4C01A

Complete crystal structure of carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEST-2923
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 84
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c01A00
2QT9A 2J4FA 5AKIA 4LXIA 2H7YA 2WIDA 2RHWA 4Q3OA 5DWDA 4BRSA 3BIWA 5DNWA 5E2IA 1A7UA 2O2IA 4BVLA 1XZHA 1QIGA 1W4LA 5JARA 3QMWA 1L7QA 3BE8A 2HA3A 3AILA 3K2IA 4N5HX 5JANA 2XMGA 4L3WA 2ZYHA 1QZ3A 3O9MA 5AKYA 4HRXA 1DX4A 3C8DA 4GDMA 5CT6A 4DMKA 3C6XA 3Q0TA 5EFZA 3I2HA 1EB8A 3WK9A 4GWLA 1UT6A 1YAJA 4DYHA 4TVKA 3IUMA 1E8DA 4LYEA 2OGTA 1ZICA 4Y2SA 1A8QA 5LZ8A 2DHDA 2XLBA 5AM4A 5ALOA 4G8DA 1T4MA 1ZOIA 1LZKA 5DJ5A 3ESCA 5K3BA 1EA5A 3NWOA 1UOOA 3H2IA 5BV7A 4RE5A 1XQYA 3HJUA 2XLCA 4QDOA 1UKBA 1XROA 1U8EA 1MN6A 1VLQA 3NOXA 3V1MA 2WU3A 4BP8A 1NU8A 3H18A 4BCDA 1GZ7A 3QYJA 3ZI7A 4C89A 4P92A 4KE7A 2HU8A 3DLTA 2HHAA 2ZSIA 4QNNA 1LPNA 3RM3A 2XQKA 2OCLA 3FCYA 3WQHA 3HI4A 4C4ZA 2OXEA 2XMRA 3H1BA 3H17A 2WHPA 4MYSA 2ACEA 2FJPA 3IIIA 2WIKA 3BF8A 4Y2PA 3FVRA 5HF9A 3WWOA 5K3FB 1H2XA 4KJXA 2PSFA 2HU7A 5D3KA 4FOLA 1VZ3A 4KYVA 5KREA 4H7HA 2C5FA 3DQZA 4ZXFA 1XQXA 1BS9A 3T52A 2V98A 5LZ7A 3G0GA 5HCUA 1ZI6A 3V1NA 3WKBA 5D3ZA 5A6VA 4WY8A 5AK3A 1P0MA 5AK4A 4WJLA 2Z3WA 2CKMA 4IHAA 4P08A 4ZV9A 4DGQA 3D4LA 3EBLA 1YR2A 4NVRA 4MQLA 4Y2RA 3I28A 1Q84A 7YASA 2GBFA 3VJLA 3SK0A 2R11A 3I2FA 2HFKA 4FBLA 4FFVA 5ALKA 3E1GA 3GROA 2WIFA 4H7DA 4NZZA 1CQZA 1Y37A 1N5MA 4DMCA 2VTVA 1RWQA 4K6GA 3T4UA 4U2EA 1F8UA 4IH4A 1UKCA 2WUDA 3FSGD 4WY5A 4BVKA 1F0NA 4UUQA 4U2BA 5LIPA 3DOIA 2VAVA 2C58A 1QO7A 4K6HA 4BE9A 1EI9A 4JYPA 2DCMA 3I2KA 5AK6A 3IURA 3HRHA 3C5VA 4X6UA 4YASA 4EY7A 5DYWA 1IUPA 2IX9A 3E0XA 2I03A 3ICVA 3VKFA 1G4HA 2HA4A 1J07A 2OLEA 1AX9A 5AKGA 1WCYA 1LPAB 5HK9A 2QZPA 4DSZA 5AOCA 1EK2A 4EY4A 4GI1A 4XJVA 1WB5A 5AKJA 2Z8XA 1AURA 3ZLUA 4KR0A 4Y7DA 4FMPA 2PM8A 2XB6A 3VXKA 2QOEA 4IH9A 5A2GA 4BE4A 1WHTA 1IZ8A 1CEXA 1FFCA 3VJMA 4EZIA 5LZ4A 4M0FA 5AM5A 1GQRA 3W2TA 2DFPA 3IUQA 3G9UA 3L1HA 4C01A 4Y2QA 2G5PA 1E66A 1HBJA 3I6YA 2V9ZA 1B6GA 2XUPA 2GYUA 1LNSA 3IA2A 1QLWA 4BZZA 5FOQA 3WK8A 3DCNA 1CPYA 1JJFA 4WDQA 1CUEA 4DNFA 4OB7A 5ALIA 2WG1A 1HDEA 5AI8A 3KDAA 1TIBA 2O7VA 2X5XA 4FHZA 1HL7A 4CG2A 2CUTA 3VVLA 2BJHA 4OYLA 5J3JA 2XDWA 1QIMA 2WTNA 1TK3A 1HLGA 2OQVA 4B80A 4F60A 3C87A 2HM7A 2ZYIA 2ZJ7A 3PUIA 5FXMA 3EQ9A 4B0PA 3W05A 4CCWA 1SCQA 1Z68A 3WWEA 1JMKC 1XKTA 4DLNA 1XLVA 4PW0A 3DL4A 2WHPB 5ALHA 1J1IA 2WJ4A 4L0CA 2ZYSA 5HKAA 2HA2A 3M83A 5CBKA 3UUFA 3CN7A 1I6WA 2D5LA 3V9AA 3R41A 1UXOA 2QRUA 4QEKA 3VJKA 1THTA 3ZV7A 2OCIA 1TQHA 3LS2A 1MT3A 3WIBA 1GKLA 5ALRA 3HC7A 4CCYB 1GT6A 1BROA 1XLWA 4C88A 4J0HA 4X97A 1OILA 1YB6A 3KXPA 3R0VA 4AO6A 2YASA 4KAAA 2QM0A 3FOBA 1TRHA 1GGVA 3STUA 4KEAA 4I19A 4BDTA 4DNPA 5ALPA 1TAHA 3H2JA 2EDAA 4HXFB 2QMQA 5DNVA 4QDZA 4X90A 1Q83A 1XZGA 3WI7A 1EX9A 2CBGA 3PUHA 2W6CX 3JW8A 1MX1A 1LBTA 2B9VA 2H9YA 3OC0A 3FLAA 5FV4A 2JGEA 3WA7A 4FLEA 2BKLA 4KAJA 2DSNA 4FWBA 4U2CA 5FP0A 2RIPA 1ZGCA 3SWWA 1AC5A 4Y2UA 2YYSA 3ICWA 4F21A 2OAEA 1CUVA 3LLCA 4AMZA 3S2ZA 4LXGA 1R9MA 2WG2A 1CLEA 2HA6A 5E4TA 2I3DA 5CT9A 1KU0A 3F98A 4GBGA 1MO2A 4D9JA 4PF1A 1WPRA 1K5PA 4C4YA 1JT2A 2PUJA 1XZAA 3I2IA 1GXSA 4HS9A 2ES4A 2DQZA 1DWOA 5AI0A 1CUIA 5ALWA 5T4BA 3ANSA 1XZFA 2H7CA 1X2BA 3JWEA 4BAUA 2HL6A 2XT0A 2AJBA 3O95A 4K5QA 4GHWA 1EINA 2QVBA 1R9NA 2Y1KA 4DM7A 4BRZA 3AUKA 3DKRA 5F4ZA 4L72A 3A2MA 1WOMA 2VA9A 3WJ1A 5AI9A 1JFRA 3R3ZA 4AX4A 4H7JA 6YASA 3ILSA 2AJDA 1GPKA 4PNZA 3UMJA 2XUJA 1EXWA 1T2NA 2XMCA 1YASA 4H7FA 3WL8A 2WIGA 4B6GA 5CH8A 4LIPD 2FUKA 4OYYA 1EH5A 1A8UA 4WDRA 1U2EA 3STWA 3QH4A 1CUZA 5K5EA 4RNCA 4J0CA 4AO8A 3M81A 5JADA 2FX5A 2WILA 2WU4A 3G9ZA 1TCCA 1OCEA 4DIUA 5HF5A 1E5TA 4UHFA 2C5GA 1CUWA 3WKDA 4MQMA 4G4GA 3G0CA 1MX5A 3WWPA 1A88A 2PUHA 5EIEA 2PL5A 4OU5A 1JMYA 1VZ2A 2VJAA 3C45A 4HRYA 5C8XA 3WWCA 2BAGA 5I9IA 2GBCA 2WLSA 1R3DA 5HK8A 3AJAA 2FJ0A 3TJMA 2BUBA 3OG9A 4MXDA 4X7BA 3G0BA 5HKBA 1ZJ5A 4OCZA 1EK1A 1QTIA 2XUKA 3LIPA 3WL7A 2BUAA 4JEIA 5AM2A 2I3ZA 1UK8A 1DU4A 3CCBA 2HDWA 2VT7A 3R40A 4G4IA 3MVEA 4X6YA 1H2WA 3ESDA 4G5XA 3ZLTA 3ESAA 2O2HA 5AM1A 4OB6A 1GKKA 1NX9A 3IULA 4X95A 1EVEA 4KE8A 1YA8A 3PE6A 4B85A 1S8OA 5CTAA 2VATA 4X3CA 4J03A 5JYCA 1G42A 3QMVA 4Y9SA 1O6FA 5EIHA 2XMBA 4HAIA 5AHXA 4B0OA 3G9XA 4EA6A 2E3JA 3IUJA 2NW6A 4X94A 4ROTA 5LKRA 2HRQA 2VJCA 4MEAA 4FLFA 1J06A 3QPCA 1K6EA 1R1DA 2YH2A 3R3YA 3YASA 4H7EA 5A71A 1Q0ZA 3WKAA 1UK6A 4EBBA 3TEJA 4HTAA 2PSHA 4IH1A 4PSDA 3HEAA 5JASA 1MNAA 2XUOA 5LYYA 3HZOA 3V1LA 1QIEA 2JGMA 2WJ3A 1PV1A 4OPMA 5HQ3B 2RHTA 2WFLB 4JH0A 4J0KA 4U2GA 1SCIA 2ECFA 4N8SA 5IVHA 2X8BA 1K8QA 2BUCA 1MPXA 2R8BA 3C6YA 3VVMA 4Z49A 5ALNA 1QIJA 4DMFA 4Q05A 1XFDA 2I78A 2JIDA 4K6KA 2VQ6A 3A70A 2ZJFA 4QE3A 2WKWA 1QFMA 5CT8A 2OG1A 4HZGA 1XQVA 2PU5A 1K63A 3NUZA 1U4NA 5A7HA 1DTEA 4OSEA 2AJCA 4KE9A 1QGED 4Q34A 2PSJA 2CZQA 5H3HA 4WFIA 3AIKA 5LKAA 2QXUA 1PFQA 3MGAA 1UOQA 3FNBA 1QIFA 5CMLA 1YAHA 3A6ZA 4N5IX 1TCBA 1LZLA 2GZRA 3EF3A 1IZ7A 1W76A 3FSGA 3LCRA 2HRRA 3B5EA 5AOBA 5CH3A 1QE3A 4BTVA 3WL6A 4E11A 1GQSA 3WMRA 5IVIA 3A2LA 4AZ0A 3IB3A 4EHBA 2DR0A 3QPDA 5D7BA 5C8VA 1B41A 2QJRA 4OUKX 4B83A 1N8SA 2JEZA 4UHCA 3IBTA 1WHSA 4KAFA 4BP9A 3D7RA 1CUSA 5K3AA 5JALA 4J3JA 3P2MA 3AIOA 2WFZA 1CUCA 1W1IA 5T4EA 1THGA 3QITA 1VXRA 3WYDA 3DKKA 3AINA 2VAXA 2XMDA 2BFNA 3GZJA 3PFCA 3F97A 3D59A 2ORYA 4UBOA 4W1QA 4ARAA 3EQ7A 1USWA 3VISA 1E8MA 2VEOA 1CIJA 2YXPX 1WB6A 5ALTA 3ZPXA 2PVSA 4HXGA 3H1AA 1RP1A 3LP5A 3BJMA 1MAHA 4EY8A 3GA7A 5JZSA 4ZREA 5EIAA 3BF7A 5FKJA 5JAOA 1H23A 2WUGA 1IVYA 1TKRA 3O4GA 2ROQA 3O4JA 4EY5A 1XRRA 2B4KA 1AZWA 2JGFA 1X70A 2IITA 5CT4A 1DT5A 1VE6A 1LPSA 1AGYA 5CW2A 1ZD2P 1CUFA 3E4DA 5HZGA 3FYUA 3O4IA 4B9EA 2JGKA 4I4CA 5EI5A 1LPOA 4PSUA 1PJAA 4FLMA 3RARA 5AIBA 4G4JA 4XWGA 4UFPA 1XZCA 4Q82A 4AQDA 4AXBA 4BCBA 4YX9A 4KRYA 1XZMA 5ALLA 4KRXA 2WSLA 3TRDA 1L7AA 1QTRA 4GW3A 1W6RA 5A7FA 4TGLA 4UHDA 5DNUA 4ZV7A 5JAUA 1EB9A 5EHNA 5ALXA 3WK7A 5JAHA 3W04A 5I8PA 3F96A 4K2AA 1GPNA 1K4YA 5HFNA 2AXEA 2Z8ZA 1ZIXA 3BJRA 2BCEA 2OPHA 2O2GA 2HU5A 1O6GA 3WZLA 4CIAA 4MJ3A 1EVQA 1C7IA 3S8YA 5T4HA 3F9CA 4BDSA 3WJ2A 4G9GA 1FFDA 4QZVA 3H2HA 5ALDA 3CCCA 1QONA 2RAUA 3HXKA 4UBLA 2WG0A 3WKCA 2LIPA 1SOMA 3STTA 3BXPA 4AB1A 4UBIA 3DD5A 3OOSA 4MWSA 4W1SA 5ALJA 3W06A 3I6MA 1EHYA 4G9EA 3C70A 1EDBA 1QIIA 4OB8A 1XRQA 4H0CA 4DMHA 4DNOA 3C43A 4CFSA 3WIOA 1MNQA 1FJ2A 5JIBA 1U65A 1FFAA 5IVDA 1QIDA 4J0GA 1AMNA 1QIHA 5AKEA 4Q3KA 4QLOA 1JKMA 5JZ9A 1ORWA 1AKNA 1ZD3A 3RKSA 1KEZA 4ZI5A 3TGLA 4RGYA 1YB7A 2XMSA 4PV7A 1R88A 4M0MA 2XUHA 3PF9A 1VOTA 1CUJA 2PX6A 3WK4A 4AN1A 1MU0A 2XUGA 1VE7A 3WKEA 2G5TA 3PF8A 1NU6A 5HFAA 4G8BA 1A8SA 2RI6A 2WQZA 3IVMA 5HF8A 2D0DA 2AJLI 2AJ8A 2CEKA 4BC0A 4E46A 2WTMA 3WK6A 1JU4A 3KWFA 4J7AA 2Z5GA 3OPMA 2WUFA 5AO9A 4TPKA 1W75A 1MJ5A 1DQZA 5K3FA 1E3QA 1DWQA 3M82A 1YS2X 2QKYA 1CRLA 1LPMA 1XRNA 1ORVA 4CG3A 2QJWA 3PICA 1XZIA 4DSAA 1SC9A 4AO7A 4YK7A 4CIBA 4ZRDA 4AN0A 4KE6A 2ZVDA 1H2YA 2PPLA 3K9BA 3WK5A 3DDUA 1ACLA 3I2JA 5EHXA 2V96A 3BIXA 4FDMA 1VXOA 4N8DA 4W1RA 3JYHA 1XZLA 4FFWA 4LYDA 3B3QA 4CI9A 1VKHA 3O9VA 1LPPA 5JATA 1C7JA 1BU8A 2OQIA 3O4HA 4UHBA 5ALZA 4DNQA 1E89A 2B20A 1ZD4A 3NGMA 4NS4A 3C5WP 1YS1X 2PU7A 1HKHA 3N2ZB 4L9AA 5DTJA 5E4YA 3D2CA 4FKBA 1ACJA 2P8SA 2HADA 4A5SA 2XQIA 3FCXA 4H7KA 3STYA 2OGZA 1ISPA 4UFNA 4BCCA 5AKZA 5AICA 1F0PA 3WLAA 2EDCA 2JGIA 4BBZA 4Y2YA 2ONCA 4EUSA 3ZLVA 1SCKA 3IDAA 1C4XA 1BCRA 3HYSA 4EB0A 1CUUA 3AZQA 4BAGA 4H7IA 1XZJA 1BRTA 1LPBB 4J0IA 1P0IA 3UUEA 3GFFA 4MEBA 4BC1A 1LBSA 4N8EA 5CURA 3A2NA 3DS8A 2WHRA 5E4JA 3PFBA 2V97A 4E15A 4WFKA 1QO9A 3QVMA 5JD6A 3H04A 1FFBA 5ALFA 3OM8A 5JD5A 2BGRA 2H1IA 3K6KA 5JAPA 3OTQA 4H18A 5IH7A 2WIJA 2XQFA 5FPQA 1KU6A 5YASA 1MTZA 3WWDA 5ALUA 4BZWA 1FSSA 3G7NA 1LGYA 2GBIA 1AQLA 4U2FA 3QZUA 5BWCA 1VA4A 1ZI8A 1ZD5A 4B9AA 5LZ2A 3H2KA 1BEZA 1M33A 4CG1A 1ZJ4A 4XVCA 1JJIA 4LKOA 2XUQA 5AM0A 1DINA 3ANTA 5A7GA 5IKXA 5CXUA 4I3FA 5C7YA 4ZWNA 3H2GA 2DHCA 1UKAA 1YSCA 3H0CA 2H7XA 2C0QA 1MX9A 3ESBA 2EEPA 4QA9A 4BATA 3DJYA 3STXA 2VSQA 3G8YA 3GUUA 4FNMA 3D2BA 2WJ6A 3WYNA 3W9BA 3DYIA 5ALEA 3AFIA 3LIIA 1CUHA 1QFSA 3FWHA 4J0DA 3F8SA 1Q0RA 3FAKA 5I7UA 3HABA 4U2DA 3HACA 3V1KA 3FLEA 2HFJA 1X2EA 5D6OA 1H22A 4XIIA 3DYVA 3KD2A 4CCYA 5EHZA 1CUDA 4OU4A 3FYTA 4C4XA 1E8NA 2XUAA 5EHQA 1CR6A 5FRDA 4V2IA 3ZWQA 5CRIA 3L1IA 3FLBA 1XZEA 1XLUA 2JEYA 4Q3LA 2VJDA 4A23A 2Y2VA 3B12A 3D5EA 1SFRA 1CUGA 1OXMA 3O0DA 3M3DA 1CUXA 5K3DA 5JD4A 5AKKA 4M0EA 4C87A 4X00A 1BEEA 4W9RA 1XZBA 3DEAA 2ZSHA 5ISMA 3G0DA 3QBJA 1XQWA 2C0PA 1N5RA 3IUNA 4JUIA 1YA4A 2XMQA 3C6ZA 3QM1A 2K2QB 3U1TA 2IIVA 4WFJA 2O7RA 3GBSA 4DTCA 1IMJA 5CT5A 1P0QA 2WUEA 2XQJA 4F5ZA 4H77A 3D0KA 1EDEA 4PO3X 5AK5A 2J4CA 2X76A 4JNCA 5BWBA 3Q8WA 5C81A 1QIKA 1TCAA 4QDTA 4O08A 4FTWA 1Y7IA 1CV2A 1DX6A 4ARBA 2XUFA 2PSEA 2GZSA 3I6ZA 3PI6A 2XUDA 5A62A 2C4HA 2VT6A 4X93A 3I1YA 4QWMA 5AKLA 4ZGBA 2Z3ZA 5AI5A 1VJ5A 1RYYA 5BOVA 4ITVA 4P9NA 3KSRA 2JGJA 4X85A 4BAZA 4UBJA 3PDCA 4W63A 5T4FA 4OD0A 2WHQA 4X91A 3E3AA 2JGLA 4PSCA 1L7RA 3QMMA 3G9TA 4AMYA 2CMFA 2HA7A 2QXTA 3WA6A 5K3CA 4GEGA 1XKLA 4XX1A 5FLKA 2Y2UA 1UFOA 4UFOA 1D07A 1LLFA 2QTBA 1UK9A 3I1IA 2W22A 1J2EA 3ED1A 2WFMA 1XRLA 5AH0A 4QDXA 4BYMA 1CFJA 4YPVA 1QJ4A 4B84A 1WM1A 4E14A 3I2GA 5ALGA 4GLBA 4Q1VA 1EDDA 4UHHA 4MYDA 2RONA 2OCKA 1XZKA 2VJBA 1JU3A 1XRPA 5JZBA 5DTIA 3FBWA 2BGNA 2PBLA 4B82A 3CXUA 2B61A 3D3NA 4C6HA 1DQYA 1G5FA 2QS9A 4G1FA 4Y2VA 3RLIA 2G63A 1UK7A 3HLKA 2PKYX 3WZMA 3KWJA 3SX4A 1JJBA 2OAGA 4J0JA 3MUOA 5FPPA 4Y2JA 4X6XA 3MUNA 3STVA 3H19A 1DWPA 4UBNA 1G66A 1ODSA 1XZDA 3R3UA 3F67A 4H35A 5DYYA 4BVJA 5AKXA 5KWJA 1CVLA 4X92A 4QLAA 5ALVA 5SYNA 4AZ3A 5AI4A 2Y6VA 4UPDA 2JBWA 5ALSA 5AP9A 1UOPA 1CUBA 4P93A 3SC2A 3GELA 4PQEA 1R4ZA 2DHEA 2DQYA 5ALMA 3BL8A 3DOHA 1ODCA 5EGNA 5K3EA 1WB4A 2Y6UA 1BCSA 2C7BA 5CH5A 3L1JA 1CUYA 2OGSA 5IVKA 3U0VA 2CB9A 2HA5A 3C8HA 4BTLA 2HIHA 2OCGA 4UBKA 2VF2A 4G8CA 1H2ZA 2QR5A 4Y2TA 4WCVA 1ODTC 1AUOA 5C8ZA 3D2AA 1ETHA 1IUOA 5LP1A 2HA0A 4QWWA 4A16A 4IQ4A 4UBMA 3G0IA 1W52X 4QDUA 3R3VA 1YCDA 5AJHA 4BB0A 1DT3A 2RGUA 5FDFA 3RK4A 3VDXA 4KACA 2ZJ6A 1ZIYA 2UZ0A 1IUNA 2ZYRA 5LLSA 3C6BA 2CJPA 1JI3A 3AIMA 5HF6A 3EQ8A 4INZA 5AIAA 5AKHA 2J3DA 1XRMA 3V48A 4GXNA 4B81A 1F6WA 4UHEA 3QPAA 5AI6A 3FVTA 2GYWA 5HQ3A 3R3XA 4NMWA 2WFLA 4B7ZA 1CQWA 3AZPA 1MAAA 3BWXA 3HSSA 5CXXA 5FUMA 2PSDA 5ALQA 2GBGA 1UWCA 3FYUC 4LXHA 5LZ9A 2XUIA 3OURA 1BN7A 4W1PA 3DNMA 3AZOA 3G02A 2Q0XA 1QOZA 5KBYA 1HPLA 4HVTA 2WM2A 5AOAA 2XE4A 3W9UA 2XI4A 4S0XA 5ALYA 5SYMA 1Y7HA 3X3HA 1WPXA 3R3WA 4IO0A 2XMZA 3FYUB 1ZI9A 2QUBA 3CN9A 1BE0A 3WL5A 3N0TA 5ESRA 5DYTA 5AM3A 4RPCA 1HQDA 5DLPA 4Y2XA 1FFEA 2J3QA 1P0PA 4FBMA 1R50A 4MWTA 4EY6A 1CUAA 5LZ5A 5KWIA 4X71A 1VA5A 2ACKA 1N1MA 2XQGA 4RE6A 3DL7A 2GYVA 1GPLA 3KOOA 3EIOA 1UZAA 3BDIA 2G4LA 4FNGA 2JF0A 4GECA 4LHEA 4ETWA 3BDVA 4JYMA 4F0JA 4HXEB 2QUAA 1BN6A 1ZGBA
chains in the Genus database with same CATH superfamily
521PA 1B2RA 2QT9A 2O48X 4HQOA 1VLMA 1H4VB 2JBHA 3L77A 4RNDB 4AWBA 4G0WA 1JHYA 4HPJB 2PX3A 3I01A 3N76A 2RHWA 3GDFA 3R0IA 1TJ3A 1YB4A 4LOJA 3U13A 3C1TA 2J33A 4P5EA 1K88A 4UUNA 1N9KA 5DNWA 3GFSA 5E2IA 1NGSA 5KX5B 2O8CA 5IUKC 3LZDA 4BVLA 1YOVA 1XZHA 1QIGA 1MQSA 1W4LA 3KJIA 4P7FA 5JARA 2JZNA 1IHYA 3D7KA 1ZGGA 4FB5A 4GQAA 4QU8A 2I8LA 2W2OA 3GPIA 5JANA 1BFDA 2FA9A 4L3WA 3PFGA 1ONNA 4QTUB 4IHJF 1QZ3A 3I09A 4Q19A 3R7LA 4LDNA 2QNRA 1M2WA 4V0OA 3RIMA 2GJ4A 1XTPA 1NNLA 1QRAA 1GVHA 4Q9KA 1C1DA 3WDSA 1HLDA 1ZKDA 1ZITA 2X0RA 2JEOA 2E4XA 3D6FA 4NHOA 4EGCB 1DX4A 1N0IA 5K99A 2HK6A 2IH4A 3LWDA 4C0SA 3EZLA 3PEWA 4F6LA 4RXTA 3Q0TA 1EHCA 3O4RA 3NNDA 3VNUA 3SNHA 4ESHA 2W2VA 4LYGA 3EG9B 5BMVF 3KQWA 4QC2A 1E6UA 2ZJ8A 2EWMA 4L4XA 2V9CA 4H4EA 1YAJA 4DYHA 4TVKA 3ORSA 2RK3A 4Z5XA 3QJYA 3V7YA 3V8BA 1E8DA 1TZCA 4LYEA 1L3CA 5IT0A 3EPJA 1O5TA 3R9XB 3LGSA 2E4UA 2RHOA 3TRJA 4NI5A 2D0IA 1A8QA 3ZVNA 1D6JA 4WLUA 5F23A 2BKEA 2R6R1 4CE6A 4C7MA 1FYEA 1OFTA 2A3NA 3BCSA 3PTLA 4Q3DA 1FW6A 3W1EA 2ZU0C 2OBNA 5AOVA 5EOVA 4C29A 3GLIA 2ZRPA 2BEJA 4CWAA 4BKMA 2NVOA 4OQLA 2WMOB 1JHVA 1LZKA 2LUOA 3DNFA 5DJ5A 3SPXA 1HZZC 3KXKA 1PI3A 1PZHA 3TTWA 5K3BA 1GTL1 5I48A 5B1EA 1MJNA 2XCUA 3DFKA 3WAGA 1DB3A 1QK5A 3OCUA 1BIFA 1U1EA 1TDJA 3GGSA 1DG1G 4FI3C 4CM9D 5BV7A 5EVJA 3PENA 1Y3IA 3ABOB 3H8VA 4IOMA 4Y1RB 4ALMA 1RU3A 1YK1A 2RGDA 2TS1A 4LPSA 4AICA 5J4KA 3GMTA 3A4TA 2HQRA 5T67A 4ARZA 1UKBA 3OEED 2ODBA 1Y1SA 2O8VA 3VVBA 3OPYB 1SVKA 2IP2A 2WU3A 2Y77A 3D6UA 3ENNA 3H18A 3QSGA 5ENDA 3KQOA 2IDKA 3FUTA 1VKRA 1KAHA 1RZVA 4CYMA 1MKYA 1NBIA 2DGDA 3ADOA 1SRRA 2AT1A 2FZLA 1QP8A 3OZ7A 3TOCA 5C7OO 2PXCA 4EABA 4MPDA 2KW5A 3ETJA 3I8SA 4JR2A 5TGTA 2ZK7A 4Y18A 1X7GA 3IVAA 1E1MA 2HU8A 4IEEA 3UJBA 4F1JA 1IEWA 1AZTA 4O02B 2ZSIA 1OWLA 2IYVA 3MBIA 2WYHA 3RC7A 3V7FA 3ZHRA 2BGMA 4MUJA 3OQHA 4FNAA 3KUCA 2XQKA 4JP5A 2OCLA 1OXKB 2I6UA 3OLWA 2BLLA 1JNXX 3OZBA 2MINB 3Q7EA 4CMGA 4MW4A 3T15A 1CQJA 3H1BA 1KFCB 2PX5A 4JP2A 2QD5A 3RSLA 4MIKA 3NATA 1JF8A 3NO4A 3N8GA 2J7KA 3ZGLA 1BOFA 2YHIA 3EFHA 4UCXA 4WKOA 5HRCA 2QSJA 3IIIA 2IF2A 2PFSA 2VI5A 2WIKA 3P9NA 1EFDN 4LISA 4TTJA 2MMCA 5IJ9A 3DG9A 4DMMA 3V80A 3HCWA 1BFKA 3E5MA 3ISJA 4WZ6A 4ENSA 3D5QA 3OO0A 1UL1X 5GZ3A 2WJYA 1XRJA 2IUSA 1XU9A 1PWYE 5DM60 3QXSA 4Q15A 2VNAA 1QZXA 1T6NA 2JJQA 2L2QA 2QNIA 4GP6A 2XXAB 2BP7B 5BV1A 5I3ZA 1I32A 4P22A 3H05A 2PLWA 4KJXA 2C4WA 5DSTA 4FOLA 4NPCA 3A9RA 4GMDA 2X9QA 3SEZA 4C4TA 4TKUA 1M6VB 1U0RA 2WRZA 3DB1A 1ADJA 4I8DA 3T12A 2GO1A 1V9CA 2QVYX 3H99A 2BFEA 3WV5A 4FSXA 1J6UA 4ENQA 2IS6A 4G97A 1A3CA 3FNRA 4EF4A 1TUGA 2VIIA 2EKQA 3KSDO 3MN1A 1UDRA 4Y9TA 3KJXA 1HT2E 1CEQA 5BSTA 2C4MA 2QZJA 3GNLA 4WV3A 5BO5A 1RHMA 1ZI6A 1XUOA 2JLQA 3V1NA 3WKBA 4J76A 1I51A 2EJBA 5DW0A 3ZQJA 3DDOA 1GG2A 1GO2A 4WY8A 4EO4A 3O8RA 1P0MA 1DAMA 1H0HA 1GRRA 1P91A 5ELXA 4IS3A 1C8VB 3VHXA 1EFRA 2CKMA 3LX4A 2Q5CA 4P08A 1I2CA 3JQ7B 4G6ZA 1PJBA 1NXWA 1YR2A 1FDWA 3N2KB 1JWLA 1NE2A 1D2EA 1QHHB 4MQLA 5JQGB 1G2IA 2OBFA 4M1SA 1G63A 1E63A 4A2CA 4BMDA 5A06A 4MGIR 4DLLA 3NANA 1PEDA 1EFRD 1IEVA 2HK8A 3RO7A 4YACA 4QFCA 1QZUA 3OJLA 5DHTA 3X43A 7YASA 5B1HA 3HFJA 3L82B 2TRSB 3VJLA 2X3UA 2PGIA 3SK0A 3WE7A 4P98A 4NTZA 5L9AA 5K4AA 2A8YA 2QD2A 3I2FA 3LLMA 4JFRA 4MI1A 4R98A 4EYQA 3UGKA 4YV2A 1ZRSA 3ELBA 3GROA 4NX2A 4H7DA 4NZZA 1FSFA 4RMJA 1Y37A 4H3KB 4LQDA 1UPBA 1N5MA 1GFWA 2O6LA 3BWCA 4OYHA 1NASA 3VPHA 4DMCA 5AVOA 5LWQA 2PZBA 2VOEA 1QPZA 2H92A 2VTVA 1TEHA 2XA2A 3E58A 2ZEJA 4JOCA 4JVOA 3CLRD 4KLAA 4ENWA 2IE0A 3GMSA 4U2EA 2FLKA 1R12A 3R9KA 3WB1A 1UKCA 1I1QB 4CL2A 1SUFA 3FSGD 3IMCA 4MHSA 5CLFA 1SEVA 4UUQA 4Q3NA 3KOMA 2BMEA 5B36A 4U2BA 1A9QA 4BV3A 4MYHA 3EE6A 4V0LA 3QKIA 4ALKA 3E9RA 3UWDA 5TS2A 1AKYA 1GZHB 2HC9A 3RVOA 3GLGE 2XVMA 3FTDA 2OBBA 3CIOA 2JJ8A 3COVA 5LZ7A 3GPCA 2DCMA 5LYJF 2WOJA 1Z7YA 3I2KA 5HGXA 1MAUA 1N5LA 1NQWA 4BO4A 2QDXA 1EZ1A 1KRWA 4IV8A 5CPFA 5KYTA 5IWAB 4GNKA 4CEJB 3TGPA 3BFJA 2XBLA 3F74A 2CJFA 2XNHA 3G9QA 4NAVA 4ZVMA 4DDMA 2HW8A 3M70A 1SBTA 2Z5LA 2ZIUB 1CWUA 4YQYA 2DC1A 1XCJA 1XLTC 2W98A 2YJNA 1ZOOA 3O1JC 1TKCA 4LCJA 5FBQB 1N4AA 4B76A 1KORA 3NXKA 3K70C 3HA2A 2RH4A 3BERA 3CX8A 2I03A 2HF9A 4R81A 2CLDX 2YMQA 5JCJA 4KUHA 1ONBA 4GGMX 2H0RA 4KL8S 3ICVA 4LXYA 4ONEA 2OO5A 4KXMA 5FTLA 1VL2A 1IN6A 3HBMA 4JDUA 5AKGA 2ZE5A 1U3DA 3H3JA 5BYAA 2D3TA 3BZWA 1E3WA 4OMDA 3SY8A 3WGZA 4PANA 3SHQA 2E5LB 3GZNB 2OWDA 2AI1A 4GXQA 3BMQB 5AHRA 2PWYA 3ROMA 4KI7A 4NQRA 2XNJA 1IY9A 5CA0B 4G5OA 5C4GB 4OAPA 4FGLA 2ONYA 5HCIA 4ND6A 3VX3A 2X5NA 4KR0A 3KYDA 1SWVA 1LRLA 4IDPA 2HZ7A 4KO4S 5J4YA 1NATA 2PM8A 4B2LA 2Z2KA 1KGDA 2PA0A 4LJ9A 4J16A 2LGJA 3CC8A 2CVPA 4IGIA 4MVJH 2JDIA 3RREA 1F4PA 4BVHA 4K46A 4RS3A 2GGSA 4E51A 3VJMA 3GVPA 5J1SB 3CO5A 3MCTA 4O4JF 4QQKA 3T0GA 3K6RA 1IY8A 1ELOA 2CL7X 2ATVA 4FCWA 1B8UA 1RFLA 2ZIVB 3F7TA 2DFPA 3IIMA 2H4YA 3OP1A 1PDVA 1TUBA 2QTLA 2JDID 4K1XA 1F2TA 3G9UA 2CXRA 2KI5A 3EQ2A 4GR4A 1PNRA 1AUPA 1VRVA 1S1CA 2OV4A 1BNCA 1CD5A 1I1NA 2FVYA 3LYLA 4LNAA 4GQIA 4M1MA 2YWDA 3PXAA 1BKSB 3IHKA 1EEXB 5A0FA 1HBJA 3G5UA 5TPWB 3V3KA 5KDDA 3WGIA 3DVAB 2VQFB 5HIAA 2GYUA 2VJOA 3TD6A 5DLQC 5IHPA 3TDKA 2VJMA 3N2NA 2E49A 4FILA 4W6ZA 5LPNA 3G2JA 4TQAA 4LJRA 1X7YA 5E4FA 2WJHA 4HZIA 4N82A 3VSEA 2XJ4A 4UPEA 1WP9A 3LFTA 2WC1A 4M1EA 1KZ6A 4KYUA 4WDQA 2ZAIA 5FORA 3LQKA 3JR3A 2IZ0A 2JCVA 2DXIA 1HX7A 3IMEA 2XDAA 1YBMA 2FPLA 2Z04A 3AUTA 9GPBA 1U3CA 3IP3A 3IDOA 1AN0A 3AQ4A 4Y9DA 3Q7TA 4CPDA 3DBVO 3P45A 4V38A 5LR6A 5H02A 1ST3A 2M1XA 4E94A 1QLJA 1L7VC 2Z0MA 3GJ0A 2W43A 2O8FA 3RJMA 3OEHA 1HL7A 2H2DA 4CL0A 3AUJB 4BP1A 1I14A 1K7XB 4YUZA 2REBA 1MABA 4HNTA 3NIBA 4B6PA 3NYQA 4CZ2A 4DJJA 5J5AA 1T9GR 3SR0A 2XDWA 3NC1C 3D1VA 4HS4A 3S55A 4RIFA 2EWVA 3B1JA 4EJ0A 4KTVE 5EE5B 3OEHD 1WXGA 4MIYA 4Z4GA 4XWKA 5SY9A 8GPBA 1FDVA 3EVGA 3A32A 5HIIA 5KWSA 1OVMA 3U44A 4MGKR 3N2YA 1ZRHA 3L04A 3RYTC 4LHSA 3N0XA 1ZM2A 4DBLE 2ZJ7A 1C9JA 2NPIA 4EPWA 1R0YA 3NS7A 4FDLA 4PAOA 1HFEL 4ZP1A 3TXAA 1W2HA 2HTEA 4LEIA 2RKOA 1LRKA 1U94A 2DJIA 2NSYA 1WSBA 5I7HA 4C4SA 2B94A 1SCQA 4GKKB 1RKUA 2WM9B 3F3KA 4ND1A 1ZHOA 1YVDA 3ITDA 3X1DA 4DSTA 1G3UA 1D6SA 1CG6A 2YVAA 1XPOA 2O0LA 4F11A 5J2UA 1I2DA 3ZUPA 5IANA 3RJZA 1E9SA 3DFMA 4PXSA 5KVQA 1Z4OA 4JX9A 5CYOA 4GE3A 2B3TA 2VYNA 2QLBA 2Q4TA 3T94A 2O3QA 1MIOA 3F3SA 4J9VA 1FQJA 3OJFA 4NNJA 4WECA 4MI6A 1W6UA 3NMUF 4Z7QB 1VMKA 4OQQA 2C83A 2BBSA 4C78A 3G7UA 2WIBA 4V0MA 4CMKA 4NZ9A 4PYKA 5K3OA 2M6LA 4DMLA 1SCNE 4P33A 3TL3A 5HKAA 1I80A 4Q7LA 1FK8A 3ZWPA 4YUAA 1AHPA 3M83A 2VC2B 1ORHA 1JG7A 2BFAA 1I6WA 3Q3CA 1UBKS 2KE5A 5KVAA 1UXOA 2QMEA 3PR3A 5CM2Z 2QBYA 1THTA 1OWNA 2HDOA 3K1JA 2AOVA 3SZ3A 1A1VA 4X7RA 2C57A 1U6IA 3ERCA 4WCFC 1KNQA 4LNUA 4ENTA 1AK2A 1IZ9A 1SHUX 2NYUA 2XDQA 3LNTA 1I2AA 3LS2A 3TLEA 1D1TA 3FHLA 2GPYA 4DA6A 3WIBA 4R8VA 4R9SA 5CLJA 5M29A 1UODA 3H84A 1KI8A 3S2EA 3LHIA 3P0IA 4EW6A 1BROA 4AIIA 3UQZA 4I1OA 4MW7A 1MH1A 3AI2A 2J9FA 2BFBB 2P2CA 4XAQA 4UCQA 4L4ZA 4MVYA 1KETA 1ZUWA 2YIJA 1RI1A 3RBXA 1GZ3A 3OKFA 1OILA 5GINE 3A14A 1T0HB 5HFJA 5EP4A 1YB6A 3DBOB 1K6JA 5A5VA 1XCPA 5GONF 5FBHA 2GYYA 3T95A 2X0DA 2B7BA 2YASA 4PNPA 5CAEB 3K9WA 1A0OA 2FZ5A 3KFLA 4LZOA 3RBZA 2PMFA 5HP4A 5EIBD 1W4CA 1GGVA 4HDKA 5K0ZA 2OFXA 2X7XA 3KUXA 2B34A 4EW1A 4BMZA 5KNLA 3W2IA 2P4SA 4BDTA 2M2IA 2MR5A 1RJFA 3E4CA 3QE2A 3NIWA 3NRJA 4OHBA 1N92A 2AR7A 3BM5A 1PKEA 4DQLA 4ROSA 1Y5MA 2SKDA 2E55A 4JI3B 3PPVA 3T5AA 1MEOA 3IP1A 1E69A 4XIGS 1XZGA 4I55F 1FXWF 3OX1A 4BNGA 4ZK2A 3ICQB 3L7AA 3TOVA 2WHYA 4MWDA 5TT1A 3JWPA 5F73A 3IJRA 4EENA 2Y1FA 3QF7A 4G1VA 3G1WA 3N7AA 3I6IA 1B42A 1ECPA 1PTJC 3FLAA 4WK0B 1H2AS 1QLHA 3WYAA 2JGEA 3WA7A 4BO8A 4M86A 1L4MA 3GBVA 4WQMA 4BLSA 1CIPA 3KSRA 4F56A 2CV2A 4EHIA 4NOKA 1G20E 4FWBA 4U2CA 5CFRA 1MJGA 3GWZA 4P3XA 4PVCA 3VGPA 1Q11A 4RZSA 4YVFA 3T7SA 3U4HA 4BX9A 2NX2A 1RYFA 3K5WA 2ZBRA 4D74A 1T91A 4Y2UA 2YYSA 1TFUA 5IBPA 3G13A 2PEYA 3LLUA 2H51A 2QF7A 4ALJA 1L9KA 1Z25A 3EGVA 3NG1A 4OFXA 3CMMA 1Z22A 3JRXA 3K9FC 3IBSA 4F85A 1YTLA 5IXSA 1N2CA 4E32A 3GGDA 1GSHA 2Q5QA 5E4TA 1MUUA 4GBED 1CY8A 4JXXA 3AJDA 3ZJ5A 1IAQA 1OBCA 3AHDA 4YJ3B 5JI3E 3EIUA 2WQ6A 1QGZA 3ORYA 4R4JA 2AOUB 4KPEC 4V1CA 4FW9A 5IRCD 2I9KA 5DYIA 1KYIA 2CKDA 3KOUA 3LKDA 1Y6FA 1CS4C 5L3SB 1RWOA 3QFHA 4HK4A 1JT2A 2PUJA 3FF4A 4PNEA 5DWQA 5H81A 3I2IA 4M7WA 2Z2XA 4PZEA 5ADUS 2AG6A 3K9NA 3BIJA 4DSNA 5CEFA 3HE3A 4YJHA 5GV7A 3W34A 2FFRA 1V3QE 4B8WA 1VSBA 4IRMA 1SIOA 1W36D 1H66A 1XZFA 3KKZA 1M67A 3EFBA 3PUZA 3NKVA 1X2BA 2IIPA 2YWFA 3JWEA 7REQB 5KYXA 3AK4A 2RGRA 2ZYTX 4BUCA 2OHHA 2HL6A 2R6ZA 4QHSA 2XT0A 4HBZA 2EKZA 1KXZA 1AF7A 4BP3A 2QM8A 1W49A 5JY6A 1RZ3A 3B6IA 2YICA 2HUNA 4BNZA 1USVA 3K0KA 2BE7A 5C53B 1J9ZA 4ZAZA 3DFIA 1ZW1A 2XNCA 3NDIA 4C20A 1OASA 5FB3A 4GPTA 3FM9A 4Q93A 3DXZA 4IY1A 2AXNA 1R0ZA 4IG9A 2VDWB 3G0HA 1D2GA 1JFFA 4MMYB 4DM7A 3F73A 2AOWA 1U1CA 2GAIA 1NJ1A 5HHTA 4BRZA 2R62A 2W2NA 2VDJA 1E7WA 4OBEA 5H70A 4EVSA 5LXTA 4L72A 2C61A 3IIKA 1R0LA 2WLTA 3DHNA 4EUNA 3LY9A 2BELA 4R0VA 2J59A 3BSFA 3KS9A 3M1LA 2OCPA 2C77A 2FK8A 2LW7A 5A3SA 5BN1A 3QEAZ 3KB6A 3G3EA 1T3ZA 4C0AC 5G0TA 4P7JA 4Q02A 2ECOA 3R3ZA 4DLKA 3GPBA 3PI7A 1I94B 2WA1A 3PGKA 5J58A 2REQA 1JQAA 4PNZA 1YZHA 2XUJA 1PNVA 2GJAA 4HUJA 3OE7D 1NDQA 2XMCA 3OQJA 4OMCA 5FV7A 1SZDA 2UDPA 3BB1A 1KDYA 3WL8A 4AZWA 2WIGA 1O89A 5F2NA 1M0EA 5CH8A 2IYUA 3IT1A 4LIPD 2QGZA 4ZJUA 2AF4C 2FUKA 2VUSA 2W4MA 3HGQA 3K9LA 5BSVA 5J47A 3L9XA 1A8UA 2KYRA 5AXDA 1MB0A 4XTCS 3WADA 1P1HA 1T4DA 4LOAA 2VNJA 3W5VA 2JHFA 5SY4A 4EG7A 1YUBA 3ZVKA 3STWA 2NXWA 3I37X 1PHPA 4PR3A 2WICA 3ZC3A 4CTJA 4OMFG 2F8TA 1OAOA 2QM7A 2PKCA 1ZK0A 3A9CA 4YRKA 2QE6A 4WINA 2DPHA 2EERA 1KGSA 5I9NA 2A2ZA 2RAPA 1MRSA 2ZW9A 4RNCA 3RW9A 5K8UA 4MIOA 3N58A 4R1SA 3RTBA 4AO8A 1UKZA 3W7AA 1IU9A 1SCJA 4EK9A 3L40A 3DWFA 5FQOA 1SKQA 2OCAA 5JADA 1P19A 1WW8A 2WILA 4PZDA 4YO8A 3I73A 3W9SA 1E1DA 2DJ5A 2IYLD 2RBKA 2IZ7A 3D0RA 3VTAA 1CERA 1PCXA 4QVKA 2ANCA 4ZTBA 1OCEA 2HWKA 3TQFA 4HMQA 4Q4AB 1KYVA 4LHXA 2GJ9A 1E5TA 5KUTA 2YHBA 1UBJS 3REQB 3A1WA 1VLHA 4FGUA 1G55A 1YB2A 4BQIA 3LVQE 5IXYA 1A2QA 1Y3BE 1TJ4A 2ZJBA 1NN1A 1XCLA 3OETA 2JGRA 4X1IB 3UMGA 4O5OA 4QUHA 4TYPA 2IOFK 3T4XA 2GN9A 4MUEA 2BSQA 3FG9A 1AG9A 3IC5A 2DWCA 4MQMA 3WKDA 2HRCA 2P9EA 4LV6A 3HDVA 3SQOA 1JIJA 1LDGA 1QZTA 5E2BA 2W6ID 1K4KA 3N0RA 5ECWA 5EIEA 3F4LA 3C5CA 4OU5A 3OU7A 4ALNA 3V00A 3VHRA 2VRBA 5BSUA 1RCTE 2YBDA 1VZ2A 4POOA 1WU7A 2PGOA 1MJGM 3U3KA 2GFIA 1XVTA 2ZREA 3CKMA 4JLKA 2QUJA 1EVZA 3EEQA 4AY5A 3PPIA 1BKDR 1UJ2A 2YZMA 1V43A 1KR5A 1MA3A 5I9IA 4CIYA 1D0SA 2A5LA 2IH2A 2BGJA 1QNLA 2F7SA 4RHYA 1XMJA 2VXOA 4W82A 4D9NA 3UPTA 1DUVG 3SJBA 3GN2A 4N03A 3WL4A 3OG9A 3CR7A 3KRTA 4X7BA 2JRLA 4NR0A 1WDTA 5CIWA 3SSAA 4H6PA 5JECA 2NYRA 2ZJ4A 3LX6A 3SC4A 3RTGA 3BFXA 4RBNA 1HGXA 5HE9A 1ESEA 2I8CA 5KHAA 4ETIA 3F6SA 4Z1MA 3THWB 5HEKA 5H16A 4QTXA 3HN7A 3LIPA 4ADSG 3WL7A 3OMWA 2BUAA 1KFJB 2OXTA 5LBUA 2AZDA 5K9ZA 3O90A 5IBQA 2DMRA 2A5FA 2VRCA 2DX7A 3F0TA 1DUIA 1ETUA 1Q50A 4JEIA 2FHSA 1V11A 3O8QA 4RELA 5ARBA 4D25A 3T38A 4K86A 1N0VC 4QODA 1XDZA 3CCBA 3DV0A 4MR7B 4TS3A 5EP2A 4LC1A 3TZ6A 2NSLA 4HMPA 2DH5A 1WCXA 1XTRA 3D8BA 2HJHA 2YN4A 2VRCD 3CF2A 4BVGA 4G5XA 3GRCA 1KOFA 4IEIA 4MVJD 4UDYX 5KTRA 2C2YA 2O2HA 3VO1A 3G6KA 3GCDA 5IKOA 5J40A 4IZOA 4CV0A 1Z13A 2XDYA 1A2OA 3EIQA 3K35A 2NVUA 5L3RA 1IMOA 4M1YA 4QM7A 3L8CA 1I0IA 2VP4A 2RK6A 4KE8A 1YA8A 1GNVA 1STOA 4LX0A 3WV4A 2B5WA 3HB9A 3K1AB 4XFDA 2X15A 3JASB 5FUWA 1S8OA 5CTAA 5I45A 1WETA 3I5AA 3QWIA 1J1ZA 1TTPB 3UKOA 5LMCA 1G98A 5ICFA 5BSRA 5AWFC 3NB0A 2OP0A 4MAFA 3GP8A 3RR2A 1BGWA 5C7LO 4E3WA 2I3AA 3GFPA 3N8HA 4TT8A 3RGGA 3U3OA 5K8LA 3HU1A 1A9OA 1RYEA 1EFKA 1UR5A 1YU9A 5EIHA 5DBGA 3X1ZA 3ZDRA 4B4OA 4HAIA 4MZDA 4ND8A 1JQ5A 4ND4A 2BFWA 1OJ7A 2XA1A 3GLUA 4AY3A 3KBOA 3HH8A 2E3JA 1GR0A 3QOWA 1V37A 3S2YA 1VC2A 3ZGOA 4E5YA 1CU1A 4TOIA 2O6HA 2C2OA 4BX8A 4ROTA 3DDWA 1W30A 4HQKA 3OA2A 4RKWA 1P31A 5LKRA 1A71A 3O3OB 2GFHA 1BD4A 2XKJE 1NZFA 1OFVA 1YJ5A 2YVLA 2ZJOA 1NNI1 1W8IA 3FTPA 2WWIA 2W48A 1G5TA 4F6RB 4MWBA 2MYPA 2YH2A 1LTKA 2BRUC 3F7OA 3VQTA 2WJIA 4H7EA 3HL4A 5KQPA 1DBIA 2GF0A 1E9AA 3AEQA 4EQ6A 2DBQA 2J6HA 3QMPA 4FEAA 1BVYF 3TQRA 1Q0ZA 1RRFA 3AHFA 4HDOB 3UNXA 3UJ9A 1AKMA 2RHHA 5CVDA 3TS1A 3V2UA 1RLIA 5FHRA 1UBFA 1T43A 3UPUA 2CC2A 1QRSA 4PSDA 3OO1A 4YCLA 4HLUC 3HEAA 1ZK4A 3UAVA 5EGSA 4RVCA 3BILA 1GPBA 3ZU2A 3AU9A 2GEFA 1PZNA 2C2GA 2WJ3A 3V1LA 5DBFA 5BN5A 3VYUB 1SH7A 1Z45A 2IYSA 1OX4B 4XSGA 4Y6OA 2CCKA 2OY0A 3S2GA 2RH8A 1U2QA 2BI7A 5HQ3B 1ZSYA 3D8SA 2J3MA 2ODTX 3E9YA 2BN4A 3PT5A 4TLEA 4CHGA 3AL2A 4QVIA 4IILA 4QT4A 3MHPA 2BM8A 4Y0AA 3PTAA 4RANA 1FDSA 2I2BA 2QYSA 4U2GA 2DUJA 2BE9A 3BCRA 4W5WA 4XKJA 3TF5A 2Q1UA 2ECFA 1LVGA 2C3PA 2R48A 3AF1A 3QVOA 2H6EA 3H9EO 4LSMA 4M9ZA 3K8YA 4N8SA 1K8QA 2BUCA 3Q85A 4DCNA 4BNDA 3TM4A 3ES9A 1B0ZA 3MYRA 4NJOA 5DMXA 5EP1A 4ERXA 1SUEA 2O54A 3CE9A 2QY9A 5F52A 1K89A 4FWTA 2N42A 4KDRA 4M76B 1JFTA 2CZGA 1OV6A 4IX1A 1YZYA 3HPRA 4OFZA 4BFLA 5COAA 5BORA 4DCUA 2V03A 2VQ6A 1FW8A 3A70A 3PXCX 2G04A 3IALA 4XWAA 3MTJA 2ZJFA 4KN8A 4CMEC 5L6LB 4QE3A 2WKWA 4D9CA 1DV2A 4ARIA 2OG1A 3MT0A 4CT5A 5GTDA 4LTNA 4NH4A 2FWJA 2O1WA 4R31A 4V03A 2NXEA 4ZVLA 1PLKA 1U4NA 5G41A 5TJHA 3IP6A 3SP1A 3BCHA 1H4SA 3RVDA 4C03A 5AVUA 2ZUDA 2PMWB 1VG0B 3CNNA 2ZUVA 1ZN9A 3JQFC 4OSEA 1VL6A 3GEMA 2IY7A 5DGHA 5KC8A 2AJCA 4L50A 4QG7A 4B3BA 1WDLA 1D7AA 1GQYA 1J0AA 1M74A 2H8GA 4Q34A 4QYWA 1QQ6A 3FMVA 3FZYA 3KTFA 3PUJA 1J2TA 3BRWA 4RHTA 1X92A 2FPPA 5B7GA 1U04A 3VUEA 3OBBA 4BQQA 1A04A 1U6KA 4G1EB 4QBIA 2F8SA 2CB0A 1EFPB 2QXUA 4RLQA 4EJ2A 2XB2A 1GWNA 4U6NA 4OHRA 2Q8NA 2AEJA 2IPOA 3RSSA 4HTFB 3BRWD 3PWZA 2CJXA 3WJAA 2H54A 1YRLA 2W2XA 4JLNA 3RE1A 3RG8A 1TTTA 4JBWA 5JNRA 4BB6A 2ZQZA 4LF6B 4I36A 1LK7A 3OCVA 2A5GA 4HMOA 5KKNB 3EPLA 2F6RA 1TAUA 4Q4JA 1IZ7A 1QBKC 1JWAB 3LCRA 3FZEA 1O4WA 3LUJA 3QIAA 5JR3A 2GPTA 3QYPA 1CDDA 2C1XA 1QE3A 1WUHS 2OCDA 2R8PA 3CO0S 3RT9A 2D2XA 2GM3A 1G0OA 1Y9AA 2Q7XA 4PC1A 4YPFA 3W9YA 3V4VB 5KYWB 2GBPA 3OE1A 2PA3A 4MUHA 4PQFA 5D5QA 4Q9LA 5IVIA 4FGWA 3A2LA 4AZ0A 4LVCA 1CZLA 1TA0A 3PEUA 4HNAB 4M7RA 2FZ4A 2OQRA 1DL5A 2XB8A 2D54A 3CE6A 3KAKA 2OB2A 4ITRC 1C2TA 4N3NA 2ZYDA 3TIIA 4YIHA 4TVOA 1YBHA 2ENUA 3KEMA 1VPWA 4B83A 1O95C 2CEAA 1Q1BA 3GP3A 3KOYA 4A0QA 1GNSA 4ANFA 4BLQA 1NVEA 1ZXBA 1WHSA 3IBTA 4KAFA 1Z16A 1YRHA 1OE0A 1M0SA 1L7OA 5DT2A 3RVNA 4RPHA 1CUSA 2IA5A 3JQ8A 3MJEA 1TM2A 2PUDA 3SJUA 1MC8A 3QK7A 4YA6A 1JQ3A 1Q22A 3OIDA 3O8OB 3R6GA 4RPKA 3FZNA 1QHEA 5BSFA 3DDCA 3ELUA 4W5NA 4BFUA 1N7HA 1Z5GA 3UK1A 1WSWA 4D4KA 1K4MA 2J3KA 2R7MA 3MT8A 3P2MA 3AIOA 3UHPA 5HZKA 4OGKA 2F3PA 1W1IA 4OG2A 4S1WA 1T8TA 2B2NA 4BQOA 2V0CA 2RD2A 2V7BA 1Z0KA 1C9MA 1THGA 2D74A 4YAFA 5KYVA 2O2XA 4Q9DA 1TEVA 3WYDA 2B6HA 4GZ3A 1GYRA 1AKQA 1PWZA 4US2R 2FPIB 3PGXA 3DMFA 1RD4A 1E7RA 1ZEJA 2M1ZA 3JQ9C 1BO6A 5KHLB 5DTRA 4XWWA 3DT6A 4QYXA 4OF4A 4HT3B 5B5SA 4JJAA 1BXKA 3WHIA 2CCJA 2XCRB 4REQA 2APJA 1IHOA 2ZJ0A 1USWA 3P0EA 4RSMA 1G4UR 5BR1A 4P4GA 3CUSA 2VEOA 3AP1A 3A8TA 3B13B 3WDKA 4G0UA 4L5JA 2DEUA 4BAGA 4ARVA 4QXAA 1PBNA 4AZSA 1BA2A 2VK4A 4KIJA 4PO8A 4LA4A 2FFHA 3ZIAD 4P7BA 2GWRA 1MH9A 1M2OB 4NAHA 4TWRA 4F97A 1FP4B 4KNYA 1MAHA 5ARCA 4I8XA 2G9QA 4MGZR 4PS0A 3CIFA 1YZLA 1EVYA 2BSXA 1F8YA 3KIPA 3LQYA 3IEKA 4Z0NA 5IFLA 3QOXA 3N07A 5JAOA 4E88A 4DGSA 1VL5A 1QGDA 3ZZNA 2E21A 2J0EA 2W00A 4RF2A 4XDGA 4HB2A 4OBWA 4DA7A 1DXQA 4LYHA 1TKRA 4GRIA 4LWQA 1GPJA 3E03A 3RFFA 2GLXA 1U3FA 2DUUA 2ZJ1A 3PDJA 4KBGA 3JARB 2ZCUA 1XRRA 1OROA 4QPJC 3ZS9A 2N75A 4O25A 4LSWA 1JR6A 1NUAA 2B4KA 2OV8A 1NNSA 3A36A 3G85A 1AZWA 1W85A 1JDZA 3BE4A 1B3BA 4ZRNA 3KQYA 2JGFA 2I5PO 1JG3A 3AUUA 1NL3A 4D44A 3KKOA 1UQUA 4XE5A 3BTSA 2AFVA 3QUTA 3DEIA 1CUFA 3E35A 4G2TA 4ZQEA 3QI7A 2OK7A 2J0QA 1PFUA 1U02A 3VO2A 2MHCA 3NBXX 4ZXPA 3HA3A 2YV4A 2DR2A 2FWAA 3ZDDA 1D1QA 3SIPA 3A7EA 3T35A 1Q0UA 1H6BA 3KP1A 4PSUA 2BR4A 5AIBA 2V3WA 4UUMA 1G7RA 4XVHA 3EX7C 4UFPA 1Z6QA 1U90A 4RMHA 1QRRA 5DEOA 1YE5A 2QR2A 1Z6ZA 4X8OA 2AD1A 4EKGA 1I1HA 2VPIA 4WSOA 3QOYA 5FI5A 3ZU5A 4L8YA 3VNBA 1KMHA 1XF9A 1ZNQO 1R5JA 5ALLA 2HMTA 3VPCA 5DM70 3E81A 1N0WA 1PLLA 2WSLA 3BTVA 2MDTA 3DV9A 5FPTA 3S40A 2GLTA 1G6Q1 1DMSA 5A3RA 2X4DA 1EAMA 1L5MA 2OHFA 3U2QA 1OHHA 2CL6X 3ORFA 2EKBA 4Q4HB 3EFOA 2VDPB 2ENWA 3GLVA 4KGZA 3UICA 1OUMA 1OLSB 2FRVA 4ZV7A 2A9QA 5JAUA 2AEMA 3BD8A 5J2UF 1OHHD 1KEEB 1SCDA 1FLDA 2CGEA 3LHSA 3L6RA 3F4KA 2EX4A 5L3VA 3CEHA 1OFGA 3L18A 4KLNA 3IAHA 5G3YA 3W04A 4BNKA 5I8PA 5K01A 3F96A 1H4TA 2QSUA 5L95A 1RWNA 4ZO7A 1W4RA 1GLVA 2K4MA 4X0EA 3SM9A 3UAGA 1NBOA 1TJYA 5JFTA 2D5BA 2OPHA 4L2IB 2YWCA 2BCEA 3TTSA 5K0CA 3IHWA 2Q4BA 2O2GA 2DULA 2EJVA 1Q12A 2CE7A 2J9YB 3NBZC 3A25A 4NYJR 4LFCB 1Y3DE 4FSDA 4MJ3A 4QULA 4ZI3A 3K6SB 1T9KA 3BWEA 3PT9A 4FZVA 4HWRA 4JIGA 4GEKA 4EQZA 1QS0B 1U1IA 3WVNA 1ADYA 2NZ8A 1Q15A 3F9CA 2ZAMA 1X8KA 3IEXA 1QAMA 3MWYW 1Y5IA 1EP3B 4UNNA 3SQNA 1UJBA 4QZVA 2YWBA 4WXEA 2J9XB 3DE2X 3U61B 2P9JA 1E5QA 1BMTA 2GILA 4AT1A 2YXDA 3IT3A 1TXGA 1ZNZA 1ZP6A 2WG0A 4EYEA 4F9GA 1J97A 2LIPA 4ID9A 1SOMA 5GOTA 1U4OA 2I4RA 2WWTA 2CDRA 3BXPA 4NDZA 4XQGA 3STTA 4BO1A 4CR7A 4G23A 2RGWA 1UH5A 4MWSA 3X44A 1CC1S 1R7RA 1YHYA 1F20A 1QHSA 2GVNA 3IAS6 4KAXA 4F9TA 2G0AA 4J29A 3ZK9A 1TPYA 2B2XA 3UH0A 2C5EA 1ITZA 2ZBVA 3EG9A 2HJVA 3BH0A 1QIIA 1ZXLA 1P6QA 2IJGX 1XRQA 1ZHHA 3LGAA 4H0CA 4F2DA 3M34A 2XT9A 1S2NA 2OR3A 2ZBEA 3MIIA 3T5CA 4B1FA 4DEVA 1FRZA 2OHIA 1T4BA 4NWIA 5P21A 3WB2A 3WIOA 1EXDA 3R9XA 1X14A 2XTAA 1FJ2A 2IRWA 1K8YB 5T6MA 4DY4A 3EF1A 5JIBA 1P3Y1 3C3EA 2WV7A 3UT6A 1OTXA 1RXSA 2AKAB 1AO0A 1UUFA 2H4HA 3AUAA 4PYIA 1F8GA 3VC1A 1XMSA 1E79D 2QN6A 1FFAA 3U81A 3JVEA 4D3YA 3ST7A 3ZWYA 1Z4NA 1NUUA 2Q3DA 1ECLA 2HT1A 1HOXA 3LCCA 5EE3A 1U0EA 4JQOA 2I6GA 3OX4A 1UXJA 4M98A 4F3TA 1Z34A 3TKYA 1ARZA 1XV5A 1W35A 3IPRA 1RWVA 4LRUA 1ZKMA 2LV8A 1GG9A 3HJTA 1HNWB 3GW8A 4C4RA 4YT2A 3ETNA 1ST2A 4EO9A 4Y1RA 2QRZA 4ZIRA 1JBQA 1KY3A 1DUSA 1AKWA 2A78A 3OZUA 3DDHA 4PV7A 4WBSA 5CPBA 3TB4A 4M0MA 2XUHA 4PG5A 1QVAA 1BOOA 2JIOA 3BD7A 4Z9FA 2GRJA 1AXGA 3KQHA 1CUJA 4AN1A 3OPYA 3HCDA 4YT8A 4IICA 4YAEA 4AX8A 3UF0A 1GL9B 1ZXXA 2GCGA 2ZRAA 3PDWA 3IDSA 3CISA 1U0GA 1E96A 3CGWA 4ON9A 4XM0A 2P4EA 4YCDA 4CMIB 1TTHA 3GAMA 1LF0A 1M83A 5THXA 4ZPXA 3N0WA 1YONA 2EJUA 5K2MA 3SYLA 4BO2A 4D9IA 1WB9A 4F4JA 2E5FA 2OMEA 2PUVA 3DWGA 5HFAA 2YHSA 1H1TA 1HZZA 5HF8A 4AROA 1KJWA 4H1WA 2HEIA 2XVYA 1NP3A 3GJXC 3KSZO 4FSHA 4JI7B 3NHWA 3LUKA 4A1OA 3B1KA 3GCGA 2WM3A 1IONA 3O38A 2Z1MA 4Y1FA 1H0SA 3LUAA 4ZALA 1U8UA 5HZHA 1NBAA 1NRWA 4FX5A 4G36A 2MINA 4AYTA 1SD5A 3TLBA 1OT5A 1QV6A 1JU4A 1T8WA 3FWNA 3KWFA 3LJKA 4I6GA 3HNRA 3TOZA 2CFCA 4OH1A 3ZG6A 3H0KA 3S0JA 2ATXA 3JVVA 5LD2C 2PTGA 3OJCA 1HTWA 4DW8A 3B6JA 3OPMA 4DRYA 1FUEA 3V6MA 5FTNA 2O2JA 1WMEA 3AJRA 2IV2X 2ZSAA 4W5OA 2Y1OA 1TZJA 5LIRA 3PD0A 4TM7A 1E3QA 3LOQA 3FMIA 1PS8A 3NBMA 2XXAA 3FYSA 1W88B 1TD9A 1C3EA 2BP7A 1OZ0A 2XCLA 3HZHA 4KXXA 2FW1A 4Z3DA 4IKPA 2F8MA 3PQ5A 4CLOB 3PGLA 4CODB 1F38A 1W87A 5LXTF 1DIRA 2OGUA 1NOIA 4YBRA 1Z06A 5E7IA 2NTJA 3QY9A 4QFBA 5FTWA 4GOMD 4JXJA 1YIAA 5FAKA 2BBTA 2BFFB 2H11A 1PQ4A 3PC3A 4QQ8A 1ZX1A 2W2PA 3DXFA 1UJ4A 1GGFA 1KH2A 4X20B 1XRNA 4P54A 5A9TA 3UFXB 1JLRA 5LD2B 2GPWA 4D56A 3GBPA 1I9CA 2BDTA 2CDNA 1O1YA 1T2CA 1MB4A 1YUNA 5B1SA 2YKGA 1ZWKA 2GOYA 1ACMA 1EFTA 2BPOA 2P41A 4AO7A 4P0TA 3ZDAA 2PUWA 2HNAA 1Y4UA 2XH8A 1JLMA 1H2YA 1UJMA 4YRPA 1DG3A 3V8RA 1S2IA 4D8YA 2PPLA 5HX7A 2OD7A 2RSLA 3IAUA 3K9BA 1WNFA 1GKUB 3SN6A 3VVCA 3DDUA 4LMAA 4ZO8A 1JAXA 4P84A 5G4LA 3JQ7A 1ACLA 1FS5A 1RYHA 3EULA 1U7DA 5DU2A 2YJ4A 3N2KA 1RM3A 4HGOA 4Z9XA 2JH3A 1QHHA 1NA5A 5JD3A 5JQGA 4N8DA 1J0DA 1JKXA 1VE3A 1GT91 3IBCA 3RJTA 2Y0PA 4LRSB 5F98A 4FFWA 1Q1QA 2HRZA 1M66A 1G3IA 4RWEA 2HSZA 1G7CA 4AWXA 3LXUX 4I1PA 2ADMA 2FV8A 1NKTA 3B3QA 5IH3A 4BQEA 5EMKA 1VKHA 5E3IA 2P9HA 1P81A 3H0EA 1PFGA 3NBUA 1LPPA 2W6PA 1OI7A 4MKHA 5FBKA 4QUKA 2Z3VA 5JFGA 2GEJA 2OQIA 4DV0B 4R8MA 4E5SA 4HX5A 5ALZA 1QGAA 1R3UA 4JR1A 3AHHA 1Q77A 3UW1A 4RA6B 1R0RE 2HEGA 3NGMA 3C5WP 5AVKA 1Q0PA 1SC1A 4P5DA 1YS1X 1N6LA 3PTZA 1FRNA 1LDEA 3M4ZA 4AAYA 4ZOQI 3ROGA 2PU7A 3B6ZA 1FPQA 4UAVA 2XAUA 5DF1A 1Z56C 4AKIA 3SU8A 2IW3A 5EIFA 1E0AA 5FWYA 1ACJA 2ACWA 3EFEA 1D8TA 4R0NA 3HZRA 2P2NA 4GVXA 4J2OA 3ZK7A 4TKVB 1A8HA 4ZVQA 1CF2O 2XQIA 2YS7A 5EWJB 1R18A 2UYOA 4BNLA 3PGA1 3BBLA 3KVNA 2OGZA 1U8ZA 3LRXA 3FCAA 4NY1A 2EEZA 2HN9A 5I9BA 3TTYA 4E03A 2F3RA 5BNWA 1Q74A 1SIWA 1UCFA 2OBMA 2X9VA 1P4JA 4MW5A 2F17A 3EJ6A 4G56A 4GX5A 2COEA 1EGMB 3CMCO 3TLJA 2X4IA 1VP9A 3LHFA 2OKGA 3I4CA 2R4UA 3OEWA 4FOTA 1WR8A 4MS4B 1H05A 3HPQA 4N40A 4Y2YA 4LV8B 3E82A 1W2GA 3EJWA 1E9FA 1UEXC 3OUTA 4NNPA 1QQ7A 1PK7A 2HSWA 3QEMB 4RORA 4EL0A 3WFIA 2XGOA 4NDAA 1TMGE 1JHAA 1VHQA 3CVOA 4N1AA 4FGSA 2ZBGA 3HYSA 3MLAA 1JAYA 4EB0A 1CUUA 1XTIA 4A8TA 1XZJA 1BRTA 2QUHA 1AV7A 2QWXA 3G49A 4J0IA 3KC2A 4WACA 3CZRA 5DMHA 5EC8A 5CA0A 4X24A 1WSDA 3X1KA 1TF5A 4MEBA 4E2ZA 2O7QA 2X8LA 4OQXA 5CJPA 4HAVA 5DT9A 1CKEA 5IAKA 3PDIB 3WOVA 3AOEC 4JNKA 5JNSA 3FLMA 1JVBA 5CURA 3A2NA 4F4CA 1ZOLA 2HH9A 2GO7A 1FDUA 2JKVA 4UASA 4UE2A 4CM4B 1XLTA 2EFCB 3CZCA 4CMAA 3DS8A 4XGKA 3DWEX 3CFYA 2AC2A 3PFBA 2JFNA 3KCQA 2JNWA 4XIFA 3JALB 2PZ8A 1NBEA 2DAPA 3A4LA 3NAQA 2VHJA 3DE7X 1YZUA 4TTRA 2ZUSA 2BGTA 4GRDA 3CLTD 4ZCPA 3LBIA 2UVPA 3MAAC 3TZKA 3WICA 4DV4B 4HUTA 2Q3LA 1D6MA 1JE1A 2EARA 3OC6A 3AVPA 3E8XA 1ATZA 2QMYA 5K0TA 4IOLA 3LUGA 1IJKA 5H8WA 1YDHA 2LZ0A 4OLJA 4EA8A 5IH7A 5KSZA 2CNKA 4YP6A 2F3QA 2UZ3A 3K2QA 1EQUA 5TPWA 3TIXB 1KU6A 2PH3A 1Q0HA 4O4HB 1U0LA 4XQ9A 4WNAB 4PBSA 1H8HD 2IGBA 4IUDS 5C1IA 4C5AA 2JCSA 8ABPA 4ZOLB 1W5SA 2E5WA 1M6NA 2SHKA 2ZYUX 4B35A 1FSSA 3LT1A 3UMMA 5A4MS 3LSYA 2ZRJA 3G7NA 1RPJA 1E9EA 2CNNA 1ZN8A 2P4HX 2IUTA 2P6MA 3LFUA 2HV9A 4Q01A 3RIGA 5M3BA 5BWCA 3ZBQA 1QH0A 4EOGA 1DVRA 2FOLA 4M36A 4DA8A 4GT1A 3OQ1A 1Z6GA 1OBVA 2J45A 1ZD5A 1DADA 1SULA 4IVNA 5C8DA 1A9SA 1CXZA 2X1LA 3JQRA 1DKLA 3T9FA 4TVBA 3U26A 4P3OA 4Q39A 3AV3A 1AGPA 1YQUA 4TTQA 2P3OA 4I08A 5DTMA 4YQEA 3WYEA 5F9HA 3Q41A 2Y66A 1H4QA 4Q21A 2ZAYA 4K9QA 4RUKA 3VU0A 5MGNA 5AVWA 1Y3HA 3EDOA 1P33A 2OL4A 3FWKA 3RGWS 1WPGA 1RAAA 1ZJ4A 4TM8A 4XVCA 2FMXA 3HYTA 1NF2A 4BV2A 5AVZA 3S81A 1MR3F 3MS4A 2RGBA 3ZDFA 1PR9A 3GLIE 4KJZA 3SYNA 1NVBA 1E7QA 1GU1A 3HQ4O 5E8JA 3S70A 3CVXA 3SQXA 4FHCA 1N6NA 3JV7A 2XUQA 1J00A 2R8ZA 3G5TA 5T3UA 2X1HA 5FTKA 4KIWA 1E32A 1K7SN 3L8YA 4J3NA 4DYDA 1C9NA 1OH7A 4AY4A 3DZ8A 3HP7A 2ZVPX 5CXUA 3O94A 1NXVA 2FX3A 4A10A 1XTSA 3RU3A 2WJPA 3QFTA 5ESXA 4ZWNA 3ZD7A 3FWZA 4G01B 4HNVA 4E12A 2DHCA 4RTNA 1LFDB 4FGJA 4MO9A 1UKAA 1OWPA 2IOYA 3D8UA 3EK2A 3Q9LA 1DCTA 2C0QA 3R76A 2OORC 3TBFA 2BI4A 5A3QA 1AN9A 4RGBA 4BATA 3PNQA 4KRFA 3GDOA 4FNMA 5ABPA 3FJYA 2BMDA 1CF4A 3N05A 4FFNA 3ZEIA 1U4SA 2DFDA 2AS0A 2EG5A 3PC6A 4A8PA 3IOEA 3IOCA 2WJ6A 4PBRA 1R0KA 5JBNA 3B9RA 1ODIA 1QX4A 3AUYA 4ER0A 3MRSA 1FP6A 3AFIA 2V59A 3L8EA 3LIIA 4HN9A 4DUGD 1XVVA 2IBMA 1JSZA 3FWHA 3BEOA 3IO5A 3HABA 4IGKA 2HFJA 3WLFA 4LDAA 2AWOA 2J8ZA 4JUAA 1EBUA 1U8AA 2PAAA 2A92A 2H1WA 1BHQ1 1V8DA 3FSEA 3QEOA 4RMNA 4UQLA 1NFQA 1GZUA 1UDAA 2XX3A 3KL2A 4IGAA 4WT7A 1WA5A 1O0CA 2E9SA 4XIIA 3SYTA 3IAEA 3OT1A 4Z9BA 3CPHA 3EBPA 5HS6A 4EATA 1GCAA 1XCGB 2FSGA 2QAGC 4OU4A 3UB3A 4DLPA 1XNQB 1CFZA 3TN7A 4C4XA 4JYAB 2J6BA 1L4YA 2XY4A 5EYPB 1IHDA 2BFBA 1CR6A 121PA 1LJ8A 4Y67A 3UGTA 4AG3A 4S35A 1Z6YA 2AG5A 4ND2A 5FRDA 5I5GA 4AKTA 5C4IA 1P8JA 2BH9A 3GD7A 4HQFA 4V2IA 3ZWQA 2Q4RA 2R87A 3II6X 7ABPA 2VNHA 2EFHB 2NVWA 4KDFA 2IBSA 1XZEA 1E6LA 2FHPA 2UXDB 1A5BB 4KV7A 2PL3A 3HDGA 1XK7A 5E6SB 1XZ8A 3SBOA 4PHGA 4WUTA 5CAEA 2HNKA 3CRQA 3FVWA 4UJ5A 5I9TA 3TB6A 1WUIS 2ATEA 2VUIB 1N8NA 1U8FO 2Y2VA 3CSSA 4KXUA 4WCFA 4NL4H 5J5CA 4QXOA 3RK0A 3KKNA 4DXHA 1SFRA 3VZRA 5B58C 4DHEA 3UK7A 1U0SY 1XHEA 1FNNA 5FT9A 4R54A 3O0DA 4YB8A 1R8QA 3MINB 3P2YA 5K3DA 1YKSA 2QAGB 3B36A 3RFUA 3HCOA 3SF8B 3BK7A 1YT5A 3S2UA 3VV3A 4OHMA 3OHPA 3V8NA 4UEQA 1NQXA 5JHGB 1NIPA 1L5QA 2HR1A 5A1TA 1IWOA 2JJ1A 3I9NA 2QX9A 3O2NA 4M0KA 4CIXA 1SURA 3N70A 1I4EB 4L3OA 4MZXA 5J63A 1YCHA 3AHIA 3W90A 5IN4A 2N0SA 3CX4A 1OX6A 3VNQA 4D4IA 1JTEA 1EUYA 3LAWA 2WKRA 3PFHA 5AJUA 4CIVA 3P26A 2JJ1D 4CLDA 3FTFA 5ISMA 1GNRA 1IH8A 1BW9B 1GNPA 3WLRA 3NOQA 1UBOS 3QBJA 4I3GA 4BNVA 2BZ0A 4DPLA 5A9RA 1SNYA 4HQ0A 1NBMA 5DASA 4EW3A 1YOBA 2IZZA 1CP3A 1YA4A 3L3BA 3HK2A 3PS9A 5K8VA 1KBZA 3G7SA 5TPZD 5IMBA 1P3JA 1NN0A 2K7FA 1E2PA 3GJ8A 1NBMD 2YXEA 4NXMB 3E1KA 3I9JA 3DO6A 4LMPA 2MT9A 1YDWA 5CXQA 2KX7A 3ZZ0A 4YJ3A 1IMJA 3D43A 3GEDA 2GZAA 4II3A 5BQFA 4DILA 2XKKA 2NUAB 1NG9A 2WNSA 1AKRA 2FFBA 2L0XA 1PTJA 3JVDA 3LBHA 4ILEA 2B8WA 2O2ZA 3GYBA 3UWPA 5DIFA 3TCNA 3SKXA 3QVLA 4M9SA 5L3SA 4LF4B 1XAHA 4E5KA 4QXPA 1WTAA 3O8CA 4PO3X 1T5HX 4TLLB 3I9LA 3JQAB 4MA5A 4RHCA 3UGJA 1E7YA 2HXGA 2PQ0A 2A9VA 2IYYA 3DHWC 3WMWA 5C81A 4MUYA 1QIKA 2X40A 3AGPA 3PHIA 4X64B 1HR0B 2BL4A 4UMDA 2G0TA 2WKPA 2Y3IA 3U5TA 5B64A 2D1QA 2ESRA 2Z5FA 7REQA 4N0EA 5IUNC 3AY7A 1Y7IA 2RKBA 2D1RA 4G5YA 4Q37A 4L28A 4DA0A 1N5KA 4B8ZA 1JLSA 5M34A 2FUNB 5KQLA 1WUYA 3DE6X 3OF5A 4KO1S 4I1YA 1S7GA 4U3JB 1JQLB 3PI6A 3LPCA 2RGCA 2A9JA 3HCPA 4WMLA 2VT6A 1CR1A 2V6BA 2G1UA 3LF1A 4IHJB 1KQFA 3VKHA 4HFJA 3RKUA 2Q6VA 4ZGBA 1RMYA 4D92A 1Z28A 4OXIA 1B8PA 4YDRA 3TH5A 3DCYA 4JC8A 3UWSA 3D4NA 1Q1AA 5EUCA 2P69A 5BOVA 4UZSA 3JD3A 3LH5A 1SR8A 1NC1A 3TZEA 2LKDA 2ZM6B 2C2WA 1A5TA 2PL1A 2EBWA 2F64A 1DXOA 1G6KA 2D4HA 3B1XA 1VYVA 1FE8A 2DFNA 4GSKA 3NAMA 4W63A 1Y63A 4M0DA 4UATA 3U3ZA 5J2TB 1B43A 1SOAA 2H0QA 4CJXA 3R0ZA 5SZIA 3IAFA 1Z62A 3V46A 1P2GA 1RE1A 3OKAA 4P2BA 4BMCA 4BWFB 1HDOA 4M60A 1HURA 1L5NA 1IAVA 1K9SA 2PRJA 1WTCA 4BX3A 1E1LA 3QMMA 1VPLA 4H3SA 1CCWA 2I2CA 1GL3A 1F3OA 1UP6A 2HA7A 5A9SA 3GLHB 1TYAE 2CNBA 2FZKA 3GAFA 1DKNA 2CLLB 2VUUA 4UPVA 1Q20A 2DLDA 2HWXA 3NT5A 3ZJYA 1RBYA 4GU5A 3SZRA 1XKLA 3HMKA 1X6VA 2X4GA 4DAEA 1NULA 2GM4A 3N7TA 3GFRA 3IRVA 3WBBA 1NVWQ 1H5NA 1T26A 2JLSA 1D07A 1T3HA 3WGOA 3WXMA 3ER8A 3SX0A 2JD2A 2CJYA 4E09A 5FBRB 3HVJA 3WLOA 4IIXA 1V45E 1JH9A 2DT5A 4L6AA 1RLUA 2ZJYA 1NF9A 1T0PA 1EX7A 1YXMA 2DFTA 3IH5A 3PXUA 4MQBA 4QDXA 1M54A 1UBNA 2ONJA 4B6JA 3NVKI 4LECA 2JA1A 3BXHA 1QHFA 2GKOA 4RYLA 3H3FA 4ASUA 2OD2A 4Q1AA 1WM1A 4PS1A 2X77A 3R6DA 5ALGA 4ED9A 4YMUA 1CE8B 2QA5A 1QX3A 4IIFA 4LVNA 1ZH6A 4UHHA 4ASUD 2CXTA 1UMKA 4S1NA 4K9MA 3E9EA 3CB2A 4M1WA 5JXJA 5JO9A 3CGGA 2JKYA 4Q4AA 1SRQA 2YTZA 3K16A 1VIVA 2RG1A 2VJBA 2ZTSA 1AD2A 2E6UX 1XRPA 3B48A 2ZXEA 2IPNA 5GMOA 2ZUTA 3ONDA 1SXGA 3REQA 5JZBA 1UAAA 5DTIA 1AZSC 4JBNA 4JD5A 1WP4A 3D0OA 1PFKA 3W3AA 4X1OA 1K5DA 3BPSA 3CXUA 3HB7A 2B61A 1LQ2A 3D3NA 2QZSA 1M7BA 3GC6A 3O4FA 4WADA 5DCWA 3RS5A 1RRKA 3OQ6A 4IIHA 3F49S 1NZJA 3DCIA 3O6VA 1SBYA 4K8RB 5CVTA 1Z0UA 5EKDA 4WVLA 1QU2A 4COOA 1E62A 1R0SA 4G1FA 1QYXA 4O63O 2D1FA 4P3YA 4N47A 3JAWB 4JLSA 3FZGA 5THKA 1J0CA 1C1YA 2GRUA 2JCBA 1YGYA 1IM8A 2EJTA 3HLKA 2PMEA 1RACA 2MSDB 4YCCA 3V4OA 2PKYX 2GM5A 3AH8A 4KVGA 4U6SA 3WZMA 3SKYA 1NXTA 1FFXB 5FPPA 3HJCA 1PSZA 4UULA 1TA4A 4X6XA 2IWHA 3SHTA 2AX4A 2H48A 1MPTA 2SCUB 3HU2A 1KIMA 1UFRA 4XARA 1DWPA 2PQMA 4UBNA 2XB9A 5CUQA 1DCKA 1U2GC 3IBFA 1XZDA 3R3UA 1UANA 2C8KA 4H35A 2EGHA 4XPIA 1HE5A 2OV6A 4QM6A 1L4HA 3LDFA 5CXSA 4IIGA 1OXTA 2J31A 1GAQA 2UKDA 1NXSA 3EOBI 3QEJA 3WGUA 4QLAA 3D6MA 3ZBTA 1YB1A 5CDFA 4HAUA 2Y6VA 1PVVA 3MF4A 1UMCA 3ROTA 1O08A 1WEKA 4V0ME 1CK4A 2EZ4A 2J41A 3DT9A 4D4GA 1DJQA 1D2AA 4RMIA 4EFNA 1CR0A 1UC8A 3EWAA 3E61A 2NZWA 1YL6A 3GELA 3EUFA 4BDSA 1JZTA 1JP7A 1ZJZA 4D42A 3U16A 5E6RB 3CLVA 2NYVA 2VQSA 2CF5A 3C8MA 3HCNA 3KR0A 4QO7A 3DOHA 4DJTA 1GUBA 3X2SA 4QIHA 4E4RA 4IFTA 3I05A 3HJNA 3QY0A 5ERYA 5IJ0B 2YMPA 2Z9BA 2Y6UA 1BCSA 4H1HA 2C7BA 5I5EA 3U6BA 1CUYA 3VNVA 4KR7A 3RAPR 3MB5A 1ODJA 4DV7B 1X1CA 4S04A 3WLQA 3D8NA 1E6KA 2FSSA 5DRTA 2HIHA 3KQLA 1K0UA 4WK2B 3SS8A 1NP7A 1ML4A 4EPTA 5H3LA 4BEJA 2YOFA 1W5EA 4WCVA 1A4IA 3U4IA 1NMZA 5FI3A 3CPJB 4RKEA 5C8ZA 4IVPA 3MOIA 3D2AA 1ABBA 2FE4A 5LP1A 1WLYA 3NQ41 2FRXA 2HA0A 3L8HA 4WPGA 2CFIA 5EVCA 5BWLA 5JQWA 3C3CA 4PHTA 1CRPA 2H1RA 3HM2A 1YDMA 1D8AA 3G0IA 2BHSA 4KIUA 1JIUA 2YYZA 1W52X 3HGTA 4TQUS 4F7DA 1KZHA 1PF7E 4ZYZA 1P62B 1Z6PA 4N6OA 1GHTA 5JV5A 1DT3A 2YUTA 3GDGA 3K0FB 3LYHA 2CLOB 3P1JA 4XX0B 2QRVB 1CSEE 1XMVA 3KLNA 1S02A 3G2KA 1BJRE 5REQB 4F6RA 1LH0A 1HYHA 1NSFA 5T7BA 4KACA 1VKOA 2UZ0A 3A04A 1A8IA 2CUNA 3UAZA 3ZJVA 4GKAA 2AIRA 3R0JA 4RC9A 1NY5A 3DMPA 4AP5A 4Y7CA 1Y1LA 5LYJB 2IPAB 4O2AF 1TGYA 1ZGHA 4EHDA 2JLYA 5JAMA 5IK2D 2FF7A 1JAHA 3EQ8A 4UVEA 1GPYA 4N5LA 2B82A 1TK2A 4F4UA 3TGWA 4BIMA 5LUAA 4N0DA 2J3DA 2CXSA 1RLOA 2HF2A 3VDRA 1GTSA 2VLIA 4GXNA 3W79A 1NSTA 2QU8A 5E9AA 2IY8A 2GN4A 3AF5A 4MWGA 2OQ2A 5FBLB 5HQ3A 5K7SA 2O8BA 8AT1A 1U9IC 4B7ZA 3GLRA 5JLAA 3ASYA 4EPYA 2R44A 4S3MA 5CFNA 4TKZA 4CM3A 3AZPA 1MAAA 5LVAA 2F1KA 2MSEB 4CUKA 2BRUA 3B1ZA 3CR8A 2PGNA 1NLUA 2FLVA 2WZBA 3BWXA 3HKBB 1DRJA 3DTVB 1H2RS 3LPAA 2O2YA 1G8JA 4IDDA 2VF5X 3FWPA 5ALQA 5JT1A 1YHNA 3IEPA 1OI4A 4FEYA 2GBGA 1P9OA 3TSCA 1KS2A 1PL6A 2FP4B 3FGNA 5AVQA 5A02A 5LZ9A 4HNUA 3UHJA 1IQPA 1O6BA 3TL6A 1YZNA 3F5SA 2OT3B 4HLUA 5JJBA 3ROEA 4MCIA 4OY3A 1FU4A 1DZIA 2A0YA 3DNMA 3OZGA 1JR3A 3AZOA 4PC7A 4W5HA 4ZQGA 2PUAA 3RSZA 3CLKA 1P4AA 1QOZA 3A58B 3CUKA 6ABPA 5KBYA 3AFGA 1B73A 3MAGA 2WM2A 4ZV4A 2CL0X 1DC5A 3H9GA 3RFVA 3K4HA 1QQTA 4BBJA 1M3SA 1P4HA 3W9UA 1O5OA 2XI4A 2H17A 4UVGA 3UHAA 1QGYA 5ALYA 1U2DC 3AEYA 4ML3A 3BT7A 3GFTA 4M21A 5SYMA 1C41A 1P61B 5A3JA 5DGIA 1Y7TA 3C14C 4ER5A 5JQGF 2RB5A 2QTHA 4F3RA 5E6UA 1UMBA 1QH9A 2F3TA 2ZRCA 1FNBA 4QSHA 2V1UA 1N8TA 1UKYA 1FY2A 2WA2A 4XPZA 3RS0A 3N0TA 2E1PA 4IRXA 1QCCA 1CR2A 1MX3A 1Z2DA 4FDUA 4KQGA 1NQ5A 4RPCA 5AM3A 3QENA 1X1SA 5DLPA 2YV2A 4CMEA 2JLRA 1CRWG 1FFEA 2B69A 2IHNA 3LXRA 4UU8A 5HYVA 3EZGA 4FYVA 4FJ2A 4G5FA 1MO5A 1U3GA 4MWTA 1U7WA 3A37A 5JMTA 2Y76A 3TO5A 2DU8A 5KYWA 2G71A 3JQFA 221PA 4JL5A 2DFLA 5KWIA 1N2EA 3QJ5A 3HM9A 1RHJA 3GVIA 4KXLA 3IOMA 4DC1A 4ENUA 1O8CA 1V6CA 4RE6A 5B1DA 4C5BA 3A31A 2J07A 4J94A 1Z4IA 2DKFA 1P5RA 3KOOA 5K0NA 3X1JA 2H07A 3BDIA 3IKVA 3EAGA 3OZAA 2IPLA 1PR1A 4BQRA 2G4LA 4PZ9A