1UA 2VJPA 1DWOA 4MARA 2PH7A 4TLBA 4BTEA 4X8HA 3HXTA 1Q7CA 1F2TA 1Q22A 2FE1A 1L4BA 3BFKA 3BMNA 4GDMA 4J4BA 4MYRA 5KINB 4CMCA 1L7NA 3AU8A 4FJ1A 3DP7A 4QNRA 1L5FA 3CRZA 1JA9A 1YMUA 3SG0A 1NVEA 1QC5A 3OC0A 4TMXA 2GHQA 3RRXA 4RZUA 1XMXA 3HL4A 3R20A 3QVGA 5GONB 2R65A 4GS5A 2OOKA 2I1QA 2WTAA 4LHXA 1DPFA 4GVPA 1O95C 1GXSA 1NYTA 1MLDA 3E03A 3ESCA 3BH0A 2ZYRA 4GLBA 1WX1A 1V8PA 3RS8A 9LDTA 3ND6A 3MWEB 3T6KA 4MGIR 1IB6A 4MS3B 3CN9A 3ELWA 1CJVC 1XOIA 3NHKA 1BCSA 3KPWA 2ZB3A 1E1NA 1YACA 1DAHA 4JXKA 1CUUA 1QRDA 5TQJA 4DUZB 4KR9A 5CA1A 1TYZA 2FFBA 4XM0A 2WFAA 4AJLA 4BJ3A 3CBQA 4P22A 2OG1A 1N7GA 3QE3A 3QU4A 4GZ6A 1LBHA 4FZ5A 4LGCA 5HF5A 3L8CA 1II8A 4B80A 1XZKA 3D5TA 1EVJA 1W1UA 4QBIA 1TFUA 1RIFA 1C3OB 2J6HA 2RCYA 1RCUA 4U2FA 5LB2A 3QEAZ 5EIAA 2W8BB 1M8JA 2H9IA 4D1YA 2EJTA 3HZRA 4G37A 5EWJB 2ONKA 2CJPA 2AQ8A 3GDGA 1RHJA 4G1BA 2QL9A 5DI3A 4JYCA 2XZTA 3GEHA 4KYTA 2ZRGA 4LX0A 4RESA 1I94B 5EWLB 5BV2P 1NJ8A 3JRNA 4LW8A 3OZUA 3QYPA 5A7GA 4K88A 4CODB 4ZYXA 1Z0FA 4HPJB 2VO1A 3ABOB 1HQCA 2RONA 4FGWA 1FRZA 2QSZA 1RTKA 4NCHA 5JPCA 5K5EA 4Q3OA 2OPBA 3C6YA 4HJRA 4RZSA 1ZCJA 3UK0A 1N1MA 1R0KA 1U0HC 1E79A 1THTA 1VPEA 1E77A 2WKPA 2XYRA 4UU1A 5TMEA 2X14A 4TV9B 1CZKA 3IV7A 4GI3A 1WIWA 4EHJA 5FYQA 5ECYA 1RZRA 5AW3A 2WAXA 5H9VA 5HS6A 3ZDZB 3OUTA 2XD9A 1RBQA 5KTRA 1R0BA 3K9CA 3I28A 2EG5A 4FVTA 3W79A 1IN5A 2Y0BA 4RZ2A 1CUEA 3DBLB 4HXEB 3HI4A 3NT4A 3HUFA 1CWUA 1W19A 5ALIA 1TM7E 1ZA1A 2QP3A 4KXFB 2F62A 4AK9A 1BN6A 4FDVA 5LYJA 1E8DA 3UN1A 2I3ZA 4QTYA 5AVOA 4G0VA 2VWQA 1QZ3A 3PC4A 4OSPA 1YH3A 4RVHA 5U1PA 2QTVA 5JAIA 5JMPA 5JO0A 2FQWA 2VA9A 1UEIA 1FUEA 4NOJA 4HDQB 3M33A 5CM2Z 2JIMA 3PENA 3OURA 2FETA 4HAIA 1D1SA 3D0OA 4L76A 2AG8A 2QGFA 3W7AA 3AETA 3IAS6 2UZAA 4OXQA 1T36A 3LQ2A 3QIAA 2ZJ7A 3IPYA 1NM5A 1JLKA 3ADPA 1OX4A 1PLJA 4ZQCB 4MWSA 4TVKA 3NONA 2ZYVX 1P45A 5KIAA 2EZUA 4AFNA 4ZT7A 4B4KA 1KK3A 3T9AA 3N7UA 4D0LB 3DYIA 3ETDA 3GX1A 3ZXXA 4KSBA 1CJBA 4NZNA 3VHLB 2EJWA 2HAEA 3MTQA 4RADA 4TXJA 1JG4A 1A1SA 1MP0A 2LXNA 1HDRA 1JIJA 1MEEA 1NQTA 3NB0A 4G5YA 5EE1A 4AG6A 5EIWA 4IVPA 2VA8A 2QXTA 2C5HA 4R81A 3PQ6A 5BOVA 3L8HA 3D8TA 3V8MA 4B87A 4EDFA 2FVYA 2Z09A 1JKMA 2PSFA 2A6PA 1HF3A 3OZDA 2Z98A 3MJ4A 3T0GA 4MR9B 1JR4A 3WNCA 3CVJA 3S2FA 3L07A 1L7RA 4JLNA 5FR1A 2PPVA 4ZYUA 1XVIA 5F3RA 3K6SA 1IDN1 4L8LA 1Q57A 3ETJA 3QVTA 4GX5A 2AFVA 1NW8A 2CJWB 2PMKA 4ILKA 1Z36A 3OEEA 3W3AA 4NG4A 1OX6A 2G82A 4RK4A 4DY6A 4JBWA 3ZXYA 1PFQA 2CMHA 2WJHA 3I5AA 4IF6A 1D2CA 4RO0A 1FXUA 1M2NA 4EP1A 1ZVKA 1YF3A 4AJOA 1KYZA 3GG9A 2CZCA 4ISCA 2BFDB 4XW2A 1JIXA 1U28A 3SC2A 1JEJA 3A4VA 3NUZA 5JI3E 1TTTA 3FRIA 3PSHA 4MR9A 2A0FA 4RDXA 3TMYA 2ZAGA 4TUYA 3VJKA 3IUSA 1SUWA 1EA5A 2VBGA 4DB4A 2BDEA 4YUXA 4ZTUB 3PG5A 3U4CA 4OQLA 1FTQA 1VL1A 5ETJA 3HRHA 3W78A 4N54A 1QQ6A 1XVTA 3LU1A 4XQCA 2CLOB 3NOVA 4QUJA 5FBKA 1Y8RB 2XI4A 1BKSB 1RPJA 2VP9A 2YW9A 3AEKA 4KIFA 4BWFB 4RM2A 3GL9A 4IOMA 4E3ZA 7ADHA 5KDOA 1WUHS 1BHJA 2WIJA 1RHRA 2ZRJA 3V48A 1Z4KA 1YRAA 4HWRA 1E9AA 4R1QA 4F4UA 2AT1A 3BHIA 4LDRA 1B42A 3BK1A 3B3GA 4JVLA 3DGFC 5JV5A 5FWXA 4N3CA 5BV0A 1MT3A 1CBUA 2IIBA 4GWLA 4EJSA 4C3UA 1WDMA 3V6MA 4CF3A 4PZLA 2JVIA 1Q0UA 2IUEA 4IDHA 3VI3B 3VYWA 3LVBA 2WICA 1BEEA 3DBHA 3R3UA 3P9RA 4GBED 2I29A 4JLUA 3UFXB 1IN8A 1XYVA 2J46A 2MTBA 3RYTC 1PR0A 3K5IA 1WLYA 4UKDA 2KBFA 4M6WB 3F5FA 3WLSA 2ZJ4A 5B30A 3ND9A 4AZSA 4NS4A 3UV6A 5GIPE 1R4ZA 1Y5LA 4HPXB 2V6JA 4MKXA 3RAJA 2H54A 5JSUA 1A82A 2HNBA 1HFWA 4LJKA 1ZU5A 3EYWA 3TXXA 3EXG2 3GJ6A 2OTCA 1S2NA 4ROTA 4C4ZA 1W88B 5AJTA 4R1TA 3ADCA 1SUCA 2QJOA 2BGMA 2HMUA 2VIIA 4FS8A 3T1VA 3L40A 1OYYA 4TKMA 4D2IA 4Q1FA 2P2LA 2X5JO 1E1YA 4YDHB 5TPZD 2Y6UA 2GO7A 2OHFA 1DELA 4E14A 3I6YA 2AFIA 2PKWA 1JZSA 1T1RA 1T4MA 1X8LA 1V95A 3KUDA 1PKXA 1ZFNA 4MLCA 8ABPA 1YVUA 3EASA 4KN9S 4JQSA 5HTKA 1WHTB 1EHCA 3AP2A 1NATA 2QAGA 4NYJR 3GOHA 5AW2A 1V1MA 2ZQZA 3OLQA 2OHXA 1LJLA 4PEVA 4C43A 4AXXA 2WMNB 1KNQA 5JYBA 1KFEB 1WXEA 4URHA 3FPBA 1IRXA 1OFTA 3B36A 4Q1CA 2V4ZA 4JGIA 1LVGA 3IUQA 2RDMA 4S1NA 4Q4LA 5B64A 4TL9A 5CB4F 3EW7A 5DXAA 1MB2A 3MILA 3PICA 4KDEA 1J2RA 4UUPA 4V0NA 2PRKA 4JB8A 1FFAA 2H2FA 3DVAA 3N1UA 1BG6A 4WZZA 4D9FA 3WGJA 1YUMA 3MBKA 1MQ8B 2EP5A 1RHMA 1ZN9A 4UPEA 1XAGA 3OP1A 4NDZA 1KEVA 4MVYA 1W0JA 3C6MA 5EP2A 3SJUA 3BTUA 2V4MA 3E48A 1BFUA 4LZJA 3U3XA 2J0UA 3QOFA 1GTVA 4PSUA 5K20A 2ZUFA 4TYMA 4BUJA 2PWBA 2Y1DA 2FEPA 3WWYA 5JRJA 4PO8A 3LCVB 1BSVA 4LVOA 2O50A 2Z58A 3O90A 4AZ0A 3Q10A 1DAOA 1GN9A 5EGNA 2DAPA 4NK4A 5MN5A 3HDTA 5I4IA 1H3FA 1H4TA 1N7IA 4L08A 4LHVA 3SDZA 1KFKB 3N75A 3OZTA 4QAQA 2EEPA 1OREA 2D1FA 1P81A 2CYAA 1J9GA 3DB1A 2E4WA 1JYSA 4IIJA 3DLCA 2PNJA 1LB1B 3RUCA 3LTNC 4WTOA 5AP9A 1U1EA 2BZSA 2OCBA 3IPAA 2VSQA 3NNDA 3ZHQA 4J0DA 4YMUA 4BFYA 4IQGA 5AOBA 3E7DA 1FFGA 3E22B 3H2HA 3QF7A 4MQMA 4P4GA 3DLTA 5ALSA 1S1CA 3PC8C 3IAEA 4G0MA 1UKBA 1JQ3A 1P9LA 4F21A 1ZJWA 3EPPA 3L0IB 2UVDA 3TE7A 2EQBA 3SR4A 1UXGA 4PQFA 4MGHA 1P91A 4E33A 4KQGA 3NI2A 4TLDA 4HBZA 3VR0A 2I66A 1WA5A 3LFHA 3L8FA 4V0KA 1NXTA 4UTPA 1W48A 4LJLA 2O4UX 1GZSA 3DMHA 3TL2A 4UMFA 1TA9A 1TIKA 3DC2A 1HOTA 4W8HA 3I5UA 4MS4A 1HRKA 1XL0A 5KDLA 1VKHA 5THXA 4LF7B 3KJHA 3PPIA 2ZBEA 3G0IA 4PZEA 1OV4A 2BZ1A 5DCUA 5ALPA 3L7BA 5ADUS 4QHSA 1SQ6A 4R7TA 4BMYA 4ER5A 2AFHA 4ENWA 3RASA 3W0LB 2PE5A 1Z75A 5KNCA 3JYLA 4I81A 1E6UA 1BXGA 3KB6A 2COKA 2PNFA 3G59A 4ZI7F 1FZTA 2VBIA 1K08A 3RARA 5AM5A 1XTIA 3G9QA 4B48A 2HQRA 3I1IA 4AKEA 3FF1A 5L4NA 2FR1A 2VZ9A 4I55B 1TB4A 1EUCA 1GFZA 5CK4A 2J7PA 4FSHA 5EVCA 1U4OA 4XDYA 1SKYB 1ISIA 4OEHA 3K0HA 1P5HA 5JH7B 1NULA 1LVHA 3LK6A 1OA1A 4BBZA 4EUFA 1NNEA 3DMPA 4GYKA 2YXLA 3M6UA 4RL6A 5M3BA 1C3LA 3WB1A 2PFKA 3KCQA 4NV1A 4BQSA 2C0QA 3C16C 3AWIA 4JT4A 3HJAA 1CUYA 2E4YA 3AG5A 3I2FA 4FDLA 4KBYA 5B4TA 1KOGA 4HUQA 2H2AA 3UC5A 1X87A 1KK1A 5KNBA 5IZCA 3T5MA 4WOCA 2GZ3A 2LCQA 4Y98A 3ANSA 2R6HA 4MUIA 5T67A 1W36B 4ITVA 2BEWA 3GXBA 5LXTF 3PYMA 3L7LA 3LCJA 5J5VA 1T1JA 1W44A 2H11A 1F51E 3DZFA 5F7OA 3KUXA 3PNYA 5A4FS 1GZVA 1KEUA 1SPXA 3KDPA 3MFYA 3A1FA 3OO0A 3VSCA 2E9SA 3WLQA 4CKBA 3GLIB 3LCMA 3ZKWB 1AVTA 3KP1A 3BRWA 3MYYA 4CHGA 4F06A 5B37A 4GGPA 5L7WA 1IOVA 1WMBA 4I9GA 1ZU4A 3Q7TA 3KQSA 4HNHA 2WTEA 4GR5A 4Q4CA 1FDUA 3OEWA 4J9VA 2CKMA 3NBYC 4US0R 1SC4A 4ETNA 1WY7A 3E3AA 1EQ2A 5CM9C 2R6DA 5AJHA 3KR1A 1QH0A 1JXAA 1QGAA 2HSEA 3DAFA 3F4LA 3IQWA 1AQ6A 1L4FA 1OBFO 1NBOA 1X1BA 4D5EA 2XJ9A 3INYA 2FRVA 2I8LA 3LW8A 4XVRA 4OHWA 1TNDA 3HDJA 4BN5A 1GRNA 4NE9A 1X86B 3C7CB 4ZPXA 3IT2A 1DFIA 1W8DA 4YUVA 4OQDA 1CQPA 1O6FA 2QP4A 4HI0E 4RTOA 2AEMA 3MGAA 1M6YA 3GHYA 2CNWA 3JQDA 4J0JA 4QFDA 3W4JA 5CA0F 2B2XA 3ITKA 1C9EA 2OGTA 3A3YA 3GLRA 4RTPA 1PD1A 1HWYA 1FK8A 4FYMA 5ELLA 3O75A 4B75A 2PMFA 1E7QA 2QMEA 4AJ9A 2VAWA 4H1WA 5ES4B 4KDRA 3MRSA 3QHAA 3TNYA 4D9NA 3KTAA 4CL2A 2B83A 1CY6A 1C3VA 1VSTA 4BS9A 5ER9A 3G6KA 1N2CA 4HN2A 1N9GA 2ZI3A 3ORRA 1R6TA 4P3KA 5B53A 5CFLA 1FUIA 4QTUB 2O2DA 5BWLA 2ZTMA 1L5NA 1NUSA 1X8XA 1VJGA 3VISA 1H0SA 1D2HA 2OV8A 4HDMA 3L7IA 2BFEB 5TS3A 1H23A 1VBMA 3ZCPA 1VIAA 4GOKA 4OHZA 1EMDA 5B6JA 2R84A 4PAMA 5CYPA 1YRQA 2VT7A 2B8WA 3QLJA 4IF4A 3T3MB 1H5QA 1O97D 4EY6A 1AS3A 1ZKDA 3IA2A 5KNCH 3JZMA 1WS6A 2ISSD 3ZQJA 4WCFC 3PQ8A 4RTRA 4N5IX 4W9MC 5D3QA 5DWQA 4LOHA 3V8QA 3HEBA 1Q7EA 5EMNA 4AMVA 5EUBA 3ZW9A 2POQX 5MGNA 5DX0A 1Y1QA 5F64A 1ZUIA 4W9NC 5B5SA 3MCTA 1S3GA 4D4GA 2RGWA 1Q19A 1PW5A 4MK4A 2BBOA 4NP6A 2RMKA 3UJPA 2HK8A 2MYNA 2UYHA 5L7TA 4FNMA 5FIUA 1M7HA 5HRCA 5JJIA 2Y92A 3D8UA 1LQ2A 4Y0NA 9MHTA 4UE3S 4B79A 4EUHA 1U0BB 4WCFB 3P19A 2CBXA 2DVMA 4P33A 1U6KA 3TOSA 3QGMA 3P1JA 2MOKA 3CJRA 4IMRA 2DR2A 4DT1A 4PR0A 1UJCA 4O2BB 5IKPA 1MOPA 3LYLA 1F0YA 5KQSA 2BF4A 1XROA 4GPAA 4BNMA 4XAQA 3D3JA 3O4VA 5LA6A 4ER7A 1U5BA 2V0CA 5CLFA 3VTZA 2I80A 2JFPA 3VKVA 1Y7HA 5C8YA 4EF5A 3GUVA 4CEIB 2Q7DA 4Z0TA 4YMLA 3IKTA 3K1AA 1JQJC 3GRUA 4WGFA 3H1TA 2HA5A 3SIPA 3SSNA 4DSNA 1B8VA 2VUIB 1VDMA 2JBHA 3KCNA 1JDVA 1M2VB 1GQSA 3B48A 3LUPA 3KHTA 3QLVC 3WKAA 2CK3A 3V8RA 2Y05A 5KQPA 3HCWA 3G2PA 1GO2A 5TY0A 3REFA 4E5MA 4WXHA 4YCAA 2VAXA 2WU0A 1KVRA 2C04A 3L8YA 3RK0A 3C3BA 1WCYA 4CIDA 1EPUA 5FUBA 3VHXB 3DOHA 3C8UA 3H05A 4RGQA 4YRRA 1T2VA 1O95A 3OKAA 3NQ41 3NETA 3K1ZA 1JNYA 5KO2A 2XTJA 1ZHHA 2IYQA 2RGYA 1QAMA 4MKIA 5BYJA 4LYFA 3EIEA 1Q16A 3F4KA 3IUJA 4LRWA 4Z54A 2BGKA 3DHYA 2GNOA 4UUNA 2GBCA 1H2XA 1XA0A 2JJ1D 3GFRA 3LLVA 3M6LA 3O4IA 5FFNA 2O8BA 1BX3A 5AHRA 2NQTA 2P41A 3FN4A 3T61A 4YUYA 2PBZA 1J56A 5EHIA 1QANA 1KJYA 1RQRA 3E5HA 3MJRA 3AZQA 4K9KA 2CHEA 3FYSA 1LTHR 4MRVA 3R8FA 3RNOA 1PIWA 3LDAA 4K2HA 3IIJA 2DPYA 3HEAA 5ALJA 2BDUA 3VX3A 2H1RA 2ZAOA 1RWOA 5B2ZA 2BFBB 4FYJA 3DG9A 4ILEA 3EOAI 1UQRA 4OM8A 1EXDA 3OZFA 4HDKB 1PE0A 2QORA 1FMJA 3NBFA 1YBVA 3EHDA 3SQLA 4LI0A 4PLCA 3CISA 1FSSA 3KK0A 4RQBA 4D5GA 1EDDA 1AB6A 2EX4A 3LQKA 4MRNA 1UDBA 1RJGA 4WBXC 3IE1A 4F9EA 4D9CA 3AVXA 3PT9A 1MRNA 1K06A 2HCBA 5KYGA 4I50F 4LAFA 4MV1A 5AKKA 5J1SB 5FQOA 3TZQA 5AIAA 3RS4A 4A6DA 3FDJA 5AKGA 4LJ5A 3CEMA 1MFPA 3WVNA 2R6ZA 2IE8A 1DS6A 2JD0A 2YS6A 2ZYUX 1H3NA 4LYYA 4U9IS 4MINA 4NQZA 1VG0B 2FUNB 4AB1A 3ZVLA 1ZN2A 2W2TA 1CRWG 3BFVA 5HUHA 3MELA 4BBAA 1ML3A 3NX4A 2JHFA 3EE6A 2I9KA 4WK4B 4OLFA 2RJOA 3K70B 4N41A 4HX9A 4UE6A 5B1HA 4PAWA 3N2GB 5HK9A 1GCOA 1LNSA 1AKTA 3ZOZA 3EJWA 3PHLA 1ZI8A 1LW7A 1Q92A 3O03A 4OMUA 3C8DA 5D6NA 1QTRA 1L5OA 4IICA 4WHMA 4XYEA 5T41A 3O8LA 4QXRA 5REQA 1EK2A 2XB2A 3OVMA 2IDZA 5AKIA 3KR0A 2WVHA 3V1MA 4RM3A 1RXEA 2SNIE 5E8RA 5JHHB 4D4MA 4JENA 2VP2A 2I7VA 2WWRA 4J6FA 2QX9A 4M60A 4Z8XA 5DIZA 2TMDA 2EARA 1GRVA 3H6HA 2YWBA 4RHEA 5AKXA 3ZW7A 5B1IA 5F7JA 1R2QA 2Q28A 5H4HA 3VHXA 2Z3VA 1CQJA 2BPOA 3LWBA 1ZL2A 4OXXA 2ECOA 5A1JA 4LYEA 1XN4A 1T2CA 1TCCA 1G8AA 1TK2A 1Z0DA 3M82A 1U7HA 5DVZA 2FU5C 3VH2A 4DMCA 1Z6QA 5LDHA 3GVHA 3NM6B 1CUHA 3A4TA 4IL5A 4TL6A 4X1IB 5ALFA 5IJAA 3ABRB 4AWBA 2G4VA 2NV6A 2PGNA 5HDQA 3ZTTA 3MTGA 4JVSB 1NVFA 1E66A 1R00A 1WZEA 3C5WP 3SEZA 3ERCA 1X14A 3FYUC 4QBKA 3II6X 4LBZA 1E3MA 1GQYA 2RK4A 1GPMA 1FJ2A 2O0MA 4F5ZA 3QOXA 3Q6NA 1R4MA 3D7LA 2ARKA 2BGTA 1PR3A 1OZ0A 1C1XB 1MVNA 3M2PA 3T5GA 1JG3A 3H2SA 4NJEA 2NTNA 3V7FA 2GPWA 4P2GA 3SX2A 2PEZA 4GVLA 4J7XA 4KP7A 4RX1A 2WA2A 1WCWA 3DV0A 1FRNA 3BYZA 4BFCA 4C0WA 4EFDA 2W6ZA 3QTBA 3N2IA 4BAZA 2C9DA 2OAGA 1IB0A 2IBSA 4OH7A 2VZLA 5C7YA 3TL6A 4B4VA 2X8WA 1CY7A 3AIOA 2O14A 2A86A 3RVOA 3KYDB 1MB0A 5CFRA 2F1JA 1EWKA 2GHIA 3C8ZA 3CX3A 3G7SA 4R6WA 1ZMBA 4MA0A 5BT9A 1W96A 3DE0X 1CDOA 4AMUA 4D79A 2NPIA 1T0PA 1NJGA 2A3RA 4GRAA 1IJFA 3AHIA 1XFDA 1WEKA 2I6XA 3L4KA 2XZLA 1KQPA 3GNTA 5AJVB 1BD4A 4Q9KA 1I4WA 2GEFA 3CMMA 3KSMA 4HG2A 4DFDA 4RMJA 2PXAA 1CY1A 2Q7XA 4WJZA 1EWQA 1V4VA 3DQQA 2Z04A 2XUJA 3D54D 3V4LA 5CVDA 4HB3A 1YO6A 2NXEA 2HADA 3S2UA 1BW9A 2XA9A 4C4SA 3NIWA 4RPCA 3OTGA 2W6QA 1R9JA 1DXYA 3T5AA 4I7EA 1ZH0A 1P29A 3FDZB 1UWLA 3O9VA 3RYCA 1USGA 3LRXA 4EHDA 4RA6B 1D7OA 1RZVA 1QV6A 1LK5A 1Y9DA 2VSFA 3AHGA 4JT9A 1F3OA 1SD1A 1G64A 3JARB 2BY4A 2O1XA 1OV6A 3W05A 5FPSA 4BNYA 2CMFA 2VRCD 1T2EA 4JMLA 2RKBA 4DT1B 2C31A 3SJBA 3D8BA 2O2CA 1EP1B 5FBHA 3T0FA 4V3CA 4C6TA 1JMVA 3UWMA 5B2FA 2V6GA 5G4LA 4AKTA 3MT9A 3PDHA 4IXNA 3KAKA 3E1KA 3ZCQA 5J2UF 2DQ4A 2ZJ5A 4WZAE 3EEQA 3MTAA 1WW8A 4A92A 1QGUB 1E99A 1I24A 1ECCA 3SXUA 1GRQA 2XWBF 3W2IA 4PQYA 3UH1A 1Y33E 1PR1A 4MKFA 1HT1E 3ZK8A 4DAEA 5JCZA 2C7PA 2WF9A 3NJ4A 1FFDA 1HK7A 1U0JA 1Z4MA 2IX9A 2WTMA 2X1VA 3C3PA 3K8ZA 3OOSA 1USWA 4ALKA 3JALB 1P8JA 2B99A 2IBMA 1NVWQ 1LBQA 4NEQA 4B4UA 4B6EA 1TUEA 1Z88A 2XNDA 3B85A 4ADSG 1WMFA 4ZOEA 4GYYA 1VYTA 4PGGA 1P60A 3SEQA 5KTMA 3VPFA 4WA8A 2BGRA 3GR6A 4F72A 4MV9A 3X1JA 3AQIA 2B98A 4FHGA 3SJAA 2ST1A 4X7RA 1KTIA 2CDBA 2JFUA 3TW8A 4XEHA 3LBNA 1EHYA 3VI4B 3UPTA 5CIYA 4AQ7A 2JLRA 2K2WA 3NAQA 3VAAA 2EF0A 1DCMA 4B7XA 1G6HA 1HE8B 1K5PA 5AVKA 1FQWA 3TGWA 2ZAIA 1GTMA 3OA2A 2CGEA 1C3JA 2IYSA 3M1AA 2H65A 1H69A 1U63A 1VE3A 4J2TA 4GF5A 3FCUB 3PUWA 1UR5A 2XQJA 1NW6A 2Y0CA 3DEKA 4X91A 4DYDA 5JARA 3HJUA 4KNWA 2B1IA 1NP6A 3BRCA 4FILA 3E53A 1YB5A 3GGJA 3H1PA 3KOMA 1MHTA 3S7ZA 4KRGA 1ILWA 1TMGE 1ZRNA 1F4LA 1G17A 4Q9DA 1DO0A 1SG6A 1WZUA 2J30A 4QBGB 1P7WA 4RJIA 4Q3DA 1CUAA 2F6RA 2AFHE 4Y9SA 2HBRA 1D6SA 3V4SA 3A9SA 1GUDA 3SJCA 2Y8EA 1FNSA 1M5UA 4JWTA 5TMBA 1D1TA 3OCYA 4J4TA 3IERA 3LUDA 1P73A 2BFWA 3COSA 4NNPA 4M9SA 3ST7A 1N5LA 1M2KA 1Q1AA 2R47A 3LMKA 1Z2EA 5TXGA 3KOZA 3AG6A 3HA5A 1NN0A 3WGTA 4DCGA 4DNOA 4R0MA 5BQXA 3DOEA 3VPBA 5IMSA 4PYJA 3WMRA 3H5AA 5DNWA 2ADOA 3AL0C 2GKOA 1J1UA 1L5MA 4ZZIA 5BNWA 1HL3A 3DMFA 5CT4A 4NCAA 3FYTA 4JVOA 4X8LA 3K7EA 1N9GB 1BE0A 3L4BC 4GMGA 1MX9A 1LF5A 1LJ8A 4NYJQ 2PT9A 2Z5VA 4Q3NA 3AHFA 2CKDA 3KSUA 2KWIA 4RV9A 1RWPA 4XIGS 1H0KA 2GPAA 1M7BA 5SY9A 1MW9X 2YWXA 1SBQA 1RXIA 1IBKB 4NF2A 4D8VA 4J1QA 2R2AA 4RV5A 1PVOA 2ZJBA 3M89A 2OCDA 3K05A 3RVQA 4BXOB 2WIKA 1YQWA 5SV2A 5JHGB 5LVAA 4NPCA 3MWDA 3I6ZA 3F6EX 1GPDG 1TM5E 2JGKA 3A31A 3EXHA 4J0FA 3KQHA 3GLKA 1RPNA 2WNSA 2IPLA 1FUKA 1WCXA 2O2JA 4JOBA 3FYDA 4NMMA 5ARDA 1T0UA 1HOXA 2WUEA 1TRHA 2Q99A 3HO8A 1SCKA 1YDFA 3SZLA 2A8YA 4E88A 2W4IA 3PSAA 1DPGA 2V98A 2A4KA 2OM2A 1JPJA 1PO7A 4QWWA 5FEMA 3WOHA 2PGIA 2CFSA 1EQAA 2I2CA 1T26A 3AFNA 4PC7A 2AN9A 4S0XA 4F7WA 5IBPA 2JLWA 4GXNA 2UYCA 1DP4A 1S0UA 1XVVA 5B7NA 1K7EB 5JG7A 5DM1A 3SBXA 4DBLC 5A3JA 2OENG 1CUFA 4M7OA 3ZV7A 2PZAA 4CGZA 4P4SA 5HNKA 4M8LA 3U4DA 1GY8A 2EQAA 1XAIA 3ACBA 1JBQA 1SKMA 3IQGX 4GICA 2XXAA 1BCSB 5H8WA 3A3KA 1I4DD 3IBTA 3G8CA 4ISBA 5T4BA 5JJBA 1H2AS 3S99A 1E3WA 2JFHA 3F6BX 2G88A 1N8KA 3BOSA 4LQCA 2CXTA 1ECPA 3NUGA 3OTQA 1L9KA 2YQZA 4G0NA 4BO7A 3QE0A 4N0EA 1V1JA 3UAZA 4LV5B 2WJGA 1IZ9A 4ZVTA 2HHJA 2PMEA 3AYXB 5DSTA 4PRYA 1U0NA 5TPWA 4ENUA 4PG8A 5ILOA 4U7DA 3MSXA 3TIIA 5HIAA 3QIVA 1YVRA 2XCLA 2R4TA 5CT8A 1AKWA 1ULAA 4B31A 5FBRB 2O8BB 1K75A 3DE6X 4MV0A 1DARA 1PQ4A 1U3GA 5LXTB 4LHEA 5CXQA 4JNCA 4C89A 1SB9A 1SCJA 2RBKA 3LKBA 4G67A 1XQXA 4EJ0A 5BUQA 4H0NA 3THWA 1G18A 4PX2A 1O9BA 5BSWA 1QIFA 4R2HA 2FQYA 1WVMA 2QD3A 3L2OB 3M83A 3QSGA 3EF3A 4IDQA 3L7JA 4M8NE 3PHJA 3OY7A 3M49A 5BSFA 3OOYA 8ATCA 4RLFA 4DTIA 1A95A 1JQLB 3BXFA 3LNTA 2CF6A 2NIPA 3R4CA 1MOZA 1MDFA 2DB3A 5D7NA 1YU9A 2IYEA 1W75A 1BN7A 1GV1A 4ZFNA 1UC5B 2NLOA 3NANA 4F92B 4G65A 5ITZA 2ORWA 1KP9A 4GAEA 4YIKA 1E8MA 1R0CA 5LUAA 5AI6A 1Z7WA 3FPHA 1DI0A 2CNDA 4RS4A 3UCEA 4DS3A 4JB3A 4UHFA 4FMCF 5FJJA 4PN7A 1S9HA 4GNRA 2QKYA 3OEHA 4D9MA 5HVNA 2KHZA 4HKTA 5T64A 5JCPA 1NT2A 4CVNA 1OT5A 3ROQA 2XA2A 1K89A 1BROA 1E6WA 2OHVA 4G6ZA 3R6WA 4KIWA 2Q5LA 2XGMA 3P9SA 1XI2A 4HWOA 1JN0A 2NO6A 3LUJA 3Q5EA 4XD2A 1QTIA 1AOXA 1P17A 3V34A 2QRJA 2RGNC 1X7ZB 2Y4OA 3G7NA 4QTZA 3T9CA 1JH8A 2ODWA 3NORA 2RGNA 3TG2A 1CR4A 4Z9YA 4TMZA 3RUFA 5GIOE 1WQ1R 1I3CA 2PD3A 3PE3A 3H2KA 3LUGA 1JDTA 2OFOA 3KLNA 3MCUA 3TW0A 3T41A 1OVMA 4FDTA 5GGYA 4C78A 1OIWA 1KQ3A 2AXEA 3KHKA 3NS7A 3C70A 4NICA 4BYMA 3TWOA 1MKYA 2FZ5A 3ZGYA 1F0PA 1KSHA 1NN5A 3S44A 2O3SA 4TTSA 5FI3A 3WP1B 1MQAA 3GT3A 3KVOA 1QH1B 1P74A 3LHSA 3WGLA 2FWIA 1QYWA 1UBFA 3DPUA 2H63A 1RDFA 2HQOA 1DKUA 2AEEA 2ATCA 4RVNA 4BV2A 1YS2X 4HAWA 1XZLA 2AI1A 3C3EA 3OE5A 5SY6A 3M3DA 3X1WA 4IDDA 3FZEA 5IT0A 1Z13A 2R6CA 3I9NA 3NEYA 4DG5A 5KNBD 2FJUA 2GVDC 2PQ0A 1YCDA 5I6DA 4D80A 3OZXA 3AKZA 1L7DA 2IF0A 4KW7A 4MQFB 3D59A 1VXOA 5ED4A 4BKUA 2VYQA 2W6PA 5EJFA 4CCSA 1G42A 3R76A 1PJ8A 2HLHA 2IIVA 4RCZA 4CM1A 1L7BA 3K9LA 3GELA 4PTYA 4UDOA 4L27A 4YAWA 4W8OA 4YR7A 1EQUA 1NGSA 1ADGA 1LX7A 1T9HA 5CPFA 2WZCA 1XNJA 5C8YB 1JHAA 3CZ5A 1CUVA 2QV7A 2VJBA 5DM60 4RD6A 1WUIS 1M2WA 1ODSA 2D06A 2Y66A 2YJNA 1XTBA 2YY6A 3OP4A 4XB2A 1CG6A 4XOIA 3SLKA 1KEEB 1XD2A 2B5VA 2D13A 1PGQA 5FF9A 1DCFA 1KI3A 2VNSA 3NCHA 3X44A 1NI3A 1RXSA 3Q5DA 4BVAA 2E5LB 2H5LA 1YFKA 3VAZA 4ARZA 2XTMA 4UU8A 1Z47A 4CNBA 4FFLA 3C8MA 1U7XA 3WGOA 1Z07A 2VHJA 4ZIRB 3F5QA 4JBLA 3TLGB 2QLMA 4UHCA 4S35A 3Q2IA 3OKFA 4MAAA 1L5SA 5K3OA 2ID9A 4LWPA 3G8DA 3QJYA 4O4IB 1KMQA 5LBUA 1P0PA 2VHCA 4LI3X 4C4XA 3E9MA 1Y9AA 1AKVA 4LZOA 1G8SA 1R66A 2AC7A 3ZX4A 1RPAA 2EIXA 1P3DA 4DVGA 3WK6A 4G5RA 3RYCB 1UQTA 3I53A 1LCIA 2GYUA 3TW8B 4D4LA 4ENQA 5C4IA 4ZCMA 4W5OA 4CT0A 1D4AA 1N0WA 4BEVA 5A9SA 1ANKA 1CY4A 1RMQA 3ZWDA 2FKAA 2AG1A 4MR7B 1C7ZA 5JLAA 3VKFA 4UHKA 2FPLA 3WHIA 5JD6A 3PEYA 5B4UA 4M1KA 1IG0A 1P9WA 1WKVA 3FHLA 3RRZA 3CC8A 4YALA 3ANYB 5DWDA 3PTAA 3OE7A 5B1EA 4NOKA 1U5CA 4HUQB 4EPVA 4RCYA 4WADA 2DWCA 4X7PA 2PGXA 1Y1KE 3WNBA 2H8KA 4MB2A 4E2WA 4RHTA 2O8FB 1NNI1 2G9QA 2CHFA 1U11A 2X7HA 2EFYA 1SVUA 3HNPA 4UBNA 1P0MA 3VUFA 1ZGBA 1NMEA 4N0DA 4MUGA 3UTDA 1HDGO 2PGAA 5T8KC 2YWHA 1JDZA 4QOJA 4DANA 1NTOA 2WWIA 4S1VA 5B1YA 5BN4A 5M2QA 4QJIA 1OFGA 3GUYA 4CMBA 3QXXA 4O2RA 5BSRA 4HH4A 4RHCA 4CE6A 3PV0A 4DSTA 1SH7A 5D5QA 3IYLW 3R5HA 4NESA 5JLJA 1AHIA 4EM6A 3ZD7A 4U4AA 5JNVA 1FP4A 2QAGB 4P0PB 4C7XA 1E2LA 2VEOA 4CFZA 2P2YA 2EDCA 5CYOA 1QHXA 2JAUA 5JCJD 5I3ZA 2YXBA 5AXDA 3PGJA 5L3ZA 2HK9A 4CM8A 1XZFA 2FZVA 2OPHA 4MW2A 1FSZA 3ZU5A 5CW2A 1US8B 4KGVA 1P8AA 5K2MA 5NLLA 5SZJA 3DHWC 2B8JA 2IOQA 3TPCA 4HZUA 2GM5A 1XZMA 5C5IA 2BW0A 3UG6A 6AT1A 2WWTA 1C3XA 2XUFA 4YJKA 3DD5A 3RAFC 3L05A 2EJVA 4P7BA 3HKEA 2GF0A 4R2WA 3S2GA 1KAMA 5IVHA 1EKXA 1V37A 1ZC3A 3CBGA 5FLYA 5L8VA 3VRHA 1H9AA 4H3HB 2WWWA 1U6JA 3OQIB 1QUEA 2XMSA 2ZYWX 4GQBA 1KZGB 3COWA 4DA7A 5IFKA 1J22A 2NT4A 5JATA 5KWIA 1EIWA 2FUKA 1Z83A 4AJ2A 3MERA 5AKYA 2VG8A 5DM0A 4BQOA 2MR6A 4Q9NA 3Q8MA 2HQBA 3HCFA 3EIOA 4PQGA 1WOYA 4ZAXA 1EK6A 4NU0A 4UFNA 1I01A 4CBVA 2NADA 1CZLA 1HGXA 4I2NA 5BPFA 3L5KA 4XX1A 4JP3A 1I9GA 4NRDA 1TEHA 4PPFA 3AMVA 3E9RA 4EPXA 2AG6A 2YDXA 4Z1MD 3GEBA 1EM6A 1KYWA 1Z28A 3QPVA 4LDZA 3VDMA 2C4WA 3LX6A 4PSAA 2V6MA 1YZYA 2PUJA 3ONDA 4QDZA 3ICEA 4EX7A 1BH6A 5J47A 2IZZA 4CR8A 2Q8PA 1SJ9A 4IINA 3ZNNA 2GN9A 4TKUA 3SNHA 4FQ8A 3AEYA 4ZKEA 1VGQA 1BA3A 1E2MA 3SPXA 1OX4B 1RM3A 2NU6A 1UWCA 3WGZA 1U94A 3SD7A 4PO9A 3DMYA 3GAMA 1HA3A 2AHRA 1V3TA 1BHQ1 3H1BA 5DPMA 2Z2ZA 3A7EA 5FHRA 3CNOA 2LTAA 1XFAA 1J8YF 1S8FA 3O4GA 1TU4A 4GUDA 5LD2C 2IY8A 4B2YA 2V54A 1KP2A 4HQOA 3W77A 2BJVA 3EGXB 2JEZA 2ZUWA 4XQ0A 2I62A 2Q0XA 4U5XA 3MWGA 4ZQBA 3MCAA 3WTCA 3DDSA 3I09A 3IBFA 4MUMA 5D7BA 1ULZA 4Z3DA 3JRXA 4OO3A 1FYVA 2JJ2A 2VHWA 4YASA 3T34A 4TV9F 1Y5RA 4Q3AA 5MFZA 3AR3A 2CBZA 5F33A 3SM3A 2CHVA 3B5IA 3KQQA 1ARZA 1S01A 1XMPA 3EDMA 2YWFA 3S28A 2WD8A 2HHHB 1UINA 3EPRA 4MEJA 1KEEA 1JDBB 4X1KA 1I1HA 4RYDA 2JFZA 3D6MA 1YJAA 3AFGA 2E3JA 5GV7A 4CM4A 1KORA 1U7OA 4DRXB 1E6EA 5F9HA 4ZT6A 2G9ZA 4QOEA 2P2NA 1MTOA 3HRIA 4BXOA 3EWAA 3A4IA 3SOPA 3AEZA 2IXBA 4WY5A 3BKXA 4O4HB 1DZIA 1R8JA 4QYIB 5BORA 1E1KA 5HOEA 2DQSA 3LY5A 2OO5C 3BBLA 4G9EA 1TLLA 2D4HA 1NDQA 3BRWD 3E6AA 4AUNA 1LC0A 3IJ5A 2GD0A 3MJDA 3PTZA 4FI3F 5IM5A 3TOZA 2VDVE 4NV0A 1WU8A 4ENTA 2D5CA 4OJYA 4UAVA 4UDNA 1VSUA 5FLEX 3L1JA 4ME6A 3WWZA 1KXZA 4ALMA 2B0JA 2J07A 4BLTA 4KTTE 1ZXXA 1AA9A 2IX3A 1Q1EA 3I3OA 1D6MA 2IIQA 1E5XA 1XLUA 3NATA 2VH1A 1HRDA 1VJRA 1R5JA 4QA9A 5LZ5A 4UVHA 2I0FA 1P44A 1USIA 3CNQS 1HNZB 1II8B 4BVLA 4M21A 4IXDA 1O94C 4XB1A 4D9BA 2JFVA 2Y9MB 4KFRA 4KPUB 3ET4A 3BB3A 3IQZA 4NFYA 621PA 1RAHA 4Q03A 1MT0A 4L4XA 4Q05A 1J8DA 4N47A 5JZVA 3IEUA 4O02B 4I3FA 1DKRA 2NV0A 3PKIA 1CB7A 5EKUA 5IMBA 3HU3A 1XB2A 3IGFA 1EJBA 4FCTA 2JAWA 2OV1A 1J5XA 3WBJA 4CEHA 1LH0A 2DUNA 1JVSA 3ZE7A 5HHTA 3JASB 1J09A 3AVVA 4D82A 2C3UA 2G08A 2VDOB 1J25A 1JL3A 1KVTA 1ODIA 3I32A 1PEDA 2H2WA 4MV5A 4O4JB 3HR4A 1ZNQO 1Z5GA 2O07A 2C1XA 3HEMA 1C1DA 2HNAA 3FTFA 2NTYC 3VSEA 2V3CC 2D62A 4RY8A 2ZUBA 4JC8A 5HOQA 5J4LA 3OCUA 4IDBA 3IBCA 3OM1A 1KR5A 5EC8A 4BLQA 3BRSA 3G17A 3OF3A 1CS0A 4KODA 2H1SA 4BN0A 3MBOA 3HKCA 3CVXA 4AWXA 1FW8A 5AVRA 5CCBA 4QBTA 2PL9A 1P39A 3KKKA 3OZRA 1ISFA 4MI9A 3ZDQA 1WQ3A 2X5KO 3DAGA 4ECEA 5AVWA 2C61A 2YJTD 1NMZA 3DO5A 4R4JA 5FL3A 4WNIA 1CEEA 1E1CA 2EFDB 3EVTA 3OX3A 2HUNA 1K4MA 3H9UA 4LBVA 5HRUA 1EGQA 3VKUA 1KO4A 4DV6B 1T5DX 4D4IA 2WJZB 5JJKA 2OWEA 2XQKA 1ESCA 3U13A 1WXHA 4YBZA 3O38A 4OQXA 4CRWB 1EBBA 2AZTA 5P8WA 4C20A 2VHZA 3NFYA 1H5UA 2J3JA 3ITNA 4EHBA 3PR3A 2PL5A 4BGVA 1LD3A 1I6MA 3TVYA 1WZ2A 2QUKA 2LRHA 5HUJA 5EMHA 3B60A 1JEOA 5D3ZA 4KN6A 2FWPA 2WB2A 3QNMA 3TZLA 3MWYW 3ZV6A 2D7JA 2R68A 3F9RA 4GC9A 3HLTA 3U40A 2Y9PB 2DETA 1XQVA 3WGQA 1OXKB 3R77A 2AEFA 3DAPA 1JLSA 4Q6WA 5JNTA 2EJCA 1UBTS 2QUJA 1GZ5A 4J7AA 2YZ2A 2YC2C 3RVBA 1DINA 3VPSA 1A9SA 4XCVA 4B73A 4BUCA 3BGDA 2SICE 3PVSA 3T7RA 3KT0A 3QYAA 1XT6A 2OA0A 3MJTA 1HYQA 4QQKA 1SUBA 2J3KA 1JIUA 4E1BA 4UXIA 1LI4A 3OZAA 1G1AA 4BEJA 1SZCA 5AM2A 3G0CA 3EODA 1OFHA 1L3BA 3X2EA 2VJMB 1RXVA 4PNPA 4EHLA 3B5EA 3DPSA 2KLHA 2APJA 1KO1A 1QGDA 3BMOA 3FW1A 2W6CX 4MW6A 4R54A 3ZC3A 4EZEA 3TGPA 1UMKA 3OQOA 1JMKC 3RCBA 1YGYA 2GOYA 2NYAA 5CYFA 2I1WA 3DJYA 3ENWA 1UJ5A 1RAEA 3ACCA 5FL7D 3W1WA 3LX5A 5K6TA 4D25A 4M86A 2CCKA 2O2EA 3CONA 3LUFA 4ITRC 4N40A 2GEDA 2E82A 1V48A 3FLEA 3H11B 5GQSA 2BEKA 3IPCA 2I2DA 4LSWA 2G70A 4N9WA 4X97A 2IOHA 3SFZA 3TXYA 4OMCA 3VU9A 3WY9A 4FWBA 2O8CA 5L95A 2HIGA 1VJ1A 4DLUA 3VH1A 2ZK7A 2ID8A 2ZVQX 3KUCA 2GF9A 2CUKA 2OLKA 4H17A 1D4ZA 1U2PA 4YS6A 1DG3A 4YIHA 3GH1A 3L84A 4E3WA 1VECA 3QHQA 4CZ2A 2FN9A 5IDWA 3USES 2JCBA 1AF7A 2L17A 2Z8XA 1G20A 2WF8A 1GCAA 2XIQA 2R8PA 3G79A 1A2QA 3G2LA 1XVLA 4GOOD 4XFKA 3TK1A 1DIGA 4F9GA 3RC7A 3GDWA 1ISSA 1E58A 4RJJA 2WFLB 1QVAA 2O2XA 2L42A 1KFCB 1SXPA 3ZBPA 1QHFA 3PEEA 5TJ9A 2BR4A 3SC4A 1AO0A 2JFXA 3RIHA 1NVUQ 4HO1X 4RPHA 3ZHVA 2GGSA 4H08A 2M6KA 3ZV5A 4UCWA 3LKDA 1ZHOA 1A88A 4NZ9A 2D74A 4U2DA 4UDXX 4YJHB 1AGXA 1G7CA 2YOGA 2ZIVB 3WRXC 4URXR 1KARA 1DIBA 1E3LA 1U8YA 2XNHA 3DO8A 4G4SP 4KPFC 3F71A 3NHMA 4NBSA 1M5TA 4BQPA 1WQ4A 1U0TA 1H42A 2GILA 1UPAA 4EAQA 10MHA 3NP7A 3G02A 4QYTA 1X19A 1CXZA 4C0JA 2P35A 2YJ5A 4P4LA 4HQNA 4TL8A 3R5JA 3MSCA 4MO2A 4CLRB 4PC2A 1PL7A 2XZPA 4EG6A 1TJNA 1QCCA 5L4LA 1GR1A 5CIWA 2RHMA 1GGVA 2C4KA 5ELMA 3R9XA 2WI8A 2ZYDA 4BVGA 1UKAA 3TD2A 2CXQA 2DLCX 2SKDA 1RYBA 2I2WA 3OTOB 2FPUA 1VKOA 2P8JA 2PIDA 4O2BA 5FKJA 1JHPA 4E31A 3OWOA 1QOPB 4CQNA 1GG2A 3EA4A 1SCUB 4DLTA 4W5RA 3CRRA 5DTQA 4KX3A 3G0DA 4AKGA 3UATA 2DFVA 4GMHA 4ZODA 3FJ1A 3U7QB 2AKAB 3K0CA 1G59A 3AVWA 5I7RA 2PX0A 1QKIA 3R7SA 1EAYA 5CLGA 4ZQFA 1Z18A 3ZXIA 4W99A 1FYDA 1FC0A 5JXHA 5CVUA 1C9DB 1N2SA 2JD2A 2KYRA 3V7YA 1S2LA 3JWHA 3OJLA 4RHYA 5T57A 5BMVB 3R9XB 5DK6A 2PJZA 1B0AA 3A1VA 3K96A 3WNZA 3DXFA 2D7DA 4XXHA 2ZIXA 1LGYA 1M6VA 2H29A 4BEWA 5CCEA 1KAEA 2P3SA 2WIAA 1GNRA 1J9EA 2ORVA 1TE2A 3HKEB 4KYIB 3WR5A 3U6BA 1HR0B 1DWQA 2O8CB 3H4VA 4I6GA 2WBLC 3V4RA 2IEBA 1XL1A 2PD6A 3TIFA 3O9MA 3I62A 1NKSA 1OWLA 5AM3A 1VE5A 3LQ1A 4OOEA 1S5PA 4EOGA 4HNVA 3K5PA 3OPNA 4EWLA 4M9UA 2WKWA 4DV0B 2W6JA 5FUWA 1P4JA 3DZKA 4QDTA 2OGZA 2ZJFA 4LVCA 1Q0TA 1KTVA 1A9YA 4I1UA 3AEQB 3USZA 4A26A 2JIZA 4TT3A 5B7QA 2QTVB 2GCIA 3K92A 2H2IA 4GH5A 4MEAA 2X76A 4H1UA 1O0CA 1M2HA 5K45A 3OIFA 4ZMSA 1A2BA 2PUAA 2KBEA 4RK6A 2HF8A 4INZA 3NBMA 1LUAA 2NO1A 2O05A 2QVGA 3KXKA 4IIDA 4JI4B 1H4SA 4E6PA 4G1MB 4IIXA 5EIHA 4YHBA 3X2SA 2WT9A 1TCBA 2ZSFA 1U0SY 4MP3A 3MZ0A 4NENB 3UXHA 1EE2A 1GIAA 2I7TA 2ONCA 4OB7A 4XGRA 1E3DA 1K4YA 2B0CA 4KR6A 1IG3A 3PHBE 3EF0A 5FH9A 1DO8A 1OQAA 2QX6A 3T0IA 2PH1A 4GR4A 4ZVPA 4GIBA 4XYGA 4MYSA 1TUGA 3NYRA 4CI0B 2JPDA 3VFDA 2J4DA 1ZMTA 2H48A 3H2YA 4KO4S 1CSEE 2GUWA 2F7SA 3HJNA 4JBGA 4UPDA 4ZHQF 5JDIA 1Z9BA 1Y8CA 3AUYA 3GLUA 5GADl 3OM8A 3UW1A 3LFTA 3SC6A 3AM3A 2D1RA 3G13A 3I4LA 2GBIA 4R8RA 4EB6B 5AUOB 3HK2A 1GYRA 1R6AA 2PRJA 1Z33A 2HWWA 4MR8A 3TCXB 3ED1A 1G8KA 3NAMA 1YR3A 2IYNA 3K0BA 5L9AA 4UXJA 3AR7A 2YIJA 3SM9A 1PW7A 1DAGA 5DHSA 3HP4A 3O8NA 1E5DA 4NYMR 2GB4A 2WKQA