3A7EA

Crystal structure of human comt complexed with sam and 3,5-dinitrocatechol
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
212
structure length
212
Chain Sequence
DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Hit to Lead: Comprehensive Strategy of de novo Scaffold Generation by FBDD. Part 1: In silico Fragments Linking and Verification of Spatial Proximity using Inter Ligand NOE Approachs
rcsb
source organism Homo sapiens
total genus 77
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a7eA00
3HVJA 3K0BA 1U2ZA 3NVKI 3UJDA 1JQ3A 4RVDA 3B3FA 4U7TB 3R0QA 1BC5A 4X41A 3FPGA 4PINA 4BP1A 3KQPA 4C08A 4CTKA 1BHJA 3LBYA 4AX8A 3OE5A 2GAFA 3MGGA 3G8AA 3CBGA 3BWCA 2ZWAA 5DX1A 2OYRA 2I62A 5H02A 2IH2A 3ORHA 2IP2A 5DTRA 1O9GA 5EGSA 1TW3A 3RW9A 5EEGA 2BZGA 4L7VA 2IFTA 3RODA 1XDZA 3CJTA 3VC1A 1XVAA 4IWNA 5DSTA 1JG4A 4QPPA 2R6ZA 4GF5A 2PX8A 4RTQA 3FRIA 1YUBA 3FTDA 3DP7A 2VZ9A 2YXLA 4QQKA 2EFJA 2PT9A 2G70A 3CC8A 3MTEA 4KIGA 1WZNA 2AOUA 3UJ6A 2ZZKA 3G88A 5FHRA 3JWGA 3LCVB 4C4AA 3KR1A 3DMFA 3G7UA 3EVAA 8MHTA 1MJFA 3A7EA 1JG3A 1ZHFA 3B5IA 2G8NA 3E7PA 5G02A 3CJRA 2G71A 3SGLA 3LCCA 3BKXA 3HVIA 5DRYA 3ELYA 5CVDA 3FUXA 4FZVA 2P41A 1WXWA 5FQNA 3KU1A 4YUYA 3GRYA 5GM1A 4RTMA 4A6DA 4RTOA 1Q0SA 1I1NA 5CVJA 1N7IA 2O06A 2E5WA 3KR9A 1FPQA 4C04A 3B3GA 1XCJA 4P7JA 5EPEA 5K0GA 3I53A 3ER9A 4QTUB 3C6KA 5EKUA 5HOQA 3G2QA 2JHCA 1X1AA 4RTPA 2Z6AA 1F3LA 1QYRA 3BGDA 4ER0A 4FT4A 2Y1WA 2VS1A 3G8BA 5EEHA 4PYIA 2P40A 3IV6A 3KPYA 2FRXA 5EHGA 2XVAA 2ZWVA 4ER5A 3GRRA 5LSAA 1OR8A 1VL5A 1L3CA 5DX0A 3HCEA 3UA4A 4RTNA 4AZWA 3D2LA 4FGZA 3OPNA 3O7WA 3HTXA 1NKVA 3DR5A 4PYKA 1I4WA 3O4FA 5F2KA 3UJ8A 1VE3A 1KIAA 2HV9A 2P3QA 3NDIA 1YB2A 4EKGA 3P2IA 4QDJA 4ER6A 5LQRA 1VP3A 2PLWA 3AJDA 1JSXA 1JR4A 4DF3A 5MHTA 4XUEA 3GO4A 5E9WA 3GDHA 1AF7A 3GWZA 2AOTA 4E32A 5CIYA 1SUIA 1IXKA 3AY0A 3DH0A 2JHPA 3G2MA 3JWIA 1L9KA 3A7DA 2FYTA 3GRVA 2PSSA 3T7RA 4QPNA 1JG1A 1SQFA 5E1MA 4LWPA 2VP3A 1EAMA 4MQ4A 3L8DA 3OZRA 2HR1A 3BT7A 3MTIA 2OB1A 1RI4A 2ZZNA 2AS0A 5DSXA 3RIEA 1Y8CA 9MHTA 1UFKA 3BWYA 2ONZA 1RJEA 4QTTB 2P3LA 3FPFA 5EOVA 4BP3A 1FBNA 1VLMA 2AOUB 4CTJA 3EVZA 4ER3A 4RVFA 5KS2A 5LQCA 5BW4A 5HIMA 1XCLA 2HTEA 2OO3A 4OBWA 3HCAA 2HNKA 5K0EA 3P9IA 2P3OA 3SX0A 4RTSA 1L3BA 2ORED 2PV0A 3OU7A 1XXLA 2F8LA 2C7PA 2OXTA 4BLWA 4YUWA 1VBFA 3I9FA 2NXJA 2R3SA 3BUSA 4BY9E 2AOVA 5D1HA 4E2YA 3QOXA 4RYLA 2JH9A 4R05A 2O57A 1KXZA 5E9QA 1EG2A 1UIRA 3GGDA 3HVHA 3C3YA 2YXDA 3M33A 1G38A 2ESRA 3LPMA 5DTMA 1AQJA 2O07A 1NW3A 1R74A 3PT9A 2UYCA 2I6GA 4ISCA 5E1BA 1YFLA 3CJQA 4E2ZA 1KYWA 2DULA 3DOUA 5C1IA 3TM5A 3FYCA 1G60A 3FZGA 1D2GA 1NE2A 4PYMA 10MHA 3KQQA 3LX6A 1ZGJA 5EQJB 5T6BA 1QAQA 4CKEA 7MHTA 2PXXA 5E2AA 4MTLA 3PFGA 5CCXA 2V74B 1EQAA 5K0NA 3FUWA 2PXAA 3A27A 1RJFA 2CMHA 3GNLA 2JJQA 2V7EA 3OU6A 1TW2A 1WS6A 3GU3A 1HNNA 3KPVA 2FPOA 2GA9A 2QM3A 3P97A 4EKIA 5IH3A 3QV2A 4H0NA 4GQBA 5E2BA 1NW6A 5ICFA 1XDSA 4YV1A 3DLIA 4R6WA 5C9ZA 2AR0A 3QOWA 1SG9A 5HIIA 5D1NA 1RJGA 1T43A 2NXNA 3I5UA 1ORIA 3LHDA 2YR0A 3UJCA 3CGGA 3KR0A 2AOTB 2UYQA 2LD4A 3UZUA 4DZRA 4E31A 2ZCJA 1N2XA 2PXCA 3C3PA 3CCFA 2JG3A 5E8JA 5ERGB 4BLVA 3HP7A 2KW5A 3O31A 5E1OA 1NW5A 1RI2A 2EJUA 2ZLBA 4YUXA 1FJXA 2BR5A 4C07A 4HG2A 4FS8A 2QRVA 1AV6A 3VC2A 4CKCA 1BKYA 1HMYA 3X0DA 1JG2A 4HGZA 1R6AA 3CKKA 3EVEA 5FA5A 2XYQA 3ER8A 1FP2A 1M6EX 2QE6A 1JQEA 2AN4A 4IKPA 3MERA 2AVDA 4PIMA 2ZZMA 3FUTA 1QZZA 2B78A 2VDVE 3PX2A 2PX5A 5T67A 3B3JA 3HA7A 4E70A 4OX9Y 3TMAA 3EVDA 4HTFB 3ID6C 4FT2A 3AXTA 3TRKA 1TPYA 3P71T 3BKWA 3G2OA 3NWEA 3R6TA 5DRTA 1QAOA 2H11A 3DLCA 1P91A 4FSXA 2ZIGA 2GLUA 3LECA 1X1CA 2B9EA 2P35A 3LGAA 4K6MA 5EMMA 4RX1A 3SVZA 5FUBA 2IGTA 2NP6A 2PX2A 2EX4A 3JWJA 3DXXA 4CXMA 2OBFA 5FA8A 2EG5A 5JR3A 2JH8A 4PYOA 1EIZA 3G5TA 3G2PA 3BGVA 1NT2A 3KKZA 3SM3A 2GH1A 4RVHA 2CKDA 4YUVA 3SSNA 1Q0TA 3BXOA 2HWKA 2I7CA 2YXEA 4GEKA 3BGIA 3TKAA 3P9KA 1KHHA 3JWHA 3R3HA 1D2HA 1JSZA 3E8SA 3KQTA 3LSTA 3KQWA 2BR3A 4FR0A 4Z2YA 2FCAA 1SKMA 3EMBA 3EPPA 2N47A 1DUSA 3E05A 1EJ6A 1VIDA 2XYRA 2P7IA 3DMGA 3HM2A 3NJRA 5K09A 5K0BA 3EEOA 3DULA 3FRHA 3R9XB 4GOLD 5E1DA 3UJAA 5LQKA 4DA4A 4XCXA 4PYJA 1G8AA 2UZ4A 1RI3A 4X61A 5DT2A 3HVKA 2NXCA 3PVCA 1ZKDA 3FYDA 3TLJA 1ZG3A 3NTVA 3TFWA 1YFJA 1MHTA 4GC5A 3A26A 4KW7A 1NBIA 2ADMA 3GRZA 5GM2A 4KIFA 1QAMA 4UOEA 5EVJA 5GINE 4DQ0A 5E8RA 3EGVA 4QVGA 4R6XA 2UYHA 2Q41A 2QRVB 4BLUA 3HEMA 2IDJA 1Z3CA 4Y30A 5DM1A 1PJZA 2AN5A 4NECA 4WVLA 5DXAA 3U81A 5HEKA 4B17A 2GB4A 3EGIA 5CCBA 4E2WA 4HGYA 3LL7A 3REOA 2C7OA 5FTWA 1NW8A 2FHPA 3FPJA 2AOWA 3P2EA 4HTFA 3I64A 3DUWA 3M70A 2ZVJA 1VQ1A 4MIKA 1KPIA 2IPXA 2O0LA 4ATNA 1ZQ9A 4C05A 1QANA 5BW5A 2XBMA 3WSTA 3TKYA 2ZFUA 3LCUA 3FTEA 4V0RA 4PNEA 1IY9A 5GWXA 2PBFA 3LBFA 3R24A 1V39A 2H1RA 1INLA 3KPUA 4OBXA 4U7PB 4XUCA 3VYWA 4RTRA 2OKCA 3HNRA 2Z6UA 1NW7A 3FPEA 3LDFA 2ZIFA 3B7PA 3LKZA 5CM2Z 2PVCA 5C0OE 4F84A 5GOZA 5BP7A 3KQVA 4XUDA 1JTFA 3T0IA 3DXZA 5DM0A 3UJBA 2WA2A 3DTNA 3P9NA 5EKXA 3TPZA 5K05A 3ELUA 5LQUA 5LQNA 3E23A 4MWZA 2DPMA 5K0FA 3Q7EA 1XJ5A 4HRAA 3HCDA 2ONYA 2PT6A 3M6VA 4EMSA 4YUZA 4FP9A 2C7QA 3GRUA 5U4XA 4WXHA 2CL5A 5CVVA 4X63A 1ORHA 2ERCA 5DXJA 3SXJA 3SSMA 3OU2A 3EVBA 3KPJA 1RI1A 3DXYA 3NDJA 3AWIA 3UJ9A 4EQZA 3C0KA 3IEIA 2NYUA 4E33A 1SVUA 3DMHA 3TQSA 4R8SA 3PTAA 2UYOA 3MCTA 5GP1A 3M6XA 3UBTA 5JUWA 3IYLW 5GIOE 3OZSA 2PKWA 5M5BA 2OB2A 3PX3A 3PB3A 4DMGA 5CVUA 1KYZA 1RJDA 3GJYA 5T64A 4GBED 2ZBQA 3T7TA 2OZVA 2NNWB 4DM3A 3CVOA 1KPGA 1NBHA 3I58A 3BZBA 5F2OA 3NMUF 2FK8A 5FULA 2ZSUA 2XYVA 2FK7A 3GIWA 1G6Q1 4KRGA 4YV0A 2OY0A 3BWMA 3OCJA 2ZTHA 1X1BA 3K6RA 1FP1D 4X60A 5CVEA 4ZTBA 3EMDA 5B1SA 2Z6QA 2ZIEA 5EZSA 4KDCA 2AN3A 3FUVA 3OFKA 4QDKA 3GCZA 4PYNA 1ZGAA 3OFJA 4RSRA 4Y2HA 2AZTA 2PY6A 1O54A 2K4MA 3SMQA 2Y1XA 1P1CA 4OA5A 1D2CA 3S68A 2GPYA 3Q87B 2HMYB 3EVGA 4LECA 1B42A 2EJTA 1H1DA 2AOXA 3OE4A 4PCLA 3TR6A 3H2BA 5LQJA 3T7SA 4GOMD 4IV0A 2PJDA 2ZBRA 3G5LA 4KWCA 5HILA 3THSA 4CWAA 2NP7A 3IHTA 1XDUA 2CWWA 4HC4A 5DPMA 3EVFA 3KQOA 4OQEA 2IH5A 4PWYA 1F38A 3A4TA 1PRYA 3P9CA 5EHIA 5EC8A 5EMKA 5KVAA 4M38A 1NV9A 2IBTA 5EMLA 1RI5A 5E9JA 3HCCA 3LDUA 4PYQA 5ICCA 5KQSA 5KYGA 3MAGA 5FCDA 5EIFA 2XVMA 2BM8A 3P2KA 4PONA 5FADA 3TM4A 1JQDA 3HCFA 3UFBA 1YF3A 2G1PA 2BH2A 5FWDA 2P7HA 2BR4A 2A14A 5F2NA 4RVGA 3SSOA 4PCAA 1VPTA 4RV9A 3KPWA 1R00A 1BOOA 4QVKA 3ELWA 2QYOA 2WA1A 4RTLA 5EMJA 3C6MA 5DX8A 4P58A 2G72A 1SUSA 5FQOA 4F85A 3MCZA 1I9GA 2P8JA 5EG5A 3HCBA 3KQYA 2B3TA 4RWZA 1NV8A 4YMGA 4DKJA 4C06A 1EJ0A 4YMHA 3LKDA 4LWOA 1M0EA 5DM4A 4GUAA 2ZW9A 3THRA 1L1EA 3EEYA 3LDGA 3NW9A 3B89A 4POOA 2YVLA 3UWPA 4DCMA 5GIPE 2IIPA 3M6WA 3PS9A 4OA8A 3V97A 4P7FA 4QQNA 1R18A 1XTPA 5DLYA 4EVIA 5FWAA 3M4XA 2BM9A 5FHQA 4IV8A 1M6YA 4C03A 5K0JA 1IM8A 3MQ2A 4M7RA 4V0QA 3F4KA 3ANXA 3MB5A 1WY7A 3HA5A 1VP9A 4PGHA 5ICGA 3FPHA 1G55A 1R8XA 2WK1A 2I9KA 3KQMA 1KP9A 3AXSA 1YZHA 2YUIA 4RTKA 3M6UA 5LQAA 5EIWA 3OZTA 4E2XA 3PLAE 2O05A 1KPHA 1P1BA 1UWVA 1DL5A 3ME5A 4P7GA 4GOND 4CKBA 3SR4A 4AUKA 5EZQA 2VDUE 4RTJA 3PFHA 1DCTA 1O9HA 5CD1A 4OQDA 4EK9A 3ELDA 1WG8A 2JHAA 2YX1A 3KR2A 3MHTA 5BXYA 1AQIA 2YTZA 2NXEA 5K01A 4P7KA 5HIJA 5HFJA 2C7RA 4X1OA 5K0CA 4MHTA 4O29A 1JTEA 3FUUA 4KVZA 4PIPA 1YZ3A 3KQSA 2CMGA 3EVCA 3GXOA 3UJ7A 3FTCA 2IBSA 2YQZA 4F86A 5KQRA 4PGGA 4GC9A 5K0LA 1N7JA 3EGEA 5ICEA 4JXJA 5DWQA 3V8VA 4E30A 2B25A 2PX4A 1L3IA 4PYLA 3VSEA 5K8VA 5LR6A 4AZTA 2P1DA 2ZBPA 5CUQA 2IDKA 1R8YA 4GOOD 4HH4A 4HSGA 4A6EA 1X19A 3ERCA 1KR5A 3BWBA 4M37A 5HZMA 2B2CA 2H00A 5K03A 1G8SA 4DCGA 3NWBA 4AZVA 2PGXA 4M36A 2OPBA 2PWYA 4FSDA 2ZULA 3FTFA 3KHKA 2PWPA 3UA3A 4AZSA 4ER7A 5DM2A 1X1DA 4G56A 1P39A 2QY6A 5P8WA 4YV2A 3HA3A 1WXXA 2VDWA 3NVMB 4R8RA 3TOSA 4LG1A 3G89A 5DTQA 3A25A 5IKMA 2AVNA 2IH4A 1SQGA 4KDRA 3P8ZA 5HIKA 2GS9A
chains in the Genus database with same CATH superfamily
4GEGA 1BXRA 2QUKA 1C9DB 3IBTA 1JQ3A 5DZSA 1M9NA 3W9SA 4A0HA 3E3MA 3RUHA 2V7QA 2Q5LA 5IM4A 1A4XA 2C31A 4LXUA 3LBYA 5B1YA 3NGLA 4LSWA 4ODIA 2VBGA 2LBPA 4U2CA 2BGUA 5EXTA 1T6YA 1FUUA 2GTHA 4CLRB 1BJKA 3FWPA 1TZBA 1PL7A 1JHVA 1K63A 2GLTA 2ZRGA 3ACBA 3QLVA 2ODAA 4R2HA 5DI9A 2IH2A 3B3AA 1L4NA 3GPCA 4EB3A 1E0KA 4UNNA 3MGCA 3GLFE 4ME6A 1MB9A 1VSBA 3PFFA 4N0PA 3BMOA 2Y76A 3UMSA 1CVRA 1FFGA 3BEDA 4WEOA 1P60A 5CW1A 5AXDA 3WJ1A 4RF4A 1IWBB 5LUAA 3FTDA 4TWZA 4H7EA 4L57A 5LP6F 4TRRA 3PL5A 4ZQCB 1ONPA 1ODKA 3MTEA 1Z5OA 1NPTO 1RAHA 4LFBB 3KUCA 1C0PA 1UM8A 2Q3CA 1AMNA 3IAS1 4NVRA 3FAZA 3EVAA 3DAGA 8MHTA 4NZOA 1DX4A 2A9JA 4RY9A 5M34A 1OV6A 2VHEA 4XVRA 1ENPA 3KV3O 1VXRA 3P0RA 1DUVG 5TMBA 3IDQA 3MUEA 3DLBA 4OQXA 3EF3A 3ZVLA 2BHNA 1BXZA 2W8BB 3MEQA 2SBTA 3AUYA 3HO8A 3PQ7A 4JLNA 4CMCA 5BRAA 1AO0A 3U09A 1MDFA 1VSUA 2GCEA 2WP0A 3JQDA 4RTOA 1SQ5A 3B1KA 3V1TC 4R31A 3WL4A 4CTMA 4LJAA 3RI3A 3M6IA 3L8GA 2PJZA 1XEWX 3I53A 2PZKA 1WU8A 1X39A 2QX6A 2C9BA 4ZO6A 3UXEA 3ZCXA 1KYTA 4PSVA 4Z51A 3RSSA 1AKMA 4FE4A 2CEKA 5J2TB 2V3CC 5E6SB 4B3TB 2QK4A 3LDHA 1BE0A 5LB4A 3LMKA 3ZWMA 4AU1A 1NAHA 3OM8A 3L1UA 5BUCA 2VYCA 2CXSA 3R3YA 4FFRA 2RKOA 3S2IA 2YL2A 4ER5A 4I66A 3C6BA 2WWYA 4RD4A 1OR8A 1J0BA 3DMTA 1VL5A 4MCIA 2X8WA 4KV7A 1QRDA 2WD7B 3CX6A 3DVLA 4LGYA 3ZXYA 1RXYA 4PYKA 1DT5A 1PT7A 3F8TA 5F2KA 3UJ8A 1KIAA 8ADHA 5KKNB 5GOTA 5JJKA 5H3LA 3ZE7A 4DLAA 1VP3A 1MV8A 2H5JA 2YRWA 4E5NA 5GZ3A 2IHNA 4TVOA 4U7JA 5KJEA 3IX7A 5HYVA 3SJCA 2PMBA 2VQ3A 1HUQA 1KO1A 1Y5IA 4Z1MA 3WHKA 3N8DA 4A0QA 1IXKA 3DH0A 3V8MA 2ZYRA 3I39X 1L9KA 4KQKA 2RH4A 2X1VA 1SIUA 3ETEA 5HKBA 2QWXA 3BD8A 3W4IA 1CEXA 2VP3A 1OFVA 3KZNA 3TRHA 3TZLA 5IYZB 4BNIA 1FVXA 3AB3A 3SKXA 3EZ7A 4LKOA 5TVGA 5MN6A 2ZZNA 2R1ZA 3JAWA 3G2LA 3RIHA 1AMUA 2CVHA 5ALUA 3QI2A 4XVUA 1QZTA 2ZBGA 3W9UA 5F4ZA 1JQKA 1WSDA 1DBIA 3FPSA 4I5DA 4L2IB 4UTOA 3LRXA 2YCBA 3WFZA 4CN9A 5TEVA 5IUJC 5KTTA 1ZNZA 1AD2A 1HDIA 4XLZA 3VHLB 3OTGA 3TN7A 1RKQA 4DMHA 4DV6B 3R0IA 2OQ2A 1P5HA 4LVOA 1GR1A 1EHYA 2CYBA 5B3LA 3MJHA 4OL9A 4U7DA 5LP6C 1NBEA 2EJWA 1O0SA 5DLDA 4F9GA 3PLAE 2AFHE 1T8WA 1QP0A 1CULC 1QH1B 3R4VA 4JU9A 2H2AA 5DTIA 1V3UA 1GTJ1 1P2DA 2A9FA 2QAIA 4IO1A 1R5NA 2QTRA 5FPQA 4E2YA 5AI8A 1JG7A 3OFVA 1E3LA 4DCUA 1VOTA 2EX1A 5IJWA 2QD5A 2WM3A 4UUMA 3IOMA 4OXIA 3WK4A 1AK1A 4B81A 1QV9A 2Y1FA 4WINA 4LF6B 2BFPA 3ZHBA 4YLGA 1A7UA 4NFLA 1R3UA 2BGWA 3KQQA 3MINB 4X6UA 3UT0A 5JARA 2ATIA 2I99A 2FSHA 4Q00A 1MF7A 1O2DA 1TLTA 3U7EB 1KKLA 1RRGA 2CMHA 1CQZA 2NYRA 6REQB 3S81A 1DRKA 2XGJA 4OM8A 5FT9A 1GSIA 3T5AA 5TF0A 2FPOA 4QATA 3R9XA 3EXG1 1YB4A 4CM9D 2FZEA 2Y77A 4MEBA 4YV1A 4R6WA 4XVCA 1SG9A 4KVAA 4J29A 4EHHA 2NXNA 2NMVA 5DDIP 4HDNB 5G4KA 1A9OA 2UVQA 2IWRA 3LLVA 2VRCA 1IUPA 1I2DA 4A5SA 1GG5A 1XMVA 4FFLA 5KU7A 4E0BA 2Z83A 1L5GB 1BGWA 3GAFA 3N2GB 1JHDA 2VXOA 3DTVD 3O31A 2OQRA 1KVTA 5CH5A 4IIJF 3OLYA 4FS8A 5JXJA 3HBAA 5E2IA 1PWHA 4LMRA 4LUCA 3QFSA 1QRRA 4QHSA 3FG9A 1WOMA 2W7TA 3ISTA 1OB5A 3OQHA 2EEZA 2IVFA 5BSMA 5LDGA 1XK6A 3UB4A 2QPLA 3ICOA 5BSFA 3GPLA 1C1XA 4RIGA 3WV4A 4LDNA 4Y2VA 4RQTA 1ICEA 1I14A 4ZDIA 4XIGS 1FP6A 2F1JA 3H2ZA 1FC0A 3NHWA 3WLKX 2HQBA 1W19A 3HSSA 1LUAA 2HJ9A 4Z7NB 2PWAA 1UPBA 2QLMA 3ECAA 2R751 2H4HA 3NWEA 2CL0X 1DAFA 1PWEA 1PNRA 5EJEA 1TKCA 4FNAA 2PGAA 1PSZA 2ZIGA 3HADA 4GRAA 4HLUA 4OUDB 4YFVA 1YRHA 3KX2A 1LQTA 3ZN2A 3UXYA 5JATA 5TQ0A 4DDKA 2BGKA 2CFSA 2K2QB 2QTMA 2WFAA 2X6RA 4XM2A 5EIBD 2JH8A 4PYOA 4DMLA 4ZRNA 1OFUX 2R8XA 4K6FA 4FE3A 5ALZA 4ZPJA 5CFRA 3D1LA 3KSMA 4HY3A 2ONKA 2FSVC 2J41A 4MVJD 1KEEB 4YASA 4CF7A 1S2DA 2C2YA 1SUBA 3PDWA 4FDVA 3F74A 3TKAA 2CFOA 3R3HA 4K9OA 4RHYA 1D2HA 1JSZA 1MO3A 4NE7A 4FR0A 5DYTA 5I9SA 3RNLA 1AURA 2V03A 1JA0A 3WLEA 5KPJA 1GM5A 3E81A 1DEAA 1V9CA 1EDOA 1KMIY 1LJUA 2X2PA 2O8BB 5I9IA 1CDEA 5HG0A 3BIWA 2HJSA 3TW0A 1YDGA 1T5BA 3UJAA 3ZXIA 2OM2A 1WPQA 2HRBA 2PXHA 3OZIA 3COSA 2ZJ6A 4Q3OA 5J2UA 2I7VA 1G8AA 2XUQA 4WUVA 5C7OO 4V0NA 4KXXA 1IM5A 4QFCA 5LOVF 3EPKA 3TLJA 3EIXA 3U80A 4DPLA 2O0MA 1AA6A 2GD0A 3NRJA 3JWPA 1YUNA 3LGSA 1UEJA 4KTVE 4P92A 3GRZA 1XR3A 3IKJA 1QH9A 1LK7A 5GM2A 4DZTA 4ZJYA 2QKYA 5FR2A 1B8OA 4C4PA 1T34A 1H0HA 1VMDA 4UMFA 3EZNA 1LZLA 4U2EA 5G3YA 3UY4A 2RFLA 1R2QA 2B94A 3E70C 2Q41A 2AV6A 4IIEA 3RK4A 2YMPA 2JLQA 4YJHA 2A5JA 4Y2GA 3RYIB 1Z5VA 3IT2A 1RM0A 2HA2A 3HK2A 1F4PA 3QG5A 3Q7IA 2ACWA 2LW7A 3U37A 3YASA 5KNBD 2GPAA 5IABA 5K0ZA 2J9FA 1EJBA 4HX2A 1I3OA 1I2CA 1Q2XA 1ZM2A 5A9TA 3SF0A 3ZNPA 2ZE8A 1O5IA 3P2EA 5IKPA 4MKIA 1ZVKA 3D7MA 5TB5A 4DGSA 4OU4A 2VK2A 1U6IA 1MJGA 3GNSA 1KPIA 1II8A 1TJNA 2Q5JA 1W75A 3IPCA 3EULA 4J7XA 4PZUA 3VVMA 1PJ2A 2FPGB 5IVHA 1WBDA 1ENZA 2CLMB 2FEKA 2PX0A 2XITA 2ZRJA 5UKDA 4F4UA 1H0SA 2IW1A 4XDHA 1ZPDA 4PNEA 1SVKA 3AETB 4P3PA 3TR5A 1U0TA 1QB7A 3EC1A 2L17A 3HZOA 2YFKA 3FPEA 4G8BA 3NWJA 3VDXA 2WHYA 3EXG2 3WYNA 1U7XA 3ETNA 4YEDA 3ZH2A 2Z08A 4JKIA 2C58A 1V26A 3AH8A 3BCHA 4S24A 1IIRA 3ABZA 2FPIB 3ABRB 1OQAA 3M9WA 2XQVA 3T0IA 1O95A 1ZLXA 3TS1A 4E5UA 3NBMA 4TXHA 4FFWA 1XTJA 4RHCA 3K9CA 4CVNA 5E0OA 1T9GS 2EP5A 3KYCA 4KDFA 1LD3A 1DKMA 5LU9A 5IXJA 3DO5A 1WV1A 3FNFA 4MWEA 3JU3A 4CF4A 3DEJA 3A1WA 2GZ2A 4YJ2B 5JYCA 4Z8XA 2C7QA 4WXHA 1XHEA 3OEYA 4KFCA 4J16A 5A5DA 4PLGA 4BFUA 3U60B 1NBAA 1VJ5A 4KFUA 2KM1A 4NYJR 1U0SY 2KX7A 1EPUA 3CW9A 5C52B 1I6KA 5B37A 4AJHA 4PPGA 4MLCA 5AMXA 3QLUA 1OBHA 3TQFA 2O14A 1FMTA 2AW3A 3T52A 1ELOA 3BSSA 3ZDXB 3LYUA 1KGSA 5K3AA 1C9JA 3H05A 2ISQA 1OAKA 4G1MB 2C0CA 3QKRB 3JD4A 2AXEA 2NYAA 4DMGA 4KRFA 4MI9A 2OFWA 3HYLA 3ENZA 3L7AA 1TT5A 3IAAA 3PC2A 4GVXA 4AWAA 3B52X 1E5DA 1AO3A 2QSJA 1JW9B 2WLTA 4JJ7A 4W99A 3RT7A 3V48A 4RULA 1ZONA 4QD3A 3CF4A 2O2YA 2OCLA 1N5DA 2PU7A 1RLOA 1VPEA 3V9PA 2OXEA 1X1BA 5JBIA 4UUQA 2BP7B 4RUKA 3GOHA 1TE2A 1JR2A 3BE8A 1P77A 3CNBA 2JL1A 3E3LA 4DIUA 5C46F 5C1BA 3IFSA 3GCZA 3PGVA 2FAXA 3RREA 4I1VA 1O54A 3G9XA 4F8YA 2ZJ2A 4BVAA 2V0CA 4BO5A 3K6SB 4AMYA 4KQHA 2NAFA 1SVOA 2V59A 2FLVA 4JQOA 4BQNA 3KALA 4DLZA 3AF6A 1KL7A 3INGA 4ETNA 1N0VC 3C4VA 1GA6A 2P62A 3CNHA 4D44A 5IDWA 3PD1A 3MLBA 1GPBA 4OHPA 3WWCA 3GP8A 1U8XX 2I7XA 3QPUA 4DARA 1KDOA 1ULTA 2FN4A 1C5KA 4Y9UA 1FE8A 4XYEA 4RQBA 1Y9JA 2X5OA 4PG7A 1ZWLA 2G1KA 4C4SA 4UOZA 5KJ1A 4LN1A 4BB6A 2FW9A 2QRPA 1GGVA 3RSZA 5AOVA 3GLHB 3JQAB 4WH0A 3D6TB 4QDZA 3U4QA 1RXUA 3JZMA 2W6PA 4B2LA 2ODPA 4R2LA 1EG7A 4TKMA 3HB7A 3QBTA 2A7XA 4R51A 5F3DA 4IDBA 3SZRA 3AHCA 2HSDA 4C88A 4LWZA 1GNLA 2A92A 1KTVA 1Z6QA 3C85A 3EDMA 1PQPA 1T0UA 4ZXPA 4FBMA 3WR5A 1TL7C 3RS3A 2IY9A 3KEOA 1XEXB 1CQIB 3VKHA 4CIWA 3L4BC 1A5BB 3C70A 2WINI 3CW2A 4KQ2A 5HFAA 4B9AA 4RU1A 1VYTA 4FCWA 3R8XA 1I7NA 4B3IA 4A8TA 1C9YA 3O1LA 1JUDA 1X70A 3HB0A 4CLRA 2VUUA 4FIDA 3O26A 1HFEL 4IRMA 1R8XA 2CB0A 4B80A 2AYZA 1MRSA 3B6KA 4GT1A 4RKEA 3DO8A 1ZK2A 2FPXA 1JAYA 2PZLA 1V2HE 4GH5A 5LQAA 3IEVA 4L4YA 4ITRC 4NATA 1G41A 3F7MA 3ME5A 3N59A 5DB4A 1PK8A 3T1NA 2P0YA 4AO6A 1Q74A 5AW2A 1DJMA 1V96A 1QIIA 1XT6A 1CT9A 1E2MA 4R71A 4K03A 3LX5A 1KH1A 3OLXA 2AR9A 2NXEA 4WWHA 3ZY6A 5HFJA 2GXSA 3RR2A 4MKFA 1TJYA 4V24A 3V7UA 2JZNA 4DJTA 5KJ6A 4P0QB 3KQSA 1SRQA 4WZAE 2CDNA 3TAHA 4DBLC 4BP8A 4DJAA 2QRLA 3WMGA 1SO8A 4C9BA 3X2EA 1N7JA 5LWQA 3R7AA 2OV4A 4L8WB 3QKUA 5CFZA 4BZXA 5IANA 2X0JA 2W8BA 2HPVA 1GO2A 4HVAA 1NZDA 3ER6A 4HSGA 4KJXA 5DH9A 1HDRA 1QIDA 1RFGE 4AS2A 4BDSA 4B84A 1UEXC 1DBSA 3A04A 1HNXB 1Z2OX 3WO1A 5HZMA 4D3XA 5J4YA 1OFUA 3D4LA 2PGXA 2QVZX 4M36A 1CRPA 4YYZA 4CL2A 1NLFA 5J2TA 3OA2A 5E6SA 1TM2A 4RL6A 4L9RA 5F3WB 3ZV5A 1KI6A 2CZCA 2PRIA 3NBKA 4AY6A 3EC7A 1OAOA 4H4DA 3A1UA 4CIDA 1QPGA 3FCXA 2YW9A 2XLBA 1Z4NA 1YRBA 3CKMA 1JDBC 3U17A 5HIKA 5K99A 4QARA 5DHRA 2WD7A 1IJFA 2CXXA 1DADA 3NVKI 4PAOA 1Q50A 2ZAMA 4XUGB 3IQGX 1XIVA 4C08A 4FYHA 2ZRAA 4ZAXA 1TO1E 5GONF 2QZZA 2QYTA 1ZDMA 1AQYA 2ATXA 1L6RA 3RKSA 1MAUA 2E6UX 3SHTA 4EY7A 1LY1A 5EHXA 4ZI5A 2QVXX 4KX3A 4UVEA 5TS2A 1SUWA 1L5FA 2BSAA 3H75A 3K32A 5FTLA 5JEEA 3F3KA 3SOPA 2FMFA 2J7PA 5DYGA 3EBLA 4H31A 4XJSA 2BMDA 4B3JA 3T9DA 1UOPA 4ESHA 3KYBA 4KWEA 3GQVA 1S2MA 4LV8B 4ZZ0A 4OLBA 4KFTA 5SZJA 4AFNA 5B4UA 2AYYA 3IBSA 1XRNA 5LKRA 2TMKA 4KQGA 3RYCB 2Z57A 4KIGA 2WYOA 3TJMA 5AK3A 1X7XA 2IEYA 2AG0A 2HRZA 3JWGA 4OGLA 4WCFC 4ZVKA 3EARA 4E07A 4OJQA 1CRQA 2YV1A 2ZSJA 1MC8A 3OQ6A 4ROTA 4PC1A 2B6NA 5LCXA 3PCXA 1D8AA 5HDQA 4TQUS 1EGHA 3AU8A 4EVRA 4U5QA 4URWR 5KDLA 3WMRA 4UBLA 4LHEA 1XRPA 5CVDA 3DNFA 2QE7D 2ZM6B 5ER6A 4P32A 1PEAA 1TYDE 3Q4GA 1QH1A 2C3OA 3A6PC 3Q3VA 2R96A 5GM1A 1RLJA 3BYZA 3HCPA 1JU4A 1OPXA 3FHOA 3IP1A 1COWD 2CL7X 5G4LA 1MJ5A 4KR9A 2WUFA 4LOLA 4QECA 5K1ZA 4JUAA 3TD2A 4C04A 1NUAA 2PPLA 4N3NA 1PR9A 2YNMD 4ETWA 5CJPA 1ISPA 1SVWA 2EKDA 1D07A 1K88A 3C87A 5AW5A 3UAVA 5JJCA 3UGJA 4RTPA 2O5EA 1AZTA 2C9MA 4UXJA 4V0KA 4UTNA 3V2HA 1R37A 1BE6A 3H1AA 3OD5A 4I9NA 1UWKA 3OZWA 3MINA 4DQDA 5B4VA 1U4OA 2QZSA 1GWNA 3MELA 2XQGA 3EZXA 6REQA 4OXRA 3C39A 4AC9A 4NNJA 4MYCA 1ZUWA 2CHGA 3C3EA 4TMKA 4WY8A 5DF1A 3V4OA 1RRCA 4EHBA 2O5RA 1HZZA 2GZHA 2N75A 4D9KA 1CZUA 2CV0A 1VE3A 3PJRA 1U5BB 2PL1A 3PRKE 1AQLA 1NYLA 3AMVA 4QYTA 4DG9A 1K4YA 2XGGA 1QO7A 2HCTA 1UCFA 3OEHA 4E4YA 4EPWA 2GZMA 1JSLA 2AW5A 4DUGD 3F3MA 1ISFA 4J75A 5LDHA 3THWB 3L77A 1DIAA 1RPJA 4H6VA 1DU4A 3GN1A 4JT2A 4MPDA 4IJUA 4R3UC 3RF7A 5FOSA 3M6LA 4W7SA 3BMXA 4LWPA 3R0ZA 3T4UA 1OCEA 3KVNA 4UCWA 3VDMA 2ZVQX 3FBTA 4XM1A 5DYYA 1SC4A 1H4SA 4J0DA 2MHCA 4AF8A 5IDYA 1KF0A 1TZ2A 4OIFA 1P1HA 1PL0A 4BV8A 2X0DA 4DVGA 3OUZA 4IG9A 4J3FA 1XCLA 1K3UB 2A0FA 1UAGA 1UXJA 1XCMA 3WB9A 1ACMA 1PR5A 1SHKA 3QEKA 4NCBA 3ESCA 1IN5A 4MCAA 3QYAA 5C1DA 4OUDA 2ZIAA 3C1UA 3ESXA 3KV1A 3IAHA 3NTQA 4K40A 3NZEA 3DF7A 5SY4A 4RCZA 4XA8A 2R60A 1YKGA 2CJFA 4DMMA 2MOKA 4QHTA 2G28A 5L9AA 1AKUA 5BMVF 3M5WA 4DG5A 5ICMA 3TBFA 3OP4A 4N01A 1G7RA 4G24A 1I32A 2ZE7A 2WU0A 1HFKA 1JWBB 2YS7A 3BGOS 1YS9A 3K0CA 3LLMA 2GMWA 2RB4A 4LZLA 5BN1A 2VHTA 7MHTA 4U4AA 2O8BA 2MR5A 2F4NA 1RJFA 2DWCA 1IONA 1CV2A 4YTEA 4UD6A 1B8UA 4G1UC 2G77B 3KAJA 1NN5A 4JASB 5D6NA 2REQA 3DWEX 1M2KA 1NA5A 2R1TB 4IDQA 4N3AA 1ESCA 4GPBA 5CIWA 4Q4AB 4AG6A 1DQNA 2H4JA 4G0MA 3UJCA 4JA0A 5LYJF 1IIBA 5G2OA 2UYQA 4N76A 4EH1A 2GN8A 1DQSA 1N2XA 3CCFA 4Y6OA 3U6BA 3IBFA 1PLLA 5DM70 4EI9A 4KGXA 2UV8A 1I0ZA 3HP7A 3W78A 3PC8A 5K3OA 3MG9A 3DW1X 4JJIA 1QM5A 3O9ZA 1ZMRA 3CRRA 3CPHA 2VJDA 3EXEB 3RYIA 1H66A 1UC5B 3U2QA 3JZAA 1AXRA 1FDRA 2QVGA 2WTBA 2X7JA 3E22B 1R6AA 3C3BA 4L8VA 4UPVA 5CPBA 2WT8A 5BPHA 1UPUA 3O7MA 3MS4A 3DDWA 3IDSA 2WKPA 2VDOB 3R5FA 2PLFA 1OXUA 4TM8A 5JC8A 4URYR 1UJ6A 5SYAA 1HORA 1O0BA 3TMAA 2IT1A 2P9GA 2X77A 1L5SA 3B36A 4TYMA 5LUBA 3TRKA 5JZSA 4MQBA 5A04A 1J2EA 1RRPA 1T3ZA 4DGQA 5CB4F 2FG6C 1J99A 1TYBE 2FPGA 2UVDA 3NM4A 4RF3A 1AZWA 4JY7A 3NC1C 4X91A 1J22A 2F90A 4FSXA 4CFZA 2M9MA 2W6ID 1X1CA 2HLDA 4K6MA 5KTYA 4BVKA 4C5BA 4HAUA 1M2FA 1W4AA 1N9GB 3AETA 2BOVA 1UL1X 1YRYE 2D4HA 2COKA 3C16C 4H27A 1SEPA 2VBFA 3ZXSA 1EYZA 2CLLB 4RVSA 3KKZA 3U0VA 2PQ6A 4JQYA 5GTDA 4RORA 1DOZA 3DVRX 3FPAA 1CX9B 2FPIA 2I7CA 4GEKA 3HI6A 5BSVA 2Z30A 3ZDFA 3HUDA 2IPAB 1XWIA 2M1XA 4TVSA 2GBLA 4OFWA 3EPPA 3L18A 3NHPA 2PWBA 2PV7A 2VTEA 5HFNA 4QT4A 5K8UA 3AL0C 1HPLA 1N5KA 3JYQA 4YJ2A 4G6ZA 2ZYWX 3PQ5A 5K09A 2BFOA 5U1PA 1VHQA 1ZSVA 2JBAA 3D6UA 2HBRA 2Z58A 1NBWB 1EFUA 2I7DA 3AR2A 3PPVA 4GP7A 4MWGA 4YMWA 5E1DA 2J8ZA 4DLRA 1OFTA 3AKYA 5TGDA 2FSIA 4XZ3A 5BMOA 2YXNA 5HGJA 5BWOA 2EFEB 1NNI1 1SHTX 1E2GA 4HWPA 3D6AA 2VUHB 1D6JA 3O8QB 3PFIA 4NEHB 4YRMA 4GC5A 2A5YB 1TUIA 3ESYA 1NBIA 5EHNA 2NO4A 1ZWKA 1UKBA 3R76A 4CE6A 1FYEA 3D7SA 2GD2A 1H0KA 1IQUA 3QKRA 2Z4RA 4L5YA 3ITNA 4R6XA 3RTBA 2QRVB 2KPOA 3G3EA 3DMDA 2JJMA 1ZJJA 4DY4A 4DTCA 2CFTA 1BGVA 1PNQA 3M83A 3CN7A 1NX9A 2WOOA 4M7OA 4DTIA 1JQBA 4HGYA 3GDFA 2I4IA 3RS0A 5TLSA 4CKXA 4D26A 5H0IA 3TB6A 1TEHA 3ZWDA 3I1JA 4R1TA 2QN8A 1Z63A 2PUCA 1F7VA 1IVYA 1HFJA 2B2XA 3GJ5A 4LX8A 4B3GA 1Q77A 4MIKA 1GDTA 2H51A 4MWDA 4H35A 4N8EA 3JQ6A 1M3SA 2Q07A 4UXHA 3X2SA 3LCUA 1RLTA 3D2BA 1NNSA 5I51A 1ONBA 1CBUA 1N2IA 3K6SA 4J9VA 4US0R 4EW1A 4J43A 2O8NA 1T4DA 2HFJA 4XEHA 2C78A 3E9CA 5FBHA 3OKAA 3GGPA 2M98A 1YDWA 4XRRA 2X41A 2RG1A 5DBHX 1X1RA 4WAUA 1JTFA 5IBQA 4GP9A 1B6TA 1JVNA 4EVQA 4ZCRA 4A6PA 4D82A 3OTOB 1Z4QA 4OJYA 1T9CA 3KOUA 5EKXA 4OHVA 1Z13A 5B2EA 4LBWA 4AF7A 1J8MF 2ZRMA 4Z3DA 3HCDA 1W6UA 2AX4A 2VA8A 4DQVA 5B6PA 2CFIA 2R6DA 5LPNA 3GLTA 4WLUA 1QTIA 3E15A 5ALHA 2GEFA 2VQFB 3EHDA 5JQGF 3KLNA 1YONA 1JAXA 4KIWA 3QPVA 3WRVA 5EP4A 4ABYA 2WU8A 3O95A 4MS4B 1SUPA 2GN0A 3R6GA 5J40A 1PKEA 3EXHA 2XMBA 1XEXA 1GEEA 3AONB 1PJ8A 1KAHA 4AUEA 2J9RA 1W0KA 3WGZA 3GVPA 1KR2A 2W6MA 5DI3B 3AJEA 4U3JB 4C4ZA 3V4RA 1U63A 1Q20A 3RAFC 1NJSA 1V11B 2VO1A 4PG6A 3ZJ5A 4NPCA 1NW9B 4E5YA 3OEWA 1K7XB 5F78A 1X38A 4OI1A 5KYTA 3KUKA 2VATA 4RJLA 3LI2A 2RBEA 4R9SA 3IRUA 4HVTA 4EUEA 2TECE 4N0EA 1TAHA 2R8ZA 4W1SA 3FUVA 3QX9A 4CKBB 3OFJA 4FDAA 4HK4A 4L15A 1U5AA 4U6QA 2IU0A 4R1OA 4D98A 5K8LA 1KAOA 1NVVR 1U4NA 3H84A 2JC3A 4N0MA 2RGNA 1Z0JA 1EIWA 3CZRA 4L16A 3MWKA 3BH6A 2I6XA 2JHFA 3G2HA 4K9LA 4UE3S 1KDZA 1KXJA 1RZ3A 1FYFA 4JLSA 1NHGA 2MSKA 3V1NA 1XN1A 3WGMA 1Y1KE 3D8NA 4B45A 4AURA 4NCXA 4LE2A 4Z4FA 4NOKA 1IPHA 4U8HA 4ALJA 3WLLA 3NKLA 3UCFA 4NQRA 3WGVA 2VQEB 5LP6B 3NKFA 621PA 5J4HA 3LHSA 5BN5A 1T9ZA 4MS3B 5KZMB 4U9IS 4DXDA 2HH9A 3LDUA 3ZH9B 3GLGE 2HR1A 2R2GA 3TM4A 2BFFB 4CKZA 1O3YA 2C8JA 1JE0A 2ZAGA 3MIZA 4IQ8A 1LX6A 4H6XA 3F6SA 3UYKA 3FGPA 4RV9A 2ENWA 1JDSA 5IC5A 3T7IA 3ELWA 4NBTA 3D64A 4Q39A 5AUPB 4RTLA 1PNOA 4XSHA 5EMJA 3M4JA 3PTLA 5FQOA 3V8QA 5L3SB 4O3MA 1LCIA 4BBJA 3A3OA 3ZYZA 4D46A 4CM3A 4HDKB 4CLHA 4FB5A 4DV7B 1I30A 5ILQA 1GKIA 2I6UA 4K9DA 4S35A 3LDGA 3CX3A 4N18A 3ST7A 3U3KA 4AXXA 2BCEA 3CSUA 3Q1KA 5IVIA 3IP5A 3GEDA 1E94E 1NIPA 4LYAA 3TH5A 3DJFA 4AMUA 3BHJA 3GFRA 2QX7A 4J49A 1G2PA 1C3OB 4QWWA 2DH6A 3ESQA 2F48A 3DHEA 1VPVA 3F4KA 3MQ2A 3PNPA 1NRIA 3WLAA 3VNVA 1N5MA 2HLHA 3DKKA 4URHA 5JXIA 1Y5MA 2I9KA 3QIAA 3NEYA 3SIXA 1O08A 1Y82A 4QUHA 4LYHA 1ZHHA 1KPHA 3RKRA 1Z83A 1HEIA 3NDPA 4ZAVA 5TEWA 4EYSA 3IOEA 5EZQA 2OVFA 2WZDA 3PFHA 1UWCA 3DJYA 3B5EA 3R3JA 1TB4A 1B7GO 1RKVA 5IF3A 1GHTA 3ROKA 2B37A 1RWPA 3RYCA 1KU0A 5A71A 1XJWA 2XCSB 1U0NA 2CUKA 2PEYA 1EE1A 1EP2B 2REBA 1Y8AA 2H2DA 4BV9A 4M98A 2AEJA 2FWPA 1MORA 1P81A 1UWLA 5DWQA 5HZGA 2PX4A 1QPZA 3QWAA 3D3JA 1MH1A 4H7FA 1T5OA 4JYBA 1Q1NA 3DEAA 3FJYA 4FOLA 1Q1GA 1R8QA 5KVQA 4AMBA 4DS3A 3ILXA 3CLRD 1E32A 2PGIA 4INZA 5AVKA 3OA0A 1U3GA 1G9XA 1UJ4A 4JUDX 4EEZA 1IEVA 4YDHB 4GKJB 3UW3A 3KHKA 4MJLA 2BGMA 1M66A 1ZRHA 4MA0A 4N9QA 4YV2A 4BWFB 1MOQA 4PHGA 2XMZA 3K72B 5EIOA 1B8PA 1LZKA 3IQZA 4UTPA 1I7QB 2C42A 2PUWA 1GKUB 3CZ5A 3GCDA 4CM1A 4MMYB 5AW3A 4F9EA 4IJ6A 4C20A 3GRCA 4PO8A 1ZX1A 3P8ZA 4G86A 2Q6VA 5LIPA 1GQFA 3AR5A 3I04A 1NUTA 1O6ZA 3HACA 4G8JA 3OKPA 5DO9A 1E3WB 2JFUA 3UVEA 5CK5A 3OZVA 2XV1A 1U5BA 4AX8A 3L7DA 4CQNA 2F1HA 2Q4OA 3LBHA 1KE2A 1WVMA 1LTKA 2Y1KA 2DCMA 3RWBA 3OJXA 2OQIA 1ZINA 5GJWC 2D2XA 3ADCA 1B1CA 2HQRA 2IUFA 2OAQ1 5EN4A 4D56A 5BR8B 1Q84A 1KZHA 1A69A 3CUEF 3QJYA 3KETA 3B9BA 1HL3A 3THWA 4RAQA 3WDMA 1XVAA 2IYFA 2JIZA 3G9UA 4OHXA 3SLRA 2BBOA 1AUQA 3PQFA 1LBIA 5AVRA 4II3A 5C7IO 2GBPA 1YUBA 3N3AC 5E4TA 4LY3A 5FO1A 1ZNYA 1NN0A 2HIGA 4BP9A 1E2QA 1GIAA 2JAUA 3FCAA 4KN5A 4F7DA 2PT9A 4DLXA 5AW1A 1MNAA 2ZYAA 4HGNA 3R1IA 2DHEA 1E2JA 2SECE 3SHFA 5IVPA 4L4RA 1T9GR 4REOA 4D3YA 4GRDA 1LPSA 3K2QA 1XZPA 1FVOA 3ED5A 3JD3A 2OILA 3OVMA 2DUNA 2ZUEA 2QPOA 2Q1WA 4QJIA 1JKIA 4IIJB 4BCCA 1ISJA 1K8YB 3KQKA 5GVSA 2Y6VA 3B1VA 2NW6A 3ELYA 3OCVA 4KE9A 4FS3A 3FUXA 5DGDA 5LNK6 2VKQA 3GLQA 3KKKA 1LDYA 1BX3A 4A2CA 2GGSA 4B76A 4PCUA 4H60A 1NGSA 3B38A 4DLKA 3D4NA 3N6XA 2AF3C 3H17A 4N03A 4O4IA 1R9NA 3V9AA 4AKSA 3WLIA 2JAQA 3BGDA 3LXMA 1OE0A 2GERA 3QTTA 2FN8A 4Q37A 5JYDA 1FTYA 1QYVA 1W4BA 3CF0A 3EUFA 2AFIE 2PPVA 3IV6A 5AVZA 2FRXA 2A9PA 3JQ7B 2V7PA 3L5OA 1V16B 3OKFA 3ZGXA 3PA8A 3W5AA 2ZRLA 4E5VA 5DX0A 5L4SA 3MTAA 3PNLA 1ETUA 1PVVA 2FNAA 2HV8A 4K6CA 1RU3A 2RHOA 4PNPA 3BMNA 2JFPA 3R9KA 1K75A 2DR2A 3IO5A 4EKGA 1G19A 1ULBA 2OM6A 2I87A 3P2IA 1RWMA 4FYXA 1OLUA 4UUNA 2H31A 1FXUA 2O2JA 3A4LA 4BQPA 5KQPA 1CUZA 2J4DA 3TLAA 3B8EA 4QYXA 5AOCA 2WY2D 1Y80A 2VOJA 4COKA 4PLVA 3H1EA 3HGTA 2IF0A 2NO0A 3FTNA 4TLBA 1KI3A 1EEXB 1ZY2A 3JWIA 2Q7OE 2XJ4A 3F4LA 1SQFA 1UMCB 4G81A 4C0XA 2J9ZB 1W47A 5AHXA 3TIVA 4CEIB 3AIMA 3EXEA 1CSEE 1H1LB 5AO9A 4ZEWA 3RIEA 5IG2A 5LOVB 4ZQEA 3E22A 3W5BA 1E98A 1CF9A 2ZOSA 2RCNA 2R6FA 1VLJA 5D85A 2JAHA 2YJGA 1XA0A 1QHNA 2ZCVA 2VPWA 3CUKA 4OBWA 1NURA 2JFQA 1JIUA 2Y67A 1UKYA 2HNKA 1OI4A 1I33A 1G3MA 1WABA 3P9IA 1FY2A 2ZJ1A 5I7AA 3LYAA 1SURA 3NIBA 3TEMA 2C84A 1IXRC 1VYUA 4IZHA 5FBLB 3RJ5A 2CXNA 3BH0A 1K7FB 1K8ZB 2IXEA 3GH3A 1FPMA 2X4DA 2Y1EA 3R09A 3ZJUA 4R05A 4N7RA 1UIRA 1NC1A 4JT9A 4R3NA 1W4LA 1N9GA 2X5JO 2XCTB 1G38A 3N5CA 1J9GA 5ADHA 3ANMA 1RJ9B 1RYFA 2F2TA 1NW3A 3RE1A 4B3SB 1XP8A 1M5UA 5E1BA 1A71A 1HYQA 4IFIA 5JDIC 4UE6A 3L8FA 3IS3A 3FLMA 1Y6GA 3TRDA 4L5BA 3B85A 4R83A 1DOHA 1O03A 4RPLA 4FU0A 1GKLA 2Z3WA 1VKRA 3G13A 4IH1A 3TVTA 4B8WA 4CUZA 1KRXA 5EJ5A 3FMGA 4I5IA 2EFCB 4X66B 4BUZA 3CUVA 1XMSA 2QEQA 2PXAA 2PZ8A 1G3QA 3QNWA 3UTCA 4MDEA 3KTOA 1PDVA 2G9NA 1EGAA 4HNUA 3TIFA 4AF6A 2EQBA 3P9ZA 1Z7WA 2FSFA 2ZT5A 3DDZX 2RDMA 3OZCA 1OXBB 2G36A 1IBRA 1M10A 1HT2E 1MQ9A 3QHAA 3CUYA 1C4OA 1LNZA 1M2GA 1ODCA 3DNPA 1Y1QA 5BR4A 4C0AC 3NGXA 3ZCQA 4IMRA 1D4AA 2W2KA 2F1OA 3CKLA 3TL2A 4LF5B 3C3PA 5B1HA 1PZEA 1V7QA 2VZLA 2KW5A 4HXYA 4Q48A 4OB7A 3B5JA 1S8AA 2OZPA 3RRJA 5T3UA 4ALIA 3PLRA 1YD7A 3NYIA 3HKBB 4DMCA 5HJ7A 5KJFA 2QRVA 1XROA 2H2IA 3KB2A 3ZQUA 2I71A 1TU4A 2GILA 4BWGA 1AS2A 1NZFA 1N5IA 2ID7A 2YVAA 5I9MA 2X9QA 3CKKA 4MQMA 1RWVA 2VTVA 2WG2A 4HEJA 5CAEB 2XB6A 3UW1A 4IUBS 3OPXA 2VDMB 3WYAA 4F1JA 1RAIA 1KAQA 4NDZA 4Q02A 5EIHA 3WBJA 4C0SA 3FBWA 1W2HA 2B78A 4WACA 3NPAA 2WV7A 4GYYA 5B5SA 3NNNA 2ZVDA 1Z2DA 1PK9A 5G0VA 1MB3A 1ODLA 3GMTA 2RBKA 3A6KA 1KQ3A 2Q1SA 4PG5A 2HT6A 3D4IA 1I2BA 4EATA 4IRUB 1ZA2A 2F3TA 4URZR 3FWYA 2VC2B 4KB5A 1JIXA 2GCPA 4JI6B 3RIGA 3DCYA 3Q3GE 3V8EA 1II9A 1X7HA 4YDQA 2ACVA 1JLMA 3OQVA 2XOXA 3BIOA 3HRKA 3F8WA 3KQNA 3OM1A 4UDNA 2Y1GA 3G68A 4TTVA 3RYFB 1IVNA 2V5UA 1EDZA 1KEZA 4UEJA 1GFIA 1NVFA 1XEWY 5A6VA 2XA9A 3ICWA 3SYLA 3OPMA 1UDCA 1U8TA 1L4MA 1SKMA 4J94A 2IXAA 1U90A 2I4OA 2P7IA 3G8DA 5B2FA 3DULA 3HS3A 1DPGA 1HLGA 2IXFA 3EWNA 3IAEA 4G25A 3R5HA 5C4GB 2WQ7A 2F1RA 4HN4B 4O4HF 5LZ7A 4ISBA 3P0JA 3RU2A 4LDZA 4WA8A 2FR0A 4X61A 1RHUA 4ND7A 4IEFB 1M2HA 2VT7A 3FYDA 3X43A 4BGVA 4PPQA 1IDN1 1L7BA 3AB7A 3SQWA 1E3TA 1F8UA 3UIEA 1SQSA 2A88A 4MS4A 4ZOLA 3R77A 1ABEA 5MFZA 4GX5A 3OZGA 2NTEA 3ZWYA 1TOAA 4Y7DA 1JDBB 4HEHA 4MKZA 4PC2A 5E38A 4GYJA 4YRRA 4ANFA 1O9BA 5KVVA 2GM3A 1OBOA 5DI3A 5LYYA 2GUWA 2Q0HA 2QTWB 2H5EA 5E4YA 1WF6A 1FXWF 1V11A 4LDPA 4QUIA 1D1SA 1UK7A 1WO8A 1YS4A 1EFPB 1I7LA 3H99A 1BFKA 2A0YA 4P4LA 4HCJA 4YN3A 4ZYYA 1FZTA 3I2YX 5KUTA 4M54A 4L9WA 2ZKIA 1W0CA 4ZP1A 1M72A 4D57A 4QLOA 2OFXA 3DC7A 1KWGA 1J09A 1GZUA 4HTFA 5CDSA 2PSFA 1PGOA 3OSUA 2AJDA 2BBSA 3QMVA 5I7FA 2ID4A 2OCDA 3G7NA 4P3OA 4RFVA 4KOAA 3HPQA 2W42A 4I1UA 3OZFA 5KREA 4REMA 2FKNA 1IPFA 3NEJA 3SHOA 4DRZA 3DAYA 2GF0A 1SU4A 2VP9A 1IXZA 2HF2A 4TM7A 3EZFA 4IMPA 3WY9A 4H4EA 3UJNA 2BCJQ 3G6KA 4OBXA 5BQPA 2ZTSA 4LGVA 1QF6A 1AQUA 4UU8A 2JIRA 5AM1A 2JI4A 4WCFB 1HDGO 1NYQA 2I4LA 3T3GA 3I2FA 2J31A 3DLHA 2VDKB 4LDAA 5FYQA 1Z5GA 2KLBA 1Z73A 2M32A 3L8MA 5ESWA 4A8HA 5LP6A 1L4LA 1KBOA 1RBMA 3EA0A 4BE4A 5K05A 1U0HC 1N4AA 5B1EA 4AO8A 1V3TA 4R5MA 2Q2NA 2JFFA 2OTCA 2GEDA 4KLCA 4JSYA 4MITA 3WIOA 4F45A 5ED4A 1JJFA 4B40A 2HM7A 1N5LA 3CCBA 3LT1A 2IYEA 3SXJA 1J2TA 2AK2A 1A9XB 1MMFB 1HV8A 1XVVA 2UZ1A 2FMXA 2R6HA 2VUSA 1ATZA 1UJCA 2I3GA 3BIJA 3NR2A 3NTXA 4HYYA 3T54A 3R3XA 1V7ZA 5T4FA 1OIXA 5L3SA 3SFVA 4EHFA 1RPAA 2B92A 2I76A 2XE6A 3MVEA 1CUFA 1EA7A 4HDKA 2WU3A 2B69A 3H5AA 4LOAA 4UULA 4J4HA 2CVZA 2J3IA 4KSBA 4RA9B 1D09A 1R0ZA 3CR8A 2Q9BA 3MTBA 3WJ2A 5GZ1A 1SG0A 1FLDA 1HK7A 5ECGC 1M7GA 3CPSA 4G1EB 3GJYA 3WZMA 1A8IA 5I4BA 1NMEA 4FZ5A 1C3OA 4X00A 1RM4A 2Q62A 1PJSA 2FEMA 3STWA 3VR4H 3CH4B 5TE9A 1LSJA 4ZVTA 2QTCA 3AU9A 1M2EA 3BEOA 4IJQA 2VCEA 3OCJA 2Q9AA 3KJGA 4X60A 1SC9A 4OYLA 1QLJA 2FR8C 3K53A 4ENSA 5JXGA 2JLZA 2WIFA 3I01M 3FDJA 4S12A 4FONA 5GONB 3TKLA 2RCYA 5IDVA 2KBEA 1EVIA 2I3DA 5AVJA 3H5NA 3T4PA 3TTVA 3GGGA 4KH1A 3QHQA 3EVGA 1SBHA 5KOJB 2P6NA 1JHQA 3ZE9A 2X19A 4KQJA 3VDQA 1GZSA 4F38A 3V1LA 2P2ZA 1J49A 2PJDA 4EG4A 4DEXA 3UTDA 3JV7A 2IS6A 2WAOA 2XYPA 2MDTA 4MAFA 5HXAA 3HR4A 1F38A 4XQ0A 3RU7A 1N6HA 3G8CA 4HB2A 4HH1A 4R1SA 5A02A 2C92A 3WA7A 4PEVA 1XPRA 1XXHB 4IGKA 4M9QA 2DRIA 1QHYA 5ADVA 1ST2A 1VJCA 1Z15A 3PF8A 4A26A 2QN7A 2GJAA 2ZBFA 3SHQA 5JASA 4FW9A 2GCOB 2A14A 1KFCB 1LPPA 1LLQA 3DFMA 3VR6D 3QTBA 3KPWA 2B8EA 1OY1A 4A0GA 3NEAA 1AGXA 4QBTA 2FSVA 4NYJQ 2P69A 1U0BB 5JYEA 2PLNA 2UZAA 2ZYTX 1QGAA 1OZGA 3HCBA 3AIIA 3QXHA 1QGDA 1VG8A 2E3JA 2CNWA 1GLVA 2NV6A 2MR6A 3A14A 4EA8A 3ULKA 3STHA 2BL4A 2W2QA 1NBMD 3EMVA 1UT8A 2I80A 3II6X 3M1IA 2A78A 4G97A 1NKSA 4MQUA 1E3WA 3DBHB 4C29A 5BV2P 5DLYA 2AG6A 1KY4A 2VHWA 4CL3A 4TSKA 2VJKA 4ZVPA 3ZLTA 4LV5B 3A3YA 5BN3B 7AT1A 1F60A 3J81A 3VSBA 5B1IA 2JVKA 8ATCA 1MP0A 2B1RA 1DAGA 2YIJA 4QSMA 1A3CA 1WSBA 1KP9A 1VRVA 3EOBI 3Q2IA 2EIXA 3I2GA 1RABA 2I3ZA 1UZAA 2Y2UA 3N8HA 4Q18A 4EG7A 3WADA 1RMTA 3ORYA 4KXMA 4BVHA 2F3SA 3ZD9A 2XCRB 3QMPA 1EK2A 2VYVA 3T12A 1PR1A 2IX9A 2Y4OA 3FSGA 5I7WA 3W8DA 1QX3A 2W22A 2YTZA 4EKDA 2NOAA 3D6FA 3BE4A 4AAYA 4W5TA 4X1OA 5K0CA 1E2BA 1U6JA 4RMJA 3MWYW 1Y48E 3J80A 2OXFA 5ALYA 3UJ7A 3HDVA 4FWTA 4MQFA 1QVWA 3DWGA 2Y71A 3I6IA 3V8NA 3K9FC 4UD2A 1AN9A 2FFJA 1ZZGA 3QW2A 2VCYA 4I14A 5EKSA 4DWVA 2IDKA 3TK1A 1VHLA 1M1ZA 1QGYA 4FQ8A 4Y7CA 3FYHA 5HS4A 4X3CA 1V95A 2I54A 3QXXA 3TOXA 2MU1A 4PTLA 1SBQA 2RHJA 3HDHA 2EKZA 1V5IA 2E5LB 4IILA 4B7XA 1JJIA 2WYVA 1G8FA 4A8PA 7REQB 3HO1A 2XCIA 4N5DA 4OJMX 3S6JA 4MRPA 1S96A 5P8WA 4DREA 3GAAA 3QFRA 1O96B 5C1OA 2X1LA 3JQ7A 3VPDA 1V16A 3QY0A 1V0JA 3ROPA 3LBAA 5EWMB 1LWOA 2AI3A 1U7HA 2ZTLA 4Q1CA 2WM8A 1T1JA 5BMVB 3WAJA 4B3MB 4RVDA 2O19A 1E4YA 1S2LA 1ZS9A 1QO9A 2J48A 1DHRA 1QNFA 5I8PA 2IOFA 3KKLA 3TGPA 3PE3A 4UBOA 2OYRA 2ET6A 4GM4A 3A4VA 2J1LA 4MW4A 1Q1BA 1YJQA 4WA7A 1XTBA 4JELA 5FFMA 5EY5B 4DEVA 2XEXA 2YIMA 4RIHA 1KRWA 5FV7A 4I1SA 2F6RA 2P8SA 1JFFB 4H3HB 5D8DA 4CUKA 4L7VA 4YHHB 4ARIA 1DCFA 5EUQB 3RODA 4BJ5A 4IDCA 5FFNA 4JR0A 4BB5A 3SEZA 1C4KA 1UMCA 4XDZA 1IU9A 3RUIA 5F21A 1XKXA 1LB1B 2VZ9A 2WJ4A 2JARA 2H4ZA 5FPPA 5M3BA 3ROZA 3S70A 4CEIA 1H1LA 1FSZA 4IZ6A 4B6GA 2WKSA 2R2AA 4LNHA 1XYGA 3DVSX 4JOQA 3RVQA 1DINA 3P26A 4K8RB 3IPAA 3LC1O 2X42A 1E3JA 4L9SA 1EA5A 2DFTA 1JG3A 4AZ3B 4IXWA 4CM5A 1ADJA 3DR3A 4NBNA 2V4MA 1VSVA 4UHJA 4A10A 4QQFA 4K81B 2YDXA 2XADA 3A36A 4J2TA 3MT0A 4ZXFA 1TC2A 1N2SA 2HQSA 2PKEA 3EAGA 4L6AA 2OOSA 2REXB 4FYWA 2VLBA 2P2CA 3FNEA 4P4UA 1WKBA 5HS6A 4NBVA 5B36A 3S3TA 4ZYLA 4YAKA 4LHZA 1K08A 1S2GA 2ADFA 2E5WA 2RC6A 1JT9A 2OBMA 4R98A 1KQNA 1XTSA 2NIPA 4P7JA 3IQIX 4US1R 4UU7A 3F90A 4P5DA 1ECCA 4WFQA 1RJ9A 3I73A 4MGEA 2Q8NA 3EOAI 3HB1A 3ZC3A 3LA6A 4F72A 1NXPA 1ZRSA 1X1AA 4KNWA 1BU8A 3TSYA 4I7EA 5CB4B 1TAQA 2PS0A 4IIGA 3DT8A 3EZYA 1P74A 2JRLA 4FT4A 3AL2A 4GSYA 1T0BA 2E48A 3O93A 4FW8A 4LPKA 3OIGA 1S01A 4J7CA 4O2AF 1QRUA 5HZKA 5AW6A 1VIMA 5L45A 2ID8A 3FDXA 5HX7A 1FZQA 3CPJB 3H9QA 4OVKA 2HU2A 3DV9A 2VAMA 4I1IA 3ZQ4A 2Z2YA 3F9IA 2JJ2A 1NVWQ 3DR5A 1QGUB 4IUCS 1EHIA 1ULZA 2WILA 1WB5A 1J07A 4ZAGA 5I5GA 1T24A 4G0UA 2XCLA 4EYKA 1CUUA 3LX8A 4YAGA 4L08A 5JWRA 1FFWA 1U3CA 2PO7A 2AZ4A 1XL0A 3CV3A 1PFKA 1T5DX 4RYDA 2CK3D 2ZRIA 1ZOOA 2HMWA 3K8OE 4PFQA 4QXAA 5FR1A 1VZ2A 3PENA 1WMSA 2BKAA 3V1YA 5AVXA 3WK6A 4NNPA 2D4AA 3RRXA 1P4SA 4QPNA 4C2UA 2W70A 1XD2A 3CSSA 3KCNA 3HKBA 3L4BA 1EAMA 3URKA 5JT1A 1R0SA 1QONA 2IUEA 3CW8X 2OLEA 3VX4A 3RANA 2W8ZA 4DC1A 1U81A 1JQLB 3NFRA 4TS3A 2WWIA 4LE1A 5EWJA 4CG2A 1SXQA 3DAFA 1H3NA 3FOAA 1C3XA 2AOUB 1O94D 3DZGA 2XWPA 1YI8A 4XE5A 4C7VA 3LVRE 2C07A 1AGPA 4RY2A 2OV6A 1KSJA 2WUGA 3LT5A 4FZJA 5FNZA 1Z08A 1Q1EA 2FSSA 5DNAA 4E22A 5J4LA 4RTSA 1JEJA 2ORED 2ZJ3A 1JDPA 3E9YA 3IC5A 3PRHA 3W7AA 3PXXA 2ZR0A 1EFDN 1JJ7A 4HDCA 3VR2A 1XLWA 2QD3A 3RD5A 2FPSA 2R3SA 4H6PA 1Z39A 3ZDRA 5C3MA 2JI7A 5AR1A 3PC3A 1KXZA 4MI6A 1ISHA 1N6IA 2DWUA 1RYMA 4MO9A 1AQJA 2LVBA 3A9TA 1K0FA 2JJ1D 4TMWA 4P82A 1QYIA 1ZVJA 1VJDA 1XMJA 1KYWA 3P94A 3RYFA 4BX0A 3DOUA 4MRMB 3MJCA 4F2HA 3R9WA 4RNCA 1XNHA 2YWHA 5BV8A 1IM2A 2EQAA 2NZJA 3HI4A 3LX6A 1DGQA 4MUXA 3PFGA 2OP1A 1EQAA 3FTQA 1KVRA 1TC1A 3U56A 1UAYA 4YQFA 2QYSA 2OAEA 3TD9A 1P7CA 1OT3A 1NP7A 3ND6A 1CUJA 3M3PA 5ICFA 5JC1A 2OFOA 5JCJA 3RTEA 1ZHOA 4ZREA 2GZSA 3NOOA 3ONEA 3FE2A 2GAJA 1M1YB 4TN5A 1I01A 5JHHB 2XAAA 4JENA 4N3GA 3D8UA 1EUCA 1T2FA 3B82A 3F5QA 1O5OA 1W35A 2CVOA 5TQVA 2HU8A 2IS2A 1XZAA 3LTEA 4O5AA 4BASA 1YWGO 2P27A 2PQ2A 2Q49A 4OBEA 4WGGA 5JQGB 4I1YA 4OK3A 1DXYA 2JGKA 2GK3A 2V4UA 1OZAA 3FVVA 2X5XA 4TV9A 4UVHA 2WPDD 4ZQGA 4ZKEA 2Y68A 4AJIA 4JLMA 4C0JA 3IUYA 1URPA 2Q3EA 2JJYA 4KWIA 4YAEA 4ZC1A 4YMLA 1EDDA 2JIMA 1G6HA 3GMIA 3N28A 3NIWA 3BAFA 5EFZA 4BWVA 4QXRA 1FLNA 1VCMA 2E49A 1LS1A 3BKWA 4MA4A 1SWVA 2PHZA 4W6QA 5KQLA 3SDZA 2K5UA 3USES 1POWA 1TQ8A 3L4EA 1MJGM 3LGAA 3B7WA 5EIBC 5EYPB 1KP2A 1NNLA 1U7OA 3K5PA 3VPHA 2EX4A 5FUVA 1N3YA 1BSVA 3JRNA 4PQYA 3HNPA 4DXHA 2HSWA 3G2PA 1UMKA 4WCFA 3IUQA 2ST1A 1VCIA 4DM4A 1WA5A 3Q6IA 1HLDA 4GNRA 4G3XA 4F91B 1T3HA 5IULC 2DOKA 2CJYA 3LUDA 4WZBE 1B73A 2LNDA 2NGRA 2VSNA 3F4BA 5F33A 4MUBA 5CR9A 4Z0NA 4XEUA 3CG0A 5A05A 1I80A 1Q5PA 1M34B 2CE2X 2VYQA 4FYPA 1C8BA 1KVUA 1D1PA 4OJNA 1GAQA 5EUCA 3K5HA 5CXSA 1WV0A 3RJZA 4QTXA 2EERA 4L4UA 2QF7A 2GYVA 4PYJA 1A9XA 1DKUA 2YVUA 2JGLA 4R81A 1NM5C 2VP4A 4H3VA 3ZTWA 4IHJF 3VKGA 4NZZA 4KW7A 1YJXA 1E7SA 1NXWA 2J6CA 3L41A 3LWDA 3ABQB 1PG5A 4K6GA 1F2UB 2G80A 3LZDA 2O3UA 4RA9A 2TRSB 1Z6ZA 2GZ1A 1GQRA 3PTZA 4A0FA 1W34A 4BJ3A 1L5KA 4NHEA 4R8KA 2VPTA 1JT2A 3Q0EA 1CUCA 2EKLA 1MTOA 1MXFA 1ID8A 4EGAA 1CUVA 2WSYB 2YDYA 2GB4A 4LC9A 4ZVQA 2C20A 3X1XA 4AM8A 1XQ1A 5D51S 3RASA 3H3JA 3VVLA 1P3DA 4CM4B 4D4GA 3H65A 2O1SA 4ZJUA 1ACLA 3TI7A 4BZPA 4D96A 4Z4CA 4Q66C 4F92B 1UBGA 3M70A 3I6MA 1YI1A 3U7QB 4GOJA 3CBQA 4Q7KA 1LQ2A 1EVYA 3R7NA 1XE3A 3CO5A 5GONA 3ZUGA 1ZQ9A 3KXPA 4BV3A 2H6EA 2ZSKA 4QG3A 2CF5A 4AP6A 3NM6B 1JB1A 4ITVA 5IAEA 3EG9B 3LCJA 1FXSA 1TA0A 3G5AA 1E5LA 3F6BX 4L8FA 2FGKA 1GN9A 1JHRA 2B6HA 3DDOA 2PBFA 1IBSA 3IV7A 4ED9A 2YYSA 4RTRA 1SXHA 1E0DA 2Q28A 2I4RA 3GEEA 3TQOA 1AE1A 1QBKC 1U8CB 5KDOA 3BTUA 2VT6A 3QF4B 4HBZA 3K9WA 4IEEA 5A7FA 2QIPA 1E1CB 3WZ2A 2B5VA 5DM0A 4D6YA 3EGDB 5C5EA 4KWHA 5DYWA 2CLHB 4CIVA 3LIPA 1JVSA 1VJRA 3RBVA 1P2GA 2DPMA 2UVPB 3TL6A 1XXHA 3CVYA 4XSGA 1OASA 1GL3A 2G8LA 3GLVA 2YJ6A 4AJNA 4FP9A 3DD5A 4TKVB 5C34B 3HB5X 1ENYA 1P75A 2EGGA 2GCOA 5CVVA 1KIFA 1YS7A 4YPFA 4M76B 2UZ0A 4MNTA 3Q9NA 4P3XA 4AN1A 3OMWA 5DNVA 1OYYA 1T2DA 3RFFA 2MIIA 4MGKR 1AT1A 3RSLA 1HC7A 1G8PA 3FYSA 1CR1A 1I5EA 1P2UA 3ZI4A 4KQ1A 3K31A 1UQUA 2C8VA 4I99A 2HIMA 3W04A 1NR5A 2WB4A 3NO4A 3W9YA 2R68A 4K88A 2Q3BA 3RBAA 1WHSB 2FUCA 1E60A 2F4VB 3N0XA 5BYBA 1DKPA 1K3FA 3ZW8A 4X1IA 4ML3A 3DBHA 2DUWA 4FDUA 5JAQA 1RJDA 2P90A 4O4LA 4QX6A 3RS4A 3CO0S 5LVAA 1TEZA 1RBYA 2AI2A 3FPCA 3IIKA 1J1IA 2XLCA 3CU5A 3NT5A 3PWZA 4TS9A 5D3ZA 3RSOA 3SOZA 4CMEC 4DM3A 3DPSA 1DCKA 2GNOA 5BN3A 4X7BA 5ELMA 3HXQA 3I9KA 1BHQ1 4Y2XA 3IV9A 1PIWA 1WXIA 3EEIA 3T7EA 3X44A 3CNEA 3WLOA 1T8RA 2O23A 3PQ8A 4D7AA 2DR3A 4QDKA 3G0BA 1S3SA 3OFKA 4BNKA 4F11A 5JQWA 1B0PA 2PL5A 4BUCA 1KE1A 2XTMA 4MV7A 4U9HS 5TNXA 1RHQA 2AZTA 2CFCA 5LU8A 3PWKA 2G1AA 1NSYA 1T91A 4QU8A 1PR0A 3ANSA 4MB0A 4OA5A 1NG1A 4ZRMA 3ZDDA 2FF5A 2O2HA 2PGLA 4XGRA 4LECA 4HNHA 1TVEA 3H2BA 5TF4A 1N1MA 5AW7A 3K2IA 3CE9A 3OG9A 1JNXX 1X0VA 3P4UA 4TL6A 4Y67A 1V5FA 4MGIR 3AWDA 1P2BA 3C1OA 3UC5A 5TPZA 1IATA 5BVHB 3IPRA 1Y7TA 5IDXA 2IH5A 3H4IA 4MW5A 1VE9A 4FCCA 4PW0A 4ZO4A 4ASUA 2FPKA 4M38A 1NV9A 5JNTA 2RAFA 4IDDA 2V1UA 3B2NA 3MAGA 2FX5A 3I1FA 5EIFA 3P2KA 4DYDA 5JAIA 2EL9A 5BORA 3HCFA 1ZAYA 1CZHA 4TGLA 2Q3FA 4N82A 3CTPA 5FWDA 3VR2D 3GJ7A 3LW8A 4GUDA 5AM4A 4B6PA 3EFEA 4UEKA 3ENQA 4V39A 3HMQA 1NXSA 2FEOA 4C5CA 2W6OA 3U9TA 4AP9A 1R50A 7REQA 5KWSA 2WQ6A 2B4KA 1IBCA 3A2NA 3RSFA 1I4EB 4DQLA 2YV4A 3ZZTA 5DNCA 1O96A 1TU0A 1USVA 4A9AA 2FWRA 2VF5X 4X62B 5DM4A 3PKJA 3AKDA 2ZW9A 3B70A 4GUAA 4RW0A 2O8FA 1XD9A 4EZEA 3BD7A 3HJRA 4EO4A 5BMVA 3VH3A 3BPSA 5BSWA 5AJXA 2O6HA 4OA8A 2ZJFA 1OH6A 4I4LA 2HXGA 1YR3A 1M6YA 4MUYA 1QJCA 1M7HA 4M7RA 1T3TA 1JILA 2ZSAA 3NYRA 5K0JA 3ANXA 1ZMOA 4G5FA 4BTVA 4HPWA 2WDZA 2D2IA 3AXSA 4D2IA 1HDZA 2IPNA 4J7AA 4WESB 2YJ5A 5I7OA 3B1FA 5I9BA 4EJ2A 2DFPA 4MUAA 2WTNA 1RRVA 4AYWA 2I1QA 3C7DB 1CZLA 1TM4E 2BMVA 4IS2A 2ZEJA 1NVVQ 4OHBA 2XRZA 1V1MB 4M87A 2V6BA 4LYFA 1P1FA 3ET5A 1C7RA 3FI0A 2CBZA 1PLKA 3IESA 4O5OA 3A3KA 3ZDYB 3OOYA 3N2YA 1OREA 4OL0A 1U3TA 4AZ3A 2PD6A 2VJMB 2YQZA 3D31A 1YOVB 3F46A 4M0UA 2IQIA 4R2KA 3AY7A 2ZJAA 3R3ZA 2OLKA 2DT8A 1EKXA 1OSNA 4IVPA 4KP7A 1YV9A 2XWSA 2BY4A 4L74A 4RSGA 2Q3DA 1WQ3A 3E35A 5DWVA 3DPIA 3N58A 4KG7A 2BFCB 1A9YA 3E9MA 3GUUA 3UHJA 2J4FA 2QMQA 3RS9A 1WVGA 4WNAB 3EFOB 3K8QA 4X1YB 1ZBDA 3ZKWB 4MVJH 1Y8RB 2VNKA 3AHDA 3RABA 2V7QD 1GG8A 5JO0A 5BSTA 1IXSB 5CB4A 1U3UA 2P91A 4BFLA 2C83A 2VQ6A 1GPAA 2C57A 3V34A 4AS1A 2UXDB 2EFYA 3F0TA 2O2XA 3NVMB 1VLQA 2BUAA 3L7BA 4ZVMA 3OQBA 3K70B 3GN2A 4JI3B 1E59A 1LBEA 3ZWWA 4C87A 1Z36A 4TYQA 4UEWA 3VKUA 3L0OA 1EHCA 2QUHA 2IHZA 3R44A 4MMZB 4DLVA 3H16A 1AF4A 3HCWA 2IZZA 4TTAA 3HPRA 3MT7A 4LJ9A 2Q1TA 5F9HA 1HQCA 3OE5A 1E6WA 4P36A 3RNOA 1B1AA 3EIFA 1OU0A 2FG7C 4ARSA 4GFDA 3LK7A 1K4KA 3VYUB 5CXQA 2QD2A 3OFSA 2KHZA 4V2IA 4YP6A 3HJTA 2HQOA 5FBKA 4CN8A 4MDFA 1HOTA 3KWFA 2BDTA 2HZ7A 4FFPA 3A8TA 3H0CA 1Y42X 1YBMA 4M86A 2IFTA 2XNJA 3CLUC 3ZI7A 4LZJA 3U7HB 1TD9A 4Q7MB 2B21A 4IKEA 4OXNA 4WHMA 4HRYA 4UW9A 5H16A 3GEMA 2V98A 5KKCA 2RHDA 2YYAA 3GZ4A 1TVCA 5KNBH 4YRPA 3GH1A 2ON6A 5H70A 4QXOA 3BWXA 1XZGA 4MSUA 5H8WA 4JI1B 4IJKA 4Z4IA 4M0PA 2V7TA 3BXXA 3F9CA 4D42A 3TD6A 3NHFA 2AOUA 1V6AA 5JVDF 5FHRA 2FEWB 4S3MA 3SVLA 3I4LA 3LLUA 3G7UA 3MJDA 4LTDA 2QJRA 4G0VA 5DGCA 2NM0A 4WVFA 2QVLA 2DKNA 4GU5A 4V38A 1HM5A 4FHZA 4FEEA 4ZO8A 5DRYA 2IE0A 2G1JA 4D81A 3W5JA 2G82A 3GA0A 4MWBA 5G1PA 5JS2A 2HHAA 2W43A 3HP1A 4TRMA 3CEAA 4DJDC 4A6DA 2QNBA 5C32A 1FFDA 1NLUA 2YNMC 2JF0A 5JG7A 2VP5A 3WK8A 1KKUA 5JNRA 1CRZA 2A4KA 3I0ZA 3V1MA 1OPRA 1CIJA 3TXXA 2L82A 4M53A 2PVPA 5FUWA 3RVDA 1DEKA 3C6KA 2JLBA 3GLHE 3KEQA 4F96A 2A58A 4RZIA 5I8WA 1F3LA 1QYRA 1Q7EA 5HR5A 5IM4F 4MRMA 2QMOA 3H8VA 1H4VB 3IP3A 2VS1A 4P93A 1GNTA 4BO8A 1Z8FA 3OCXA 1SCNE 1I36A 1E2NA 2C9YA 4ETIA 2RBGA 1FNDA 4KPGA 2JFVA 4CKWA 1Q14A 2E4YA 3STYA 5LSAA 4QUJA 3VZSA 2DHQA 2WWVD 4DMRA 3ZXXA 2ZIVB 1GQQA 2PUBA 4E51A 1FS4A 3E1GA 1IOWA 1GZ7A 3ISVA 5D7NA 5K2MA 4RTNA 1EFHA 1KNXA 4IXNA 4R9RA 3T99A 5AVTA 1EUQA 3G7SA 1OLSB 3AOGA 4GBGA 1SVIA 3VAYA 1NUUA 1YOBA 4TRNA 4EUFA 3ESZA 3SBEA 4UBNA 3TOCA 5J5AA 2I9PA 4QBFA 2H1FA 2GPWA 2JNWA 1M1YA 3K1ZA 3PQCA 1YQGA 5EMHA 4IHQA 1AF7A 1HXHA 1E6EA 1X8XA 4OYHA 2WG1A 2CLDX 2P5UA 2VHJA 3MAAC 4JEIA 3OQJA 4PLWA 1IEWA 5CIYA 5HBRA 3DNMA 2FYTA 3CRW1 5FL7D 3UUGA 2VJAA 4O4HB 4RE6A 4KAJA 5DASA 3PWSA 5A03A 4NK5A 1ESMA 3COZA 3NM5A 4OAQA 1H65A 5HMLA 3PXGA 1QYWA 1MR3F 1UBLS 1UDBA 2C29D 2I1VB 2PAAA 1UKCA 3BWYA 3CEHA 3FHCB 4HS9A 5E7JA 2XUGA 3HO6A 4GZMA 4KH0A 4UARA 3ZVRA 4B75A 4BP3A 1Q15A 2OV8A 3IPXA 3IUNA 2H2GA 4LCEA 3P1JA 5DGXA 4BGIA 4KUGA 2JCYA 2JIDA 3RC3A 4PV7A 3RHSA 5C4MA 4TT8A 3K70C 2BSXA 3EGCA 1QVVA 4OB8A 4MKXA 1PU2A 1FNBA 5HE9A 3I6QA 2OXIA 4HAZA 4R8LA 4EBFA 1BDMA 2C7PA 2FB9A 3K1AB 5FWXA 4CHTA 2JLAA 2HGSA 2XJ9A 5EYPA 5JBNA 5FEUA 1O7JA 2GBCA 4PPYA 1EG2A 2RHLA 2EZTA 3GGDA 3IPYA 3GDOA 1RVV1 4N3BA 1CUWA 3KAPA 1V1JA 5F4BA 2DFNA 2FX3A 4ZOEA 4XFJA 4KAAA 1DRVA 2B8NA 3GY0A 1GITA 1GU1A 1TJ3A 1KI9A 5C1IA 1P1JA 3A37A 4FNMA 4K6OA 5HCUA 3WWDA 3WYDA 5KTSA 3FZGA 4IFEA 4PYMA 1Z6YA 4TVBA 1ZGJA 2VRCD 3C41J 4EPRA 3JX9A 3WWOA 2JLVA 5KYYB 1M34A 4G0WA 3USZA 4B71A 2HW8A 2FEAA 1F20A 1TW2A 1WS6A 4W9NC 5IMSA 1A95A 1V1RB 5BNWA 3TLYA 2JLUA 2HA7A 3QVKA 1XQVA 4MVJP 5DCLA 2B36A 4ALKA 1D6MA 3EIHA 1XDSA 1WBJB 1TIPA 3ETHA 1PAUA 3KLBA 4P2GA 2NAPA 4XCQA 1YZTA 3VPAA 4X84A 4CMJA 1KQOA 3CLVA 1QZXA 2R47A 4C6SA 3LHDA 3ZY2A 1ADYA 2GD6A 1CS4C 2ZGVA 4PZZA 4E31A 2DERA 2OCIA 2PJUA 1DTSA 1KMHA 4GWKA 2P9CA 5TRTA 1UOEA 2JW5A 2YBDA 4ND4A 2GKOA 5DU2A 2J0VA 1TUGA 3HN6A 3UAOA 2I1LA 5KHLB 2BH9A 1D6SA 3DPUA 3IVGA 4HG2A 3VC2A 4Z1OA 1LJLA 3NDBB 3KB8A 5JY1A 1HMYA 5IAAA 2CD9A 4BQOA 5EXEA 3USCS 5AVYA 5CIQA 1JG2A 3KZ1E 3X0DA 1TVKB 1TQ6A 3WI7A 4UREA 2ZUTA 3PDIB 1I1QB 1OC4A 1BCRA 2QE6A 1MOPA 3TMYA 4CM4A 4W8GA 3SPXA 4E7OA 4B6RA 5P21A 4DVJA 1Z4JA 1T9HA 3PX7A 5AVVA 2OGUA 4UM9D 1THTA 5HTKA 3HABA 4EYEA 3EVDA 2ZJOA 4DQKA 3AXTA 4HMPA 3U7QA 3CRNA 1BYIA 4MUNA 4OQNA 2XKJE 3FPBA 4RF2A 4AJEA 3DDUA 3L8ZA 5DRTA 1CKEA 1UH5A 4CT5A 1EFTA 5JD4A 5TV2A 4KBFA 1KO7A 2QYHA 2BVNA 8OHMA 3C74A 3EG9A 1LLCA 2ZRCA 1YS1X 2GHTA 1YSCA 2PX2A 3IJPA 4U0JA 1DVRA 1DC6A 3PLNA 4NV0A 4WE3A 4NKRA 3E2PA 3ML1A 4N7JA 5EJGA 1SHJA 3W05A 4C4YA 3PVSA 2CMDA 4MV5A 3H5IA 1PQUA 3ZX4A 5D3MB 1MT0A 4GNKA 4BNVA 3PF9A 1SU7A 2GN9A 3DYVA 3QF4A 4KBGA 5KQSA 3AHEA 1E1CA 3DE4X 3LSTA 3R0JA 3KQWA 3QBVA 4KXLA 2P2DA 2QSYA 1KZ9A 1RWKA 2UVPA 2ZT7A 3EMBA 2VHYA 5CNJA 3EDCA 3SC3A 4D9JA 4JLAA 2DBRA 2XD9A 1E1RA 1JU9A 4I5FA 3JZFA 2F3RA 3FDZB 4S1WA 3REQB 1A76A 3VO2A 4EF6A 5GQSA 4YCMA 3QVVA 3NOQA 3NVDA 1LSSA 4NU6A 2CUZA 3WICA 3FZEA 2XB8A 2W2LA 3P2OA 3ZEIA 4Y6PA 2GVDC 3K15A 1U8EA 4ESEA 2IHJA 2NXCA 1CNMA 1YR6A 4UHHA 5A5GA 1WVIA 2ACKA 5GV8A 2IOHA 5JISA 4ZVSA 2WJWA 3O75A 2NUPB 1P7PA 3C3WA