5EN4A

Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
b'GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5en4A00
1PZGA 4LN1A 3TZ6A 4AFNA 4TMFA 5G0TA 5I9NA 4J7UA 2CZCA 1IZ0A 4RLHA 2B5WA 1YBAA 3O8QB 4UVEA 1N9GA 1EDOA 2YHIB 2FR8A 4F45A 2DM6A 1OAAA 4NHEA 4BB6A 3E8XA 3U4DA 1LLQA 3CH6A 1JVSA 1OC2A 4KTTE 1EZ4A 2VZ0A 1NTOA 3AUUA 3EAGA 3H4VA 3TWOA 4R01A 5AXDA 2X0NA 1YVEI 3AI3A 1NAIA 1JKJA 3ULKA 4GSKA 3WGHA 3DOOA 3TJRA 3V1UA 2P9CA 2WD7B 1WW8A 3RUAA 4NPCA 3NEPX 5ITWA 1ISMA 2VWGA 3F6YA 4R69A 3R6DA 1E92A 1SB8A 3B1JA 2VRCA 4XEHA 4GKVA 3JQ9C 4P38A 4QECA 2X1HA 3JQAD 3EZLA 1Z45A 1Q7GA 3DZHA 5FI5A 3WLEA 1P45A 4M86A 3L9WA 4HX5A 1SB9A 5KVCA 1LJ8A 4C7JA 3PHJA 4Q3BA 4DPLA 3DO5A 2O3QA 4OKIA 3GOHA 1ZUD1 1Y6JA 1HZJA 4R4JA 3WICA 4JROA 3VZSA 5JO0A 3F4BA 3ANMA 4J9VA 1VL6A 3QVXA 1NVGA 3A06A 1YWGO 4RZIA 4ZU3A 1PQUA 4OIMA 4YJGA 1E3EA 1LUAA 4CR7A 3PLNA 4NK4A 1LDMA 1C0PA 3IDSA 4LW8A 5DT9A 1QMGA 1CDOA 1PJ3A 4FD3A 4D3FA 1IPFA 3NT2A 4YRBA 4TVOA 3VPHA 4IMPA 1C14A 1RKXA 4GGOA 3P5SA 4BMVA 1I5RA 3BMCA 4IDGA 1BVRA 1DRUA 3WJAA 1MC5A 1DIGA 5BR7A 5LC1A 2VUTA 5JDCA 4QFDA 2YV2A 2NU6A 4WE3A 3DHYA 1PGJA 4DBVO 4OXKA 5I8WA 1P77A 2JCXA 2WWRA 4YDRA 4Q3AA 4Y8VA 5C3MA 4GAEA 3TQHA 5JDIA 3DMTC 3QY9A 4W99A 4U7WA 1K89A 4NIMA 2D5CA 2FY8A 4HUJA 1IB6A 2IXBA 4YXFA 5IFLA 4NBUA 1X13A 1X7GA 2RAFA 1ZK3A 3T4XA 4OXYA 3COSA 4DREA 1GPJA 3LQFA 2CUKA 2NVBA 4XA8A 3WGQA 2DBRA 3GNQA 1UXIA 1O0SA 1UXJA 2JL1A 4M49A 5CP8A 4FC7A 3JYNA 1A9YA 4XIYA 5G2OA 3CE6A 3WB9A 4DIFA 2P9EA 2VN8A 3ZWXA 2PH3A 4OJNA 1H9BA 2JHFA 1LRLA 2J3KA 3RCBA 2I3GA 3D0OA 3DFZA 5TLSA 2OORA 4L4SA 3GC6A 4A26A 3ZV5A 1ENZA 1NFQA 1WLYA 4DGSA 1KVUA 3Q6IA 2GYYA 4ZRNA 3OQBA 4NFSA 2VYVA 4IUYA 3JQ7B 3V1TC 4Y6RA 5ILGA 1SMKA 3JQFA 4TRNA 3Q1LA 1ISJA 2NM0A 2D8AA 2DPGA 2NQTA 4MKZA 4EJ6A 2QRKA 2D5AA 4JN6B 3VH2A 3ZV3A 1MUUA 3DBRA 2VRCD 4LCEA 1RM0A 2B35A 1IYZA 1YQGA 4CUKA 2EKLA 4PVDA 4PG4A 2O7SA 4WNCA 1ENPA 2HK7A 1S6YA 1WDKA 4J9UE 3I9OA 3QQPA 3MWDB 4WCFC 4QQRA 1E1KA 3WG9A 2YQ4A 1LQUA 2GN9A 4J0EA 1PIWA 4H7PA 2IZZA 4JP3A 2P9GA 3BMQB 3ZDFA 2UDPA 2OZPA 3ADPA 5JAQA 5DZSA 1ADGA 4QTZA 3K31A 5DOVA 1NP3A 3U3XA 1KVTA 3WYEA 1EDZA 3I1JA 3BHMA 1KEWA 1XHLA 3DL2A 1UAGA 1UDAA 3UCEA 3S2IA 1IHYA 4O0LA 1UDCA 5AVOA 1WZEA 2EV9A 3FSRA 4BVAA 2ET6A 1JA9A 5L40A 3ROQA 1LSJA 4CM7A 1VSVA 1A4UA 1LTHR 2YFHA 3AI2A 4GX5A 5JC8A 1ISHA 4CV3A 1T2DA 1ZK4A 2GN6A 3ZNOA 4IPTA 3OM9A 1SOWA 2HAEA 2NV6A 4I9HA 2V7PA 1H6DA 4W7IA 2WDZA 1MA0A 3PJFA 1KEVA 3BTVA 5F1OA 3GDFA 1NBOA 4H16A 3ZU4A 4AJOA 4BO5A 4WOKA 5FF9A 1YRLA 3TL3A 1PTJA 4WECA 3VPFA 1CEQA 1KC3A 4M89A 2G76A 2I9PA 2JAPA 4J3FA 4J7CA 1EE9A 4NFYA 4ZJUA 4MKXA 2OP1A 3KSDO 1DPGA 4J6FA 1BG6A 4HP8A 1FK8A 2WYWA 3JQBC 3ZCXA 1E5QA 3WBFA 1C1DB 3CMMA 2GNAA 5JY6A 4ZQFA 2FRDA 2VOJA 5KJ1A 1B7GO 3OEYA 4PG8A 4PGFA 2RIRA 4BNHA 5JCJA 2GGSA 1JU9A 3DBLA 3QVOA 5KJFA 1QYVA 1Y5MA 3KBOA 1HT0A 3DAPA 2VTEA 4S1VA 8LDHA 3GUYA 5COQA 3GNTA 3HZZA 4AJNA 2Z1MA 1ZVMA 5L95A 1QYXA 1YKFA 3QRWA 1GAEO 1YJ8A 1YONA 2VYVD 3P7MA 3INGA 3RIHA 3OICA 3PFFA 3I23A 1GEGA 4D45A 3NT4A 1LLUA 2X0JA 1X7HA 4IJUA 2PZJA 2VZ9A 2Y1CA 4NU5A 1MG0A 3PGXA 1VM6A 2VT2A 1BVUA 3GAZA 2AQ8A 2B83A 2E49A 4FS3A 1HSOA 1Z7BA 3P2OA 4R3NA 3AFNA 4XJSA 4XYMA 1VKNA 3MJVA 3RJ9A 3M1LA 3V8BA 3FTPA 1LRKA 4BNMA 3IOYA 5B1YA 5F5NA 1K6XA 2PZKA 3A1NA 4FFRA 3DZIA 3MJTA 3ZHBA 3IL2A 4O63O 4IDAA 4CM4B 1H0KA 4AVYA 1NXQA 1I32A 4J2OA 4R1TA 4XCVA 3RAJA 4HADA 1PS0A 5A02A 3SJUA 4Z6KA 1YL5A 4XX0A 3RBXA 3DONA 1PR9A 2JFFA 4YJHB 4DQVA 2HU2A 5IXYA 2Q1WA 4D43A 2XF8A 1O6ZA 5JCXA 5B4UA 3A9WA 4XDZA 5A3JA 1ENYA 3IKTA 4RCVA 1IE3A 3IP1A 1U2GA 1IZ9A 1TVEA 2Y66A 3FWZA 2WE7A 3G3EA 3PYLA 4W9NC 3RU9A 1G0OA 2POQX 1U1IA 2ZCUA 1HDOA 1ZSNA 3RC9A 2CDAA 2YHUA 5KNLA 4LVUA 5MGBA 3ROMA 1NR1A 4BKPA 3UCXA 1VKOA 4WJZA 2ILTA 2ZB8A 1U8FO 3DZKA 4L8VA 5AXCA 2CD9A 3K5PA 2NNLD 3UOGA 2PGLA 3C7DB 1P9LA 2A94A 3DWFA 3L77A 3QSGA 2JAHA 4ND2A 4DL9A 4WCDA 5L51A 4RPHA 4UVDA 4ALJA 3W8DA 3JQAB 4U0JA 5BNFA 2O4UX 4DWVA 4RQUA 1E0DA 3D4OA 3VKUA 4J4HA 3U4CA 5IDYA 4F6LA 4QO7A 2YFQA 3D4NA 5JAMA 4ROSA 1NX6A 3IJPA 5AXAA 3KVOA 3D4PA 3ZZNA 3BMNB 1WXDA 4I1IA 2AHRA 4OAQA 5IXSA 2CVOA 3C1TA 1JAXA 3EVNA 5JCJD 5JMPA 3DAGA 2UUOA 1GZ6A 1SZJG 4OQZA 3EZYA 4CODB 4XJTA 1U4OA 1CERA 1W0CA 2PGJA 3VDRA 1RM5A 2QHXA 3KYCB 1N1EA 1R37A 2OP0A 2PZMA 4R5HA 1SPXA 3V2UA 2Y68A 4CUZA 1ISGA 2YUTA 4Y98A 1OMOA 5DBFA 1CETA 2AE2A 2V6BA 3B20A 3KHUA 2OFPA 1P1FA 5GZ6A 3WBBA 5HTOA 3TRIA 3ZHZA 4CPDA 2ZKLA 1XG5A 3K92A 4BB5A 2DFDA 5B37A 4Z0HO 2ZATA 3WQSB 1HDCA 2X0RA 4B8ZA 2X5JO 4CLDA 4FOSA 3UW3A 4BNNA 1RM4A 1RYDA 1MLDA 3DDNA 3ZGYA 4ZRMA 5EPOA 1HE4A 4RF5A 3ZN2A 1YOVB 2JD2A 3MOIA 4BNWA 2DVMA 5L45A 1VJTA 1Z73A 3U49A 3NTOA 4IZIA 3HDJA 1AHIA 4J2HA 1LDEA 4BNLA 4R1UA 4R5MA 1VC2A 1N9GB 3W6UA 1O5IA 3AOEA 2JJYA 1GU7A 4KP7A 3PRJA 2NWQA 3WGOA 4BO6A 3W6ZA 3GVCA 4E21A 2CF6A 1YB1A 3E6AA 2D1YA 3R0IA 4MVJI 2Y0EA 4E3ZA 5CFZA 1O9BA 3E5RA 3ZWBA 1JTVA 4RDHA 3PHHA 1ZBQA 3A14A 4OOFA 3DBVO 4II2A 4UEJA 2Y93A 1ZXLA 1DC3A 1HLPA 1I2ZA 3ICCA 2FZWA 3I5MA 1EMDA 3ENNA 1MFPA 3ZI0A 1DJQA 1Y8QA 4INAA 2C7VA 5G0SA 3H8VA 1ZEJA 3OQ1A 1E6EA 1QV6A 4P4GA 4PIVA 3EMKA 2PZLA 1N2SA 3JQDA 4JQCA 5HWSA 4RLSA 5FFFA 1E7SA 5I7FA 4PLWA 4LCJA 1A4IA 2DKNA 3WGZA 2O23A 4I5EA 1EVYA 3VH4A 3Q0EA 1TT5A 3JQ8A 1B0AA 5JSFA 1X7DA 3PPIA 3AOEC 3KYDA 4FCCA 3ST7A 3MEQA 4GVLA 1NPDA 2JD1A 2I6TA 1HWYA 3GVIA 2P68A 1F0YA 4ND1A 2H63A 2EW2A 4XRRA 4KMSA 5L4LA 4YJGB 1LEHA 1D7OA 2O3UA 2EJVA 3N58A 3WOHA 3NJ8A 1B3RA 2GLXA 3F5QA 5ES3A 5IN5A 1J6UA 4Z3KA 1GCOA 1XYGA 4G5HA 1PJCA 1U5AA 4R9SA 3NJ4A 4CM3A 4D7AA 1W6UA 3ZWYA 3RSHA 4A73A 3BXXA 4MP8A 4CMBA 4YAJA 3V1YA 3ITKA 3BMCB 3WJ7A 1DC4A 3RUDA 1KYQA 1PJLA 2AQIA 4IINA 3K9QO 4DA9A 2IDZA 3AY3A 5G0WA 4GX0A 4KTVE 3HDQA 3I9KA 3W1VA 4YA6A 2QZ9A 3JYLA 1U3TA 3BTOA 3ZV6A 4WK6A 4DYDA 4H3VA 3PQEA 2Q2WA 5G0UA 4TZTA 4RJTA 5U9CA 1U3UA 2BF7A 4C7KA 2Z5LA 1F8GA 1Z74A 2GN8A 1PQWA 3R3JA 5CDSA 1ZMOA 2VWHA 4I08A 4EUEA 2Y99A 3RFVA 1DAOA 3I52A 3A28A 1MP0A 3H65A 4I9UA 1DC5A 3RUEA 3AUAA 3PHLA 3H9GA 3AM4A 4CMEA 2IRWA 5KVSA 1B8PA 1DJNA 3FNGA 5TIIA 4CM1A 1FDWA 3HE3A 2IXAA 4B4WA 1Y9EA 2Z1NA 3Q9NA 1ISIA 3WGTA 2CY0A 2X5OA 5AXBA 5IDQA 2C7GA 4DLAA 4R1SA 4WASA 4BV9A 2BI7A 1R16A 3FBGA 3ZU3A 2HMTA 3SXPA 3V2GA 4G2NA 2ZTUA 4NU6A 2TMDA 1AXEA 3PWKA 2C5EA 2OHXA 2C07A 4LGVA 1XELA 2EW8A 3P2YA 1G6KA 2HKIA 4EW6A 4GLLA 4B79A 3VTZA 2P91A 2GO1A 2WE8A 4WKGA 1QR6A 1SBYA 3DBRB 4Z9XA 1F8FA 3DTTA 4BO4A 1T2EA 4DTIA 3VZQA 1NQAO 1JDJA 1EVJA 1A7AA 3QIVA 1XCBA 4FW8A 1UXKA 2CF5A 3DTYA 1Q7CA 2E37A 2GF2A 1ZSYA 2DU8A 5K6AC 1DFHA 1HE5A 5KKAA 4P22A 3AU9A 1PGNA 3HWRA 4LMPA 1QG6A 1DFGA 1V35A 5A03A 3DAFA 4JIGA 2LDBA 3RC2A 2AE1A 1SO8A 4R51A 4J0FA 4L74A 1Q1NA 4XYBA 4IXWA 5LDGA 3JQGB 3Q2IA 2JKVA 1HDXA 2VWPA 4FB5A 1YS4A 3ETGA 2O50A 3UAGA 2D3TA 3H9UA 2E4AA 5ILOA 4Z9YA 2A9FA 5G0VA 3VHRA 4DC1A 4IQ8A 4RPKA 1BXGA 4QEDA 4ZA2A 3RC7A 2V65A 4IM7A 1N1GA 4OSPA 5EINA 4BNJA 4EUHA 2C5AA 2UV8A 4AG3A 1RM3A 3VPGA 5TRTA 1MX3A 5TJ9A 1T24A 4CM6A 3I6QA 5JAIA 1ONOA 4FSHA 5A9TA 3SC6A 1P0FA 3JCZA 4AJPA 2J5RA 2QYTA 5L3ZA 2CNBA 3AW9A 3NDIA 4E5MA 3MTJA 2VYNA 1PJQA 1TLTA 4CV1A 1U28A 3R3SA 1U4SA 2G0TA 3NV9A 4HNGA 2X9VA 4BO1A 4BO7A 1V8BA 3KOUA 3LVFO 2HJSA 3CKYA 3JQ9A 2X8LA 4A5OA 3H2SA 3ONFA 1ML3A 4IJVA 4YACA 4IZHA 3FNEA 1T1SA 3LF2A 6ADHA 1VJ0A 3Q11A 1KVRA 1E6WA 4A03A 1U7HA 3DBLB 3OJLA 2P5UA 1KEUA 4TQGA 3GEDA 4II3A 4IDBA 5JFOA 4CM9A 3BTUA 4RVHA 4UVGA 1UP6A 3AFMA 1HEUA 5CHEA 1EEHA 1PL6A 1D4FA 1GR0A 2E48A 5TSDA 1NNUA 4EGFA 1LX6A 3GPDG 4A2CA 1HDYA 3W4KA 5GMOA 4HFJA 1C0LA 2B37A 4IJWA 3F9IA 4HFRA 1R4MA 3E18A 3BIOA 3DXFA 4F6CA 1Q0LA 1YB4A 4RGBA 4GL4A 1I2BA 3GGPA 4B7UA 1ZIDA 4YAEA 5T8KC 4E2XA 5JLAA 7ADHA 1E6UA 3OIDA 4PG7A 3DMTA 2IZ1A 4D44A 1UZMA 4G65A 4ITUA 4NR0A 4YT4A 2X0IA 4IDCA 2NU9A 3K6JA 4I8XA 1ADCA 2J8ZA 3RUFA 3WX0A 4BKUA 4ALLA 2OMEA 1X0VA 3DZJA 4GI2A 1DBVO 1HDZA 3VPSA 1QLJA 2W2KB 5A4DA 4FN4A 1E7YA 3QW2A 5GY7A 3G49A 2B4RO 3C85A 4DBZA 3WLFA 3KSZO 5GZ3A 3H5RA 1N5DA 3I3OA 4GX2A 5KIAA 3K96A 2VHXA 2VHWA 1ZXBA 1ADFA 1NFFA 4PZCA 4QFCA 1Q2XA 2FP4A 3QWFA 4WPGA 2HO5A 4PG5A 3WNVA 2CVQA 4CMGA 5A5EA 4E12A 3C1OA 1I3NA 4BS9A 3OSUA 5I7EA 5JS6A 4ZQEA 1E7RA 2HMUA 4W6ZA 1NAHA 2Y1GA 1Y1PA 5KJEA 3GVXA 4OSOA 1WDMA 4FQ8A 2VYND 3GLQA 4CQMA 3O03A 3AWDA 1CRWG 4BNFA 2ZK7A 1W73A 4TSKA 2FPIA 4UUPA 2AEJA 4FIZA 2NACA 2AQKA 1XGKA 3PJDA 4CMKA 4CQLA 4BQRA 1DSSG 2ZYDA 3MOGA 4B7CA 5IN4A 2PD4A 4LK3A 1ONPA 4RORA 3QV1A 2HUNA 1JQBA 3GAFA 2NADA 2AMFA 2HK8A 2HJRA 2EJWA 1ARZA 1KVQA 3H7AA 4WCFA 4XRGA 3MZ0A 4XQ9A 4Z9FA 3PGJA 1SNYA 1A27A 4BNZA 3LT2A 3GDOA 2GERA 2Y0CA 1C1XA 4ILKA 3UKOA 1ZSVA 4CM9D 1YXMA 3KB6A 2JCYA 5DNAA 1XWFA 2I65A 4DMMA 4G81A 3S55A 3W8FA 1NASA 4YT5A 1H2BA 2DBVO 3PQFA 1AUPA 3ZWNA 2JFGA 4L76A 4ND4A 2UYYA 3NYWA 1VL0A 4MVJF 3EY4A 1RYEA 5THQA 1PEDA 3T4EA 4BO9A 2X9NA 2ZJ0A 1P0CA 3L4BC 3BYZA 1JW9B 2IODA 2VZ8A 4BNIA 3DFUA 4NNJA 5ER6A 1BXKA 4M54A 3JQ6A 4WLFA 3CINA 3ZNNA 5FEUA 4DQUA 3KYBA 5EESA 3VC7A 1U5CA 5I9MA 3DC2A 4WEOA 1UZNA 2JCVA 1I33A 5FI3A 4B4OA 5AOVA 3G1UA 4MVJH 2JD0A 5A3VA 5A1TA 1QORA 3PHGA 2I76A 3JQBA 1FDSA 2QIOA 1K6IA 3RWBA 1MFZA 1Q7BA 4L73A 1ISFA 3CSDA 2RBEA 3ENKA 2Y05A 2VHZA 3NDJA 4YBZA 4EYEA 4X54A 3UUWA 3W8EA 1ZO8A 5G4KA 4QX6A 3GHYA 4ALMA 2HK9A 1OOEA 4IJKA 1K3TA 3NT5A 2ZQYA 4FGSA 2GZ3A 1QV7A 3FPLA 4J1TA 3MCVA 5I8ZA 2H5LA 4K6CA 2HRBA 1XA0A 4KWHA 4CMIA 4R3WA 4CQMD 5HM8A 1PGQA 2JHGA 2O7QA 3VH3A 1YL6A 2SCUA 3EVTA 1NHGA 4YJFA 3D64A 4J4TA 3WTBA 2GZ2A 4BL5A 4CMAA 4B3HA 1PS9A 1OBFO 3RUIA 3OH8A 1GL3A 3PWSA 4UVIA 3PWZA 4CL3A 3GGOA 4ALIA 3JQ8B 5I9LA 2QYSA 4AL4A 3BAZA 1PWZA 3HNPA 3KYDB 4IGFA 7MDHA 4J91A 1GQQA 1O89A 3R1IA 4IXTA 1AGNA 2YV3A 1J49A 3DZFA 3E82A 3Q2KA 1NVTA 2BGMA 1N7GA 4NQZA 4XQEA 3FR8A 2O3RA 3G79A 3JD1A 3QHAA 1EVIA 4DLLA 1C3VA 4WLEA 2YZ7A 2AA3A 3F3SA 5L4NA 2Q99A 3FN4A 3GRPA 1XQ6A 4IIVA 3X2EA 2W98A 2Y0DA 3LF1A 4PRKA 4W9NA 1YGYA 3T7CA 4FFNA 3TZKA 3UVEA 4YTEA 3RUCA 3TOXA 2NVUB 1DAPA 3AK4A 2CSUA 2EKQA 3H3JA 1FMCA 1QYCA 4RF3A 4EJ0A 4B4VA 4CMCA 4FFLA 3LYLA 1R66A 2AG5A 1YQDA 5I7SA 4M55A 2CMDA 2QX7A 3I9MA 4YCAA 1A9ZA 3PXXA 4KQWA 1EQ2A 2W4QA 1EVZA 1YO6A 1T26A 2ZB7A 3BZUA 4E5KA 2E6UX 3QWBA 1UP7A 3CMCO 5T57A 1ZFNA 1BW9A 1ZCJA 3CPSA 1T4BA 3VZRA 5DCWA 1ZKMA 1NQTA 1QLHA 3VZPA 4YJDA 5T6BA 1V6AA 2I5PO 1C0KA 1KERA 3UGKA 2D59A 2YQ5A 2BFAA 3QVWA 3E03A 3TN7A 3I9JA 3PFWO 5L7YA 3ROPA 3CZMA 3QP9A 4WEQA 3GFBA 3KV3O 1JKIA 1DRWA 1AN9A 2HMSA 4GQAA 3IUPA 1I36A 2UAGA 1D1TA 1QSGA 1O8CA 1KETA 3GZ4A 4DMLA 3GZNB 5IZCC 4Y9DA 1PX0A 3NDRA 3JSAA 3DZGA 4XYLA 2EG9A 2Q2VA 3JQEA 4NBTA 4NBVA 3O4RA 1DIAA 1MXFA 4WUVA 1QP8A 3RU7A 3ETDA 4TRMA 4ALKA 4A27A 1NM5A 1TA4A 3G17A 1LNQA 4DPMA 2AW5A 3ZWCA 1B15A 3GDGA 4N54A 2D2IA 4WLOA 2A4KA 2VHVA 5CEJA 3WGIA 5JY1A 3I6IA 2A35A 2X58A 1V3VA 5CG1A 4D0RA 1FDTA 1T2AA 1GZ3A 5H81A 1ULSA 3IJRA 3LT4A 2R2GA 3GUCA 1HSZA 4EJMA 2EHDA 2C2XA 3GR6A 3ZV4A 3ONDA 3VAZA 1LDYA 2FZEA 4A7PA 8ADHA 4FDAA 2AEMA 3ETEA 1T2CA 4RDIA 1BXGB 4CMJA 4R41A 1H9AA 1HYHA 4YAGA 2WMDA 4KUEA 3L6DA 3LLVA 3LDHA 5L9AA 3PVZA 4JLWA 2ZCVA 1RWBA 3CIFA 2PLAA 4PG6A 5H82A 4FJ2A 2DAPA 1KVSA 4PLHA 4FBGA 2NUAA 3RUHA 2CFCA 1QXSA 1U9JA 1WAMA 2YDXA 1AXGA 5CPBA 4KWIA 2YV1A 1P3DA 1EBFA 3C1AA 5FYDA 5KTKA 3UF0A 1PJ4A 4NJMB 5EMHA 5CDTA 5T64A 2GUGA 4RPJA 3G0OA 3H9QA 4CLEA 5BSHA 2RH8A 5F1KA 5DF1A 4FR5A 3K30A 4AJHA 3WFIA 2FR0A 1FDUA 1LBEA 1NWHA 4BO2A 2EGHA 1WP4A 2DTXA 4OL9A 3HADA 1A5ZA 3W4JA 5ADHA 4YAIA 1PGPA 2J6IA 4URFA 4CV2A 4Z0TA 3RBZA 4RV9A 1NQ5A 4PLZA 4OMUA 3O38A 4J1QA 4QT0A 4AJJA 1XQ1A 3VVCA 1YH3A 3GG2A 2P2SA 2LDXA 1WDLA 1ZK2A 1Z6ZA 4YQYA 2NTJA 1MC4A 3F46A 4MP3A 5TJHA 1R4MB 3FR7A 1E7QA 3GEMA 4IY1A 3ORFA 1I2CA 2I3AA 5TNXA 2VTDA 4GX1A 1LSOA 4OYRA 2UVDA 1Y9AA 2XOXA 4MIEA 2QW8A 3RFTA 2C20A 3OF2A 1QYDA 3GT0A 1ZW1A 4E33A 4BOYA 5THKA 2QQ5A 2AEFA 1OZAA 5COAA 4HNHA 3K73O 1H6BA 4FJ1A 1I01A 5KOIA 4M1QA 3VKVA 3H9EO 1PGOA 3O9ZA 2PKQO 4GVXA 4B3JA 4E31A 4ALNA 3SVTA 1NWCA 1PJBA 4RVGA 1EUDA 3SLGA 4D46A 5ICMA 9LDBA 4OGWA 1YB5A 1ULUA 1WZIA 1MGOA 1YBMA 2DPHA 2Q50A 1EK6A 2QG4A 3D3EA 2H1SA 3EC7A 3KXDA 4K6FA 3E9NA 4BNUA 3U5TA 1C0IA 3H2ZA 2F1KA 2QRJA 3GVPA 2WYUA 4TKMA 4WGGA 1SEVA 1TXGA 1VSUA 3H5NA 4RF2A 4L75A 3IQDB 3FBTA 1EUCA 3OA2A 2VUUA 3ZHYA 1A71A 3MJEA 2Z95A 2NU7A 4GWGA 3NAQA 1RJWA 4XWYA 3DOJA 1R15A 4YR9A 2EGGA 4JBHA 1LLDA 1M6WA 2FPPA 3LU1A 1LC3A 3AM5A 2HLPA 3QVTA 1J4AA 4XB2A 4O1MA 1R0SA 5CEFA 4NZ9A 4BKRA 5L7WA 1MG5A 3MWEB 3F1KA 2EKPA 3E9QA 1KEPA 1PJTA 3QE3A 5AQ1A 2C29D 4IS2A 3IIEA 2QZZA 4E5NA 4ND3A 4CQLB 5ICSA 2DFVA 3GMSA 4D41A 3IS3A 5DBGA 1WMAA 3Q9UA 1EQUA 1UUFA 4Q39A 2Y1OA 4BNKA 5JE8A 3PDUA 5HA5A 1Q0QA 3S2EA 1G1AA 2O4CA 3ANNA 4WCFB 2OL4A 3AY7A 1H93A 4GWKA 2BFMA 5K6AA 1C1XB 4W82A 2TMGA 1PR3A 2YYYA 3I83A 3PJEA 2ZYGA 3AU8A 2VWQA 3GFGA 3FHLA 5BNIA 5CDYA 2G82A 1E3SA 1XKQA 2OXIA 1GV0A 1DEHA 1R0KA 4NG5A 1CQJA 1ZZEA 2NVWA 2DC1A 4XKJA 2NU8A 5IF3A 5DBIA 3ABIA 1LA2A 2VHYA 3ASVA 3DBHA 3IC5A 4E0BA 5TF4A 4UUNA 4CM4A 3TDKA 2GDZA 3AUTA 3KUXA 1EFLA 1DDOA 4JX8A 5DCYA 2Y67A 2C54A 4PLGA 5EJ2A 3U09A 3ZWAA 1GTMA 2C0CA 1H6AA 3FI9A 4EEXA 5ER9A 1L7DA 1JWAB 4BKQA 5A9SA 2ZIZA 4K1LA 4IS3A 5GZ1A 1BDBA 5EERA 3E9MA 4BO8A 1NYTA 2OOSA 3D1LA 4EITA 3U62A 1FXSA 3HN7A 3ON5A 4K26A 4Y6PA 2W8ZA 3PI7A 4WLUA 4XYGA 1G0NA 3DZBA 5HS6A 2R6JA 2X22A 2O3JA 5TC4A 5A5FA 3ZU2A 5JYEA 4TRJA 5HBRA 2FR1A 3PJGA 3CXRA 4LRTB 3INTA 3GHHA 3C8MA 1M76A 4J43A 4OXNA 1WPQA 5DDIP 1Z75A 4J90A 3PQDA 3VH1A 1P1JA 1DOHA 1ZMTA 2B36A 3HB5X 4GPD1 3RFXA 5DP2A 4Q3DA 4YYZA 4UEOA 1GEEA 1N7HA 4BV8A 1IPEA 4DYVA 1BDMA 4AJLA 1M6HA 4ID9A 1ONNA 1Y5RA 2BLLA 2GSDA 2O2YA 2R00C 3I4CA 3JQAA 3RC1A 3WYBA 3VDQA 5CEEA 3KEOA 2X86A 4N5NA 4Q3CA 1HF3A 2X4GA 2FOIA 3JQCA 2HDHA 5T67A 5CAEA 3P19A 2IYOA 3HFSA 4ND5A 4CM8A 3M6IA 4CMIB 4KUGA 4IIUA 3PIDA 4NFHA 4ZVVA 3VTFA 2PWZA 5TGDA 3IAHA 1UJMA 1AE1A 3AUSA 3GG9A 1J5PA 4RL6A 3V2HA 5JYDA 1ZK1A 3A4VA 4L4XA 3NX4A 3RKUA 2CDBA 1J0XO 1L7EA 2CVZA 3GN1A 3WXBA 3DHNA 3C24A 3PK0A 4HBGA 4UREA 2XPCA 3HSKA 4UUMA 3GF4A 4JGBA 4K9DA 5T8KA 2Q49A 1XU7A 1YBVA 4RVUA 2NTNA 1F17A 4Q3NA 4FFPA 2VT3A 4YWJA 3EDMA 4J1SA 2GD1O 3OA0A 4LRSB 1XR3A 2H6EA 1PU2A 1X14A 2VNAA 3GH3A 3MJCA 1U8XX 2Q4BA 1LDGA 4RVDA 5I7VA 4XGNA 2NSDA 1Q0HA 4Y67A 2YY7A 1IY8A 3C7CB 4DXHA 1WWKA 1VRWA 4E2ZA 3AI1A 2FMUA 1KY5A 2EERA 4W4TA 3S2FA 2FHSA 2PTGA 2EP5A 2GPTA 4MIOA 1HETA 4R54A 4AJIA 1YOVA 4BNTA 1U3WA 1UXGA 4K28A 4JJFA 1R4NA 4PRLA 3L0DA 1E3WA 1B8VA 2J3JA 3DR3A 3HDHA 4RQTA 3ADOA 4DRYA 3KETA 1I10A 3CZRA 4MO2A 4MOWA 2ZTLA 1NHWA 4UAGA 3CTMA 4FFOA 4A10A 1FF9A 1E3IA 3U0BA 5JMWA 2J3HA 2PH5A 2XAAA 3L9XA 2BMAA 3QWAA 1CWUA 3F47A 5K9ZA 2DLDA 3DB2A 3HB4X 4F46A 3DQPA 4OH1A 1PZFA 1BGVA 2BGKA 1DHTA 5IDXA 3D3WA 3WR5A 3KZVA 4YAKA 3GY0A 1XSEA 1B14A 1ORRA 4NH4A 3MJSA 4AJEA 4O6VA 4BGIA 1BW9B 1PS8A 2B4QA 3BA1A 3GPIA 4P4LA 2I99A 1XLTA 1BTOA 3I4FA 2Q1UA 3H5AA 2W2LA 4MKRA 1ZK0A 5DP1A 5K0ZA 3QWIA 4D0SA 4JK3A 3UH1A 4OQYA 1DLIA 4MJLA 5FWNA 5HRUA 5ITVA 4DIOA 1GFSA 4IGEA 1DIBA 3HJAA 4FFMA 4YEDA 1OFGA 2EXXA 1P74A 5LCXA 3KO8A 1CJCA 2O2SA 4IBOA 4NBWA 4QXMA 4D79A 4OM8A 5KWEA 5F3RA 1JN0A 1T2FA 2PA3A 5A05A 3PDJA 4HXYA 5MDHA 3M2PA 3WIEA 3DMYA 3U9LA 1DRVA 4LVCA 3GMDA 4KDFA 5KVQA 4CR6A 1VE9A 4QUKA 3ZW9A 1VJ1A 5A06A 2GR9A 1I3KA 9LDTA 2O48X 1ZJZA 5CDUA 1E77A 1VPDA 4W7HA 3SBOA 5L4SA 3LC2O 1F14A 3JYPA 4MVJA 3ZWPA 3L4BA 1E1NA 3OBBA 2FPGA 3CUKA 4H15A 2PKQP 1KC1A 2ZJ1A 3LT0A 1JWBB 1RPNA 4YRAA 1EK5A 4LMRA 5COBA 2ZB4A 4XR9A 1H94A 1KOLA 3ZU5A 4N7RA 1UZLA 2V6MA 4UUOA 3WGYA 3EYWA 1V3UA 4CLHA 3OECA 1PL8A 4MVJM 4RPGA 1HYEA 3ZHXA 5B12A 1D1SA 4MDHA 4KOAA 2FSSA 4OKNA 1QKIA 3GEGA 2BI8A 4RPLA 3PZBA 2OUIA 2D4AA 3KSUA 1DHRA 3TFOA 2PD6A 1VL8A 3KTDA 2OO5A 1NR7A 4MVJG 4PLFA 1LDBA 3SX2A 1K5HA 2WTBA 4IDEA 2B4TO 4E5YA 5JAZA 2XXBA 4J4BA 3N7UA 4IDDA 1D8AA 1BMDA 5DN9A 5A04A 1H6CA 4HY3A 3ZW8A 1I24A 5TT1A 3WSWA 4YVFA 5JXWA 1HKUA 1KS9A 3FTNA 1XIVA 1E3JA 1NVMB 3PYXA 1IOLA 2P4HX 4XDYA 4DPKA 3JYQA 4YQZA 2X6TA 1BHSA 2IE0A 3F4LA 3LSYA 4HV4A 1OI7A 2VCYA 1WNTA 5JBIA 3JD0A 3ZWMA 3AM3A 1I0ZA 5JDCC 4GMGA 3T7EA 5BNTA 3BMOA 4RO0A 2W2LD 4YT8A 4NDNE 1VI2A 4PLYA 5JDIC 3FWNA 4E2WA 1QRRA 5C37A 3PZRA 4PVCA 2DBQA 1BRMA 1UXHA 4YPOA 2BD0A 2Q3EA 1M67A 2PD3A 2ZQZA 1MV8A 1FJHA 3ICPA 3IKVA 3NGXA 4XD2A 4B7XA 5HS4A 5L53A 3ZNPA 2X5KO 1Y8RA 3D7LA 3NTQA 2GASA 2OBYA 4CLOA 3H6KA 3JD2A 2PFGA 3L4SO 2HCTA 4GSLA 4ZHSA 1K2WA 3WMXA 1P1IA 2OGUA 4P4NA 4JBIA 4PLVA 2RH4A 4J1NA 2PNFA 5EQDA 2Y1FA 5EQFA 3IUSA 2BGLA 1Y8QB 3WNQA 1N92A 2Y1DA 1CYDA 3JQGA 1GADO 4MPDA 1X0XA 1SEPA 4XZ3A 3K8ZA 4EDFA 4JCOA 4EEZA 4MVJD 1GZ4A 2HMVA 1E1MA 4U0KA 4ZD6A 2B69A 1I30A 4RVSA 3W4IA 4XGIA 1HXHA 4CLRA 5JC1A 2Y1EA 2J5QA 4AJ1A 3JQFC 4RVFA 3ZH2A 1JLLA 1PZEA 1XDWA 3MTGA 1TT5B 2V6FA 3I9LA 3OJFA 4GLOA 4BMNA 2BELA 3HHPA 4O59O 3WGGA 4XQCA 1H2HA 4PLTA 1A72A 3TZCA 4I5FA 2Q2QA 1LLCA 1CIVA 3WWZA 2O3SA 1AHHA 3OFSA 3SEFA 4CM5A 3JV7A 2X7HA 4NMHA 2F00A 3B1FA 4L0QA 4N5LA 2Q46A 3UFXA 1PZHA 1Z7EA 2AXQA 2B0JA 3HG7A 5CG2A 2I67A 1Y81A 2BRUA 4B3IA 4BHTA 1ADBA 1GYPA 4FPXA 1LI4A 1GYQA 2PGDA 2HSDA 3RI3A 1LSUA 4AJ4A 2YW9A 1DFIA 4BNGA 4OO3A 3E1KA 2WYVA 4OOEA 1PQPA 4D3DA 4MVJE 1Y7TA 2VQ3A 1HDRA 2IEBA 1GQ2A 5KKCA 3H9JA 1UR5A 2ZTVA 3O8QA 4CMHA 1YDWA 2BKAA 2YHIA 3RROA 1D3AA 2PR2A 4XQGA 5IZCA 2X9GA 2DTDA 4EBFA 2OBNA 3JYOA 5U4QA 3UCFA 4YB8A 4PN3A 5AYVA 3TNLA 3TZHA 1SAYA 4GH5A 4PLPA 4BGEA 1W4ZA 1LSSA 2NQ8A 4N18A 1XU9A 2VUSA 4M8SA 4Y6SA 4UULA 2QRLA 3LC7O 3PIIA 4XR4A 4NI5A 4MIYA 1NPTO 1HZZA 2GN4A 3NUGA 3OHSX 1LDNA 1B16A 2C59A 4KDEA 5JPIA 5C7IO 4RZHA 3GNSA 2WD7A 4DLBA 4TVBA 4P8RA 2AG8A 4MP6A 2VNSA 1FDVA 3ANLA 4ESOA 3GK3A 3D5TA 4B4UA 3B70A 3L6OO 1IULA 2H9IA 3WWYA 3BHIA 4E2YA 1F06A 2VRBA 4JJGA 3K2BA 3DBHB 1R0LA 5KJCA 4B8WA 1GUFA 1U2DA 5KJ6A 2BFPA 4E13A 1GYRA 4TROA 5IDWA 1I8TA 3WDSA 2P4QA 3TF5A 1IUKA 3PYMA 2NTVA 2FWMX 3E48A 1IHXA 5BT9A 1GUZA 3HDYA 1B3BA 3TPCA 1E7WA 4CR8A 2EWMA 3RD5A 4CLXA 1DXYA 5A9SB 2EF1A 2CDCA 2W2KA 2PY6A 5TT0A 5ENDA 3OETA 4AJ2A 1DC6A 3STHA 1HDGO 3KRTA 3DHEA 1P1HA 1CQIA 1T4DA 3QLJA 5DCUA 4NBRA 4U6QA 1B26A 3AOGA 4PZEA 4CV0A 3LLSA 4GGPA 4DIBA 3PHIA 5TQVA 3FF4A 1T1RA 4BGVA 3NRCA 1NPYA 2X23A 4NJOA 3FRJA 3M1AA 3MJ4A 1KY4A 1YDEA 2GZ1A 4PZDA 2WD8A 1WMBA 2FSVA 1ZJYA 4EI2A 4BQPA 1GY8A 4ZQGA 1VLLA 3BTSA 3K2EA 3FNHA 4YRDA 4R1NA 1UAYA 1U7TA 3L07A 1NQOA 2V6GA 4UEKA 3RVDA 5J23A 3GGGA 1X1EA 3RJ5A 4JJIA 1E3LA 3F5SA 3AY6A 1P44A 5IJZA 5U1PA 1HRDA 1PWXA 1M2WA 1EBUA 2HRZA 3UXYA 5IZ4A 4WLNA 2DQ4A 3RASA 4CM8B 1JAYA 3HN2A 4WNIA 4XB1A 1LU9A 2P5YA 3SC4A 1V9LA 3INRA 4I5DA 2YJZA 1M75A 4BNXA 1KIFA 3DEYX 3JD4A 4BKOA 4HWKA 2AQHA 5F1PA 3OEWA 1HTBA 3ZWVA 1GQYA 5A9RA 5BSFA 3OIFA 1JKFA 3WS7A 3UHAA 2BFOA 3IP3A 3KLPX 3M2TA 3JQ7A 1K0UA 1N8KA 4PCVA 2PV7A 4BNYA 3BHJA 4JNKA 3NTRA 4KQXA 1U3VA 3HQ4O 2GRAA 3WYCA 2WEKA 3WIDA 5DOZA 2PKRA 4XYEA 3ROKA 1UP4A 4C4OA 4IMRA 3Q3CA 3DOCA 1F12A 4MVJP 4DQXA 1YE3A 2C82A 3PEFA 4J49A 1R4NB 5T5QA 5CDGA 5B4TA 1PJ2A 1E3WB 1B8UA 1HE2A 1PSDA 4U8GA 2Q4EA 1DLJA 3BMQA 3PP8A 3NGLA 3JTMA 2NLOA 3OJ0A 3S8MA 2DTEA 5B4VA 3TOZA 4E5PA 1EUZA 5BSEA 1XEAA 4PFJA 3D3WB 2WSBA 3GA0A 1IL0A 2IYPA 2G17A 4DVJA 2Q1TA 2J3IA 4WLVA 3SLKA 3S2GA 3SJ7A 3RQSA 3EGOA 3ONEA 4S3MA 5H83A 3TFQA 2E82A 1GV1A 2EEZA 4GBJA 1R6DA 2BHLA 5TX7A 1I3LA 4BMSA 2D0IA 2YDYA 4JXKA 3ZWWA 4IQGA 5G4LA 1NFRA 1LXCA 3EW7A 3UN1A 3ZNQA 3VVBA 4ZICA 4KUHA 2W90A 4U5QA 3S1LA 2Q45A 4ZQBA 1GDHA 3FNFA 4BO3A 4IDFA 4UVHA 4EZBA 3WMWA 3GVHA 1SOVA 1HYGA 3G1TA 3TL2A 2ZYAA 2DBZA 5ENVA 3UICA 4Z3DA 4TWRA 1P31A 2C2YA 5BQFA 1I3MA 2DT5A 3LC1O 2UUPA 1E5LA 3FD8A 1CF2O 2XXJA 4GKBA 1K6JA 1DO8A 3ZWOA 4FC6A 2GCGA 1C1DA 1E7MA 1X1TA 4E30A 3QVSA 2HMWA 4I5GA 4CQMB 2RHCA 2O3TA 2IZ0A 2VOEA 2G5CA 4JBGA 1PJSA 1UDBA 5C7LO 1E1LA 3QA9A 5JO9A 1LQTA 4CJXA 1V0JA 3IMFA 1S7CA 1MB4A 4ZN6A 3KEQA 3WFJA 4ONEA 1DIRA 4XGKA 2NVUA 4PLCA 2PK3A 3OP4A 4GMFA 4J7XA 3VPXA 1UH5A 3KM0A 1TT7A 4RF4A 4R68A 5C5IA 5C7OO 2WJPA 4BNVA 1BXZA 1L1FA 1YL7A 4NK5A 4TZKA 5F21A 4D3SA 4D42A 3WTCA 2HQ1A 2R00A 6LDHA 4CUJA 3X2FA 5JW6A 3HFGA 5BSGA 3WQRA 2G1UA 1QYWA 2IEDA 3B6ZA 2Q1SA 3C3XA 3V5NA 2B5VA 3VOSA 5EL0A 4BGUA 3HUDA 1T25A 4A0SA 4YJHA 2WM3A 3JD3A 4N5MA 3OJEA 3GN2A 3WQQA 1DIHA 4ZGWA 1DB3A 4LSMA 4BUCA 3NKLA 3AJRA 4L9RA 4CL8A 4HKTA 4U6SA 4JP2A 1BSVA 4AJKA 3ASUA 3D5QA 3GQVA 1X15A 1GD1O 1EE2A 4E6PA 1W8DA 5TS3A 5JNLA 3H3FA 4R9RA 1O95A 5KCZA 1LC0A 3EUWA 1JVBA 1V3TA 3BMOB 4DUPA 5KVVA 3U4HA 3C7AA 1Z82A 1ZNQO 5L7TA 3OQ6A 4MINA 4LSWA 4FOOA 1ID1A 2J5KA 1B2LA 3GZNA 1P33A 2DUWA 2RHRA 4AICA 4E4YA 1O94A 1EFKA 3OIGA 3PTZA 1SC6A 4BIIA 1MXHA 4OHUA 3WSVA 1R12A 3CEAA 3LK7A 3QWHA 4QO8A 1Y8RB 2A92A 4HFNA 4J16A 4LISA 4ZQHA 5G4KB 4CLOB 1GPDG 4CMEC 5LDHA 1ZH8A 3OJOA 3B1KA 3KLMX 1TI7A 3E5MA 1KBZA 3LZ6A 4F3YA 3EK2A 1YQXA 1BWSA 3TSCA 2EP7A 3L6EA 4XIJA 1PL7A 3U4IA 2BH9A 1HLDA 1OC4A 1SCUA 4Q9NA 4TKLA 1GCUA 2ZB3A 2DUUA 3BMNA 2ZTMA 4E32A 1WVGA 1A7KA 1YJQA 4L4RA 4YJFB 2JFHA 1P1RA 4WOJA 4EUFA 3FPCA 3N74A 3TZQA 4CLRB 1TEHA 1P1KA 4Q3EA 4Z0PA 3KYCA 3F1LA 3FCOA 4M87A 2RCYA 4HFMA 5F5LA 4YT2A 1HE3A 1LRJA 4DC0A 2I66A 4O5OA 1ZEMA 5CPFA 4TRRA 3RKRA 1M66A 2EIHA 2FN7A 4KZPA 3GRKA 3RBVA 1H5QA 5IG2A 4IQ0A 1HL3A 3LT1A 1GUYA 3EHEA 1ENOA 4FJ0A 5DULA 3QJ5A 4R16A 5EN4A 3OMLA 3O26A 5EIOA 3ITDA 3PLRA 4BO0A 3I9NA 4NJMA 5IAAA 4I9NA 1TB4A 4QSMA 4FGWA
chains in the Genus database with same CATH superfamily
2RKOA 3LL4A 2PNJA 1RPTA 1XB2A 3AHFA 1P5HA 1PZGA 3K1ZA 4GE0A 1OIWA 2XWPA 2WIAA 1I7NA 1U2QA 3PE6A 3LWNA 3CURA 4DSOA 1YBAA 2EKBA 4AZ0A 4FYKA 4DJJA 5F1YA 1VBNA 4F45A 3L0PA 3VR6D 4BN4A 1OAAA 3C3KA 3EDCA 3K0FA 3U4DA 1K2VN 1LLQA 4FS8A 4IIGA 4L2IA 5EWLA 1KI7A 1QAMA 1XLUA 2ID8A 4MAAA 3Q3JB 5CU7A 1OC2A 4ZRDA 3UJ9A 1Z6QA 4GMHA 4DQKA 1NIPA 1HRKA 3VR2A 3AEKB 3CIOA 2X0NA 5AXDA 1MQ9A 5BO5A 2OQVA 3KEMA 3IEPA 1IG3A 1YQWA 2NO5A 1JKJA 5FL7D 5A5DA 1YKGA 1EGAA 2FW6A 1CUDA 2QTVB 3HV0A 1REQA 2GPAA 4JBLA 1S1CA 5AJHA 3ULKA 3TJRA 3V1UA 2GOYA 4D92A 1O2DA 4L95C 3O6VA 3CO0S 2JLXA 4TPKA 3GU3A 3MGBA 3NEPX 4NPCA 3RUAA 4C9BA 1P6UA 2UZIR 1D0VA 2VWGA 4DLUA 5E0OA 2XB2A 1V5EA 3WLHA 1GA1A 4DV6B 1CJSA 1E92A 2KMLA 2LRHA 1JHXA 1NOKA 3BWCA 4O2BF 5JV5A 4MITA 1JIXA 3GLHE 2HIAA 4ID3A 1VCIA 3ZXXA 1Z45A 1Q7GA 2V1UA 4DBLC 4M86A 4EY8A 3PTAA 1QFSA 2QOEA 4FBMA 1SB9A 1LB1B 2FVYA 2JBWA 4HX5A 4P7FA 3AL3A 5KVCA 2BFCA 4L7VA 2O05A 1XRSB 2O3QA 3HCAA 3IVGA 3LBAA 2B99A 1Y6JA 2C4MA 1U7DA 1HZJA 1L7OA 5EC8A 1EWKA 2DXIA 4R4JA 3G89A 3WICA 2VDLB 5C1BA 1NI4A 3GXBA 4O4IB 3L05A 4OP3A 3ND7A 3Q7TA 3AB3A 4UU7A 3QVLA 3VZSA 4LJ4A 3W79A 1VL6A 1ULHA 1GSOA 3IP5A 3FFWA 2AJCA 2CXOA 5SZIA 1DRKA 3YASA 5AW5A 1VIAA 1E3EA 1LUAA 3GUHA 4DCCA 3FYCA 3HK2A 2I9KA 4RCYA 3UFBA 1C0PA 4LW8A 4AS3A 2QVLA 4JSTA 1VXRA 3OQIA 4FD3A 2CLFB 4PCUA 2AN9A 4TVOA 2IE8A 4QZVA 2IHJA 3ZQUA 1C14A 1O1YA 1G4AE 1F1JA 4TLLB 1Z5ZA 2H07A 2I2DA 2NUTB 2RFLA 2X1LA 3BMCA 4HLCA 5CIQA 3DB1A 5KSWB 1N2CE 4NCBA 5IC6A 1H3EA 1GNVA 3CX3A 1W5EA 4PO8A 1VE6A 1F7VA 1YB7A 1W88A 4Z1MD 3U4QA 3BK7A 2H1CA 1JI0A 5AJXA 4H1UA 3E3MA 3KLNA 2IYNA 5FWXB 4BNDA 3GLTA 1U0RA 5I8WA 4LX8A 3PXGA 2WWRA 3ZJ4A 5EXPA 2IXEA 3KT0A 1TJPB 5FOVA 4UC0A 3WQBA 1WCYA 2RHOA 5JDIA 1YZGA 3DMTC 4IV5A 4NIMA 1X86B 1NXXA 4QYIA 1NBHA 2VF8A 3FETA 4LV6A 1G60A 2R7LA 5IFLA 3CBGA 4NOMA 2ADFA 2V9CA 2RAFA 1JHRA 4KVGA 4S04A 1T5OA 3L40A 2EL7A 4FMDF 4M0PA 3EGXA 3COSA 4I4NA 1A9RA 1J00A 1XL0A 2XB9A 3BULA 3W2FA 4C21A 1QYRA 3CXUA 3LQFA 1OI3A 5K4HA 2CUKA 1UPTA 2DBRA 3HBLA 1UXIA 4Z86A 2AYYA 3CZ9A 2ZRMA 4GM0A 4B3FX 4YUZA 3KU1A 5D7BA 3IEKA 2EDCA 3SHVA 4JLPA 4M49A 2MWMA 2WWHA 4QRIA 3V34A 2FF7A 3JYNA 3WB9A 1KRHA 4DIFA 5JQGA 5AJVB 1KSHA 1EXNA 2RHBA 4M37A 3ZWXA 3PUZA 4RE5A 4GPIB 4CKEA 4MO9A 5I3ZA 4L4SA 3GC6A 3SSMA 3P52A 3RRFA 1HT2E 5B55A 1NKVA 2X8AA 3MFQA 3L7KA 3ZGVA 2OWDA 4FYVA 2HADA 3NTLA 3OQBA 4MUBA 4PX5A 2BUBA 2PQMA 2O7RA 2ZP1A 5ILGA 1SMKA 1BDHA 4UE2A 2DPGA 2NQTA 3SIXA 2GBLC 3AF4A 4WCVA 2Q6IA 4QUBA 3UUFA 2QQFA 4HPWA 1MUUA 5JMTA 2YQZA 4OI0A 2Q6TA 3HCWA 3H1EA 2DSNA 1GNRA 1EA7A 1RM0A 1U1EA 4H3SA 4QXQA 1WB4A 3A36A 4PG4A 3T3PB 4WNCA 3ER8A 1WMSA 5CVEA 3TCKA 2HK7A 4I6JA 3KLOA 4DYHA 4J9UE 2QTLA 5ANRB 3KJGA 1GPLA 1XVAA 2Y6VA 3DUWA 3QBTA 1V6CA 3PPWA 4XPZA 1Q1ZA 1RXSA 2WJ4A 821PA 3KCNA 1PIWA 5E4TA 4PPYA 4B9EA 1N34B 2NO1A 3V7UA 2UVPA 3VHXA 3P9QA 5KQMA 2WU4A 3ZDFA 1QLWA 2QE6A 2OZPA 1G291 5EJAA 3ADPA 5JAQA 5BN3B 1N8SA 5IKMA 2H54A 2G28A 4O08A 3U3XA 5IW8A 1V9SA 2H2AA 3I1JA 2AC2A 3SMVA 1SUSA 3BHMA 4G0MA 3R74A 1KEWA 3JY6A 2J6BA 4ZI7A 4F9EA 2FE1A 4DMKA 1UDAA 2XNDD 4GYYA 1FOEB 1XRJA 2IYZA 1N2HA 1IHYA 1TYCA 4Q4JB 3ZG6A 1RVDA 3H05A 2VDQB 1GA6A 3S70A 5EKSA 3G68A 1JDSA 2IHKA 3FSRA 2X40A 3N8KA 5AVOA 5BRAA 2P41A 1QRSA 2BFDA 2ET6A 4G6ZA 2XWJI 5LWHA 4GM4A 2FDXA 3ROQA 4YMIA 1XZGA 1RKBA 2BDTA 3FKSD 1SU7A 2YFHA 3PA6A 4BB9A 4URXR 1F6BA 4JCCA 4Y1RB 1ZK4A 4IHQA 2WWWA 3DHVA 2NV6A 3EF1A 2AFIA 3S2UA 4BBZA 3QZUA 4EHHA 2WDZA 1CRLA 2H1LA 1KEVA 1Z5OA 4KQMA 4P7BA 4YJKA 5EIFA 3ZPXA 4BO5A 4MZXA 1ZP6A 4ZAZA 4YMUA 2AI2A 2UXBB 2XWQA 3GZJA 4KBFA 2D7DA 3ZXIA 2OBLA 2XVMA 2VPQA 4MV7A 3TE7A 1WD7A 2C2ZA 2QAIA 3EZ2A 4H0NA 1EE9A 4J3FA 4NFYA 2I6XA 2G40A 2R6HA 5DRYA 5IVIA 2PQ6A 2F55A 4ARZA 3KSDO 4KI7A 3NVDA 2CLOB 4J6FA 3UMSA 2R8EA 4HP8A 4J0HA 2HPAA 3AVVA 3QKRB 3KDPA 2Q5FA 4KC0A 1DS6A 3O8LA 1WVIA 3ZCXA 1STOA 4HDAA 5BRJA 3OE7A 4L15A 4Q3OA 4EHDA 4B17A 1R0ZA 1X7YB 3CMMA 2GNAA 1QMPA 1VE1A 5LIRA 3QMVA 1P9NA 3RHZA 1YRYE 2R7MA 2VOJA 4YFYA 2XIJA 3VSEA 1TO2E 2E18A 2H92A 4PG8A 3HXQA 1YZFA 2DLCX 5AM2A 3R5FA 2QSJA 4HH1A 1JU4A 1KBOA 3OCJA 1QYVA 1Y5MA 3PNYA 3V4FA 3DMGA 4QG3A 4N3BA 1P8AA 1GU1A 2O1WA 2Q5CA 5HUJA 3ADKA 4QOHA 3DAPA 3NHKA 4GGMX 8LDHA 3GUYA 4J1TC 2A58A 3GNTA 3U3MA 2Z1MA 2B3DA 1QVVA 3GFPA 1YKFA 2XE8A 3G8AA 2J5BA 3QRWA 1I7PA 3WK4A 4ISCA 1GGNA 4YC7A 1YONA 1LZKA 2VYVD 3INGA 5E6SA 3RS4A 5AHWA 4DMGA 1V45E 2ZLBA 3PFFA 4D45A 1GEGA 4RD1A 2A7QA 3NT4A 3I1FA 3J80A 2WQ6A 1LLUA 1ZG3A 1CUCA 3SICE 4AX4A 2BMEA 1MG0A 4F0JA 5CFMA 2XMRA 1T3ZA 4W5RA 1UMBA 5DISB 5SICE 4C2UA 1BA3A 3P2OA 4XYMA 3MJVA 8ATCA 4O4JA 2X76A 3V8BA 2OCIA 2Q5JA 3IOYA 1CEEA 5F5NA 2PZKA 3R7SA 2A33A 3VGJA 3TJMA 3C98A 4X6LA 4F3CA 2BR4A 5FO1A 5LYYA 4QOFA 4FX5A 2QZJA 4RVOA 4IDAA 1XCMA 5I3CA 1AKEA 1NXQA 4MV8A 1I32A 2CK3A 1JSXA 2RHDA 3DV0A 5TVKA 5KSOA 4XCVA 4JYMA 3SJUA 1TAHA 1LTKA 2B8WA 2M6SA 5JJ5A 4XX0A 1YZYA 3J7TA 4IIDA 3RBXA 3C97A 3DONA 1UBHS 4YJHB 4F12A 4KXQA 1K8ZB 3MD9A 3O3OB 1XT6A 1T0HB 1X1CA 3O3NB 1O6ZA 4RFSA 1P4RA 1K86A 4RZSA 5B4UA 1FNNA 2PAAA 3A9WA 3GCDA 4MMXB 4WXHA 1RQGA 4N1AA 3R7LA 3IKTA 4RCVA 4BFLA 1SD1A 2W48A 3RABA 5GTDA 4OB8A 1U2GA 4UJ3A 3R7AA 1IZ9A 1TVEA 2Y66A 4EUSA 3PYLA 3QHPA 4W9NC 1RE0A 3RU9A 1W36B 4EI9A 1U1IA 2ZCUA 1PR1A 1KK0A 3VQTA 2G4CA 2IIBA 2ODAA 2YHUA 2NAFA 3U17A 1TM4E 5FOXA 3MIIA 2DHDA 3ROMA 3CX7A 1LWNA 2QXUA 4E5DA 3NR2A 3T7RA 4BKPA 3TLKA 3UCXA 1VKOA 1NJ5A 1Z12A 3UMJA 4E7OA 1HK7A 1O8BA 3EVFA 4WJZA 3DMHA 2PS9A 4OHZA 5AXCA 1CP3A 2R8PA 3ZK8A 3UOGA 1KMNA 1M2VB 2PGLA 3NANA 3OWOA 1CYEA 1N7JA 1P9LA 1PZMA 5D3KA 1ZLXA 4GNRA 3QSGA 1H8ED 1E98A 5L51A 4BAZA 1JYFA 5FORA 2F8SA 4RPHA 4UVDA 4ALJA 3OT5A 4U0JA 3EIUA 3LUGA 3C6MA 4NE2A 2GD6A 4PSKA 3EIHA 1E0DA 1OYWA 4B84A 4JS0A 2QK4A 3IAS1 1G42A 3FWPA 3Q98A 5DX1A 3GP8A 3U4CA 4MCAA 3ZDAA 4NCAA 3V1MA 1JECA 1QIIA 1VCNA 2YWRA 4F6LA 5JZ9A 5A3QA 2YFQA 4HAUA 4RAQA 4GYKA 2Y3IA 1NX6A 2QLFA 3Q3EA 2VFAA 4I1IA 1B93A 3MINA 1NRXA 3C1TA 3EVNA 5JCJD 2QM0A 5JMPA 3WHPA 2B8TA 1SZJG 3FMIA 4RGYA 4XSHA 3VV3A 4K9SA 4XJTA 3BE5A 2NSYA 2J3DA 4CCWA 5EIXA 1RM5A 2QHXA 1ZC3A 1G6OA 2RHGB 3LDGA 3KYCB 5I4IA 4YAOA 1WS6A 4C6TB 1L8XA 1SPXA 2GNOA 4EB3A 1QU3A 2GK3A 3E9EA 4WXEA 5JH7F 1TGVA 2FPOA 3FVVA 4B3DA 1OWNA 3B20A 3FLAA 1ECCA 1U0HC 3N3BC 3T5TA 1P1FA 3ZY2A 5J4VA 1KGDA 5HTOA 2YINC 4QJBA 5DSXA 2ZUUA 1U4NA 4BB5A 2Q2OA 2DFDA 2JJ2D 1KI6A 4O4HF 2J9XB 2ZATA 4LA4A 2ZM5A 3TIGA 3WQSB 3HCDA 4J29A 5LLSA 3V4PB 4X63A 3DQZA 4MJXA 1QIMA 2X5JO 4CLDA 5ED0A 3UHOA 1GIAA 2V5UA 4Q01A 4KR2A 3JASB 5AKKA 1SVSA 1Q20A 1VHTA 1RM4A 2D1SA 4LUCA 1MLDA 4IEIA 1D2CA 3RTDA 4OQDA 2UUAB 2NIPA 4QYMA 4NONA 3ZN2A 2B5OA 1GAWA 1YOVB 1LF0A 2JD2A 4RZ2A 2DVMA 4BNWA 3HCOA 1G8JA 3U19A 3FUTA 1A8HA 2VIIA 4KACA 1BA2A 1D03A 1VJTA 2HDNB 4KNWA 1KZGB 1ZM2A 4QHSA 4BJ1A 1L7RA 1T15A 2SKDA 3RTCA 3DMNA 2ADOA 2JIBA 2IEIA 4Y1FA 1N9GB 1M54A 2IOYA 1J23A 2H06A 1U3GA 4HWPA 1GU7A 4MGZR 5LYJA 4RQBA 1E1QA 2B21A 4ZREA 3WB2A 1CDEA 3AP2A 4XTCS 1J8DA 3W6ZA 3GVCA 2VK8A 2CF6A 3UB2A 2HA3A 3KC2A 3E6AA 1CULC 3MRSA 5CNMA 5A6VA 3BA6A 3QPDA 3A1CA 1O9BA 3ZWBA 3HB7A 5K09A 1GP2A 3DBVO 4II2A 4BP8A 1GPNA 1GTRA 2DZDA 2QMYA 1HLPA 4BE4A 2M98A 2JCBA 2PKCA 3RBAA 3WFJA 4W5QA 1Y9DA 3AZOA 1Y33E 2IU3A 2ZBQA 2J32A 4ER6A 3ZI0A 1QKKA 1N2GA 3LFUA 2H4XA 2OPBA 1CJMA 3FI0A 2AWOA 4KCGA 4FEYA 1YK1A 3RHTA 3WAKA 4O5AA 4UNRA 2PT5A 3NH9A 5G3YA 1U0JA 2CYCA 4EG4A 1TC1A 4KE8A 1Y5IA 1RJEA 5A3SA 3T3HA 3EMKA 2PZLA 2YY6A 4C01A 3LBHA 1CY4A 1EHYA 4CQJA 1VE7A 5I7FA 1I7SB 2FPLA 2PG3A 3EDOA 3ZJVA 2V7XA 3EEQA 1Z88A 3ZY4A 1G2OA 1KFKB 1U3FA 1EVYA 2R8XA 2ZROA 3IOMA 3M5PA 2NZUG 4NU8X 3VGPA 1TT5A 1KQFA 3KE9A 3X2SA 4MYRA 4MZDA 4AW9A 5JARA 5JS8A 5JSFA 4KFCA 1X7DA 4N3NA 1EXMA 3RS5A 4FCCA 4U7TB 3MEQA 2QTZA 4GVLA 1NPDA 2JD1A 5T4EA 1KYIA 1ORDA 5KDDA 2I6TA 2W71A 2C8JA 1VMKA 2J31A 3GVIA 3RIGA 1GM5A 1CUEA 2C9ZA 3X43A 2VKQA 5AKGA 3H2IA 5L4LA 5KREA 5EJIA 1LEHA 2O3UA 2EJVA 3N58A 1JI3A 3WOHA 1W49A 2OBFA 3BGVA 3EXAA 1RQNA 1VPVA 3HCFA 4UD6A 4UZSA 3DLIA 5ES3A 1HOXA 2FPGB 2I4IA 3EXFB 3TRKA 1GCOA 2OCAA 4G5HA 4Z3KA 1U5AA 4WBXC 5FL3A 1ZCAA 3I6ZA 4JLSA 2ZT6A 5TQ2A 2JASA 2R44A 1SXJE 4FHZA 3BXXA 3RSHA 2G77B 5JECA 2VH5R 1AO0A 2I8LA 4BTVA 2CL0X 1Q91A 1KYQA 5BW8A 4QGHA 3AEXA 3NEAA 2O8FA 2AQIA 1FFDA 3K9QO 3LHFA 5G0WA 4GL2A 1UIRA 2FUG6 3FDFA 3UMCA 2Z4TA 1T6BY 2NU6B 3O2SB 4IVRA 4NZPA 3BTOA 4PYOA 3ZV6A 3DYVA 5KDLA 4H3VA 3PQEA 2Q2WA 4RACA 5KAMA 4XLZA 5U9CA 2IXDA 3HUTA 3HY6A 4ZTZB 4XW2A 2DQKA 3CT4A 4ML3A 4NMMA 3UW1A 2XZPA 3BIFA 3SAJA 5HOEA 2Y2VA 4KAXA 1WUIS 2SNIE 2AN4A 1X8KA 3I52A 5JNTA 3R20A 5FOSA 3H65A 1R8SA 4C6RA 1DG1G 2NGRA 3PHLA 2W6NA 4RSMA 1RR6A 2GD0A 5BOSA 4KR7A 3CO5A 4F97A 3PEEA 1NVKA 1QC5B 1XQXA 2B9EA 2FZLA 2FN8A 4C5CA 5JZBA 1UFKA 2DCMA 3LKZA 2JJ1A 5KNBH 3NKFA 1RZRD 3QUCA 2Z1NA 2DUMA 2WICA 3GRRA 2X5OA 1SA0B 4NBSA 1C30A 3BXGA 4WASA 1MCZA 4RHUA 5EHIA 5IJXA 4EP1A 1NL3A 2Q28A 3FBGA 1AURA 1ECBA 2HMYB 3BHNA 3E81A 3DVAB 4OA8A 4AZ3A 3GGSA 4NU6A 3R5XA 4BWGA 4QBFA 1XJ5A 1FPQA 2OHXA 3GYBA 1JG7A 2I6GA 2C07A 2WA1A 1XELA 2ZSAA 2I6SA 2VUIB 4LGVA 1LBQA 3DFKA 2KJQA 1YACA 3PXAA 3QKSA 4LY9A 4V0LA 1ML4A 4F5YA 3PUWA 3SSOA 4BX2A 5DASA 4YHBA 4CN9A 5TGZA 3V46A 1SBYA 1VLMA 1II8B 3SEQA 3ANXA 4BATA 3DTTA 2P1DA 2GD2A 3PC7A 4CDGA 4KFTA 4LYYA 1YNSA 1MH1A 3LCUA 3KKMA 4MEJA 2QROA 4BC0A 3QIVA 3COYA 5KS2A 1XCBA 4JYPA 4B43A 2HX1A 4OQPA 1XFDA 4FW8A 1N2CA 2V7QD 3CCFA 1UXKA 2CF5A 4P82A 2PXXA 1Q7CA 1DT5A 4LY0A 2ZJBA 2DU8A 3PD7A 1HE5A 5KKAA 4P22A 1W76A 5CLIA 5CW1A 5IAJA 2HK6A 1W0KD 1DFGA 3ESQA 3DAFA 1HKHA 1QK4A 1S4QA 2R62A 4L8FA 1PLKA 1TJ4A 5CW2A 4F4CA 1YZQA 2EARA 3K9HA 3TXYA 2LDBA 3CUEF 1SO8A 2FWAA 1EINA 3ESYA 1FBNA 3KKOA 1T2VA 2P7IA 3I34X 1C5KA 4IXWA 3IVXA 2PX3A 2JKVA 1GA4A 1IM2A 2VWPA 2BVNA 1CY7A 2BSQA 2GDJA 3S44A 3RJZA 2BBWA 2ZBVA 3OZCA 4ZVTA 1DINA 2XR1A 4JDPA 1GGVA 4J7AA 4ZVUA 3N6XA 2WU0A 3OX3A 4ZVOA 2WJIA 3FMVA 4NL4H 4DC1A 2Z04A 1BXGA 4QEDA 3TNDA 4ZA2A 3RC7A 4DSNA 2HWUA 4KX5A 1QG4A 4OSPA 1FTWA 3E9DA 5LQRA 2F17A 4E70A 1RM3A 1FFXA 2DY0A 3RAFC 3F96A 1ONOA 2I4LA 2FPKA 1DIOB 4GYWA 2J5RA 1MX1A 3T1QA 4LJ9A 3ICOA 4JUCA 4DUGD 1TYDE 2CNBA 2QTNA 3AW9A 4E5MA 4XVCA 3DFFA 5JALA 1ONBA 1F2TA 4RY2A 3VBCA 3N70A 1USUA 1PJQA 3RS8A 3QU2A 2WJJA 5AHXA 1K68A 4GOJA 4CF4A 1M2KA 2EBWA 3UC9A 3OI7A 1WXFA 3DE7X 5JSZA 2XI4A 4FZ3A 2A59A 4OQQA 1S2NA 2HJSA 2X8LA 4IUBS 3M3PA 4A5OA 5KTYA 5BP7A 4MS4A 1ML3A 2Q3LA 3AEUB 1BX3A 2G9VA 3F6RA 3KX2A 4MICA 2WU3A 2WKWA 2G9NA 1T1SA 4A0RA 4C7MA 6ADHA 1U90A 4MWGA 4L0MA 4UHKA 3CNQS 5JAPA 1ELOA 2AHOA 2ESRA 4FYXA 2XCTB 4II3A 4JYAB 2HBQA 5JFOA 3LLCA 4OI1A 2E4YA 4YR7A 1ODTC 3PTLA 3LUFA 1HEUA 1I51A 1NC1A 4P4UA 3O9MA 3IPAA 2CV0A 1QGZA 3T1YB 2YXLA 4QGSA 3GLGA 1H2FA 2QQEA 1NNUA 2GBGA 3C7KA 4H3KB 5CB4A 4C7BA 1MEOA 4JNCA 2F67A 3SBDA 5H3HA 4V2IA 1APBA 1LX6A 2RONA 3LHDA 4LYDA 4R1PA 4A2CA 3BFPA 5GONA 5GMOA 3RUPA 4HFJA 3P0HA 4EHKA 3F9IA 2C0PA 1KYZA 1GJRA 5FPKA 4X1YB 1MO6A 2GETA 3OZXA 1RVV1 3OZBA 1TQ6A 2ECPA 4PPNA 2Q3BA 2WIFA 1TDJA 1WABA 2OGZA 4WTOA 4GL4A 4D0NA 3M6UA 1I2BA 4LXHA 1ZM4A 3VJLA 1VLHA 4LK2A 3W6OA 2UZ1B 3GD5A 4UBIA 5T8KC 1E6UA 1YIOA 3G8DA 1RSZA 3OIDA 4LOKA 4ESVA 3R3VA 2IY9A 5EGNA 4LF8B 4F04A 2HU7A 5K8UA 3IV6A 2C1ZA 3LUKA 4A0HA 1I14A 4ITUA 4NR0A 2YV4A 3WB1A 5EHNA 3OO0A 4NATA 4QGBA 4RADA 4I8XA 2IZ5A 2J8ZA 4IJ5A 1YQUA 4ALLA 3V42A 3DZJA 4RPIA 1QQAA 1DBVO 2QD2A 4TWAA 5G1NA 1QLJA 5FKJA 4L5CA 3U0VA 1U0OC 4ZCTA 1E7YA 4Z7NB 2B4RO 4IQ4A 4J2TA 4ZOCA 4MULA 4Q03A 2V1XA 3KSZO 4C3OB 1AC5A 4XLLA 1T13A 2D00A 3A1WA 3H1FA 1N5DA 1E2LA 3PDIA 3K96A 1W52X 3PR3A 5ENZA 1ADFA 1LQ2A 2JLCA 5DHSA 1NFFA 4PZCA 3SC2A 1BO6A 2QPOA 4KIFA 5LOVF 1QPZA 2CVQA 1CTQA 4KYIB 3V8QA 3KPJA 4IXMA 3VVMA 1NF2A 2ZJ8A 1N6PA 3AIKA 3C1OA 5BWNA 1XZMA 4BS9A 4HTFA 3T12A 1QR2A 5AOCA 4WZBB 5I7EA 3FUUA 1WHTA 3NAZA 4MUYA 4EYSA 5AO9A 1EFDN 1Y4UA 1SK8A 1QHIA 3C3WA 3GRUA 4FB4A 1GAJA 5FJJA 1HNWB 2OFXA 3MC1A 1FJXA 1CRWG 4E6EA 4DV7B 1CFZA 2FPIA 3ZD9A 1K88A 2Q1XA 4FIZA 1R6VA 3PJDA 2PGNA 2BFFB 2XUZA 4JI5B 1L8QA 3AR2A 3MOGA 4B3BA 1XLTC 1E2JA 3TPFA 4LJ5A 2PD4A 3L6UA 4IQFA 2Y71A 2HUNA 4A8PA 5E38A 4IDPA 2EJWA 3HLTA 4ZPXA 2H7VA 4IV8A 3U2QA 5C0OE 2O5CA 3FOZA 4Z9FA 5TQJA 3ZVLA 2VJNA 1U8TA 5HF5A 1TZCA 1GU0A 2FOXA 2YR0A 3LT2A 5F7OA 5IYZA 3IYLW 2XH8A 2OO3A 4ILKA 4JJZA 2ZBFA 3M6WA 3AUKA 5KNCH 5EPUA 5EMJA 3QOXA 1OX6A 2YXNA 4NV1A 2JCYA 3OJXA 1NSTA 1ICEA 3EXHB 1JJAA 2I65A 3H83A 4MUMA 4G81A 2CWWA 4EMBA 4S0XA 1V5GA 1EFTA 1LVUA 4QOIA 1H2BA 2ATEA 2CHGA 3ZWNA 4L76A 1EDEA 4ND4A 5E1BA 2UYYA 4ZCLA 4BVFA 3WKBA 1C3OA 1EFVB 4P6VF 2WIJA 4DAOA 2Z2XA 3VR4H 4UXIA 1G21B 5DI3B 1JR3A 3L7DA 4L3OA 3D4LA 1JVNA 2ZJ0A 3ICVA 4KVAA 3RSCA 3WRYA 5ICEA 1EQAA 2DBYA 2IA5A 2C8LA 2YJ6A 4PPFA 5LD2C 2PUTA 4FU0A 3MNFA 2FRXA 4A0FA 2BEUA 2ZUWA 5A4IS 3CGWA 1C9MA 2CFOA 3B7GA 4PZ0A 2JGNA 5EP3A 5FADA 4QPJC 1ZR4A 1BXKA 4M54A 2P75A 2WT4A 2ZRLA 4BVEA 3ZNNA 1L5ZA 5C52B 1JS1X 4DQUA 1TFRA 4W5TA 1G3IA 2B2XA 1CR1A 3KYBA 1N6NA 2VLIA 1PF7E 4Q16A 3OT1A 3DC2A 4II7A 4EW2A 4QATA 3R4VA 2JCVA 2K2QB 3A2MA 4OB7A 1PI3A 2HGSA 5EMMA 5AUQA 2QR5A 3PL1A 1YJAA 1TC2A 3NUQA 1BH2A 4EI7A 1HI9A 1NDHA 2JD0A 2R4QA 3HKEB 4I1YA 3FCSB 4YJ3F 3ESCA 4Z8YA 4BYMA 2BFBA 3JQBA 4C7OB 2QIOA 1MFZA 4C3UA 1S3SA 4WBNA 3A9RA 1A98A 2OO5C 3IUEA 1IH8A 4BDSA 1QG2A 2C4NA 2YWBA 1CLEA 4QX6A 4RGQA 4W5JA 1JHPA 5EFZA 2FEPA 1YFJA 1J2JA 4DA4A 3S5UA 1ESEA 1UFOA 3MD0A 3NT5A 2ZQYA 2GZ3A 1EI9A 1RQPA 5IH3A 3SOZA 5HKAA 3DM5A 4GR9A 5IMSA 5I8ZA 2XZTA 4G3XA 3TKYA 3A6FA 4TTPA 2F1HA 5FOQA 3B3QA 3EGIA 5KOJB 3ZTYA 2HJHA 2WOJA 1XA0A 3ABOB 1TCBA 1UJCA 5DWQA 4CMIA 1PGQA 2O7QA 5BRNA 1RHMA 3ZGOA 3PUIA 4FYWA 2R66A 4U6NA 2UXDB 3LVQE 1RXUA 1G5IA 1AMNA 1NR5A 2ZBRA 1PS9A 1ZJ4A 4MW1A 2D1QA 3W04A 1IY0A 1Y80A 3IIJA 4MUIA 3LE8A 1N6IA 3MT0A 4F4HA 4UVIA 4ZDIA 5HDQA 5J4KA 3BB4A 1K5PA 4AL4A 4EG6A 1PWZA 1VZ2A 2PL5A 3M6LA 4K2HA 3EHDA 1VG8A 3OKPA 4ZQCB 1BE1A 1FNSA 1E6CA 2MR5A 4MRMB 1O89A 4LFBB 1MAVA 4ERNA 3HYLA 3OIWA 3KVNA 1NXPA 1Z13A 4QWWA 1IIBA 3GJ3A 3E82A 2NYVA 4JJ6A 5EXTA 1E4YA 2BGMA 1T3GA 1S7GA 1XXHA 4NQZA 3FR8A 4A4DA 2JJMA 2O3RA 1K8XB 3G79A 1P2SA 1JDNA 1P2BA 1UBEA 1VMDA 1Z47A 2O8BB 3IPXA 4DLLA 1KOGA 8GPBA 1D4ZA 5A4FS 5JMOA 2AA3A 5CTJA 4ZI7F 1GRQA 3F3SA 3W9SA 3FWKA 4JKOA 4A1OA 2XYGA 3DOFA 3WMRA 3AFOA 1PNOA 4PRKA 2P27A 3CWQA 5HF6A 1QQ5A 3N5CA 3UVEA 3RUCA 1SIWA 1Z56C 1JSCA 2NVUB 2YTZA 1U2RA 1DAPA 3AK4A 4PFKA 1P4SA 2EKQA 3AP1A 1IIRA 4RF3A 4P35A 4TN5A 2JGDB 1TQHA 1AUVA 3LYLA 3SF8B 5DRTA 1R66A 4W9MC 2OC4A 2Y92A 1DG9A 1TD1A 1OX5A 3G9XA 2D5LA 4R0MA 4QBKA 2QX7A 2YJ3A 4H9GA 4RANA 1PSZA 3W7VA 4CVNA 2IKQA 2YJTD 1O3YA 3I9MA 2CT8A 3HU5A 1XQVA 2RAPA 4IIJA 1CDDA 1ZMXA 1TUBB 3K5HA 3B2EA 3LQQA 4B2IA 5HKKD 4BAGA 1CUSA 3B48A 5EA2A 1YO6A 4X6YA 5BMVA 1T26A 2VZEA 3BJZA 2E6UX 4TUYF 3UBTA 3G0IA 1TAGA 1RWPA 3D8SA 1US8A 1ICIA 3M82A 4OFBA 4N3CA 4NDZA 4ROTA 2E5LB 1NKSA 4ZEVA 3BL5A 1T4BA 5AVYA 3BJRA 4URYR 1QLHA 3VZPA 4AP9A 3AFHA 1RHKA 3Q3GE 1KI2A 3MW8A 2VO1A 3TVDA 5ADUS 2JKYA 3LOUA 1PD0A 3H19A 3UGKA 3GLRA 4JSYA 2GZAA 3UUEA 3VZCA 3IEMA 4M1EA 1XK7A 1UC8A 5ICCA 2QY6A 3A4LA 3PFWO 4DHWA 3PEYA 3E9RA 3ROPA 1X1QA 3T5DA 1DCTA 2J9ZB 3GFBA 4YRZA 3CVJA 1IQPA 2BE9A 4IZ6A 4DE5A 1J8VA 1KY2A 1EGHA 1UMCB 3E3NA 4R31A 4XE5A 3IQWA 1I36A 2C94A 4F56A 1N32B 2XX3A 1D1TA 1OXTA 1QSGA 3D7SA 1KETA 3H2BA 3QLVC 3RSFA 4CYMA 2WHQA 4DMLA 1RZ3A 2GFQA 4Y9DA 1FYVA 3JSAA 4U7GA 2QNRA 1SXJA 1TECE 1JILA 1G5RA 3OPNA 1UKVY 2EG9A 1GAQA 1NONA 2KLHA 4B76A 2JEYA 3JQEA 1NUHA 5CYGA 1JXOA 3DNFA 4CG2A 5HW0A 1DIAA 2H4FA 1E64A 2O2JA 4WUVA 4AC9A 3BXOA 4KHZA 4TYYA 4A27A 5K0SA 5K8IA 5KYWB 1NM5A 1JAHA 2CHFA 3OZUA 3HXKA 4O4JF 4QQKA 5FIUA 4DPMA 4ZVRA 1P62B 1N6OA 1UKAA 3ZWCA 1B15A 2QRVA 5JRJA 3GJTA 2ONJA 3LFTA 4B3TB 3HKDA 5HG0A 2A35A 5H4GA 5EE1A 2X58A 2EC5A 2WOOA 2J0UA 4WA7A 3ZW8A 1L5MA 1Y42X 1N5RA 3LT4A 3GUCA 2BKUA 2AC7A 2BTEA 3BWMA 5G41A 1XPUA 1MNAA 3ZV4A 4G5GA 2OHHA 3VAZA 5DSZA 1J21A 4TS1A 2CMFA 4QPDA 1SBNE 3W78A 2RHLA 3CB4A 1OH7A 2NSHA 1IBLB 2V96A 1FFCA 1GDTA 1ABFA 2DKFA 4ZYZA 5A2QA 1HLGA 3SF0A 4KUEA 3BCSA 5HXAA 2H1OA 3LPLA 3QVUA 4AQDA 2JIOA 4PG6A 4WDQA 3U60B 5JY6A 2FWBA 3FLBA 1YVUA 3ITNA 4D56A 1YRHA 3GV0A 1IMOA 2NUAA 5G53C 1PQ4A 2H5IA 2X42A 3KYIB 4Q37A 4D97A 4EA8A 1QXSA 2YDXA 2QY9A 1N7IA 2P6OA 5CPBA 1DAMA 1OLUA 2RGUA 3R23A 4DIMA 2XCRB 4KWIA 2IK8A 2LZ0A 2ZTHA 1JMVA 2UKDA 4AX8A 5FYDA 3H86A 5KTKA 2XNJA 3W6PA 1H2AS 3SZGA 5EMHA 4EYQA 5AI4A 3ZDYB 1JLRA 3I2KA 4LSGA 4XFDA 2JHPA 3ZDBA 4CLEA 1OYOA 1SVIA 2QM7A 4YH1A 3WYNA 5DYNA 2CHUA 4O2BB 4AJHA 4CCSA 1RRFA 1Q1BA 3KL2A 1QH8A 1QF7A 5GM1A 4BFUA 5AKXA 2J4FA 2OBBA 1QZXA 2WVGA 4BO2A 5BN5A 4LV5B 1GG5A 4WI1A 2EGHA 2QDKA 3A9SA 4P58A 1YZLA 1ZVQA 2KPOA 2VHUA 4JP8A 3HADA 4P2GA 4YMSA 1KGSA 2P3OA 2QG6A 2V4UA 3FRHA 2J6IA 2ZW9A 3FYHA 2PRZA 3HZHA 4URFA 4WNAA 4Z0TA 5CMLA 2ROQA 3EOBI 3ORHA 4OMUA 2F4NA 3O38A 5EHZA 1CUGA 3A6LA 1XQ1A 2J3QA 2DWCA 4P9NA 5HKOA 1A9QA 3GG2A 2IOFK 4HS9A 1HH4A 4JZYA 4L57A 4N82A 4LF6B 2Q1YA 2FVXA 4YQYA 1DXQA 4ZT5A 2Y8EA 3FPGA 4Q19A 5AUNB 4Y2SA 3UENA 4D4IA 5K99A 5LVAA 2NUPB 2NTJA 3GW8A 5TJHA 2XUPA 1R4MB 4K05A 1H4SA 3GEMA 1YQTA 1ND6A 1I2CA 2YCBA 1LK7A 2QD5A 3ORFA 3ZBQA 1U0EA 3R0XA 1LSOA 2GO7A 4Y0VA 4MVCA 1KO7A 3D2LA 4HS4A 4ZV4A 4HAWA 2RHTA 2XOXA 3RFTA 2PPLA 3OF2A 1CQWA 5THKA 4HNRA 2QQ5A 3GUUA 2ZSKA 4JLBA 5COAA 1K7FB 4TS3A 4HNHA 1UOEA 2L82A 1H6BA 3NIFB 3PJRA 4JENA 5KNBA 4M1QA 4BCBA 2VTBB 1TK2A 4NYIR 2PKYX 4D82A 4R7TA 3DCIA 1VGQA 3OQOA 4R9UC 1SURA 3H8SA 3ELDA 3WADA 2E9SA 5BYBA 1Z0JA 2VA8A 4GVXA 4DCUA 1E0JA 2ODPA 2RGYA 4ALNA 2JH8A 2XTZA 2O8DA 5AVWA 1E59A 2ZITA 4KMMA 5AP9A 5M29A 1RPZA 2C77A 2R0QC 3TUIC 9LDBA 2MSCB 4X8LA 2AF3C 1YB5A 1BFDA 5H0IA 1WZIA 4G9EA 2QG4A 3D3EA 3KXDA 4MUFA 1WKBA 2REOA 3E9NA 4BNUA 4CFSA 8OHMA 3U5TA 3T1HB 3H2ZA 1C7IA 3I9V1 5LUBA 2EWWA 1L5KA 2YZ2A 2C9BA 1X80B 3AHDA 1SEVA 4RF2A 4Q4AB 4ZVKA 1B6TA 4L75A 3IQDB 4I1OA 2FX3A 2IEGA 3ZHYA 3N2KA 1N4DA 4CIBA 3JWGA 2O59A 4JB8A 1ZW6A 2DY1A 2PGXA 2Q2NA 3PIRA 4KW7A 1R15A 5BPHA 4YR9A 4BMCA 3LU1A 1PWEA 2EX4A 5EEHA 2OXTA 2J30A 3C43A 3EBLA 2RGNC 2II6A 4O1MA 1R0SA 3HJUA 3PHBE 1NY5A 3AJ8A 1YI0A 3L7BA 2Q9BA 4QYSA 4HLUC 3F1KA 3MT9A 3K09A 4FFWA 5IMBA 5CT6A 1O0BA 4O3MA 2DG2A 1K6MA 5BV8A 2XQGA 2XMSA 4ZDKA 2YWEA 1E2EA 1M8FA 4WFKA 3RHSA 2KB0A 3DDOA 3DBIA 2Q21A 4ND3A 4C76A 3FDZB 2DFVA 2ISQA 5K3EA 3H4MA 4W5OA 3VPAA 3QF7A 2B34A 2VVTA 4YP9A 1UUFA 4KEAA 2JGJA 5JE8A 4BVBA 5JT1A 1XN1A 2WUWE 5TPZD 1NXTA 3ANNA 4Y3UA 2X2EA 3AY7A 4ZANA 3IB6A 5K6AA 3VTKA 4YRLA 3G7SA 4E1AA 5JFGA 1GZHB 4D9BA 4QXPA 3GEBA 3LI2A 1E2DA 3CEHA 4W82A 3Q8KA 1EX9A 2FMTA 2ZSBA 5C80A 1VOTA 3ORYA 3PJEA 5AM4A 1SR8A 3CR7A 3P8ZA 3I39X 1WU8A 3GJ6A 3K0CA 3EGEA 5K3AA 2HA5A 4HH4A 1FVFA 1E3SA 3F78A 3NTUA 3QLUC 4YO7A 1GV0A 3G23A 4OUDB 4D6XA 1G8GA 1R0KA 3FJYA 1CQJA 4NG5A 5E2AA 1NF8A 1FP1D 1XCGB 4TMWA 3HCRA 3L1JA 3ZLTA 3ZIDA 4FFDA 4F71A 1LA2A 2ONCA 1YGPA 3ASVA 3BBLA 3DBHA 3PFGA 4HDNA 4ZAVA 3ASYA 1SXPA 4UUNA 4Q4CA 3R0JA 3AUTA 3TEJA 2AD1A 2Z5FA 3DTVA 4HOYA 2HHHB 1P5FA 1GPYA 2C54A 2J87A 2JZOA 4BV2A 5AK5A 5LUAA 2FF5A 1DUSA 2C0CA 2XT6A 1DEOA 3JZMA 1H6AA 2ZULA 3M4YA 4RJJA 1BCRA 3RYCA 1E60A 2WWFA 1WCXA 5D51S 4EY3A 2HPZA 4MAFA 1Z0SA 4IS3A 5GZ1A 1FQOA 1LPAB 5EERA 5FCDA 3E9MA 3PA8A 3T41A 5FOWA 2HRDA 3QEBZ 3E70C 3RE1A 5B7QA 3F90A 3U62A 2FPSA 3P32A 1FXSA 5JCOC 4F2HA 4K26A 1NVEA 4X9XA 4G67A 4WLUA 2FZ4A 1G0NA 4XYGA 3DUFA 1P1BA 3O4FA 3PITA 5DLYA 4YP6A 3UMVA 5TC4A 1ZIPA 4MQFB 3AONB 4B31A 5E8JA 2B1IA 2G25A 4DDTA 2XAUA 2F3SA 1E58A 1BN6A 3FYUC 3DEHA 3GHHA 3INTA 4LOJA 4MUXA 4RXTA 3QVJA 3PQDA 3DS8A 4J90A 5DWVA 5REQB 1AV6A 4X3OA 5TV2A 2HB6A