5EN4A

Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5en4A00
4EDFA 4RPJA 3C1AA 3ANLA 1GDHA 4ZQHA 4ALJA 5EPOA 3AUAA 5I8WA 2WDZA 4QXMA 4OQYA 4K6FA 4RVDA 3HN7A 4JBIA 3DWFA 2VWPA 3D5QA 2V6GA 1S6YA 3VVBA 2GN4A 4B79A 3GPIA 2G5CA 5T5QA 2ZJ1A 3C7AA 3MEQA 1U4SA 2GN8A 1WXDA 4OXYA 4BB5A 1N9GB 1PS8A 2CZCA 1GU7A 2NU7A 3QHAA 1P0CA 1GYPA 2DBQA 2F1KA 5JCJA 1F8FA 1DFHA 4WUVA 3Q6IA 3RAJA 2IE0A 1E92A 3H9EO 4IDEA 2Q1TA 4FR5A 1GTMA 1KEWA 3FCOA 3FR7A 1A27A 2YV2A 5DBIA 2ILTA 3WBFA 5BSFA 2B5WA 5EERA 4Z9YA 4AJ1A 5JDIC 3ZWAA 1GZ6A 4GX1A 4CPDA 1ISJA 3QWFA 4CV1A 1I01A 3TWOA 4J9UE 1EVZA 5L4NA 3KZVA 1U8FO 1WZEA 4WE3A 1KC3A 4WLUA 5F5NA 2JAPA 2PA3A 2R2GA 4XQEA 1CDOA 1NQAO 3EMKA 3QE3A 3MOGA 1BDMA 1EZ4A 2O3SA 4IIUA 5A03A 4B8WA 4BNFA 1LEHA 4IJKA 4OO3A 4Q3BA 1E7RA 3COSA 2Q49A 4RPGA 1AHHA 2C82A 4BIIA 3AK4A 2XXJA 1Z82A 3RQSA 3D1LA 3QVWA 3ST7A 4JCOA 5KJ6A 3B1KA 3G17A 1NWCA 3KTDA 1G0NA 4CM5A 2VOJA 1QYVA 1EVYA 5B4VA 4RORA 2EWMA 3MZ0A 4CV3A 3V2GA 5A05A 4BGUA 1WVGA 3SJUA 4J1SA 4YAJA 4ALKA 5L4SA 2QQ5A 2Y0DA 3E48A 2AEJA 4PVDA 4TQGA 5JFOA 2CVQA 4YBZA 5L9AA 3UVEA 3AI3A 3RI3A 2W2LD 1YL6A 4JX8A 1QYDA 1HL3A 3HZZA 1H94A 1UXHA 3SEFA 1PGQA 1H2HA 1I3NA 5A9SA 3FNFA 3ON5A 3IKVA 1UJMA 4GX5A 1U2DA 3RBXA 4GAEA 4IS2A 4KMSA 2EKPA 1K3TA 1E7MA 2G76A 4ID9A 3GDOA 1NBOA 2D2IA 4HY3A 4CQMD 3PWSA 2NVBA 1VJ0A 4XCVA 1Z7BA 3TZCA 3OIDA 1OC4A 4PG4A 4CLRA 3L9WA 3RBZA 1EMDA 1DPGA 2WD7A 3IDSA 3PHJA 4NJOA 3AY7A 4A2CA 4BOYA 4D79A 1KS9A 3OJFA 5CPFA 1J6UA 3AOGA 4J43A 2HCTA 2VRCD 2UVDA 1FMCA 4Q3NA 1YRLA 4D46A 1PEDA 3A9WA 3GHHA 4R1TA 1E1NA 2AMFA 3C1OA 1OAAA 4LSWA 3W6ZA 5MDHA 4DMLA 1ZBQA 3JQFC 4PGFA 1SB9A 1DIAA 3RCBA 4E21A 4XGNA 4IDDA 2Q3EA 2VYNA 4OKIA 4TVOA 1UXGA 3FRJA 2P91A 1ENOA 4WEOA 5CP8A 1N5DA 3K31A 5LDGA 4FQ8A 3TL3A 5IFLA 1YJ8A 2PZJA 2V7PA 1B14A 4EEZA 1Z74A 3L4SO 2ZYAA 3MJCA 3EUWA 4G2NA 4MP3A 1MX3A 3QLJA 1JW9B 1RM5A 1IYZA 3D4NA 3QWBA 3G49A 3CINA 3VKVA 1HEUA 1N2SA 3Q0EA 1M76A 2O3UA 1DB3A 4Y6PA 1GQQA 2W90A 2BI8A 1UZNA 3K5PA 3M1AA 2JAHA 3ICCA 1XIVA 1VSVA 4JXKA 1DRWA 5IXYA 3BMNA 1GEEA 4J49A 4RLHA 2B4QA 5TT1A 1I3MA 5DNAA 3ONEA 1OBFO 3CXRA 3ZHBA 3IC5A 3T4EA 4E2XA 3AI1A 1DIGA 3FWZA 3H5NA 1NFRA 4IIVA 3ZDFA 3GC6A 2AE2A 3Q9NA 4BNGA 4HWKA 1ZEJA 4RO0A 1RYDA 2EF1A 4OAQA 3GDFA 1GUZA 2C2YA 3A14A 2AA3A 4I08A 2YDXA 2H6EA 1QG6A 5T64A 3W4JA 1U5CA 3DZHA 1M75A 4DPLA 3Q2KA 4U0KA 1TT7A 5J23A 4ILKA 5FI3A 2FHSA 4CODB 1L7EA 1QMGA 4M1QA 2PWZA 4EUEA 1DRVA 2OFPA 1P1JA 3PIDA 3PYMA 4JJFA 4MKZA 4YT4A 3UCFA 1YKFA 2TMGA 4XYEA 1XG5A 1LA2A 4QUKA 5BSEA 1J49A 1AE1A 1EQUA 3KEQA 5KNLA 1JAXA 4QFCA 3UAGA 3NJ8A 1ONNA 3DMYA 1ISFA 4Y6SA 5G0TA 2BLLA 1JKFA 4D7AA 7ADHA 2FWMX 3LT0A 3ICPA 1QV7A 4CM9D 4JROA 3PLNA 4L76A 4NMHA 3GEMA 3HFSA 4YQZA 5I7EA 5IAAA 4TZKA 5K9ZA 1J4AA 1GPJA 5JMPA 1E5LA 2WSBA 1PTJA 3MOIA 4UVHA 2EGGA 3INTA 1P3DA 1X7GA 1LQUA 4CUKA 3OBBA 4CLEA 1XU7A 1MGOA 2EGHA 3DOJA 1C0IA 4BHTA 3RSHA 1SEVA 3BIOA 3H9GA 3I23A 1RYEA 1XYGA 4BNLA 4EJ6A 2J3JA 2QRKA 2JCVA 3H5AA 4DIFA 4IPTA 3I1JA 4EI2A 3HNPA 2C54A 5U1PA 3CUKA 3F47A 1EVJA 3AI2A 1Y9AA 4J2HA 4WLNA 4O63O 4YYZA 3WQSB 2I65A 4W82A 3ZWMA 2HKIA 2PZLA 2ZB4A 5JC1A 2Z95A 3WGQA 4F6CA 3OIFA 3E18A 5JO0A 4GVXA 1ZEMA 4GLLA 2VN8A 5TQVA 1LDMA 2ZB7A 4J0FA 5CDGA 1FDSA 1L7DA 4EBFA 5JAMA 2Y1DA 4PZCA 1ULUA 1VM6A 1CETA 3D7LA 1ENZA 4N5MA 4NIMA 4R5HA 5U9CA 5TGDA 3H65A 2D0IA 5GZ6A 1ENPA 1O95A 2Q2QA 3LC2O 3DTYA 4NHEA 4Y67A 3TOZA 3U62A 1DSSG 1H2BA 3H2SA 4PCVA 4AJPA 3RC2A 3WGIA 3DOOA 3RFTA 1C3VA 1EQ2A 2W2KB 4OKNA 3QWIA 4CQMA 1YH3A 3I5MA 3UHAA 1U1IA 2C5EA 5G0WA 2ET6A 1YVEI 3VZRA 3U5TA 1HT0A 1GAEO 2GZ2A 4KUEA 5HBRA 3BZUA 3ZNNA 1UZMA 4L0QA 3ZWWA 3KYCB 2NTVA 1H6DA 3JYPA 2QYTA 4Y98A 4KWIA 1Z6ZA 4FPXA 4DMMA 4RL6A 4C4OA 3PYXA 3P2YA 1MFPA 1N1EA 1MFZA 4E3ZA 4L4SA 4NBRA 4YJFA 1RPNA 3JCZA 4MPDA 3K8ZA 4GKVA 2BFPA 5EN4A 1HDOA 3EHEA 2NNLD 4K28A 5ILGA 3LT4A 3I9LA 2NU9A 4R5MA 1QLJA 1U9JA 1T4DA 2OUIA 3GVIA 5A5EA 4XD2A 5F1PA 5JLAA 1UP4A 1DFIA 1ONPA 1FDUA 1LX6A 1MXFA 2Y93A 4HFJA 4TRNA 2XPCA 4LVUA 4PG7A 4J16A 5KIAA 2VOEA 1KEVA 4BNWA 4II3A 1U3WA 3KBOA 1YWGO 3HDYA 3D3WA 4J0EA 3ZNPA 4WLOA 3TF5A 1T2CA 4UUNA 3D5TA 3MJTA 3KSDO 4W6ZA 1NQ5A 5BSGA 4AJ2A 5C37A 3ZZNA 5JW6A 4ZU3A 2WEKA 3HDQA 1BW9A 3L6EA 1T2AA 3VHRA 4J4HA 2B4TO 2HMUA 4BNNA 3LSYA 3SLGA 2ZJ0A 3ZHYA 3MTGA 2DTXA 1Z7EA 1Y6JA 1EE9A 1HYHA 2OBNA 2VNAA 2GERA 3OM9A 2B36A 3JQ8A 5EIOA 1Q7CA 2VWHA 2AQKA 4G5HA 3KVOA 3OA2A 2OP1A 4MJLA 5BR7A 2X0JA 2NSDA 4I5DA 4IJVA 1Z73A 3CMCO 4RPLA 4XQGA 2PGDA 1JTVA 4J6FA 1PU2A 2X5OA 3W8EA 1EEHA 3GRKA 4E6PA 1C0PA 2YQ4A 5T67A 4L74A 2DBRA 1NPDA 2J8ZA 4BGIA 4XYLA 3DONA 2VWGA 1XA0A 3PDJA 3FNHA 3O03A 4DPKA 5JAIA 2UUPA 4Y6RA 4RDIA 3KEOA 4MVJE 3WDSA 4CLDA 1J0XO 2UYYA 1DXYA 1VJTA 1UH5A 2J3KA 3LF2A 4AJIA 2C2XA 3GVCA 3ZN2A 4GX0A 2ZTUA 2PH5A 4TROA 4CR6A 3ULKA 4FN4A 1ZMOA 1NR7A 1P9LA 3ANMA 3F1KA 1NAIA 5TJHA 4B8ZA 3Q11A 3GFBA 1DHRA 4KDEA 4XQ9A 3RC7A 2Y67A 4PLFA 2Y0EA 5A9SB 3BXXA 2FSVA 1LQTA 1R6DA 2Y05A 1LSOA 3LDHA 3PGJA 1MV8A 4FSHA 4DRYA 3JQ9C 5FI5A 1O89A 2O3QA 3ZCXA 1Q7GA 4NJMA 4C7KA 4RF2A 4BB6A 4CLRB 4CMIA 2VTEA 2OP0A 5KCZA 1E3WA 3ETGA 5F1KA 2V6FA 4CQLB 2Y1FA 2WD7B 4MO2A 3DR3A 4YCAA 4MVJP 1GL3A 1LRLA 2DTEA 1RM0A 4J7XA 4XB1A 4J1TA 3I9NA 1AGNA 3MJSA 4L8VA 2HAEA 2O2SA 3I9KA 4BKUA 4IZIA 1DBVO 3PI7A 1PS9A 2IODA 1YJQA 4M89A 4CUZA 5KTKA 5CDUA 3D4PA 2OORA 3AM3A 1FDTA 3ZU3A 3K9QO 4AJJA 4R01A 4YRDA 1YQGA 1PQUA 1E5QA 1LJ8A 1HZJA 3DHYA 5GZ3A 3WLEA 2JHGA 3KUXA 4O0LA 3TQHA 4BMVA 4Z0HO 1NFQA 4UEJA 2HRZA 2IZ0A 1E6EA 4RGBA 1DAPA 4PZEA 4MIEA 3CIFA 3K2BA 2B35A 4B4UA 1H9AA 4KTTE 4YAEA 2VUUA 3PDUA 3JD2A 1QYXA 4DXHA 2AQHA 4CJXA 1JA9A 3BMNB 3X2FA 4KUHA 4ZHSA 4LRTB 1E0DA 1U7HA 2ZYGA 4MIYA 3TNLA 1Q7BA 5FWNA 5TC4A 4GL4A 4HX5A 4WOJA 2G1UA 4Q3CA 5KVQA 2GASA 4UVGA 1CRWG 3DEYX 2R6JA 3DMTC 4NG5A 1U3UA 1TXGA 1ZSNA 4FGSA 4BO3A 4PN3A 1CQJA 3AOEC 4IJUA 4R3NA 1TT5A 1HYEA 1LLCA 1O6ZA 3HSKA 5F3RA 1T4BA 4XX0A 4FDAA 1P74A 4EZBA 2AXQA 4ZGWA 4P4NA 4D3FA 1EUDA 1GCOA 1LDNA 1CWUA 5ICMA 2EERA 2JFHA 1NP3A 4KTVE 4WEQA 1YE3A 4HFNA 1H0KA 3JQ7A 4E30A 3UW3A 1PJTA 1UAGA 3NUGA 3D4OA 2BF7A 3SJ7A 3ZHZA 1XDWA 4OIMA 4P38A 4FFMA 3INGA 2VQ3A 3B20A 3R6DA 4HNGA 4BNJA 4GQAA 1W0CA 2C0CA 2IXBA 4E33A 1N92A 3ONFA 2F00A 3GVHA 1VL0A 3NAQA 2PKQP 5IN5A 4E5KA 2HMWA 2P5YA 2OXIA 4E4YA 3R3JA 1TEHA 3PWZA 2QW8A 3KXDA 1XELA 2WWRA 4E5YA 4EW6A 2A94A 3LF1A 2OZPA 1TLTA 2JCYA 3GMDA 4R54A 3S2EA 3JQCA 4TRRA 4L4RA 3GG2A 1TB4A 1T26A 2D59A 2ZTLA 1W4ZA 1YDWA 3HWRA 3JD0A 1NASA 3LQFA 3NTOA 5T6BA 5F5LA 1BXGB 3GDGA 1EBFA 4NBWA 4NH4A 1ZXLA 3OQ6A 5G4LA 1VKNA 2RCYA 5A06A 5KWEA 3ZV4A 4E5PA 4Q9NA 3FN4A 3R3SA 4IDAA 4QT0A 4H16A 2CSUA 1QV6A 3O4RA 1I0ZA 3FHLA 3ZWVA 1WLYA 4TWRA 4B4VA 5JYEA 4E32A 3DHNA 2ZIZA 2FR0A 4ZQGA 3WYBA 4EJ0A 3NEPX 2DKNA 3JQBA 1LRJA 1AXEA 4IXTA 4FC7A 1KVQA 4E0BA 2BFAA 5LCXA 1XGKA 2A4KA 1ZH8A 2IZ1A 4M54A 1EDOA 1LI4A 4GWKA 4CMAA 5MGBA 2CY0A 1IOLA 1ZNQO 3OJLA 3DB2A 1WMBA 2VNSA 4YJDA 1E7YA 5JY6A 2X22A 3KB6A 3OHSX 3E03A 3NTRA 3VPXA 1E3LA 2QZ9A 4RF5A 3UKOA 4HBGA 2IRWA 4OOFA 3ROMA 4XIJA 1PL6A 1ZIDA 2ZYDA 4TRJA 4UULA 1VL6A 3G3EA 2G0TA 5JSFA 1LLDA 4U6QA 4CQMB 3B1JA 4R9RA 2X5KO 1MC5A 1X15A 4I5EA 4EEXA 4O1MA 4F45A 3WMWA 2FSSA 4N7RA 1PGOA 3OQBA 1IE3A 2Y1CA 4PLGA 1K0UA 1NX6A 4IM7A 1GZ4A 4YJFB 4AJHA 1I36A 5H81A 2J3IA 5CG2A 2E49A 2Z1MA 4J1NA 1I32A 3PXXA 4KQWA 5FFFA 1I3LA 3BMOB 1V6AA 1C1XA 4LN1A 2X0NA 4WPGA 3IIEA 4A10A 2FN7A 1UP6A 4Z0TA 4I1IA 4W9NC 3KSZO 1YQDA 3NJ4A 4YWJA 4FFOA 5FEUA 2QHXA 5DCUA 2YFQA 4OXKA 3JQBC 5G0UA 3K92A 3EW7A 4EGFA 4OSOA 3A4VA 1UXJA 3P2OA 4QECA 4QX6A 4LK3A 3V2HA 2VWQA 1DO8A 3ENKA 1CERA 4YACA 2PNFA 3D3WB 4J7CA 4L75A 1C1DB 3VH4A 5HS4A 5IDWA 3G79A 4ND4A 3WFJA 5L7WA 3PJFA 2AQIA 3JQFA 2YV1A 1MP0A 3WSVA 2FRDA 2C7VA 4DL9A 2HMTA 2WYVA 3ZU2A 3I3OA 4K9DA 1BW9B 2GDZA 5DDIP 3AUTA 1FK8A 4NFYA 2OBYA 4RLSA 4RVGA 3UCEA 5EL0A 4R3WA 2O3TA 1E7WA 3H4VA 1UDCA 3QVSA 4ITUA 2RHRA 3C3XA 4DC0A 4BKPA 2ZCVA 3VKUA 3DHEA 4Z9XA 3V1TC 5BQFA 3JQ8B 3KV3O 1A4IA 3MCVA 4RVFA 3TDKA 2HRBA 1JVSA 5IDXA 1PJLA 1NNUA 4PZDA 5L45A 1D8AA 1TA4A 2B69A 2VHYA 1ISMA 1DRUA 3Q9UA 1Y5MA 2O50A 4OYRA 2H9IA 1R0SA 1U2GA 2G82A 5JS6A 1PZFA 1PJCA 2JKVA 2UDPA 4M55A 4N54A 4R51A 2B0JA 2QG4A 5C7LO 5AXAA 1P77A 3ZGYA 5ADHA 4ZQEA 1GUFA 4CQLA 3AJRA 2VHVA 2J5QA 3JQGB 3GHYA 2FPGA 2BGKA 3HQ4O 2R00C 1DLJA 1QR6A 4HKTA 4XKJA 3GT0A 3VTZA 4JBHA 2AEFA 1K6JA 3G1TA 1PJBA 1LDBA 1YB5A 3E5MA 2HU2A 1P1KA 4R16A 4DLLA 3GMSA 2GZ1A 4DLBA 1ZK0A 1Y5RA 3ZI0A 2DLDA 4J4TA 2JD1A 3OICA 1CF2O 1UDAA 4WECA 4C7JA 3H7AA 2EV9A 2WE8A 1T2DA 1HLDA 3C1TA 1W6UA 3BHIA 3GEDA 4R1UA 1X0XA 2TMDA 4ZD6A 3WX0A 1ZK1A 2VUTA 2NVUA 1IZ0A 3PJGA 1TVEA 3QP9A 2YJZA 2CF6A 3BMCB 2O7SA 3CEAA 1HE5A 2BKAA 3SBOA 3WQRA 3NKLA 4NJMB 1FDWA 3PEFA 4IGFA 1XU9A 2IYPA 4CMIB 3F3SA 3INRA 1Y8QB 2OO5A 1V35A 1E3WB 3IMFA 5ITWA 3EVNA 2I67A 3Q1LA 3BTSA 4NK5A 1SEPA 2PKQO 4MVJI 5TX7A 3U9LA 1K6IA 2GPTA 1CYDA 2NACA 5L3ZA 2A9FA 3R1IA 2NU6A 3DZJA 3FTPA 3CZRA 5AXBA 1K89A 1O5IA 4YB8A 2B37A 3WGHA 4CM8A 3BA1A 3H2ZA 3PTZA 1IPEA 3AWDA 3H9UA 4KWHA 2PD4A 4RPKA 1H9BA 1R37A 1PJ3A 2Q1UA 1LU9A 1NVGA 1PJQA 4YJGB 3U4HA 1KOLA 3UGKA 5CEFA 1ADCA 1T1RA 1JWBB 1VLLA 1XKQA 2PV7A 2E4AA 4XWYA 5TSDA 3W4KA 4WK6A 4K6CA 1E6UA 2O3RA 4MVJM 1MXHA 4K1LA 3PHLA 4GPD1 3AFMA 4JQCA 1O0SA 3WIDA 3HB5X 3QIVA 1ML3A 1R4MB 3U49A 4F6LA 1LDGA 1I5RA 5AXDA 1ZVMA 5EQDA 1YQXA 2EW2A 1XHLA 4EYEA 1DAOA 4NDNE 1O94A 5CDYA 3W4IA 4U0JA 2WJPA 2WD8A 5A9RA 2W8ZA 2QYSA 3GLQA 1PR9A 3F46A 2EG9A 4E2YA 4R4JA 1M6WA 4FCCA 1DC5A 2BRUA 1F14A 4UUMA 3GQVA 5G0SA 5JE8A 2IEDA 2DAPA 4UREA 3AW9A 4NQZA 1Q0LA 2SCUA 2Q4EA 3QY9A 4UEKA 6ADHA 1WDMA 4XDZA 3GGGA 1PJ4A 2UUOA 2DFDA 4IJWA 1DOHA 2PY6A 2NM0A 4II2A 4ND3A 4B7CA 3L0DA 1S7CA 4DPMA 2P4HX 4IDBA 1N1GA 2I76A 3GN2A 1GQYA 1TT5B 4NFHA 5F1OA 1L1FA 1Y1PA 5C3MA 3RD5A 3GVXA 3RJ5A 3L07A 1B8UA 3ITKA 4DTIA 1BTOA 4IY1A 1Q0HA 4W7HA 1BXGA 1NQTA 2BHLA 3LC7O 3E1KA 3JQ7B 1GV1A 3A06A 4Q3DA 4AJLA 3ZV3A 3KHUA 5TF4A 4UUOA 4KDFA 4AICA 4P4LA 3WOHA 4INAA 4MDHA 3GAZA 1QYWA 4LRSB 4U8GA 4OMUA 3OMLA 1SZJG 2E48A 2YQ5A 4YRBA 3E8XA 4IDCA 4HFMA 4KQXA 3H5RA 5TJ9A 1XWFA 1R4NB 3ETEA 5FF9A 2FY8A 4RVSA 4FJ2A 3QA9A 1VL8A 4L9RA 3GPDG 1EK5A 1VI2A 3RFXA 1KETA 2FPIA 3WMXA 4AJOA 1YBAA 4XEHA 5KOIA 4O59O 3P7MA 3BTOA 3PYLA 4IQ0A 3CMMA 3M2TA 2B83A 4EUHA 3H6KA 2W2LA 2B4RO 4E5MA 1R66A 1PJ2A 4BV9A 1D1SA 1VE9A 2IZZA 3Q3CA 5JDCA 3C7CB 1WDLA 1NTOA 4CM6A 2J5RA 2V65A 4WLEA 3VPFA 5I8ZA 4FOOA 3WXBA 5JYDA 3NDRA 2HMVA 1SB8A 3BTUA 3EYWA 4M8SA 1IZ9A 1WW8A 5JO9A 3GN1A 3GEGA 3EGOA 4PFJA 5EJ2A 2CF5A 4XA8A 2NTNA 1HE4A 4P8RA 4L4XA 4ZRNA 1VPDA 4WCFC 4IDGA 3SLKA 1KIFA 5A1TA 5JNLA 4CMEA 3C24A 1E3EA 4BMNA 3PQEA 3RVDA 3E9MA 3L6DA 1I2ZA 2HMSA 2VRCA 5C5IA 3GUCA 1NWHA 4CLXA 3JQDA 3IS3A 1UUFA 4GSLA 3GR6A 3U3XA 4DA9A 4PRLA 1ZJYA 2HDHA 4IMPA 2PD3A 4FIZA 4DBZA 4YT8A 3BMOA 2POQX 4U5QA 4R1SA 2Q99A 4ROSA 4XZ3A 2J5KA 2VT3A 3NX4A 2E37A 3PQDA 2FZEA 2P4QA 4R69A 1EFKA 3H3FA 1LSUA 2GO1A 1EE2A 3RUHA 2Q2VA 4BS9A 2QIOA 1JDJA 5KJEA 3HFGA 4I9HA 3JD1A 2YFHA 5G4KA 3K30A 1OOEA 4Z0PA 1ZZEA 4BGEA 3WSWA 4LW8A 1C1DA 4A73A 3U4IA 2GF2A 3F5QA 4GH5A 1ZW1A 4RCVA 3HG7A 1JWAB 4UAGA 3O8QB 2CFCA 5JDCC 4CM4B 3N74A 4AL4A 4MP6A 2O4UX 1NAHA 1U8XX 4RJTA 3OA0A 2OGUA 1NQOA 4G65A 5CHEA 3JQ9A 1C1XB 1QORA 1P44A 3KLPX 2XOXA 4RV9A 3RASA 1E3SA 1KERA 1E6WA 5A9TA 4E12A 4HFRA 1V3VA 3I4CA 3W6UA 3ZWOA 4CMEC 4DREA 4XGIA 4LCJA 1EUCA 2Y1EA 2YW9A 3VDRA 2PGJA 4BNKA 2O3JA 3DBRA 2FP4A 3RU9A 4D3DA 3LK7A 4RVUA 1DC6A 3GRPA 4CV2A 2Z5LA 1K2WA 1KC1A 1R15A 4F3YA 1AUPA 5JXWA 3GOHA 3RC1A 1SC6A 3EZLA 1M66A 4G81A 1KBZA 4GMGA 5K6AA 4YAKA 3H8VA 3UCXA 1R0KA 2VHWA 4YT5A 2C59A 5G0VA 4PLCA 4ALLA 1HRDA 2BD0A 2P68A 5T8KC 3VDQA 3PHHA 3P19A 3OJOA 4E31A 3E82A 3JQGA 3DOCA 4DIBA 1PZHA 2Q46A 3DFZA 1B2LA 3H9QA 2QX7A 2DBVO 3WWYA 4BV8A 5ILOA 3DBHA 4BNUA 1SPXA 4CM9A 4CUJA 4W4TA 5CDSA 1X1TA 2FMUA 5KVVA 3TFOA 1IULA 2VHXA 3ZWYA 4XDYA 1GR0A 3KYDA 4BUCA 1G0OA 3AUUA 3WR5A 1YONA 4IZHA 3MJVA 3L4BA 1U5AA 4TRMA 3EAGA 1X14A 2P9GA 3TZ6A 4URFA 2DPGA 3ZNQA 4I9NA 3BMCA 1DIRA 2DQ4A 3VPGA 4I5GA 1DIBA 1G1AA 3MJEA 3ADOA 4YR9A 1IL0A 1HDGO 4J90A 3WBBA 3GNSA 3PJDA 1Y8QA 3HN2A 3DBLA 3DMTA 5DULA 1ADBA 2GN9A 3TN7A 1UXKA 2IXAA 2HQ1A 4MVJD 4RQTA 1JU9A 5KKCA 4R68A 1PZEA 4PVCA 5B4TA 5ITVA 3AOEA 1LC3A 1OFGA 1I8TA 1HDZA 4KP7A 4FJ0A 3IUPA 4ND5A 1GQ2A 3VOSA 4I8XA 3OIGA 3ASUA 3S55A 5K6AC 1DIHA 4ONEA 1P33A 3I83A 4TMFA 1XEAA 3OJEA 1FJHA 1DLIA 1HWYA 9LDBA 3VPSA 3PLRA 3V8BA 4DYVA 4BNXA 1A71A 3PPIA 3PVZA 3TZQA 2NVUB 2NWQA 2EJVA 1V3UA 3AU8A 3D64A 3NT5A 1BHSA 4YJGA 2J3HA 1YO6A 2I99A 2YUTA 3RUDA 3BTVA 1BXZA 4J91A 2X0RA 3NRCA 4BNVA 1BVRA 3C85A 3M6IA 2ZB8A 2I3GA 3ABIA 4Q3EA 3WYEA 2Q50A 2Y66A 2HO5A 3DL2A 1B8PA 4OHUA 4DQXA 1R4MA 1DEHA 4PG5A 3SC6A 3U0BA 1A72A 4S1VA 5DCWA 5AYVA 3BAZA 4FS3A 4B7XA 3PWKA 3L4BC 3TSCA 4CR8A 4OOEA 4UUPA 1P1FA 3LT1A 2Y99A 1Y8RA 2CVOA 1ISIA 5L40A 3S2FA 3S8MA 3TOXA 1D7OA 3FPCA 8LDHA 4M49A 2NUAA 4MVJH 3I4FA 3N58A 4CM8B 1E7QA 4ALNA 1F8GA 1V9LA 2XAAA 3O38A 3I9OA 2OOSA 2RAFA 3F4LA 3WJAA 3H3JA 5AVOA 2X4GA 3FWNA 1GEGA 5IDQA 1A9ZA 1PGJA 3DZKA 4NBVA 3WGOA 3IAHA 3ZHXA 3L77A 1ADGA 3CTMA 1HDCA 4FC6A 3RWBA 2GNAA 3EK2A 4NFSA 5KJ1A 2O4CA 4U6SA 3AM5A 1PL8A 1PSDA 3ZWCA 5F21A 1PQWA 4CM3A 3KETA 2P5UA 4WLVA 5TNXA 1HE2A 4J2OA 5A02A 5BT9A 4YT2A 4PLPA 2E82A 9LDTA 1DHTA 1A9YA 4P4GA 3C7DB 5CFZA 3U09A 4JP3A 1YS4A 3ETDA 3RBVA 4I5FA 3CZMA 4EJMA 3PHIA 3K73O 2X6TA 3BMQB 4PLWA 2YZ7A 2GCGA 3V1YA 1R4NA 2EIHA 2I3AA 3P5SA 3RUAA 3I52A 1NHWA 4BKOA 5BNIA 4FFNA 1HTBA 4A0SA 3JQAD 3JSAA 4WCFB 2ZQZA 3W8FA 5DT9A 1D4FA 4RZIA 4BO9A 2Q2WA 4YRAA 1GPDG 2RIRA 1A4UA 2EW8A 2ZQYA 3A28A 4R41A 4BKRA 1G6KA 2PKRA 4CMCA 4DWVA 1TI7A 5IZ4A 3VZSA 4QSMA 2A35A 1B15A 1D1TA 1RWBA 1T2FA 3ORFA 4IXWA 1OC2A 5JAZA 3F9IA 4QQRA 1IUKA 3OSUA 4XRGA 3ZWPA 2DPHA 4IMRA 5ER9A 3K6JA 1XCBA 2X86A 3QW2A 4RPHA 4BL5A 2EEZA 1R0LA 2IDZA 3L9XA 2DUWA 3DAGA 3PRJA 1AN9A 3UOGA 4D3SA 5CAEA 1PIWA 5BNTA 5IG2A 3BYZA 1N7HA 2AHRA 5EQFA 4W9NA 4E2ZA 1LC0A 1AXGA 3QJ5A 1WZIA 4PIVA 2DFVA 5I9MA 3N7UA 4IQGA 1GY8A 5L7YA 3T4XA 3BHJA 5HTOA 1T1SA 2C07A 2VYVD 1CQIA 3S2IA 3WNQA 1E77A 1KEUA 5K0ZA 3DBVO 1QLHA 3UUWA 4EITA 1XQ1A 1X13A 2PR2A 4HXYA 2BI7A 1BVUA 4YVFA 5I9LA 4YQYA 4FB5A 1O9BA 2C29D 4Q3AA 1KY5A 5TRTA 3EDMA 2QRLA 2X9GA 1LLUA 4RF3A 1CJCA 1IB6A 3M2PA 1E3IA 3QSGA 1B3RA 1PQPA 3ZV6A 1VKOA 1NFFA 4LCEA 1A5ZA 3JTMA 3RJ9A 1O8CA 1ZKMA 4FFLA 2RH4A 4MKXA 5LC1A 2JFGA 5LDHA 1QRRA 3JD3A 1BGVA 3QV1A 4GKBA 5EESA 4DGSA 2VCYA 5TIIA 1JQBA 4MVJA 4JGBA 3VZPA 1ADFA 1QP8A 1HDYA 3O8QA 3LZ6A 1B8VA 3FR8A 3GH3A 3TZKA 4CM4A 4GGPA 2C20A 3QVOA 4DIOA 3LC1O 2CVZA 5AXCA 3FSRA 3PZRA 2VTDA 2X23A 2X5JO 2EXXA 1DJQA 1M6HA 4P22A 4LSMA 1RM3A 1KVUA 1HSOA 2QZZA 1K5HA 1V3TA 4R9SA 3K2EA 5C7IO 1E1LA 3HADA 1B3BA 1HDXA 2ZTMA 1NXQA 3RUEA 4Z9FA 3OECA 1HXHA 2R00A 4EUFA 1ISGA 4DQVA 5G4KB 3JYQA 3OETA 2DBZA 3G1UA 3JV7A 1I24A 4CMKA 4A5OA 3DDNA 5THKA 1ONOA 1KVTA 3NDIA 4AJNA 2EKLA 1QKIA 1SOWA 2EHDA 4PLTA 3X2EA 2BFMA 1QYCA 2ZB3A 4NNJA 3UF0A 1Y7TA 2AE1A 2BMAA 2AG8A 2D3TA 3RROA 1SO8A 5BSHA 1HDRA 2WTBA 1X7DA 4J4BA 3W1VA 3O26A 5DBFA 3PFFA 2JFFA 1N8KA 2YHIB 3IJRA 2PLAA 3NGLA 3RFVA 3WQQA 4NU6A 4YAGA 1PR3A 2FOIA 4L73A 4A27A 1OZAA 1LTHR 1PZGA 1ZSYA 3SX2A 4OH1A 1YL7A 4FOSA 3TRIA 3WGYA 2XF8A 1WNTA 1QXSA 3ZW8A 2CD9A 3DBRB 4NZ9A 4DBVO 3GY0A 4IINA 2PH3A 3UH1A 4ZVVA 1F12A 3FNEA 3ZU5A 5B12A 1PWXA 2ZK7A 4YXFA 1ARZA 3PGXA 2Y0CA 3LYLA 1BRMA 4BNMA 1WMAA 4YEDA 4WCDA 4CMJA 2VUSA 2YHUA 3AY3A 4Z3DA 1Q2XA 3NT4A 1GD1O 1MG0A 5HS6A 3RUIA 5B4UA 2X9NA 4NU5A 2E6UX 3S2GA 2GZ3A 2PFGA 3ZV5A 3CE6A 4GGOA 1JKIA 4BO0A 3KRTA 1B0AA 5H82A 4IQ8A 1XQ6A 4FD3A 3OQ1A 4XYBA 2NADA 3DBHB 5IZCA 4WOKA 2DUUA 2J6IA 1JAYA 4NI5A 1EUZA 3FI9A 4BO6A 1BDBA 1IPFA 4NBUA 3JQAA 3KYDB 4J3FA 3DQPA 5CPBA 1H6AA 4YAIA 2P9CA 3ONDA 4XYMA 4ALIA 3GGOA 3O9ZA 4YDRA 2OL4A 3WTCA 1ENYA 1M67A 3EZYA 3SXPA 4Z6KA 2JJYA 4XJTA 1R16A 1ZMTA 5I7VA 1PGNA 4WNCA 5H83A 1HSZA 1NHGA 4WGGA 1U3TA 2LDBA 2NV6A 2D4AA 4FW8A 3LU1A 4MOWA 3DBLB 1UDBA 5A3VA 1ZFNA 1SAYA 5JMWA 3ADPA 1YB1A 3RU7A 3QWAA 1SNYA 2H63A 4HP8A 1LNQA 1U7TA 1U4OA 1UZLA 1IHYA 3SVTA 2YDYA 2PGLA 4RZHA 4NK4A 4J7UA 2VZ0A 3HHPA 3QWHA 4J9VA 2DVMA 4HADA 2RHCA 3W8DA 4PG8A 4R1NA 4LISA 3AM4A 5TS3A 2VYVA 3GFGA 7MDHA 2RBEA 5THQA 4ALMA 4BQRA 1I2BA 1A7KA 3ZNOA 3U4CA 3OFSA 3D0OA 4RVHA 5COQA 2FR8A 2WMDA 1GYRA 1W73A 3ZWNA 5HWSA 1GYQA 2O7QA 8ADHA 1C14A 3FD8A 3NYWA 2W4QA 3IKTA 3WTBA 4GI2A 1Z45A 5IZCC 1PX0A 5IDYA 2DTDA 2D8AA 4WNIA 4WKGA 4ZRMA 4JN6B 3IP1A 3NDJA 2IEBA 1KEPA 3UXYA 2H5LA 2EJWA 4Y9DA 5DCYA 2UV8A 2PTGA 2BGLA 1Y8RB 4HV4A 3ANNA 3WFIA 5COAA 4PLYA 2CMDA 2HJSA 3GGPA 1I10A 4NPCA 2ZATA 4BNHA 2HJRA 4BNYA 3U4DA 1RKXA 4UVIA 4MKRA 3BMQA 4JP2A 1P31A 4BO8A 1Y9EA 2Q1SA 1I30A 2UAGA 2Z1NA 4BO4A 4ZJUA 1LRKA 2GSDA 1NVMB 4YJHB 3WGZA 5HM8A 3DZBA 4OSPA 1H6BA 4FJ1A 4QEDA 3VC7A 1BXKA 1C0LA 4WCFA 4H7PA 4CL3A 1YOVB 3F1LA 3UICA 1N7GA 5GY7A 4CLOB 1LBEA 4LGVA 3I6IA 1YBVA 2P9EA 4HNHA 4UVDA 5I7SA 1JN0A 2WE7A 2JCXA 1EK6A 3F4BA 2GR9A 1LXCA 1K6XA 4TSKA 5L95A 3OEWA 3JD4A 4FFRA 4YPOA 2A92A 3GUYA 3T7EA 3L6OO 3GG9A 1T25A 2H1SA 4MP8A 3GA0A 5DN9A 4DYDA 4X54A 1NYTA 4D43A 1GADO 4BO1A 3CH6A 1YGYA 3FBTA 1MLDA 3FTNA 5JPIA 3OP4A 2DC1A 4CR7A 5JC8A 2BGMA 1RM4A 4DLAA 5AQ1A 2NQTA 4E13A 5DBGA 5L7TA 1VC2A 4FGWA 4GVLA 3ENNA 1F17A 3LT2A 3GZNA 2YY7A 4N5LA 4ZQFA 1U28A 4BMSA 5EMHA 3I9JA 2OHXA 2GD1O 3NV9A 1P1RA 1QSGA 3KSUA 4LMPA 4WASA 5I7FA 1ULSA 4O6VA 4KZPA 4JIGA 3GAFA 1GFSA 3B6ZA 3UFXA 5L53A 4Z3KA 2Q4BA 4W7IA 5KJCA 3JYLA 4NBTA 1WDKA 4RQUA 3DO5A 4IUYA 3PFWO 4D41A 4CMBA 4D42A 3HDJA 5IF3A 1VRWA 4B4WA 1EVIA 1SBYA 3WGTA 3RC9A 4CM1A 2D5AA 4M86A 4UVEA 5B37A 5CEEA 5KJFA 1MA0A 2AQ8A 1FDVA 1Z75A 3H9JA 3PP8A 1VSUA 1CEQA 1ZSVA 3AFNA 4K26A 1DDOA 1OMOA 5ENDA 1ZJZA 3LLSA 3RUFA 4B3HA 1ZXBA 2HK8A 4J1QA 2YYYA 3WICA 3DFUA 2GYYA 3V2UA 4BKQA 1HKUA 4CV0A 4WJZA 3DZGA 1NM5A 3RKRA 1N9GA 1WWKA 2BFOA 2CDAA 4QFDA 4GSKA 1EDZA 3CPSA 4XGKA 3ROPA 2NVWA 5T8KA 4IBOA 4ZN6A 2HK7A 4D45A 3NT2A 4DC1A 1M2WA 3TZHA 2P2SA 3PJEA 3GVPA 3QVXA 1JKJA 3IP3A 5JY1A 1GUYA 2NQ8A 3I6QA 2NLOA 2HUNA 3EY4A 2V6BA 3GK3A 4GX2A 5AOVA 4AJ4A 3IUSA 4QTZA 4N5NA 2C7GA 3GNTA 2X1HA 1P1HA 5ES3A 3MTJA 3WWZA 5DOZA 4KUGA 3TJRA 5A3JA 5IXSA 1SMKA 3S1LA 4N18A 1PL7A 3IQDB 2C5AA 1H5QA 3PK0A 3WGGA 4JBGA 3NTQA 4Y8VA 2CUKA 1ZK3A 3KO8A 3VTFA 1ZO8A 3GF4A 4RDHA 5HA5A 3HJAA 2Q1WA 5GZ1A 2YHIA 4BVAA 2HK9A 3ZW9A 5L4LA 2CDCA 4XR9A 1MG5A 4OJNA 1FF9A 3T7CA 4BNIA 2HSDA 1SOVA 1HZZA 1ZK2A 1NVTA 1HLPA 2VRBA 3ASVA 1C0KA 3F6YA 3K96A 3TFQA 5CEJA 3AUSA 1GCUA 1MB4A 4GMFA 4LVCA 2Q45A 4ZA2A 1Q0QA 2FR1A 1R12A 4TKLA 5DZSA 1B16A 3MWDB 1U3VA 4PRKA 2O2YA 3G0OA 2VHZA 3WYCA 1VJ1A 4B3JA 2LDXA 2ZCUA 1FXSA 2W98A 2BELA 4XJSA 2BH9A 1UXIA 3DXFA 1H6CA 1NPYA 1KVSA 4OXNA 5C7OO 1CIVA 1BG6A 4CMHA 1UAYA 3IOYA 3ZH2A 1YXMA 4PLVA 1P0FA 1B26A 4OM8A 5A4DA 1T2EA 1V8BA 3ZWXA 3PHGA 1XR3A 4E2WA 2GGSA 2RH8A 3SC4A 2JD2A 2WYWA 3OEYA 1DJNA 1F0YA 2DU8A 3JYNA 2I6TA 4ZQBA 4FBGA 1LUAA 1BSVA 3QQPA 5KKAA 1YB4A 4CM7A 1GZ3A 2I66A 4KOAA 1KVRA 3RIHA 3AY6A 2I5PO 1GV0A 5CG1A 1XSEA 4M87A 1PWZA 2D1YA 3VAZA 1I2CA 1YBMA 4YA6A 3VVCA 2Y1OA 5CDTA 2PZKA 4AJEA 1BMDA 1LSSA 4E5NA 4O5OA 5DP1A 3TL2A 1V0JA 2GRAA 4XYGA 3DAFA 4AG3A 1DC3A 3DZFA 4XB2A 4MVJG 4BO5A 3QVTA 3B70A 5U4QA 4RF4A 2AW5A 3PIIA 4W99A 4D0SA 4GLOA 1LSJA 4MIOA 3RUCA 3DC2A 3DZIA 2VT2A 4F46A 5L51A 1IHXA 4GBJA 1LLQA 3FBGA 3BHMA 4PG6A 3JYOA 1XLTA 1WP4A 4IS3A 3JQAB 4XIYA 3HDHA 1X0VA 5TLSA 1W8DA 2CDBA 1ZUD1 2GN6A 1RJWA 1WPQA 5T57A 5JCJD 1EBUA 2FZWA 3EC7A 2X58A 3TPCA 4D0RA 4UEOA 4A03A 2GLXA 2PZMA 3WG9A 4HUJA 4YTEA 1JLLA 5B1YA 3OF2A 4BNZA 3RKUA 4IDFA 3WNVA 3B1FA 1HETA 1I33A 1YDEA 4TVBA 1J5PA 1DFGA 3C8MA 1HE3A 1P1IA 1SCUA 5ICSA 4AJKA 5BNFA 2VZ9A 3GZ4A 3M1LA 2OMEA 1X1EA 2O23A 4GWGA 1NR1A 2HLPA 2AEMA 3FF4A 1IY8A 2GUGA 5JBIA 5HRUA 2CNBA 3HE3A 3V1UA 4DQUA 3FNGA 2X7HA 2ZTVA 5GMOA 4BGVA 3IL2A 3HB4X 2G17A 3NGXA 4ZICA 1PJSA 4B7UA 4MINA 5A5FA 4YJHA 4B3IA 3LVFO 3DAPA 4OGWA 2EP7A 3AU9A 3LLVA 4MVJF 1HF3A 3F5SA 4CL8A 3MJ4A 3A1NA 1YOVA 3E9NA 3VPHA 3WB9A 1F06A 2QRJA 1OI7A 2DM6A 4LMRA 4BNTA 4CLOA 5IN4A 4XQCA 3FPLA 3WLFA 4TKMA 4TZTA 1E1MA 3ITDA 4CMGA 3KLMX 4A26A 3MWEB 4PLZA 5JAQA 5IJZA 2XXBA 5KVCA 1ID1A 4DUPA 3UN1A 2B5VA 2EKQA 3E5RA 5EINA 2JHFA 3D3EA 4BO2A 1X7HA 4S3MA 3ZU4A 5G2OA 2PK3A 1MC4A 1E1KA 1LDEA 4QO7A 5I9NA 2JL1A 3VZQA 2V6MA 1ZCJA 4NR0A 3KM0A 4DVJA 3OJ0A 5DOVA 5FYDA 1Q1NA 4H15A 3GNQA 1E3JA 2VZ8A 4JK3A 3VH2A 1WAMA 2X8LA 1MUUA 3CSDA 4ESOA 1YL5A 5JCXA 4Q39A 5KVSA 1E7SA 3OH8A 3E9QA 4OQZA 1KYQA 4BQPA 1EFLA 2ZKLA 3QRWA 4JJGA 5ENVA 4D44A 1BWSA 3HUDA 3PZBA 6LDHA 4BO7A 4I9UA 1UP7A 1Y81A 4XRRA 1A7AA 3E6AA 3R0IA 1UR5A 4IGEA 5A04A 4A7PA 1D3AA 1LDYA 3ZWBA 1ISHA 1NPTO 2FPPA 3CKYA 4JNKA 4PLHA 3JQ6A 1KY4A 1P45A 2DT5A 2NTJA 2I9PA 2AG5A 2EP5A 4QO8A 2PD6A 4AFNA 2Y1GA 3DTTA 3STHA 1B7GO 2X9VA 4H3VA 2O48X 3JQEA 4WLFA 4CLHA 2VYND 1ZK4A 4AVYA 1PGPA 1DC4A 2Y68A 2YV3A 4OL9A 3WJ7A 4B4OA 1PS0A 3WS7A 2JD0A 5TT0A 3KYBA 3EVTA 3ROQA 5DP2A 3VH1A 2NU8A 3ROKA 3PQFA 5JDIA 3V5NA 4U7WA 3GZNB 4ND1A 2W2KA 1T24A 5ER6A 3VH3A 3KOUA 4JLWA 3Q2IA 4FFPA 1I3KA 2X0IA 2IYOA 3I9MA 4XR4A 3IJPA 1JVBA 3WIEA 5DF1A 1ORRA 3KYCA 4JJIA 1H93A 1HYGA 2D5CA 5COBA 2WYUA 2WM3A 4ND2A 1AHIA
chains in the Genus database with same CATH superfamily
4U2KA 1J8MF 4B45A 3D6HA 1GDHA 1ZVQA 4TSRA 4ZQHA 1OZGA 1U3GA 1ZRHA 3AUAA 1V1JA 4U2GA 4S1WA 1F2DA 2VQ6A 4KGVA 2OCLA 4OFZA 3CRRA 3KNZA 4QXMA 2B34A 5E1OA 3T5CA 1I7LA 2FOLA 4O4HB 4OQYA 4K6FA 2F8MA 1TJYA 2EAUA 4GDMA 3HN7A 1WBDA 1BWRA 3HBLA 2XADA 2YR0A 4GYYA 2GTIA 4EM6A 1KK3A 2V3CC 3BGWA 4WESB 1K8XB 3ZE2B 1MEJA 3L7YA 3C7AA 3KOYA 3NM5A 4TT3A 4XWWA 1OU0A 4DIDA 1KSHA 5LWQA 1U4SA 1XKXA 4QOSA 5D87A 4A2CA 1B4DA 4JODA 4ZV4A 1O94D 3F98A 4Y1GA 2UZ0A 4BQOA 3OZVA 2ODAA 2M6LA 1GU7A 2AOTB 2NU7A 4JASB 2CBGA 2OWDA 3GELA 1DFHA 2BZ1A 3GNLA 1EBBA 2PH1A 2IE0A 2JLWA 2RK4A 4RK6A 5JSKA 1UBSB 3FMFA 1W88B 4YRKA 2NZXA 4F3KA 1KEWA 2AOVA 2HQOA 2W7TA 3EXIB 1TM7E 3IELA 2I2BA 1ESCA 3VSAA 1JG3A 1OAKA 4OHVA 1E69A 1FP2A 3OPYB 3ZWAA 1SU6A 3QMVA 1Q5PA 4KQHA 3ZDRA 4M83A 3EEOA 1PK8A 4CV1A 4ED9A 2R79A 5JSUA 2ON6A 4JUDX 3W06A 1QP0A 2ZUUA 2YZMA 5HQ3B 5CIYA 1P9WA 1EVZA 2LCFA 3O1LA 2RHTA 1LF5A 1G7SA 1M5UA 5FWXB 1U8FO 2HU5A 2YC2C 4BEVA 4BRSA 4EAQA 2BGGA 1KC3A 1AS0A 2NNWB 4HTFB 2X4IA 2UZAA 4JH0A 2EQ5A 2PLWA 3KU4A 2PA3A 1MZVA 4RSGA 6GPBA 3DLBA 2JIBA 1UK9A 2QRVA 2ZG6A 1W8IA 4JQSA 2GFHA 2ZIEA 2WRZA 3EMKA 4ZOEA 5FD8A 1UBNA 5BT8A 1BDMA 2O3SA 3SY8A 2V97A 2Y27A 2HBZA 1W4BA 1WSDA 1AURA 1X1BA 1YRQA 4OO3A 4Q3BA 1KDTA 1WPGA 3PLAE 1AQJA 1W0KA 1DE0A 1I4TD 5JRZA 3FPJA 4LWOA 3RQSA 3TQSA 3ZJ4A 5KJ6A 5IH7A 1NWCA 3K09A 1G0NA 1Y3AA 5SYNA 3FOAA 3BF7A 3TIXB 3O4HA 4UTPA 2NO1A 2VOJA 1QYVA 3QEMA 1Z36A 5KREA 1PHPA 2W4MA 4I55F 1PT7A 3LX8A 1U9IC 5JQGA 3G8YA 3O8NA 3TM5A 4HQRA 1ORWA 3FE2A 4OGKA 5LIRA 3ZE0B 5BN4A 4ZI7A 4ALKA 1E9DA 1RI5A 3VXKA 2Y0DA 1BO6A 2NYUA 2D1FA 2QK4A 1ZD8A 4YRNA 2IBTA 2XGSA 3SCZA 3CHYA 4ARSA 2QX8A 1OIXA 2GFIA 3ICOA 2W2LD 5BW4A 1RCFA 1SHTX 3NUQA 4JX8A 3B7PA 3HZZA 3FHCB 1GSOA 4ZALA 1H94A 2RGBA 1XJ5A 2H92A 2Q5LA 4DDKA 4EFNA 3SEFA 1PGQA 1H2HA 1IG0A 2QRQA 2V3VA 5HMMA 3AETA 4ZYUA 2NQ2C 3EDQA 3SGLA 4RL4A 3V4LA 5HIAA 3DEKA 4GAEA 3RRFA 5KNBH 4ARVA 3L5KA 4ID9A 4B71A 4E4TA 1NBOA 3PWSA 4F4IA 5K8TA 2O2IA 4HCJA 1Z7BA 3TZCA 2I22A 4A8TA 4HMQA 3L9WA 1E61A 3RBZA 5BNWA 5FNVF 1JU3A 1W19A 1EMDA 2GPWA 3KKKA 3ZEIA 4BOYA 2BPOA 2O0LA 3DE6X 3B6KA 2ZBDA 1BJTA 3FLEA 5CPFA 3V8PA 2XT0A 3DDWA 1J9EA 1C4OA 2R7MA 2UVDA 2V9ZA 1NVVR 2ZYUX 5AKXA 4D46A 4QPDA 3RWMB 1P7CA 2NG1A 3GHHA 1EZ1A 5EJFA 3G85A 1DXOA 1NUUA 2AMLA 2JRCA 2RG1A 3C1OA 3W6ZA 1NONA 5LB4A 3IAFA 4DMLA 4ESEA 2I54A 4LJ9A 1DIAA 4E21A 1JRLA 4XGNA 4IDDA 4LHZA 1BVYF 2O0JA 4TS9A 3NBMA 1UXGA 3FRJA 2FSHA 5CP8A 1BA3A 4JDPA 3K31A 4GGMX 1JT9A 2PZJA 1B14A 3UQYS 4EEZA 4O2AA 4D96A 1RBYA 4YGYA 1AQYA 2QBYB 4PAGA 2QUHA 3BWXA 5E4TA 2LR0A 3D8HA 3QHQA 4B44A 4CCWA 3D4NA 1IYZA 3FVWA 4N7JA 1UK6A 3G82C 1A8PA 1TJPB 5H9VA 1ZIYA 4RJIA 1M76A 1VSBA 2O3UA 3NOXA 3I34X 1GQQA 4Y9SA 1PBNA 1RWOA 1UZNA 4FR0A 1UKZA 4G84A 1Y7PA 4HRAA 3LWDA 1UBHS 1L5HA 2CT8A 2JAHA 1XIVA 3E3NA 3G0GA 1K63A 2M1ZA 2NXWA 4JXKA 1DRWA 4K0RA 3K0FB 4J49A 5TY0A 2R66A 2IHKA 4IX1A 4EHHA 1U2GC 1ACJA 1MO6A 4MQEA 2OEPA 4FYIA 1OBFO 3CXRA 4RTJA 3LQQA 3PPYA 1PSZA 1SK8A 1DIGA 3FWZA 4PX5A 1NFRA 2V7XA 2VP5A 3ZDFA 4CKEB 1RQPA 1U0RA 4F84A 3GXBA 1TU0A 4H7EA 2WJHA 4GXRA 1E2NA 2XB4A 4RO0A 3VR2D 1Z5PA 1QF9A 1H3EA 1GUZA 2P79A 2ZANA 2IBMA 1WF6A 1LVGA 3QKSA 2AA3A 1PSWA 3CPEA 3MUEA 4V39A 2HB6A 2XDYA 2G40A 1KJZA 1TLFA 2O5VA 4GKAA 4OFXA 3FCYA 5LZ9A 4JT4A 5LZ5A 4UQOA 2YWFA 3QG1A 3Q2KA 5E1DA 3M34A 4ILKA 1L7EA 1QMGA 4DJDC 1ZD9A 2PWZA 5INTA 2GN0A 1HOXA 3NM6B 4I1UA 4KFRA 2OFPA 2VKQA 1EEXB 1P1JA 2YN0A 3PIDA 4XAQA 5IC6A 1H8HA 1DUIA 3UCFA 2DRIA 3CNNA 3V8NA 3IO5A 2JFWA 4BN0A 1SD1A 1J49A 1V5IA 1JPNA 3ETCA 2LVBA 3Q5GA 1XTTA 4WK0B 2A5FA 3ZDXB 4PZ9A 4ZOLA 2BLLA 1XLWA 4TVSA 1QHHA 1SUDA 1T3ZA 3O3OB 4QXPA 5K8VA 1H66A 4S12A 3IOCA 1B6SA 1UWKA 3O73A 1PG2A 2Z5FA 3PLNA 4NMHA 1BOFA 4C9BA 1Q95A 4L16A 3X1KA 2Y1WA 2C7RA 2JIRA 2Q6VA 3SJBA 3UWDA 2IUYA 3CF2A 1X3SA 2FZKA 3GT4A 3N2GB 4YP0A 2WNIA 5AKGA 3B6EA 3RHFA 2ZUFA 1KI6A 2GD6A 3LY8A 3MOIA 3ZUPA 4F8JA 1XJ0A 1P3DA 4MA0A 4DV1B 2J59A 4CUKA 2RGNA 2VQDA 1MGOA 4UAJA 4HDSB 2J48A 3HUEA 1F5SA 3U2QA 1UINA 3AJAA 3CLTD 3DV0A 1PR5A 2JCVA 2QRKA 3H5AA 5E9JA 3VC3A 3WIUA 4EHNA 4IPTA 5KEIA 1G2PA 3I1JA 4C5CA 4OFWA 5B58T 5M3BA 2GBPA 3UPDA 1X3LA 2J9FB 1PT9A 3LKBA 5ESDA 1EVJA 1G6HA 1ZN7A 3AI2A 4GSYA 4LNAA 2VPYA 5THXA 2VJPA 2BGNA 2XMSA 2IV7A 1KWKA 4DJEC 4X1YB 3WQSB 3RT9A 3REQA 1J0EA 3OCUA 3Q40A 4GI5A 3SZMA 5LYJB 1SKQA 2FPPB 3VSEA 1H0SA 2H7XA 4LY9A 4EHDA 2CYAA 2AEEA 3E18A 4H1TA 4R8VA 5TVGA 1QKJA 3BXFA 4FHEA 2O8DA 2P9ZA 1LDMA 5CDGA 1TVKA 5EP4A 3COJA 5JAMA 1O94C 1ULUA 2BUAA 5JBQA 2ZETA 3QMWA 3Q2OA 1GN8A 1W87A 2Q0QA 2WWXA 3L7BA 3TQFA 4CDNA 3C3CA 4R5HA 4WY5A 2ZXUA 5HCNA 3H65A 4X00A 4RTPA 2W48A 1T6ZA 1OTXA 1T5BA 3UA4A 1USWA 4O4HA 3LA8A 3LC2O 3WWCA 1NBWB 4Q37A 3O1JC 3TOZA 4ER7A 5C1IA 2B4KA 3ZE6A 3VNVA 5BMVB 2XTJA 2FJ0A 5ALSA 4OHBA 3Q3IA 5ULLA 4OI1A 2GEBA 4Z49A 5IBRA 3OZWA 4MW4A 4WESA 4AJPA 3RC2A 3V9AA 1NT2A 4YCLA 4X44A 1JQJC 1TCAA 2W2KB 3U3KA 4MKFA 4GPTA 4WZBB 2MCFA 2VHUA 4Y7DA 2QP3A 5K3FA 3QM1A 4WN9B 4ZC1A 2OZVA 2R6HA 3I12A 4LFBB 4AYTA 3LNTA 2NYAA 1U9CA 1YVEI 1NA5A 2AKAB 2GZ2A 5ALLA 5HBRA 1D1PA 3BRWA 3SX0A 4OX9Y 1CRQA 1P75A 1H6DA 2X77A 2QYTA 4L5AA 4KWIA 4Y98A 2RK3A 2R5WA 3QNMA 3E9CA 3P2YA 4UNNA 2C1XA 3MJFA 3P97A 3QMMA 3IVXA 4MV4A 4YJFA 4AUMA 4E3ZA 4YMTA 4YI3A 1MX1A 4MPDA 4DCCA 4K40A 1JBKA 1DDIA 1FX0B 1E2GA 2OXEA 3LYHA 3OPYA 4GKVA 4H6XA 4PRZA 4PS0A 5E1MA 5J40A 3RJMA 2HHJA 5AUQA 3STXA 4K28A 3M0EA 4AG6A 2I4OA 2NU9A 4R5MA 1QH0A 1QLJA 5HQ3A 1U9JA 1TVMA 2ZYTX 2Z1DA 5FWXA 2LCQA 3RVNA 1P3Y1 1RTTA 1BFDA 1THTA 3D0KA 4HTFA 5ECGC 1APBA 4LVOA 1DFIA 3WFZA 1RC8A 1LX6A 1MXFA 2Y93A 3EXG2 3P4UA 5K01A 1IOVA 4TRNA 4POAA 2JLXA 2XJ4A 4LKOA 6Q21A 5KIAA 3ESCA 1RP1A 3N8KA 3BDAA 2G83A 1DWUA 2HJVA 1M83A 2XUZA 4BNWA 5EJEA 3KOOA 4HEJA 3QE4A 3F4KA 4O8CA 4CHGA 4J0EA 4ETMA 2O1XA 3V8EA 3TF5A 3VNBA 1Q6ZA 3HKCB 4V2UA 4CKWA 3D5TA 5LN1A 4S24A 1YRWA 1NLUA 3KSDO 2QN6A 2ZJ8A 2NTEA 3VV3A 3ZZNA 3BULA 3NH6A 4I14A 4JDUA 1O6FA 2XITA 4UAUA 3HDQA 1BW9A 5EZYB 1ILEA 2N0SA 1BXRA 3F0TA 1T2AA 3PNLA 4ZVNA 4Q12A 3D8SA 3VHRA 3VR5H 2B4TO 3W7AA 3QU9A 3LSYA 1NC3A 4AX4A 1G8JA 1QRUA 1VMAA 2ZJ0A 3D2LA 3MTGA 2D1TA 2IPMA 1Y6JA 3PQ6A 2P0EA 3UBTA 1Y6FA 2VNAA 1T0HB 1HOTA 1OTYA 2NOAA 2RAVA 3OM9A 3ZE1B 1I7PA 3U44A 2VG8A 2B36A 4M9QA 4PS1A 2VWHA 5C8YB 4F71A 1P8JA 2BFCB 3HS3A 3OFNA 3VR2A 2JHCA 4UM9D 4A5SA 4CT4B 3AF5A 3W2HA 3B3GA 1USUA 4I9GA 5BOVA 1V7QA 4I5DA 1KF0A 1Z73A 1Q19A 1PW7A 2DUNA 4G63A 4XQGA 4J6FA 5AK4A 1PU2A 3EQZA 4G0YA 4ZO7A 3OQNA 1EEHA 4URUR 2PGAA 4EGQA 3QYFA 2EATA 3WKBA 5A5DA 1GQOA 2CNWD 1NPDA 2VR1A 3U17A 1QG2A 2VDPB 4XYLA 4RQAA 3DONA 2H16A 5TGTA 5DM1A 4BFLA 5CA1F 4KVFA 1UMDB 3QU7A 3A0RB 5ALEA 1M2GA 1DAMA 3PDJA 4C7BA 5F2KA 2AXEA 1QQBA 1XF9A 4RXMA 2J6BA 5LUAA 1QP4A 4KR6A 4YP1A 2I71A 2GD2A 5JAIA 2IX9A 4JI7B 1FQWA 1YQWA 4Y6RA 5D3MA 2X0EA 1L8XA 1FVXA 1T2NA 1X7ZB 1XZKA 2Y92A 5AWFC 1F6WA 3OO0A 1M33A 4CLDA 1J0XO 3AVOA 4IIJB 2WWVD 3AF4A 2GCEA 1WTCA 3A10A 3GVCA 1EDBA 3RF7A 3TLCA 4DR3B 2V5VA 5DVZA 2MR6A 2F9LA 4C5AA 3CZAA 3RREA 1L5NA 3FPSA 2DHEA 4JLNA 3VYVA 1IUOA 4DLZA 4F11A 3AXTA 2Y67A 1MCZA 4FMCB 1WB5A 4NOLA 1E2UA 3DE7X 4NOKA 4D81A 2FW0A 1R6DA 3AO0B 2QR3A 2Y9MB 1TPZA 2CLLB 1UPFA 2MHCA 5J59A 3TDNA 3WYFA 3NHSA 4FSHA 5DM4A 1PR0A 5ALQA 3SNHA 3DEFA 4JB3A 3DW1X 1I2AA 2O3QA 4JUCA 4PZ0A 5AP9A 3ZCXA 4QDZA 2QBYA 2PXHA 1M54A 3BIJA 2QGNA 2C97A 2MYNA 2ONCA 4BB6A 3AHFA 3SBEA 5EJ4A 3IE1A 3NW9A 2CV0A 2Q62A 2V6FA 2AR7A 5C51B 3EC1A 2PSHA 5BW6B 4YCAA 4RANA 2VDJA 3VPBA 3R3YA 1LRLA 3M6WA 1XKTA 2PSDA 1MTZA 4J7XA 1PP4A 1BCRB 2HA7A 3FWYA 3L8FA 521PA 5LXTF 1AGNA 3BXPA 4JJKA 3K0FA 4BLUA 3QVMA 2C5FA 2HAEA 1E79D 2O2SA 1GJRA 3LDFA 3O47A 1W4LA 1TECE 3WKDA 3EZ2A 4C4RA 1PS9A 4BECA 4F97A 3C43A 3R4CA 5DNEA 3SSAA 3EVCA 4HNRA 2OZKA 1U8TA 2X2FA 5JAPA 5CDUA 2WK1A 3OPNA 2YXNA 1T9GS 4UHCA 3R7WA 1ZMRA 4AJ9A 4BU1A 4NMMA 1O58A 1W34A 1J2YA 2GS9A 3IE0A 1LV7A 3ESXA 1SZDA 4E51A 1IU9A 1MO4A 4YALA 5FL7A 4IG4A 4LDPA 2NYVA 4INZA 4JZYA 2ID8A 4MPJA 2JHGA 2A1IA 1E4EB 1WJGA 3D5EA 2ZRCA 3KUXA 5T4HA 2PYIA 5K6RA 1LWNA 2C94A 1ODFA 2JNWA 3N0XA 3T5GA 4BMVA 1IZZA 4LQDA 1P7WA 4RXTA 2OD9A 4MGKR 4EB6B 5IMSA 2ATXA 2CXTA 5H3LA 3ZS8A 1YI8A 2XNKA 5ICCA 5FT9A 1CDZA 1DTWB 4HVCA 4PZEA 4EYSA 2WF9A 3IVCA 3KYJB 4HAOA 4CF4A 4YAEA 3MGAA 4MYDA 2X1VA 1YTLA 2XZPA 2J7PA 2O7RA 1VYTA 4XCXA 3N1UA 3AMVA 5DHTA 3X2FA 9MHTA 2H1RA 3RW9A 4ZHSA 2BKXA 1J33A 4TTSA 2EP8A 1JLMA 4MIYA 1NW6A 3CLTC 1FUIA 4H3HB 4L7VA 4L02A 5FWNA 4IJ6A 1JX6A 4X3PA 3MHTA 1X9HA 1G8GA 2G1UA 4GF5A 7AT1A 4BAZA 1JLKA 1K7SN 1ZJ4A 1P9OA 3DCJA 3RS5A 1WDTA 2PKWA 3SXJA 1RHRA 3TXYA 1DAFA 3ELWA 3PX2A 2DYKA 1UL1X 1UDWA 1TXGA 4BLQA 4PXAA 4TXHA 4DV3B 2CNLA 2Y0BA 4AZ0A 1M8KA 4AN0A 1XCJA 1KTIA 3A36A 1PUXA 4IJUA 1IUPA 1FUUA 1TT5A 3WKAA 2IF0A 4BVGA 4ENUA 1KEKA 2P2LA 5F3RA 4KREA 2E4YA 2J3LA 3T5PA 2WQ7A 3WLNA 1XYVA 4A6EA 4CT0A 1XN4A 4G25A 4D3FA 1E64A 1C30B 4FN5A 3L93A 2EERA 5ICMA 1IAQA 1OGJA 2W42A 4HMOA 4KTVE 4WEQA 4KKXB 4QGAA 1RJGA 4JA2A 1ZR2A 3U81A 3UW3A 4KNVA 1UAGA 5DV9A 2ZWIA 2O8VA 2A9OA 2J9FA 4UBLA 3V4VB 4YR7A 3PGLA 3D4OA 1OE0A 2BF7A 4HZGA 3TOVA 3TR5A 2IY8A 4P38A 4C0KA 1SU8A 2VQ3A 4GEKA 1ZGHA 3ZLUA 2RIPA 4Q7JB 5EJAA 5JJBA 2PL3A 4HNGA 2W0SA 4F38A 2PH7A 2C0CA 5LYJA 1NVXQ 1KQNA 1T43A 2F00A 1VL0A 3IBTA 2PKQP 1GKUB 3NAQA 1QMPA 4E5KA 1VIVA 2UVQA 4DM7A 4RJJA 3CRNA 2BUCA 2I80A 4E4YA 3DAYA 2EJUA 3Q7PA 4QQKA 6ABPA 1J0AA 1Q0SA 3TLGB 5CYGA 1CQWA 3GMDA 2JCYA 3PQCA 1MIOB 4KB5A 1OXBB 4PNEA 2BBOA 4ETIA 4TRRA 3E2IA 3BVPA 2WB4A 1CQPA 1T26A 4WXYB 1W4ZA 5T6BA 4FHCA 1JHQA 1ULBA 4HS9A 3AP1A 5F5LA 1IC6A 1U1EA 4NH4A 4Z5XA 5AVUA 3HDGA 3RH0A 2VPXA 1WTAA 4PNZA 2AIRA 5A06A 5BMVA 2HWXA 3E3AA 5KWEA 4E5PA 4L5IA 1QQ7A 1X1RA 1CUZA 4BNDB 4EABA 3EPHA 4H16A 2CSUA 1JEQA 9ABPA 5E9AA 3I1IA 3VMMA 5IK2D 3SHQA 2JLUA 1WLYA 3U61B 4WZBA 4AUEA 2I6SA 3MYRA 3P45A 5LP6F 3DHNA 2J41A 2FR0A 2VSNA 2ZIZA 1T5IA 4P3OA 2IXDA 2J9XB 3NEPX 4WN9A 4ZQGA 5H5JA 4C4ZA 3IP8A 4IXTA 1DBIA 3SFTA 3G2HA 4AY5A 4FC7A 1KVQA 4G24A 2JASA 4XJXA 2BFAA 3VNQA 4NMWA 2ABWA 2PX3A 4LJAA 3UK7A 1SURA 5AH0A 1R27A 1Z0UA 1XGKA 3UJPA 3VR6H 1CRLA 2XHEA 1UPAA 1LI4A 1YIAA 5MGBA 1L4KA 3QPAA 3QVKA 1FFAA 3KC2A 1MC8A 4MPTA 1ZNQO 3OJLA 4YCJA 4MMXB 4E5UA 1XZIA 3ENWA 2XYRA 4KGDA 3D2BA 3F3MA 3KB6A 4XCQA 3FDJA 3T0FA 1I6LA 5G53C 1QQTA 4RF5A 3QPUA 2YHSA 2QMEA 3DBOB 2H4XA 1UT5A 4QARA 3A1WA 5HNKA 4TOIA 1O7JA 1B76A 4IGKA 2GILA 4CT5A 1ZIDA 3AC0A 1GWNA 1YJBA 3HBAA 2P78A 4RIEA 3ZI7A 2H08A 5B7PA 5FJIA 1FSFA 1CR1A 1WVIA 4KN6A 4KXQA 4U6QA 5HDBB 3B1JA 4R9RA 2R1UA 2F62A 1J39A 1IHPA 3QEKA 1H5UA 3IUMA 4JT8A 1MC5A 1Z2DA 4N0EA 3V1LA 4O1MA 3QEOA 4X6LA 3WMWA 4C7VA 1MOZA 1G6Q1 3ELUA 3OOYA 2GN1A 4N7RA 1TM4E 1Q7RA 3KB2A 2PBFA 1CUIA 2ZJAA 3LBYA 1VE7A 3ANSA 5LL6P 4CL2A 3I73A 1FYDA 1N8NA 2QV7A 1JHAA 1P91A 4PLGA 5IKMA 3IDZA 3OQHA 2J3IA 3AGQA 3NVAA 4KQKA 2Z1MA 4V1CI 5ADWA 5D8DA 1YU9A 1JPJA 4KQWA 4L3WA 3T94A 5KQPA 1I3LA 4QVIA 1QTRA 1C1XA 4I6JA 3FMIA 4AX8A 1Z83A 3MRXA 1NW4A 4Z0TA 5KU1A 2FPSA 4W9NC 1UWLA 3BXOA 4YWJA 4FFOA 1MOQA 5C8YA 2YFQA 4KQFA 2BFCA 3VGPA 3CUTA 3A70A 1AF7A 1RLMA 3ZCRA 1OFUA 1H0HA 4P81A 4B9EA 2DJ5A 2QNBA 4LK3A 3L6CA 3V2HA 4Z1MD 3W2EA 2PNFA 4X60A 4X66B 4J7CA 5HVNA 2R96A 3IKLA 5FORA 3VH4A 2OBBA 2DP4E 1CJKC 2VCHA 3G79A 5DB4A 3WFJA 3COVA 1CZNA 2FFHA 1A5SB 4UQLA 4LNUA 5A0FA 2AQIA 5ALGA 1MP0A 1XA4A 3RASA 5JARA 4DL9A 3I61A 1UMDA 5I51A 1ZPDA 2WYVA 2ZSDA 1S96A 4HS4A 5EPEA 3AIMA 3ENZA 5DDIP 1XPOA 1SBHA 1FK8A 1XTVA 2MYPA 3AUTA 4KYVA 4RVGA 3SZGA 1PNQA 1JIUA 1U8AA 1U0LA 4XX1A 5JBNA 1X7ZA 1MAHA 1DEOA 2HLDA 5E3JA 3QVSA 5LMCA 2J4DA 2QMUA 5EE0A 1YDHA 3C3XA 4BKPA 3E9RA 4JL8A 3ILVA 3H97A 4QTUB 4AUKA 4KMOA 1KZ4A 1LPPA 3ZYCA 2WQ6A 1Y9ZA 3RVMA 5AJWA 3RSLA 3TDKA 2GYWA 3TOCA 2X2OA 1PJLA 4W5QA 1ZJJA 1S2LA 3AJ8A 3GJRA 3AEQB 1MJ5A 4PZDA 1EFCA 1TA4A 2WZDA 4KBGA 1LI7A 2G80A 1VIDA 2QMHA 4MHTA 3NASA 1DRUA 4TXLA 4EO9A 1Y5MA 2O50A 3KVYA 1EU1A 3MRVA 4OYRA 4P93A 4PNPA 4QDOA 1RWPA 1GT91 1TRKA 2GHIA 2H9IA 2XGGA 4HF7A 4Y2SA 1XZHA 3R3UA 3A31A 1M6NA 1DEKA 1Y5NA 3B7GA 2UDPA 3JQRA 3SZOA 4NESA 4LZZA 4ASUA 1M2KA 3ND6A 5AVJA 2E3JA 2EQBA 1NT4A 5EE5B 3PV0A 2IDJA 2BEKA 1YVUA 3LUCA 1JE1A 5DHUA 4A6DA 4DYHA 5AD1A 2H2GA 2A57A 2FG5A 2QUIA 5ADHA 3HO1A 2KLBA 2QL5A 2J67A 4BVJA 3FUUA 3BUSA 2GEKA 2OKCA 3O6VA 1EUQA 5AW7A 2VHVA 2J5QA 3NDPA 4H4EA 4UEQA 3GHYA 4TLCA 4S04A 3ICVA 2Z43A 3D6MA 3EVDA 3HKBA 3B5EA 5KU7A 1WIWA 1TMOA 2IHTA 3PEUA 4HJRA 3GYBA 4HKTA 2FA9A 4XKJA 1FLAA 4HUQB 1BCRA 3QX3A 2DX7A 2QI9F 1YB5A 4D9BA 3E5MA 2HU2A 2V7BA 4GHWA 4R16A 2CMGA 1G8FA 1SC3A 2GZ1A 3D6TB 3UO8B 5JH7A 4MB2A 4MR9B 3ZI0A 2DLDA 4DKXA 4ON9A 5JFTA 3GZTB 3UJBA 4X90A 2YBEA 2EV9A 3H7AA 3GEDA 2XH8A 1A9QA 1W6UA 3PUIA 5GV8A 1X0XA 1ZD1A 4B5LA 4PN7A 3IIMA 4YLEA 1TC1A 3PA8A 3FKSD 3PEEA 1V7ZA 4PYOA 3L4KA 1FUKA 1IZ0A 3QFRA 3A1CA 3KTFA 3CEAA 3QUBA 1CFJA 5G41A 4JLAA 4WX2B 5EFOA 3WQRA 3T5AA 4KQIA 1XU9A 2IYPA 4G09A 4UM8B 5JEEA 1G42A 4QU9A 2ORED 3VJMA 3F3SA 5FPSA 2ZI5A 1E9VA 2OO5A 4EX7A 1T9BA 1V35A 4RH0A 2O0KA 4QFMA 3WL6A 4A0HA 1OXTA 5A1JA 5CM2Z 2ALJA 1Y1RA 4DG9A 3EVNA 5IK2A 3BQMB 1LNSA 2IYWA 3EDOA 4G1UC 3A58B 4R2KA 2J0QA 2VXOA 1SEPA 3R7LA 3E0QA 3TGPA 2YICA 4MVJI 4B76A 1Z8NA 3MC1A 3R77A 3SDSA 1CYDA 3AFHA 4HWGA 2A9FA 2JFVA 3ELDA 3LKVA 3R1IA 2NAPA 5AO9A 2ESRA 4Q01A 4MR8A 1CT9A 3AFIA 3TGLA 3WMRA 3L1HA 1NOJA 2VJMB 4N3NA 4Y0NA 1QVZA 1P7PA 3PEVA 2PDAA 1DL5A 3IYLW 3VV2A 3BA1A 2NP6A 3DWIA 4EQZA 3KJZA 4YASA 1V5FA 4JOSA 5BRAA 4MJ7A 3UGKA 4YJGB 2ZP1A 4CCSA 4MRSA 4JVSB 2IIVA 3AILA 3HCPA 1ADCA 2AX3A 1JWBB 1XKQA 2ZRMA 1QLWA 1SUIA 4O5AA 4LRUA 4BVFA 3AEKB 4E2FA 3ZTWA 5EJMA 5KINB 1R8QA 1B93A 2O3RA 4MVJM 5LA6F 2GPJA 2YH2A 4K1LA 3TRKA 4MKIA 2WVAA 1O0SA 3A3NA 3RYIA 5LQKA 1KU0A 5CLLA 1FJ2A 5KC9A 3AJEA 1LDGA 3UC9A 4J0HA 1FFYA 1JXQA 3LAWA 2EW2A 3JVEA 4LWPA 1C30A 2JIDA 3PUJA 3ILYA 3PQ5A 2MR5A 4MQ4A 2YRXA 3W4IA 7REQB 1X7XA 5I7AA 5K0TA 2JK0A 2OLEA 3GLQA 2YOHA 1TZCA 1RJ9B 3NIGB 4E2YA 4FCCA 1DUSA 4WOPA 5IJ0B 1R6UA 5HUJA 2NUAB 3FWPA 2YCBA 4KEAA 2RMKA 4F9EA 1CY8A 3UPTA 5G0SA 4BX0A 3HH8A 4BQSA 1Z62A 4UREA 1JQEA 4NQZA 6ADHA 2FF5A 4DV6B 4WKNA 1Y1SA 3ZGVA 2WV9A 4FE4A 1WDMA 2JLSA 3P2JA 2UUOA 4P7GA 2DFDA 2UZ3A 4OMFG 1DX4A 2PY6A 3CVJA 3DL7A 4B43A 2NM0A 1QIEA 1T9CA 3LPMA 4ND3A 4UE3S 1DXHA 5K8CA 4B7CA 3L0DA 1S7CA 2P4HX 4IDBA 1N1GA 4R2HA 3DLAA 3U40A 1RSZA 3TLGA 4WXEA 4NFHA 5C3MA 1Y1PA 1O57A 2A3NA 3GVXA 5BV7A 1MIOA 1Q1BA 1TA0A 2D0OB 2KM1A 3WAGA 1OXUA 2YVQA 4OUKX 1EUDB 3OWXA 3E9YA 3ZY5A 4YRCA 4DHWA 1BTOA 5JATA 1AKWA 2AN3A 1Q0HA 4W7HA 2A5LA 2AF4C 4E09A 5DYIA 3E1KA 1L8OA 3KHUA 1QZ3A 2PJDA 1B1AA 3SF8A 1MX5A 4Y18A 4UUOA 3E7FA 3I64A 3H05A 5FTJA 4C2AA 2WIJA 1QYWA 1CB7A 4LRSB 4OMUA 5I9BA 1QGOA 2C2GA 2E48A 2YQ5A 4R1MA 5FNVA 1JDBC 1J8FA 1H4QA 4L7QA 5GM2A 4HFMA 5LP1A 4QPNA 5TJ9A 3IVAA 2ZUSA 3KR9A 3RC3A 5D7NA 1VXOA 3C3MA 3QA9A 1TO2E 4NV0A 4ZT7A 3GPDG 1EK5A 2OSVA 4Q3LA 3RFXA 5K3CA 3U4QA 3PFBA 2GHTA 1U63A 4KMRA 4O59O 3TIGA 3MMPA 1E0SA 3TLAA 1MAUA 1S9DA 4IQ0A 1I6KA 1QFJA 1MEOA 2Z3ZA 3Q7EA 1XALA 4D4MA 4DEVA 2B4RO 2FZCA 1SQSA 1UQTA 2HMYB 4IRXA 1R66A 3EOZA 2ENWA 4BV9A 5JDCA 2IZZA 2IZ7A 4PYRA 1AS3A 3CVOA 1XLVA 4HQ0A 2AK2A 3L01A 4W5JA 3QKTA 4CM6A 1RLUA 1G7TA 2V65A 3C74A 1T5LA 1GKIA 4IW3B 4Z54A 5C4GB 2FU5C 2HMVA 1H1DA 3REFA 5CJJA 1JSLA 2G1PA 3CVVA 3OIUA 1NZJA 2WJ4A 2L69A 1CF9A 1HE4A 3A2LA 3G2IA 3ICWA 1RCUA 3M3DA 1UJNA 2VH2A 4M0PA 5A1TA 3KJIA 4XVQA 1JH9A 2QRMA 1ND5A 2QF7A 2WJ3A 1W5SA 1ZGBA 2HK6A 1E3EA 2V7QD 4BMNA 5AUOB 3PQEA 4NYMQ 2Z58A 4EYQA 2DPYA 3RVDA 4ER3A 4WAUA 4MDYA 3IJ5A 3TNDA 1I2ZA 5C5IA 3GUCA 3A1TA 4Q9AA 4JLPA 1IB0A 1NBMD 2ES4A 4DAEA 1PBTA 4G0XA 2G6BA 2IQIA 4PRLA 4DA9A 4HDMB 1QCYA 4IMPA 4FIZA 1XVAA 1U02A 2X6QA 4ZO9A 2POQX 5EJ5A 2DWPA 2Q99A 5GJVC 4X64B 4EY4A 3CWZA 4MLCA 3UAVA 3PQDA 3E4DA 1WUKS 5DX8A 1LSUA 4RHYA 4RSMA 4KPUB 6AT1A 3OEEA 4MI6A 4BTEA 3W5DA 1R1DA 2R4QA 4BS9A 4FNOA 5BRNA 1CULC 2I2XB 3HFGA 5KJEA 2AVDA 1G3MA 1EJ2A 2G09A 3R7AA 2WHXA 3GGCA 1DP4A 4IJ5A 1OOEA 4OM7A 1E94E 1ZZEA 2V59A 3K9LA 4YDQA 1EXWA 4LW8A 5FAXA 1H4VB 2GF2A 4GH5A 1ZW1A 4RCVA 2ZYIA 3HG7A 1JWAB 1QO7A 2LIPA 2W2PA 4QUBA 1D1QA 4ZCQA 2JLZA 5JDCC 3WP1B 4AL4A 2LWIA 1R0XA 3RLFA 4W5TA 1NAHA 1N5JA 1Q2UA 5LJIA 3R8FA 2E5LB 2QTBA 1IM5A 1NQOA 1FZQA 5CHEA 1Z7WA 1MABB 2B94A 1V45E 1UCFA 3FSJX 4WRRA 4P3KA 1P44A 4ICIA 3VDNB 1FJGB 4D6XA 1ZNZA 3KLPX 2XOXA 4ML3A 3IR5A 3DLTA 5KYYA 1FSZA 5E7JA 2VAMA 2LE0A 1Z4QA 4UU0A 1S5PA 5CK4A 3I4CA 3W6UA 1C4XA 4YDSA 3UXEA 2NSLA 1W1IA 4P3PA 4YMSA 4EKGA 4LCJA 3V6LA 4CTMA 4Z51A 5KNDD 3DBRA 1WCIA 1J8DA 1YKSA 2G08A 4DMKA 4RVUA 4HX2A 1WKVA 5LQJA 2Z5LA 2EFDB 1R15A 2HF9A 4TMYA 4F3YA 3FYUA 4O25A 4MQFB 1XMJA 4GMGA 1BD4A 1KBZA 4AKEA 2F90A 1RHMA 5HILA 2O14A 5L3SB 3WDLA 1JTEA 3MS4A 2JLBA 4IZOA 1XXLA 4WMLA 5K2MA 4LECA 3OF3A 5G0VA 4EVRA 5FDFA 3B9RA 4YS6A 5JZOA 2YINC 1NGSA 1T13A 5T8KC 2ZJBA 3C5CA 4LBVA 4LXGA 1LS1A 1RRGA 3EFHA 3IT1A 4M1YA 1G5IA 4YJ2F 3E82A 4ACAA 4BRWA 3NVKI 2WG1A 2JEOA 4BMYA 4AZTA 3DFZA 3GLHA 4DWWA 2QX7A 1GNTA 1C8LA 1OLOA 2IYNA 5IS2A 4EELA 2F3TA 1XRPA 4EW3A 4B2LA 5CDSA 5JYBA 1ZBDA 4G4JA 3HBMA 3UMBA 5KVVA 1SZCA 2ZU6A 3A9SA 1XHFA 3L0OA 2YMLA 4MR9A 4OHWA 2QSJA 5FIUA 3SOZA 4RIIA 5C46F 1MV5A 3AUUA 4JB0A 3ZJ5A 2QPAA 1H4SA 3R2JA 2VJDA 3L4BA 1BGXT 1R6AA 1ZESA 3QU4A 4HH4A 1E1CB 1OX5A 2ATVA 4HEA1 5GVRA 1NLMA 3NC0C 5FX2A 4I9NA 3KZXA 4CCYB 1C4KA 3HC7A 1Q11A 2AG6A 1KRHA 1PKXA 3D6UA 2H11A 1IL0A 1HDGO 4KAFA 3WBBA 4ETWA 4TYMA 2OGWA 1VP9A 3AHIA 3RGWS 1N75A 1FU4A 5CTAA 5M04A 1HZZC 5F9HA 3KALA 1GQRA 1UXKA 2PQ2A 3QTLA 2O6HA 4RQTA 4BC1A 2QZJA 1KDRA 1NLYA 2FEKA 2EKZA 1CUYA 2LP4Y 5AKZA 1LC3A 1OFGA 1QWSA 1SKMA 1DTEA 1I8TA 2R6ZA 2ZQ5A 4UZFA 5DK6A 3KX2A 3NBQA 4ND5A 1T3LA 3FYUC 1GQ2A 4IIBA 4M9CA 4I8XA 3DXXA 4AD8A 4D9IA 2I0FA 1E2JA 3OIGA 1X8XA 3WRXA 2VSFA 1E4OA 3HJUA 1XZBA 1VPWA 2QG6A 4UFNA 1XJWA 3IEXA 1VYUA 3OJEA 4M2LA 1IZYA 9LDBA 2OCPA 3L49A 3PLRA 3VPSA 1OX4B 1NVDA 3L7DA 3PPIA 3ZTTA 3BC1A 1S4MA 5LYYA 2ZI7A 3N0VA 4TWJA 1KMMA 2EJVA 3D64A 1E4YA 3PVCA 3TLBA 4WKCA 1BHSA 1FNMA 1BNCA 2GT1A 2VC2B 1VTKA 4TXNA 4YJGA 2OPHA 4FDMA 2C77A 1XTZA 2G1JA 2LRHA 3AP2A 4IVQA 3RUDA 4DCVA 4DMUB 3KJNA 4RGYA 2RH9B 3M6IA 1W49A 2ZB8A 1UBFA 4CF5A 2F64A 4QASA 4QREA 3ZXUB 2Y66A 4D9GA 3KUDA 2XKJE 3PGVA 2PJUA 3ORSA 4DQXA 2ZWAA 1DEHA 1D4OA 3U0BA 3H3XA 3KELA 2OY0A 4OB6A 1NVVQ 5AYVA 5DU2A 3F5MA 7REQA 3PWKA 3L4BC 5GPBA 3A6GA 2GB4A 2Z4SA 4CR8A 4UUPA 2I6QA 4KRGA 3LT1A 1ZIXA 2V7QA 4F4HA 1P62B 1UKCA 1Y8RA 1ISIA 1RJ9A 2CVOA 3BILA 3TOXA 4KR7A 4JBXA 1I0IA 1GTZA 3PFKA 5B30A 3FPCA 5IJ0A 2NUAA 1IG3A 4MVJH 4X8HA 1S2MA 3N58A 4CM8B 1E7QA 4X9XA 2OCDA 5A6SB 3EBPA 3HEBA 5LVAA 4IAOA 2ZRPA 3A9RA 3I9OA 4N8EA 4RAQA 1KBQA 2ACEA 3R5TA 1BMFD 2M2IA 1VKZA 1U0BB 3CCFA 4US1R 5EXDA 3FWNA 2E0IA 3QTTA 2R1ZA 5IDQA 2DFPA 2O8NA 2B3DA 2XOKD 4DV2B 4CEIB 1AVTA 1ADGA 2HZBA 4RA9B 1CZRA 4BXOB 3O94A 3VPCA 4KWEA 5ICFA 3TX6A 2NX2A 1KO4A 3E7DA 5KJ1A 1ORIA 4GYKA 3OURA 3MSXA 3LVRE 2CL0X 2YUIA 1ZU5A 3ZWCA 1RRMA 1J9GA 2WV7A 1LPAB 5BWCA 1XDZA 1PQWA 3KETA 4EP1A 3M83A 3ZUGA 2B8EA 3HYSA 5JPCA 2E82A 4P3YA 2IYUA 1E32A 4WERA 3B48A 3EQ8A 4DBLC 1F9AA 1X2BA 4YV1A 3C7DB 4ZZ0A 2ZROA 2I6XA 2WU8A 1KNQA 4XPIB 3BXGA 2OAEA 4R9NA 1Q0UA 3OSZA 1B43A 1RLJA 2R6CA 3RBVA 2HA3A 3CZMA 4QBHA 4EJMA 4CIBA 2YRFA 3DFFA 3K73O 1E9EA 1E4VA 1L7QA 2X6TA 3EIEA 3AL3A 4PLWA 2PXCA 5CGZA 4Z9AA 4J0QA 3Q8LA 4GL2A 2IW1A 4ZTZB 2WF8A 3H2GA 3I52A 4HLNA 4EHKA 2ZPUA 4KV9A 5HW0A 1JB1A 5E38A 5LBTA 3KLOA 3OTHA 1GDDA 2H4HA 1YKGA 2RHWA 3VDMA 4X8MA 2Q2WA 2WUGA 1GPDG 4YRAA 2ZQYA 4M0FA 4QPCA 4BKRA 4B83A 2HA2A 3BL8A 4CMCA 4DWVA 5MN5A 4KQCA 2Y3IA 1P6UA 1B15A