3W90A

Crystal structure of cmp kinase from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
198
Chain Sequence
GIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRAREQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Crystal structure of CMP kinase: insights into initial substrate recognition and reaction mechanisms
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 70
structure length 198
sequence length 205
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w90A00
2G1JA 1OSNA 2GJSA 2PJRA 2IEZA 2YHSA 3ZQJA 1NVWQ 421PA 2G1KA 1E0SA 2RH5A 1IHUA 2ZXUA 2ZJ5A 3I3SR 3NDBB 4LOAA 1W36C 3A37A 2WIBA 4FIDA 3RAPR 1SXJE 3GJ5A 4LJAA 3PUXA 1SKYB 1CXZA 4Z54A 3MAAC 1WRBA 3K70D 1RPZA 2NG1A 1G20E 5EXPA 4C3ZA 5EZ5A 5AJYA 2O8DB 3GLHE 4Q7KA 3V4RA 2VP2A 5KU1A 1F5NA 4D2IA 1D8TA 3AGQA 1XTQA 4G5GA 2P0EA 3E1SA 5SZJA 3OEHD 4DSTA 3QQ5A 4DLTA 2QAJA 2FPMA 1NN3A 4YLGA 5AR1A 4F4CA 2O8DA 4HATA 4KBGA 3X2SA 3UPUA 4LDJA 4V0ME 1CF4A 2BM0A 4XVQA 4OI2A 4MRRA 1JAHA 1YU9A 3V00A 3DZ8A 1NSFA 1BH2A 1NY6A 1E1QD 1ZC4A 2O0HA 2RGGA 2VQSA 2YWGA 3NH6A 3QEJA 3TH5A 1U90A 2ECKA 3FFBA 4MGYR 5FBQB 2IA5A 2QT1A 2FFHA 4LHYA 1GITA 4OJKA 2O5VA 2ZU6A 4ZCLA 4M8NE 5L3SB 1KJYA 4WVFA 3IEUA 4JVMA 4DXAA 5EJEA 3U60B 1G18A 1NKSA 1BO6A 4NPHA 4OYHA 5HZKA 1JAIA 3H4MA 1X1RA 5SZHB 2BEKA 4PSKA 1BMFD 3WXMA 2ZVQX 3NBFA 2QUZA 4QXAA 1SVSA 1AK2A 3WYGA 2FE4A 1HE1C 1QHIA 4US2R 1F2UA 2VRWA 3LH5A 3ADCA 5F98A 2BVNA 3T1OA 1E2PA 1G8GA 2BEJA 5L3RA 1MV5A 1HYQA 3P1JA 3W6NA 3PCRB 2OHFA 4KSCA 1AKEA 5FTKA 4JVSB 2XZLA 3SYKA 3ZGXA 3SBEA 5B58C 3MFYA 1UPTA 2JJ1D 3QUSA 4PZZA 1NKTA 2ZREA 2WHXA 1D6JA 1Q1EA 4DLZA 4LC0A 1D2EA 2F1IA 2ZQ5A 5KSPA 5KNDA 4P0TA 2V7QA 1ZNZA 4MUBA 3TAHA 5KNBA 2AKYA 4LSGA 2WIAA 5KDOA 1IY0A 5EUQB 1X6VA 3TSOA 3M0EA 2FF7A 3CF2A 1Q1ZA 5KSOA 3THWA 2O0JA 5J4KA 5HE8A 1TUIA 4I81A 4A15A 4DLWA 1TTTA 3X1WA 4MDFA 1JNYA 2QE7D 1US8B 3C5HA 1U81A 3EX7C 2FPKA 1E1RD 3FKSA 4XVRA 3KFXA 4CGZA 2PZGA 3LBIA 1L4YA 4JIMA 4QHSA 2WOOA 5KSZA 2ZUDA 1AA9A 2ZRCA 4B74A 2ODWA 1Q3TA 1US8A 1E2NA 5TMPA 3TE6A 4DB2A 1G21E 2Q0HA 2IX3A 4TQAA 5AJVB 4PFSA 2HV8A 4HAUA 2J3EA 2YWEA 4S35A 3A1VA 5CDFA 1NF3A 1E96A 3BC1A 4ACAA 1VYVA 1XPRA 1XZQA 2PMKA 1R0ZA 3CH5A 3IGFA 3EZ9A 621PA 3VR5A 2R9VA 3AH8A 1S96A 5GVSA 1G6OA 1EFCA 4IOKA 2CDNA 4XWAA 2GJ9A 1E98A 1N6HA 4GI7A 2BMDA 4A2QA 1DS6A 3KKPA 1QHHB 4YONB 4AKHA 3LXXA 1XEXB 1XU4A 3X1ZA 1KZGB 3N2IA 1R0YA 2FX3A 2AFIE 2CBZA 4DDWA 4CEJA 2ZRKA 2WWGA 4MYCA 1SULA 1QHHA 4DIDA 1OXXK 2Z6VA 3WMEA 2RB4A 4BWYA 1XEXA 4QBFA 3QPVA 3B60A 1N6NA 3SJAA 1E4YA 3GEIA 2IYVA 4JS0A 1PV4A 3EZ6A 5K8LA 1W44A 4TTPA 1RVDA 1N6RA 2H18A 3T5DA 3UMFA 3A4MA 3GCGA 1II8B 2W6JD 1GSIA 3TR5A 1EWRA 2D7DA 1SQ5A 2WSSD 1PLJA 3T1QA 1RYFA 1ZMXA 2CCJA 3SYNA 5P21A 1R0XA 1TADA 4F38A 5AWFC 3M4YA 4DSNA 1XRJA 4DB4A 1II8A 2J0SA 4X8LA 2Z5FA 1P73A 3HPQA 4M1OA 2KBEA 1GKIA 2FJUA 2X1VA 5BN3A 3GFOA 4R98A 1Y3AA 1G3IA 2LKDA 5JMTA 3I32A 2QPTA 4LZZA 4DLSA 4FWTA 4HAZA 5CM8B 2N46A 3L2OB 3WP1B 3B5JA 1CJTC 2ZRGA 4WXPA 1QG2A 4Q03A 2VHUA 4W9MC 1H65A 4FINA 5JZVA 1VCNA 4TLEA 4G5SA 2FH5B 4AWXA 4J0QA 4KLNA 2XNDA 3IEVA 1KI9A 3LW8A 3LXRA 4XSHA 2OILA 1IN4A 4ZDJA 2EFDB 3BK7A 3PIRA 5L3VA 1X8JA 3IPYA 4PAQA 1TQ6A 1T4GA 4HSEA 4EJSB 4IDQA 2FFAA 3KJEA 5FOVA 1W47A 4TL6A 2ODBA 1S9HA 3HR8A 4UQOA 1W0JD 5CJ2A 4C9BA 1IXSB 2RGXA 3WNCA 1WP9A 1S1CA 5DYGA 4U5XA 4EJSA 6Q21A 2ATVA 3NTUA 3PXGA 4FMDB 1FQJA 1RZ3A 3FDIA 3KXIA 3MWKA 4N0EA 4UXIA 1DELA 4CT5A 4AKGA 4L16A 5TV2A 4BLRA 1Q22A 1X8LA 5H68A 4A92A 2DY1A 3C14C 3K0FA 3E5HA 4KFTA 4C4PA 4URXR 2BMJA 3IIKA 4H9GA 1E9RA 4EQ6A 5FUVA 2GJ8A 2F43B 5C1BA 3U3OA 5FBRB 4RSGA 4MITA 4CW7A 1ZD1A 4BLOA 2G9NA 4QJ4A 1JQJC 1SVMA 1XMIA 1N5KA 4I1OA 1XP8A 5D3QA 4CIDA 2B92A 1T5LA 2WAYA 3SE0A 5EE5B 2QSYA 3X1DA 1OH6A 2F43A 4OK5A 3RC3A 4DBLC 3F5FA 3THOA 1NBMD 4D0GA 5CYPA 4TT3D 2ZANA 2VP6A 4L15A 1YZQA 4JLOA 4ZI3A 5LPNA 1GRRA 1E2GA 3P20A 4V0OA 3RS4A 2W58A 2JJ2A 1G7TA 3UG6A 1WB9A 2QI9C 1CU1A 3TIFA 1EWQA 3K1JA 5KDDA 1AQYA 2BV3A 1YR6A 2RGNA 4LUCA 4KVGA 4RKEA 4BRUA 1IN6A 1ZD8A 2AK3A 5C4GB 1KO1A 5IDVA 2QN6A 5FPTA 4DLUA 2VYFA 5FPSA 3ZLJA 1XFAA 1Z6YA 1T6NA 1M7HA 2ZEJA 1G4UR 2GILA 1DE0A 4P4TA 3C15C 4IKEA 1VG0B 3IQXA 1YZUA 2IS2A 2FSHA 4IW3B 2LKCA 2QGNA 1Z3IX 4OI4A 1W5TA 5A4JA 3QKTA 3GLIB 4OL0A 1FTSA 3AKYA 1KJWA 4Q9LA 4C7OA 3KKQA 1PLLA 3KDSE 1XTKA 3I4LA 2WICA 1G7RA 3VR4A 4LJ6A 2P5SA 2AX4A 4YDSA 3GLIA 4BQSA 3U3KA 1FUKA 1O3YA 4KV9A 1F6BA 1CBUA 1W7AA 3QVVA 1YJ5A 3E2IA 1NVVQ 4Q1AA 1QZXA 2EW1A 3T34A 3EASA 3LBHA 1N5JA 4KFUA 4LYFA 2ZSDA 3N5CA 4IEIA 5DLQC 4BZQA 1RE0A 1VMAA 2NO0A 4M53A 2VA8A 2MSCB 1OFTA 1GM5A 4D0LB 3QF7A 4DDVA 1N0VC 2EFEB 2ZJYA 3BORA 2IXGA 1FMLA 3A6PC 4QJ3A 2DFTA 3CNLA 3KTAB 1P60A 3UWOA 4Q9HA 1WCV1 1IJFA 2GCOB 1NLZA 4HLCA 5FUXA 1EFTA 2MMGA 5KOYA 4PPNA 1OIXA 3PEWA 1VPLA 1NMYA 1OPXA 1M74A 3U6BA 3KTAA 1Z6AA 1VHTA 1Q1QA 3H1TA 5SZIA 1FX0A 5BYKA 1Z07A 1Z83A 4DT1B 1EFRA 1UKVY 1GWNA 2CK3D 4UNPA 2ANCA 1G8FA 1PZNA 1VCOA 1Z28A 2VLIA 1RRCA 2IEYA 2XSZD 1NBME 2R8RA 4IOMA 2GBLA 3U5ZB 5J4LA 3CLVA 1A2KC 1NVVR 4OHVA 2BMFA 4QHTA 1EFHA 3GJXC 3KQUA 2XTMA 2H7VA 1E2IA 2YVUA 4L4UA 2OLJA 1QHNA 4QJ5A 3MWJA 4E03A 4GL2A 4BFWA 2GZHA 4GSYA 2GZDA 1DAMA 2Q6TA 2ZJZA 1DG3A 4ARZA 2IYTA 1HUQA 3TVTA 3U2QA 4DSUA 1S9DA 3F0TA 2WWWA 1GTVA 4HYYA 3FHTA 1W4CA 3W3AA 3K0SA 2A9KA 4Q4AB 2FFQA 4PQRA 4TSFA 4XJXA 4TMXA 3T06B 4B73A 5JJKA 2CHGA 4E07A 4W5JA 4B6FA 4B48A 1GAJA 4Q1BA 4MKFA 4NP6A 4KLZA 3AVYA 2FGJA 3AF1A 3NVAA 4B71A 2ZU0C 2NMVA 2C9OA 1OKKD 3IBGA 4Q18A 4Q4AA 2ZAOA 3OAAD 1YZTA 1IONA 1Z63A 3BERA 1XWIA 2P5TB 2JLQA 1ESNA 1GG2A 4FMCF 1ZUHA 1WQ1R 1RIFA 1XTSA 2GK7A 1R2QA 3BFKA 3SR0A 5EP3A 2IC5A 4BFZA 3LNCA 2B8WA 4KITB 4DCSA 3CNOA 3NG1A 4IDHA 3EC2A 4YMVA 1Z0DA 2H8KA 5FUYA 2TMKA 1XF9A 3MLEA 3QKSB 3DOEA 2YNMA 3B78A 2Q9AA 2ZS8A 2HXYA 1HA3A 2REBA 2QQ0A 3A4NA 3P27A 4ACBA 5JBQA 3KFVA 2KI5A 3AF0A 3VR2A 3LA6A 3W6OA 4LBWA 4DLRA 2EFCB 4BPBA 1E3MA 3CZQA 4AK9A 4KHZA 3LDAA 4NCNA 2EYUA 1G41A 4Q9IA 3DEFA 3B82A 2AWOA 2HYDA 2XB4A 4IVPA 1NY5A 4MGIR 5D3MB 1UEIA 3O8BA 3Q72A 3EA0A 1IN8A 2WKRA 4PPGA 1P9NA 1KTVA 2N42A 1NI3A 2DFNA 1KY2A 2Z43A 2JASA 2IT1A 1E2KA 4FN5A 4UXHA 3VTKA 3QKRA 2QPAA 5B30A 2JLYA 2EWWA 2GZAA 5JWHA 3VKGA 2FWRA 3K0CA 3LQRA 2IL1A 1LFDB 3GQBA 4ESHA 4UNRA 4DC9A 1KKLA 4DLXA 1QF9A 5KHOC 2D7CA 3LQQA 4PC6A 4F92B 3FWYA 2RMKA 3WYFA 2G3YA 3QBTA 4I99A 1KDRA 3ZZ0A 4EPTA 3T35A 1TF2A 2WJGA 4JLDA 4N0DA 4PO1A 2WPDD 2IUTA 5FL7A 4DWJA 1W5SA 4D81A 1P3JA 1XCMA 2CCGA 4M9SA 3T1TA 2ZJOA 4PZLA 1D5CA 1Q1BA 3QEOA 4RD2A 2O8FB 4BFUA 3L0OA 1TEXA 2ZJBA 2EFHB 2JLWA 2V3CC 2IW3A 1SXJA 1FTNA 2RGCA 2QGZA 3I8SA 3UMSA 1JPNA 2IYWA 4B3DA 2OESA 1XTJA 4BGDA 1YVDA 4RFSA 5HR5A 3GLHA 4QM6A 4GMXA 3TUIC 3SBDA 2IYZA 3HU2A 2OG2A 1CR0A 4LI0A 4DDTA 1HQCA 3I92A 1W1WA 2BBTA 4HLUC 4M9QA 1QDEA 3Q9LA 1WMSA 2ZIAA 1ZUIA 4V0MA 3RS0A 3ZIAA 4LHVA 4M1TA 3UKDA 1TX4B 5A5GA 1FP7A 2BWJA 2JLRA 3EC1A 2QL6A 4QL3A 2D06A 4EPYA 4LV5B 4JJKA 2DWPA 1RRPA 3FMOB 1N5IA 2J0VA 5AJXA 3SZRA 3ZVNA 5JJIA 2GRJA 3A4LA 1J8MF 2QT0A 2ZS9A 2FU5C 4QGHA 2JDID 4Q4HB 1N6PA 1II0A 2ZVPX 2RGEA 1SGWA 1KK1A 1EGAA 4BEJA 4Q47A 3C4JA 4AYXA 4KYUA 4B2IA 3HYTA 2R6CA 2V1XA 3BOSA 4JBYA 4B34A 1W36D 2J7KA 3GFTA 1G3RA 1UAAA 1COWD 2IYYA 5JWOA 1RFLA 1CR4A 1FMJA 721PA 2GEDA 2Q3FA 1GIAA 2J0UB 3O8CA 2NZ8A 3NC1C 1U9IC 4B47A 4AD8A 4GOJA 1GDDA 4G5QA 4JLAA 4LGMA 4QGGA 3BBPA 3LVRE 3OESA 1ZVQA 2J0UA 2C9YA 3P4YA 1TU4A 2R65A 3LV8A 1OXTA 1UBCA 3UG7A 2VHJA 1MO4A 2MSEB 3AQ4A 1XDBA 4EFNA 1XXHE 3P4XA 4JLPA 1JI0A 2GF0A 4Z8YA 5HKKA 4F91B 3EG5A 1W0KD 4BFVA 2XOKD 2W6IA 5CK4A 1M6NA 4OQLA 3NDPA 1II9A 2GAOA 3BB3A 3RSOA 2XXAB 4W5HA 3H0KA 4BLQA 3R7WB 4B76A 5HCNA 3DKVA 4G0NA 1ZM4A 5E7JA 1E9CA 2J9RA 3S1AB 3K70B 3SJBA 1LVGA 5L8VA 1ZNYA 1VKJA 4TLBA 2XXAA 5CIWA 2JJ8A 4NYJQ 5A0FA 3R7WA 1XEWX 3R8FA 3BAFA 2ZPTX 1ZRHA 4ZDWA 2P2LA 4XVUA 2YINC 1T0HB 2GKSA 4P31A 3SJCA 3OEEA 5FOSA 2HXSA 1CP2A 3GJ3A 2WWHA 1HY3A 1NVUQ 1E69A 3MCAA 1XNJA 4ZV4A 2VP0A 3IO3A 3QG5A 5JRJA 3TNFA 1G8PA 3AF4A 2QTFA 1NL3A 4JL8A 4M22A 1G5PA 4Q7JB 4TL7A 3SOPA 1HE8B 3BB1A 4BECA 5H70A 3RSLA 1XEFA 1E1QA 3JZAA 4Q1EA 1Z0IA 3LAWA 1EX6A 3SFVA 3PR1A 1R0WA 1PLKA 3VX4A 3AVUA 3DVLA 2C95A 4F4IA 3OFND 3EA5A 1E9AA 2HLDD 2ZRPA 3D8BA 1V43A 3SYLA 4RY2A 1JJ7A 2ZYTX 1SVLA 2HT1A 5KNCA 2I3BA 3K0EA 3K09C 4JBXA 1PUJA 1JXMA 2IF0A 1OXSC 5E7IA 521PA 2XGJA 1S0UA 4JKYA 2IBMA 1QBKC 3D7MA 4X8HA 3HJNA 4ASUA 3OIUA 4TMKA 3SDZA 1KI7A 1AM4D 1VG9B 1H8HA 4EAQA 1P72A 1BMFA 4US0R 2PLRA 5HCIA 4XWOA 4QFMA 4GRAA 2OCBA 2IXFA 3CX8A 3W90A 2C04A 4Q7LA 4I1SA 4D80A 4XH9B 3P32A 4QRHA 5BN4A 4C30A 4JLMA 4PTLA 3G82C 2DFLA 4LYAA 4WOPA 3D3QA 2FSGA 1XCPA 1QHYA 1SVIA 2Q9BA 1E2HA 4N3NA 1UKZA 3CPHA 3UMRA 3HWSA 3A1TA 3KKOA 1UBGA 2IXEA 2JIZA 4HUTA 3TRFA 4C0LA 3N2EA 1LNZA 2G77B 2F1RA 1CS4C 2JJ1A 5JI2E 1NMXA 2ZE5A 3CB4A 5FR2A 4JSYA 5DNYB 2HUPA 1F2UB 2R6GA 4GDFA 1W49A 3AVPA 4C0QC 4UNQA 2AN9A 3RS5A 4DDUA 3X1XA 4DEXA 5H1YA 1ZP6A 3RABA 3L0IB 2QP9X 1S4QA 3SQXA 3ADKA 3U7FB 4M1SA 1KOFA 3U61B 3PG5A 3WRXC 5FBVB 3VU9B 3PUZA 4EUNA 2C8VA 5HE9A 2QE7A 2Q9CA 4D6PA 4B3GA 5DIFA 2ZI6A 1E1RA 4NCIA 1GKUB 2AKAB 1XMJA 2IF2A 5DI9A 4D82A 3VU9A 1AIPA 4NDZA 2ZRLA 1E0AA 2KSQA 1KO5A 3EZ7A 4OHYA 2WV9A 3ONWA 2O8BA 5ELXA 3THWB 2OXRA 2WTUA 1P2VA 2WM9B 2A7QA 3QIAA 2FDCA 3LX8A 2IS4A 1E0JA 2FZ4A 1K6MA 4XTCS 2PZFA 1E9FA 2XX3A 4LHXA 4KBFA 2D2EA 4HB3A 4P3YA 1WE2A 4V02A 2ASEA 3H84A 4JT2A 5CITA 5JECA 4QBGB 3GLFB 2FGKA 3QNUA 3DM9B 3PITA 2VTKA 4C0KA 1G9XA 2FA9A 4OKSA 1DBSA 4OBEA 3SHFA 1E9DA 2L0XA 1Q44A 4FD2A 3V9PA 1M7GA 2ZYWX 2OT3B 1IQPA 1H8ED 2A78A 4V0NA 3GLFA 2F3RA 1KI6B 1N6IA 2IYXA 4BLTA 5AUPB 4ZCMA 3WNBA 2GCPA 2IS6A 2IYLD 3GJ0A 3B1XA 2R6AA 1ETUA 4NKRA 1DAIA 2GK6A 1XEWY 4RKFA 1WDTA 1T5IA 1A5TA 1E99A 1KI6A 1QHXA 1UADA 2OFWA 2GNOA 2JCSA 2ZRIA 4PHTA 4TL9A 3HPRA 5AUOB 3NKVA 5TARA 2W6JA 3B13B 3GJ4A 3KZ1E 4R9UC 4O3MA 4CEJB 3HU1A 4YXWD 4PPFA 3L82B 1N3BA 2G6BA 3M6AA 1VCMA 4ZKDA 1N25A 2DB3A 2UVQA 1Q0UA 3BH0A 3GLGB 2NO1A 2GTPA 4NBSA 1TPZA 4Q5IA 2V7QD 4Q4LA 4WZBE 2XZOA 1EX7A 2AK2A 3T15A 1ZM3A 2V6JA 4M9ZA 5C46F 3AVWA 5FUWA 3B1ZA 4H1VA 2QY9A 1W46A 2ZRAA 4LK2A 3RRYA 5E4FA 2F55A 4OI0A 3GLGA 4WW0A 2R44A 4DUGD 1OXVA 4IFEA 3ZJYA 3R9WA 3RS7A 2A5JA 3EAQA 2X77A 1FW6A 3SI7A 4HDQB 2NGRA 4KU4A 2ZJ8A 4D4KA 4BFTA 2QMEA 5GADl 5K8IA 3TBKA 1MO5A 2NIPA 3QG1A 5FTJA 3GP8A 4L9WA 2NQ2C 4GBMA 1ZC3A 4HLDA 4RFVA 2BDTA 1SKYE 2EQBA 2VP5A 3QJYA 3PQCA 2ZE7A 4LHZA 1G3MA 2WOJA 3C7KA 2GXUA 4U7DA 3WY9A 2GESA 2CJWA 4JL6A 2O8CA 4B3XA 5TXGA 1ZM7A 1YRBA 3U44B 3KKNA 3O8RA 3N70A 3DL0A 1ZW6A 4N1AA 4PC2A 1M34E 1UM8A 2LCFA 3BE4A 3U3JA 2YWFA 4YMSA 2JGNA 4FXPA 4B35A 4C0SA 4KAXA 4A0FA 3U44A 2R2AA 1YR8A 4DHEA 1E2EA 2XITA 1E79A 2E87A 1U99A 3B1VA 2CLSA 2WJIA 3K9LA 1CJMA 1YHNA 2BHRA 2QM7A 5FOUA 1PUIA 1XJCA 2JA1A 4Q7MB 3K0FB 1I4DD 3ZZTA 1OHHD 3CBQA 4XTRA 5C4MA 3KX2A 5BW8A 1E2MA 1R5OA 2PZEA 4EQ6B 4BRWA 3KJHA 4PZYA 2ONJA 1G5TA 1BYIA 2V9PA 2XJ9A 3UANA 2YJTD 3PV0A 1FP6A 1U0LA 3W9YA 2QAGB 2GJAA 3MGCA 1F2TA 4B2PA 1LF0A 5DSZA 2C99A 1JR3A 2GDJA 1MR3F 5BQ5A 4A6PA 1KIMA 1ELOA 2X8AA 3F3YA 3PUWA 3UK6A 4KVAA 2YC4C 2QAGA 1KSFX 3QF4B 1OH8A 1FNNA 4G5RA 2HDNB 2XB2A 3PVSA 2MMCA 3QI2A 1B23P 4OHZA 2XNDD 2OZEA 3HDTA 4LJ4A 4MYTA 1U0JA 2ANBA 2VSOA 3V4FA 1T0JB 1XJQA 3JZMA 1NIPA 1J99A 3QF4A 5CLLA 4ILEA 3TMKA 3KXLA 4LPKA 1YZKA 1R10A 3QY0A 4A8JB 2ERYA 4NCKA 2IWHA 2OE2A 1ZU4A 2YZ2A 4HI0E 2RAPA 1WBDA 4ZDKA 4QGFA 4R7ZA 3CPJB 2OUKA 4NTZA 1U98A 5GJBA 1KO8A 3HU3A 2ERXA 4FMCB 3ZVLA 4EKDA 4A8JA 2ZSEA 1C4OA 1HH4A 2QRNA 5J40A 1YKSA 5CDFE 2C96A 3QXJA 5EE0A 5G53C 4UNSA 3J81k 3R9XA 1ZIPA 1GUAA 1ANKA 4GMDA 4C7OB 3TQCA 5BN5A 4IVQA 1J8YF 4DEYA 1Y63A 4UJ5A 1OJLA 5L3QA 4ZKEA 1KSGA 3FMFA 2HJVA 3NIBA 1XMSA 4BFYA 1OB5A 4B43A 4RD1A 3FOZA 2KE5A 1VIYA 2QROA 4M9XA 3MD0A 2J45A 3K9GA 2W2TA 5IHPA 4URWR 5G3YA 1KZ7B 4B3BA 4Q00A 2NOAA 2GETA 4AYWA 1ESMA 1R8QA 2QNRA 4TYNA 3I72A 2J7PD 4R2HA 3CF0A 5TVKA 1Z0FA 1EESA 2ZI4A 5JWRA 4Z1MA 2OSBA 1J70A 2CK3A 2J59A 5DISB 3B7GA 1QVRA 3DOFA 4B3CA 3ZS9A 1JPJA 3AP2A 4XOIA 5CB8A 5G41A 1VG1A 1EXMA 1G7CA 3AP3A 1MRSA 5HTKA 3IHLA 3U4QB 1QG4A 1FX0B 2A30A 3IQWA 2QTVB 2PCLA 4DCTA 5CIQA 1XX6A 3QPWA 3ZH9B 1FOEB 4LX0A 3VFDA 2QM8A 1VIAA 1BS1A 1P9WA 2JLVA 3U4QA 2CNWA 4YC7A 5FTNA 8OHMA 4IEEA 1VTKA 2B7BA 1YZLA 2XTNA 5DH9A 2XNSA 4D4JA 3CRQA 1TMKA 1JB1A 3Q5EA 2J5XA 4HZUB 5DN6A 2REOA 4D4LA 4EJSC 4LJ7A 3AUXA 4EDHA 5JJLA 2VF7A 5FBWB 1OKKA 4M2LA 3OAAA 3HYRA 3TGPA 1ZCAA 3IPXA 1AJEA 4ARZB 2WMNB 4HZUA 3RWOA 1RRFA 5FH9A 121PA 2DYKA 1W4RA 3PFIA 3Q5DA 4OQFA 4NE2A 1NG1A 2JLXA 1VG8A 3LFUA 3LD9A 1RRGA 4P4SB 1NJFA 4IDNA 5FOXA 4I4LA 4TMVA 2D74A 5EXTA 2ZI3A 4IFBA 2YOFA 3K0AB 3A36A 4AC9A 1C1YA 2H57A 3A8TA 4GPTA 4PANA 3SC3A 4P4SA 3NBYC 5KDLA 1KNXA 3LRPA 4XD7A 4R2IA 5FL3A 3WMGA 3K0AA 3BH6A 4KI0A 4ZPXA 3C8UA 3EW9A 4CEHA 4NMMA 1ZJ6A 4Q1FA 1U8AA 4JL5A 1AS3A 3WP0A 3LVQE 2FMXA 4MRNA 3ND9A 1E2LA 5EE9A 3W34A 3LY5A 2HCJB 4MKHA 4Y0AA 4OK3A 2HCBA 3CWZA 2H5EA 3DMDA 4O25A 2W2XA 4A36A 1AKYA 1KAOA 1R7RA 2RGNC 1FPMA 2OM2A 821PA 2F9MA 1E2DA 4GNKA 2C78A 5B2ZA 3IKJA 3GEEA 3ADBA 1N0WA 5FPHA 3D6TB 1Z2AA 1IY2A 1S2MA 4URZR 3DO6A 5C2JB 4D26A 1ZNXA 4FCWA 3T12A 1G64A 5DHFA 3IILA 1GNQA 1CR2A 2ZYUX 2V4ZA 1U8YA 5JI3E 1XXHA 1D2MA 1G1MA 1KMQA 2RHMA 2D3WA 4JLNA 3THXA 4ESVA 1GRQA 1U2RA 4ITRC 3QKRB 4IDPA 4C0BA 1QHSA 4JVLA 4TSFD 3RNLA 4R71A 2YYZA 2B8TA 1KGDA 2WPDA 2AWNA 3HR7A 3SFZA 1UDXA 2J87A 1IM2A 4TN1A 1JBKA 2PT5A 2QEQA 3CIOA 1FL9A 5B57C 5J4VA 1DVRA 3CUEF 3B6EA 1QHGA 1RKBA 4RCYA 5JHHB 2XTZA 1L2TA 4Q9KA 4RZXA 4ZCIA 1IXRC 4NCHA 4MRVA 1RC8A 4TMTA 1MABA 3Q85A 5TDHA 4YDHB 1ZUNB 4NHOA 4TLCA 3KJIA 2O8EB 1ZAKA 2C5LA 2G88A 2QMUA 3U7HB 3GJ6A 2YWHA 1G291 1DTSA 3SU8A 3RVBA 1NN1A 3GLIE 3W6PA 4V0KA 5IF9A 2ZSFA 2K5UA 5EE3A 4DZZA 2O8EA 3K8YA 1R8SA 2J0QA 1D2NA 1G8YA 3WYAA 1SXJB 5KYKA 3VKWA 3AVOA 3EPHA 4WZ6A 4DRZA 2GA8A 3CWQA 5SZKB 1CRQA 4RFSB 4GP6A 4CT4B 5LD2B 2FG5A 2VH5R 3GLHB 4E5UA 4PSVA 3THYB 2GWHA 4A6XA 1DAGA 5JSZB 5FI1B 5F9HA 2UZIR 3G5UA 3MWYW 5EE1A 3RS2A 4B75A 2RGBA 4OJQA 3VR3A 1ZCBA 1ZM2A 1P5ZB 2GBLC 1E2JA 5IK2A 4CYMA 3THYA 3QXSA 3QSYA 2CHVA 5JSZA 1TL7C 3B9QA 2D2FA 1G17A 2EWVA 2C2HA 1VECA 1KAGA 3VNVA 4QOSA 4M4SA 4QC2A 2CE7A 4LYJA 2PH1A 1AS2A 1UF9A 4PC3A 4HUQA 4QGAA 2QMHA 4NL4H 1KSHA 1JECA 1COWA 2QA5A 2Z4SA 3MWLA 3ZS8A 4BFXA 1SHZA 1X3SA 3FVQA 2V54A 1VDZA 4CVNA 2C98A 1UBFA 3NWJA 4AG5A 2AR7A 3PEYA 1Z0JA 3OIWA 3QE0A 3Q7PA 3EIHA 1UKEA 3UXMA 4DSOA 4MUAA 3NBXX 5TB5A 3VAAA 4B33A 4OK6A 2H1LA 4CZ2A 1N2CE 4DKXA 1OXUA 2WJVA 2ZI9A 5FTLA 4LYHA 2QQEA 3U3MA 2QRZA 1IN5A 3QKUA 5DHAA 4CRWB 4F7WA 4DLYA 3TKLA 4HAVA 1BOFA 1YQTA 2QG6A 2AXPA 5FL7D 2ZROA 1W0KA 2MSDB 3VHXA 2XOKA 2YOGA 4Q1CA 1Z8FA 4HEJA 5J4HA 1NVXQ 3EXAA 2BIFA 1ZU5A 1CIPA 2VIIA 1W48A 3OE7D 5IT5A 5IRCD 5HZHA 4WZAE 3PUYA 1W2HA 2ZI7A 3IBYA 3UATA 2Z0MA 3BS4A 1F48A 1KI4A 2FNAA 3LWNA 2NO9A 1GILA 1M1YE 2E1RA 4V0LA 4EPXA 4O0MA 4QNMA 3KUDA 3MSXA 3R20A 3QXXA 1U8ZA 5AJZA 4BZXA 5DE3A 5EXSA 2ZS7A 1OW3B 2QU8A 3C5CA 3CPEA 3SHWA 5CYOA 1DPFA 2PCJA 4KJZA 1DARA 1OFHA 4OHXA 5KO2A 3KQNA 4NYIQ 3L43A 2BCJQ 3ZIAD 2VSFA 2D62A 3I1FA 3L0SA 3QENA 1W2GA 1IJEA 3A1WA 4RJLA 2CCKA 3ZZUA 4MA4A 3EARA 3AF2A 1LS6A 2GF9A 4A0GA 3KUCA 2NO7A 4AY2A 2PEYA 2SHKA 4KSBA 2PX3A 2WJHA 4PO9A 5H8WA 1NMZA 5EP1A 1KY3A 2NO6A 3BRWD 3DKPA 3TW8B 3CKLA 4RD4A 3NH9A 3X1YA 2CL7X 3IIJA 4TTQA 1K8RA 2NTYC 3K0CC 3VNUA 3OFNA 4JLKA 5LB2A 4WAUA 1J90A 3LO5A 3W5JA 2H16A 4EIWA 1ZD9A 4PXAA 2DFKB 1GP2A 2YV5A 2ZE6A 5FPYA 1XPUA 4DJTA 2ZR7A 5EP2A 1NG9A 1VYUA 3CW2A 1UEJA 5LB4A 3AV0B 4P32A 2ZITA 3U7GA 1SVKA 3OEHA 1FUUA 4I1UA 2ZRNA 3I8XA 1ZM9A 4JSTA 4NYIR 4PAOA 4ON9A 3TUJC 4MQBA 3ADDA 4RZ2A 2EU8A 1CR1A 2RHDA 2QTHA 2JATA 1TF5A 2OFOA 1LY1A 1SXJC 3RANA 3RWMB 3RS3A 3GJ8A 2W6ID 3RC8A 3VQTA 5JS7A 3MUFA 3W5IA 1GNRA 1OIWA 5LD2C 1FFHA 1CRPA 4E09A 4NYJR 2VP4A 2DWOA 1ODFA 4ZI2A 3ICQB 4IRUB 3OF5A 1HTWA 4GT1A 2W2VA 5JLJA 3QXCA 3GPLA 4A0HA 1MKYA 1VYTA 3L8YA 1LB1B 2IHBA 4KYIB 3Q8XB 2ZSAA 3EZFA 4KCGA 4MYUA 1G8HA 3AM1A 1KI8A 2AFHE 2EFGA 3OEED 1P6XA 4TQ9A 1SHKA 5F3WB 2GEVA 1OT3A 4M1YA 1KI3A 1U0HC 1UFQA 4RD3A 2P6NA 1AZTA 4C0JA 2G0TA 1J7KA 2PMDA 3EWSA 2OEPA 1P75A 1NP6A 4TTRA 2WWIA 3FHOA 3BJIC 4GZMA 4Q1DA 1HV8A 4P33A 2X19A 5CK5A 2ZE8A 1JR6A 1DOAA 2XZPA 1GZSA 1CTQA 3DPUA 4RCZA 3PJRA 2ZR9A 5JS8A 2FSFA 4TZ6A 1AQUA 1S1MA 1TUEA 4Q01A 2IK8A 4PO8A 1DO0A 5BXQC 1JXOA 4OQXA 1M7BA 2ZTSA 5FBLB 3CH4B 2Q3HA 3EWAA 2A5YB 1D9XA 2F1JA 2WJYA 1ZINA 2HJGA 5EP4A 2KBFA 4FCVA 1Z29A 3T5GA 1S8FA 4Y0VA 2O8BB 1Q12A 1HT1E 2ZAMA 4URYR 4TMWA 1ZBDA 2WAXA 1H8EA 5DYIA 4KO8A 4ASUD 2WSMA 5E95A 4ZDIA 1DAHA 5L3SA 1H8HD 2HT6A 4BLSA 4JMPA 5EXXA 3K9NA 4UJ3A 4JLJA 4S2EA 4URVR 1KDOA 4CDGA 3PEUA 4U02A 5AUNB 2BKEA 4MKGA 2RCNA 3PENA 1LTQA 1BIFA 1UJ2A 4M1KA 4A4DA 5K8UA 1J2JA 4JYCA 3AKDA 2JIZD 3D31A 4KODA 2OBNA 4AKIA 1I2MA 2WWYA 4YXWA 1BYUA 1UKYA 4GZLA 1ZNWA 2IYQA 3GJ7A 1A7JA 2GJKA 1KKMA 4Z8XA 4WBSA 1P2UA 3ICEA 1TAGA 2CMKA 2ZSBA 3K70C 2CEAA 2GVDC 4YMWA 3CO5A 5LBIA 2W00A 4K8OA 2IS1A 1AGPA 2A3RA 5AUQA 1B0UA 1VHLA 3CONA 1OFUX 2PBRA 2E9SA 4EPVA 1G6HA 4BEBA 2CLDX 5ANRB 3CF6R 4DUGA 1LV7A 2FPLA 3MMPA 1GFIA 2ZJ2A 4URUR 1IOZA 3E70C 2DHRA 4HAYA 4JYBA 2CL6X 2WSSA 4PC7A 3RDPA 1P9RA 1YZGA 3B9PA 4GOKA 5JRZA 2O52A 2PJZA 1I2DA 4PPQA 4EPWA 3NEYA 1TQ2A 2VHQA 1R6BX 1KNQA 1A1VA 1R4AA 4NZYA 2CXXA 3Q7QA 2PLFA 4X8MA 1Z2CA 5LDDC 1IAQA 2F6RA 2ORIA 2H92A 1SVOA 3PUVA 3QXHA 2CVFA 3NBZC 1G4AE 4DIEA 3DDCA 3RHFA 4ABYA 3L0PA 4LBVA 4NH0A 4E22A 2QP4A 4IVRA 2ONKA 3FKSD 4AI6A 2O0KA 1Q3HA 4A2WA 4IOJA 4C0AC 3TQFA 4IJMA 3ZVMA 1T3SA 2BKUA 2C9CA 2BMEA 3REGA 3NC0C 3LLUA 4LCBA 1E94E 1V5WA 4BUJA 1KJZA 5DO9A 2KWIA 4LWZA 2CJWB 5G40A 1SVWA 1GL6A 2V6IA 2O8CB 2HEIA 3AKEA 2G0NA 2Q21A 1EK0A 4LJ5A 1W0JA 2AXNA 5TY0A 3DMNA 2PT7A 1Q57A 2WMOB 1IXZA 1D9ZA 3R9IA 1OHHA 2OXCA 3ASZA 2ORVA 1SKQA 1CULC 4MRSA 3VHLB 3TR0A 4FI3C 4A1FA 4Q9JA 2VF8A 3FMPB 4JKIA 2BBSA 2FOLA 2J46A 4QBHA 3EZ2A 3TW4A 2OCAA 2FSIA 4PSAA 3NHBA 1T91A 2B21A 4L5BA 3I5XA 1TF7A 4POAA 3VMFA 5GJCA 1IBRA 1ZIOA 4BFSA 4DCVA 4V03A 2QBYB 1WA5A 1CEEA 2FV8A 1TEVA 2C03A 3SJZA 3ZVRA 5F9FA 4Q21A 2H17A 1KHTA 3B8HA 3QOFA 4PHGA 1GKYA 1L8QA 1Z5ZA 4ZO4A 3SS8A 4FMBB 2YKGA 4QM7A 5GJVC 2QBYA 3C16C 1OH7A 1XB2A 3O47A 1ZYUA 1K5GA 3RRNA 1NBMA 2CVHA 3K53A 2HYIC 2V1UA 1NN0A 4TT3A 1P7CA 2IYSA 1KI2A 1E6CA 2VHCA 1KK2A 4PC1A 3ZQ6A 1HQYE 3PEVA 1F2TB 4IOLA 1NSTA 4A82A 1G3QA 5DGXA 3C41J 2CE2X 1N5LA 1T3LA 1E2FA 5E7MA 3FHCB 3H86A 3KKMA 5CM9C 5DI3B 3IHWA 5J4YA 4K81B 1W4BA 4RZUA 3NEJA 3EIQA 2BBOA 2P3SA 1Z0AA 3NXSA 2J41A 4GFDA 4BE7B 4JLBA 1OYYA 3AVVA 3ETLA 1DG1G 5DI3A 1OF1A 3O8DA 3L8ZA 1T9HA 5KUTA 3TAUA 2VEDA 3KQLA 2ZETA 3CZPA 1CJUC 4M21A 3AGPA 3NHAA 4UKDA 4A2PA 1AN0A 2OLKA 3A1SA 3B1YA 2D4HA 3MJRA 1YR7A 3EIEA 5EZ6B 5KPDA 2VHTA 1E79D 2ZI5A 3GLFE 1X86B 1OYWA 5BYJA 1XJ0A 5JEDA 4IDOA 2WVJA 5FI0B 2J7PA 1YE8A 3FFAA 4BASA 3EPKA 4EFMA 3MG9A 3QVUA 5L3QB 3BWDD 4UNNA 4A0RA 2JLUA 4RD0A 1KI1A 1GRNA 2HF8A 2I1QA 4D25A 1DADA 1M8PA 4HAWA 4U00A 5BWMA 4LJ8A 1E9BA 3ND8A 4XSGA 3B1WA 3AUYA 1P2SA 2EVWX 2UZ3A 4EPRA 2ZM5A 4A9AA 1XD8A 4LRWA 2QMOA 5FTMA 3BH7A 4O2LA 1JR3D 2ZRFA 4PQYA 5CJPA 4B44A 2BJWA 4NONA 3W8RA 2GEUA 1KSJA 2RGDA 4IXMA 4DCNA 4US1R 1JJVA 1HURA 3JVVA 2FEOA 1G16A 1NNEA 4G3XA 3GLGE 1K5DA 3SQWA 1MRNA 1LS1A 3I61A 1FZQA 1WF3A 1TU3A 4ZIRB 1Z06A 1E4VA 3U7EB 3WBJA 2YOHA 2CL0X 1Q21A 1GVNB 2JJ2D 4TYPA 1Z08A 2XSZA 4HDCA 2WZQA 1XD2B 3I73A 4M1WA 3ZDQA 1FNMA 1XCGB 2PEZA 1G3UA 2KJQA 1Z22A 2VBCA 4ZIRA 4XWKA 1OV4A 4RZ3A 4IXNA 2DPXA 2WKPA 1IY1A 1O87A 4KFSA 2JAQA 4LY6A 1XD2A 1Q20A 5AJWA 3W3ZB 3TSZA 4C2UA 4CF7A 1R5BA 1M2OB 3JVUA 4EFLA 3KJGA 1TQ4A 3KXKA 1P62B 1XD9A 4D4MA 4AKEA 2BC9A 2FZLA 2V55B 2P67A 3M1IA 1BKDR 1NN5A 3BFXA 4JVNA 1R5NA 2ZJAA 3FGNA 1IN7A 2DR3A 3B2EA 3IO5A 4MH0R 2ATXA 2A5GA 3U3RA 3BXZA 3VR1A 4FMDF 4HB4A 1DO2A 1N6KA 1FQKA 1G7SA 1XZPA 2ZUCA 3AF3A 4M1MA 4TL8A 2PL3A 4QHYA 1CJVC 4PR0A 2GCOA 4DVGA 5J5CA 2XAUA 3FMIA 4Q48A 1XMVA 1SZPA 2NPFA 3RLFA 1DEKA 1MH1A 4Z1MD 4TLDA 3W8NA 3OIYA 4CEHB 1NLYA 4HB0A 4RVCA 1A2BA 3AKCA 3CM0A 5F2EA 3QPUA 2OBMA 2IYUA 4DT1A 2XJ4A 2QAGC 3CNNA 3EPJA 4L8GA 4Q4JB 3VR6A 2C77A 3RRZA 1P2TA 1AGRA 2HF9A 4CEIB 2J1LA 4HLUA 4P4UA 3IUYA 2A5FA 1XBTA 1F3OA 1WXQA 4FCTA 1E9SA 3I62A 1E32A 1WBBA 2QP3A 3TUZC 2GXQA 2Z4RA 3GFPA 4KFRA 5K8TA 1GOTA 4GOXA 4Q4JA 4MRPA 1DAKA 3CR7A 2CNWD 2B6HA 3AP1A 4QNRA 4CEIA 1JALA 1JR3E 3TSWA 1TNDA 1EFRD 3OIVA 1NLFA 5FR1A 5JCPA 5DN6D 1U94A 2P6RA 2RGAA 2GXAA 4G1UC 4C2TA 1PJRA 2IUSA 4IHQA 4B2LA 3DM5A 4A8JC 1MO6A 3ZYCA 1S3GA 1KK3A 3AVTA 1P61B 4Q66C 2NPIA 1XXHB 4MGKR 3KB1A 3GD7A 3WMFA 3FTQA 3MJHA 1XTRA 3THXB 5M04A 4QKQA 5JFGA 3OHMA 3WBKA 3U6KA 3TJZA 1QRAA 2ZRBA 2QPOA 2A2ZA 4WA7A 2WBLC 2BM1A 4AIIA 3AB3A 2OO7A 1KO7A 1OB2A 2IYRA 4HAXA 2ZUBA 3P26A 2PX0A 2R62A 4TMZA 2VPPA 2FEMA 1P4SA 2W83A 1U9IA 4D0NA 5JCZA 1TQDA 1T3HA 2WKQA 1W4AA 4AYTA 3CRVA 2QORA 4XD7D 3FKQA 1Z6TA 3LX5A 1QVAA 1MABB 1Z47A 4NU0A 4BZPA 3KB2A 2GVZC 2RKOA 3BIFA 3QKSA 4G5OA 4AG6A 4ERNA 3CX6A 5GJWC 1HEIA 1OLOA 5JEEA 3T61A 3DZDA 1AS0A 1EFUA 1JEEA 4KXFB 1YR9A 2F1HA 1Z6XA 3VX3A 4Z51A 4O2RA 2JLZA 2OCYC 4QG7A 4GP7A 2B7CA 4DCUA 4PHHA 3TVDA 3AVXA 3G0HA 2IWRA 5CB6A 4HZIA 4TLAA 1N6LA 3CX7A 4F93B 1JEDA 3ASYA 4LBZA 1UBEA 4TWZA 2NZJA 3FB4A 5D3MA 2WJJA 2AD5A 4PHFA 3RYTC 1MO3A 4JJZA 3HP1A 4YMTA 3WHLA 2WWXA 4YQFA 4HLQB 3FE2A 1OIVA 1RW4A 1T8TA 4H1UA 2ZRHA 5CLQA 1PVOA 2R6FA 2W0SA 1OFIA 1OH5A 3ZD7A 1GL9B 2BJVA 4WXRA 4HDOB 2JDIA 2VO1A 1L4UA 1MOZA 3UWKA 3KQKA 1W36B 3EPLA 1JQLB 4HUQB 1A4RA 4MGZR 1G19A 4MDEA 2BBWA 2UKDA 4W7SA 2FFBA 2KB0A 2ZRJA 5FOWA 3UIEA 2GHIA 2Z83A 1XPOA 2CLCX 1HT2E 2BOVA 2AD1A 3OE7A 3BFVA 3SN6A 4OQMA 3CR8A 3ZD6A 3MRSA 2Y8EA 4LBYA 2ZRMA 3A58B 3GEHA 4FWIB 2O8FA 4TQUS 2EYQA 3K09A 2P6UA 3WRYC 1EG7A 4AURA 2YC2C 4OI1A 3LBNA 3A1UA 4K46A 5UKDA 2ORWA 2XEXA 3K9HA 1YZNA 2QSZA 4X8OA 1X8KA 4PX9A 4B6EA 1A82A 3VKHA 1G5RA 2V8OA 1RJ9B 1YRAA 3CRRA 2QZ4A 3WNDA 3FYHA 2OAP1 4Q02A 1UDWA 4UXJA 4TYYA 1CKEA 1NRJB 2F7SA 2ZR0A 3ECCA 4LJYA 2W0MA 5FOTA 1L7VC 1OE0A 4WIAA 1RYHA 1RJ9A 3SEAA 4L9SA 3DHWC 1SXJD 2VL7A 2GCNA 2LWIA 4F4JA 1XTIA 4XIGS 2OCPA 3BD9A 2Q3MA 3IDQA 4BLPA 5IK2D 2IHYA 2GXSA 3R8CA 5J47A 1MT0A 5HPYB 1DAEA 3BB4A 3Q3JB 5FFMA 5EQTA 5GVRA 4B3FX 4B32A 2ZRDA 2OV2A 3RRMA 1C9KA 4LHWA 2BCGY 4Q4HA 3B85A 2JLSA 4YMUA 2F9LA 4C0HA 1KO4A 1T8UA 3BGWA 4I1VA 1E9EA 4RD6A 2GAAA 221PA 2VSXA 1VCIA 4NYMQ 4PAMA 4PQFA 2AHOA 4LC1A 5FPKA 4FW9A 1X1SA 4G01B 1N6OA 1KDPA 1S3SA 2DWQA 2ODNA 3GMTA 4HB2A 4JZKA 1DAFA 3LW7A 4LV6A 4DLVA 3LLMA 3SNHA 5KTYA 2I4IA 1GL7A 4TYWA 2ODEA 4LJ9A 4QBIA 1ONBA 3OZXA 1AZSC 5KSYA 5AK0A 4JT4A 3CRMA 2HLDA 3KL4A 3IIMA 2CHQA 3QBVA 2X2FA 3CRW1 1KYIA 2ZYVX 1GNPA 2X2EA 1N0UA 3WHKA 2QENA 4Q19A 2WWFA 3I5YA 2R6DA 4TZ0A 5C18A 2A5DA 3H2YA 1E0KA 3KQHA 1Z6GA 1F60A 5JHGB 1LW7A 3REFA 4II7A 4NCJA 2IUUA 3TK1A 2OFXA 4LPSA 2DCUA 2OAQ1 3AEZA 5EUMA 4W5WA 5G3ZA 2FN4A 1NJGA 2VP9A 1NIJA 3S1AA 3AVQA 2AL7A 2OBLA 1KDTA 2P65A 4JBWA 4MYHA 4NYMR 1CJKC 4TYQA 4OHWA 4JLVA 1LF5A 1E2QA 1KMHB 3F8TA 2DBYA 1I4TD 1KK0A 2G83A 3FPAA 4LV8B 1CLUA 1Z0KA 5HKKD 1I4LD 4MKIA 2F3TA 5E3HA 3TLXA 5B64A 5KPJA 2REXB 3T1VA 2I1VB 2N1BA 2JEOA 4OQNA 4M0LA 1KMHA
chains in the Genus database with same CATH superfamily
5K0NA 4KO4S 4P3PA 1YB5A 1LU9A 3ZQJA 3BHNA 1PJZA 2CVOA 5EVJA 1PKEA 1F4LA 1GARA 3I5UA 3W8EA 2RG1A 5CUQA 4W1SA 1UDAA 2BFDB 4ZHSA 4DG5A 2X5XA 2PUAA 1T0UA 1O1YA 2DU8A 2O0MA 3RAPR 3ZE2B 2VFAA 3HXLA 3ZI7A 4YBRA 4R01A 2JBWA 3WNQA 3PUXA 3TTXA 3SC6A 1CXZA 4RKWA 4IEFB 2AZTA 1G20E 4C3ZA 4UHBA 5EZ5A 3BFJA 3O1JC 1GR1A 1Z73A 1J0EA 1ODKA 2C0PA 2VP2A 3AINA 2FRVA 3M5WA 3NTQA 5KU1A 1MFZA 1D8TA 4G5GA 2Q3EA 2QTCA 2EX4A 2J3HA 4FN4A 4HRAA 4C6SA 2P0EA 4D4GA 3KELA 3QQ5A 1H4VB 3I0MA 4NEHB 4N40A 4U8GA 1NUTA 1NN3A 2O7NA 4YLGA 5AR1A 4L28A 5FFNA 5CB0A 2IODA 3DMRA 2CNDA 3X2SA 3PNSA 1V39A 1J39A 3MTIA 4GPIB 1FTWA 3PDUA 1Q0SA 1YU9A 1T29A 2XWQA 3TFQA 1NSFA 1BH2A 1NY6A 1X1CA 3TH5A 3JATA 2F8LA 3NH6A 3ZG6A 1WSWA 4YUWA 1P31A 4YRKA 3EVGA 2A1UA 4NU6A 2QT1A 4B79A 3ESCA 3AIOA 3EAGA 1M34A 2NYVA 1A1SA 4BVBA 1DCFA 3E8XA 4ZCLA 2R8BA 2ZU6A 1MGPA 2VTBA 4FBLA 4DCMA 1GGVA 4KYVA 3OZ7A 1FXWF 3HA2A 4INZA 5B37A 3T3HA 3U60B 3VVLA 3ZHCA 4X5OA 3I64A 1NJ5A 4KKXB 3Q87B 1XLTA 1PZMA 5LZ5A 4EKGA 4AZ0A 4LDQA 4F5YA 1LLQA 3H4MA 4TTSA 1J2RA 2ZVJA 4PSKA 2RHJA 4PM4A 3WXMA 4HVTA 4TKVA 2PUFA 2Q5QA 3NBFA 4QXAA 1NRXA 5KQLA 1AK2A 1P39A 1ZN8A 1P1CA 3BA6A 2B5OA 2FE4A 1HE1C 1QHIA 4KO2S 5EGNA 3P19A 1NURA 2BPOA 4D0SA 1MC5A 5FWYA 4ZAVA 1NGSA 3EGXB 3JWHA 1G8GA 2BEJA 2CL5A 2CHUA 5L3RA 2FZGA 1JHMA 1HSOA 1E6UA 2C57A 3GNTA 4F2GA 3PCRB 4QRIA 2I6XA 1YS9A 4XXHA 1F2VA 5CA1B 2OHFA 4P3XA 4KSCA 4OQPA 1MCZA 4M88A 1ZIXA 2B9VA 3H1PA 1XDDA 3R5KA 1GN9A 4JVSB 3V48A 3WIEA 5LFAA 3NW9A 2P9QA 1KYZA 5JQGA 1UPTA 2ZB2A 1Z16A 4MR9B 5F3RA 3HDYA 3DAHA 1JH8A 1RRVA 4CXMA 1D2EA 1C29B 2F1IA 3CLSC 1BMTA 4H1HA 3DE7X 5KSPA 4BPRA 2V7QA 4Y2JA 8GPBA 2JGEA 3TQTA 5E3IA 4HWRA 5DF1A 5HF5A 5KNBA 1W85A 2QTAA 4LSGA 3VC1A 4MV9A 3WV5A 3CLUD 2HREA 3BGDA 2HO4A 4NFYA 1VLJA 4ZQCB 3HEAA 3M0EA 4IGIA 1IE3A 3CF2A 1Q1ZA 4PS0A 5EJFA 3REOA 2O0JA 3PPYA 4BNFA 4OQ4A 2AEEA 1HDOA 3MLBA 4YI5A 2I34A 3TX2A 4DLWA 2H2IA 3ET4A 3C5HA 1U81A 5K3FB 4J4TA 3FKSA 1JIVA 4C7KA 4RMJA 1Q95A 2NLOA 3FYCA 5KSZA 4TRJA 3AERB 4XA8A 3WGVA 2PUEA 1AA9A 4Q34A 1WP4A 3GD5A 1Q6YA 1B41A 1US8A 4HX5A 2ZR8A 5D1HA 5IH3A 4ZYXA 3S28A 3MQ4A 1FDOA 5FO1A 5TMBA 2PE5A 3BIWA 4DB2A 4UCWA 3IAM1 2C3MA 3AUTA 4CU5A 3NZEA 4OQYA 2NXWA 2PUVA 4HNSA 2IQIA 2PMKA 3CH5A 4C21A 1L5GB 3FOBA 4RO0A 4GGMX 2QNBA 4JR1A 3K2BA 3OD5A 4MJLA 5GVSA 1G6OA 3ACDA 5K0LA 5JMOA 1LLCA 1WUJS 1NOKA 3OM9A 3Q12A 4QQNA 5FULA 1DS6A 3ZI0A 3VBEA 3D6FA 3U13A 1ADGA 4JWTA 3ZE6A 3AUSA 1H2BA 1H4QA 3AEYA 1ODLA 4AUMA 4NVRA 1K7CA 4U7PB 1KZGB 3FUUA 3N2IA 1MO2A 1R0YA 3SXUB 1YHZA 4EGQA 4CEJA 3PK0A 1ZONA 1X7YB 3KYDB 3G9QA 4OQQA 3VZSA 4DIDA 2QX9A 1C7ZA 4HDMA 4D96A 2RB4A 4MINA 1DFIA 3G2PA 1GZ7A 4GS5A 3LQKA 4XDZA 4LF7B 4O4IF 1TUGA 1E4YA 1XJWA 2IYVA 3SSMA 1S2GA 1AXRA 3WL8A 3UMBA 2GM9A 2GNAA 1G59A 2GHTA 1EFVB 2XHEA 5HIIA 2C2ZA 2NU7A 1II8B 4LNUA 3OM8A 5K8VA 1GSIA 2QRHA 1EWRA 2XT6A 3BIXA 3WMWA 2CDCA 2WSSD 1A8IA 1ISGA 4EZBA 5ALVA 1ZMXA 2J5BA 3Q10A 1L5KA 3EOAI 3EXFB 4EF6A 1R0XA 3GJTA 3GJRA 3GXOA 1XRJA 1UQRA 3EEBA 1CG6A 4X8LA 5EOVA 1LKZA 2Z5FA 3EJ6A 3PZBA 3HPQA 3ZU5A 3PF9A 3TECE 5BY2A 4GSLA 4Z8YA 1Z25A 3ZGLA 5BN3A 3Q8WA 3PIIA 4D9FA 4R98A 4CNQA 1G3IA 2Y1LA 3I32A 4AF6A 2P9BA 1M8FA 3OC0A 4JP5A 3W1VA 3WLMA 3E9RA 4DLSA 1AA6A 2AZXA 4HAZA 5FWDA 2XDQB 3AL2A 1KJ8A 3B5JA 4RJ2A 1J97A 5EZYB 2OCKA 3R09A 4W63A 1APBA 1Q11A 3LUFA 4TLEA 4NF2A 4U7HA 2Y1WA 4RNDB 1YA8A 5KYWA 3GHHA 3A7DA 1AU9A 1KI9A 5DULA 1C0PA 2FYTA 2OILA 3DZGA 3FHJA 4ZDJA 2H4HA 2EFDB 3CRNA 4NU5A 3BK7A 4TV9F 3PIRA 5GONA 4CKEA 1A3CA 3AR8A 3IPYA 5L3VA 3HK2A 1GQ2A 1ENOA 4EJSB 3GVXA 2GM3A 1C2TA 5KYXA 1H3EA 1DJNA 1P81A 1VIDA 2YMQA 4FR5A 2C1EA 4BZZA 4JBGA 4PIPA 3SEQA 4LOHA 5BXYA 4KGXA 4P0PB 1IBSA 1L0BA 1QAQA 2Q49A 1S9HA 3H1GA 3AOEC 4D8VA 3NIGB 4WK2B 1H2YA 1Z5VA 1XZJA 3G79A 3GOQA 4LMBA 1NX9A 2V97A 4GP9A 1QQBA 2VJMA 1RZ3A 4E1AA 2AJDA 1GAEO 4QQRA 1QPZA 5TV2A 5LP6C 4M87A 4BLRA 3UBTA 1G0NA 2PS0A 4KTTE 3C14C 1RXYA 3MD9A 3M9LA 4HHEA 2EBUA 4OUDB 1TO2E 4C03A 2Z2YA 1MC8A 3IIKA 3I9JA 1PJ8A 1E9RA 1YOVB 1MU0A 4WESA 5E6UB 4EQ6A 1NJ2A 3SVTA 1ZGGA 2G1PA 3HG7A 5FBRB 2HRZA 3OE1A 1J6UA 2UVPB 2G9NA 2FW7A 1XMIA 1HYHA 4X6UA 3J81A 4CKYA 3O9ZA 2OC4A 4Q9NA 1FFBA 4BV2A 1RI2A 1E3WA 2WAYA 3GDWA 4QYWA 3SE0A 2EF0A 1M72A 3VBCA 2WEKA 4RJJA 4CM9A 1WPRA 2CVPA 1UBHS 3OX3A 4OK5A 1MJGA 4U9UA 5AM4A 2I2FA 2Y0EA 3F5FA 4BNLA 4EGCB 5JH7B 3AHGA 1T0BA 4AG3A 5BNTA 1N5DA 4XJTA 3M6IA 4R2LA 1D1QA 2WIJA 3RGWS 1I4EB 4L15A 2IE8A 2HJRA 1VLZA 3U7QA 3SHVA 3OF3A 4F4HA 3L0CA 3WZLA 5A0VA 3PNOA 2JAXA 4EY5A 5F76A 3MJFA 2REQB 5I4BA 1O5OA 3SZOA 3O2NA 1CU1A 2AMVA 2JGLA 2XT0A 4P38A 1YR6A 1GT91 3KZOA 1Z68A 4KVGA 4BRUA 4LOKA 1PUXA 3RVJA 4YR9A 5T67A 2CJFA 1H22A 1Y6RA 3VJMA 2AK3A 1RLIA 4FOPA 2JFOA 2O2GA 4CUKA 1DDIA 1KO1A 4C7VA 4DMKA 4LMAA 5IDVA 5K2OA 1UMBA 3OPYA 1KRHA 3PXEA 4D3FA 4BXOB 1SU4A 3A3KA 4IIBA 4YAWA 3ZEIA 3ZV4A 3NV9A 3DEJA 3F8SA 5ALQA 3RT9A 1VG0B 3FNBA 3DE5X 5ECYA 1YZUA 3V3KA 2FSHA 4XWGA 5KU7A 2QGNA 5LJIA 2PKQP 2G07A 1UXIA 3IXMA 3CVUA 3T4EA 5A4JA 3UAOA 1E7QA 1EZ1A 1VL8A 2YHIB 4YH1A 5CAEA 3RU3A 1EFPB 5LR6A 3L5OA 1T9AA 1FTSA 2RD2A 1DBRA 2MSKA 2Z3VA 4H0NA 4Q9LA 3WYDA 3QEAZ 3CU5A 2ZJ6A 4C7OA 1DEHA 2AKEA 2WICA 3BHIA 3QI7A 1NJ8A 3GO4A 3VR4A 4A8TA 1YK1A 2MTBA 2ATIA 4KXQA 3U3KA 3VZQA 3NYRA 2F17A 2FWPA 4TGLA 4HTAA 1K6XA 3CZ9A 2CJPA 4J16C 1F6BA 4R8LA 2JF0A 3QVVA 1E8DA 4QGBA 1VMDA 1NVVQ 2OBBA 3FPSA 1L5ZA 3X1KA 1QZXA 3ZCPA 5IN4A 2WYUA 3ICPA 3LBHA 3KBOA 4WCVA 1RJDA 3BG5A 4LYFA 3N5CA 4IEIA 4ZP1A 1TYEB 4BZQA 1HDCA 2HHLA 5CA0F 4ZVOA 5K9ZA 2VK8A 1X42A 2MSCB 2Y9MB 2YX1A 4ME6A 4D0LB 5IZ4A 3CN7A 4Y9DA 2EFEB 2TYSB 3LCMA 4XSVA 5I7SA 1C8VB 2CB9A 1YL6A 4QJ3A 1OAOC 2DFTA 3CNLA 5K51A 3CVYA 4XM2A 1P60A 1P4GA 1AB5A 4Q9HA 4Z3DA 4DWWA 1P9LA 2ID4A 2B82A 5AKXA 2J6IA 1FS4A 1NLZA 4WECA 1OUMA 1BWRA 2FHPA 2FVYA 3DFUA 3QWBA 5E1OA 3SS7X 5KOYA 2QVGA 4UZSA 4ZA2A 1OIXA 1SU6A 2X40A 3QJGA 1KQ3A 2J9FB 3EFOB 1OPXA 4DJDC 3MS2A 3KTAA 3ILHA 1GTJ1 3DYBA 3CZCA 3H1TA 1YTUA 1FX0A 1BHSA 1Z07A 4DF3A 1Z83A 1JWBB 3JS5A 4YV2A 3LDGA 4RY0A 3Q3EA 2H51A 3JASA 4J7UA 4IDDA 2CK3D 3UWSA 1Z28A 3PUJA 1N2CB 4O3FA 5DYNA 3O73A 4JN6B 5KVCA 4OGFA 3U5ZB 1MJHA 1AGYA 1A2KC 3ID6C 1LZLA 2J3IA 4ZHQB 3LOQA 5HFAA 1V7ZA 3PNMA 4JX9A 2WNHA 4OHFA 5LBUA 1D1SA 1ULTA 2XTMA 1I33A 4HNTA 3KXPA 4K5QA 1LWNA 1SKUA 4ZQEA 4B09A 2OLJA 4QJ5A 4YJKA 3WGTA 1I4WA 2DTEA 1JEOA 3OWHA 4BFWA 1RWMA 4GSYA 3QE9Y 2ZJZA 4DUPA 1DG3A 1T9GR 1VGVA 4ZOQI 4C6TA 1C0KA 2C2MA 2XECA 2WWWA 2NVUA 1YQXA 3FFWA 3UENA 4HYYA 4MYDA 4DABA 3NWEA 1RYDA 4HK4A 2VXCA 5EMNA 1WLYA 1I10A 1NW5A 1HE3A 4TMXA 5IW8A 3RGGA 4IZ6A 3T06B 1V7CA 4EW6A 3S8MA 4PYMA 3NOOA 1FS6A 3TCKA 2BONA 2QJWA 2FGJA 3NWPA 4B71A 2QLNA 2NP7A 2JAOA 5BPFA 2AX3A 1OKKD 3IBGA 4CQLA 1NYTA 1ML3A 4QO8A 1ZH6A 3D7NA 2PX2A 3RREA 3RWBA 4ALMA 1XHLA 1LLDA 1ZUHA 1LUAA 1RIFA 4UU1A 4LGVA 2GK7A 4J07A 1WZNA 3BFKA 2TMDA 1E2BA 2PS3A 4CLOA 2C4HA 4D3YA 4BFZA 1F7UA 3A04A 5KKCA 4B4UA 2GLUA 3CNOA 3NG1A 4IDHA 1ATIA 4ZVKA 2B37A 1YJXA 4PNHA 1IHOA 2P5YA 4BX3A 6REQB 1QP4A 4BO8A 1DIBA 3RAEC 1JJAA 1F8GA 3KLBA 4KZKA 2GTHA 1FB5A 1PFQA 3MQ2A 4M3NA 3JYQA 4PICA 3JQ8B 5BNIA 1HMYA 2SICE 2ZS8A 3M1AA 1KR5A 4GM4A 2REBA 2XI4A 4LHEA 4ML3A 4UEOA 4I4TA 1WCIB 2QQ0A 4OH1A 5E4JA 3W5BA 1YFLA 1ZVVA 2WD7A 2VWGA 4RVNA 4OM8A 1RNLA 1HETA 4N4AA 4XEUA 1TC1A 4BNIA 1FNSA 4ISBA 4EY8A 1U5CA 3H5VA 3JALB 3PTAA 2EFCB 1Y7IA 4FSXA 1HI9A 5DYTA 4P7JA 4WI1A 4AK9A 1X9HA 3LDAA 4DARA 2PKEA 3I4CA 3FWZA 1DWOA 3T4PA 3D1VA 3FLEA 4NHEA 5AVWA 4RNCA 4NE7A 1FY2A 3KTFA 4MGIR 2VT7A 4GXTA 2FMKA 5D3MB 2FN3A 4FOOA 1TVMA 1VE9A 4LY9A 3LCJA 5DLDA 4Z9XA 4CMAA 2GPSA 2CXQA 4PPGA 3OHSX 4KQGA 4PE5B 1KTVA 2N42A 1EK5A 2Z43A 5BP7A 3PKIA 2WJ6A 2G5TA 5FKJA 1MUUA 3O4HA 2JVJA 2P9CA 3KQTA 1UL1X 2JLYA 3SQLA 1I0IA 2GZAA 2R1TB 2ZQZA 2IUFA 3QWHA 3PKZA 2QIPA 5A6VA 4W9NC 1YWGO 1QK5A 2EBWA 2NVBA 1LSSA 2HWWA 2YV1A 3GQBA 4CMEC 1CD5A 1HG0A 3GRAA 4DC9A 1QO7A 3D3WB 1KKLA 4QYIB 5F1KA 4FB5A 2D7CA 5KTSA 4F92B 3H83A 1PT7A 5LOVA 3RKRA 1DUVG 1EGMB 4ZV9A 3KR2A 2BUBA 3VPCA 4U3JA 2H08A 3W1WA 2FJ0A 4I99A 1KDRA 3ZZ0A 4AAYA 4C5CA 1A27A 5HX7A 3U4GA 1PN3A 3V1KA 1UBSB 2I22A 4JLDA 4N0DA 4ZTBA 4DZTA 5BVGA 1YJAA 3A9TA 5AI4A 3BTUA 1UEXC 3WTBA 4D81A 2WB2A 2CCGA 4MRMA 1KIAA 1TJ3A 2AFHB 3ECSA 1D5CA 3QEOA 3DCIA 3L0OA 5DWDA 5KNLA 1TEXA 2B4RO 3ETNA 3LY7A 2V3CC 2WINI 3EVBA 2XYHA 2FF5A 2RGCA 2XVZA 1U11A 5AI8A 4ZEOA 5JFOA 3I8SA 1JPNA 1TRKA 5EWMB 5FT9A 5B3LA 2EZ4A 4B3DA 2OESA 5KTNA 3L4JA 4BGDA 2QMZA 2ZT7A 5A6SB 5TQJA 3E0QA 3GLHA 3N7AA 4GMXA 4IJQA 3F6EX 3M34A 3JQ9A 4LJSA 1C9EA 1GFZA 2WLTA 2OG2A 4ND1A 3F8WA 1D0VA 1QV7A 4Q6BA 1YS7A 3I92A 3IV7A 1STOA 2HIAA 3GPCA 3LTNC 3Q9LA 4IAOA 1V16B 1ZUIA 4V0MA 1M10A 2V7EA 1HDGO 4JBHA 4QBTA 2AYZA 4LXIA 2AJBA 5A5GA 2ZZMA 1MDBA 1FP7A 3ESDA 1L5LA 4KIWA 4OJTA 4ZVTA 4Y2VA 2GAJA 3LL7A 2V6MA 2A33A 3HXKA 1N5IA 4TTIA 1O08A 3SZRA 4Y6QA 5FJJA 2VUTA 4QPNA 3W9UA 4AMVA 3GJYA 1TU0A 2PPVA 3ZWPA 4CG0A 1J8MF 2RBKA 2WABA 3FCYA 3HABA 1GKLA 2JDID 4UAUA 5J5AA 4FX5A 4BNKA 5FEUA 2RGEA 3NOXA 2F2TA 5B7NA 3RQIA 2XUAA 3CT4A 4NMHA 4AYXA 2PXHA 2TMGA 2D8MA 2BSAA 3HYTA 3COWA 3L1VA 2IHUA 1W4LA 2Y1FA 2RONA 2X0DA 4B34A 4YPFA 3LCVB 1U2PA 4JGGA 1UAAA 5JWOA 4JDUA 1Z35A 1CR4A 2PGJA 4BJHB 1THMA 1O8CA 721PA 2J0UB 1RBZA 4NX2A 5AKJA 4BMPB 4WKCA 4B47A 5KDOA 4BGUA 4ZZ0A 3VGJA 1GDDA 1JQBA 2O2CA 1CUBA 3ERCA 1EZ4A 2B1GA 3L4BA 1IUKA 3V4OA 1FXWA 5CVDA 3OIDA 2E2WA 1Q74A 4LGMA 1UBJS 2Q8PA 3JD1A 4WASA 3BBPA 5ARBA 3PRYA 3LVRE 3P4YA 2N47A 4IGAA 1OXTA 1UBCA 4WCFB 2VHJA 1MO4A 3AQ4A 4LSMA 2DQYA 1XDBA 3OQJA 5BT8A 4JLPA 5JYCA 1KJJA 2VDWB 2HMWA 2XOKD 3SNKA 5MDHA 3HVUA 5CK4A 1AN9A 2J8ZA 3NDPA 2YWBA 4R2KA 1CZUA 4E5KA 2LD4A 5IZCC 4QUGA 3FDJA 1Z2NX 1T6XA 1YK0A 4DJ5X 5HCNA 4QSMA 3CXRA 4X3PA 1ZM4A 3PNQA 4EUSA 2J9RA 4OQDA 2P9HA 1PQYA 4ZT5A 3K70B 3G5LA 5EQDA 5L8VA 4HFJA 1TLTA 3PEEA 1ZNYA 2PSFA 5DLEA 3AJ9A 3RR2A 3SD7A 3P96A 4DY4A 2E4YA 2JJ8A 4NMLA 1SH7A 5J1SB 1E4OA 4E2WA 3SM9A 4F1JA 1XWFA 4RZQA 1CFZA 5A4FS 5CFOA 1R3DA 3RUEA 4DG8A 4F86A 4NV1A 1KAMA 1TB4A 5CFPA 2WF5A 1JQKA 4AP9A 2AE1A 2VEOA 2R1UA 1B73A 1CP2A 1WHTA 4B9AA 3GJ3A 5COBA 1L4FA 1E59A 2Y0PA 3GARA 1BCSA 2F4NA 4MIYA 2IV3A 4F6RA 1E69A 1WU7A 4L4ZA 3EZYA 2MYTA 1V11B 3OMWA 4YROA 3CNQS 2VP0A 4DLTA 1WR8A 5JRJA 4TLLB 3TNFA 5IJ9A 2C2YA 3Q6NA 2QTFA 1EVIA 1NL3A 4QOEA 1E3IA 2VYVA 3DDZX 3CKKA 1KEUA 1JMKC 4DN6A 3AM3A 3KK0A 4Q3CA 1TPYA 2BJHA 2WTXA 1V9CA 4M1QA 5CFZA 1IIBA 4RLQA 4Y1EA 3AVUA 1ZCFA 1RSZA 2C95A 2C9ZA 5E8RA 4DCPA 1E9AA 3DSRA 2EL9A 2HLDD 3D8BA 1EWVA 1GRCA 3G1UA 3R3HA 4UVHA 1JJBA 3UXHA 2ZYTX 3Q98A 4UHCA 3UN1A 4F72A 5KNCA 2I3BA 3K0EA 4G8BA 4AY3A 3DFFA 5A02A 2OORA 3PDHA 4HEA1 4PU0A 3UTCA 2IF0A 4BU0A 4ZOLB 1OXSC 4E15A 2XGJA 1N2GA 3STTA 1WXWA 2F62A 3RAJA 3VDRA 4LZNA 2GD0A 3G5AA 3LVFO 1YMQA 5E1DA 5FLYA 1T35A 4DIKA 4F4FA 4XWOA 1WKBA 1P2BA 1VXRA 2D59A 2VG8A 2IXFA 1ZY2A 1CUSA 1OU0A 1U3CA 2KYRA 4R8MA 5JATA 1MZPA 1PWEA 4I1SA 1UPXA 4OOEA 3HWWA 3P0RA 4Q7LA 1PGOA 4R3UC 5LA6F 3UC5A 1BDBA 1ZK1A 3TB6A 5EIEA 4ZO8A 3F9IA 4KQIA 4C30A 3G82C 2DFLA 3FTFA 3Q8KA 3D3QA 1XCPA 4QICA 4ZYWA 4P82A 3U40A 1Z18A 3UMRA 3NM4A 4FHDA 1A9OA 5FHQA 4LY3A 4FFLA 3FZGA 4CMIB 4DL9A 3TRFA 3EQ9A 2UZ1A 4C0LA 3COJA 4YV0A 2BUCA 3LE8A 2F8MA 1C9DB 1CS4C 5AOCA 4O4IA 5JI2E 1IXYA 1NMXA 1R18A 2FEWB 2WP8J 3MCZA 4FGZA 5FR2A 1R74A 3OE4A 4JSYA 2HUPA 4EHHA 3MB5A 5HM8A 4C0QC 4BQNA 2G5PA 3DZHA 3RS5A 3BXFA 1PEAA 2JFWA 3L05A 5H1YA 2HA7A 1W59A 1XZLA 2I6QA 1EHCA 3N6XA 4RHFA 2HRCA 4JI4B 3SQXA 3ADKA 2HU5A 3U7FB 4M1SA 3HVIA 4GOLD 4WK0B 3GP3A 3L4SO 5FBVB 3F9CA 3PUZA 2BGWA 4QDJA 3EXEA 1Y3IA 4HRVA 5IABA 3O83A 2H1HA 4FKMA 2ZI6A 1E1RA 4DV3B 3PNLA 4M76B 4NCIA 5H81A 3NCHA 1CF9A 3UH0A 5JAPA 4NXNB 3ZJ5A 1NX6A 1AIPA 2LUOA 1IB0A 5HG0A 4OHYA 2WV9A 3FZEA 3W7AA 3GLRA 3FUTA 4G65A 5LQMA 3BJZA 3AX6A 1J25A 3PWKA 3THWB 1AQ6A 2WTUA 1C3XA 3HDHA 4C4XA 3Q6MA 1KEEA 2VPYA 1K3TA 2PAAA 2ZFUA 2IS4A 1CY2A 3MOIA 1M54A 1OVMA 3B3AA 4IJKA 2XX3A 4MW2A 4LHXA 2VF5X 5EKXA 4HB3A 2O4CA 3PT5A 3T7DA 1Q17A 1QIIA 1WXFA 4P3YA 5CDGA 2FZWA 2ASEA 4E32A 4QBGB 2XW6A 3A9CA 1Y5RA 2Q5FA 3PITA 4N5DA 2VTKA 1BN7A 4C0KA 2OP0A 2FA9A 1QCZA 3ZHSA 2JAPA 3CIFA 4OBEA 3TXXA 4BC0A 5INTA 1Q44A 4FD2A 3I8OA 4X63A 4U63A 3MVEA 2ZYWX 4ID9A 1IQPA 1H8ED 2X76A 4LYDA 5JV5A 3HNOA 3OT5A 4LF4B 1JHRA 4GVPA 3NANA 4BLTA 2UVDA 1V48A 2VJPA 5AUPB 5LL6P 2EJWA 4AZTA 3NIWA 1ZOOA 3QEMA 1ETUA 2GK6A 4PYOA 4TM8A 4B8WA 1OZFA 3KD3A 1T5SA 4ZGWA 1ENZA 4FS3A 2C82A 1QHXA 2OFWA 2P6MA 1Y3BE 2IOYA 4TL9A 5HK8A 1XFDA 3BEOA 4PHTA 2GPWA 1TKBA 3TQQA 4K0RA 1FMFA 3KZ1E 3R9XA 4R9UC 3JTEA 3QNWA 4U5QA 3WDKA 2EBFX 3PC3A 4ID3A 3D7SA 1T2EA 3L82B 1UT8A 4NCBA 1P4RA 2JFYA 5J2TB 1IUOA 3RYIB 3JARB 1WXIA 4D56A 1ML4A 1LLUA 2PH7A 1YCDA 3RFFA 2LCQA 4Q4LA 4UREA 5AVJA 2XZOA 1W76A 1DXHA 3L6EA 2QTNA 1L3BA 1XKTA 2AK2A 5JZ9A 1S2LA 1BDHA 2E5FA 3FZQA 3EW7A 4TUYB 5FUWA 4P4NA 2ZRAA 4G0WA 4WW0A 2R44A 3ITDA 3P4UA 3GEMA 1LJLA 1X1DA 4TRNA 2A5JA 5EINA 3RS7A 3T9CA 2JGMA 4NZ9A 4CR7A 4PZUA 2JZNA 1KFCB 4Y9RA 3V1MA 2P9JA 1U4NA 1JRLA 1ZMTA 2YIJA 4A8PA 2POCA 3O4JA 2V4UA 4YAUA 1KJ9A 1MNAA 3TBKA 3VR6H 1TJPB 4L9WA 4OYRA 5I9IA 2O2ZA 4HLDA 2H29A 4GMFA 4B46A 1KPHA 2EQBA 2FWNA 3QJYA 4ND5A 3PL1A 1TVCA 3KQQA 1GSHA 2PU7A 3DW1X 3GFBA 1GGEA 3CXUA 2NU9B 2B36A 3DFZA 4EUHA 1ZL0A 4LHZA 1K7EB 3D6UA 1O2DA 4Q05A 5EWJA 3HN6A 2IW1A 2B35A 1U1IA 1GAQA 2WOJA 5I7UA 4B84A 1PNOA 3V32A 2GESA 3QMWA 1RQLA 2OOKA 1GTG1 1RLOA 3EGDB 3O0TA 2OXEA 2XNHA 4J43A 4RSHA 3S29A 3WL3A 2XGGA 3N8KA 1U8UA 2FN8A 2OCXA 3PFWO 1ZW6A 4R2MA 3ZWYA 2CXTA 4PC2A 4X1IB 2C7RA 3N59A 3V6LA 1QGUB 1VZ3A 3DDWA 2YWFA 1EINA 1H9BA 1PSZA 2ID9A 3PXDA 1AO0A 2XBMA 4B35A 1F17A 4BIMA 3DOJA 1A95A 1YR8A 4YCCA 2AZDA 2ISQA 1RXIA 3CRZA 4DHEA 3LZDA 1GGMA 4DG9A 4KQKA 3GUUA 2JB9A 1JV2B 1CNMA 1EE9A 1SHJA 2WJIA 2QYSA 2BZSA 3AFNA 3K9LA 4X95A 1PUIA 2JA1A 3PGXA 1HTBA 5CTJA 1GSAA 1T0IA 2VDJA 1Q77A 3JW8A 4FQ5A 4NZMA 5IYZA 1P5FA 1F1JA 2YVKA 4FD3A 3F6PA 2Q07A 3G0CA 2BD0A 1R5OA 2PZEA 3AB8A 2GCEA 4E1BA 2H31A 1HYGA 2NUPB 2ZKLA 3LUKA 2HNAA 2JAUA 1TCCA 1KKUA 1VKNA 4PZYA 1T0PA 5EJ4A 4B5LA 3ZV3A 1XRMA 2WILA 1FP6A 2P9GA 1WG8A 1U0LA 4NATA 1JHAA 2OO5A 1B8PA 4ZZ2A 4IJ6A 4II2A 2IYAA 1K27A 2GJAA 4MLZA 3FUXA 4F3YA 1QCDA 3MGCA 3T7CA 3ZGZA 1LF0A 1HGXA 2D2VA 4DRYA 1MR3F 1QM5A 5ALEA 4CKXA 3PUWA 4KVAA 2FW9A 5AW4A 4FUQA 4MQ5A 4D4HA 5EJ6A 4RELA 1OH8A 3AO0B 3D6MA 2PT9A 1B23P 1Q2XA 3QI2A 4IY1A 1PNQA 3AFOA 4Y6LA 4YRLA 2R8PA 2XNDD 3QU7A 2Z6QA 3CGGA 4LJ4A 4MYTA 1YDWA 3KIPA 3RRBA 1XZGA 2C42A 1T0JB 4PLZA 2WI8A 3V4FA 3ZBTA 3JZMA 3P0IA 4U2CA 4MROA 3QF4A 1CE8A 2WVGA 2YXDA 3VOBA 3ZUPA 5KTMA 2A14A 1BVYF 2MSLA 1MB2A 1PJ2A 4CE6A 4NCKA 2PKYX 2IWHA 1DXQA 1E1YA 2YZ2A 5ICFA 2QR5A 4AULA 5FP0A 3ISTA 3N3AC 2I2DA 4IZOA 3I28A 4RK5A 5E6SB 4PSDA 3IOYA 3WYEA 1Y6GA 5LBTA 2FPSA 4EBBA 4FMCB 3W5DA 4N01A 1J8FA 2ZSEA 3IR5A 3MPUA 4A8JA 2C1XA 2Y05A 4PFJA 1I5OA 3HKCB 5JU6A 3JD3A 4K86A 3WLJA 4FOLA 5TJ9A 5JAMA 4LFBB 4UOZA 4GMDA 1TTHA 3U16A 1Z82A 1JB9A 4IVQA 1J8YF 4IIXA 3UICA 1PZEA 4UJ5A 4RIFA 4F9FA 2IEAA 1R6DA 5ALXA 5JD6A 5ES4B 3G2HA 4BVGA 3EDRA 4GECA 2WYVA 5IDQA 3NIBA 3RC7A 1VL1A 4F2PA 3ND6A 4B43A 1PAUA 2PMWB 3GYGA 1V5FA 2QROA 1ZITA 1BD4A 4M9XA 4OBWA 4BNUA 1FFGA 2W2TA 2RH9B 3FNQA 1EMDA 2QYHA 4OBBA 2NOAA 2GETA 4IKOA 1ESMA 1V2HE 5GV7A 1Z74A 2I6TA 1RHJA 3H8JA 3NPMA 3NP9A 4ES6A 3PLNA 1ORRA 4KVFA 1EESA 1IAVA 3PDWA 1GDHA 3WWYA 5JWRA 2DOKA 1CLEA 1RCUA 2J6CA 3E8SA 4C7JA 3RUCA 3IKTA 4MMZB 1RHQA 1CUFA 3NTLA 3GLTA 2CXPA 3B7GA 1OBCA 1BDIA 1YS1X 5L95A 1J8VA 4B6PA 5JR3A 1YVPA 1JPJA 5CB8A 3PSHA 1GV1A 3RBAA 4DNQA 4G63A 4EJ2A 5G41A 1NBIA 1TM5E 4QYTA 4H7DA 3CTMA 4BMDA 2H52A 3N2GA 4HGYA 4JI7B 1MRSA 3EE6A 5DFAA 3IHLA 3EC7A 4OYLA 3NOVA 3UOWA 5IVPA 5JARA 1GUZA 3OJCA 4ECAA 2A30A 5CLGA 1RXCA 8ADHA 4RW0A 1OC4A 1UC9A 2PCLA 3O91A 5CIQA 1W75A 3GRKA 4MV8A 3ZU4A 3CR3C 5CDYA 5ALRA 3B9RA 1AKRA 3FPJA 4KIJA 2QM8A 1RCTE 1VIAA 2EIHA 2HMYB 5DNWA 1BW9B 1ZMRA 3KYCA 8OHMA 4YC7A 3RBXA 4O6VA 1CYEA 1YZLA 4AS3A 4Y98A 2P3QA 1SCBA 3FLMA 1CVLA 4D4JA 4ZJZA 2J33A 1JB1A 1H6BA 3VH1A 1K7XB 5CU7A 1M2OA 4HZUB 2REOA 5IU6A 4QAQA 4D9HA 1WKCA 1P2FA 5DBFA 1J42A 1QO0D 3ZNPA 2VQEB 3OAAA 4WADA 1U28A 3NI2A 4JIGA 4KN6A 2D2XA 3IPXA 1HBJA 4REOA 3RHSA 5L51A 3RYCA 1UWLA 1AJEA 3VTFA 1ORVA 3VDQA 5REQB 2I3DA 5C34B 3RWOA 3RVLA 121PA 1GPKA 3NTRA 1W4RA 4HYEA 3HRHA 2NT3A 4NE2A 3EBLA 2Q6VA 4R8VA 3RC2A 3SF8A 2HNKA 2JLXA 1YB4A 4LWPA 1E5TA 4N3GA 4BNJA 4WN9A 1SQFA 3OLYA 4TMVA 3UH1A 4EECA 4QZVA 1PR3A 2D74A 1DKUA 2H3EA 2ZI3A 5KNDH 4IFBA 3A36A 4UPDA 3D81A 1KH2A 1MENA 5GTDA 4PANA 2X6RA 2AYYA 4DPLA 3RFTA 3WRYA 1I80A 1XZNA 3QLTA 3LRPA 1U3VA 3WLSA 2XRZA 5FL3A 1XTPA 1P3DA 3D8TA 3MINB 3IAXA 1C4WA 4ZPXA 4Z5XA 4NMMA 1B6SA 1XOIA 5I4IA 4HXEB 2FPUA 2G82A 4LRTB 2PVPA 4MV4A 3P2MA 4KAAA 3W34A 4GKJB 5T41A 4IH9A 1E3JA 5F7ZA 2A0FA 3IVXA 3QVSA 1SNYA 5JNLA 2H5EA 2QQFA 3L7LA 4J2TA 2KM1A 1RZUA 1YIAA 2ZJ0A 4L5JA 2ABWA 2WPNA 4MV6A 2QV7A 4RQAA 3VJLA 3AL3A 2F9MA 2YIVX 3GR6A 5DHTA 1T2AA 1DINA 3KEFA 4MR8B 5JZBA 4GL4A 2ZUVA 4LVCA 3GEEA 1PEDA 3ADBA 5A4DA 3D6TB 1Z2AA 1IY2A 2CY0A 3MUEA 4WY8A 4D57A 4A73A 2OHHA 2ZYAA 4JJFA 4KL8S 5EJMA 3WAKA 4D26A 3IOEA 1E7MA 1UPFA 1OXKB 2EZ8A 1G64A 4Y2XA 4KACA 2W11A 1GNQA 2W2LD 1DC5A 1EDZA 4EKNB 2V4ZA 3FWPA 5IS2A 2XE8A 4F84A 1NC3A 2X7HA 4MW7A 3ZE9A 5CDHA 1D2MA 1G1MA 2C7OA 1Q84A 1ND6A 2NV0A 4JLNA 2R4TA 4P6VF 1GRQA 3OBIA 2RIRA 3QKRB 2X5KO 4V1CI 5J63A 5K4HA 3S81A 4TSFD 4BKOA 1Y42X 4NOLA 4BO2A 2AWNA 5IPFA 1CY0A 2IXBA 3SFZA 4AS1A 3K5PA 3OUTA 4FE3A 3E15A 3CIOA 1JW9B 3CUEF 5AXAA 3TLJA 3SEFA 3EQ2A 3A6GA 1TK9A 1PR6A 4B81A 5JXWA 1GNVA 4A16A 1T6YA 4O4HF 1IZ9A 2QV0A 3V2GA 2C5LA 1RU3A 1XAGA 1Y33E 1E6LA 4Y6SA 2NYUA 3LYAA 4N54A 4QPDA 2VNAA 1GEGA 1G291 4KQFA 4I50B 2XE7A 3SU8A 2AMFA 1SCUB 5EIHA 4MB2A 4N5IX 4DZZA 4YJFA 2EX1A 1KVSA 1X7HA 1XRQA 3D8SA 1C7QA 1R8SA 3K8YA 3L7KA 4FS8A 2J0QA 1D2NA 1G8YA 2YJ6A 5KYKA 5EYPA 3TLEA 4BWVA 3H05A 1X87A 2CJYA 2GA8A 3CWQA 1TD9A 5I5GA 2Q3CA 5SZKB 4JC4A 1OCEA 1G20B 4RFSB 1B0ZA 5LQAA 5M29A 4M9CA 5KVSA 2VH5R 4TROA 2G9UA 2WD9A 3DHEA 3OPYI 3I37X 2RE8A 4WJZA 5A2QA 5FI1B 4ZFNA 4YCJA 2UZIR 3MRVA 5JSZB 4B75A 3GV0A 5F9HA