4C01A

Complete crystal structure of carboxylesterase cest-2923 (lp_2923) from lactobacillus plantarum wcfs1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
275
structure length
275
Chain Sequence
b'MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEST-2923
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 84
structure length 275
sequence length 275
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c01A00
4UBLA 4KE7A 2XMQA 3ESBA 1CV2A 4M0EA 3WK7A 4IH1A 2AJBA 3E4DA 1ZD2P 4RE5A 5ALDA 3TJMA 2DFPA 3R3ZA 2P8SA 4BE9A 1J2EA 5DNWA 1Q0RA 2WFMA 3WK8A 3I6MA 4Y2JA 1EI9A 2AJCA 4B82A 1IMJA 4YK7A 4HRXA 2XI4A 2OG1A 3F9CA 4LXGA 1W1IA 2WG2A 4G8BA 2VF2A 3FLBA 1QIJA 1QTIA 3TRDA 1IZ7A 4QDTA 5AKEA 3ESCA 2BUCA 4AO6A 2GZRA 1K63A 3DNMA 3I28A 1XLVA 2XUFA 2XMZA 4K6GA 2QMQA 2ZYRA 3KOOA 3QPDA 1JI3A 1YCDA 4U2CA 2W22A 2JBWA 3R3XA 5CT4A 3QZUA 4IHAA 1EXWA 1QOZA 2AXEA 1GPNA 2VTVA 4BCCA 4G8DA 2GYVA 4U2FA 1DX6A 3IA2A 1X2BA 2HA6A 4G9EA 4GBGA 4PV7A 4GECA 3C70A 4H7HA 1A8QA 4K6KA 4XIIA 4B9AA 4GWLA 4C88A 2OCIA 4OU5A 2OGTA 4QLAA 3D3NA 3MUNA 2HDWA 1TAHA 1LPPA 4MXDA 2WFLA 3O9MA 6YASA 5ALFA 3M3DA 1ETHA 5LP1A 4X71A 1BCRA 3GELA 5LIPA 1N1MA 5D3ZA 5CTAA 1MX1A 1WOMA 4Q3KA 2GYUA 5E4YA 3FYUC 5AO9A 2GBGA 3F96A 5AK3A 3OTQA 5EIEA 3RLIA 2UZ0A 4MWSA 5HF8A 5LZ2A 3BDIA 5AKIA 1UKBA 3VISA 3YASA 3O4JA 2GBIA 2XMGA 1P0IA 1RP1A 3ED1A 2H1IA 3U0VA 5AK4A 3AFIA 4FWBA 5KWIA 5JASA 2DCMA 2PVSA 4ARAA 4Q34A 3WYNA 4A23A 5FXMA 4B84A 2G4LA 4PW0A 2XQIA 1XRPA 3SWWA 4C6HA 3WKEA 5KBYA 2XQJA 5EI5A 1XRNA 2JGMA 1SCKA 3W06A 4FOLA 4AXBA 3U1TA 1CIJA 4BCDA 1E8NA 4X91A 2IIVA 1H2YA 5CW2A 3M83A 1J07A 2HFJA 3VVLA 3ANTA 4I4CA 5I7UA 4OYLA 2WHPA 3R40A 5FLKA 2PSJA 2WQZA 4EZIA 4B83A 3EQ8A 2YYSA 3DS8A 1LLFA 1CQZA 1JT2A 4J0IA 3R3VA 2ZJ7A 4GI1A 4AMYA 5ALSA 5AP9A 3C6YA 3B5EA 3STVA 4AO8A 1UT6A 4Y2PA 4HAIA 4NVRA 1E8MA 4BB0A 2HU7A 4HRYA 3T4UA 2VAVA 5AM2A 2GBCA 3O4IA 1EX9A 3KXPA 3V1NA 2XMSA 4ZV7A 3DL7A 5BOVA 3PUHA 2E3JA 3AIOA 4KAAA 4EY8A 1C7JA 5T4BA 5AKLA 2VT6A 5IVHA 5K3DA 1YS2X 4DMFA 5CXXA 1EK2A 3ZV7A 4GDMA 1ACLA 4DNOA 5AM5A 1L7QA 2PPLA 2WIKA 3WA6A 3OG9A 5JANA 4N5IX 5JAOA 3D4LA 1EINA 1YA8A 3MGAA 4QLOA 2ACEA 3WQHA 1G42A 1DWPA 4BTVA 3G8YA 2JGEA 3IIIA 1T2NA 2R8BA 3V1MA 3BWXA 4E11A 3STTA 2GBFA 1U4NA 3IUNA 2EDAA 1QIIA 1FJ2A 1ZD5A 1XZKA 5DWDA 3PFBA 1BS9A 3FYUA 3EQ9A 5K3AA 3IUJA 2Y6VA 4LXHA 3ANSA 4CG2A 4UHCA 5ALRA 3QMVA 2WHQA 1QIHA 1YA4A 4G9GA 2V96A 4X6YA 4DYHA 1IUOA 5E4TA 4H7KA 4P93A 4W1PA 4EUSA 3QVMA 1XZHA 4OB7A 1ZOIA 2JIDA 1VXOA 4FHZA 3P2MA 1E66A 2PUJA 4BATA 1BEEA 3W04A 2ROQA 5DNUA 2B20A 2DQZA 5ALHA 5HKAA 1EH5A 3H2IA 2DHEA 4X93A 1CUSA 3R0VA 3G0DA 3JYHA 1Q0ZA 1U8EA 2RHTA 4ITVA 4DIUA 1QLWA 3ESDA 1ODTC 4S0XA 3WWDA 5AI6A 3TGLA 1ZJ5A 4WCVA 4DMCA 4YPVA 4UPDA 4KRXA 2BUBA 2HHAA 5EHQA 1LPAB 4G8CA 4G1FA 3G02A 1XRRA 1OXMA 2ES4A 1IVYA 2XUIA 3PF8A 1VE6A 2FUKA 2R11A 3WLAA 4BCBA 1HL7A 4NMWA 1O6GA 5HF9A 4F60A 3ILSA 5LKAA 4A5SA 4YX9A 4QEKA 4HS9A 2PL5A 1P0QA 2RIPA 3HI4A 4PO3X 4BRSA 4ZRDA 1AX9A 2VJAA 4C4YA 1VOTA 3HRHA 1L7AA 2HRQA 3SC2A 4ZXFA 1A8UA 2ZYIA 3R3YA 3G0CA 1YR2A 3IUQA 3K9BA 4X7BA 1Q83A 5FRDA 3ZPXA 2XMDA 3QH4A 4Y2XA 3VJMA 4EY7A 3IDAA 2QXUA 3QPAA 1K5PA 1WM1A 4OB8A 4ZREA 4AO7A 1EDBA 4I19A 3G9TA 3NGMA 2QS9A 1U2EA 1ZJ4A 1QFSA 1JU4A 5A7FA 1DT3A 4G4GA 3D0KA 2XE4A 4F5ZA 4HXEB 3ICVA 1UOPA 3EF3A 5ESRA 3BIWA 1J1IA 3BIXA 2BGNA 1CUHA 2Z8XA 3EBLA 2RGUA 3H17A 4UBMA 3RM3A 1EHYA 3KWFA 3H18A 4Y2UA 1O6FA 3CN9A 3UMJA 4WJLA 3DEAA 4M0FA 1CQWA 1FFCA 4UBIA 4ROTA 2ZYSA 4KE9A 1YAHA 4V2IA 4KJXA 5IKXA 4UHDA 1EDDA 3WK4A 3AIKA 4C4ZA 1XZDA 2HU5A 3M81A 4JEIA 2XQKA 3BE8A 5AKYA 3CN7A 5AOCA 3HZOA 1QTRA 4HVTA 5EIAA 5AKKA 2HA3A 1LZKA 4BP9A 5DYTA 3QBJA 1EA5A 4CCYB 4HXGA 5DTJA 4FBLA 5AIBA 4JYMA 5LZ8A 2I3ZA 1VLQA 4Z49A 4H7EA 1XZFA 2Z8ZA 3F97A 2Y2VA 4MWTA 4BZZA 4F0JA 3LIPA 4X97A 3M82A 4QA9A 1UWCA 2WSLA 3C8DA 5EGNA 1XZJA 4CI9A 1NU6A 5K3FA 2XT0A 3LLCA 4AB1A 4M0MA 1HQDA 5AM3A 3K6KA 3G0BA 3D7RA 4J0GA 1HKHA 2OQVA 3VVMA 4IH9A 4Y2VA 2QUBA 2X76A 2XDWA 3ZWQA 3O4GA 3STXA 1TKRA 3HXKA 2ORYA 4BDTA 5AOBA 4Y9SA 5ALKA 3V1KA 2CB9A 2QM0A 4PSDA 4P92A 4B6GA 3FWHA 2VSQA 3Q0TA 2XMBA 5AKZA 2IITA 1HDEA 2NW6A 4BZWA 2VEOA 3K2IA 2ONCA 1MPXA 5AKXA 1WB6A 5DJ5A 2WG0A 3H04A 2WU3A 3KSRA 4FFVA 1QONA 4OYYA 5DNVA 3H2HA 5AI0A 1XQYA 3R3UA 1R9MA 3FVRA 2YXPX 4N8EA 4UBNA 2J3QA 4AZ0A 3L1IA 3LIIA 4AN1A 4DMKA 2XLBA 1W75A 4QDOA 1XFDA 3V48A 2BGRA 4G5XA 1S8OA 5JIBA 3S8YA 2DSNA 3UUEA 2RI6A 1R9NA 5BV7A 3OOSA 5AKJA 5CT8A 5JZSA 3X3HA 1JKMA 2VQ6A 2WG1A 1L7RA 3H1AA 2QOEA 3DD5A 4J0CA 4FTWA 1LZLA 1EVQA 2JF0A 3F8SA 2HL6A 3VXKA 3DDUA 4DNPA 1MX9A 4QE3A 2PSEA 1MAHA 4KAFA 2XUDA 4FLMA 4DSZA 1PJAA 3PF9A 4CG1A 3G0IA 2H7XA 3BL8A 3PFCA 3AUKA 2HFKA 3W9UA 4N5HX 2J4CA 4FMPA 5BWCA 2RHWA 4EHBA 4U2DA 4Q3OA 4ETWA 3FCYA 4C4XA 5ALGA 4MQLA 3FYTA 5ALTA 4E46A 4O08A 3A70A 3B3QA 2CKMA 4X95A 1DQZA 4EY5A 1PFQA 1A7UA 5HF6A 1TQHA 4B7ZA 3WKCA 2GYWA 4UHEA 2O2HA 3WZMA 5CT5A 2WIJA 1AKNA 3O4HA 2BUAA 3QPCA 5HK8A 1E89A 3CXUA 2C5FA 4OUKX 1DWQA 4Q82A 4K2AA 5CXUA 1W4LA 3A2MA 5DYWA 1XZIA 4XJVA 1ODSA 1BRTA 1TCBA 5CH3A 1WB4A 3WKDA 3A2LA 3MVEA 2I03A 3BJMA 5CRIA 4B9EA 5EHXA 1Y7IA 1JU3A 1AQLA 5FP0A 3WWPA 5CH8A 1KU0A 4HTAA 3WK5A 3AINA 4J7AA 1LPBB 1SCQA 4UBJA 5AM4A 3E1GA 4GLBA 5SYNA 4Q05A 5AICA 4JYPA 1XZCA 1GQSA 4BTLA 4H7IA 1USWA 2WUEA 5YASA 3I2GA 1VZ2A 3NUZA 4X90A 2ZSHA 4WFJA 1MO2A 2XLCA 4BVJA 5K5EA 3I2IA 1UXOA 4TPKA 5JATA 5AIAA 2HIHA 2WTMA 5JARA 4ZWNA 3I2FA 5HK9A 2PU7A 1CUXA 3WL5A 4BAGA 1R1DA 3H2GA 5AK6A 1QIDA 5H3HA 2XQFA 5JAHA 3C5VA 2WUDA 1YAJA 3G7NA 4RPCA 3VDXA 1SC9A 4W1RA 4X00A 2HA5A 2WIGA 1CUWA 3W2TA 2C4HA 3V1LA 1Y37A 5ALPA 2V97A 4LKOA 4QDZA 1EVEA 5DLPA 4JUIA 3DLTA 3QYJA 2PBLA 3NOXA 5AI8A 1CVLA 3IUMA 4PNZA 3WWEA 1DQYA 1W52X 4HZGA 4KACA 5LZ5A 4F21A 2OCGA 3I2KA 2CUTA 1SFRA 5EHZA 1QGED 4X94A 4H7JA 1SCIA 2XQGA 1R88A 2VJDA 2I3DA 1ZIYA 4J3JA 3IURA 2CZQA 2XMRA 2JGIA 1H2XA 1RWQA 2QJRA 3D5EA 1XKTA 3HC7A 2YH2A 3UUFA 1P0MA 2ZJ6A 2Z5GA 2EDCA 1K8QA 5CT9A 4X92A 4B0PA 3WIBA 4BAZA 4XX1A 1MAAA 1ORVA 3H2KA 4H35A 2V98A 1F6WA 3T52A 2CEKA 1N5MA 4MJ3A 4UBOA 3SK0A 3H2JA 5DTIA 1XQWA 3A6ZA 1SOMA 1CUIA 1VJ5A 3VJLA 1HPLA 1M33A 1LPOA 4RGYA 3O95A 2VT7A 5LKRA 5AHXA 2XUKA 3ESAA 1DX4A 5AKGA 4JH0A 1CR6A 1CUDA 4BDSA 3PE6A 4KR0A 3KDAA 3ZLTA 1WPXA 5JZ9A 2XUPA 1JJBA 1F0NA 3WWOA 4DLNA 4U2BA 2O2GA 1AMNA 5A62A 5KWJA 4FFWA 5FDFA 3D59A 4J0JA 1F0PA 4U2GA 1LPMA 2OGSA 1DINA 1TCAA 1QIKA 3FCXA 2CBGA 5SYMA 2DHCA 3GBSA 1EB9A 2B9VA 4DGQA 3I1IA 1W6RA 4BC0A 2ZJFA 5A7GA 1HBJA 2OGZA 1GGVA 3LP5A 4A16A 2AJLI 2IX9A 5C8XA 1QIFA 3C43A 2CMFA 3ZLVA 1CRLA 5AM0A 4OU4A 2XUJA 4Y2SA 3WJ1A 2QVBA 1CUUA 1VE7A 3EQ7A 4AN0A 4XVCA 3BDVA 3FLAA 4Y2TA 5FOQA 1MU0A 1G5FA 5FV4A 2OLEA 4AX4A 2PSHA 2ECFA 3FNBA 4J0HA 2QKYA 2AJ8A 4L0CA 5T4EA 2G5TA 4LXIA 3IULA 1UK8A 2OXEA 2K2QB 4C87A 5HF5A 4DM7A 1H22A 2J4FA 4PSUA 1YB7A 3AIMA 4X3CA 4E14A 3G9ZA 4W1QA 2HADA 1E5TA 4X85A 4B85A 1JMKC 3Q8WA 1CPYA 3O9VA 4L72A 3C8HA 4BP8A 1LGYA 1N8SA 5LZ7A 2OCKA 3FSGA 5DYYA 2WLSA 3V9AA 2B61A 4AQDA 2QXTA 4CIBA 3I6YA 2C0PA 5T4FA 3STWA 3WA7A 4ZGBA 3G0GA 4UHFA 5AI4A 3WK9A 1XZGA 4BAUA 1BE0A 3C6BA 4DSAA 1XQXA 1J06A 5AM1A 4FLFA 2B4KA 1GKLA 3HJUA 2WUGA 1LBTA 2H9YA 4FDMA 1B41A 1KEZA 5FKJA 7YASA 3A2NA 1XRMA 4EBBA 4WDRA 2BFNA 1E8DA 5ISMA 4IQ4A 2WUFA 5CH5A 3G9UA 3IB3A 2QR5A 2BAGA 3F98A 1XLWA 2BCEA 1QIEA 1JJIA 5ALWA 3FBWA 4G4IA 4HXFB 2D5LA 3N2ZB 3BXPA 4ZV9A 5K3EA 4B81A 1Q84A 3WMRA 2X8BA 4Q3LA 3O0DA 1OCEA 1ZICA 1JMYA 3KWJA 3GFFA 5CBKA 1R3DA 3CCBA 4RNCA 2ZSIA 1YS1X 4KE6A 1C4XA 4DNFA 4FKBA 2XUGA 5EHNA 1BEZA 3DOIA 4UHBA 4EY4A 5LYYA 4J03A 1AC5A 4Y2YA 1G66A 4L3WA 1EB8A 2O7VA 1WPRA 3C87A 1GT6A 1CUZA 3E0XA 3DKRA 4EB0A 2HA7A 4KEAA 4DNQA 1R4ZA 2Y6UA 4X6UA 4QDUA 5J3JA 1IUPA 4J0DA 4W9RA 1BCSA 1CFJA 4QWMA 1UK7A 1WCYA 3AZPA 3OC0A 3CCCA 3DYIA 3AZOA 3NWOA 1MT3A 4FBMA 4KAJA 3N0TA 3WWCA 3FYUB 2O2IA 4UFPA 2JGJA 1UOOA 3SX4A 4WFKA 2XUQA 1FFEA 4TGLA 3VJKA 1FFBA 3DJYA 1CUGA 3L1JA 4Y7DA 1NX9A 1YB6A 4OSEA 5HQ3B 3C5WP 4K5QA 3WL8A 1F8UA 5FPQA 2VJCA 5FPPA 1YSCA 3WKAA 4EA6A 3JW8A 3BF7A 2Z3WA 3WL6A 4UHHA 1AURA 1THGA 4U2EA 4D9JA 1GZ7A 4BE4A 1CUBA 4LYEA 4ARBA 2CJPA 2LIPA 1XZEA 5JD6A 3HLKA 1Z68A 2PM8A 5AH0A 1XZLA 3LS2A 1XZAA 2OQIA 1JJFA 1CUVA 2ZYHA 5A7HA 2XB6A 4YASA 3GZJA 1MJ5A 5ALEA 1GXSA 4PF1A 2OAGA 4H77A 2VJBA 3E3AA 2WFZA 1ZGCA 2C58A 5A71A 4UFOA 1ORWA 1XKLA 1ZD4A 4BBZA 3ZLUA 1VA5A 2G5PA 2JEZA 4G4JA 1WHSA 2QUAA 1WHTA 3C6ZA 3PI6A 3WK6A 5IVDA 1VKHA 1CUJA 1W76A 1GPLA 2XUOA 1MNAA 4L9AA 2Q0XA 5ALNA 5ALIA 1MN6A 5JYCA 4GXNA 1UK6A 1XROA 3C45A 4TVKA 4IO0A 3OPMA 2ZVDA 2XMCA 5ALJA 2HM7A 1ISPA 2JGLA 4P9NA 5HKBA 1FSSA 2XUHA 4UUQA 5JZBA 3IBTA 2WIFA 3PUIA 1H2WA 5CMLA 1FFAA 4K6HA 4GEGA 2XUAA 1LPSA 4C89A 2H7CA 1R50A 2H7YA 3OURA 4GHWA 1B6GA 4OCZA 1XRQA 5A2GA 5K3BA 1TCCA 4H0CA 4I3FA 4CCYA 1AGYA 1KU6A 2DR0A 3AILA 1HLGA 2C0QA 2OAEA 2QZPA 1QE3A 2WIDA 3LCRA 5C7YA 2PX6A 3PICA 3AJAA 4QNNA 1QIMA 2ACKA 4MEAA 1T4MA 1ACJA 3WIOA 3R3WA 4QWWA 5ALYA 4LYDA 2VAXA 2VATA 2GZSA 1XLUA 3HABA 2C5GA 5ALLA 2QT9A 1BN6A 4PSCA 1X2EA 4BYMA 5JAPA 5T4HA 5AI9A 4BVKA 3WZLA 3HYSA 2V9ZA 3BF8A 1YASA 3GROA 4AZ3A 2FJPA 3FAKA 2J3DA 1P0PA 1GPKA 1QFMA 2Z3ZA 4KE8A 3R41A 4B0OA 2HA4A 2Y2UA 2DQYA 3WI7A 2QJWA 1UOQA 3H0CA 5E2IA 3WYDA 2WILA 1RYYA 4H7DA 3RARA 1C7IA 2DHDA 3WKBA 3I6ZA 5HCUA 1UKAA 1ZI8A 4CIAA 4N8SA 1CUYA 5AKHA 2HA0A 2D0DA 4ZI5A 5D7BA 5K3FB 2PKYX 3STUA 5JD4A 5A6VA 1ZI9A 1UFOA 2I78A 2WU4A 4FLEA 5JALA 3STYA 5HQ3A 1JFRA 3QMWA 2PU5A 4FNGA 1VZ3A 4J0KA 1ZD3A 3IVMA 5ALUA 4LHEA 5ALZA 3EIOA 5JD5A 1EK1A 5AOAA 2QTBA 5AJHA 5C8VA 1U65A 3FLEA 3H19A 1QJ4A 1DU4A 2PSDA 5EFZA 1GKKA 4IH4A 5C81A 4WY5A 1BU8A 2Y1KA 2PSFA 4NS4A 4DMHA 1XQVA 2JEYA 3FSGD 5KREA 1DT5A 1CUCA 4MYSA 4N8DA 4OD0A 4MQMA 3GA7A 5K3CA 1LBSA 3FVTA 3F67A 1CUFA 3DL4A 1G4HA 1PV1A 3PDCA 2BJHA 2QRUA 1A88A 4H7FA 5JAUA 1XZBA 5D3KA 3RKSA 2FJ0A 1CUAA 4MEBA 4WFIA 1BROA 4KYVA 2WJ3A 4MYDA 5ALOA 5IVKA 5I8PA 1XZMA 1Y7HA 2RAUA 2WJ4A 3DCNA 3RK4A 4W63A 5LZ9A 1CUEA 4C01A 4LIPD 5BWBA 3H1BA 5HZGA 2EEPA 1LPNA 3D2BA 3MUOA 1CEXA 2WKWA 3D2AA 1BN7A 3QITA 3VKFA 3BJRA 4QDXA 1UZAA 2WFLB 4Y2QA 1GQRA 5HFNA 3TEJA 2PUHA 1TIBA 5CURA 2HRRA 1ODCA 3I1YA 4BC1A 5F4ZA 1I6WA 5C8ZA 4WDQA 2HA2A 3KD2A 2JGKA 5FUMA 3ZI7A 4AMZA 2X5XA 5ALQA 4UFNA 1FFDA 5I9IA 1ZI6A 2WHRA 1QZ3A 1ZGBA 3HEAA 5HFAA 2VA9A 2W6CX 3I2JA 3I2HA 1QIGA 1VA4A 5JADA 5E4JA 1E3QA 5LLSA 1IUNA 1H2ZA 1MNQA 3QM1A 1TK3A 4CCWA 2WM2A 2RONA 1NU8A 3B12A 1DTEA 1EDEA 1QO7A 4CG3A 2C7BA 3DKKA 3D2CA 1WB5A 4W1SA 2FX5A 1K4YA 2YASA 5ALVA 2OPHA 1UKCA 1A8SA 4QZVA 4DTCA 3GUUA 3OM8A 5ALMA 1H23A 1AUOA 2HU8A 4BVLA 2OCLA 4JNCA 1XRLA 1DWOA 3FOBA 1MX5A 1ZIXA 4UBKA 3G9XA 3L1HA 4B80A 1TRHA 2WHPB 4OPMA 3WL7A 1AZWA 1MTZA 3WJ2A 2JGFA 3HSSA 1LNSA 4Q1VA 2WTNA 1UK9A 2WJ6A 3DOHA 1VXRA 5ALXA 5LZ4A 3DQZA 4CFSA 5CT6A 1N5RA 5AK5A 4NZZA 4X6XA 4BRZA 3AZQA 4WY8A 5AI5A 1QO9A 1K6EA 2AJDA 3C6XA 3S2ZA 2O7RA 4EY6A 1D07A 4KRYA 3ICWA 4PQEA 2BKLA 4P08A 5IH7A 4E15A 4INZA 4H18A 1THTA 5IVIA 3QMMA 2G63A 1X70A 3DYVA 4OB6A 5EIHA 1OILA 5D6OA 1CLEA 3HACA 3JWEA 1IZ8A 3W05A 4RE6A 4Y2RA 4GW3A 4FNMA 3W9BA 4XWGA
chains in the Genus database with same CATH superfamily
4NJOA 2R7KA 1WCV1 4RPHA 1SY7A 3F3SA 3LGSA 4KE7A 2XMQA 3OX4A 2ET6A 2QT1A 4M0EA 4YQZA 2C5LA 2D3WA 2LW7A 4IVNA 4KBYA 3WBJA 1H8ED 3OCJA 5A3SA 2AZTA 1ZD2P 3CX7A 3G9QA 4R1OA 2BHTA 2H8GA 5JT1A 3TBKA 1UMCA 3HJAA 4AWXA 4D99A 3VKWA 4GUAA 4FEAA 3DZDA 4FFNA 5LQUA 3E2IA 2ZM5A 1Q0RA 4GE3A 2D7JA 1RLUA 5IAEA 2QRVA 2OSBA 2HCTA 4HRXA 4EUEA 3TXYA 2WKQA 1ZCJA 4QUAA 2OG1A 4LXGA 2DEUA 3ORRA 1JHOA 4CXMA 2ECPA 1X7YA 1E7WA 1MABA 4MICA 2HO4A 1YNSA 1A8IA 4LBYA 3L7BA 4BV8A 2ZANA 2BDEA 1Q3HA 3PFHA 4J1QA 1JZQA 3CNBA 2NPFA 4EA8A 1JHYA 3TG2A 3ZCTA 5CJJA 5GM2A 1P9LA 4HLUC 3TQIA 4DM4A 2BLNA 5I4KA 2G9VA 5DB4A 3VOSA 3RJ9A 3GL9A 4L16A 4TLLB 1VE5A 1ADYA 3USZA 2OC9A 3TOXA 4GM4A 1K63A 3MINA 3X2EA 3B51X 1WW3A 3GVPA 1XLVA 3PP8A 1DGQA 2J6HA 4DKJA 1Y9AA 4J3FA 1AZTA 1SHLA 1KSHA 2WYIA 4II7A 1PTJA 1ZWLA 2C3PA 2J5KA 3KPWA 1WXHA 3LM8A 5IKPA 3DKVA 4ZZ2A 1ADCA 1JI3A 3NPMA 5B3AA 2BBTA 2PH5A 2W22A 2GPYA 4U2CA 3ZS9A 2CMDA 2EAUA 4P4TA 4B3CA 4ZOQI 4LDQA 5DOZA 3LBNA 3U9SA 4AJ2A 2W2KB 3Q7TA 1I51A 5K0TA 2AXEA 1I33A 1GPNA 1L3IA 5IBRA 2IXBA 1OGJA 5A4IS 1JSRA 2FFRA 5LIRA 1WUYA 2GYVA 2O2EA 1D04A 3EVDA 2OZKA 4PIPA 4DLZA 4NFHA 1M2KA 4G25A 1HFJA 2H4FA 3BB3A 2PR2A 1KMNA 1MCZA 2VSYA 3I9KA 3IA2A 4M8KA 4BNZA 4GBGA 1DRJA 1RKQA 4WCDA 4XGIA 4KLCA 3PHCA 3AI3A 2H2AA 1A8QA 1TYBE 4ID9A 4XIIA 5IDXA 5IBCA 4DV1B 2BZGA 1E61A 3NNDA 4GWLA 1PD1A 1XU9A 3KJZA 1GHTA 2VUIB 3VPSA 3MWKA 3U60B 1IBKB 4YIHA 5HHTA 1OT3A 3RG2A 4C88A 1XDZA 4RMNA 3H4MA 1SNYA 3UG7A 3NDIA 4EJSA 2CCJA 1TA0A 1Z6PA 3ISVA 3U9LA 3CURA 1E20A 2PJDA 3PQ6A 4LE2A 4OU5A 5TSDA 2B4QA 3GUCA 2R00C 3ME5A 1AHNA 1F8YA 1WW2A 4QLAA 2JIPA 3WXBA 5FD8A 1CZKA 1O8CA 1P44A 1IOLA 1OXSC 2HDWA 1TAHA 1U3DA 2I4MA 2WFLA 1ZK1A 2ZS9A 3OKFA 4TMXA 2A2ZA 3TVYA 3VI4B 3LHFA 4A6PA 1Z38A 4WCFB 4DYDA 3M3DA 4HDMA 4KV9A 3RU2A 3O73A 4QBFA 1QVVA 4X71A 1KRHA 5LIPA 1UXJA 1N1MA 1SKYB 1UXHA 3KSDO 2B3TA 3CX6A 3P9CA 5CTAA 3QX9A 1MX1A 4Q3KA 1OXVA 5EFOA 3RJMA 4NWIA 4KNYA 1H4TA 2Z43A 3CLTD 4EB3A 1HMYA 1BG6A 3IBYA 5KPDA 2JLVA 3MNFA 2AKEA 1OVMA 3DZIA 4HN4B 1CE8A 3F6PA 3FTFA 2PUTA 1AO3A 1W0CA 3C97A 2ZI6A 4ZVSA 4ERXA 1BE1A 4KQWA 4BEBA 2XA9A 2VUSA 3HO6A 1AK9A 5CPBA 5AK3A 5EIEA 3ZDBA 1CYDA 4F56A 1I2AA 3UKDA 1EWYA 3UM9A 3JD1A 4QM6A 1HEUA 2QN6A 3AJ8A 1NGSA 5H1YA 3F1LA 4CKCA 3AFHA 3BD7A 2GI4A 4P84A 5EPOA 3H86A 3X1YA 1FYEA 2ZYUX 2B1JA 3ND8A 2VDJA 2CK3D 4Q24A 5CUQA 1CQJA 3VISA 3YASA 1L1FA 4WD3A 4I55B 3UHPA 3ED1A 3SJAA 3TZ6A 4D4KA 1ISRA 1O94D 1SJ9A 1U7TA 2BGMA 2FX2A 3U2QA 3U0VA 1G8FA 4DVGA 4CF7A 1Y6RA 1P6QA 3EUFA 3CVJA 3OO1A 5KNDD 2JDIA 1TPZA 2HLHA 4HL6A 1RHQA 2PVSA 4UNQA 2GK7A 4JHLA 1B1AA 2ZUBA 2Y1XA 4Q16A 5FF9A 4JOCA 3ILYA 4F2DA 2CFOA 2HCRA 4ZGGA 1NJ6A 2XX3A 3E2PA 2JGNA 3W4KA 2IVZA 5AT1A 4ARAA 1RQ2A 2QTVA 4Q34A 4YJGA 2V6MA 4ZQBA 2Z6QA 3JRWA 5FXMA 3V8BA 3GA5A 3TLYA 1AK2A 2ZRHA 3EGXA 3V34A 2RHJA 3EGCA 2G4LA 4N6GA 2E4UA 2PGJA 3V8QA 2DAPA 3HXOA 1J22A 3AOEC 1FBTA 1UAGA 4U6QA 2XQJA 4DLAA 3AHIA 1YT5A 1W0KD 3KLOA 3NEYA 3NHFA 4OLHA 4KMSA 1PD0A 1Y48E 2VK1A 3AL2A 2AHRA 3C0KA 4BUCA 2YWXA 4ZVVA 5H83A 5AVWA 2DBYA 4DAEA 2XOEA 4HD8A 4JQYA 3NIDB 1MIHA 3IDZA 1RPJA 2QE7A 5I4IA 3DCYA 4X91A 3NGLA 3UB3A 1GGFA 1NE2A 1MAUA 4IVQA 3PVSA 4E0BA 4UU8A 3HCDA 3GCXA 5L3RA 2AQIA 5BUZA 3QPVA 4YRFA 1F8GA 4MIYA 3RC3A 1I30A 1URPA 2Y76A 4TTIA 4JXKA 5B1IA 2V6IA 5B55A 3F90A 4DQUA 1WXEA 1PWYE 1U9ZA 3VH1A 4WL0A 5HBRA 1NULA 1YK1A 4GNRA 3RYFB 3EIUA 3K0FA 2WJZB 1WXDA 2VDUE 2GASA 2LCQA 4BN0A 4RD0A 1H1LB 2IDZA 4DSTA 1ZMBA 2WHPA 3ZGYA 2PQMA 1UM9A 2IEYA 3I6BA 4Q5IA 3U1BA 4HEA6 1JLKA 1PWHA 4MPDA 4ARZA 3WAJA 2J5QA 1J0XO 3O3CA 3OWXA 5SZJA 1O9HA 3CU5A 2PSJA 1GU0A 3GFPA 4Y2HA 3ZE2B 4YMIA 4MHSA 4YJ2A 1WCIA 1IOWA 3DVAA 4PLPA 3EQ8A 3UJ9A 3ZGOA 1GG9A 1CEQA 3I61A 3P71T 4Q15A 4BFCA 1JAHA 1VL6A 3KZNA 4AYXA 5BNTA 4H6PA 1HT3A 2IDKA 4IUDS 3WFZA 1YWGO 5JY1A 4M49A 3IL2A 3RIMA 1ELOA 3RFTA 5ALSA 4Q7EA 1GA6A 5AP9A 1QYDA 5JJCA 4CEIB 4I6EA 2MDTA 2AA3A 4Z99A 4DY6A 3NWEA 3STVA 2XJ4A 5DYIA 1NMQA 4Z1MA 4AO8A 3BFXA 1NMSA 3FWYA 4BNDB 5I9TA 3PRKE 1NVEA 2A1UA 2XYHA 3MFYA 5F51A 3W3AD 1PJQA 3H6KA 3LHDA 1UJ6A 4HAIA 4BWGA 5G0SA 3DG9A 4HP8A 4PGGA 1E8MA 2AXNA 3EIWA 1H5QA 1ZN9A 3A27A 3IEPA 4HRYA 2VAVA 4XM1A 2GBCA 3WNBA 3K0EA 4CF3A 1EX9A 3C14C 3KXPA 4YXFA 2XMSA 5EUMA 1U2RA 3TVDA 3DL7A 4J0EA 1QCZA 3WGOA 4A82A 1ZD1A 2W4MA 5BT9A 2PSSA 3GIDA 2OHGA 1C7JA 4F9EA 2C3UA 3A4YA 1A8HA 2IEIA 4FI3F 4WNAA 3UIEA 4ZHSA 3Q2OA 1C7RA 1QGAA 3I4LA 1HTTA 3N2KB 1JJ7A 1C0LA 3NHMA 1ZUHA 2ZWMA 1WLSA 3H65A 1YCGA 3DKPA 1TU0A 1EK2A 3BG5A 2GPTA 3PWSA 5REQB 4KC0A 3T7KA 4GMFA 5KUTA 1BJTA 3UOWA 1VCOA 5CLJA 3C1AA 5AM5A 4IDBA 5CDFE 5ERYA 4P5PA 3QVSA 5IDYA 5BUQA 2A4MA 5TGDA 1F5SA 1H8HD 3SYRA 3ZE0B 2P6RA 3IBCA 3TM4A 1ISHA 3HS3A 5DULA 4YRNA 1CG6A 5C0OE 1COWA 3CRVA 1UWLA 2ACEA 2YXEA 1N1GA 2ZCVA 3Q7IA 4MX8A 2HMAA 4U7JA 3WQHA 1KI6B 3HHEA 5H5JA 5EXPA 2X19A 3UJ7A 4IYRA 1KRXA 1QS0A 1FSGA 1P29A 3JWJA 1TVEA 1Z13A 1T2NA 2R8BA 4GMXA 4YC7A 1NI4A 2HU2A 2Y0BA 4F6CA 3TFQA 1NR5A 1M2VA 3Q0IA 3RRYA 4IINA 3BSSA 4LTMA 5JBNA 2XKKA 2LZ0A 3Q9LA 4HNGA 1OPXA 4AJJA 2CT8A 4IQ8A 1JYSA 1OV4A 1DI0A 2PBFA 2EDAA 1WY5A 1L7OA 1GYRA 2ZRJA 3DDZX 4KWIA 3U3ZA 1OBVA 3E8XA 4RORA 3T06B 3KQWA 2XWJI 2V5AA 3A3PA 3EMVA 3NRJA 1P45A 2ZTSA 1WWKA 3FYSA 1I6LA 4FD3A 4YQFA 4YT8A 3BWYA 1N77A 4DPLA 2DY0A 3BD6A 3FYUA 1IEQA 1W4ZA 5JWRA 3AVQA 3EQ9A 2JVJA 1SQSA 2ZJ3A 3AUYA 3OTWA 4LISA 4KDEA 3HUTA 3TW8B 4LXHA 1Z0SA 2RGCA 4L8FA 5D5QA 3TBHA 2A78A 2ZAIA 3KL4A 3QNUA 5A3JA 1WF6A 3FNGA 5ALRA 3QMVA 4QGSA 4AX8A 4BX3A 4RCYA 1JDNA 1WZUA 3NP7A 1TMGE 2PXAA 4GI5A 2R6HA 3NHRA 4I6GA 4A6EA 2OV2A 2V96A 3MUFA 3HKBA 2JGAA 5C7OO 4CM9A 2UUOA 3SC4A 4Q9HA 1L8XA 4RV5A 5JJIA 1FYXA 4IMPA 4XUDA 4H7KA 4P93A 3I6IA 2IZ1A 4W1PA 5JZMA 1NVTA 1DKRA 1T24A 1CS4C 2OCPA 5JNVA 1J2YA 4HK4A 3S2IA 3ELUA 1VXOA 1FNBA 3OX3A 1ZRNA 2F3TA 1E66A 4IS3A 3UANA 3K9FC 4GI7A 4V0SA 4UCXA 4FUTA 2PXHA 4KQJA 4XIJA 4ZI7A 5F9FA 1VIMA 3DV2A 2QVXX 1L9XA 2AL7A 2XYVA 1JEEA 1COZA 1EEHA 1PGNA 2J3KA 3DJFA 3L06A 1IJKA 4HMQA 3S1AA 4JMPA 3WRYA 2HNBA 1YKFA 4M76B 3EPLA 1MH1A 4ENSA 5ES3A 3HCEA 1ONSA 4NBUA 1YS9A 3RSCA 2DHEA 2IPOA 1CUSA 3FPCA 2RARA 4UD2A 3JYHA 1L5GB 1MVNA 1Q0ZA 1QWOA 2EZTA 3C85A 2QJTA 1KPGA 2R1UA 2H9IA 3AJ9A 3CEMA 3IXLA 4Y6GB 4AJKA 3F1KA 4CRWB 4EAQA 5K0GA 4BLVA 2F59A 2RHTA 3ZWOA 3MFQA 1GFIA 5J2UB 5KJEA 5KNLA 1PVOA 1KAOA 4L50A 4KYUA 5K4GA 4A27A 1VI5A 2XW6A 3C3MA 1F8XA 4GQAA 5AQ1A 1V5IA 1M7HA 4OMDA 3L0OA 5AI6A 1FDIA 3GYBA 5DTRA 1YJXA 1V37A 3UF0A 2OP1A 2ZVQX 5EIFA 2FFHA 1TK2A 3IEXA 2FB9A 3SGLA 1TM7E 4BUZA 4DMCA 5TIIA 1L5LA 3P2YA 2BUBA 5LMZA 4IWNA 4PICA 4V38A 4C30A 3HDQA 3FYDA 3FDZB 1L0BA 4FW9A 2M6RA 2P3OA 2XF2A 3I0MA 1FQWA 4BFLA 3O75A 3W5DA 4G1FA 3BCHA 1EFKA 2VJOA 3UV6A 3VC1A 2YIDA 1QTNA 3Q4GA 2ZSDA 3LXUX 3SJCA 3GPIA 4KR7A 1IQ0A 3HU1A 4WTOA 3U7RA 3ESQA 4U7FA 4HWKA 4W5TA 2J0UB 1JEJA 2R11A 3TNFA 1O9GA 4DR5B 1JTVA 2ZYGA 4LJ6A 3R5KA 4YAUA 3FW1A 1HL7A 3ZCVA 3ST7A 4HBGA 2DKFA 1RAFA 5DLEA 4NMWA 5JAZA 2DY1A 3X1JA 3QKRA 2NNWB 2OMEA 1B6TA 2P78A 4TMYA 4XPIA 5DX0A 5J43A 3PUJA 2HHHB 4JGBA 4IJ6A 2D5BA 4F60A 3PE4A 4L8WB 3RAFC 3P52A 5LKAA 1YMQA 2VSOA 3GJ7A 2XGOA 4QEKA 5JNLA 3TQHA 5L3SA 2B1RA 4I1IA 4I4NA 5EC8A 3GLKA 2H54A 1P0QA 2JI7A 3IELA 4JOSA 4UTPA 4FGLA 1NFFA 2XNJA 2XYGA 4L4XA 3RAGA 4Q47A 3MCVA 1LFAA 3FVWA 4AURA 2VJMB 4R9UC 3K96A 1ZR2A 4ZRDA 1EK0A 3ECCA 1I5EA 3GMTA 3IPLA 4FFOA 1RQXA 4C4YA 3EA5A 3GWZA 4YUAA 1KMHB 2D2IA 2B92A 1RHJA 3DH0A 3THXB 4M99A 1L7AA 1Q77A 3MUEA 1YACA 3NBAA 2FNAA 3QXGA 4HAXA 1E1NA 3IAM1 4I3GA 3NDPA 1A8UA 4AFNA 3BMNA 1EP1B 4F72A 3FOAA 3UMMA 3CZPA 3S5UA 4YRRA 4NEHB 1NBWB 3QBVA 4QUEA 1F1JA 5HP4A 2CV2A 1ABBA 3B7GA 3RVBA 4IOLA 1Q83A 3FFXA 2QN3A 5BW8A 3ZPXA 4D9NA 4HGYA 4QNMA 3JQDA 1F2UB 2I2BA 4G26A 2G0TA 2X9LA 2ZSBA 1MB9A 4IF4A 2DKNA 4MINA 1C9MA 5EJIA 4QOHA 4EY7A 1HUQA 1JHXA 1KDPA 2ZB8A 2PBRA 3V2IA 1K5PA 1WM1A 2VPTA 4H4CA 4NE2A 4Z0PA 1DCTA 3SQNA 4DT1B 1TA4A 5D85A 3ETGA 1WUKS 3M70A 4GKAA 1S8AA 3UGKA 1GFWA 3VH2A 5LWQA 5CVEA 3UMRA 4C7OB 2ZW9A 2Z1MA 3R1IA 3QWIA 1BXGB 1LW7A 3ZW8A 4GDFA 1KK2A 2G1AA 3LUHA 3ZTTA 1NKSA 3QLEA 1JU4A 1GWNA 2GJ4A 1G6HA 1J8DA 4TZTA 3WSVA 4NBRA 3B1XA 1ABEA 1T43A 2QRNA 3DBVO 3L4SO 1EBFA 2HRBA 3NOQA 4QICA 3WB2A 4EG7A 3U5ZB 1JKJB 5BMVB 2WOOA 3D0KA 3DV0B 3G5AA 4YLYA 5H68A 1V9SA 1C4WA 3HR7A 1UMDB 3M6MD 4HH3C 2JCYA 1KKUA 4MV4A 3ZI0A 3ZLBA 3OUTA 5B64A 4I2VA 5G2OA 3LXMA 4H3HB 3UMBA 1Y9DA 5AR1A 5DGTA 1RXVA 4GOMD 5CBPB 2B5VA 4DLBA 1O7JA 2GD1O 5ESRA 2PQ2A 3TOVA 3S7ZA 4UTRA 3FPGA 1MFZA 3FTDA 2JFZA 1Z4JA 1YL7A 5HS6A 4F45A 1UM8A 2WJGA 1ZGHA 5B5SA 4KYIB 3D3JA 1WRBA 3F71A 1Y3CE 2GZDA 3AUFA 4G0VA 4Q9KA 2WWWA 3RJTA 3WJ7A 1QCDA 4Z7QB 5BVHA 1FUYB 4HG2A 3NH9A 5EMJA 4EMBA 1AHHA 3FTQA 1TNDA 3I92A 3KWFA 4TSFA 2H4JA 3H11A 4Y2UA 4EJ0A 3W5AA 1RYMA 3PTZA 1FBNA 1NLUA 2PYZA 2AOTB 4O4LB 4KXLA 4EENA 2ID8A 4M0FA 4LXTA 1CQWA 1SZJG 4IJUA 4NL4H 4QPCA 3UVEA 3LUBA 3VFDA 4ROTA 4M1QA 2VP3A 3PR1A 4GQIA 4JITA 4KJXA 4N4AA 5COQA 5LM3A 3B20A 2C5AA 2ZXEA 3AIKA 2WICA 5DN9A 4C4ZA 2V3CC 4NJMB 3VH4A 2O0HA 1XZDA 2J0SA 1RABA 4UU1A 3G2NA 4JEIA 4V39A 3VPCA 4E22A 5JNTA 4C03A 1P2GA 1ZN8A 5TT0A 1HA3A 1MB2A 3CN7A 2YINC 2BEJA 1QTRA 3H99A 2L2QA 3TQCA 5K9ZA 4QEZA 1NN0A 4LZLA 4AY5A 2VSFA 2Y8EA 3TPFA 5C5EA 2BFMA 3KYCA 1IM2A 5CFPA 3QBDA 3CH6A 1U2DC 2AJTA 2PFSA 2WZQA 4E5UA 1VYTA 1B2RA 3DCJA 3K1AA 1I7QB 4HVAA 3DDOA 2PZGA 4W8GA 3OLVA 5F3DA 3FJYA 2P75A 1S2LA 2Q3FA 4LHZA 4P3NA 2HYIC 4LG1A 5HQTA 4D0SA 1E60A 1KAEA 3PEEA 1EJ2A 5DZSA 5ERXA 5TVKA 4LYFA 1U04A 1EPUA 3NORA 1SWWA 5LZ8A 4FR2A 2AMYA 4MZDA 5A9TA 4BVHA 1AA6A 4AT1A 3FDJA 2UUCB 1GGNA 2IXGA 1CR4A 1SWVA 5B4TA 3C3AA 3AF1A 4H7EA 1TLFA 3VYVA 2W5UA 3WP0A 3A1UA 4O2BB 3UNXA 3F97A 3AGQA 2GNOA 3HKDA 2P9QA 2YMQA 3ABIA 4L0QA 1HSZA 1RRCA 5JS7A 1QB7A 2G5CA 1Y7LA 3QWAA 3EPHA 4CI0B 3ICOA 5AWFC 1GPJA 1UZNA 1UPUA 3FI9A 3PU6A 3M9WA 3CB2A 1NQVA 1NUSA 1BHSA 3QVUA 4Q6BA 5DBHX 2PZJA 1NJ1A 1OBHA 1RYEA 3A4VA 3E7DA 4BBPA 1M2GA 2G06A 1NU6A 3I9JA 5K3FA 4F9TA 1JH9A 4PZYA 3ICQB 3RRZA 4LZAA 4QTZA 1KR5A 1K7YA 1H85A 1X74A 1HQDA 4M0MA 1XVLA 1DAOA 5AM3A 3K6KA 2FF5A 5A0TA 4F4UA 3R3SA 2QAJA 5CCXA 3HSKA 1PE0A 5LUBA 3G0BA 3NYRA 4LY3A 4HDNB 4OQYA 1KJJA 1ZU5A 4BNTA 3OETA 1MMFB 4NBKA 5FBLB 2OUKA 1RIIA 3HA3A 1CQIA 3RAEC 2JIQA 2GYYA 5CPFA 1NV9A 2X76A 1INLA 3ZWQA 3KKEA 1XTRA 1T1GA 4I50A 5FQOA 2JDID 1RI4A 3AERA 5BNWA 1SXJB 4D3ZA 2L42A 3D7SA 1BFKA 4Y1FA 3HZHA 3QY9A 1ZCZA 1NVDA 2B4TO 4BDTA 3ELWA 2I54A 3ZVKA 2CHFA 4RD4A 4YY3B 1N92A 4BXOB 3CW9A 3J80A 1ZJWA 4A2WA 4OHUA 3K72B 3SVTA 3VO2A 5KQGA 2VSQA 4RC9A 5BN4B 2P9EA 2Y4NA 4H4EA 3QEMB 4IGIA 4UE6A 2XMBA 2KM1A 2QM3A 3LX5A 2GPWA 1HM5A 4WI1A 4QT4A 5HRCA 2YWGA 1XNJA 3BMXA 3SJZA 3CVUA 2I87A 3RTCA 2C5EA 4Q3BA 4GVXA 3RODA 1E3SA 4OOFA 1CS0A 2JFWA 3EXG1 2IU3A 1KI2A 2ZREA 3K2IA 4WK4B 3V2GA 3U17A 5DWVA 3ROQA 4D46A 5AJZA 3KB1A 1WB6A 1GG5A 3ORQA 4ABTA 2HEGA 4DRXB 2YNMA 3ZDZB 3ROPA 2HLDA 1MDFA 3K20A 2LD4A 5BWNA 1M1NA 3HCCA 2VCYA 2EKLA 3ECAA 3RVRA 2FSVC 5BV8A 1DCKA 1I94B 2CLSA 1RLTA 5KU7A 4Q9NA 2DWOA 3KSRA 4LW8A 4FFVA 1CY0A 1QONA 5KYUB 3L5OA 3H2HA 4RTSA 1UWKA 3DZGA 1HE4A 1SCNE 1Z2DA 2A3RA 3TE7A 3DWGA 1IEWA 4I2NA 1BFDA 3QBEA 1Y1SA 2VDWB 4ID3A 4L3VA 1QG4A 1KVTA 3EOBI 1XT6A 1WD7A 4N8EA 4ZEVA 4YCDA 3ZDEA 1TK9A 4GKBA 2XWQA 4JBXA 3FKQA 4NC9A 4AZ0A 3A9WA 1E9FA 3R5HA 5TXGA 4CT4B 3L6UA 5LB4A 2C9YA 2FQ1A 3DVRX 3EZXA 4BX0A 1GNVA 2VCEA 4EM6A 1CDEA 1W75A 2H00A 2WZCA 2QUIA 4WZBB 5CM2Z 5E1OA 2QZJA 3F5MA 2XWSA 1P4JA 3BM5A 1JHQA 1U80A 3GFVA 4B3XA 1XNRB 4G5XA 1KDVA 2OM2A 1WV1A 2R87A 2XVAA 1IHPA 5TQJA 4BLPA 1QHFA 4WLUA 4DDUA 3A14A 1DIAA 5JIBA 5D3MB 4OGGA 1K7CA 1UPFA 3U44A 1F51E 1SOWA 2MSEB 2DSNA 3ADOA 4Z1MD 2ZIVB 4JYBA 2JJ2A 1L5HA 4EFKA 4ENQA 3SYMA 2OORA 5LP6B 3AMVA 1YDWA 3V33A 1RJ9B 3I5UA 5IC5A 4IIJB 1TA9A 1WXGA 1EXMA 1A76A 2HIGA 2KYRA 4V1CB 3IIEA 3HCBA 3QU9A 4ENPA 2Q5OA 4MR9B 1KO8A 2Q3DA 3GBPA 1QV6A 4Q0MA 1ZIDA 1OASA 2EERA 2C04A 3H1AA 3PYXA 3L01A 2QOEA 3I05A 4J0CA 3WLEA 1F2DA 1F9EA 2JF0A 2YMMA 1U8FO 3JXEA 4IDDA 2JCSA 2D1RA 2QGFA 3F8SA 4WXYB 3VXKA 2DFNA 4LRQA 2ABWA 4PYLA 3JSXA 4LBWA 1SELA 4QE3A 2ZIUB 5E9WA 3KETA 2IVFA 2PSEA 3K5HA 3ORFA 3LI2A 4HATA 5ILOA 2CNBA 5EWMA 4QOEA 1S7CA 3WR5A 5K8TA 4QELA 1VYVA 2HIMA 3VDNB 3AHCA 4Z7NB 1OQAA 5G41A 2W83A 1W5EA 3LQ2A 4E7PA 3UAZA 1GUDA 3ZXYA 5HGXA 4MIEA 3GEPA 2I2DA 2DU8A 4CG1A 1IXSB 2VZ0A 4MYRA 3O4VA 1H42A 1II9A 2JBHA 3GAAA 3D3EA 5F9MA 5JMPA 3ZEAA 4CTMA 1E9BA 2ZRIA 1BVHA 2RHHA 3N8GA 1MEOA 5BMVF 1JQAA 2EJCA 3MZ0A 4MLCA 1YULA 5CX1A 2V0NA 4MGIR 4MUJA 5DGDA 2A0WA 2J4CA 4FMPA 4KLRA 1Z0DA 2G7MC 3DMYA 3HL4A 4OP2A 3IR7A 1L2TA 2PEZA 3PRYA 2RHWA 4TKLA 2UYCA 2UYYA 1KQPA 1TD9A 4U2DA 2OCBA 3AEUB 3E9DA 2NSHA 4N6NA 1AH2A 4PE5B 2HV8A 5G4KA 2C2HA 4ETWA 3FCYA 3P9SA 3WY9A 3WGTA 4B75A 1YR3A 4MCJA 1HG1A 1P1HA 3HTXA 1ZN2A 1YVPA 1G3MA 1XG5A 2XUZA 3TW6A 5B58C 5PGMA 4AXXA 3HHPA 1P73A 2O7NA 2G07A 3OSZA 4JB3A 3LDGA 4L4RA 2VJQA 2WD8A 2CHGA 4I08A 4BNHA 1T15A 1ZOPA 1KP2A 1DAFA 2X22A 3CF4A 4ZCMA 2GHQA 4MAMA 1X7ZA 2MMCA 3K9WA 3WGYA 3ERCA 4J4BA 4DBLE 4E46A 1KY2A 1UF9A 1M83A 3MA0A 4O4LF 3CSDA 1I5OA 1WTCA 4WCFC 1KS9A 1UAAA 4NJEA 2CKMA 2VPXA 1YGYA 5KB3A 3FHTA 4F3NA 4GL2A 2JB9A 2ZBEA 3K4PA 1I80A 4X95A 5DCYA 3LPDA 3PUXA 5TGTA 1O0CA 4ZO6A 4CM7A 4D8XA 5C5DA 1OXXK 2JFFA 2I80A 3VMFA 4IJVA 4QARA 5FT9A 3RU7A 4E88A 4ESVA 1B26A 3NEAA 2QQ5A 1J0AA 5TEVA 4PLYA 1IEXA 3LT2A 4OQ4A 1OT5A 5LXTB 3T3DA 1CDDA 4D57A 4UHEA 2O54A 1LX7A 4DWJA 5KOHB 2TMDA 3BBPA 2FZLA 3JALB 1XGKA 3AYXB 3DFZA 3WZMA 1W0JD 4FQ7A 2CNNA 2JAXA 1IULA 3LWDA 3M3PA 4MGEA 2IGBA 3SEZA 3IKVA 4G0UA 3C98A 4CEJB 2BUAA 1EXVA 3EZLA 3QPCA 3H87A 1W46A 5LL6P 3Q3JB 1NBEA 1SVNA 4BO5A 4DIFA 5DFAA 1E89A 4JU9A 5F23A 1D2MA 4GAEA 4U7DA 3GFGA 3UFXA 3N6XA 1E4EB 1CSEE 2JFPA 1WIWA 1R0RE 3T9BA 3A2MA 3H3JA 5CTJA 5DYWA 3C3XA 4CV0A 1NHGA 3A1WA 4YGYA 4HWTA 1N5DA 1AF4A 4BVGA 4XJVA 1KK1A 2XDAA 4QASA 4BNMA 1DG1G 4MRRA 1MFPA 3QTTA 1YUMA 4G4SO 1XKQA 2UAGA 3T1OA 3FMPB 2QA5A 4YUWA 3V1TC 1PVVA 3C3CA 3Q3CA 3JASA 1L3BA 5CRIA 4I9NA 2WRZA 1JU3A 3QOXA 5DHAA 1PYGA 1XFAA 1J7JA 4RV9A 5FP0A 1EM6A 5CLHA 1HZZC 3I76A 2CSUA 5KSOA 3NIWA 3PPYA 1M6WA 4AIRA 4J7AA 4TMWA 1JH8A 1SCQA 3AF6A 1ZK3A 2A0KA 3KOXA 4TYQA 2O5VA 4CM5A 2X0KA 4IVPA 6REQA 1PF7E 3EYAA 2A14A 4Q05A 4EELA 2JA2A 2AB0A 3LA8A 3CO5A 3KX2A 1XZCA 2A9RA 1C30A 3E82A 1TYCA 4JX9A 2VK2A 4GSKA 3KKPA 1EP9A 4OX9Y 3AB7A 5B2ZA 4EHAA 3VU1A 1VZ2A 3KK0A 1IM5A 3AC0A 3NUZA 4TTJA 5HM8A 2HBZA 2J1LA 3G8CA 2A5JA 5L53A 1TQ6A 3I12A 4WFJA 5BY2A 1MO2A 3HRKA 1TZKA 2D1TA 2WTBA 3SNKA 4QM7A 3PJEA 1UBKS 5DMHA 4GC9A 2ECOA 3M5CA 1V6CA 5JQWA 1VLZA 1T8PA 2FSHA 5AIAA 2HWKA 4ITUA 3TZLA 2C77A 4A0FA 2ZKIA 4CT5A 2XE7A 1U3VA 3BE6A 4HMPA 3T7TA 2YIJA 1R16A 3L7CA 5LDHA 3DW3X 2GFHA 4J6FA 1P5ZB 5D7NA 4FFRA 2O2XA 3I2FA 3GY0A 5I9LA 2WPDA 4KVAA 2PU7A 3ZH9B 5BR8B 3AVWA 4YP5A 1MC5A 1MV5A 1E7MA 3OKPA 4JJAA 1RE0A 4WEQA 2RMKA 3FCEA 3L7JA 2O0JA 5KYVA 4BAGA 1MGOA 4JLWA 4N9WA 3MIZA 5H3HA 3U13A 1J0EA 2CHEA 2E4VA 2YRWA 3I52A 3NYQA 4EKDA 2WAXA 1XVIA 2XQFA 1GSAA 2B0CA 4GRAA 3C5VA 4A0SA 2NSDA 1GLNA 3NQ41 2HLNA 1YAJA 4M1WA 4P98A 4M21A 2RGNA 2QTWB 5HYVA 3WGHA 4NU8X 5HZHA 3T99A 2IXFA 1FS5A 2BISA 2XY4A 3HGTA 3NHYA 2WIGA 1UXKA 1CUWA 2H1SA 3EG9A 4C6TB 4KGVA 1DO2A 2IYYA 2Z83A 3CEJA 4MQUA 3WGZA 3K5WA 5LFAA 2AZXA 5TNXA 4E6PA 1MVOA 4K3VA 2PS0A 3PFNA 2IRWA 3U4QB 3PEUA 4YUZA 3HVKA 5BN5A 3TUZC 1R0ZA 2VHJA 3KEOA 4WLFA 4REOA 5IDVA 1CQXA 2QMZA 3UT5B 1EVEA 5CP8A 4REQA 3T9FA 4B7AA 3DXXA 4RM2A 2YV3A 4G41A 2WMNB 2IZOA 5AJVB 4BFTA 4OYHA 4S24A 4PM4A 2PBLA 1XJ5A 3QKUA 5JV5A 3NOXA 4WUVA 4E5MA 4KREA 4PNZA 2O0LA 1R4AA 2XCIA 1MVLA 5F73A 3F8WA 1G3UA 1OREA 1LK5A 2G8LA 3DBHA 4MKIA 2QB5A 4HFJA 4CMEC 3SFTA 4Z3KA 5DBFA 3GLGB 1PAUA 4YN3A 4RTOA 2CYAA 4RADA 2G7ZA 4CBVA 4YUVA 4DCCA 2BGWA 2CUTA 2ZIWB 4RKEA 1E2HA 3FH0A 3IOBA 4OHBA 5DHTA 1PFKA 1XMPA 3SX2A 2LV8A 4MDFA 1GAJA 2ODEA 1TIPA 3F5SA 4XJSA 4ESOA 1U0FA 4GX5A 2EWMA 3GJQA 1C80A 4M8LA 4EL5A 2VJDA 1N2XA 2I3DA 3T8YA 2HIAA 3IYLW 1LEHA 1EFVA 4CM8A 1CRZA 1OKKD 3JU3A 3NNSA 4N49A 4A8JB 4BQFA 3J81k 5JDCC 1V0JA 4HHEA 4W6QA 3BWCA 3D31A 3GMIA 2JGIA 5CLFA 1SPXA 1XVVA 2HWUA 2C9MA 1XNHA 2J6BA 1Z4LA 5IEBA 4HVCA 4FX2A 4AJ1A 2EVWX 1E9VA 3EUAA 3HDVA 4YAGA 3I3SR 3TO5A 5EJ6A 2B2NA 3MCAA 2V7GA 2ZSAA 3JQ9A 5EJ4A 2CXXA 1FSFA 1O4VA 1V39A 1CJMA 1PHPA 5CITA 5CDTA 1BOFA 5JXGA 4PO1A 3N2LA 2QZZA 3OO0A 1SVUA 1P0MA 3W90A 3W9YA 1JKXA 2FQXA 1YUBA 3OZVA 3IEKA 3KOUA 1BXRB 3VGJA 4EQZA 3WRXA 4CMCA 3INNA 4ZT4A 4F3CA 2Z5GA 4FIZA 3SN6A 3PUZA 4TSFD 3QUBA 4HH4A 1GPYA 3ZWXA 4B0PA 3W7BA 4BAZA 5LNK1 3TS1A 4DR4B 3DFIA 4H0FA 1X7YB 1A1SA 2EC5A 3GEEA 4H35A 5FV7A 4XQ9A 2DUNA 3W5HA 4AJNA 5DBEX 1NW7A 5JXWA 4CMGA 1IJEA 1V45E 4G0OA 2GOYA 4J2TA 1BCSB 3SK0A 1N5MA 3UV7A 4HTFA 2ZR9A 4TV9F 3IQZA 1JSXA 4OLFA 1XQWA 3R7FA 4YT4A 2JK0A 4V0OA 2OCDA 3FGOA 1Q92A 3PWZA 1VJ5A 2C5HA 1U28A 1ZVMA 3AEXA 1I3KA 2WNSA 3CXRA 4LECA 1N75A 1TT5A 5AHXA 5LKRA 1RSZA 3ESAA 2JLWA 2ADFA 1EUDB 5K0LA 2CZGA 1PNVA 3RUEA 3IP9A 3ZWAA 5FTNA 2IS1A 3OM9A 1H9CA 5IZCC 3U4AA 4HADA 1N36B 4P2GA 4D0NA 2FMTA 1NASA 2HRZA 1OI2A 2PGIA 3E1KA 3AUUA 4KN6A 1L8QA 1FRVA 3RCBA 1DBQA 1G3QA 1JR2A 1GG2A 3KDAA 1X3SA 2BGKA 3Q2KA 4XM0A 3Q3EA 1ZRMA 3MT0A 1YHYA 1R0KA 1F0NA 1GPAA 4HLDA 4JB2A 1E3WA 1AMNA 4RENA 3CE9A 3MRTA 1WBDA 1FLAA 3IP5A 2V6BA 3F49S 5ABPA 1F0PA 1MXHA 1WD5A 1YRQA 3PGKA 5LQJA 1QAOA 2C9CA 4Q4LA 4YVFA 2ODQA 1TCAA 3FCXA 4XYGA 3A10A 1UEJA 3LKDA 4RK6A 4MRPA 4DV2B 1XN4A 2PRKA 2O1SA 1NWHA 4ZV4A 2B9VA 1TEVA 1EP3B 4R2LA 4HT3B 3C6MA 4H6VA 4IO1A 5T5QA 3PGJA 5HJ5A 3I1IA 1W6RA 2ZJFA 4PWZA 1IXKA 2OGZA 2BM8A 1GGVA 2DH5A 1LI5A 4EJSB 4IGFA 1U8XX 2A0UA 2IX9A 4B7XA 3GLIA 2A35A 3WYAA 5AUQA 5T7BA 4HCJA 1TKAA 4MUIA 5AW4A 4TX1A 4JLVA 4JR1A 4FWTA 4MQEA 1RAHA 2GAAA 5FOSA 5JZVA 3R8XA 4UCWA 1VSVA 2E37A 4M46A 4Y2SA 3W34A 1VCNA 1DJQA 3B9RA 1XIVA 1A9RA 3G85A 4H60A 1PL0A 1ZGGA 3H4TA 3O8NA 4GSYA 1UPXA 2C2OA 5FOTA 1OUMA 3X1KA 4AN0A 1KFEB 2FEKA 1OYOA 3FLAA 1SH7A 2ZSUA 4OATA 4Y2TA 2IYOA 1U3FA 1UP7A 1FLVA 1MU0A 3N2GA 3L7DA 4NESA 3CF2A 4JHXA 2C78A 5E7MA 2FSIA 3RUFA 4AJHA 4S04A 1EUQA 1SHUX 3V55A 1GT91 1O6CA 1IQPA 5BUCA 2M2IA 1MG0A 2NACA 4XWOA 2O20A 2SECE 1K2WA 4ITRC 1FDWA 2WM8A 2WF7A 1L5FA 3WAGA 2V1XA 4RGQA 5GMOA 1GU1A 5FPSA 5HE9A 4ARCA 3N0XA 1ZNZA 2HPZA 3K0HA 4NSNA 2ZQYA 4M1ZA 5HFJA 3RQSA 2WA1A 3WIDA 3CX4A 2EIHA 1FDVA 5T57A 1R6VA 3RGWS 3EEFA 3DEYX 1HO3A 3H5LA 4FK8A 3QENA 1HYBA 4TLBA 4HPJB 4JI7B 1P6UA 4H59A 5HF5A 1WZEA 1DRWA 2I6UA 2Q7XA 3IT1A 2J4FA 2YNMD 1N25A 3KAQA 1XMVA 2HLDD 4F5WA 2BR4A 3F7NA 5U1PA 4BO0A 3QA9A 4AG3A 3K0SA 1VKZA 1UEXC 2GVNA 3EC2A 4JVOA 3T5AA 2P2YA 3E8SA 2ZBFA 5JC1A 4HQFA 5DDIP 4AZTA 2X15A 3Q8WA 4P3PA 4AJOA 2YZGA 2YWJA 4HWRA 4F4JA 3JQBC 1G55A 1Q0LA 3LY8A 3O9VA 4M1KA 2R8YA 3AI2A 2WD9A 2GTIA 1US8A 4BP8A 1LGYA 4W82A 3FG9A 2MOKA 4JJFA 4C0BA 1JEAA 1UKZA 5TPWB 5AVRA 4B3BA 1W87A 2W71A 1U31A 1KEEB 2CL0X 4RPGA 5C1IA 4QSMA 1NW6A 1EQUA 5KVCA 2BFCA 1LK0A 3MOIA 2WLSA 3WNZA 5KEIA 1RDFA 1Q21A 2JHPA 2B61A 4OV6B 1GEEA 2N42A 1W44A 2RBEA 5JEEA 4CIBA 1U0LA 3ABQB 4O5OA 3M4YA 5CB6A 2QMEA 2PXCA 3M1AA 1E2MA 3PFIA 3QLTA 1FA9A 1VBNA 2A5FA 3TZEA 2PD4A 4AICA 3DOFA 4V1CI 3JAMA 1AKUA 2I2AA 5DCLA 2FZGA 4LKRA 3OIVA 3DOCA 4H1UA 3H5AA 4OI4A 5JS2A 2WU8A 4UUMA 3ZD6A 2AC2A 4QQRA 4F85A 1IZYA 5EJEA 4NV0A 1PU2A 2C2GA 3UCFA 2JJ2D 3ZDAA 1NNLA 2DUJA 1Z35A 1R0LA 4G4SP 1F3OA 4JLOA 2BFBB 3U37A 5T8KC 1O6ZA 4R1TA 2H5EA 1WUIS 3O90A 3PXAA 1GOTA 5AM1A 2O2ZA 2Q6LA 3MTQA 2B4KA 1KK0A 4R5MA 1GKLA 4Z9YA 4MROA 1J97A 3DL2A 1X38A 1FU7A 3UOAB 1LBTA 2OBNA 1E1CA 4RHUA 2OBLA 4XIGS 3G7SA 1CR2A 5E95A 1C8KA 4ARUA 3SZOA 2CJXA 1GCOA 1YB1A 3A2NA 4LSGA 1L6IA 3CLUD 5CK5A 1ILEA 2Q1TA 5GZ1A 2BRUC 1XRMA 2R8RA 4EBBA 3ZQJA 1WVIA 2GAJA 1L4LA 3LY7A 2BFNA 1KJYA 5GZ3A 3VM6A 3TSYA 3HYTA 2ICAA 5BQ3A 4UU7A 1JQ5A 3OFKA 4MUNA 4Q3DA 1K3TA 1QDLB 4JN6B 3ZD8A 4DA6A 3A06A 2EW2A 3UHOA 3I58A 2WUFA 2PFGA 5CH5A 1E3IA 5SZKB 5FWNA 1KDOA 2IZ5A 4PHHA 3LT1A 1FQKA 3WQSB 3A6PC 5UKDA 3IQGX 2QR5A 3KAKA 3NM4A 1XU4A 4C0HA 3ZZTA 1SC4A 1PT6A 1QE0A 3I0ZA 4YJHA 4WNIA 2NPIA 1QIEA 2QDKA 3VZQA 1AGNA 5ALWA 1MENA 2NXCA 2Z2XA 2W6IA 3FBWA 4NIMA 1U6JA 3E22A 3TSOA 5JH7B 1JXAA 1ZSYA 3EDYA 2CDCA 1JECA 2F7SA 3CE6A 4GEKA 4PO9A 1YVEI 1U2GA 3JZIA 4JUBA 2D5LA 2PH3A 1U6IA 1G21E 2ZBUA 1IN8A 1UKVY 2QN8A 3I01A 3ISJA 3OIGA 3MXOA 3N07A 4JAVC 2C07A 3SCZA 4WERA 2X2EA 2XHEA 2FOIA 2X8BA 3FY4A 2RHGB 3VI3B 1OBOA 3H2YA 3IAEA 1OCEA 2BIFA 2A58A 1EVJA 1ZICA 2QU8A 1VE3A 1BDBA 3VHLB 2B1IA 1MORA 4D74A 4ZYUA 4NENA 3SJBA 3CCBA 4ZAXA 2A59A 2ZSIA 1V5WA 3PDUA 1FNNA 1MW8X 1J4AA 3A4LA 4JI5B 3VV2A 2AFIA 4JP8A 5EHNA 1VSQA 1FDOA 3M4NA 1XV5A 2IOHA 2OGWA 2W7TA 4O8CA 3QSGA 4F1JA 3RUHA 2VPWA 1OZFA 1SBTA 1G5TA 3W2HA 2CHVA 2XB4A 4J03A 3AEQB 1A2OA 4MP8A 4Y2YA 2IYTA 1G66A 4L3WA 3H75A 1EB8A 1EWQA 4JP3A 1O54A 2O7VA 1ST2A 5L40A 1OE0A 1HT2E 2ASVA 1QS0B 2RG1A 2CNKA 2YCBA 5EMNA 1U3UA 4XB2A 1NMYA 3N8KA 5DX8A 5H16A 3U26A 2HA7A 4PS1A 4EB0A 1N32B 3INYA 3D6AA 1M2VB 4E31A 4LZPA 4N18A 3RS2A 5J3JA 1IUPA 2O2SA 3DAOA 5B4UA 3QMPA 4OGFA 2DR3A 1I32A 5LA6B 4XGKA 4LJSA 2ZQZA 3AZPA 2X3UA 3OC0A 3W5CA 2HV9A 2VR1A 3AZOA 3CZAA 2QSUA 4J9UE 3MTDA 4KAJA 3N0TA 3HCOA 2FN4A 4FDLA 3FYUB 1PK8A 4IWYA 3RBXA 4UFPA 1WY7A 2EZ8A 1UOOA 1QYWA 1YE5A 1Y9JA 3E9NA 4BNYA 3L3BA 4WFKA 4N0EA 4ER5A 1RXSA 4H3VA 5KKNB 2NVOA 3ET5A 5C5CA 4JUAA 4MDHA 5BORA 2NXNA 1JSLA 3I64A 2FW9A 3HJNA 4NHEA 4BB6A 1GDTA 1E9DA 1EDOA 3ML1A 2H52A 4B4DA 1HYGA 4L5YA 4X1YA 3CLTC 3WYCA 3CVOA 1WV0A 1SXJC 4ZEOA 1E0JA 2ZTUA 3HA2A 5BOSA 1IONA 1UJ2A 3ZBQA 2E5LB 1USIA 2PZLA 1R4NB 4I7EA 3HFGA 1K4KA 3EHEA 3T9DA 4MITA 2VJCA 2WA2A 1YB2A 3A6FA 2IHYA 4ZI7B 4UOQA 1J8MF 4EA6A 2O07A 4M1TA 3MS2A 3ZHSA 1KQFA 3IMEA 3L0PA 3BPSA 3MJHA 5IC6A 1HXHA 1T2VA 2VJNA 4GWKA 1GILA 3R23A 3TNJA 5JMOA 2AC7A 4GZ3A 1THGA 1XP5A 2NUTB 3DOJA 5SY4A 3S1AB 3SZLA 2ERYA 3PIDA 1YIAA 5JSZA 1L3CA 4D4GA 3A25A 2VA8A 3HVIA 5KJCA 1O94C 3K0CA 2JHCA 5DCWA 3T1QA 2CJPA 1N8NA 1UDRA 2CLMB 1DXOA 2NXEA 2IUEA 3BFKA 4OLAA 2X1LA 3N87A 2FRDC 5EJ2A 5JD6A 1LWOA 3LKBA 1Z68A 2PM8A 3E3NA 3KTFA 4YBZA 2OXIA 2V7PA 2DR2A 1JIQA 5IWAB 3R5SA 1UIMA 4RTPA 2CXNA 3LS2A 5EJ5A 1D9XA 1YDGA 1SKBA 4JIMA 5AK6A 2GSDA 2ZYHA 3MMSA 5FEMA 3UUWA 1BMDA 1FMCA 4OYRA 1Z4QA 2DWQA 2IL1A 5ALEA 5EE0A 2BHSA 3FF4A 2QY9A 5GZ6A 5T3UA 4D9CA 4MGZR 1U9JA 3T5PA 4FHDA 2XB9A 4DLUA 3UXMA 5FQNA 2JG3A 4KN5A 1HI9A 3E3AA 5ETJA 1DJOA 2P9CA 2WFZA 3AR5A 3H5IA 1G64A 1HZJA 3BC1A 1WOYA 2PGOA 3SQMA 5HKKD 5M7EA 2H29A 4R16A 1TTTA 3HU3A 4K8RB 3DDNA 3IH5A 1OZGA 1R6XA 1XKLA 1ZD4A 3HCRA 5EEHA 4A1FA 1IBMB 3WBBA 3AM3A 1U5CA 1W9MA 5FI3A 2G5PA 4D79A 4G4JA 1QVAA 1Q3KA 1QB8A 2FPPA 2QUAA 4M89A 2REXB 3VPXA 2B83A 1A7AA 1U3GA 3GP8A 3E7WA 2Q3LA 1RI2A 1T29A 1FEZA 1T6NA 1QZTA 3VOTA 3OX2A 5L3QA 2JI9A 1N6KA 2AUNA 2FF7A 3MT8A 4M37A 5LP6C 1V8ZA 2X8LA 1C1XA 3CZRA 5ALIA 5CHYA 1Y7TA 4Q1FA 2OY0A 4ZGWA 2O8BA 4AS3A 3DAPA 1UK6A 1XROA 1DIOB 5EWJB 4PZ9A 3MCTA 2R25B 3OPMA 1YZUA 3NT2A 5ALJA 1FFHA 2COEA 4O5AA 4EFLA 2JGLA 3OT5A 4PG4A 4DC1A 1FSSA 1JLSA 3DNPA 5CVJA 4RHFA 1VIYA 2O6LA 4RU1A 5JQGB 4NTZA 2X6TA 4Q01A 1TI7A 1VJRA 1GTG1 5CYOA 5K99A 2JH8A 4RTNA 1P3JA 4OUDA 3NP9A 2DQ4A 3L4BC 4YIKA 5LMNB 5CMLA 1FFAA 3D64A 5CVDA 4PCVA 2BKVA 5KAPA 3OIFA 2XUAA 3P9XA 2PMEA 1HDRA 1BMFA 3GCWA 4RZSA 2ZAGA 3S6JA 3P94A 1BX0A 4G5QA 1KI7A 2H7YA 3BHIA 3CUTA 4MVYA 4FFDA 1RKVA 1XEWY 3GGOA 4MI1A 1OH8A 3L8GA 4KG7A 4KOAA 1M72A 3I01M 1KL7A 1O1YA 3FZGA 4PYKA 5FWDA 1NLZA 1SB8A 2G9UA 3FB1A 1XYYA 3TLKA 5KHOC 4WZ6A 1C3OA 2OFFA 5A2GA 1H05A 1N3YA 3OE1A 5EZSA 2DXIA 4ZT2A 3N2EA 5J1TB 4FEYA 1UBOS 3SM9A 2ZLBA 4CCYA 4MZXA 1FW6A 2FHSA 3BB4A 3DF7A 1VPEA 2Q45A 2YXLA 3KPUA 3S8MA 1V43A 1T0BA 1QU3A 4OAPA 4A0RA 4NZNA 5BNFA 1RXUA 2QLTA 4FGSA 1HLGA 4HDOB 4NBNA 5DT2A 1DKQA 5AVQA 5DI9A 4LS3A 1BQ3A 2VJYA 1EFTA 2QZPA 2ZJ2A 2CFTA 3GT0A 3GRCA 3OQ6A 1R0YA 2DFDA 3M4ZA 1HOXA 3VHRA 3GWGA 4JLMA 3W5UA 4UD6A 4LNHA 2ZK7A 2IU6A 3D5QA 3RVDA 3TVTA 4XVRA 3HDJA 3NPAA 3WMEA 1LDGA 3DFKA 2EL7A 3MWGA 3SI7A 3TLBA 2VHEA 3HB9A 5K20A 1ZO8A 3V8MA 1RHUA 5K6AA 1HETA 3DE2X 3KZ1E 4G2NA 4HLUA 4CFYA 3AJAA 4B6QA 2YDYA 3T9CA 2PEYA 5BSHA 4P4SA 2B25A 2R6JA 1OC4A 4QPJC 3DSRA 4RJ2A 4XDZA 4DAOA 2VWGA 4H3SA 3ZC3A 1L5OA 2ZE8A 4M7OA 3FOCA 1U63A 4BGDA 4RIIA 5TQ0A 3NBXX 4DTIA 1C1HA 1HDGO 1ACJA 1T9DA 1JQLB 1U7UA 1XXLA 5CLLA 4QWWA 3R9WA 2W8BB 2IQIA 2BI4A 5AQEA 4C1BA 5HRUA 1A9ZA 1ULUA 4GMGA 4DL9A 1FP7A 5LPNA 4AD8A 4NV3A 1F14A 2EFJA 2W6NA 2GN0A 4KPEC 4LQLA 4O25A 1F0KA 4CMJA 1TAUA 4IXDA 1V6AA 3CY6A 2MYUA 1U9YA 4RF3A 1NVUQ 1T4BA 4Y67A 5F7JA 4DKXA 1XLUA 3EX7C 3VAYA 4L95C 4O63O 1RXWA 2HMYB 2DKOA 2R6CA 4NK5A 4F11A 4QOSA 1DAMA 2EP5A 3VU8A 3PB3A 4B6SA 3BORA 4PSCA 3QY0A 4C2BA 2VF7A 1TTQB 4YECA 4B44A 3NTOA 2BYTA 1SBNE 4EFMA 3T0GA 2D8MA 3KYBA 2XTZA 1ZISA 3OU2A 1CVIA 4OHFA 1GCUA 4BVFA 1ZM3A 4UPVA 2V9ZA 2HMSA 3PXEA 4AZ3A 1LLUA 4BJHB 2FJPA 2B0JA 3KS9A 3MJCA 4J7UA 1ZP6A 2A5DA 1KFKB 5FUBA 5EJMA 3SYKA 1Z83A 1ZNQO 1I3CA 1EQ2A 1X0XA 4FC7A 3ZK9A 2MHCA 4W5QA 1GPKA 1QG0A 1ZJ6A 2B78A 1C1DA 3CPSA 1SUWA 1NR7A 2QAIA 2R00A 2W6OA 2Z3ZA 3HCPA 1WVGA 2HA4A 4KBFA 4WNYA 4EW6A 2CV1A 1GR0A 3HYRA 5LA6F 4ZFNA 1I14A 1N2CE 2VNAA 2YVAA 5DXFA 3HYNA 3H0CA 2AN4A 2VP9A 4PAWA 4R2JA 1LV8A 2GJ9A 1RYNA 4LRUA 4R2KA 5ECGC 1RYYA 4H7DA 5A4AA 1I4TD 4O0LA 3RARA 4ALNA 2L17A 3BQ9A 3B6JA 1GL9B 3EEBA 5HCUA 4K9OA 1UKAA 4PQGA 3BWEA 4RY0A 2PUVA 4W4TA 5JFTA 4XUGB 5DOVA 4HJXA 5KO2A 5DM2A 1RI3A 1YKGA 3SC6A 2EX1A 2O2JA 4D0GA 3TTTA 3C7AA 2IELA 2P9GA 2WIBA 1TVMA 3HKDB 1TPYA 2XZPA 2QD5A 5L51A 1JFLA 1CUYA 1T3LA 3Q9SA 2A57A 2ASEA 4B3RB 1UT5A 4FFSA 2HA0A 2H2DA 3CNNA 4YMUA 1G20E 1R9GA 2OXFA 1EMDA 1JQKA 3EWNA 4JWKA 3WLNA 3ZKAA 4I5IA 3K71B 1GZVA 4XVHA 1X1RA 5D7BA 3UOGA 5K3FB 3FPFA 4AJLA 4RTRA 1Z15A 2Q3EA 1QP7A 4Y0NA 1JP7A 1PNRA 3KC2A 4K03A 5KTPA 2COUA 2AV6A 4RWEA 3EODA 3S68A 3F7OA 2AG0A 2QTNA 2WU4A 2A67A 2WUWE 2I8AA 5HQ3A 5C8YA 2C4MA 2DYKA 3CCFA 3QBTA 3QMWA 1P61B 1PFVA 4HEA1 3C6KA 2JLYA 3KHKA 1A9YA 1Z7GA 1ZD3A 2FFJA 3IVMA 1ZLXA 4Q1CA 4X0EA 1J9ZA 5LDDC 4WKCA 4GBMA 5DHRA 5KOJA 4Z0NA 1D7AA 3EIOA 4MPTA 5BT8A 4HMOA 4LV8B 3OCXA 1JHAA 1VCMA 2XDQA 3PD7A 3AERB 4RH0A 5ES4B 2ZQ5A 3C24A 4FXPA 1O96A 10MHA 1ZINA 2J9FA 4PCLA 3HN2A 1HQKA 1D5CA 3FLEA 5KX5A 1E0KA 5DMXA 4R2WA 5JSUA 4JL8A 5TJ9A 2NUAB 4AP6A 6Q21A 3LZDA 4XWYA 4FFPA 4WZAB 2IV7A 1D6JA 2ILVA 2PGDA 3HXPA 3T3PB 4U5XA 2CWDA 1GKKA 5F7XA 1AVTA 2EXXA 3ZZUA 4KR2A 1G5QA 5C53B 3GG9A 4D4LA 1JIXA 4OXIA 1CS0B 1OWMA 1PKEA 1YVDA 4NS4A 2IWHA 4DMHA 4ZTZB 1K0FA 3RYHB 3P96A 5DXJA 4EAAA 1IM8A 3HLYA 4DHWA 3PX7A 5SZIA 1P74A 2JLSA 4N8DA 3VAAA 5HIAA 4L3OA 4MVJM 1VYHA 4KWEA 1Z75A 2BPOA 3GA7A 3IAS1 1C1YA 4TYYA 1G8HA 1KVSA 3LMKA 3BK7A 2YRXA 1M1NB 3PG5A 3U3JA 1JFFA 2X9QA 4U0KA 3QF7A 1LBSA 2JJMA 1HE5A 2Q6VA 4KKVA 3ROXA 3SDBA 3DLIA 5LYJB 4R41A 4GOXA 1Q0PA 3OEYA 2NYRA 1ONPA 3JATA 4I3HA 1A88A 3L8FA 3T1VA 3ZEIA 3OJLA 3DMRA 4KW7A 1XZBA 3REOA 5A03A 4NS1A 1DFGA 4GBJA 1D09A 1X1DA 3SFVA 3BSWA 1T5LA 2ZCUA 3PPIA 4LE1A 4B33A 4B3TB 1W8IA 3PDHA 4A8JC 1EFPA 3MIIA 4YDHB 3VV3A 2AK2A 4QPZA 3GHYA 3Q40A 3K53A 4TUYA 3PJDA 1DKNA 3R7DA 5MGBA 4F86A 5LZ9A 2GJAA 1V35A 1KBZA 1LVUA 2IY8A 3OZBA 3ZU3A 1ETUA 4BMPB 3VYUB 4HV4A 3LUFA 5FUVA 4PG5A 3R4VA 3A6DA 3LPCA 1BX3A 3QXCA 4KDRA 4P33A 3E3LA 4FT4A 5FBWB 2VDPB 4RTLA 3DMFA 4UM5A 2JANA 2OFWA 3E5HA 5B58T 4CKXA 5JXHA 2MIIA 2WKWA 3UK0A 3D2AA 2RHMA 4RZUA 5JQGF 3QITA 1TTHA 2J9RA 3C8MA 2YZMA 2Z30A 3LQQA 3VHXA 2C00A 1OC2A 4AU1A 1L5HB 4YRIA 4IHJB 1UC9A 2J59A 4HC4A 4RGBA 2AX4A 4K0RA 1JG7A 2HPHA 1K7XB 2YJZA 1QTQA 4Y2QA 1GQRA 2W6ID 2PH7A 3I04M 3AEKB 2GEVA 2NN3C 4MW2A 1QH9A 2R7AA 3TEJA 2QI9F 4ZMSA 4JBHA 1OIXA 2ZRNA 3TFWA 3VRHA 2JARA 2PX5A 2VBCA 1EAMA 2H6EA 2ZM6B 3H2SA 2RGGA 3EFOA 5A05A 1U2TA 1KC3A 1VDMA 3HE3A 3JQGA 3QLVC 3U49A 5BW5A 4BC1A 1ZXLA 2Z3VA 5EZYA 4E51A 4PPQA 2I55A 3SFZA 2R4QA 3ZGZA 2Q2QA 3NAGA 1V2GA 3RE1A 1QHHB 5FA6A 4W9NA 1OHHA 5E0KB 2X3YA 3DT6A 1PZXA 4XB1A 1VG8A 2HA2A 1W85B 3V97A 1FP4A 1KVUA 2SBTA 3KKOA 4N5NA 5EWMB 3ZU5A 3AVTA 2R47A 3HA5A 1DLJA 1TZJA 2L18A 2WAOA 3PZBA 4I4TB 5T41A 3RREA 4JLJA 2CGEA 1PEYA 4RH1A 3TLMA 1TFUA 1V2HE 1PTJC 3OAAA 2CLKB 3EXFB 2X41A 4UFNA 5I9IA 3W2FA 2JGRA 1ZGBA 3ZHRA 4ZYWA 3I4FA 3OM1A 3EPRA 4LOIA 4E2WA 1AKTA 1PT8A 2AR7A 5FADA 5KU1A 1T8WA 3TNLA 3CVXA 4A5OA 3TKLA 1QAQA 1V7ZA 1MO5A 4LGYA 3OU6A 5ESDA 4L7VA 3RS8A 4NNPA 1FX0A 2WP8J 4NFYA 1X1EA 2JAUA 4PRKA 4QRDA 4C5AA 3OZDA 3PSAA 3H6HA 1EVZA 1PNTA 4PLWA 4YMLA 3ZHUA 1G6KA 2X23A 4A8TA 3QM1A 3B2EA 5G4KB 2HDNB 1TK3A 3L6EA 4JVMA 2GO7A 4LWOA 5FNZA 2P2GA 3ZS8A 1I0IA 4PAMA 1GCAA 5CHEA 4KO8A 1NU8A 2PE5A 3F4KA 5DI3A 1PR1A 3Q11A 1EQAA 1MB4A 3FHOA 1EDEA 2YX1A 1JG4A 4V0KA 2C7BA 2BEUB 4ZAGA 3M49A 1V7QA 3DKKA 4EJSC 4BNNA 4E08A 3FCUB 1L5QA 3AG5A 3H1FA 4G0YA 1IBCA 1T3SA 3CG4A 4R0VA 3UJ3X 5ICEA 4PXYA 2MR5A 2X9GA 3EUEA 4HX9A 4IDAA 1V8DA 5K51A 2JLRA 1A72A 1BW9B 1OLOA 1TMKA 2ATEA 4YCCA 4LF7B 1USVA 5CNIA 1SKMA 3G0HA 4XDGA 1S8NA 2I22A 4TLAA 4QZVA 4XWWA 2VF5X 4II2A 4ON9A 4B6JA 4MHTA 5BSTA 2W48A 3L1UA 4N48A 5ALMA 4HO1X 4EJ6A 1E79D 3NTQA 3D4IA 3QU7A 1Z0JA 4B32A 3OZGA 3QX8A 2O50A 4JNCA 2ZSJA 2EJBA 3KTOA 2IHUA 2AG8A 2PMFA 4R83A 1AO0A 3TLJA 5BP7A 4NOLA 3UAWA 1PKXA 3L7YA 4FZVA 4A4DA 5M34A 1X8KA 3VR6H 4RVGA 4HFRA 2QYHA 1ZH4A 3LUCA 2DWPA 2IIQA 2X3FA 2HWYA 2G36A 4JL5A 3ORSA 4PFKA 3O9ZA 4PVCA 3GJ8A 4K9PA 3DNFA 2FPXA 3NHWA 3HR4A 2E4XA 3G9XA 4MVJP 1MTOA 5T3YA 1MXFA 4QYWA 2DBQA 1JAYA 2VDKB 4TMVA 2QPOA 2QY6A 2IUUA 2IHKA 2IODA 4R0NA 4B3GA 1LJUA 1Z29A 3TIXB 2ORVA 4RABA 5C7LO 1LNSA 1W94A 4FU0A 4IDFA 4JLSA 4ZT7A 3MGCA 1ZG3A 3NC1C 2QLNA 4UTXA 4F7WA 1KY5A 4RFSB 2Q5CA 1U1EA 2W6MA 2EBHX 1KGDA 1VXRA 3C5CA 3QJ5A 4EKNB 1OBCA 3RDPA 5CB0A 5LZ4A 3EIHA 4Z9AA 2F43A 5CT6A 1GAEO 4X8LA 1Z4NA 1UXIA 1I3OA 4NZZA 1QCCA 5CDUA 2P2SA 1K97A 3AZQA 4L15A 2Q49A 1L8LA 5AI5A 1QO9A 5JPDA 4HFNA 1OWPA 2HY7A 4JI6B 2GAIA 4BMXA 3WB9A 4J07A 2CHQA 2C3MA 3B6IA 2C4WA 3ICWA 3NXKA 4KRYA 2EGGA 1RI1A 3UO8B 4P08A 2NM0A 4XSVA 1W4RA 1YI0A 2P30A 3ZGNA 5CIYA 3LNCA 3VPHA 4IEFB 2RAFA 1N2IA 2GH1A 3FWZA 3P9YA 3PXUA 4H18A 1C5KA 1K88A 5IVIA 3RFUA