3W90A

Crystal structure of cmp kinase from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
198
Chain Sequence
GIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRAREQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Crystal structure of CMP kinase: insights into initial substrate recognition and reaction mechanisms
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 70
structure length 198
sequence length 205
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w90A00
1XPOA 1IY2A 2QE7A 2WZQA 1XEFA 1YHNA 3EZ6A 1XEWY 2VQSA 3SBDA 1EK0A 1E94E 1G41A 1ZUIA 4KODA 2D2EA 1TEXA 3MUFA 5KNDA 4TL6A 2P5TB 1KJYA 4PQYA 4C0HA 2ZUDA 3T12A 1MV5A 2QPTA 2QBYB 3NHBA 1N5KA 4MQBA 3OIWA 1ZUNB 4TMKA 4XTCS 1PLLA 4NYIQ 4A8JA 4P4UA 3RDPA 1C9KA 1M1YE 1U2RA 2JASA 2ZSAA 3EASA 1ZM2A 4HLUA 2W2TA 2V7QA 4AK9A 2AXPA 4A2QA 2XZPA 1CKEA 3RANA 1HYQA 2VHQA 3HU1A 2P67A 1N6RA 1NNEA 5FPTA 3W8NA 3TR0A 3P27A 4M1TA 1SVWA 2IXEA 3OF5A 3REFA 1HE8B 5JRJA 2C78A 4M1WA 4F7WA 2AKYA 4MGKR 1ZC4A 1HT2E 3LD9A 4HDOB 2WSSD 3V00A 5CJPA 5L8VA 4AKIA 4XH9B 1G17A 1UBGA 1YU9A 2D62A 3NIBA 3MJHA 4DUGA 3GEHA 1Q44A 1J2JA 4PTLA 5KSZA 1TEVA 2XB4A 3U7FB 4OQFA 2WIAA 4Q1AA 3H4MA 4KXFB 3NDBB 2GJAA 1HV8A 1YQTA 4AD8A 2DFNA 2O8DA 2AX4A 4TLAA 4OI1A 1ELOA 4B35A 2ZE7A 3DZ8A 3C15C 4RVCA 1CULC 3GLHA 1YVDA 5K8UA 1JQLB 3T35A 3Q7QA 3ASYA 1ZM7A 4ZDJA 1RRFA 3BH7A 2BKUA 4BLQA 4GNKA 4M21A 2HF9A 4MRPA 3RC3A 2ZREA 1FUUA 3ADCA 5H8WA 4M22A 4JMPA 3UIEA 3THYB 1G3MA 2ZETA 2KWIA 4BPBA 2VP0A 2GXSA 1IJFA 2IL1A 3R20A 1Z08A 4Q4HA 5L3RA 1UF9A 1YR6A 3K9GA 3FMIA 4BRWA 1CU1A 3THWA 1EFCA 1XCGB 3BB3A 2B6HA 2JLXA 2VP2A 3QEJA 1RE0A 4KFRA 5E4FA 4V0ME 2CJWA 2VTKA 3RLFA 3SS8A 1AKYA 3AP2A 4QBHA 5AUQA 1X8JA 1A5TA 2NO1A 4ACAA 5BN5A 2ZJ8A 4LJ7A 2C04A 2EFHB 2YYZA 3QKRA 3OESA 3EZ7A 1NG9A 1GKIA 1TMKA 1N5IA 2AWNA 3LBNA 3NWJA 2VLIA 4NYMQ 5HZKA 5F3WB 3DKVA 5AJYA 2UVQA 4BZPA 4Y0AA 2CHGA 4AWXA 1IN5A 1T0HB 1ZP6A 5CLLA 1Z0FA 3U5ZB 3RRMA 1MH1A 1QDEA 4YONB 3L2OB 4AKGA 2FFHA 2WMOB 2A3RA 3PQCA 3P1JA 3L0PA 2BKEA 4BFUA 2HF8A 2QI9C 1OB2A 4HB2A 2D4HA 4EPTA 2WKPA 2ZRHA 4YC7A 3IIKA 3CRQA 2B8TA 4JBWA 1XMSA 3O47A 4Q7LA 4G5RA 8OHMA 2BOVA 3IO5A 4MRVA 5DIFA 3OIUA 3RS5A 3T1QA 4G0NA 3K0EA 1E9BA 1BYUA 3UMFA 4MGYR 5IF9A 1OFIA 2VH5R 4PC2A 1W0KD 2H57A 2IUTA 2DYKA 3QKUA 3TAUA 5B30A 2G83A 3R9IA 2WPDD 4IW3B 5BN4A 1II0A 3LA6A 4LX0A 1Z0KA 4Q1DA 5G41A 1XFAA 2RGNC 2J7PA 1W36C 2QROA 2B8WA 3PUVA 4EJSB 1LVGA 3P20A 2H7VA 2Z83A 3KQLA 1OW3B 4Q4JA 3SI7A 1E0AA 3GPLA 3IILA 1XB2A 4ZV4A 2IYRA 3K09A 1E96A 3FE2A 1P9RA 4XJXA 4IDQA 4N1AA 1QHHB 4F91B 2O8EA 4TWZA 3CZPA 2PLRA 1E1RD 2FX3A 1AQUA 3IO3A 4CT4B 5IHPA 3PUYA 2FPMA 2C9OA 4JVLA 2GJKA 1FPMA 1CTQA 5J40A 4N0EA 3U3JA 1GOTA 2XNDD 2Y8EA 5KPJA 5FFMA 1XF9A 5G3YA 1HQCA 3W6PA 5JMTA 2EW1A 3AGQA 1YR7A 4XWOA 1UADA 1UFQA 3RS3A 3CUEF 4JL6A 1IN6A 4EPVA 4NCNA 3LBIA 3TVDA 4OYHA 3BRWD 5AUOB 3E2IA 1AJEA 2GXQA 2PZGA 2ZR7A 5JCZA 4JT2A 3L0OA 3MWJA 2GNOA 2CL6X 3A1UA 4M9XA 1XXHA 5M04A 5C2JB 5IK2D 2LKDA 1GILA 3AKYA 1DO0A 1LTQA 4LDJA 4NBSA 3U2QA 1YZTA 2CE7A 3DPUA 5L3QA 2VSOA 2H16A 2WAYA 3SBEA 3IHLA 4A8JC 4OJKA 4HLUC 4BFWA 3I61A 3O8CA 3HU3A 1S4QA 1BO6A 2BBWA 2WJYA 1V5WA 4DCVA 4TLEA 2JAQA 3Q3JB 1E9SA 4GT1A 2IEYA 5AJXA 1AQYA 3BK7A 2J59A 1P4SA 2D7CA 3GP8A 3SHWA 1OH6A 4C2UA 3B1XA 1M6NA 3BH0A 4HLDA 1U9IC 4WXPA 1E2KA 3V4RA 1G9XA 3CPHA 4Z1MD 2ZM5A 4Q01A 3A8TA 2P2LA 4JLNA 3NEYA 4QM7A 3UPUA 2V55B 2O8CA 3TLXA 4WW0A 4URUR 4F93B 1D9XA 1UPTA 2IS1A 1W2HA 2OFWA 2PX3A 1S1MA 1DAKA 1VKJA 1HTWA 3A36A 1W47A 4A8JB 1AS3A 1CJTC 4DKXA 4R2HA 4XD7D 5C1BA 3HPRA 1N0WA 821PA 1U0HC 2AD5A 3CBQA 4NYJQ 2HYIC 3CWQA 1Z28A 2IYXA 2QMUA 3EC2A 1E69A 1CP2A 4EPXA 3X1ZA 4QC2A 3KFVA 4TL9A 4BZQA 4OI2A 4ITRC 2C5LA 4D25A 3AVQA 2FGJA 4F4CA 4W5HA 1OXXK 4H1UA 4BFSA 4GP6A 1ETUA 2REOA 4QOSA 4JBYA 4US1R 4AYWA 1JAHA 4UNPA 3EA0A 1Z6AA 2IWRA 3B6EA 1A2KC 4LHWA 1VG9B 3DOEA 2QT0A 4RD4A 3FHOA 2O0HA 2CNWA 5FBWB 1YR9A 1XTSA 2O8DB 2XGJA 4I1UA 2FEOA 1G8GA 4JZKA 4BFTA 2WBLC 4EKDA 4C4PA 2F1IA 2DWPA 2X1VA 221PA 1YJ5A 2OBLA 4FXPA 4KSCA 3W34A 3AKDA 1JPJA 2AHOA 4Q9IA 1CJMA 4Q1EA 1AS0A 2ZRNA 4PHFA 1KI6A 3DM5A 2GK6A 3WYGA 1FL9A 3FTQA 2FPLA 1G291 1A82A 1E79A 1DVRA 3WRYC 3M1IA 1OHHD 4QHYA 2J45A 4Q4HB 2QSYA 4PPFA 4U00A 4JBXA 3LO5A 4HAZA 2ZYTX 4IOJA 1Z22A 4LJ6A 3VNVA 2GETA 4PHGA 3PV0A 1JB1A 4HZUA 4R7ZA 2Q6TA 1HY3A 3THWB 4M0LA 4QJ5A 5HKKA 3ZS9A 4KYUA 3VKWA 3PUWA 1XPRA 1NVUQ 1VCNA 5G40A 2CJWB 2FEMA 4PR0A 1DOAA 1Q3TA 1T91A 1VHLA 1TQ2A 2JDIA 2WJGA 2XX3A 1QHYA 4EUNA 2C95A 3D6TB 4JLPA 4G5OA 4E03A 1NVWQ 4JIMA 2ORVA 3SZRA 4DRZA 1LS6A 1GFIA 1NSTA 3QKRB 1WE2A 4LV8B 3WP1B 5KSOA 3TUIC 2EYUA 5EP2A 3AH8A 3CH5A 3EAQA 4JL8A 5EXPA 4B76A 1MR3F 5HCIA 1N25A 3QXSA 3RS4A 1W5TA 4LJAA 1KZ7B 1E9RA 2QMOA 4GZMA 3CB4A 5H68A 3K0CA 3ICEA 2W0MA 4LWZA 1ZC3A 5AUNB 1G8PA 5F9FA 1KDRA 3KUCA 3OIVA 5JSZA 2GBLA 3U6KA 1PV4A 5TDHA 5CB6A 1N3BA 2H8KA 2W2XA 2AFIE 4O2LA 1ESMA 2F1HA 1HURA 3K09C 1GP2A 1G3QA 3QF4A 4KJZA 4HSEA 4ZDWA 1NP6A 2BEJA 1UBCA 1SGWA 1Y63A 3MAAC 4B47A 1NMZA 1UKEA 5IT5A 4HYYA 3U7HB 3I32A 1OH8A 5JJKA 1E6CA 1WA5A 1XTJA 2BV3A 3SOPA 5CYPA 4DB4A 1UEIA 5FBVB 2VHCA 5LB4A 1J8MF 1I2DA 2A9KA 2UZIR 2J0UA 1DBSA 1GNPA 2V6JA 2HT6A 4JLMA 4CIDA 1XXHE 5FR1A 3OFND 4TQAA 1VIAA 1X8LA 3GEIA 2IBMA 4KITB 3K70D 1CJUC 5F9HA 5EE3A 1W46A 4CEHA 1KDPA 1KMHA 2D3WA 3RS0A 3B60A 3AEZA 1G8YA 2P6RA 1AGPA 1N6PA 1E2EA 4R9UC 1P60A 4WXRA 1QG2A 4C0LA 2YKGA 3BC1A 4Q4JB 4F4JA 2GEUA 1N6NA 1GKUB 2A2ZA 3KB1A 2OV2A 4DLUA 3GQBA 4Q1CA 2O8EB 3QVVA 4FMDF 4CVNA 2ZQ5A 4MKHA 2WSSA 4Q03A 1US8A 1G64A 1D9ZA 1EGAA 4HLCA 4LPSA 4MRNA 5G53C 621PA 3MFYA 1W4RA 1FFHA 4LJ4A 1MRSA 4I99A 3OEHD 2YWHA 4A0FA 3F8TA 2R2AA 5FUWA 1IQPA 4URXR 2GJSA 5CDFA 5HPYB 2V1XA 4IOMA 4JLDA 2WKRA 1ESNA 1NSFA 4Q1BA 1GRRA 2Q0HA 2YC4C 3T1VA 3GD7A 2ZU0C 4DCSA 2CL7X 3FKQA 2W58A 5EE0A 2N1BA 4TMWA 1IN7A 2O8BA 3V9PA 3ETLA 2QL6A 2GXAA 2OCAA 1AZSC 1OE0A 1YKSA 3O8DA 2C9YA 5J4VA 5GADl 1XXHB 5KYKA 3AVXA 1G1MA 1TX4B 1Z47A 4DB2A 3IPXA 4LGMA 5CM8B 4TMZA 1II8A 1IAQA 1VHTA 2PT5A 1XMJA 2DFKB 5EE9A 2WWWA 1P5ZB 1AM4D 3TGPA 4PHTA 4LJ5A 5JRZA 5L3QB 2ZRKA 1KYIA 4C0AC 2ATXA 1KSGA 3LWNA 1YRBA 3SYKA 3QKSA 3CNNA 4ILEA 2VSXA 4R2IA 4Q1FA 2WOJA 4TSFD 3ZLJA 2FF7A 4M8NE 2HCJB 2WM9B 2X8AA 4M1KA 1KI1A 1P2TA 2OILA 2ORIA 4LJ9A 2PMDA 3JZAA 2FZ4A 4O3MA 1E2IA 3GJ6A 3AVYA 1OSNA 4YMSA 3W5JA 4LHYA 4BUJA 1E2FA 5LDDC 2XTNA 3LW8A 1RZ3A 3BAFA 2ZUCA 2YINC 3CNLA 4PAOA 3M4YA 4TYNA 1KSHA 4KHZA 3BS4A 5BYKA 3AUXA 1E98A 3EC1A 3FFAA 2O8CB 4XIGS 2ZI4A 5JECA 1NY6A 5DYIA 1E2GA 4QNRA 1W4AA 3BBPA 4V0MA 3UWOA 1T5IA 1BIFA 1VG0B 2E9SA 3BE4A 2VBCA 5FOTA 3U44A 2PZEA 5EJEA 2YOGA 121PA 1XPUA 4DWJA 2QAGA 2JLYA 1OH5A 4CRWB 1XBTA 1WXQA 3NTUA 4QGGA 2NO6A 3LX5A 3RVBA 3ZZUA 3ZQJA 4FINA 3W8RA 1U81A 1E9EA 4DLXA 2ZI5A 2D74A 1G16A 3MJRA 3KDSE 4ZDKA 1GWNA 3CWZA 1S3SA 2JJ1A 4GSYA 3QEOA 1CS4C 1Q1BA 3CKLA 4RKEA 1I4TD 1W0KA 1EFHA 4XTRA 2WPDA 3WYFA 2WWHA 3BJIC 3IHWA 1IBRA 2DR3A 3U3KA 5JS8A 2BIFA 1QHGA 4TMVA 2WWIA 4OK6A 3Q8XB 3BIFA 2OBNA 2R6CA 2GVZC 3DZDA 2JLVA 1G3RA 1P3JA 1PLKA 4RD1A 5LB2A 1SXJE 3PR1A 4DLZA 3AVUA 5DE3A 5BQ5A 3UWKA 2ZAOA 2VF8A 1OFUX 3AVWA 4G5QA 2ZXUA 4C0QC 2ZSEA 3PEYA 5BXQC 3PENA 2AK3A 3SU8A 3ZVMA 1KI6B 5JWRA 1SVMA 4TZ0A 1ZCBA 2XEXA 1ZAKA 5FOWA 2BEKA 3HYTA 2JLWA 1W4CA 3K0CC 2XNDA 2ZYWX 3ZS8A 3EZ2A 4QHTA 4B3XA 2PLFA 2GBLC 2GF0A 4KLNA 5J4KA 3P32A 5FL7D 2O8FA 4OHXA 2QTFA 4HZUB 4JLBA 3BB1A 4YXWD 2IHBA 4A2PA 3HWSA 2XITA 3I62A 2AD1A 2J3EA 1KO4A 2HXSA 4EFLA 2TMKA 5IK2A 2WIBA 2WWGA 3EZ9A 4JL5A 2YNMA 1DEKA 1G7RA 4OI4A 2ERYA 3L8YA 4CEIA 1G3IA 4IVQA 4B6FA 1RPZA 1GKYA 3ZD6A 1F60A 1KY3A 4D26A 3AVVA 4HAWA 3KXIA 4M1SA 4V0KA 5LPNA 3GJ5A 4JYCA 3KL4A 4KBFA 4AC9A 1XCMA 1A1VA 3MWKA 3CONA 2ERXA 4P3YA 1XWIA 5JSZB 5KNBA 1E3MA 1NY5A 1D8TA 1KKLA 2CK3D 1N5LA 2RB4A 5IDVA 1XRJA 2FSIA 1OV4A 1DO2A 1NMXA 4UXHA 3B1YA 2BMDA 5CDFE 2GZDA 3QF4B 1Z6XA 2EYQA 1F3OA 2V54A 5TXGA 4A82A 4LI0A 1JR6A 3K53A 2ODWA 2PCLA 4BEBA 2ZRFA 4V02A 1Q1EA 4QHSA 3BFKA 1MOZA 1M74A 4HUQA 4EQ6A 5AJZA 2YOHA 1R0WA 2JLQA 5IRCD 3NG1A 1EX7A 2D7DA 4OK3A 1HT1E 4W5WA 2J0UB 2R6AA 1U99A 3H84A 4TMTA 3IIMA 3BGWA 4IEIA 3UANA 4ZKEA 1DELA 4LJ8A 2RGAA 1NVXQ 5EZ6B 1COWD 2QMHA 4CEHB 3IQWA 3AGPA 3HYRA 4KFSA 1KMHB 2A30A 4XD7A 2ECKA 3PG5A 2H5EA 5EE5B 1FOEB 1VYVA 3DOFA 2DY1A 3AF3A 1LNZA 5FTKA 4O25A 3FFBA 2FNAA 5G3ZA 2ATVA 5A4JA 3MSXA 1XD9A 1N6KA 2G6BA 3Q5DA 3SYLA 1CIPA 4WA7A 3HJNA 4TLBA 1IJEA 1US8B 3IKJA 2FA9A 1VG1A 2IEZA 2XSZD 2P65A 2GVDC 4ABYA 4LV5B 4DCUA 3PUXA 4BZXA 2OHFA 3BWDD 4AKHA 3CR8A 5A5GA 1NIJA 3U3OA 1OIWA 5JS7A 2IS2A 1GRNA 3A1TA 4H9GA 5JI3E 1JR3D 4LRWA 2GF9A 4IKEA 2VIIA 3LXRA 1J99A 3BB4A 2AKAB 1Q20A 2JJ8A 2OFXA 2PX0A 3A4LA 4P32A 3Q7PA 2VL7A 1OKKD 3IIJA 4K8OA 3RS7A 2O8BB 2XZOA 2FOLA 2JIZD 4YLGA 1RRPA 1Z5ZA 2YV5A 2ZEJA 3AKEA 3OE7D 3Q72A 4DT1A 4F4IA 1JEEA 3CR7A 5FPHA 4L15A 5JZVA 1NKTA 5JJIA 3AV0B 1QHSA 3KXKA 4L4UA 1DAHA 2QP3A 4ZI3A 1II8B 1X8KA 4LJYA 2XAUA 3EPKA 4N3NA 5HE8A 4B3CA 4CZ2A 1XTIA 2QAJA 3EWAA 3NH6A 2E1RA 2ZJYA 4JVNA 1B23P 3TH5A 2EU8A 2F1RA 1EWQA 1BOFA 1Q57A 1XJQA 3GCGA 3VU9B 4EJSC 3QKSB 2VYFA 2QAGC 2ZRGA 1H65A 4WZBE 3H1TA 1II9A 1R5NA 1UJ2A 2VP9A 3QXHA 5L3SA 3OEED 5CITA 2BBSA 3FKSD 4MUBA 1OXVA 2FFAA 5BN3A 2CLDX 1KZGB 2F43A 3WRXC 2J0SA 4PZLA 2DWOA 5K8TA 2QGZA 2MSEB 5SZKB 2G0NA 1NVVQ 4NE2A 1DAFA 3NBZC 4ERNA 2REBA 3PJRA 3CX7A 3KTAA 1P6XA 1H8ED 2W0SA 4QGFA 4BLPA 3BH6A 2ZI7A 1AN0A 3LNCA 2ZE8A 1U98A 1IONA 4KI0A 5TB5A 3RSOA 3I73A 2NGRA 1UKZA 1XZQA 1GL6A 1KY2A 4ASUD 2GCOA 1R6BX 2CVHA 4DEYA 2OCYC 5FTLA 1SVOA 1G18A 3Q9LA 1G21E 4Q5IA 3GFTA 2SHKA 2JLSA 4DIDA 3U44B 1W0JD 2QAGB 3KZ1E 4UXJA 3NHAA 5FPSA 2R62A 4Q9JA 2R6GA 2CVFA 1X1SA 1R4AA 3CX6A 1D5CA 3NBXX 4I1OA 4D4KA 2ZVQX 1RRCA 1QZXA 4UNRA 1EG7A 3CF6R 2QUZA 1SHKA 2B21A 2O5VA 1KO5A 1XD8A 3PEUA 5KO2A 5FOUA 1FP7A 4Q4LA 1XEXA 4RY2A 5EE1A 3F0TA 3OFNA 1MABA 3ADKA 2YJTD 1W5SA 4NCHA 5B64A 1ZVQA 1RYHA 1PUIA 3TSWA 4B3FX 4PSVA 5DH9A 4DSTA 3X1WA 2RHMA 1FUKA 3AP1A 2A7QA 1W36D 3IEVA 1ZM3A 3T15A 1W48A 2IK8A 3LVRE 4MKFA 3SQXA 1NJFA 3VR2A 3GJ0A 5BW8A 1H8HD 3REGA 2NOAA 3KQKA 1NN1A 4PQFA 4DLYA 4GL2A 5SZHB 4TYQA 3GJ8A 4Y0VA 2QT1A 4ESHA 4MKIA 1LF5A 1DE0A 4GI7A 1FX0A 3SFVA 2F1JA 4URZR 3W3ZB 3A4MA 3AVPA 1X3SA 2ZTSA 5FTMA 2W83A 1QVRA 2BHRA 4IFEA 3OEHA 2P5SA 2GTPA 5J4HA 1CRQA 3VR3A 4GRAA 3W9YA 1NJGA 5FI0B 3R7WA 1G6HA 4TTRA 4Q02A 2O8FB 1FTSA 3TKLA 1JNYA 2DPXA 2EFDB 4TL8A 3HR7A 1RRGA 4FIDA 3B7GA 3N70A 4GZLA 1MO3A 1HQYE 1VCIA 3EWSA 3OIYA 5EXTA 2QE7D 4TQ9A 3WMGA 1IY0A 3DMDA 3CO5A 3K9NA 4YMVA 3OZXA 2HJVA 2RHDA 3CM0A 5EXXA 2IA5A 5CYOA 5HZHA 1TQ6A 4A36A 4CEIB 4YMTA 3U7EB 2IT1A 2QSZA 3KX2A 4D81A 3GLFA 2NZ8A 2YZ2A 1LY1A 5P21A 1HUQA 2HJGA 3WY9A 5KDOA 1GSIA 3RRZA 1P7CA 3TMKA 4RZ3A 3VR5A 2QRNA 3F5FA 3NEJA 4GOJA 3AUYA 4LC0A 1SVLA 4TSFA 5HCNA 4B75A 2PMKA 4TQUS 2CXXA 1G7SA 2KSQA 2K5UA 1E2NA 4RD2A 3QXXA 4Z54A 3PITA 1OT3A 2G0TA 4IVRA 4BFVA 4MYUA 3AQ4A 3QENA 4C3ZA 1JEDA 1E99A 1Q21A 2BJWA 4JVSB 4IDPA 5L3VA 4HUQB 4RZ2A 4FMCF 4EQ6B 1MO5A 3Q85A 4LBWA 2E87A 4DEXA 4L5BA 2IWHA 5EP1A 2GESA 3KQUA 2QTHA 3C7KA 3LRPA 4JS0A 1N6LA 1ZRHA 5FL3A 1O87A 1JALA 1CBUA 2RGBA 1GAJA 4QXAA 3CPJB 1VPLA 1CJVC 5KSPA 4ZDIA 1WCV1 1A2BA 1M7GA 4S2EA 2F55A 4HB0A 1MO4A 1WB9A 3NDPA 2WKQA 2XOKD 2WJIA 3CRMA 4B3GA 1OIVA 2FH5B 3GFOA 4YDHB 4NMMA 2IYZA 5K8LA 1R8QA 1BMFA 4QKQA 4Q48A 4BWYA 2ZJ5A 3CIOA 1YZNA 4S35A 4DSUA 2H92A 4US2R 1JI0A 1Q1QA 2QU8A 4OK5A 2R6DA 5D3QA 3AF2A 4U7DA 3GLIA 1U90A 1QVAA 3T1TA 3ZIAD 3P4YA 1ZNXA 4NZYA 4NYMR 4AI6A 1AK2A 3NC1C 5B2ZA 1Z0JA 2H17A 2XZLA 4HATA 3VFDA 4ZI2A 1KNXA 2FGKA 4OBEA 4P33A 1CR0A 1SZPA 4DC9A 3D3QA 1P9NA 4RKFA 4KU4A 1TU4A 3EX7C 3QBVA 5EP4A 2DHRA 1F2TA 3SNHA 1N5JA 2ZI6A 2GJ9A 2GJ8A 1ZD8A 4TYPA 2IYSA 5KTYA 4MYTA 3TW8B 3GMTA 4DT1B 2HYDA 1F5NA 3EA5A 4KO8A 3E70C 3AVTA 3RWMB 4A15A 2IXGA 2FDCA 2A5GA 1S3GA 3VX4A 4JKIA 2W2VA 2XTMA 3NBYC 4OQXA 2QORA 4DXAA 4Q4AA 1PUJA 2YVUA 1E2DA 5ANRB 3UG7A 1NG1A 3AP3A 1M2OB 4MITA 2HEIA 3IBGA 1SXJA 3R9XA 1OYYA 3I72A 3RWOA 3GFPA 3G82C 2G77B 5KNCA 1SVIA 1CR2A 3B1WA 5FL7A 2VP6A 5CB8A 5DSZA 5HTKA 4YXWA 1KI3A 5EUMA 5L3SB 3O8BA 1Q12A 2CLSA 2HDNB 5JFGA 4Q9LA 4JLVA 1W4BA 2F43B 2ZVPX 3QIAA 2IS4A 4P31A 3N5CA 1KK2A 2QZ4A 1KTVA 1Z2CA 3FMFA 4LYAA 4AG6A 4XSGA 4ZCLA 4A9AA 2A5YB 2QM8A 2ZR9A 2GEDA 1OXSC 3QXCA 3B78A 4UJ3A 4US0R 2QGNA 1T8TA 3KTAB 4QGAA 4E09A 1T3HA 2P3SA 2ZYVX 3HPQA 3ZYCA 4DJTA 2A5DA 2DFLA 4QM6A 1Z3IX 2PBRA 2Z6VA 5BYJA 2IF2A 5CK4A 4RFVA 3LH5A 5B57C 4XVUA 3JVVA 4V0OA 4Q18A 3BFVA 3FHCB 3PCRB 2GCOB 3C41J 1Q0UA 1UBFA 2CMKA 5KUTA 2NMVA 2GAOA 1IXSB 1TNDA 4LBZA 1N6OA 3IBYA 1QF9A 2QQEA 2R44A 2VHJA 2WICA 1XEWX 2CK3A 3CZQA 4BQSA 2HUPA 4XVRA 4C0KA 1ODFA 1G5RA 3QG5A 4OQNA 3X1XA 3U60B 4BRUA 2ZSBA 1CR1A 4JLKA 2YWFA 2IC5A 3MWLA 1SHZA 2BCGY 2CCGA 3SJZA 3QF7A 4E07A 1LF0A 4J0QA 1GG2A 2N42A 4PHHA 1IOZA 2C8VA 5KHOC 4RCYA 4Q7MB 3AF1A 3ONWA 1KK3A 1OJLA 2WWFA 2CBZA 4A0GA 2V3CC 2Q3FA 5BWMA 1ANKA 1XEXB 4ZPXA 5E95A 4RCZA 1ZJ6A 3S1AB 1MABB 3LFUA 4RFSA 4JLJA 3ND9A 3KKNA 3K70B 2QA5A 1COWA 3GLFE 3BORA 2OCBA 3N2EA 4LZZA 5FBQB 3SQWA 4D6PA 1FP6A 3R9WA 3I92A 3F3YA 3VR4A 4DZZA 2H1LA 1KO8A 4LPKA 1CLUA 1N0UA 4LC1A 1XNJA 3L8ZA 5FTJA 4GMDA 3MG9A 5ELXA 2ZRBA 4D0NA 2J9RA 3VX3A 1IHUA 5JEDA 3EZFA 1NMYA 3ZQ6A 1FZQA 2FSFA 1VTKA 3X1DA 1NL3A 1GRQA 3C5CA 2IHYA 2NIPA 3QG1A 3CNOA 3K0FA 3QJYA 1FX0B 4PC6A 3I8SA 4EAQA 4BGDA 2ZJZA 3TUJC 4GBMA 1GNRA 4OL0A 5HE9A 721PA 5C18A 4P4SA 2JJ2D 2CE2X 4H1VA 4HZIA 2BBTA 4PPGA 3A1VA 1N6IA 4Q7KA 5FUVA 3TUZC 2EWVA 2OESA 2YWGA 2WTUA 1JR3A 1MKYA 3DKPA 1L7VC 3PFIA 3ZVRA 3R7WB 3VR6A 3QY0A 2QENA 1E4VA 5E7MA 2VF7A 3VU9A 4DCNA 1IM2A 2GK7A 4IHQA 2UZ3A 3L0IB 1ZU5A 1MRNA 1OKKA 4DLWA 4EPYA 3RC8A 1BS1A 3IGFA 2QPAA 2XNSA 4NYJR 3X2SA 1N6HA 2VHTA 3KQNA 5DISB 1WF3A 2JIZA 3KB2A 3DDCA 4BLRA 1DAGA 3OE7A 4PX9A 3D31A 2ASEA 2Q3MA 2FWRA 5FOSA 2OEPA 4PAMA 4QBGB 4RD3A 5EZ5A 3B9QA 2ODNA 3CH4B 4O2RA 3LXXA 2RGCA 3GLFB 4OI0A 3TW4A 1DARA 3H86A 2BDTA 4NTZA 3VKGA 1KAGA 2GZAA 4FWIB 1W49A 4IDNA 5DHAA 3WXMA 2JA1A 1R5OA 4F92B 2W6JD 4MDFA 4K46A 1RYFA 1ZUHA 2RAPA 2BMJA 3GJXC 2IXFA 4B2IA 3GLIE 3I8XA 3TNFA 2OLJA 4G3XA 4OHYA 3OEEA 2CHVA 3FKSA 1S1CA 2B7CA 2XTZA 1QHXA 4BECA 3KQHA 3EPLA 1RFLA 4V03A 1KI4A 5FBLB 3SJCA 1E1QD 1JJVA 4M9ZA 4PC3A 3QPVA 4G5GA 1TF2A 3I1FA 1G4UR 1RIFA 2G1JA 4A0HA 4BFZA 4AURA 3IUYA 1E2PA 5FUXA 3MMPA 1H8EA 1KHTA 5KDLA 2QQ0A 4FD2A 2NO0A 1ZNZA 3QPUA 5J4YA 3B1VA 2XXAA 1RW4A 5DNYB 2UKDA 4L9WA 2Z4RA 1R0XA 2O0KA 3WNBA 3K9LA 3B5JA 5TARA 4ASUA 2V1UA 4RJLA 4PC1A 3NXSA 4PO9A 4B48A 2JLZA 5JLJA 1NN3A 4U02A 4WBSA 1OH7A 2ZANA 3QNUA 3C5HA 4BFYA 1M7BA 4DHEA 1NKSA 3KKPA 2IYUA 1KK1A 1L4YA 1GUAA 1RJ9A 1DAMA 1YZKA 2Q3HA 1W0JA 2ZRPA 3PVSA 4B71A 5AR1A 1XZPA 1OIXA 3VMFA 1JQJC 2X2EA 4LBYA 5C4GB 3T1OA 4V0NA 1E2QA 4DDUA 2QG6A 4QGHA 3QKTA 4HAUA 4DLSA 2HLDD 2QP4A 1Z6TA 1IXZA 4BASA 4IXNA 5CM9C 4B74A 3FVQA 1WMSA 2CDNA 3GJ4A 3OHMA 2ZRDA 1UAAA 3ADDA 3FB4A 4ARZA 2RCNA 3GLIB 1E1RA 4D4MA 2J46A 2OM2A 1SXJC 2DBYA 1YR8A 2VSFA 3X1YA 1W44A 5FUYA 4HUTA 4UNNA 1EWRA 4HI0E 2IYVA 5KPDA 2A78A 4B3BA 5JI2E 3EIEA 3CW2A 2FFQA 3MCAA 3B82A 3UMSA 3BERA 2WAXA 2MMGA 3DHWC 2OBMA 4MYCA 1F2TB 2MSDB 1ZNWA 2ZR0A 3DMNA 1K8RA 2NQ2C 4UQOA 2WWXA 4TMXA 5JJLA 1ZD1A 2GXUA 1H8HA 2ZE5A 3GEEA 1Q22A 3BFXA 2D2FA 5AUPB 4M53A 1R7RA 2KB0A 3CRVA 2C99A 5SZJA 4LYJA 3K9HA 5GJVC 2OXRA 4DLRA 2GWHA 2NZJA 3PEVA 3PUZA 4EFNA 5D3MA 3ZZTA 4C0JA 1UKYA 1ZW6A 2P6NA 4NPHA 2ONJA 1G7CA 4TT3D 2BCJQ 1Z0DA 4Q4AB 4B3DA 5DI3A 2YWEA 4KFUA 1J90A 2FZLA 3DL0A 3JVUA 1E0KA 1SXJB 4KV9A 4HDQB 5KDDA 3AKCA 1KAOA 1A4RA 1T9HA 1XX6A 1ZINA 1EFRD 1E4YA 1TL7C 2ZS7A 3IEUA 2W00A 4WOPA 4HEJA 3LDAA 1B0UA 3L0SA 5GVRA 2WVJA 5JCPA 3U3MA 2VP4A 1SVKA 3RAPR 2AFHE 2VA8A 5UKDA 3EPHA 1R10A 3C8UA 5AWFC 2FMXA 4WZAE 2ZU6A 1A7JA 2CLCX 5DYGA 1P72A 2GDJA 2BJVA 4Q00A 2WMNB 3CLVA 4LK2A 1QRAA 4QBFA 1E2MA 4CGZA 4Z51A 1M8PA 4YQFA 3RABA 1N2CE 2Q9AA 2D06A 1R0ZA 3ND8A 4PSKA 4Z1MA 1LB1B 3L82B 4ACBA 2JLRA 3J81k 4KSBA 1KSFX 1NLFA 1KDTA 3M0EA 4PQRA 4TLDA 3RRYA 5C46F 1NF3A 4IEEA 4L8GA 1U94A 3QI2A 3KKQA 4M1YA 4Q21A 3UXMA 3E1SA 2F9LA 4XOIA 3DM9B 1OFTA 3ADBA 1P73A 1TQ4A 4OHZA 3VNUA 3U3RA 2RGDA 1JR3E 2GCNA 2Q9BA 521PA 1GNQA 2ZRJA 1D6JA 5K8IA 4D2IA 4JJZA 3RNLA 3PEWA 2W6ID 2KJQA 3IDQA 2G88A 3W6NA 3R8CA 3I4LA 3QSYA 4HDCA 5LBIA 4WAUA 2FN4A 2NTYC 2QNRA 4A6PA 2RGGA 1T3SA 1U9IA 2IS6A 3SN6A 3HU2A 1KJWA 2NO9A 3W5IA 1NI3A 3QUSA 3ZVNA 4KAXA 2O52A 4YDSA 4QNMA 2QMEA 5DN6D 3KUDA 1J8YF 1UM8A 4D4LA 4RFSB 4NL4H 2JEOA 5GJBA 4QBIA 1TPZA 1UBEA 2I1QA 4TZ6A 4YMUA 5EP3A 5CK5A 1M34E 2XOKA 5CJ2A 4B2LA 1VECA 5GJCA 1NLZA 1JXOA 1IY1A 2X2FA 2H18A 3B2EA 1AIPA 4Q66C 4Z8XA 4UKDA 1LV7A 2BMFA 1T8UA 3UMRA 3G0HA 4ON9A 4WZ6A 5TMPA 3MWYW 4Q9HA 1QHNA 4G5SA 1L4UA 1LW7A 3I3SR 3K0FB 5DI9A 5J5CA 2EVWX 3R8FA 2PJRA 3ZIAA 4A1FA 1SQ5A 2A5JA 2JLUA 4B73A 4P4SB 2ZIAA 1SKQA 1OHHA 2RKOA 4KYIB 2EWWA 4LHXA 4O0MA 4FN5A 4JKYA 4MGZR 4IFBA 4D82A 4DVGA 3VKHA 4BE7B 5F98A 1G5TA 4JSTA 3TJZA 1NBME 4I81A 4LOAA 3MLEA 1FMJA 3B9PA 4FMDB 4R71A 1P75A 2ZUBA 4QG7A 3C14C 1DS6A 1F48A 3K8YA 1KO7A 4E5UA 1TF7A 1ZU4A 3T5DA 1RVDA 1YZLA 1S96A 4IOKA 1WDTA 2Z4SA 2ZS8A 1GTVA 2QM7A 5AJVB 1E0JA 1RC8A 4C0BA 2N46A 1NRJB 2JGNA 4NH0A 2CEAA 1BH2A 3QXJA 2I3BA 1C4OA 1G19A 2PEZA 3P4XA 1K6MA 1NBMD 2GKSA 3U61B 2ZRMA 3A1WA 4DLTA 4W5JA 2ZAMA 4LHZA 2QTVB 1OLOA 2ZRAA 4IXMA 4A6XA 1JECA 2PT7A 1KI7A 4CF7A 1XJCA 1TAGA 1VYUA 5HR5A 1DG3A 2JCSA 1D2MA 3LVQE 1CEEA 2ZJOA 1G6OA 3OAAD 4QJ4A 4ZIRA 2FSHA 3CRRA 2ANBA 3EARA 3V4FA 2BWJA 4KCGA 3U4QA 4NCIA 4GOKA 4A2WA 2JJ1D 4CEJB 4C0SA 2ZYUX 5B58C 1OPXA 2ZRIA 2EFEB 5FBRB 1ZM4A 2ODEA 2ZSDA 4B32A 4DDTA 4DDWA 1S0UA 5E7IA 4XWKA 1AGRA 2XXAB 1LFDB 1TU3A 2C2HA 2DWQA 1AS2A 4TL7A 5H1YA 1PJRA 1IN4A 2GAAA 3BXZA 3W6OA 2DCUA 4LV6A 4DLVA 2FU5C 1Z6YA 3G5UA 3S1AA 3TQFA 2NO7A 4HAXA 3CPEA 2J1LA 4MDEA 3FHTA 1SULA 4UJ5A 1YZQA 5SZIA 1JJ7A 1S8FA 4OHWA 2IYYA 1RJ9B 1Z29A 4X8LA 1P2VA 4DBLC 1GM5A 1E2HA 5KU1A 1KJZA 2GA8A 3SDZA 1QG4A 3TQCA 3TBKA 1DPFA 5GVSA 1NN5A 2WJJA 3UK6A 3ASZA 3B1ZA 2R65A 3VTKA 2F3RA 2F6RA 5DHFA 3VHXA 2EFCB 2ODBA 3DO6A 1KO1A 3WYAA 2LCFA 2OAP1 1U8AA 3NC0C 4JYBA 4RD6A 4X8MA 3A4NA 4ARZB 4CW7A 3TSOA 4Q47A 4IOLA 2AL7A 2KI5A 2PL3A 3LAWA 3LLUA 4KVAA 2BBOA 4OKSA 1DAEA 4UNSA 3SE0A 2V4ZA 4AIIA 1OB5A 3D8BA 2IX3A 1TTTA 4UNQA 4XWAA 2QY9A 2C03A 5JBQA 1R8SA 4NKRA 2YC2C 4HB4A 1WP9A 1FQKA 4TLCA 1W36B 1K5GA 1KGDA 4NYIR 1J7KA 2IUUA 2LKCA 2AK2A 1VG8A 4OQLA 1TUIA 4M9SA 1TUEA 2BMEA 3KJHA 4LCBA 4NCJA 4M1OA 3UG6A 4A92A 4DDVA 4HLQB 2HXYA 3RYTC 2QEQA 1E2JA 3QOFA 2V6IA 4ZKDA 1G8HA 1KI9A 2J0QA 4PPQA 1CR4A 3B85A 421PA 2VO1A 4M1MA 5D3MB 2BVNA 1EFTA 2PJZA 3NVAA 5FR2A 4Z8YA 2JJ2A 1P2UA 3IPYA 5FI1B 4MH0R 2CHQA 5DI3B 3SC3A 1XMVA 1SKYE 4NCKA 3ZH9B 4Q19A 2G9NA 3WNCA 1S9DA 1DG1G 4Q7JB 3O8RA 1OYWA 2NPIA 3KJIA 1WBBA 2OSBA 1ZM9A 3H0KA 3WBKA 1OFHA 4HAYA 3WP0A 2V7QD 4XSHA 1XD2A 4CDGA 5H70A 1Z83A 1KKMA 3A1SA 3WNDA 4ZCIA 2C98A 2GILA 1UDXA 3T34A 5LD2C 3FPAA 1XDBA 3TIFA 1CF4A 3GLHE 3H2YA 4TYWA 4FCVA 1HE1C 1G3UA 2R9VA 3FGNA 1PVOA 3FDIA 3GJ3A 1X86B 1NIPA 2LWIA 3NH9A 1R5BA 3N2IA 4JSYA 2J5XA 3UATA 1I4DD 4NDZA 3LX8A 2W6JA 3MD0A 4FCTA 4DUGD 1VCOA 1XJ0A 4MRRA 4BEJA 3SJAA 4HAVA 1VDZA 2FPKA 1C1YA 4TN1A 1EESA 1ZYUA 2ORWA 1GDDA 4GOXA 4EFMA 5DGXA 3DVLA 1SVSA 4X8OA 4URWR 4D80A 1BYIA 2ZJBA 2OAQ1 5J47A 3LLMA 1E1QA 3WMEA 4I1SA 2F9MA 4TYYA 5E7JA 2QP9X 4D4JA 1U8ZA 2I4IA 3WMFA 5CIWA 3FOZA 2DB3A 1E9AA 2FV8A 3ECCA 1J70A 4AY2A 5LD2B 1G7TA 1RKBA 1SKYB 4LSGA 2KE5A 3CRW1 3RSLA 3C4JA 3KFXA 4P4TA 3CF2A 4LY6A 1P2SA 4MA4A 3GJ7A 1VMAA 3JZMA 1TF5A 4Q9KA 4B6EA 3VR1A 4LYHA 2MSCB 1Z06A 2OCPA 1F2UA 4C9BA 4K81B 1T5LA 2PCJA 5FPYA 1I2MA 2F3TA 1OXUA 4FWTA 1XTKA 4A4DA 4DSNA 3K0AA 2IUSA 3LY5A 4KLZA 4AKEA 1D2NA 2Z43A 2YOFA 1E9DA 3LQQA 3GLHB 4KBGA 4TTPA 5TVKA 1CJKC 5EXSA 2VHUA 4PAQA 1X6VA 1JAIA 3CF0A 3MRSA 1P9WA 4EDHA 1YZUA 4ZO4A 4JT4A 1I4LD 2C9CA 4KVGA 1W7AA 3PIRA 1W1WA 1E32A 1NVVR 2HLDA 3TVTA 2DFTA 3K0SA 3W3AA 1XP8A 2FJUA 2ZITA 5JEEA 4M2LA 2HT1A 2XJ4A 3DEFA 2OUKA 3BD9A 5EUQB 2WV9A 4PXAA 4C7OA 1HA3A 2HV8A 2IF0A 1R2QA 1IXRC 4MRSA 5AJWA 3GLGA 1U0JA 4LYFA 2REXB 1KI2A 4QRHA 4A0RA 2PH1A 1XTRA 4QL3A 1AZTA 1Z0IA 2R6FA 3T06B 3A58B 3QE0A 2YHSA 4AYTA 5KSYA 2BM0A 3B8HA 2OZEA 2XJ9A 2Z0MA 4IVPA 1FMLA 3TE6A 2VRWA 2OO7A 2OFOA 1XU4A 3AB3A 3ZGXA 5TV2A 2WJHA 4WIAA 3THXA 5JHHB 3QPWA 1F6BA 3TRFA 1CRPA 4AYXA 4PZYA 2OE2A 3ZZ0A 1FTNA 3AM1A 1KDOA 3PXGA 5TY0A 3ZD7A 3NKVA 4X8HA 4PZZA 1XTQA 1HH4A 2QRZA 3SEAA 2FFBA 3E5HA 4BLOA 4TT3A 2BM1A 2VP5A 4DIEA 2O0JA 4WVFA 2ZRCA 4V0LA 1E2LA 1KK0A 1EFUA 1KI8A 3HDTA 4XVQA 3K70C 1R0YA 3I5YA 2QBYA 4GDFA 4B43A 1EFRA 2V9PA 5CIQA 2KBFA 2J7PD 5E3HA 4EPWA 2X77A 3LV8A 1ZCAA 2ZI3A 3NBFA 2OLKA 4MKGA 3SYNA 3SR0A 3QBTA 3Q5EA 1WQ1R 3RHFA 1G4AE 2AWOA 4ZIRB 4DCTA 1Z0AA 2FE4A 3T61A 1Z6GA 3U4QB 3WHLA 4EIWA 3LW7A 5JWOA 1S9HA 1DAIA 2OXCA 2J87A 4B34A 3C16C 1Q3HA 4MGIR 5DLQC 2ZJAA 2V8OA 1VCMA 2CCJA 2RMKA 2JATA 3ZDQA 1YE8A 3QQ5A 3KKOA 1WRBA 4G1UC 4NHOA 5DO9A 1UKVY 3EIQA 1GVNB 4POAA 5J4LA 3B13B 1Z63A 1NLYA 1GL7A 1LS1A 2FG5A 2P0EA 1TQDA 1E0SA 3A6PC 3WBJA 2F7SA 5F2EA 5A0FA 3D7MA 2IYWA 4G01B 4JJKA 2XB2A 4D0GA 2A5FA 4D0LB 2W6IA 1ZD9A 4BFXA 2R8RA 1PLJA 1V43A 1E9CA 3A37A 3THYA 2P6UA 2OG2A 1P61B 3I5XA 2Z5FA 4PO1A 1T6NA 1DADA 1ZBDA 4IRUB 1Z8FA 3EW9A 2XSZA 4C2TA 5DN6A 4PSAA 4URYR 4RD0A 1ZMXA 3VHLB 5JWHA 1Z2AA 2RH5A 1O3YA 4I4LA 1ZIPA 4OQMA 4IDOA 4FW9A 3ZVLA 4PC7A 4B44A 2L0XA 1G8FA 4CYMA 5C4MA 3LBHA 5GJWC 1FW6A 4C30A 4ZCMA 3FYHA 4BLTA 1K5DA 2AR7A 1FNMA 2C77A 3EG5A 3KJEA 6Q21A 4M9QA 1XMIA 1VIYA 4W9MC 2HCBA 3EPJA 1D2EA 1BKDR 2GEVA 1TADA 2OT3B 1AA9A 1P62B 1T0JB 3TAHA 2J41A 1G5PA 4NONA 1L2TA 2B7BA 4II7A 4MYHA 1KIMA 2IW3A 1X1RA 4R98A 2NPFA 2J0VA 4I1VA 1L8QA 5JHGB 2Q21A 3L43A 2C96A 3EIHA 3WHKA 4UXIA 4F38A 3M6AA 4GFDA 4RZXA 2ZRLA 4DSOA 1UDWA 4PANA 5FTNA 1U0LA 3RRNA 2X19A 1VYTA 1GIAA 2Q9CA 3KKMA 1XD2B 4N0DA 5KOYA 1T3LA 3TK1A 2IYLD 1JBKA 2ZS9A 2WJVA 4L9SA 1IN8A 1ZNYA 4ESVA 1GITA 1CXZA 1GZSA 1KSJA 4JLAA 4LBVA 4CEJA 4P0TA 4RSGA 1DTSA 4W7SA 1G20E 2FSGA 3RS2A 3SFZA 5FOXA 3TR5A 1YZGA 3ICQB 3LQRA 2GCPA 4NU0A 2GRJA 5FOVA 1NBMA 2WHXA 3IQXA 4CT5A 1HEIA 4GPTA 4QJ3A 2AN9A 1N0VC 4PPNA 3FMOB 4L16A 2ONKA 1W2GA 3AVOA 4EJSA 2RGEA 4RZUA 2CNWD 3KXLA 4E22A 2WOOA 1XCPA 2CL0X 2PZFA 4TTQA 3GLGE 1Q1ZA 3OAAA 3KJGA 1WBDA 1ZIOA 2QPOA 1BMFD 3K1JA 4GMXA 4YMWA 3SJBA 4B2PA 1PZNA 1ONBA 5EQTA 1JPNA 1QHHA 4EPRA 4GP7A 2ANCA 3HR8A 4NP6A 3T5GA 1Y3AA 1OF1A 3FWYA 3TSZA 4KFTA 3MGCA 2PEYA 4U5XA 1E79D 2AXNA 2BC9A 2G1KA 3EXAA 2J7KA 4IDHA 3AF4A 1F2UB 4FI3C 2RGXA 2WSMA 3AF0A 2MMCA 2ZI9A 2QN6A 3HP1A 4URVR 1E9FA 1JXMA 3K0AB 3UKDA 5FH9A 1QHIA 1EXMA 1OXTA 2B92A 2WWYA 2ZROA 1FNNA 2RGNA 3BOSA 5HKKD 2GZHA 4B33A 4JLOA 2EQBA 2CCKA 1KOFA 1UEJA 4FMCB 3VAAA 4QFMA 1Z07A 4M4SA 1FQJA 3W90A 2ZSFA 5AK0A 2I1VB 4FMBB 2JDID 4JVMA 4IJMA 5FPKA 3VQTA 2GHIA 1MT0A 1NN0A 5CLQA 2ZJ2A 1GL9B 4OHVA 1QBKC 4PFSA 4C7OB 2KBEA 1SXJD 2VPPA 3GLGB 2ZE6A 4LUCA 2ZPTX 4HB3A 1YRAA 1KMQA 1U8YA 3P26A 3THOA 2EFGA 2NG1A 3ZJYA 2IYQA 4LHVA 4AG5A 1M7HA 2G3YA 2IYTA 4MUAA 1KNQA 1MO6A 3FMPB 4PO8A 1S2MA 3QVUA 3U7GA 1EX6A 3THXB 3SHFA 1AKEA 3U6BA 1T4GA 2VEDA 4BLSA 4FCWA 3CX8A 4OJQA
chains in the Genus database with same CATH superfamily
1T6ZA 2DR2A 2V0GA 2C7VA 2QE7A 1NZFA 2WZQA 4YRPA 1EFKA 2I2AA 1BH6A 5CW1A 3IB3A 3HVKA 1N2IA 1G41A 2OHIA 2D2EA 4MMYB 1QIJA 3DQZA 3T5BA 1XDUA 5AT1A 1AB6A 3MUFA 1QNFA 1Y5IA 3G02A 5DNUA 3TF5A 4N65A 2PV0A 2C97A 3WR5A 4HNVA 4FGUA 4TGLA 1C7RA 3T12A 3V34A 4EMBA 1N5KA 4MQBA 3HNPA 2EBUA 2H11A 4KDEA 4GIBA 4TMKA 1B8VA 2BZSA 2BGMA 1LC0A 3GUUA 3RDPA 1KOGA 4AK9A 4HLUA 1ZM2A 4BP3A 2W2TA 2YQ5A 2Z6UA 1L4GA 1L8LA 3WL6A 1P1FA 3F74A 4LKOA 3RANA 5CXSA 4DREA 5DIZA 1B8OA 4N6OA 1ZGJA 2H4XA 4M1TA 5HJ2A 3V1KA 1ZN2A 3REFA 3K05A 5A4MS 1V45E 1SKUA 2QRVB 4UAVA 5CCBA 4UFOA 3GHYA 3QKIA 5ICSA 4F4HA 2HO5A 1DV2A 2BRUA 2H2AA 3LDFA 4YIHA 4AT1A 1U4NA 2PUJA 2YZMA 4X5OA 1PFWA 4XH9B 2Q5IA 1QWOA 3DE6X 5FD8A 2HK8A 1ADYA 2D62A 3VZCA 3WAKA 4ETWA 1C7JA 3D2LA 2VNHA 3CY6A 3MJHA 3LCVB 4V38A 3CBGA 5I8PA 3ICOA 3QTLA 2O1XA 4I55A 1J2JA 1GD1O 1ZI9A 4AF8A 1XQ1A 4FGJA 4Q1AA 2WVGA 2BGIA 3DOJA 1RJWA 2GVNA 3QK7A 2QN3A 4G4SP 2LCQA 5IUNC 4AD8A 1PRYA 2DFNA 2AX4A 2O8DA 4G4JA 4AP5A 1ELOA 3ABZA 4RVCA 3CVYA 1CULC 4E2FA 3AR9A 3USZA 3UJ8A 3HI4A 3SBOA 1C14A 1JQLB 3L7LA 3T35A 2C57A 1HZZA 2Q4DA 3O6VA 4YWHA 1NW7A 1GTG1 1NMSA 2G6TA 3SXPA 4C7MA 2IU3A 1RBYA 1W5FA 4DSZA 4UUQA 2HF9A 4MRPA 2EJBA 4N3BA 4F72A 2F4VB 1X70A 1V3TA 1BEZA 1KGSA 2VK8A 4X91A 1XGKA 4I19A 4ZAGA 5IVKA 2GTHA 3OQBA 1CY1A 2DPHA 4RM2A 4KWHA 4UARA 5FFNA 1XHEA 3B3FA 2ZETA 1L5SA 1LU9A 4BPBA 2REQA 4LGVA 3TINA 4YRAA 3K20A 5ICMA 1DI0A 1RYZA 3IKVA 2JVIA 4CXMA 1UF9A 1QLWA 4ZEXA 3K9GA 2GYVA 1SD5A 3AEQA 3DPIA 1EVJA 3LSYA 1FDVA 4J0FA 4QRDA 5H9VA 1CETA 5IZCA 2W98A 1DBQA 3THWA 3PNPA 3QMMA 4HRXA 4IF4A 5BO5A 5I4CA 3Q0EA 2I76A 1C0EA 1MX1A 4XUEA 4YQEA 4YMLA 3UAGA 1RE0A 5BSEA 2WA2A 5L51A 4LY3A 1ZD2P 2CJWA 2X8JB 3TOXA 1HEYA 3ZG6A 2PH7A 3AP2A 3LP5A 5EWLB 3WB9A 1O2DA 1X8JA 2NO1A 3B51X 3FWNA 2ZYGA 4RK4A 5BN5A 2BDUA 2ZAYA 4YAIA 2C04A 1NG9A 3PDJA 5I4IA 2UUAB 1GKIA 2O19A 4B0PA 4H6WA 5AVKA 1N5IA 4XW2A 3LBNA 3NWJA 1U0GA 3S4YA 2WHPA 3KEQA 4Z4GA 3DKVA 4I8DA 3RIYA 4BZPA 4TQGA 4WLUA 2CXHA 2WT4A 1X1EA 3IAS6 1H5QA 1T0HB 4AWXA 1DC3A 1KIFA 1ZP6A 4KQ6A 1MHPA 3NIDB 2DH5A 1JSZA 1ZAYA 1QDEA 3RK4A 3L2OB 1JH9A 4V1CI 2V59A 1NULA 1VE6A 2A3RA 1X1CA 3L0PA 1N0IA 3P1JA 3VJMA 1OB2A 1J0EA 5ICCA 5KWVA 3H19A 2ZRHA 4E6EA 4E70A 5DXFA 4J4TA 3HWRA 2MINB 1XA4A 3AONB 1XMSA 3R4VA 4Q7LA 4TKZA 2YL2A 4FX2A 2CDBA 4F7DA 3ACCA 3EZLA 2PS9A 3I52A 5EIEA 3T1QA 2Q7XA 3BQMB 1M66A 4B82A 5FFFA 1KJ9A 2JGEA 5IF9A 2HNAA 3IUJA 1FW8A 4PC2A 5AKLA 4F06A 3HKBA 3QKUA 4GX2A 1GARA 2IV7A 4RC9A 2G83A 4O4HB 1JWAB 3MMZA 5C0OE 5BN4A 1ULAA 1UWVA 4JCCA 4A0SA 2PPLA 5K6AA 3R3XA 5FNVA 1XFAA 4YAOA 3LLCA 3ZWBA 5ECWA 2J7PA 5K05A 4GLOA 1QU3A 2B8WA 2P4QA 2H7XA 2QIPA 3FJYA 4OGGA 5M2QA 3IOCA 4IQ0A 1G8KA 4I4TA 5HGXA 3IL2A 2HQSA 3GARA 4M8LA 3JQDA 4TKUA 3TIGA 3P8ZA 5JO0A 4KXMA 2H7VA 4NK4A 2Z83A 2BP7B 4ZCRA 4Q4JA 2GQ0A 3UY4A 1A8UA 1T34A 3OE5A 1E0AA 4N18A 3IILA 4NENA 1ZNQO 1YSCA 2G9UA 3L49A 1XDWA 3OWOA 2A58A 1JVSA 2R84A 1IUNA 4QXPA 4WXEA 4YT2A 5GOZA 1WR8A 1AQUA 3CKMA 3M4JA 3IO3A 1N3LA 2QUJA 5C8YB 1YMQA 4AS3A 2A0XA 5ITSA 3D2BA 2FPMA 2YY7A 2C9OA 2XXJA 4JVLA 2HHLA 2HWKA 5JXGA 5KX5B 4N0EA 1MJNA 1R6TA 1Z39A 2Y8EA 1Y4UA 5JSUA 3ZLTA 3DDOA 5FFMA 3ZCSA 2NTNA 1QIIA 5JMTA 1VL2A 3AHFA 5CT9A 4DWWA 4K88A 3CUEF 4JL6A 4FB4A 4B5LA 2EJWA 5HA5A 2QJFA 4Z49A 3LBIA 4OYHA 3FJOA 5AUOB 2XDAA 1AJEA 2GXQA 4ND8A 4R3WA 5JCZA 2QD2A 3OM8A 4JT2A 3EYWA 3L8CA 2GNOA 1EVYA 3MWJA 2MWMA 2V7VA 4RSRA 1S2GA 2GN4A 4ZMBA 3SYRA 5M04A 1NQ5A 2H4YA 4DF3A 3SVTA 1GILA 4NX2A 5TGTA 1YMUA 4XGIA 5HMLA 1LTQA 4J1SA 4LDJA 1E6WA 2CE7A 3G2NA 4GMFA 3OQOA 2WU1A 1AKMA 1EWYA 4XB1A 4RTJA 2H16A 2WAYA 4FYIA 4O1HA 4QOGA 3A3NA 3JQ8A 4Z99A 2HQ1A 3D6AA 3DSRA 4HLUC 4KWCA 5A04A 3I61A 5EIOA 4QDZA 1FYFA 1BO6A 2AUTA 2E5FA 3GRUA 1KF0A 3IPLA 1TCCA 3WJAA 5KNBD 2V97A 1C7QA 1XLUA 1GSAA 4RHEA 2WIDA 5CFQA 2XT0A 2ZYHA 2AUNA 3MINA 1BFDA 4RNDB 4WZZA 3DONA 5K0TA 4AKTA 2BRUC 1IG0A 4X1KA 3GP8A 4QDJA 3W1WA 2I67A 2Z2KA 3HB1A 2PXHA 4TM7A 3U4AA 2O5CA 1OBOA 4IH4A 3CTMA 3BH0A 2JFFA 4WXPA 2HREA 4ZO6A 1AQLA 4Z1MD 3ZE8A 1IFXA 3EGWA 4K6MA 1YVUA 4WOBA 1DDOA 2P2LA 2XOEA 5ALXA 2FR1A 1E20A 3UJDA 2P9FA 5IM5A 4EFDA 1AQNA 5D2CA 2A67A 4Y2QA 3UPUA 1E1CA 4WW0A 4ZOLB 4DMGA 5F9MA 5K8JB 1Q7EA 3CZ9A 5MFPA 2IZZA 1D9XA 1HYBA 1E8MA 1UPTA 1KH3A 1WMEA 3CA8A 4LXQA 4PQGA 3V5NA 5JD6A 4MVYA 1HTWA 1DWOA 2HJRA 2J9GA 1W47A 5EJ2A 2DVMA 3C3JA 3M5CA 4WKOA 5LMZA 1U3CA 1HZZC 1XQXA 4L07A 4R2HA 1QYWA 4XD7D 5C1BA 1KFKB 2HR1A 821PA 1EZ1A 1SCBA 4NYJQ 1YF3A 2HPHA 4GSLA 4R0MA 1M8GA 4LOLA 3RKUA 4IF6A 2LDBA 1PQ4A 2R7MA 3DXZA 1IZYA 4MTLA 4PRLA 4BQFA 3KFVA 2R0QC 3LYUA 2FTKE 1TJ3A 4X90A 5FTWA 4BZQA 5EJ7A 4J3NA 1E7YA 3SXUB 1EFDN 4RQUA 3TQHA 1SU7A 4H60A 1Z0SA 2XD9A 2J4DA 4Y18A 3DP7A 4HN2A 1BX0A 3H5WA 4P1ZA 4W5HA 5JJCA 2EP8A 3RUAA 1JHQA 2REOA 4FGWA 3ZD8A 1I2AA 3JU3A 3KBOA 4AYWA 5BT8A 1JAHA 2RSLA 4UNPA 3EA0A 3L0DA 4HX9A 3RBAA 3B6EA 2GWRA 5IZCC 4YJFA 1A2KC 5FLEX 2CUNA 4S1VA 4MS4A 4JI0B 1VG9B 5LN1A 1I01A 4JVOA 6YASA 1HNWB 4Y1RB 3CB2A 1W4LA 1FF9A 1KYXA 3E7PA 2D8AA 1C3LA 2GK4A 2V9ZA 4MYSA 2XGJA 4PVDA 2NV6A 1N2GA 2XQVA 3C0KA 1JHMA 4E94A 1G8GA 2G7ZA 2Q0SA 4JZKA 5EWMA 3G1TA 3Q8MA 2F1IA 4ZODA 2X7HA 2P2CA 1KR2A 5LA6A 4U63A 2EGUA 5E4JA 1G8MA 1G20A 3KYBA 3T6KA 1ZCJA 4BMSA 2P4HX 1W2WB 4Q9IA 2LPMA 1AS0A 1TMYA 3UT0A 1RRVA 4D3DA 4G41A 3OG9A 3PUHA 4IDGA 1T3ZA 5DCUA 1GTRA 1BN7A 3CC8A 4QDXA 3V97A 2NYUA 3G9TA 2XWSA 1MB3A 2JLBA 1UEXC 1YQ9A 5ULLA 4EGQA 3HQ4O 3JCZA 3ECAA 3EY9A 2A9RA 1Y82A 1XXLA 3QLVA 3HM9A 1SC3A 4PPFA 4TLMB 5B6IA 3LO5A 4FHZA 4HAZA 3SQLA 2B34A 4N39A 2HI0A 3WOHA 1N7GA 1Z22A 3ESAA 3D8SA 1ZGGA 3RTBA 4DAEA 4QTYA 2WG1A 3MGGA 2GETA 1JB1A 2V0NA 4J0JA 1ENPA 2Q6TA 3BIWA 4U2EA 3OPVA 1DC4A 5E2AA 4QJ5A 4XJVA 4D3YA 4AJHA 5HKKA 4MQEB 4TKLA 4EO9A 3DEZA 1C1HA 2IE0A 3PQFA 2AQ8A 5G40A 2FEMA 5CEJA 4PR0A 3G9XA 1PBNA 3UFXB 1F4VA 3GZTB 3PHBE 4LDPA 4EUNA 3P5BA 4YT4A 1NVWQ 3SZRA 1VKNA 3EEBA 2CBGA 1NSTA 1GFIA 5DX1A 1CP3A 1UJMA 2CXSA 2HLHA 3R0ZA 5FRDA 4F84A 1RMQA 2AJ8A 3EAQA 2VR1A 1RI4A 4RO0A 3VI4B 3K8QA 3HFJA 4JJ8A 4A7PA 1N25A 2B61A 2HRBA 4WCDA 5KCMA 3RS4A 2EEPA 4C1NA 4LSMA 5DHPA 1E9RA 1V4VA 1WDWB 4GZMA 3WTCA 4KK3A 3K0CA 1QP8A 2PSDA 2W0MA 3E5MA 4H3VA 4JQOA 2AZ4A 5AUNB 2L69A 2WSLA 2IYOA 4L3OA 2VPTA 1PV4A 1UFVA 1SB9A 3IQEA 2NUAA 4P4NA 1RLJA 3RYCB 3H2HA 2GI4A 2VXBA 2AFIE 2W2XA 2Y67A 5JPIA 3AR3A 1H3NA 4URHA 4AUNA 3QF4A 3JTMA 4RWEA 2F64A 4TWJA 2B1GA 1M75A 4OHCA 1UBCA 2WM3A 5LP6F 5IT5A 2NYRA 2CHUA 1VPEA 1OH8A 2RHWA 4WINA 4FP9A 1E6CA 1WA5A 1XTJA 5EPOA 3SOPA 5IAAA 5ITZA 5FBVB 4DL9A 1HI9A 2N9UA 5DHUA 5LB4A 1L9KA 5DEIA 2DBRA 5T6BA 1BNCA 4LXHA 4P7BA 4XQEA 3V8MA 4CIDA 4ZJZA 1XIVA 2J08A 5I9IA 1ILWA 3OFND 5JZMA 2Q50A 5KC9A 3WRWA 3UHPA 5EJ5A 3K70D 1CJUC 2FPPB 1EK2A 1WZEA 2RI6A 5F9HA 4XQCA 5EE3A 1W46A 3QUQA 5CXUA 3RS0A 1FLVA 3FFWA 3AK4A 3RRJA 3FF4A 4KZPA 2P6RA 4C78A 4R9UC 4H4CA 5HFJA 3VR2D 1M1UA 1P60A 2YXNA 4WXRA 5CM2Z 2P69A 4HH1A 5H81A 1WEKA 4Y0NA 3ROGA 4F4JA 1GKUB 1WG8A 2Z6AA 1U1GA 2P9JA 5EPUA 2OV2A 3GQBA 5JO9A 2IY8A 4OGKA 3K1ZA 5EL0A 3W5UA 4AMUA 2WSSA 4ZFNA 4YASA 2VSNA 2A7XA 4NMHA 1D9ZA 4R51A 3JQAA 2QD4A 4HLCA 1F3LA 4LPSA 4ZVMA 5BSRA 4ETNA 5CEEA 3AESA 1TM4E 3HADA 1ZQ1A 2PZMA 4XB6B 3ZDXB 1MRSA 4I99A 4PXSA 4GMGA 4PGFA 4A0FA 3F8TA 3OMXA 5HF9A 1F4PA 2RKWA 5CDFA 3LQ1A 2Y9PB 4NULA 4JLDA 3BG5A 1ESNA 2VPZA 4QDKA 4X1IA 4JI4B 1IWBB 4Q1BA 2ZWAA 3UWSA 5I7VA 2YC4C 3T1VA 3WWDA 2WUFA 2CL7X 2G8NA 1PGQA 3AYZB 4JB0A 2W58A 3N28A 4N47A 4EUSA 1EVKA 4D97A 3W5AA 3H04A 1EM8B 4TMWA 1C8LA 2O8BA 2JL1A 4MROA 1OAKA 1OT5A 2JGRA 3QYAA 1SCQA 2GXAA 1VJCA 2FFJA 2OCAA 1OE0A 2BTQB 1GQ2A 4GLBA 5HJ7A 5J4VA 4NCXA 1H94A 4DB2A 4KUGA 1MO2A 3IPXA 1KDZA 3DYBA 2Q7DA 1F6WA 4LDRA 5EE9A 1CYDA 1J4AA 1AM4D 1P5ZB 4YUZA 3TGPA 1SPXA 3ZU5A 2Z56A 1KVTA 5FORA 3LWNA 1CZNA 1NW6A 2OAGA 5TE9A 4X6UA 1PSWA 3QKSA 1QO0A 4ILEA 1KZHA 3VR5D 5KTRA 1SK9A 3D4PA 1N7IA 3RRXA 2WM9B 4BBAA 4M1KA 4H7JA 4DUYB 1PQUA 1DKMA 2A9JA 4OHKA 2XZTA 4CKCA 2ORIA 4BX0A 4C3OB 3WIUA 3O3NB 3LHSA 1CT9A 2OP0A 3JZAA 4NOLA 4CV1A 1RQLA 4OGWA 3GJ6A 5CX1B 3CX4A 1RQ7A 3G0GA 4TZKA 4CFYA 4Q3CA 4BUJA 1KWGA 2QYSA 4RIIA 2ETVA 2Q8PA 4A8PA 1M1ZA 4GXQA 3BAFA 4DFDA 1GU7A 2YIDA 3CNLA 3IQGX 1PKXA 4NFLA 3I04A 3OMWA 1QQ6A 4FFNA 4YRGA 4D56A 5DTJA 3W2IA 2R4TA 3AFHA 5JECA 1CE8A 3DBOB 3M89A 1HSOA 4QDTA 4ZMSA 4LF9B 3F6EX 1E2GA 1FXSA 1IHOA 3N2KA 2J5KA 3HYNA 4QNRA 1SN7A 4D6YA 4G1EB 1PYOA 8ADHA 4MVXA 4U6QA 3T0IA 3A10A 1W87A 3HXLA 4IL5A 7MHTA 4WNIA 3CKYA 5D3KA 121PA 4JJIA 4DWJA 5C3UA 1XPUA 2GTIA 1CLEA 2ZIGA 3OSUA 5FKJA 1DJNA 1Z6PA 1JVNA 3ED1A 2NO6A 3ZZUA 2V58A 5A3RA 1YB7A 3WQQA 4DLXA 1PK7A 2ZI5A 3DFKA 1ZISA 2X9QA 4Z2YA 2JJ1A 2Q5FA 5CYFA 4M8SA 4E5NA 1I4TD 1W0KA 1OQAA 4YPVA 3VKFA 2P5YA 2WPDA 4G9BA 4L5JA 2BF4A 5D7BA 3VUFA 1WPGA 3WYFA 3BJIC 3BM5A 2DR3A 3TNYA 4EHIA 3LIPA 2JVKA 2QRHA 3DKIA 2I87A 4TMVA 3QFRA 3A27A 4NBLA 3SF0A 2C2ZA 2WWIA 3ZJTA 2O2CA 3Q8XB 1JG3A 2M1XA 2OBNA 3M3HA 1XOIA 1Z45A 2A6PA 2GEBA 3C74A 1PLKA 3A06A 4IWYA 2RGUA 5LB2A 1U7XA 2BGKA 1J2RA 1NQAO 2NAPA 3KZNA 2H7CA 1TM3E 1IPHA 1S8NA 1V26A 3GYBA 3IT1A 5L7WA 2VYCA 4B7ZA 2BR4A 1WZUA 2FW0A 3CW8X 2DHCA 3ZDRA 1TM5E 4LZPA 1U8TA 1Q74A 4WEOA 4AMGA 3OJ0A 5SV2A 1OFUX 4OMFG 4EB0A 5E2IA 2ZXUA 1NVFA 1ONOA 2ICAA 2KYRA 3OD5A 3AL0C 1TZCA 3STHA 3NHKA 3SU8A 4Q0MA 3ZVMA 3G0CA 4G25A 1SUSA 1UM9B 4BNIA 4D3XA 1K7YA 1YC5A 3S2SA 1VBFA 3V6LA 3JV7A 2YV2A 4EF6A 5CP8A 5H3LA 2BEKA 3K0CC 3HJUA 2XNDA 1A77A 1YA8A 3OIGA 3EZ2A 3Q9SA 3CGWA 5NULA 4B3XA 2PLFA 1HG0A 4GOMD 1YJXA 5G4KB 3IV9A 4COKA 5KNCD 2PUVA 3KKEA 5C8XA 3ISTA 4JLBA 5E4TA 3BB1A 3AYXB 4YXWD 1USUA 1QLHA 4L2IA 5TC4A 2RHRA 3O9ZA 3BRWA 1A9PA 2QTAA 3RYHB 5KKAA 1KQNA 3HWSA 2DHEA 1U7DA 3AILA 3CF4G 3L8HA 2PMEA 4E13A 5IAKA 2AD1A 3IAFA 3FYUA 1GZ3A 4OHRA 4ZVUA 5TMDA 5KNLA 3E8SA 2Z8XA 3NTRA 1ONSA 5KYVA 3Q9UA 3V7UA 2YNMA 3EAFA 2Q1UA 4OI4A 2ERYA 4CEIA 5COBA 2G8LA 1KQFA 4MIEA 1YL6A 2IPNA 1G3IA 3BSFA 5AXDA 5A9SB 2UAGA 4UHHA 1KY3A 3HEBA 3AZPA 4O4LF 4RSHA 3T9EA 3TL3A 1SR8A 4TV9A 5TLSA 1V47A 4D26A 2Z2YA 3KXIA 3HJTA 5LPNA 1X0XA 2ZT7A 3T4EA 5KINB 4W5RA 4JYCA 2VCHA 5K7SA 4KBFA 2G71A 3R3SA 2PUHA 4J16A 4ZOLA 2IY7A 4ZOQI 1XCMA 3CONA 4KIGA 3L1VA 4BWFB 4S0XA 4ZYVA 4ZP1A 1JSCA 3LUKA 5BUZA 1NW5A 5MN6A 1E3MA 4MWTA 1NVTA 1W6RA 3A6GA 3F98A 4GXTA 2CK3D 4L22A 2HBQA 4NMWA 1SEVA 2PX2A 3IELA 4RLSA 3UUEA 2I54A 2BMDA 2C3UA 4CU2A 1R6AA 4Z0TA 4FFDA 4AU1A 4CM7A 1JHAA 2D2VA 2V54A 4FKZA 1AKRA 2GASA 3BZUA 4OBXA 2ODWA 5TXGA 2XZDA 1UCFA 4V02A 5AHRA 5DU2A 4HR7A 1Q1EA 4QHSA 3BFKA 4X7MA 3EVZA 2FDXA 10MHA 4EQ6A 2AZTA 4GO1A 4OU5A 5AI0A 2JLQA 3OZSA 1ENZA 1P6UA 2GLXA 4D57A 3MCTA 2D7DA 3MWDA 3UICA 3FOEC 1Z36A 2VOEA 2V6FA 3DWEX 5AI4A 4ZKEA 1L5VA 1YDHA 4MUHA 5H4HA 3NR2A 4LJ8A 1Y1KE 4LOIA 4JY7A 4TVKA 3VZRA 1RP1A 2APJA 4CEHB 3AGPA 1KMHB 4O4JF 5GPBA 4BV2A 3OX4A 2ECKA 1YUNA 3D0QA 3PG5A 4FSXA 3VR4D 3FJ1A 2R1VA 2V03A 3QVWA 4HDMA 4EG5A 2WT8A 2OO3A 2XDQB 1XCBA 3E48A 1SRRA 1A5ZA 3O8QB 4HWOA 4YRSA 3BT7A 4ZTUB 1QH8A 3UVEA 1LNZA 5FTKA 2GZ1A 4EHHA 2VS1A 3FFBA 4D9GA 2DQKA 3MSXA 2H59A 1XD9A 3A1FA 1US8B 3WLJA 4BO8A 4CMEA 1TYZA 2FA9A 4R2JA 4EKYA 5J2TF 2IEZA 2Y3IA 3LBAA 3OCZA 4MDYA 4LV5B 4JI5B 4ABYA 3ZHUA 4BX3A 2ZPUA 3H1GA 3HCAA 1TAUA 5K0ZA 3QOYA 1G6Q1 3A1TA 1W6UA 2Q41A 2NAFA 4LRWA 3EOAI 2AV6A 3OEYA 3TOCA 1EUCB 1WHSA 1MC4A 3ELYA 4IKEA 4I1IA 4GC9A 3BB4A 3EFOB 3IAHA 3OCJA 1KIAA 3QNMA 2OPHA 2A9QA 1WU8A 1F8UA 3B8EA 3QX7A 1CRWG 3FLMA 3GH3A 3CLRD 4FOSA 4JOBA 4W4TA 1OKKD 5EKUA 2M6KA 4UAUA 4M37A 2PE5A 5IYZF 5BWNA 4NZOA 1M6EX 1UXOA 2WI8A 4ALNA 1QKJA 3UV6A 1FK8A 2WG0A 1QH0A 4DT1A 3OE7D 1CS0B 3EVNA 3ORHA 1U2PA 2X1LA 3A3YA 4F4IA 1W5AA 2QYOA 5A1JA 3K9CA 2G80A 4YAUA 1DJPA 2IITA 1U0RA 4NXMB 1MH9A 5K8CA 4BVGA 1PZGA 3PJEA 1DAHA 2XY4A 1Y37A 1RLTA 3AZOA 3I28A 4L4UA 4ZI3A 4Y9SA 2VJCA 3GQVA 3DC7A 3G2LA 5LZ5A 5KOJA 4L4XA 1EXWA 4N3NA 1EE2A 2I8AA 1XTIA 3ABOB 3EWAA 3NH6A 2PX5A 3BGVA 2CJFA 4JGGA 1QKIA 4PGAA 5HJ5A 5CLJA 3HXQA 1B23P 2F1RA 2H48A 4CGYA 3RHSA 5CW2A 2JHAA 3SGLA 5JXIA 3PLRA 2VK1A 3RGGA 1EWQA 1R4NB 1AKTA 1C1XA 1QDLB 3SEQA 1DKLA 4WZBE 3H1TA 4YJ2B 3PJGA 5DNDA 1R5NA 1UJ2A 2J9XB 2V45A 3E5NA 3LRTA 3OEED 1QIKA 3QXHA 3ZCXA 5CITA 1OXVA 3M6UA 3WRXC 1KZGB 2F43A 4Q3NA 2OORA 3WLKX 2DWOA 2HTEA 5K8TA 2LIVA 3U39A 1MOSA 3VJRA 3KT0A 4N0QA 2YS6A 1PJ3A 4ZO9A 4W99A 1DAFA 1UBMS 3NNDA 3L5OA 2REBA 4H16A 4DCMA 4PY2A 4ERNA 5CFLA 1A3CA 3OBIA 4PF1A 4GL2A 5JH7B 3U17A 1S8AA 4PFKA 4MEAA 1SD1A 1S4MA 2XHZA 3VGJA 5KTTA 3BH6A 2ZI7A 2ACEA 4WK4B 4OFZA 4W1PA 3ZZMA 1U98A 1IONA 1JHRA 2XMCA 4K40A 3RSOA 1XCLA 4WFJA 3KT8A 1ML3A 1KY2A 4CL8A 5IU6A 2XVXA 2V74B 3U16A 2GBCA 4DEYA 1SHLA 2OCYC 1N1GA 1G21E 5BOSA 5LQAA 4IQ4A 1XZNA 1D2RA 1WEHA 5NLLA 1M2GA 2BF7A 3K1TA 2JLSA 3MAGA 4DIDA 4OP1A 1UOEA 1HETA 2KS6A 2OCGA 2E4YA 2AZMA 3KZ1E 3KZVA 5M5BA 2GHQA 5K3AA 5MN5A 2CVFA 1JJIA 3M3PA 1JN0A 1V1JA 3N2GB 1XZJA 3A28A 1D5CA 4I1OA 3ROTA 4UUOA 4YAFA 2ZVQX 3LUCA 5CXXA 1CUGA 2JEYA 4DG9A 3QOWA 1YZFA 3T38A 2JFYA 3U3XA 4C3UA 1V6AA 1CY6A 2O5VA 2ZBEA 2GO1A 5BWLA 4ND4A 3VDRA 1RD4A 4CKWA 3F0TA 2D00A 4O2AF 1MABA 5I51A 4DV1B 2ID8A 1T5BA 4NCHA 1ZVQA 3OH8A 3TSWA 5K09A 1Q7CA 4I5FA 3IXMA 4PSVA 5F1YA 4DSTA 2JZNA 1XC7A 1FUKA 4TTJA 1W36D 1ZM3A 1CWUA 1SCDA 2IK8A 3EQ7A 2ZKIA 4GX1A 3TYXA 3TGLA 3RODA 3WIVA 2B4QA 6GPBA 2E5LB 5SYNA 3ANXA 1KQ3A 1Z88A 2B9EA 4P83A 3GJ0A 4H77A 4CHTA 4P82A 2XV1A 3RBXA 1J42A 3JYQA 3FD8A 2QY6A 2Z9DA 2YNMC 1MRZA 4K9PA 4DLYA 4B4OA 3UQZA 3HFGA 3ROEA 4ZOEA 1F2DA 2EKBA 5DMXA 3LGXA 4GI7A 2P9HA 3UAOA 1FX0A 3SFVA 3F6BX 4XR9A 3OQIB 4ZRMA 1ZOIA 4MGHA 2BGJA 2PSHA 1ISHA 3N2YA 4ZRDA 1QVRA 4J16C 3CLTC 3OEHA 4Q15A 4C22A 1L7AA 1YT5A 4EMSA 1B74A 5B6JA 5BSFA 2BTEA 3VR3A 1CQJB 3MMSA 2WFLB 2YBDA 4FZRA 4LXUA 1KZ4A 2C83A 3LHDA 2VHZA 4JJGA 1MUUA 4RVGA 5G4LA 2PGJA 3ZWAA 1DEAA 2PBFA 3P0IA 3B1FA 4Q02A 4RADA 1I7QB 3NU1A 1CZLA 1HDEA 1HLGA 2IP2A 2JGMA 1QPBA 1FTSA 2UZ1B 1WXFA 2Y1CA 4LZAA 4QAQA 3V1YA 1I4WA 4NFYA 3HY3A 1RRGA 4XDZA 3VYRB 1AC5A 1O7JA 3CZ4A 5B7PA 2ILVA 1HQYE 3GRZA 3HI6A 4IJVA 2C2KA 4G5FA 2P77A 4NJMB 1MN6A 5LUBA 2V8BA 2WNIA 3OZXA 2RHDA 3E6AA 4XEUA 4BMDA 3I1JA 3GROA 1JBEA 4R5MA 5HILA 4A36A 1G9TA 1WIWA 4KQCA 5C32A 3PE6A 1UBOS 3AR4A 1QOPB 1FFXB 5AJHA 2Z09A 2P4EA 4BCCA 3OM0A 5JSFA 1JDNA 1KEEB 3IV6A 4BJ1A 2YZNA 3ADOA 4YV0A 1P7CA 3E4DA 4BNFA 4WBNB 1O5IA 4BDTA 3EMKA 2P2ZA 3ISVA 2F90A 2H06A 4TSFA 4EITA 3N58A 1Z0ZA 2O2EA 3IP9A 2CXXA 2XB9A 2GBFA 3DC2A 1G7SA 3OBBA 3WIDA 3X1KA 3SVLA 3AG6A 1YRWA 2QG4A 4RHXA 1RAFA 4Z54A 1EUYA 2Y6VA 3ASUA 3IRVA 4BGVA 4EO7A 5IM4A 4RQBA 1GNSA 4BFVA 3E0XA 2V7XA 4EUHA 1JEDA 3V46A 2BI4A 5B37A 1FSSA 4CMEC 4RAQA 5KYWB 3ZQ4A 4IDPA 1Y7PA 2QVBA 4AICA 1I1QB 1YGYA 3G0BA 1ODLA 3CNEA 5LZ4A 4FMCF 3F6RA 5AVQA 1P2DA 4K6GA 4LBWA 3VTZA 1X1AA 1O57A 2E87A 5JIBA 1FRNA 3PQ2A 2DEUA 3QQPA 2EBWA 4L5BA 5IMBA 1G98A 2AN4A 3N6VA 3OTWA 4AJ9A 3KQUA 1EZZA 5FL3A 1CBUA 1Q7BA 1SD2A 3A32A 2RGBA 1GAJA 3LY9A 3P9PA 5TPZD 2PSFA 3CMCO 1CJVC 1SC4A 2EGHA 3AETA 3DBHB 3MTJA 1YVPA 2IZ1A 1P4HA 1FRVA 1A2BA 3L92A 5CX4A 3J7AC 3ZCQA 4HB0A 4P22A 3V32A 1PFQA 4MCHA 4F1WA 1WB9A 4JC8A 2ON6A 2WKQA 3HJHA 4X92A 2WJIA 3VNAA 2XW6A 4B3GA 1OIVA 2UV8A 5T4EA 3U6KA 1FUIA 4AXBA 2IYZA 2OPBA 2FG7C 2B20A 1R8QA 1SPBS 2IHNA 1AHIA 2H92A 5CHEA 3EVFA 1JI0A 1LPAB 5CURA 2HIAA 3ZHTA 2FW9A 5KHLB 5D3QA 3P19A 3OF3A 1U90A 1QVAA 2QV7A 1Y1LA 2AXEA 1K63A 2X58A 3FUUA 3HL4A 1UUFA 4JODA 3TDMA 4D41A 2GDZA 1RLIA 3PNMA 3HJFA 3VFDA 2OB2A 3BEDA 1O94D 2E48A 2OECA 4HQOA 3E2MA 2Q5LA 3FI9A 4NQRA 5J58A 4GKKB 4HADA 1PQPA 2PRZA 3TEFA 1T8PA 1E3JA 1Q1NA 1Z6QA 4XVHA 2OORC 3QBVA 1J8DA 3C43A 4MWZA 5EP4A 1N5JA 3AIMA 3L3BA 1BGXT 1CRZA 1ZXLA 5TQ2A 3FCEA 1RWXA 1ST2A 4EL5A 1TT5B 5A5FA 1M0TA 4UMVA 3S99A 2YXPX 5CDYA 4WN9B 3TW8B 3NB0A 3F1KA 2O2DA 2HYDA 9LDBA 1F5NA 1G63A 4MUKA 1HE3A 2CGEA 2Z30A 2ZQYA 3FY4A 1NPTO 1DKUA 3JSAA 3OP1A 2A5GA 1K7EB 1S3GA 3PEEA 1DXHA 2H9YA 2RIPA 4JKIA 4MQ5A 5TMEA 2XCLA 3BGSA 3WLRA 3OQVA 4Q1VA 1O54A 5EAIA 4IUYA 3HUDA 1ISPA 1SO8A 4G6ZA 4HWKA 4Q4AA 5ANRB 3NW9A 1GGMA 1NG1A 1RBZA 1GQRA 2QNIA 3IIEA 4MITA 4RLQA 4KV7A 1OYYA 1Q11A 4KQ2A 3P2JA 3GFPA 1GPH1 3G82C 3RWOA 1B14A 1SVIA 4BO5A 1ND6A 4HY3A 2QK4A 2XGSA 2VP6A 5CB8A 3MOGA 3L4SO 2G4VA 2WHYA 5EUMA 1Z5VA 3O8BA 2CLSA 2HDNB 3G8CA 2PWYA 1GZ5A 4RMHA 5HKOA 1W4BA 2O7SA 4F6LA 1JHPA 4PLFA 3RUHA 4NBRA 2PMWB 2CEKA 2BM8A 2DY0A 1A9XA 4XSGA 3FWZA 1NYTA 2BFOA 4NMLA 4ZT2A 3OOJA 1DC6A 1OXSC 3FSGA 5LXTA 3COWA 1UMKA 5KTNA 2ID9A 5LJIA 4KL8S 3ZCTA 3O7WA 4ZREA 2A5DA 3FUWA 2X0IA 4CKEB 4H17A 2Q5QA 5CK4A 3G17A 1DBWA 3H7IA 3HCBA 3JVVA 5B57C 2E3JA 3JRNA 3BFVA 4BMZA 5GM2A 1UBFA 2AW5A 1GPMA 4K9NA 2WIGA 3K8ZA 3LCJA 4KE6A 5LIPA 5DHRA 4KX5A 2VZ8A 4TYYA 3TKAA 1N6OA 3IBYA 4BIMA 2R44A 1HDOA 4BEWA 1FRFS 1XEWX 1PJ4A 2YJZA 3PXXA 4XVRA 3WK6A 3PDHA 1FYWA 3IIIA 2I9KA 1CC1S 1MC8A 1XRMA 3D8UA 3QG5A 3X1XA 4RMIA 1D03A 1WULS 4PPYA 4BRUA 4JLKA 1CR1A 5EERA 1Y9JA 1U1EA 3CJQA 3MFQA 1SHZA 4DJEC 1N8TA 1WX1A 5BSGA 3WZ2A 3CZCA 5HZGA 3SJZA 3K6SB 1LF0A 4J0QA 1GG2A 3V1TC 2N42A 2PY6A 3MYRA 1EIWA 4NZPA 1RKQA 4RCYA 2EF1A 2YY5A 1IOLA 1K7FB 3AF1A 3RROA 2WWFA 2GFIA 1N2ZA 1Q84A 2CZQA 3TQSA 4ZGBA 4ZPXA 1XEXB 5BWMA 1XV5A 4D0SA 5LFAA 1YJQA 3EMDA 3K1YA 4B6QA 5JXJA 4ZICA 3LFUA 1PWZA 1A9QA 2NVBA 4JLJA 3ND9A 4L6AA 4N0PA 4RGQA 1O4VA 3RHZA 3T7JA 4AJKA 5EGSA 2OCBA 1EUCA 1Y9AA 2GK3A 1FVFA 1G5IA 2G67A 2J6HA 1FP6A 4FGSA 4JHLA 5LUAA 3F3YA 3TM5A 4LOJA 2CYAA 1VE3A 1KVUA 4QJBA 4LPKA 2F3QA 1N0UA 2Y1KA 4YRKA 1W35A 4RTSA 4MVJG 3I9MA 3I6QA 2RJ3A 3Q15C 2PAAA 3MG9A 4GMDA 4WE3A 4XM1A 4IEFB 2XUDA 3L1UA 2HFKA 4D0NA 3DLCA 4BB5A 3O9MA 3KS9A 1X7YB 3OO1A 3Q4GA 4OB6A 4CLEA 1TKAA 2IHYA 3HNOA 3HXPA 4G07A 5ALOA 5HMMA 3JAKA 3CNOA 3FRIA 3QJYA 4EAQA 5E2BA 4OXNA 1U0FA 3QA3E 3TUJC 4E4TA 2EBFX 2A86A 2D0OB 4IX9A 3TW6A 2NYVA 3KL2A 2YYSA 3PEFA 4PPGA 3RVSA 3U0VA 5LL6P 2EWVA 2WTUA 3PT9A 5K6RA 3HCRA 3IUBA 5I7AA 1L7VC 3T52A 5FQOA 3DVAA 3PGVA 1PHPA 4TTAA 1T5DX 3O4JA 3UXEA 5DF1A 3E7DA 4D45A 4I50B 1IM2A 2G5PA 1YK0A 2J6BA 3IMGA 3GUYA 4MNTA 1AUQA 3FSRA 1IQUA 1FFEA 1MRNA 1ZU5A 2C2BA 3L07A 4G09A 4M1EA 3HGQA 4Q39A 3RC2A 1BS1A 4EG1A 2XNSA 3AT1A 3IDFA 3LTEA 1P44A 3UAVA 3L77A 1DAGA 4J1TA 4IUBS