3W90A

Crystal structure of cmp kinase from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
198
Chain Sequence
GIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRAREQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cytidylate kinase
publication title Crystal structure of CMP kinase: insights into initial substrate recognition and reaction mechanisms
rcsb
source organism Thermus thermophilus
total genus 70
structure length 198
sequence length 205
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w90A00
2MSCB 1MABA 4BFTA 3HU3A 2HT6A 2BV3A 1OPXA 1US8B 1OB2A 1WA5A 2P6UA 2O8DA 1GKUB 4PR0A 2RGGA 4QGAA 4V03A 2RGNA 2WJHA 2V7QA 4X8OA 4UQOA 2D74A 1XNJA 3FFAA 3OE7A 521PA 1EX6A 4FMDB 4TL7A 5FBVB 3ZDQA 1E4YA 3CKLA 4C0JA 5FTKA 1FFHA 1E1RD 2UZ3A 4M53A 5KDOA 2IF0A 4CW7A 4H9GA 4PANA 4Q18A 1XB2A 1E2JA 3NH6A 5HTKA 2V55B 2PLRA 4LJ5A 4UNSA 1E0JA 2ZROA 3EWSA 2EFDB 3P20A 1EG7A 5TV2A 3R9WA 3QF4A 2VH5R 1XD2A 3OEHA 4KODA 2WWWA 5JEEA 3ZS9A 4MYHA 1U8AA 1Q3TA 1XEXB 2BMEA 1ZUNB 1GOTA 2WAXA 2IX3A 2HCBA 1ZVQA 2QGZA 3OAAD 3TAHA 3RC8A 1ZCAA 2NO0A 4M22A 2OBMA 4BRWA 3BBPA 2BCGY 3SNHA 5E3HA 1HQYE 3AP1A 2Y8EA 3VHXA 4WXRA 1A82A 3ZIAD 2Z83A 1JAHA 4QJ4A 3AVWA 2G0TA 1W4CA 1Z0KA 3KKNA 1US8A 4LJ8A 3DVLA 1TUIA 2OAP1 1W47A 4D4JA 1XWIA 3F3YA 2GZDA 1SVIA 2HF9A 5BN3A 1E2MA 3PITA 2G1KA 2F43B 3L82B 2VPPA 4TMVA 1AM4D 1X3SA 2D3WA 4QNRA 1M2OB 4D26A 2QTFA 1IJFA 3ZJYA 4HAZA 1VIYA 2R9VA 3KJIA 4NH0A 1WBDA 4LHVA 2GXAA 5FTMA 1Q3HA 1ZAKA 4OI2A 4RZUA 3WMGA 4OI0A 4G5QA 4PSAA 1Z0AA 2ZR7A 3KKPA 2IXFA 2BMDA 5EP3A 1JAIA 2Q3FA 2QP3A 3DL0A 4A0HA 2V6JA 3K9NA 4LRWA 2ZRLA 4C7OA 3ADDA 1GNPA 2BIFA 2IC5A 4IJMA 1G21E 3GMTA 5B64A 3PUYA 5LDDC 2OBNA 2D06A 1FMLA 1G18A 4P3YA 3MJRA 5KDLA 1RC8A 1II8A 3W9YA 4Z8YA 1CTQA 1CJKC 1VMAA 5IF9A 3GLHA 2JCSA 2A30A 2QRZA 1ONBA 5DSZA 2VP4A 1VG8A 4A6PA 2O8EA 3K0AB 4XH9B 1HE1C 4L5BA 4MRRA 2WAYA 1KO8A 3UANA 3MMPA 3F8TA 3B1VA 3BK7A 3FMIA 1A2BA 3MGCA 1N6OA 1QRAA 2P65A 5FTJA 5D3QA 3QJYA 4NMMA 2PBRA 1DG3A 4HI0E 1AKEA 1D6JA 1R7RA 4AG5A 4E09A 1YVDA 3IHLA 1W4RA 1CS4C 4FWTA 2GJ8A 2JIZA 1G20E 4KAXA 4HLUA 1PLKA 1ZD8A 1OB5A 1KAOA 3SI7A 3TR0A 2ZETA 3I8SA 3FB4A 3BB1A 4MGYR 3TR5A 3LDAA 4AKIA 3SFVA 2G77B 3QXCA 3KJGA 2YWEA 5CK5A 1OH8A 1X8JA 2FU5C 1XTIA 2QMHA 4UJ5A 4DLSA 3KQHA 1QZXA 3Q8XB 2GTPA 1OXVA 2XITA 2ZQ5A 4C0AC 1QHXA 4RCZA 3C41J 1NIJA 4EAQA 4BGDA 1QHNA 3NTUA 2VHQA 4ZDWA 3RYTC 4MUBA 3B13B 3GQBA 5CITA 4TZ0A 4KI0A 4F38A 3OEEA 1ZNYA 2N42A 3TW4A 1YZGA 1YZUA 4PQFA 2AFHE 4RD2A 1EWQA 4UXIA 3NIBA 1NVVQ 4TMTA 4ERNA 3GJ8A 4LPKA 4B32A 4D81A 1J7KA 2RGAA 1OXXK 3SHFA 3MWLA 5HPYB 2AKYA 2ZS9A 2RGDA 2CLSA 1IM2A 1QBKC 1NI3A 1RKBA 2OEPA 2VP5A 3EIEA 2AD1A 1KDRA 3HPQA 2GJAA 5BQ5A 1Q57A 1XXHB 2QT0A 2DWQA 4BLRA 3WP1B 3DOEA 3RLFA 4DLVA 1YZLA 3UG7A 1GDDA 4Q7MB 1W0KA 1YE8A 1GWNA 3L0SA 1KJYA 3R7WB 5KDDA 5EXSA 2VSFA 4DSTA 3GEIA 1KKMA 2ERYA 2IHBA 3RC3A 3QVVA 1N5LA 2ZRAA 4N0DA 1GRQA 5FPSA 1C4OA 2PL3A 1KI2A 3BB3A 1XD8A 3EIQA 3D31A 3Q5DA 1G3UA 1G4UR 4LOAA 1KI6B 2ZRPA 3T35A 3AF3A 4XVUA 2IYLD 2O8BB 4QBFA 1KK0A 1KNXA 1JR3E 1NKTA 1E94E 1CJUC 1XJQA 2GVZC 4XVQA 5G40A 3BFKA 5TMPA 3WNCA 3N2IA 2FX3A 4NYMQ 1NLZA 4BECA 3TVDA 3VR3A 1NN3A 2VP6A 1VG0B 1RZ3A 3J81k 3KQNA 4JZKA 4TQUS 2P67A 4KV9A 3EC2A 5CM8B 1JR3D 2AWNA 5JS8A 2WOOA 1JBKA 4IHQA 3TIFA 3U2QA 1EESA 4UKDA 3ZQJA 4HAWA 4B76A 1PZNA 2C78A 2F3RA 2ZRJA 1P2SA 2GXSA 2F1JA 4GBMA 5DIFA 1OXUA 3VR2A 4C0HA 2FFQA 1ESMA 1QHIA 2DR3A 4TSFA 1AS2A 2IS4A 3B8HA 2RB4A 4M9ZA 3W5JA 2XTNA 3SBEA 1T0JB 1VCIA 2KSQA 1RRGA 3TSZA 2GXQA 2HYDA 4YMWA 2C9OA 5J4VA 4A8JC 1VKJA 4EPXA 3ICEA 3GJ5A 3I5YA 5EP2A 3W6PA 1H65A 1IHUA 5FR1A 1QG4A 2GRJA 2LKDA 2FPMA 4IDOA 3ZS8A 2ZANA 4WZAE 3HYTA 1SULA 4GNKA 3ZD6A 2RHDA 1R2QA 4MYCA 1SVLA 1Z8FA 3RS2A 2ZU0C 2O8BA 3KB2A 4MKHA 2QBYA 4QM7A 3SOPA 3PQCA 1JNYA 1CJTC 2ZE8A 2CNWA 1HQCA 4W5WA 1GUAA 2JDID 2QAGB 1SVSA 3AF1A 1HA3A 2ZRIA 2ZJAA 1TU3A 4EJSC 5IHPA 5JWOA 5FL3A 3B82A 3T34A 5B30A 4BFXA 1A4RA 1E98A 1JJVA 4MYTA 1TAGA 4QHSA 4Z8XA 1PV4A 1UEJA 4O0MA 1TUEA 1TF2A 2FFHA 4WXPA 1GKYA 3GFTA 1VIAA 4OHYA 4B6FA 2HEIA 4TLCA 2IUSA 3H1TA 3AQ4A 3B5JA 4CGZA 1E2EA 1AZTA 4HDOB 3PCRB 4CZ2A 221PA 2IYZA 4UNPA 1ELOA 2IWRA 2VIIA 1N6IA 1QHHA 1ZIPA 1GM5A 1T91A 4HYYA 4M1KA 1IY0A 3ADKA 4DLUA 4B48A 2GBLA 2JJ2A 4URZR 3IHWA 4U00A 2WIAA 3GP8A 3UKDA 2R2AA 2OILA 1NF3A 1HT2E 2D62A 4TLAA 3FHCB 4GZLA 4LBWA 1BMFD 2O5VA 4QHTA 4F91B 1YJ5A 3CF2A 6Q21A 3QG1A 3H0KA 4ACBA 1NN5A 4M2LA 5JHHB 3L0PA 2QUZA 2XEXA 1G8YA 3QKTA 4QBGB 2BM1A 3TRFA 3ZVRA 1OFUX 1W5SA 4CEJB 5FI0B 1CBUA 1G5TA 4DUGD 2D2FA 2F1HA 1EWRA 1NN0A 4HATA 3NC0C 1UEIA 2J45A 2QP9X 1GNQA 3B9QA 3VFDA 4A82A 2QENA 4NE2A 3VQTA 4AIIA 4BEBA 1Z2AA 3WMFA 2O8CB 3B1ZA 2IYUA 2ZTSA 2DPXA 1SKQA 1T5LA 4CVNA 3RS4A 3FWYA 4HB4A 3H86A 1UJ2A 1W49A 4KFSA 2IUTA 3B1XA 4DEYA 3AEZA 3K53A 1QDEA 3AP2A 4JLPA 4N0EA 4X8LA 4ZI3A 4B73A 1OYWA 3SEAA 4MKIA 4E07A 3DKPA 4O2RA 1O3YA 5JCZA 1R0YA 5P21A 1Q20A 1KO4A 2B6HA 1NY6A 4JLAA 3TE6A 3LY5A 5J4HA 4C9BA 4HEJA 2GF9A 3UMRA 5JSZB 3SFZA 4US2R 3MAAC 1U0JA 4Q19A 5ELXA 4FXPA 1E3MA 2HV8A 1P4SA 2AX4A 1E9EA 2XOKA 1E2FA 1E2KA 1U90A 2HCJB 2HF8A 3QXXA 4UNQA 2IS1A 3ASZA 2QSZA 1KI3A 2HXYA 4NCKA 2ECKA 2QA5A 2CCGA 4HZIA 2AN9A 2AXPA 4TYWA 3C16C 4KHZA 3MCAA 1E9SA 3O8RA 4OI1A 4A0GA 4DDWA 2RGXA 3UATA 1BS1A 3KJEA 4BFYA 2YWHA 4GMXA 4DDVA 3THYA 3T06B 5GJBA 4ASUA 3EG5A 4CEJA 4QKQA 3GLIA 5FUYA 1FP7A 4XD7D 5D3MB 1XCPA 3ASYA 4AKEA 3X2SA 1M7BA 3QXJA 1CF4A 2ZIAA 2J7PA 1NBMD 4XSGA 2O8CA 1MH1A 1Z2CA 3QQ5A 2NG1A 4V02A 4LJ4A 1MO4A 1XMJA 1Y3AA 4NYJR 5JJLA 3VTKA 2YYZA 4M1TA 5BWMA 2B92A 3RRYA 4N1AA 4TTQA 4BE7B 1H8HA 1DG1G 2G9NA 1KMQA 3DZDA 5A0FA 4MITA 1P6XA 2EW1A 1ZM7A 1R8SA 3U7EB 4A8JA 2J46A 1HT1E 2F1RA 3CF6R 3OFND 3VX4A 5JSZA 2YOGA 3P26A 1MO5A 4JVNA 2BJVA 1QHYA 4K8OA 4Q5IA 3R9XA 1AKYA 2XTZA 4B3CA 2CK3D 3CRW1 3SBDA 3QUSA 2ERXA 1FNMA 3LQRA 1NMXA 2A5DA 1W44A 4OK3A 2GZAA 4QFMA 4RZXA 5DI3B 1XFAA 5CB6A 1J2JA 2ZI4A 4FMDF 1QF9A 1N6RA 4DVGA 1PLJA 2JLWA 1WXQA 2EYUA 2ZJZA 4LBVA 1UBFA 1CRQA 1PVOA 2BJWA 3PUWA 1ZJ6A 2H92A 1KO1A 1CULC 3IKJA 3NH9A 4PHHA 2Q3HA 1HYQA 2FH5B 4R2IA 4GPTA 4KYIB 5EE1A 4Z54A 3ZYCA 2AFIE 3GLIE 4JYBA 5D3MA 4MGKR 3PEUA 4KO8A 4OHVA 1OFIA 2O52A 1YR9A 4PHTA 1XJ0A 2RGNC 2OFWA 3T12A 3H2YA 4P4TA 4BFZA 1M7HA 5KSPA 4Q02A 3EC1A 2DY1A 2RGBA 3LRPA 4QHYA 3SHWA 2V1XA 5IK2D 5JRJA 1LS1A 4HUTA 4DLTA 1KDPA 2GCOB 1GL7A 2LCFA 4RZ2A 4QC2A 2QMEA 4HDCA 4YMSA 4BZPA 3BH6A 5JWRA 3NEYA 2KBEA 1OSNA 3IBGA 4YLGA 1L2TA 4OHXA 4TQAA 2FZLA 3RAPR 4LJ7A 2ZR9A 4KFRA 1GZSA 4M1MA 4TL6A 4Q9IA 4GP6A 2CL0X 2IYSA 1EFRA 2QSYA 3M4YA 4Q47A 1TMKA 3I5XA 2ZU6A 1E2GA 4ZIRB 1Z6TA 1E99A 1IN4A 4YMTA 3I62A 5IDVA 2YOFA 1DVRA 1FTSA 2FZ4A 3QXSA 3GJ6A 4OKSA 1YZQA 4PC7A 3WBJA 4IOJA 3S1AB 2GJSA 1S4QA 3EZ7A 1D9XA 3T15A 3TNFA 3SDZA 2ZE5A 1E9DA 1G8HA 1NVWQ 1OFTA 4LHYA 2ZRHA 1BH2A 1JB1A 4BASA 4LHWA 4B2PA 4LBYA 4KXFB 2XSZA 4JMPA 4B35A 5KOYA 2JLXA 4QJ5A 3CRVA 5ANRB 1NL3A 1OHHD 1RW4A 3CLVA 2CVHA 4PZYA 4BFWA 3NEJA 4O3MA 3TSWA 4F93B 2JAQA 5M04A 2GCOA 4Q1EA 1GITA 1JPJA 2QE7D 2IEZA 2PZEA 4DIDA 4HUQB 2D7DA 2WOJA 4Q1FA 2AXNA 2OUKA 4PPFA 5F98A 3HYRA 2V4ZA 1XDBA 3LVQE 4ZKEA 4DEXA 1M34E 4EFMA 3PUZA 1R4AA 1Z06A 2V6IA 4TT3D 4KVGA 1EFCA 1ZINA 3DMDA 1GKIA 2FSFA 2XZLA 1FPMA 3QE0A 4JBYA 1WQ1R 1N6NA 4LPSA 1E1QA 2ZS7A 3ZGXA 3PEVA 2DFTA 1UKYA 1QHSA 1IN7A 4HAUA 3R8CA 3P1JA 3UIEA 2PX3A 3ADBA 2OSBA 3LX8A 3QBVA 3KTAB 1GIAA 3I92A 3TMKA 821PA 3FE2A 2C04A 1KK2A 1XCMA 4KYUA 1OH5A 4OYHA 5HKKA 1B23P 3A1UA 1X8KA 3M1IA 1DPFA 1I2MA 2BMJA 4GMDA 3C8UA 4MRNA 4L8GA 5KNDA 3NDBB 3DZ8A 3GLGB 2IYYA 2IEYA 1XX6A 1HV8A 1SXJB 2CE7A 5GJVC 1NKSA 1P9NA 3LWNA 4DSOA 3DEFA 1AS0A 4CT5A 3K70D 4DSNA 1O87A 2C2HA 2WMNB 3KQUA 2W2XA 5JWHA 2ZRCA 1IJEA 4D0NA 4YXWD 1N6PA 2WPDA 4HLUC 3TAUA 1T8TA 1U81A 1WDTA 3CH4B 3CM0A 2JLSA 2ZRMA 4KSCA 4DWJA 5EZ5A 1Z3IX 1NVUQ 2E9SA 2IXEA 2FSHA 3GEEA 5K8TA 1SHZA 3SYLA 3QPVA 1HE8B 1Y63A 3I4LA 1I2DA 3L0IB 3HDTA 5EE5B 3UWKA 1YQTA 4TL9A 3A4MA 3RSOA 2WSMA 2D7CA 4JLDA 4MYUA 5DYGA 1G1MA 3KTAA 4CDGA 2V3CC 1NN1A 3ZVMA 1N0WA 1R5OA 2QMOA 3K9GA 4AD8A 4BZQA 2A5GA 1LNZA 3O8CA 1AK2A 2R6FA 1V5WA 4HZUB 2YZ2A 2TMKA 1U8YA 2W6JD 5CDFA 2REOA 2BDTA 4IXNA 1SXJA 2OT3B 1S3GA 4U7DA 2ZSDA 2AR7A 4C0SA 1KI9A 1EX7A 5C4MA 1NJFA 3NDPA 3DO6A 4HB0A 5J4LA 3BS4A 2JJ1D 1E69A 2VSOA 4D80A 4Q7KA 1DO0A 1GILA 5FOUA 4ZCMA 5JCPA 2VHCA 3FFBA 3PUXA 3RRMA 4OQMA 1MV5A 4KLZA 1NY5A 1OE0A 4A2WA 4GT1A 4OL0A 121PA 4DCUA 4HLDA 2QTVB 1Q1ZA 2WBLC 4ZCIA 1KYIA 5DLQC 4G0NA 3GFPA 1NSFA 2GZHA 4JKYA 3W8NA 3LLUA 4C3ZA 1M1YE 1IQPA 2XJ9A 4Q4HB 5J4YA 1SKYB 1L7VC 4QG7A 1XD9A 1T3HA 3AUXA 2GAAA 4WVFA 2QL6A 1M7GA 4IW3B 4OBEA 3IPXA 1COWD 4TYNA 4RY2A 2C96A 1OKKA 3LBIA 1QG2A 4WA7A 1KJZA 3JZAA 1ETUA 1U0HC 2JA1A 4UNRA 5CDFE 3TUIC 2EFCB 4CIDA 2ZI3A 1G6OA 4I4LA 4LUCA 5BYKA 2PX0A 4K81B 1CU1A 5FFMA 3U60B 5DHAA 4U02A 3L8YA 1HY3A 1Z29A 2MMGA 3B1WA 4L4UA 2OV2A 2FE4A 3BOSA 2ZITA 4YMVA 2V1UA 4JYCA 1KZGB 1NLYA 1XZQA 3WMEA 4HAYA 2Z4SA 4MQBA 4B3BA 4EFNA 1IXZA 2ZSBA 3OZXA 3AVVA 3K0SA 3JZMA 5KSOA 1PJRA 2V7QD 5KPDA 4KFTA 3N70A 3OE7D 1R0ZA 1CLUA 2CBZA 3REFA 4IEIA 1E2QA 3KXLA 2WWHA 1XEXA 2NQ2C 4DKXA 1W46A 5LD2B 4GZMA 2VP2A 3MD0A 4Q4HA 2Z4RA 3ZVLA 2FMXA 4XIGS 1KDOA 1KI1A 4JT2A 3OIVA 3OEHD 1RYHA 1SVKA 2EFHB 1Z6YA 2ZYTX 2QZ4A 3NBZC 2QMUA 4HLCA 3AUYA 5GVSA 1NMYA 4RFSB 5GJWC 1G291 4Q9HA 3FKSA 1D2MA 2EFEB 5JJKA 1OJLA 1ZC3A 2F43A 4OHZA 4BZXA 3A37A 1XF9A 1W48A 4MRSA 4AKGA 2OLJA 1MR3F 3IDQA 1CJMA 1DAEA 1UM8A 4B47A 3BORA 4FD2A 2JATA 2J0SA 4AK9A 1E2HA 1E0KA 5EXXA 3P32A 2OZEA 2ZVQX 4LX0A 4DHEA 1IN5A 3C7KA 3CO5A 5FL7A 2VSXA 1GTVA 1XTRA 1XJCA 4QBHA 2Z43A 3UXMA 3AF0A 4CYMA 3CWZA 3PXGA 4EPTA 2GBLC 4Q7LA 3IQXA 4TYPA 4DIEA 1JJ7A 1L4YA 4DZZA 4L9SA 1ZNZA 1KSFX 4UXJA 2QP4A 4PO9A 2FEMA 2AK2A 2GESA 1ZIOA 3BH0A 3DKVA 1C9KA 5K8LA 2A2ZA 1R8QA 2XZPA 4IKEA 3OF5A 5HCNA 1MO3A 1Q0UA 3B9PA 3GEHA 2JLUA 5KSZA 1ZU5A 1P7CA 1XRJA 2HJGA 4TTPA 5JHGB 3GLHE 3Q85A 5KO2A 4TMKA 2WJIA 5G3YA 2QAGC 3K0AA 1N6HA 3UMFA 3HU1A 3KKOA 2ZEJA 1N6KA 4FMBB 3LX5A 1E79A 1NVVR 4RFSA 1VG1A 4JKIA 4CRWB 2GAOA 2Q6TA 2A5FA 2W6IA 3RRZA 4IVRA 2HLDA 1VCMA 2NO7A 4GSYA 2F9MA 5AJXA 5LPNA 4LK2A 4JLOA 3VR5A 3Q72A 1TU4A 1JECA 3QENA 1GRRA 1OH6A 3PEYA 2LWIA 2JJ8A 3R9IA 4JT4A 5EJEA 3ONWA 2DWPA 4MRPA 2OFOA 1ZM9A 4MH0R 4NCHA 4OJQA 3GJ3A 2YKGA 3VNVA 4B75A 1W0JA 3LBNA 1M74A 4B34A 4IVQA 3KJHA 4JLVA 2DFLA 3CRRA 2JIZD 4XWOA 4C4PA 2BEJA 2CVFA 2O0JA 3KUCA 2GVDC 3MSXA 5DI9A 2C9YA 3DPUA 2ZJ5A 1OT3A 1Z08A 4URUR 5KUTA 4G5RA 2WJYA 5DE3A 3CUEF 4OQFA 3QBTA 2ZRDA 2OESA 3KZ1E 4NYIR 2EYQA 4RFVA 2PCLA 4G5GA 2VO1A 2FV8A 1FTNA 3BH7A 2NO6A 3AGPA 4NYMR 3SU8A 4URVR 4I1VA 2GETA 1S0UA 2A3RA 3HP1A 2N46A 2ZUDA 3FKQA 3K9LA 5CK4A 2J87A 2NGRA 4FI3C 3T1TA 1DAKA 1E32A 3NHAA 4B71A 1FQJA 2OBLA 4XTRA 3BIFA 3CF0A 2REXB 4B43A 3V9PA 3WYAA 1ZRHA 3OEED 3AKCA 1P62B 3CPHA 4M21A 1W7AA 4LJAA 3BD9A 1XXHA 4PHGA 1TADA 1CEEA 4JSTA 1AIPA 1T3SA 1KI7A 3R7WA 4EDHA 1KK3A 2ZSFA 3WYFA 1LTQA 1ZM3A 2YNMA 4JJKA 4CEIB 4IEEA 2QI9C 3IPYA 1WE2A 2OCPA 5FBWB 1T5IA 5K8IA 1TF5A 3B6EA 3GJXC 2ONJA 3TW8B 4WZBE 4EKDA 4PHFA 2VF8A 2WZQA 2ZI6A 1P2UA 2XAUA 1S8FA 2ZYVX 5AJYA 4EPRA 1KIMA 4EUNA 1KI6A 4GL2A 1W0KD 2H17A 4D82A 4I81A 2FFBA 4M1OA 1OF1A 2V8OA 3EAQA 3MJHA 2D2EA 5F3WB 1IY1A 2XNSA 4V0OA 2J9RA 2WTUA 1ZYUA 1H8EA 2VP0A 4US1R 2C99A 3PFIA 3T5GA 1DTSA 5EQTA 2PJZA 4A9AA 5AR1A 3EARA 1ZD1A 4PXAA 3TK1A 5HR5A 4Q7JB 4M1WA 5FPYA 2QGNA 4QRHA 2OCBA 3EW9A 4Z1MA 2UKDA 1M6NA 1XBTA 2FGJA 2OO7A 5L3SB 3U3OA 1P73A 1XXHE 1OH7A 3K0CA 4KFUA 5EE0A 4A1FA 3IO3A 4ZKDA 1G7CA 3B78A 1HURA 1OIVA 4Q1AA 3UK6A 2CHGA 3WNBA 2CJWB 3K9HA 1CKEA 4DCSA 4GDFA 1LB1B 2ZE7A 5FOXA 5TARA 1I4LD 4GFDA 4PAMA 3CWQA 2CDNA 4TSFD 2FG5A 3QEJA 2A7QA 3FVQA 2WHXA 5FR2A 4RZ3A 1A1VA 1W36B 2ODNA 3K0EA 3LXXA 3V4FA 2CMKA 4ZDIA 5KNCA 2P3SA 4B3XA 2UZIR 1S1MA 4EQ6B 5E4FA 1P75A 1VPLA 4RCYA 2QAGA 2XB2A 1KK1A 1KKLA 2IK8A 4AURA 3L8ZA 2RHMA 4IRUB 3HJNA 1F60A 3F5FA 2B21A 4YONB 1I4TD 1DAGA 1G3QA 1NNEA 1NG1A 3W34A 3WRYC 2XZOA 5C46F 4RSGA 1NSTA 1RRPA 3UPUA 1XEWX 2W0SA 3HU2A 2ODEA 2X2FA 2ZR0A 1I4DD 3E2IA 3WYGA 1FW6A 2CNWD 1UPTA 1P61B 3KKQA 2X77A 1TTTA 3QOFA 3KQKA 2ZRFA 2P6RA 3GD7A 4KJZA 1MOZA 1IOZA 2QPAA 4TYQA 3PUVA 3CNLA 5CLLA 2W00A 4LYJA 4PC1A 2ZVPX 2R6AA 2WKRA 4GOJA 3LFUA 3DM9B 1E9AA 4R98A 1T4GA 1XMVA 3CNOA 3TUZC 4WZ6A 4UXHA 4W7SA 1MRSA 2NZ8A 2K5UA 2HXSA 3IUYA 4M8NE 2ZUBA 3UWOA 3IQWA 3LNCA 1KMHB 4BFUA 2J0QA 2JEOA 4AY2A 5DN6A 4V0KA 5CJ2A 1E2IA 1S1CA 3ZLJA 4Q4JB 3Q9LA 3QVUA 2P6NA 1W2GA 2JJ2D 2AHOA 1YRBA 2GXUA 2H8KA 2MSEB 4TQ9A 4EIWA 1TPZA 4A6XA 4L9WA 3KX2A 2JLYA 4K46A 5L3QB 1JR6A 3RNLA 5C4GB 5GVRA 2OCAA 2VQSA 2WSSA 3P4XA 3PENA 3FDIA 2CEAA 2ZRGA 5HCIA 3WRXC 3R8FA 2FDCA 3ZZUA 3LW7A 2ATVA 3AF4A 1KI4A 3M6AA 4M9QA 3AF2A 4DDTA 1DAHA 3HWSA 3FOZA 2W83A 1SVWA 1S9HA 2ZAOA 4CT4B 3ZD7A 1G19A 3KKMA 4JVLA 4DLRA 2HYIC 1RVDA 4DJTA 3SN6A 4M1SA 3I32A 1J90A 2VEDA 1OIXA 2O0HA 2DB3A 2KWIA 3TBKA 1OV4A 4LSGA 3THXB 3A36A 5DH9A 3TVTA 4BLPA 5AUQA 4Y0AA 3V00A 2OHFA 1W4BA 4LBZA 4P33A 1U9IA 1Q1QA 4C0BA 3FYHA 3GLFB 4XVRA 5AJVB 4IDPA 4G5OA 4Q4JA 3C5CA 1ODFA 2IT1A 4J0QA 1FOEB 2XOKD 2J41A 1G8PA 1FX0B 2G3YA 4RVCA 5HZHA 3LW8A 1CR1A 4FN5A 4Z51A 2P5TB 2VRWA 3FMFA 4TLDA 3FPAA 2Q9CA 2BVNA 3PJRA 3PVSA 2QG6A 3CONA 1CP2A 5AK0A 5F9FA 4M0LA 2WJGA 1G3MA 1JEEA 3CH5A 1EGAA 3BC1A 3KFVA 3W5IA 2WWXA 3NKVA 2BBWA 3KXKA 1YZTA 1ZC4A 1ZW6A 4ZV4A 4A0FA 1SXJC 1PLLA 2YJTD 3SJZA 1XMIA 4QNMA 4DB4A 4RD0A 5GJCA 4RD3A 3EPJA 1RRCA 3BB4A 3X1WA 5KU1A 3K70B 3EPKA 1S9DA 1KO5A 4ASUD 3CR7A 3TUJC 3RRNA 3AKDA 1KGDA 2J7PD 5CIQA 4OI4A 1OYYA 3GFOA 3AVTA 2FNAA 3K09C 2PMDA 3NHBA 4IDHA 2X2EA 2EQBA 2GHIA 2H5EA 3CR8A 4Q9LA 3KFXA 5BN5A 2NMVA 5EUMA 3D6TB 4P4SB 2IYWA 5DI3A 1H8HD 2WWIA 3U4QB 2ZRKA 621PA 4TLEA 4R7ZA 1TL7C 4C2UA 1GL6A 1NG9A 3A4NA 1KOFA 1P9RA 3KUDA 5FOWA 4O2LA 4I1UA 1JQLB 3GLFA 2BBTA 1FQKA 3VU9B 4MDEA 4DB2A 3MWKA 4XTCS 4ARZB 3CB4A 5C2JB 2ZRNA 1F2TB 4NU0A 1R5BA 1OW3B 1JXOA 2W58A 3HPRA 4LC0A 3LXRA 3WBKA 5EP4A 4BRUA 1G5PA 1TEVA 4JL8A 4PAOA 1P2VA 1VG9B 3QI2A 4B44A 3U3MA 1KAGA 3LAWA 5J4KA 4B6EA 4US0R 2QRNA 1OIWA 4WBSA 1G5RA 3ECCA 4LJ6A 2GNOA 4G1UC 4GOXA 4OK6A 2EVWX 4DCNA 5C1BA 2F1IA 3BERA 4NONA 1KJWA 3U61B 4IOLA 3RWMB 3LBHA 2GKSA 4LDJA 5TDHA 1BYIA 1CR4A 4Q4AB 4ESHA 4PPQA 2KB0A 4JBWA 4RKFA 3PEWA 3N2EA 2W2VA 1YRAA 5AUPB 4NBSA 1DADA 3I1FA 3U44B 4R9UC 5JZVA 2IYTA 4NPHA 1JPNA 3A1VA 4Q9KA 5TY0A 2ORVA 3VKWA 3ZZTA 3RS0A 4QXAA 1BOFA 1F5NA 1KI8A 2WJJA 3AVQA 3HR7A 3U4QA 2GA8A 1UFQA 1OFHA 2BMFA 2EU8A 3T1VA 4KLNA 4BQSA 1U94A 4DLWA 2FWRA 2YOHA 1X1SA 4L15A 5B2ZA 1ZP6A 4XJXA 2OAQ1 2EWWA 3RDPA 1II0A 1E9FA 1YR6A 3LO5A 4ZIRA 2AKAB 1RIFA 1VCNA 5FUVA 1F2TA 3S1AA 4LI0A 1KSHA 5CYOA 1E2LA 2XNDA 1ZD9A 4LZZA 3Q5EA 2IHYA 1EFRD 3ND9A 4PO8A 3GPLA 3U6BA 1DAMA 3DOFA 3EPHA 4EPYA 3ZH9B 3THWB 5L8VA 2BKUA 4QJ3A 5BXQC 1E9CA 2KBFA 1L8QA 3IEUA 5BW8A 4OQLA 4BWYA 1MT0A 3C5HA 2NOAA 1X1RA 5FUWA 3LVRE 1E9RA 1XPRA 2CCJA 1E1RA 1DAIA 1P72A 2OE2A 4NDZA 2WIBA 3CRMA 4QGGA 1GFIA 5JMTA 3D8BA 5TXGA 2KI5A 4HUQA 3X1ZA 1U2RA 5CLQA 2O8DB 3IILA 3U44A 4B3GA 5C18A 1CIPA 2C95A 4LJ9A 3A1SA 4JIMA 4AG6A 4AWXA 2XSZD 4P31A 4W9MC 4BLQA 2C77A 4MKGA 4O25A 1WP9A 2JLRA 1Z47A 2GJ9A 1Z6GA 3QF7A 4PC3A 3X1DA 2FGKA 2ZUCA 4M1YA 1E4VA 3G82C 1D9ZA 3JVVA 4E22A 2OM2A 2ZI9A 5LD2C 3QKSB 4TTRA 4EFLA 1NP6A 3OAAA 4PX9A 3M0EA 1TQ6A 4DXAA 2HT1A 3U7FB 3IIKA 1T8UA 1NMZA 1TQDA 4A2PA 2PEZA 3SJCA 2A5JA 3EZFA 5F2EA 2C9CA 3ZIAA 3CPJB 1XD2B 2F3TA 2CLDX 4LV6A 2UVQA 5SZIA 4D6PA 2P2LA 1E1QD 1B0UA 1ZUHA 2YVUA 4X8HA 1HEIA 5FOTA 2OLKA 1X86B 4XWAA 3GLGA 1RE0A 1HTWA 3P4YA 3THWA 2ORIA 3BXZA 1ESNA 1D2NA 3MRSA 2PEYA 2I1VB 2QN6A 4N3NA 2ZJBA 1G41A 4QL3A 4URWR 3U3JA 1ZU4A 3B1YA 3T1QA 2GK6A 1SGWA 4OK5A 5HKKD 2REBA 3BGWA 4LJYA 3WXMA 3DDCA 4PQRA 4JL6A 4JLMA 3K09A 3LA6A 2BBSA 2IWHA 2FPKA 3IIMA 3EA0A 4OHWA 3NBYC 1F48A 1YKSA 5L3RA 3IBYA 1IAQA 1S96A 4Q1CA 2HUPA 3I72A 3O8DA 1RFLA 5FBLB 2QPOA 3E5HA 4YMUA 5FBRB 5AUNB 3TKLA 1G3IA 3NG1A 3CX8A 1JQJC 3Q7PA 1FUUA 2WPDD 3E70C 3W3AA 3TGPA 421PA 3QKSA 1KDTA 4ABYA 4F4IA 3MG9A 5LB2A 3QKRB 2QM8A 4DLZA 3LLMA 1XTKA 2XNDD 3GCGA 4BFSA 5KPJA 5DO9A 2JLQA 2ZJ2A 4X8MA 1N2CE 2XTMA 2QU8A 5E95A 4JLJA 4ITRC 3VR4A 4HZUA 3I3SR 4Y0VA 1XZPA 4B74A 4C7OB 3AP3A 4Q00A 1W4AA 1XTJA 2R6GA 3GLGE 2CE2X 1SXJE 1AN0A 1E2PA 3FHOA 4DC9A 2B8TA 3EX7C 3HR8A 721PA 1II8B 1JEDA 2BC9A 2GEDA 1LV7A 2R6CA 1KSGA 1BYUA 3CNNA 4LWZA 1AQYA 2P5SA 3RS3A 2NPFA 3GLHB 4RKEA 1Z5ZA 2A9KA 2JASA 3ETLA 3H84A 3H4MA 3SS8A 2QTHA 4MGIR 2O8EB 1DELA 1OLOA 1AQUA 5FOSA 3U3KA 5EXPA 2JGNA 1U8ZA 3P27A 1DO2A 1FP6A 1OXTA 1VYTA 1SXJD 2XX3A 4WW0A 1E2NA 3CZQA 3EASA 3RWOA 3WP0A 5K8UA 4CEHB 5KTYA 1DOAA 3L2OB 4XWKA 2AK3A 1DARA 1D5CA 4QGHA 4ZPXA 4BPBA 2AL7A 3DMNA 3BAFA 3VKGA 2IUUA 2DFKB 4MKFA 4D4MA 3EIHA 4GOKA 1Z6AA 5AWFC 3MUFA 2PLFA 4RD1A 1IBRA 3QKRA 3R20A 4TMXA 1ZM4A 3A4LA 1R0WA 2QQEA 2YWFA 5CIWA 2ODWA 2QORA 3MWYW 4FW9A 1A7JA 4HSEA 2G83A 5JI2E 1G16A 1LVGA 2PT7A 2ZM5A 1XP8A 2X1VA 3ND8A 2Q0HA 1T0HB 1W5TA 5JS7A 4V0MA 2ANBA 3X1YA 3EZ9A 2JLVA 2C5LA 2X19A 1K8RA 3MLEA 3B7GA 3EXAA 5GADl 1RPZA 2VP9A 1K5GA 3AVOA 3SYKA 2FF7A 4HAXA 3I73A 1TQ4A 4UNNA 4NHOA 1WMSA 1EFHA 2PCJA 3NXSA 1OKKD 4JVSB 3IIJA 5DGXA 2NO9A 1RJ9B 2DYKA 3SZRA 3U7GA 3K0CC 2WMOB 5SZKB 1R0XA 1S2MA 4JJZA 2FJUA 3RVBA 4FIDA 4CEHA 4QM6A 3D3QA 3TQCA 4R2HA 1M8PA 3N5CA 5LBIA 2L0XA 3KL4A 4WOPA 1XEWY 2QT1A 2B7CA 3NC1C 4YDHB 5KHOC 2ZE6A 1GAJA 4A2QA 1KSJA 1K6MA 4HB3A 1JALA 4IOKA 2H1LA 1TX4B 1T6NA 1SKYE 3UG6A 3X1XA 4IVPA 4F7WA 3QY0A 4R71A 1HH4A 3PIRA 2PZFA 2ZJOA 2NTYC 1AGRA 1T3LA 1PUIA 4FCWA 4D25A 3SQXA 1ZUIA 2D4HA 1ANKA 2ONKA 3CX6A 2PT5A 1E0AA 2WWGA 4AKHA 4A4DA 4BFVA 3EWAA 3LV8A 3MWJA 4I1SA 1Q21A 1JR3A 1SVOA 4V0ME 4A92A 5FTLA 4KU4A 4KITB 2ZAMA 5AJZA 3BWDD 3D7MA 5FBQB 4D0LB 5G3ZA 1G9XA 2E1RA 4NCIA 4DBLC 2SHKA 4XOIA 1WF3A 2BKEA 2FA9A 1RJ9A 1Q12A 2QAJA 3QXHA 3FKSD 5EXTA 5FI1B 3T61A 1UF9A 3C4JA 5JECA 1XEFA 2YINC 4U5XA 3BJIC 4S2EA 2J0VA 4YDSA 4EPWA 4B2LA 2CL6X 2WWYA 4LV8B 4PPNA 1KNQA 2Q21A 5EP1A 4ACAA 1N5JA 3RHFA 3K8YA 4W5HA 2V9PA 1Z22A 3A6PC 1YHNA 2CHQA 2VHUA 1RRFA 3TH5A 2ZPTX 1YZKA 1VECA 5FL7D 3CRQA 5A4JA 1KY2A 3SYNA 3LQQA 1W36C 1IONA 1LS6A 2IYRA 1AGPA 3BE4A 2NPIA 1VCOA 3NVAA 1IXSB 2JDIA 3PV0A 1FZQA 1Z0DA 1KHTA 4JLBA 4JSYA 4Q1BA 4Q9JA 3RS7A 2G0NA 1D2EA 3WNDA 4PFSA 2J7KA 2YC2C 3TQFA 1AJEA 4C30A 5KSYA 5JRZA 2F9LA 3QSYA 4MDFA 1G17A 2BM0A 3VMFA 3W6NA 4D4LA 1G7RA 1CRPA 3IEVA 4II7A 3SR0A 3G0HA 5DISB 4JS0A 2QBYB 4P32A 4NYIQ 4E03A 2E87A 1QVRA 1IXRC 1N6LA 2NO1A 5DYIA 3VNUA 2VHJA 2MSDB 3FTQA 5JBQA 1Z83A 1NIPA 1Z0JA 2DBYA 2RAPA 1E79D 3OHMA 3RANA 1KTVA 4TL8A 4FINA 1UBGA 3W3ZB 2W6ID 4KBFA 2CCKA 3TSOA 5CJPA 1G6HA 5KYKA 5IRCD 2IYXA 3NBXX 4Q01A 2HLDD 4WAUA 1N0VC 3AV0B 2RCNA 2BCJQ 4IOMA 4D4KA 2ZJYA 5J5CA 2IL1A 2ORWA 2IS2A 4CF7A 1GL9B 1U9IC 2IS6A 1BMFA 1QHHB 2VL7A 4UJ3A 2FSGA 3E1SA 2OCYC 4D0GA 4TZ6A 1W0JD 2RH5A 3SJAA 1XTQA 2P0EA 5E7MA 5FH9A 3GJ4A 5J47A 3IGFA 2ZYUX 3QIAA 3ZQ6A 5KNBA 1VDZA 4P4UA 4DUGA 5H8WA 5AUOB 1EFUA 1CR0A 2VHTA 2XXAB 4KBGA 4LHXA 1XU4A 4JBXA 2ZS8A 3CBQA 4FCVA 4WIAA 5E7IA 2Z0MA 5JI3E 1FNNA 1TNDA 4A36A 1Z63A 2H7VA 3PG5A 1E96A 1MKYA 4G5SA 1X6VA 3L43A 1BIFA 3REGA 1UKEA 4M4SA 2BEKA 5UKDA 2WM9B 1TEXA 3QEOA 2FEOA 2V54A 4TN1A 2FPLA 1Z07A 2RMKA 2AWOA 3FMPB 1LY1A 2PJRA 4E5UA 5G41A 4CEIA 1VYUA 5L3VA 2IA5A 2OFXA 2ZREA 3K0FB 1G7SA 2QEQA 4C0LA 1GSIA 3KB1A 3OESA 5EUQB 1DAFA 1W1WA 1XTSA 1QVAA 3WHKA 1V43A 1CR2A 2VBCA 2VYFA 5DNYB 1ZBDA 3B85A 2CXXA 3K1JA 4URYR 3U3RA 2ODBA 2B7BA 3NWJA 4FWIB 1II9A 4M9SA 5SZJA 1WRBA 5FPHA 4BLOA 4XSHA 5EE3A 4B3FX 1VHLA 1NJGA 3ZVNA 4LV5B 1W2HA 2VF7A 4AYXA 4BEJA 4XD7A 5BYJA 1EXMA 4ON9A 2IW3A 3AVPA 2XXAA 1NBMA 2RKOA 4I1OA 4I99A 1ZMXA 1P5ZB 2X8AA 4LY6A 4LGMA 5CM9C 1OXSC 1H8ED 4TMWA 2KJQA 1J70A 2O0KA 3DM5A 4NKRA 5L3SA 2A5YB 2ZSAA 3AGQA 4LYFA 3K70C 3THYB 3LD9A 2H16A 1BO6A 2QNRA 3GLIB 1DS6A 4M9XA 4LC1A 2BHRA 1J99A 1Q22A 1U99A 2ZI7A 4HLQB 4BLSA 1DBSA 4DLYA 4RD6A 2XB4A 3RSLA 3OFNA 4Q4LA 4KCGA 3KQLA 1DEKA 3KDSE 4Q66C 3OIUA 2CJWA 5AJWA 2YC4C 3L0OA 4Z1MD 4B2IA 3EA5A 2CK3A 2IXGA 1KY3A 5BN4A 3K0FA 5TB5A 1UBEA 5FUXA 5A5GA 4PQYA 1WB9A 1N5IA 2QQ0A 4NZYA 4TLBA 2IBMA 2ZI5A 4JLNA 1MO6A 1ZM2A 3ICQB 4PSKA 4P0TA 4A8JB 3T1OA 1E0SA 4URXR 1GVNB 3VHLB 4PZLA 1UKZA 2NIPA 4EQ6A 3W8RA 3QNUA 5JJIA 2CHVA 2J0UB 3BFXA 4HAVA 4YC7A 2VTKA 1YZNA 2WV9A 4FMCF 2ZYWX 3QG5A 1AZSC 3THOA 1ZNWA 1NBME 2C03A 4DRZA 1VYVA 3I61A 1G7TA 8OHMA 2R6DA 1R5NA 4QOSA 5FOVA 4A0RA 4ZDJA 1LFDB 2W2TA 4QBIA 4EJSB 4FCTA 5IK2A 1WCV1 4PC2A 4MGZR 3B60A 3WY9A 3Q3JB 2ATXA 3IO5A 1F3OA 4HDQB 1NVXQ 2CLCX 2QPTA 3QPUA 1P3JA 3VX3A 2CL7X 2DHRA 4IFBA 4ZCLA 4ESVA 4NYJQ 1LF5A 1P60A 1QHGA 1N25A 3FMOB 1Q1BA 2VA8A 4NCNA 4PC6A 2YHSA 4D2IA 1U0LA 2GCPA 4IDNA 1X8LA 1YR8A 1KMHA 4G3XA 3U5ZB 2ZJ8A 1CJVC 2J1LA 4LHZA 2GEUA 3A1TA 4YQFA 1L4UA 4RD4A 1VHTA 1GNRA 2RGEA 3SQWA 4AYWA 2DFNA 5CB8A 2AD5A 5IT5A 1P9WA 2GJKA 1XMSA 3I8XA 2HDNB 2PMKA 5L3QA 3A8TA 2J0UA 3FGNA 1G8GA 3EZ2A 5H70A 2BBOA 4B33A 1IY2A 4OQXA 3DHWC 4IDQA 5DN6D 2Z5FA 3AVXA 4NTZA 2G88A 3RS5A 3U7HB 5F9HA 1W36D 1JI0A 4IFEA 3CX7A 1UADA 1KZ7B 1G3RA 5JFGA 2R8RA 2Q9AA 4NCJA 3EPLA 1OHHA 4GI7A 4EJSA 3AB3A 1DE0A 2WVJA 4V0NA 4LYAA 2GF0A 1EK0A 4BUJA 5JEDA 2WSSD 1G64A 2ZXUA 2G1JA 2FOLA 2QY9A 2IYQA 1FMJA 2GCNA 2F7SA 2QE7A 3GJ7A 2R65A 3VAAA 1WBBA 4Q21A 4V0LA 1YR7A 3BRWD 1UAAA 1F2UB 2MMCA 4OQNA 3THXA 2A78A 1BKDR 2G6BA 3WHLA 2J5XA 4Q03A 4TT3A 1G4AE 3KXIA 4ILEA 1Z0FA 5HE8A 1AA9A 5E7JA 2J59A 1FUKA 1SVMA 1XCGB 1P2TA 2WKQA 5H1YA 1TQ2A 4Q48A 4C0KA 1LW7A 2QROA 4MA4A 3OIWA 1F6BA 1FX0A 1SQ5A 4LCBA 1D8TA 3A1WA 3AH8A 4H1VA 4TMZA 1IN8A 1T9HA 4KVAA 1GG2A 3Q7QA 4L16A 4OJKA 5HE9A 1YU9A 4BLTA 2FFAA 2LKCA 1R10A 1GRNA 4DDUA 4HB2A 2I4IA 4PPGA 3AKEA 2ANCA 2F6RA 3TLXA 4DSUA 4F4CA 2DCUA 2BWJA 2H57A 3B2EA 4PO1A 3U6KA 2O8FB 4AYTA 2BOVA 1C1YA 3CW2A 3EZ6A 4NL4H 4A15A 5EE9A 3O8BA 1PUJA 1Z28A 4YXWA 4DLXA 3QPWA 1UDWA 1Z0IA 4F92B 4Q1DA 1G8FA 2I1QA 4JL5A 5B58C 1R6BX 3CPEA 2DWOA 2RGCA 2W0MA 1J8MF 4NP6A 4P4SA 1F2UA 2WICA 3SE0A 1SZPA 2J3EA 3C14C 2GILA 1E6CA 3NBFA 3OIYA 5CYPA 5FPTA 5LB4A 1IN6A 4DT1B 4ZO4A 4PSVA 5EZ6B 3UMSA 1UDXA 4TWZA 3GLFE 4JLKA 1FL9A 1XPOA 3VU9A 2WJVA 4PTLA 2I3BA 3G5UA 4ARZA 1E9BA 4DCVA 2NZJA 1NLFA 3GJ0A 5B57C 2N1BA 3MFYA 1ZNXA 2R44A 1LF0A 3VKHA 5FPKA 1N3BA 2JLZA 4AI6A 3F0TA 2Q9BA 2IYVA 2W6JA 3SJBA 2ASEA 4B3DA 1J8YF 1MRNA 4POAA 2XGJA 2GEVA 1K5DA 1Z6XA 1N5KA 2VLIA 4DCTA 3CIOA 1A5TA 2PZGA 5H68A 4GRAA 2R62A 1AS3A 1A2KC 2O8FA 1E2DA 1HUQA 4Q4AA 2H18A 4H1UA 4C2TA 1MABB 2JJ1A 1SHKA 5J40A 4F4JA 3JVUA 4W5JA 2YWGA 4AC9A 3AVYA 1JXMA 4MRVA 2KE5A 3O47A 3PR1A 1CXZA 1Q1EA 4LYHA 4S35A 4QGFA 3T5DA 3VR1A 4GP7A 3AVUA 2ZSEA 4RJLA 2GK7A 4FMCB 1U98A 2Q3MA 4G01B 3ZZ0A 2C98A 2OXRA 4C0QC 2WKPA 1N0UA 2FN4A 5FTNA 2GWHA 3AKYA 2GDJA 1KO7A 4DT1A 2B8WA 5TVKA 2WWFA 4MUAA 3W6OA 5DHFA 1RYFA 3CZPA 4IXMA 3RABA 1GP2A 1ZCBA 3ADCA 3FHTA 3W90A 4JVMA 5SZHB 2HJVA 4PZZA 2OXCA 2IF2A 3TJZA 3C15C 3QF4B 3BFVA 5HZKA 1EFTA 2XJ4A 4TYYA 3VR6A 3V4RA 1COWA 2EWVA 2YV5A 5JLJA 4EPVA 2C8VA 4ZDKA 2PH1A 1UKVY 3A58B 3SC3A 2OG2A 2EFGA 4PAQA 3QKUA 2ZRBA 1Q44A 2FSIA 2QM7A 3LH5A 1S3SA 3AM1A 2Z6VA 2F55A 1NRJB 1VTKA 1XPUA 1UBCA 5G53C 4KSBA 4ZI2A 1TF7A
chains in the Genus database with same CATH superfamily
3HXQA 4WBNB 3PNBA 4EVRA 1OPXA 2PUTA 3V1TC 4CKCA 1VJ5A 1F06A 3F71A 1WA5A 1UK8A 2O8DA 1B3BA 1YBFA 1IOLA 4PR0A 3U37A 4A7PA 4BZZA 4QGSA 1DC7A 4INPA 2RGNA 4KKXB 4ZQFA 3A1FA 2P7IA 2WW8A 2YY6A 3ANXA 1A9XB 3ET5A 3IUQA 1R1DA 2K6GA 1EVIA 3KR0A 4FZVA 4NABA 3QYFA 2IXBA 3KLBA 4QPCA 4Y1FA 2PPLA 5DNUA 2GHQA 2BFWA 2I1WA 5IULC 2VDVE 5BSWA 3G68A 4C0JA 1VLMA 3NHUA 3KQOA 3IX7A 4FC7A 2IF0A 2QTWB 4OHCA 1RXSA 4G65A 4Q18A 1P2GA 4G1VA 4HQOA 2YBDA 2B83A 3JV7A 5HTKA 4DLAA 5JJCA 5KTKA 5FV7A 1QUEA 1J5PA 4LJ5A 3T9DA 2ZROA 4CFZA 3V4ZA 5IMSA 1SCKA 2I6QA 2BFCA 1EG7A 3KO8A 4F04A 3TYXA 1IK4A 4CKBA 3R9WA 2W90A 2PSDA 3NWEA 4I5IA 1TIBA 2P6PA 4MEBA 4ND2A 3OEHA 2NWQA 4KODA 1NMEA 5JMPA 4CMJA 4DANA 3N3BC 3V80A 1KR5A 1EIWA 1U8AA 1Q3TA 2B2NA 2VCEA 3M81A 1C9JA 1ZUNB 4I6GA 4MI9A 2E55A 3WBBA 5ITWA 3EDYA 1BHJA 2HCBA 2P2ZA 2QGZA 2NU9B 3HC7A 3OAAD 1TFUA 4ZOAA 2OBMA 3NTXA 1FVXA 2WF7A 4CLXA 4I4TB 3SNHA 2C1ZA 5E3HA 3HFGA 3AP1A 1GKKA 3A4YA 1KC1A 2BP7B 4TSRA 4YJDA 1PR1A 4MMXB 1UZMA 2R66A 3ECAA 2AXEA 3CVYA 4EA8A 4QJ4A 3AIKA 3MBIA 3UJBA 3KKNA 1VC2A 2YX1A 5CFZA 1US8A 2O2ZA 2QDXA 6LDHA 4LJ8A 1TUIA 3ZE7A 4D4JA 1XWIA 1T9DA 1VZ2A 1AU9A 2PV7A 2GZDA 1SVIA 3IODA 3R24A 1E2MA 1T1RA 3FYUA 4RK0A 1A76A 4RUKA 2G1KA 2CLMB 5ICFA 3FPCA 1E4OA 3SR3A 1OU4A 1AM4D 5HYVA 3HDJA 5CM2Z 4S1NA 3AESB 1BU8A 3ZJYA 4HAZA 4IKOA 1HFKA 1AXGA 3A6LA 3BXGA 1TM7E 2XCOA 5EHGA 1Y4SA 1PL0A 3EGXB 4NDNE 2V7TA 4YRKA 1JSCA 4YUXA 4OI0A 4RZUA 2QTAA 4MWOA 3WR5A 1N9ZA 1P0CA 2DGDA 2VNHA 4G5QA 1Z0AA 2IHTA 2WDZA 4QUIA 4R1LA 4ROSA 1ULHA 1NBIA 4CQLA 3LXMA 4WJZA 4EKYA 4IH9A 4NRDA 2OPHA 4QOGA 3OUUA 2PK3A 5A62A 3K9NA 3TOCA 1X1BA 1USWA 1UWVA 2P9FA 2PUCA 1YC2A 3P9ZA 4KUHA 2F2TA 3UFXB 2BIFA 3ADDA 4GM4A 4IJMA 4C7OA 1G21E 1P1IA 3PUYA 1MJ5A 4YRFA 2OBNA 2CXOA 4JC4A 2P6MA 2R1TA 1U04A 4EX7A 3DLCA 2GK4A 3MJRA 1F9AA 2GF2A 3I01M 3OX4A 3W9YA 4AZVA 5JQGA 1JHAA 1A71A 3BHNA 1GCGA 1CTQA 1RJWA 1CJKC 3IAM1 3ENQA 4GC9A 2BUCA 2VXOA 4TKMA 1T3ZA 2J6CA 2PMEA 1QIJA 2QRZA 4CE6A 1ONBA 4PLCA 4PV7A 1MX9A 2VP4A 3ZZUA 1R00A 4IIEA 4XH9B 2DLCX 2CKDA 3JXEA 1HE1C 1KZ6A 1MDFA 4J4BA 1DEHA 3DQZA 4RK4A 3S81A 2B61A 3F8TA 3WL4A 1E3SA 1A8SA 3MGCA 1YFLA 1BMTA 1GZ7A 5D3QA 3QJYA 4JI5B 3ICCA 2QJFA 1XA3A 4NMMA 5JDIA 1YONA 4GLJA 4HI0E 3L9WA 2HPZA 3CUKA 4O1HA 2OV3A 3HY4A 3OP4A 4L95C 2A4KA 3IHLA 3K3PA 1W4RA 1C7FA 1O6FA 2JIZA 4FWTA 2OWDA 5CURA 1KXZA 4X1YB 1XYYA 4LQLA 3SI7A 1CUXA 2ZETA 3FB4A 4REOA 3VNBA 3VZRA 4JC5A 3W2EA 2KHZA 7ABPA 3CG0A 3AYZB 3GGGA 4H59A 4CTOA 4AKIA 3QXCA 4FFBB 4FI3F 1DGQA 4X20B 4YQYA 4W99A 2BR3A 1X8JA 4BMZA 2FMKA 4RETA 1DFGA 4UJ5A 1GZ4A 3O91A 4A1OA 4FOSA 3ESQA 3QOYA 5IVKA 1QHXA 1NIJA 2F3SA 3R4CA 5JW6A 4XR4A 3NTUA 5EXDA 4ZAFA 1EVJA 1BVUA 2RDMA 4ZRNA 1GGKA 5H4HA 2JAHA 5K51A 3RYTC 4HH3C 4KDFA 4TZ0A 2MTBA 3CX4A 4WNAA 3CZMA 3L0DA 4AF7A 1HO3A 1TB4A 4MVCA 2FTKE 1ZNYA 4EW6A 1XQXA 2B4RO 3M83A 3ORQA 3O3NB 3TW4A 1YZUA 1ZOIA 3T94A 3QBJA 4RD2A 3GROA 4MUNA 1ADJA 3QUAA 1EWQA 1E62A 2X3YA 2X3UA 5FD8A 5B12A 1DJMA 1M8FA 4MTCA 5TGTA 2HD4A 4LPKA 2Q3CA 4B32A 3HJRA 3K5IA 3DCYA 1OXXK 4P4GA 3SHFA 5CH3A 1HE4A 1JV2B 3LLSA 4LTMA 4BNKA 1YQEA 4MUHA 4EHBA 3EY9A 4XIJA 4S1WA 2X58A 3RD5A 3UHPA 1QBKC 4D5GA 5AKJA 4TWBA 2FMUA 5B7QA 3IKLA 3GMIA 1KOJA 2C29D 2XHZA 3SVZA 3QQPA 3D02A 3FX2A 1WABA 1FLVA 1E3JA 3H4TA 4MX8A 4DLVA 3C6ZA 3UG7A 2R8OA 1DXYA 4Q7MB 1W0KA 3OIFA 4HQFA 3OMWA 3QLEA 3ODGA 3MUOA 1YDMA 3R7WB 5C7YA 4WPGA 5EWLB 5MN5A 3ZV5A 2W8BB 3F9CA 3L7NA 3JAKB 2PYDA 5CT4A 2Y99A 1PFWA 4L4YA 4WSOA 1TVKB 4N0DA 3ISJA 3U4IA 3KOUA 3LRXA 3HSKA 3BB3A 1KI2A 3SD7A 2NP7A 1G3UA 1KI6B 2Q41A 3ICPA 1X7WA 1Q11A 3ZV3A 4EO9A 4XVUA 1IDN1 1DKQA 3AC0A 1KNXA 3P9YA 1SY7A 4N54A 3N76A 4QBFA 5FTWA 1B1AA 2FVYA 3MC1A 4EW3A 4JU8A 2E2WA 4YJ2B 1CJUC 3FF4A 3JQAB 3PC6A 3WV4A 4FGUA 3U49A 2CXSA 2O14A 5IG2A 1M5UA 4BO8A 3BFKA 2IOHA 1I7QB 3WNCA 3ZCQA 3KZCA 2F8SA 1AK9A 3C3XA 3R5FA 3HZOA 4JY7A 3P2JA 5F1YA 1CJBA 1FLAA 2HREA 2I4TA 2VP6A 3VR3A 1JGTA 4CR7A 4KV9A 5DPMA 4I9GA 1JR3D 2WDPA 1HE2A 5JS8A 3HVUA 2G04A 5EIWA 2EC5A 1PZNA 2C78A 2F3RA 4NV3A 4BO9A 5IJ9A 4WY5A 4AU1A 5IUJC 1KHHA 2F1JA 4GBMA 3FJ1A 3VR2A 2HK7A 1Z6QA 4IV8A 3VV3A 4PRZA 4TSFA 3FFWA 3HTXA 3MWGA 2LPMA 2MINB 2IS4A 3B8HA 5KOJB 3K72B 1T0JB 1VCIA 3EIUA 5EHIA 3ZCTA 3ACDA 4P82A 5B4VA 3L0YA 3AF5A 4FYIA 1IZ8A 1JDSA 2DM6A 4YNBA 1EK5A 1H65A 1NBEA 1P3Y1 2C4UA 1IHUA 3FETA 1F0NA 2YTZA 4IH1A 4IDOA 4NV0A 4RABA 2AOVA 4E5YA 1RAAA 1X7GA 3E15A 1DCMA 3LUJA 3NRCA 4A2CA 5KJEA 4C2AA 1R4NB 1IQUA 1R9JA 2RHDA 1Q1GA 4RS3A 3I2HA 2FLKA 4TQGA 4KAJA 1KKUA 3HKDA 1SVLA 1YS7A 3PXEA 3B8EA 5KZMB 1T4MA 3Q9UA 1R18A 1H6BA 2CB9A 1C8KA 2I4OA 4H7IA 4UUBA 4XDHA 3SOPA 2RHCA 1JNYA 1T2AA 3F3SA 5FUQA 2JDID 2FP4A 5JNTA 2QAGB 4E21A 1ABEA 3FVVA 2DKNA 2DWCA 5AM0A 1J24A 3ANYB 5IHPA 5E6UA 5JWOA 3C7DB 5FL3A 1MB4A 1VSUA 3GIDA 2GM4A 1JJVA 3ZBQA 3BQ9A 2HIAA 1UEJA 5LLSA 1YFJA 1TUEA 3LC0A 1TF2A 3D5TA 5EJFA 2HNBA 2Q5LA 2DR0A 2KPOA 4OHYA 1GCOA 2HEIA 3JASB 4CLHA 3L40A 3IRVA 3MJVA 3WIEA 1YJCA 4ZVVA 4R41A 3B5JA 4FGJA 3TLBA 3RSHA 4UFOA 2ZB2A 1AZTA 4HDOB 2QX9A 4MUKA 3IVGA 4E1AA 1OUMA 3FNFA 2IRWA 1XCLA 1ZIPA 3E7WA 1HBJA 2FKAA 4M1KA 4RA9A 4BUZA 2J9FB 5JQWA 2QXYA 1NX9A 2B3DA 4S12A 1Y6JA 1RM5A 1TTQB 3KL2A 1JTFA 4U00A 3UC9A 2WIAA 4DYDA 3NHWA 1DAPA 2VPZA 4G1CA 3EF3A 3MIIA 2D62A 4TRNA 4W5RA 4GZLA 3N3AC 4I08A 2VA9A 4QHTA 4WFIA 3CF2A 3DQQA 1Z34A 1DL5A 3RJ5A 1QH1A 2AKEA 1NN5A 1O95C 5BMOA 3RIMA 2G1AA 1M67A 1TAHA 1TKCA 2W6MA 4CR8A 4EF6A 3QKTA 2BM1A 1BDIA 3TRFA 4K03A 1Z2PX 2IHVA 5KNBD 1VPTA 3HKCA 1JG3A 4CEJB 1CBUA 2N0SA 3CZ4A 3NC0C 1GNQA 4FYYA 1H2RS 2J33A 2X5KO 4PZ0A 3VQTA 1Z2AA 3B1ZA 3IELA 2IYUA 2ZTSA 4BQNA 5CDSA 4CVNA 3KWMA 4HGNA 3RC1A 1QLJA 2GWRA 5FIUA 3OWHA 4DEYA 4F4DA 4OXNA 1UBNA 3AEZA 1QDEA 3AP2A 3K53A 3KZVA 3P2IA 2VQDA 4I55F 3DE2X 4N0EA 4MS4B 4Z3KA 4E07A 1F8YA 4IHAA 3I6ZA 3OCJA 4PHCA 2HWXA 3C6QA 2XRFA 3RIHA 3LU1A 1L4KA 1Q20A 3GI1A 1KO4A 1HYBA 1NY6A 1XVUA 4MKXA 4PQGA 1YGYA 4JLAA 3TE6A 5J4HA 3GUCA 3KAKA 4OUKX 4YO7A 2WE7A 3BM5A 3C97A 4PYKA 4URFA 1NA5A 3BRQA 2NZWA 1AO0A 1TVMA 1QVWA 3AUAA 3LPDA 1FDVA 1E9EA 2XOKA 3LOUA 1E2FA 3LPAA 4B6SA 4E5DA 3RUHA 2IDZA 3ASZA 4HFMA 3MTQA 3QX8A 3I09A 3E9QA 2XVAA 2VTEA 1JEOA 1MORA 4F9TA 5G02A 1DX9A 1LQTA 5IJWA 5KTRA 3DOIA 2CCGA 1DKUA 2IYOA 3O3CA 2AN9A 3MS4A 3BHIA 1IL0A 1VP9A 2AQKA 2EF0A 4IFIA 4L5JA 2PNFA 3GW8A 2PN1A 1DIBA 3AILA 4KHZA 4ITVA 1D2GA 2L17A 5I7OA 1EBUA 1LI5A 3KJEA 3QLTA 4D9MA 2MYUA 2FWIA 3BICA 3EODA 1NBOA 3MYRA 4GMXA 3WG9A 4BFYA 4ASUA 1PZGA 2IDKA 3EAFA 5K20A 3SM9A 5GJBA 1FMFA 5AW2A 2ALJA 1IZ0A 1CF4A 3P2EA 1M7BA 1OLXB 1YVUA 3QXJA 3ZY4A 5JO0A 3TL3A 4XSGA 1Z2CA 5FPQA 1RMQA 5LZ5A 3VGJA 1PT8A 1NGSA 5FADA 1UPXA 1XAGA 2VJDA 4ZO6A 5FA6A 4EI7A 1FDUA 5I51A 3KQVA 2AOUA 1MCZA 3CVWA 2I2AA 3Q6MA 2PD6A 4OTZA 5BWMA 3RRYA 2VYNA 4TTQA 3B6IA 3RQSA 1KMQA 4EHIA 1QIHA 1U7XA 2DQYA 1AKUA 1WUKS 4IGEA 1P6XA 4MITA 1RAIA 1J1UA 4R8MA 4PTYA 4RGYA 4LF8B 2W6OA 5LA6A 2BMAA 3CF6R 4O1MA 1AUPA 2BJVA 1QX3A 3DHNA 1AKYA 2XTZA 3KALA 1PS9A 4FFSA 3HCWA 4QU5A 3SBDA 3PWSA 3RTBA 3TLAA 1AKMA 4QFMA 4AMGA 3PRKE 3CXUA 1H1TA 3O92A 4A03A 1WDLA 1V37A 3EISA 4TKLA 2A1UA 4N0MA 2J6HA 3DZCA 1ESEA 1J2JA 3ETJA 2ZI4A 3SWWA 2B6NA 3B3QA 4MQ6A 1CFJA 3NHJA 3WL5A 3QBEA 2VJCA 4A6DA 1JEYA 4QYTA 1PLJA 3IEKA 4JX9A 5FNVB 3UF0A 1EP2B 2LNDA 1I30A 2OYSA 3PUWA 1RABA 5CYFA 1LX7A 2XBMA 3IKJA 3KEQA 3KELA 3NH9A 4GEKA 4KH1A 3WL8A 2CLHB 3ZVKA 5TEVA 2QVLA 3HADA 3EC7A 2AFIE 5F33A 4JYBA 1LZKA 3WLJA 1LNSA 3M6FA 5JVDB 5AVOA 1R6UA 1IHOA 1NYLA 3ABQB 1YR9A 5CVTA 3B89A 1XJ0A 3GH3A 2Y9PB 1NUUA 4R1NA 4BVAA 5JDCC 1RMTA 3V6LA 2QUAA 4TRRA 4YDRA 4TZTA 1ZY2A 3GLSA 3V7NA 3QX3A 3LRPA 2DY1A 4OL9A 3SHWA 2VDNB 4UVIA 2V1XA 2D1YA 3RJ9A 4ZA2A 2AFVA 3E03A 4WHMA 3EXEA 3EIWA 1KDPA 1U65A 2B1JA 3EWNA 3UYLA 4BN0A 3W2TA 1UUFA 3W1WA 5KU7A 3M7IA 1VDMA 4YO8A 2QMEA 5GWXA 3SNKA 2UYOA 1Y9ZA 5HMLA 5CA0B 4O2AB 1C3OB 2RHLA 4PE5B 3UCFA 4HDCA 2CNDA 4YMSA 1MD9A 1RQ2A 3G2IA 3DXYA 3PGA1 5DEOA 4FM9A 5HHTA 4BNDB 1XCBA 5BSEA 1OSNA 3V3KA 5AYVA 4ER6A 1L2TA 1Q95A 3IP1A 3V3TA 4LJ7A 5C32A 1UL1X 4KRFA 4KFRA 4KGDA 3CLSD 1XZBA 3OJWA 4GP6A 1ULAA 2IYSA 4X3OA 2NSLA 1NU6A 4Z9FA 4C4AA 4EZBA 3S7TA 1RXIA 1O95A 4HQLA 1YR3A 3OIGA 4Y98A 2ZU6A 4A91A 1E2GA 1VL0A 1Z6TA 2G0AA 2XQVA 3ZU5A 4YMTA 4ZIRB 1FP2A 3V1YA 4NX2A 4G4SP 4GX2A 1ECGA 1YZQA 4PC7A 3C5VA 1ZFNA 3PPWA 2GJSA 2ZJ3A 5DMHA 3RR2A 1I10A 3W9BA 2NUAB 1E9DA 1LA2A 1OFTA 3PXAA 1SUBA 4HNSA 1KDYA 1T13A 1GTJ1 3ZWXA 1BH2A 4YRIA 4RHFA 4KQ2A 4BASA 5KOYA 2IYAA 5E2BA 2Y1OA 2AC7A 2BW0A 3CRVA 1NL3A 3ESYA 4QJ5A 4YROA 2Q7OE 3SX2A 4D3SA 1F7VA 5H82A 2CVHA 3ESXA 4PZYA 3H17A 5THKA 5D2CA 4ZCRA 1Z6ZA 3IMCA 3TSWA 4EB8A 3PTAA 4O3MA 4UMVA 3UBMA 1R37A 4K26A 1JPJA 3LHIA 4ZOCA 2IEZA 5B1SA 3MW8A 3FDFA 4HUQB 4M89A 4A10A 5I9SA 2D7DA 4XI9A 2PVPA 2HPVA 1SBTA 3LMKA 2AXNA 1EINA 4JQYA 5LZ7A 1UK9A 5F98A 3HA5A 2V4ZA 1H94A 2K4MA 3LVQE 2DSNA 4HWKA 4J76A 4DEXA 2YRFA 3K1AA 1P80A 3ZQ4A 3W5DA 1B6GA 4K5QA 1EJ0A 2WHEA 3I64A 4ZP1A 4V1CA 5BWBA 2X0EA 1Y8ZA 4PVCA 1PZXA 3TD2A 2VWQA 4FGZA 1V35A 1JSRA 2BONA 1GKIA 2XZLA 3F2VA 4JBYA 5CXUA 4O3FA 5ILOA 3HBMA 3O7MA 3ZGXA 3KZNA 3PEVA 2O2IA 4HAUA 3P1JA 1TK2A 1H9AA 2W43A 4MRMA 2V7GA 3FWZA 4Y9SA 1BHSA 1RBQA 5TF4A 2Z6UA 3EUAA 1NQOA 3DZKA 4G1MB 5FFFA 2FWBA 2P79A 3KTAB 4D99A 2I78A 3I92A 3NBUA 1RJFA 5DK4A 4AP9A 1RYMA 2G5PA 4GOOD 4C0WA 2P9EA 1YO6A 4YYZA 4NE7A 4WOKA 4UQPA 1RXUA 3Q87B 4I7EA 2BE7A 4GMDA 1YJQA 2HF2A 2BZGA 1MX1A 4MRNA 6ADHA 3NDBB 2JRLA 2IYYA 2OV6A 2CE7A 2GO7A 3G8YA 2VDMB 1ECBA 3U4AA 1HI9A 1UBKS 4XB1A 1NKSA 2P78A 2QN7A 2QN2A 1AS0A 4Z0HO 2WV7A 4CT5A 4EY5A 2QMYA 1P4RA 4ZZ1A 3A6ZA 4DSNA 3K70D 3KQUA 4MQUA 2Z1DA 2D13A 3IQIX 1L5OA 2JHAA 5B7NA 1YVEI 2N9UA 4WBXC 5BOVA 2XCTB 3H19A 3HCAA 4L50A 1KIFA 2VF2A 5THQA 4JI3B 4FB5A 2WPDA 2XKAA 4WJKB 1DC5A 1T8TA 5BRAA 4B6PA 1D5WA 4IGKA 2FPPA 1U81A 3CH4B 4P3PA 5ENVA 3I2FA 3WLTA 3OVMA 2VWGA 1C50A 2OK7A 4KB5A 1ZIYA 5EZ5A 2VJMA 2XVXA 1FW8A 4WQMA 4RK5A 2JGAA 1XXLA 3HGTA 4XX0A 5EHNA 1QH8B 2E9SA 3KLMX 2FSHA 3DDWA 3D0OA 1HZJA 5GGYA 2WUGA 1RXCA 1OYVA 4PN7A 2A3NA 1SEVA 2TSYB 3AFMA 4O02B 2Q6VA 2SKDA 4TV8B 1U5BA 5EHQA 4CKWA 1Y8QA 1CQJB 1P6UA 2CUZA 2EKDA 3A4MA 3UH0A 2YFHA 4MW2A 5AK4A 4C6RA 4EWLA 1U0TA 2GCGA 3O2QB 1O8CA 1OOEA 2WSMA 3AO0B 4JLDA 4MYUA 1PJ4A 1PZFA 4CLOA 1NN1A 2QMOA 3OOYA 5DP1A 1QP4A 1UXIA 1LNZA 4TTAA 2I3GA 1AK2A 3B6MA 4HZUB 3PDWA 1DV2A 2YZ2A 3EWIA 1ATIA 3HA3A 3OU6A 3KDAA 3PL5A 4PZ9A 4H77A 1GPAA 3IPRA 3VR0A 2ZUWA 4IEFB 5DWDA 1PWHA 1ZMBA 5CPFA 1T1EA 2NZYA 1N2XA 3GRCA 1C7JA 2JIRA 1Z88A 3TJMA 2AR7A 1I2AA 3MTJA 1RRVA 5COQA 4ABTA 5K8CA 3ZBUA 1NJFA 4U9IS 3NOVA 3OPYB 5I7AA 3R75A 2B1GA 5F23A 5M34A 1CZKA 3B51X 4UMFA 1WHSB 1XTUA 2JJ1D 3NHSA 1UKCA 3FFXA 4QRDA 3MWDB 1XR3A 4Q7KA 3THSA 1BX1A 1DO0A 1GILA 3SSAA 4CMKA 4ZCMA 2FEWB 1U1EA 3WYBA 4RDXA 3S8MA 1WSBA 4LZNA 3RRMA 2YXPX 2VQFB 1MV5A 1NY5A 1WUYA 3PWTA 1LI4A 1V6SA 4JITA 4UVDA 2OA0A 3V2GA 3IHKA 3VNRA 3BSYA 4OL0A 2QTBA 2VDOB 1NV8A 4X1IA 3V7UA 4DCUA 3IB6A 4G0MA 4W7IA 3EOBI 3N8NA 4LF6B 3HUEA 4H3VA 2O2DA 3WLNA 4ZCIA 4E31A 1LBTA 1QORA 1SUIA 3DE4X 4NZOA 1CJCA 4BMNA 1NSFA 3PC4A 3UKJA 3W8NA 4RTKA 3K30A 4K6CA 4F7DA 1IQPA 1L1FA 4INJA 4MVJP 4LGYA 5JAHA 1QE0A 4WKPA 3T9CA 2IZZA 3PI7A 1X1AA 3CEPB 1T3HA 2FZ5A 1QVZA 2HQBA 4WVFA 5I01A 4HNAA 4IW3B 3IPXA 4EGFA 4DDKA 2G9RA 2IOQA 3LQFA 4RY2A 2GAFA 1K63A 4FHZA 4WA7A 3N0RA 1EJ2A 3JZAA 3NAZA 2Q7DA 5BQPA 1YRWA 2EFCB 5C8VA 4LUCA 2PT6A 4MJLA 1TK3A 5K6TA 5L6MB 5FFMA 3VXKA 2W6QA 4MUIA 5DHAA 5IAJA 4L4UA 4D44A 3WAGA 1NQXA 1JL3A 2XXBA 2NU6A 4BVHA 3U19A 2CBXA 1C30B 4JYCA 2FWJA 1NLYA 5AHXA 1XZQA 2F8MA 3QTLA 5AW8A 1ZIXA 1QQ5A 3BFPA 1RD4A 4PXYA 3FTPA 3F2IA 2ZSBA 3RU2A 3HWWA 2BGWA 1TKAA 2QXUA 1LLUA 3S2IA 3VC1A 1IDOA 2RJNA 5KSOA 1YS9A 2V7QD 3OCWA 4M6WB 2Q6IA 4YMLA 3U40A 3GFVA 3ORHA 4H31A 4UM8B 2Z9DA 5A4KA 2VOEA 3BSFA 4KMRA 4B82A 2IZ0A 1O03A 2K2QB 4N7BA 3KT3A 2FK7A 2Q0XA 3EGCA 2BFAA 1MQAA 1TD9A 1W46A 4DKXA 5FEUA 5LD2B 4GKKB 2SICE 4GZMA 3BQMB 4KPUA 4GYWA 1ULTA 4AP5A 4LFAB 5CP8A 2OK8A 3COSA 3UQYS 3OX2A 2Z4RA 2EBWA 5KOHB 1XRMA 4FGKA 1RYEA 4XIGS 5K1ZA 4E5PA 2VPYA 2PGAA 5IAEA 4JI8B 4AJ9A 4YWJA 4GXRA 5BVHB 3RRXA 4HF7A 3VOAA 2WP0A 1EFKA 2VYQA 3RNOA 1Z6YA 2P9TA 4AJ2A 4IQGA 4JD5A 2G06A 4B83A 4HLCA 3UEOA 4YT4A 2EG5A 3HWRA 3AUYA 2OAEA 4Q9NA 4RFSB 3R5XA 3BREA 3VTAA 1JTVA 3ZDFA 1ND5A 2WT9A 1N2ZA 1AHPA 3Q15C 3PJDA 4A0HA 2PR7A 4HQ0A 1OJLA 2BZSA 5JJKA 1MNQA 2XUGA 3JRXA 4K1LA 3TNYA 1XF9A 4AKGA 2OB1A 2OLJA 1WZUA 3B2QA 4LI3X 4R54A 4ER0A 3S70A 4BCDA 4YRMA 4B47A 2UYGA 2ZFUA 3BORA 4FD2A 4DBVO 2IX9A 1V8OA 3HU5A 3UV7A 3P32A 3ZE9A 3ORFA 1UT5A 4K6KA 4FBGA 3B20A 1BVRA 3CNHA 3GDWA 4IIBA 4P7FA 3RIXA 3IAFA 4JEHA 1XDSA 3C7KA 2YWCA 1DIAA 1WPRA 3CO5A 4Q16A 3BPSA 4FGWA 1P77A 2R7AA 3AF0A 1Z5VA 3CWZA 3JAWA 2QX4A 4EPTA 3DTNA 5AW3A 1DX6A 4DIEA 4X65B 1Z13A 1H3FA 4F3YA 1I7SB 4KXMA 1Y89A 1FLDA 2W71A 4UVGA 1KSFX 2I7CA 3V8NA 4EP1A 5LP6A 3P9QA 1EDDA 2AGVA 3LGAA 2ZUSA 4WV3A 1MB9A 1OX4A 2P62A 1ZIOA 2P9GA 1BXRB 1KQNA 1C9KA 4KXXA 4BKRA 2A2ZA 1R8QA 2XZPA 1UQTA 2ZSUA 2LVBA 1BFKA 1MO3A 2Z8XA 3IQEA 3JD2A 1R6VA 1WQ4A 1X87A 3RG8A 1Q0UA 3IP8A 1QYWA 3ZX4A 5KSZA 1M2VA 2HJGA 2PWPA 5JHGB 3KK0A 1R0KA 5KO2A 4GP9A 4DG9A 1JMYA 2QI9F 3NQ41 4UATA 2A57A 3K0AA 1N6HA 3NYIA 1IUOA 3KKOA 2ZEJA 4OREX 4P53A 4FMBB 5KHLB 4TPKA 4E11A 1T2VA 1EQ2A 1Y5IA 4LYEA 4TVKA 3RRZA 5IFKA 2ADFA 1VCMA 1VKRA 2NO7A 4GSYA 1TTHA 3GELA 4LK2A 2BSAA 5ALOA 1QZ3A 3ZDXB 4B3SB 2HUNA 1LRKA 1YQDA 3PEYA 1JJAA 1EFPB 1JLHA 2GM5A 3RVNA 1NASA 4LVNA 5JAZA 2LWIA 2I7XA 4WECA 5SV2A 4YV0A 3EG9A 4EEKA 4JT4A 1O1YA 1P19A 4TS9A 3N7TA 4F86A 2DWPA 1QIMA 3VNVA 4DJAA 1BXKA 4G86A 1F3LA 5HK8A 3JQBC 2Z8YA 4NICA 4D9JA 3P0EA 4ROTA 4YRRA 2AN4A 4YRJA 4XWOA 4IZIA 1QV9A 1T8SA 3VMMA 2BEJA 3KUCA 2GVDC 4B9EA 1K08A 1AKQA 2XMPA 3DPUA 4EI8A 4PQEA 4NEQA 1OT3A 2O6LA 4JEMA 3T1HB 4H0FA 3IS3A 4N47A 2WJYA 1IZYA 4EZEA 3CUEF 1I4WA 4JP1A 1FB5A 4OQFA 2ZRDA 3KZ1E 2LW7A 4TYMA 1YBVA 3TTWA 2CSXA 3GRYA 1LLQA 1E5XA 2A5LA 1ZMTA 1FTNA 2VF5X 2NO6A 2LZ0A 3AGPA 1K27A 3F5MA 2GETA 1TA0A 5LQUA 2QTMA 1J8QA 2ZUDA 1OAOA 2VUSA 3ZJUA 3T1TA 1NXVA 5BXYA 1J0XO 1A5ZA 3FUUA 3V42A 2HMAA 2VTBB 4OHMA 3ZHVA 1P4AA 3O6VA 4YP9A 1GGNA 3C3JA 5IANA 1FQJA 4BGIA 3NONA 4B43A 1QU2A 3WYAA 4JI7B 3OEED 3ZDDA 3JQGA 3ZKWA 1OC4A 1BMQA 3VPCA 4HRXA 3KKLA 5LC1A 1JAYA 4A26A 3AZQA 5IKEA 1ISSA 1UAYA 1AIPA 4M55A 4RWZA 1T3SA 2BI7A 2R7KA 4Q3OA 1ZI9A 1KI7A 3B3AA 4EDHA 3DW1X 2B36A 2HF7A 3R5HA 1C81A 5T57A 3CLTC 4K9QA 2ZSFA 3WYFA 4TKVA 2WJWA 1LTQA 5H9VA 5A4AA 1M2FA 2H7XA 4F6CA 2ZBDA 1KERA 1L6RA 1P7PA 1WE2A 2A67A 2E4VA 2WF5A 2C3UA 2WPNA 3BHJA 3E7FA 3H9CA 3QUQA 5CVEA 2EATA 5LBTA 3SEZA 1EDOA 3GJXC 4IRXA 2P9CA 4O5AA 4QDKA 1SAYA 2VF8A 1N1MA 1NSYA 1HDXA 2DTEA 5AJYA 4KQIA 4EUNA 2A9FA 1YB1A 3PK0A 1R9NA 1KYQA 4B85A 3LUGA 5EJGA 4H6WA 4OA5A 1L7MA 3ZHOA 5KWSA 1A8QA 4UAJA 2V8OA 2NSJA 3AEUB 3PFGA 3MJHA 4QPNA 1KYTA 4UCFA 3OKCA 3EN0A 1IY1A 3N2ZB 4MW1A 3LT1A 2G9UA 3C5WP 4BJ5A 2WTUA 1H8EA 1TO2E 2VP0A 3IMGA 5HIIA 1U11A 2XQJA 1NRIA 2X8LA 2AYZA 3EMVA 1DCTA 3EDQA 2UUAB 2XMGA 4HMOA 2PRSA 1V96A 1YUBA 3DFIA 4HDKA 4PX3A 1GUFA 3VZCA 4M1WA 2R751 5FPYA 4TOIA 1JHMA 2OCBA 2B4AA 1NW9B 3EW9A 4Z1MA 3ZV6A 2ZUEA 1FSPA 2DY0A 4GPIB 5IM4A 3ES9A 4NMHA 5JROA 1NVGA 1C0KA 2OO7A 3BXOA 4W1SA 1XXHE 2OTCA 2QL5A 4LW8A 1EBFA 2HLPA 3DJFA 1G5HA 4J3FA 3RFFA 1HT0A 4E15A 5ISMA 1OH7A 2CBGA 3IO3A 3MYYA 3BGDA 3DTYA 5JZSA 1GQ2A 1XLVA 4G41A 1OIVA 3TQHA 5T8KC 2N1MA 3JWIA 2HBYA 1BQ3A 3O4JA 2CJWB 4K0KB 2V74B 4DCSA 4GDFA 2ZE7A 3UAZA 3VZSA 4PM4A 2RHTA 2EQ5A 1Z5PA 4C3OB 2DSTA 4NG5A 4KZPA 1KBQA 3PX2A 4YJ3A 3ITKA 1V0JA 4U2EA 4WEQA 3FVQA 4BB6A 1RKUA 1TXGA 3FSEA 1WXGA 5ER9A 5BVGA 1Y8AA 3GRFA 3UAXA 4RZ3A 1LV8A 1W36B 1LK5A 2GD2A 2EKPA 3ABIA 3V4FA 4M1ZA 3VSEA 4XWYA 4JI1B 4X5OA 2NT3A 1QC5B 4QSHA 3UO8B 1QWSA 4MQFA 3TINA 1KKLA 2IK8A 1X7HA 3C8DA 2RHMA 3D0KA 1CUFA 4OH7A 4H17A 2OFPA 2SCUA 3V2HA 3LY9A 2MOKA 3Q41A 1DQNA 3U7QB 3W34A 2GNPA 3GEPA 3VYSB 1NQAO 3WLFA 1WVGA 1NSTA 3WRYC 2XZOA 2AMLA 1ENYA 3LECA 2NXCA 2ODEA 4EO7A 1I4DD 4F2DA 3NHFA 4E2YA 2LCQA 2CNWD 3LDUA 4JYAB 2QUBA 1C3LA 2AYYA 1E1KA 2PYZA 3HLTA 4OBWA 3UAOA 3A4TA 3M4XA 4S0XA 1GAXA 3A6DA 3BMNB 2O1EA 5MN4A 2VZ9A 4FKBA 4HOYA 3AVYA 2AFIB 3OJFA 5EKDA 4DAEA 1YS4A 5KQGA 1MAAA 3LOQA 2WKRA 1Y1KE 4GOJA 5AI5A 3ZHTA 2G5GX 4ATNA 1JP7A 1E9AA 3IIEA 3KV3O 1YQQA 1KZ9A 1R0RE 4QBKA 3MMSA 2JFOA 3EXHC 3JYLA 5C8XA 1MF7A 2BFFB 1RQ7A 4CN8A 3D43A 3OC6A 5JJBA 1DWQA 2JK1A 1AXRA 2LR0A 3RC7A 2ZUBA 5F2NA 2PUGA 1WAMA 4B17A 3IQWA 2V59A 2V7BA 1EP1B 3LNCA 3SYTA 1BFDA 2JEOA 4A16A 4BFUA 1PSZA 5CJ2A 3SEQA 4AY2A 1CLEA 4TRMA 4Q4JB 2PGOA 2QMQA 1W2GA 1DRWA 2JJ2D 3WHIA 1A9RA 1QXSA 4FFRA 1TPZA 2VK1A 4QU8A 2JH3A 1RWKA 5ALFA 4HFRA 3KX2A 1GLVA 3KQSA 3DHEA 3FSGD 3LK6A 1AA6A 1M1UA 4K46A 3IURA 3RNLA 2OCAA 1SVNA 4TV9A 3J80A 4BV2A 4MQEA 1OQAA 3ILYA 1L5HB 2YDYA 2UXDB 1GU0A 1OZ0A 1X94A 5HCIA 1L5VA 2RK6A 2WHPB 1GFZA 3PNVA 3R8FA 1V8FA 2ATVA 3BRWA 4FIZA 4EDFA 4M9QA 1W94A 4UASA 5AM3A 3EBLA 4C0XA 3HWSA 5LZ2A 2QIPA 4U2FA 1P2FA 3RUCA 1H5NA 3ZD7A 3L1VA 2HYIC 3CJTA 4IIFA 4PSDA 4BB0A 4DGSA 1VZ3A 4DJTA 1BX3A 1Z4LA 3I32A 4M1SA 1J90A 5CH5A 4AXXA 1NQVA 5F76A 4BVBA 3IPLA 2QLMA 5B5SA 2JGDA 2QYSA 4HNQA 4RL4A 3E5RA 3OLWA 3TBKA 3L1KA 4ZYWA 1PK8A 3RB8A 2JLCA 4BLPA 4XUEA 3ZWVA 5FBHA 3A6GA 3ABOB 1K3TA 3OMXA 5CEEA 1IUNA 1NTOA 2IIBA 2AEJA 1ZH4A 2ODPA 3GLFB 3HDVA 4KQ9A 4IDPA 4PR3A 3GV0A 4H18A 4J90A 1A8UA 3ZDYB 4I2VA 1FOEB 1G8PA 5JJ5A 1S02A 1KPHA 4MVJD 1R9GA 3A05A 2O8BA 4OA8A 2B1IA 4S1OA 1THGA 4MGHA 9GPBA 3I53A 4I6EA 4JCOA 3H1EA 4EUKA 3DZFA 3PVSA 2QG6A 2KLBA 2JHCA 4XPZA 3WLRA 2WJGA 4NOJA 3DMGA 1FFXA 4Y2XA 3LO8A 4LXQA 1A4IA 5E1MA 2WWXA 1XDDA 4Z7NB 1K9VF 5JYEA 4YRNA 3C85A 1ZC4A 1UBOS 3WB2A 2RJ3A 4I0WB 1PZHA 2FEPA 2V6MA 4A0FA 3PQFA 4BP3A 5AVXA 2C92A 1TZBA 3SJZA 4BN5A 5K0BA 3HN6A 4HSGA 3REQA 1GTRA 3EPKA 1AKNA 4PSUA 1N8NA 4OAPA 1BW9B 5DWQA 1C7RA 2ODTX 1CDDA 4MKZA 3AKDA 4JDUA 5T8KA 5CIQA 4R6XA 1KVRA 3MB8A 1OYYA 4LZLA 4OFXA 1NNSA 2FNAA 2O3QA 3KTOA 4X7PA 4HNVA 2GHIA 1Z5GA 3VVLA 3D3KA 3FI0A 4CCAA 2ZUFA 1TUGA 2VQ3A 1Y81A 5BN5A 3UY4A 2WFLB 1MC4A 1LLCA 3FBTA 3H3XA 1V2H