5EN4A

Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title First Structure-Activity Relationship of 17 beta-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 251
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5en4A00
5IG2A 5L45A 4UUOA 1Z6ZA 1K3TA 4KQWA 4B79A 2WE7A 3K8ZA 2FZWA 4C7KA 5EQDA 4XA8A 4GMFA 2JD2A 3AUSA 2VYNA 1SAYA 4BO0A 2EIHA 4MVJA 4RPHA 5KVVA 1A4IA 3Q2IA 3RUCA 4IGFA 3SX2A 5I9LA 1I01A 2G5CA 1E1LA 4CLOA 1TVEA 4R69A 1ULSA 4OSOA 3NT4A 1DLJA 1OMOA 1ZH8A 3H7AA 1U3UA 3I5MA 3JQ6A 3L9WA 4BO2A 4RDHA 3L77A 4OQZA 2JL1A 4E13A 1Q0HA 3HFGA 2VWQA 1Y7TA 3RVDA 3QSGA 3BMNB 4L4SA 3LQFA 4CV2A 3JD0A 1T1RA 3B20A 1B8VA 1FMCA 3SC4A 2NACA 4BNHA 1JLLA 5ENVA 5COQA 1ZK4A 2I5PO 2Q46A 3DC2A 3RFVA 1SB8A 3WB9A 1P1IA 4I1IA 4RVGA 3ITDA 2D1YA 3VZPA 1EK6A 4Q3EA 4XGIA 3BIOA 3INGA 2VNAA 4WCFB 2ZJ1A 5JSFA 4FFRA 2Y1CA 1U4OA 4PLVA 1O9BA 3RAJA 3RI3A 4K6CA 4E5YA 1PGOA 1Q0QA 3PLNA 3DBRA 5TGDA 2HDHA 3F5SA 3QVTA 1H2BA 2PZJA 3DBHB 1LLQA 1ONPA 2CZCA 3FCOA 4U5QA 4CQMB 1LC3A 5IXYA 1KEUA 2Z5LA 3G79A 5BNTA 4XYGA 2RH8A 1CWUA 2O2SA 2X58A 1ZXLA 4ND2A 3H9JA 2HJRA 2HLPA 3TDKA 3QWBA 3GQVA 3DOOA 4IXWA 4PFJA 5KWEA 1MC4A 4D3DA 2E48A 2HJSA 3WNVA 3H8VA 3OA2A 1W0CA 1YJQA 3F4BA 3DFZA 4KOAA 4U8GA 2FPIA 4O63O 1E77A 4DRYA 4EUHA 9LDTA 5CDGA 1CQJA 3PIDA 2X9NA 4YJDA 3GGGA 4FFLA 3JQBC 4WLNA 2POQX 1C3VA 4YJHB 2Q99A 4KDEA 3WBFA 2EXXA 3GVHA 1IPFA 4II2A 1DC5A 1UUFA 3TNLA 5JY1A 3FD8A 1JQBA 4B4WA 1QMGA 2YQ5A 5A5EA 2HK7A 4BO5A 4XDYA 3S8MA 1EUZA 2WD8A 4AICA 2X22A 5A1TA 1OAAA 2D5CA 3I9KA 1EE2A 5EESA 1GPDG 5HBRA 5KTKA 5TQVA 1LLUA 1JKJA 1QYWA 4NBUA 5JC1A 1TT5B 4GX5A 3RU9A 4BNNA 1RM0A 5JYEA 2GZ2A 1YVEI 1PJSA 3NKLA 5A3VA 1DJNA 4UUNA 1EDOA 2DPGA 4BNLA 4DVJA 1QV7A 3WOHA 3RROA 5IN5A 5DT9A 3OECA 2VUTA 5L7YA 5JFOA 3ASVA 1HYHA 3AW9A 3WIDA 1RM4A 3DAGA 4E31A 3ONEA 2YW9A 3GLQA 3F6YA 2B5VA 3DL2A 1BXGB 5DF1A 2WWRA 1GAEO 2PKRA 2O3UA 4GX0A 4Z0TA 4XGNA 3OM9A 5TX7A 4GGPA 3VZQA 2OP0A 3P7MA 4OJNA 4DGSA 4FOOA 1U3TA 1QORA 4MP6A 2PA3A 1Z7BA 1DIAA 3FNFA 3WYCA 2ZTMA 4FIZA 4RPJA 3NJ4A 2J5KA 5CG1A 3B1FA 3FHLA 2P68A 3C1TA 5L95A 3A14A 4KTTE 2ZATA 3WX0A 4OM8A 3E03A 3QWHA 4J3FA 3K31A 3ROPA 4IM7A 1P1FA 4RF3A 1GYQA 3PGXA 2QHXA 3TPCA 3ROQA 3OEYA 4GGOA 4ZJUA 1J6UA 3T7EA 4WEQA 2YZ7A 4I5GA 3FTNA 1ZUD1 2X8LA 4M87A 4D7AA 3G17A 4IGEA 1H6DA 2BELA 1LI4A 4M55A 1PS9A 2DPHA 2YFQA 4IJWA 4RVHA 4OXNA 1YL7A 5CPBA 3A9WA 4YA6A 1T2CA 1NM5A 1OZAA 2CMDA 3VZSA 4Z9YA 4Y98A 3ZN2A 4TROA 1GY8A 3JQDA 4UUMA 4BIIA 4BNVA 4E0BA 3SC6A 2C7VA 3AI2A 3ENKA 2JCXA 1LNQA 3IAHA 1LXCA 1MLDA 2NUAA 3WGQA 1PQUA 1P33A 1OFGA 3NJ8A 2B83A 4DLAA 3CH6A 4OKIA 4YJHA 2NVUB 2WJPA 5CEFA 4CQLA 4LW8A 1E92A 4PLHA 3UFXA 3VC7A 3E1KA 4M1QA 1JWAB 2ZB4A 1ZW1A 2HMWA 4U6SA 5IZCA 5L7WA 1P3DA 3EAGA 1I3MA 3ONFA 3QQPA 5EQFA 5CHEA 3MJVA 3DDNA 1VL8A 4H16A 4M8SA 1SB9A 2G17A 2EJWA 1YB5A 4QSMA 4HFRA 1OOEA 3FBGA 4YXFA 3QE3A 3BMCA 4AJKA 4GVXA 3PRJA 3TL3A 3VDQA 4QEDA 3RJ5A 2Y1DA 3TN7A 3U09A 1DRUA 5IDYA 5JDCC 4CR6A 1HEUA 2FWMX 1OI7A 3K73O 2VUUA 1JW9B 4NR0A 3UCEA 6LDHA 1EUDA 5BSGA 4CMGA 1Z75A 4JJGA 3PYMA 3RC1A 4D79A 3OJOA 4QO7A 1B7GO 2HQ1A 1HTBA 1NVMB 3QLJA 1FDUA 4NG5A 4BMVA 2X4GA 3WTCA 2DUUA 3JD1A 4RZIA 4BGVA 4BNJA 1BXGA 2VWGA 4JX8A 3RIHA 5JYDA 2BFAA 1H2HA 2DVMA 3HUDA 1C1DB 2GR9A 1GQ2A 3INTA 4DA9A 4J16A 1Y8RA 1E7WA 3WS7A 4GSKA 1ZVMA 4OHUA 4PRLA 1L7DA 3EZLA 5KKCA 3G49A 3ZV3A 3KBOA 1YDWA 3R3JA 2I65A 3GVCA 4I8XA 4J7UA 4D3SA 4A73A 3HDJA 1PJ2A 4W99A 4NNJA 2DTEA 5L4SA 3GG9A 1P44A 1PL7A 3MJEA 1UH5A 4N54A 1DRVA 1YO6A 3CKYA 1E5QA 5EINA 5DNAA 8LDHA 1X14A 1H6BA 3D4NA 1LQUA 1ML3A 5TNXA 4NJOA 4CMEA 5JC8A 1AHIA 4RF5A 4U0KA 4KUEA 1YDEA 2PZMA 3JTMA 5KJ6A 3W8FA 3MTJA 4GWGA 2C0CA 1GD1O 4XWYA 3S2EA 2QIOA 3U62A 3UUWA 4IDFA 4BGIA 5K9ZA 1UAGA 4ZVVA 4XZ3A 1XR3A 4PRKA 5FYDA 3ZV4A 1U7HA 2X5JO 2IEDA 4CM6A 2VZ9A 2HO5A 2NVWA 3E18A 4RO0A 4UAGA 5KKAA 3L6DA 2NVUA 4NFHA 4CM7A 1PR9A 2AW5A 1NHWA 2RIRA 2XXJA 2GDZA 3R6DA 1XKQA 2JJYA 4BB6A 3HADA 4Z3DA 4L0QA 4GQAA 4E3ZA 1LC0A 3DMTA 1HDCA 2CF5A 3TZQA 4HNGA 2GD1O 5ILGA 4ZQBA 4CM4A 3PEFA 1MXHA 3OIDA 4WJZA 1ZCJA 2EP5A 3GHYA 1OC2A 4NDNE 3OIFA 1UDAA 1KEPA 1JVSA 3H5NA 4OXYA 1ZIDA 3VHRA 3WMWA 1YB1A 4JGBA 3HQ4O 2CY0A 3U49A 4CR8A 4E2YA 1IULA 4YTEA 1XLTA 5C3MA 4YACA 3KUXA 4PZCA 4NBTA 1J0XO 3H4VA 1R15A 2BH9A 4FR5A 1F14A 2PH3A 3GHHA 1PX0A 1X7DA 4K1LA 4FSHA 4J43A 4MVJG 4XJTA 5A4DA 3JQAB 1BDBA 1J49A 2AQ8A 2C07A 3INRA 5JXWA 1DC6A 4DWVA 4BO1A 2CF6A 4CUKA 4RVFA 5TT1A 2AEFA 3ZI0A 4BQPA 1GUZA 1ZJYA 2FP4A 4FD3A 1D1SA 4OOFA 1SMKA 5G0TA 1FDSA 2PR2A 3VTZA 3GH3A 4TRNA 5B1YA 2W8ZA 1HZZA 2D2IA 4J7XA 3FI9A 4CLDA 4Q39A 4E5PA 1FDWA 2VHVA 4MOWA 4ZQFA 3WQSB 5JY6A 2YDYA 4D41A 4IUYA 1GEGA 4WLUA 3FBTA 1ISHA 4TWRA 1ZKMA 2HK9A 4CM8B 1C1XB 5EJ2A 2O3TA 2ZJ0A 4NK5A 4RVDA 4YAJA 2GN8A 4A2CA 1K6XA 4RQTA 4BKPA 3G0OA 3T4XA 2EW2A 3M1AA 3PYXA 4LRTB 3MJTA 3RUEA 3NT2A 3PWSA 5EERA 4FCCA 1TI7A 5CP8A 3GUCA 1ENYA 4R1SA 3LT0A 4PIVA 4FJ2A 1JU9A 1DRWA 3N58A 4IJKA 9LDBA 4I9UA 1P31A 5C7LO 3ABIA 2X1HA 2X23A 4PLCA 1HDRA 1HRDA 1IHXA 2A35A 4UVIA 1KEWA 4MVJI 2W2LD 3ADOA 4IQ8A 3QY9A 4J49A 3EHEA 1K6JA 2AMFA 1HDGO 3FNGA 4PG5A 1RYEA 3STHA 4PLPA 1NHGA 4GPD1 1E7RA 2E82A 3AU9A 5U4QA 4CR7A 1SPXA 2O3JA 2ZB3A 5G4KA 3WNQA 2X0RA 2B4QA 2Y99A 2C7GA 3BMQA 3GGPA 1XGKA 3QWFA 3PHHA 2O23A 4RVSA 4B7XA 1LEHA 2GGSA 1P1KA 3B70A 1S7CA 3VPHA 3AK4A 1CRWG 5DBIA 1ZK3A 1DDOA 4HBGA 4E21A 2RH4A 2F00A 1HE2A 2PZKA 1DC3A 2WMDA 3A4VA 4ZD6A 5BR7A 3TF5A 3RUAA 1LDBA 4R9RA 2HU2A 1B16A 5MDHA 1ISIA 3JQAA 3D5QA 3GDFA 1ADBA 4GLOA 3EMKA 2GASA 1DAPA 1A5ZA 3HHPA 3CIFA 1YQXA 5G0VA 1ARZA 4E30A 4MVJD 2PD6A 5TJHA 4XR4A 4NU6A 1PJTA 1QLJA 4IINA 4UEKA 4B8ZA 4CUJA 4WPGA 3D5TA 3MJ4A 1CDOA 4NPCA 2O7QA 1HL3A 2UUOA 1F17A 1QRRA 3I3OA 4X54A 3ZHYA 2JFFA 5DCWA 3ZHXA 2WTBA 4W7IA 1ONNA 3UH1A 2X7HA 3HZZA 5BT9A 1PZGA 1UXIA 3KRTA 3AU8A 2FR0A 2NSDA 1I10A 4YQYA 4HFMA 4ND1A 1C0KA 3U4HA 1PGPA 1R12A 5FFFA 3Q9UA 2C82A 3WJAA 1BW9A 3L6OO 3I83A 5IDWA 4KTVE 4XQGA 1TB4A 2NTVA 3HB4X 3WQQA 4A27A 1WZIA 2PY6A 4FC7A 3QV1A 4PLGA 5IZCC 5I7VA 4IDEA 4D46A 1XYGA 3K96A 5COBA 1YXMA 5KNLA 3NTQA 3RSHA 1IL0A 3IOYA 4XX0A 5AXAA 2VYVA 1KC3A 2OMEA 4DMMA 5ICMA 1NASA 3F9IA 1XEAA 3QWAA 4P22A 3SXPA 1SBYA 1UP4A 3KM0A 2Q2QA 1ID1A 3EC7A 3RKRA 3I9OA 4N7RA 2C29D 3A1NA 2D3TA 2R6JA 3ZU2A 4JIGA 2IYOA 2X0JA 2VHWA 3DEYX 4NBRA 1N5DA 3ICPA 4FOSA 5GZ3A 4QX6A 3LC7O 3HG7A 3BA1A 2UVDA 1EVIA 2EWMA 3ENNA 3VPXA 1CETA 5JAZA 3U0BA 1KY4A 1VI2A 3C85A 2C54A 4E33A 4ID9A 4HXYA 5GMOA 5C5IA 3KSDO 4CL8A 3AUAA 5KJFA 3KO8A 2C2XA 3FWZA 3AI1A 4U7WA 4UREA 2WYUA 1GYPA 2NNLD 4RLHA 1LSJA 2VUSA 4GBJA 2PD4A 1EK5A 1YS4A 4CL3A 4ZGWA 2O3SA 1LDYA 1NAHA 4CMBA 3GF4A 3OH8A 4IXTA 1KVSA 5KJ1A 2AG5A 2NU7A 4Q3DA 4PLTA 5FEUA 5TLSA 4DUPA 3P19A 1DIHA 4UULA 4NI5A 3PWZA 3H9EO 3WWYA 4B3HA 2QRLA 2GRAA 2ET6A 1NVTA 3ZWXA 4ILKA 3CZRA 4JJIA 3GZNA 1QP8A 4GH5A 4PLZA 5I9NA 4N18A 1I0ZA 3SLKA 2VCYA 1G6KA 1NYTA 1WMAA 4BO4A 3ZWCA 1GV1A 4CMEC 2DBRA 4CM9A 2CSUA 4ZN6A 1T1SA 3JYLA 4AJ1A 4CM5A 2QX7A 2W90A 4YRBA 1PJBA 2E6UX 3B1KA 3IC5A 4BO8A 3EVNA 1GZ3A 1E3SA 5U9CA 3F3SA 2NTNA 1E3WB 2Y68A 3FPLA 1DFHA 2BMAA 3WJ7A 1VPDA 3P2YA 3SVTA 3CZMA 4AJPA 2BGLA 3WSWA 3O38A 3C3XA 4JXKA 4XRRA 4Y9DA 3DBVO 4OH1A 3WGOA 5K0ZA 1PU2A 2IXAA 2GF2A 2ZTUA 2FRDA 3EGOA 3LYLA 5T67A 4KDFA 3DMTC 3IDSA 5COAA 1DC4A 3HDHA 5CG2A 3EVTA 1UZLA 4R1UA 4URFA 4WNIA 1N2SA 2XXBA 1GV0A 4QQRA 5IZ4A 1P0FA 1HT0A 3JQ7A 4QTZA 1GZ4A 2PLAA 4BMNA 2PGDA 1HYGA 4E2ZA 4JP3A 8ADHA 4PZEA 4YJGB 4CQMD 2WYWA 1U2DA 2EEZA 5L53A 3LVFO 3H9GA 1M76A 2DTDA 1LDEA 3W6ZA 3C8MA 3F5QA 1MG0A 4GVLA 4AJJA 5T8KA 4TZKA 4E2WA 1E1MA 1PWXA 4J0FA 3AM4A 1V6AA 3BTVA 2A4KA 4IPTA 3C1OA 3JQ9A 3ZNQA 3EUWA 1QXSA 4R1TA 2OO5A 4P4LA 1NR1A 5KIAA 4MDHA 3PQEA 3VH1A 4BNGA 2AG8A 5I8WA 1M66A 4OGWA 1T25A 1LA2A 1KOLA 1S6YA 4YT2A 2Y1OA 3AJRA 5KVQA 1E6UA 3NDRA 1X0VA 1VL6A 3ZV5A 1KETA 2AEMA 2EGHA 3ZWOA 1VL0A 1HSZA 3BXXA 1RYDA 4UVDA 4QFDA 3PLRA 1EBFA 3K9QO 3OFSA 1EQ2A 5BSFA 4ALJA 1GTMA 1DIGA 5EIOA 4RJTA 2H9IA 3SBOA 2RCYA 4CLHA 3I9LA 1DSSG 3PYLA 4XR9A 1KYQA 3CPSA 2CDBA 1H5QA 3E5RA 3H9UA 4YVFA 4CMAA 4AJOA 1LJ8A 1R4MA 1K2WA 4EYEA 5FI5A 1PJQA 4QFCA 1O8CA 5LC1A 1YKFA 3NGXA 4Z9XA 4IZIA 2NTJA 2J3IA 3QVWA 5L9AA 4FQ8A 1LSOA 3RUIA 1YWGO 2BD0A 4PVCA 3QVSA 3ZGYA 3RJ9A 3QA9A 1V3TA 5H83A 2I3AA 1V3UA 1E3WA 4KWHA 3KV3O 1DIBA 1J4AA 1B15A 4CQLB 2P2SA 3MTGA 1DXYA 2QW8A 3PI7A 4FJ1A 3V8BA 4NZ9A 4R3NA 5JCJD 3K5PA 1KS9A 1H0KA 3SJ7A 4LMRA 4ZICA 2Y1EA 3GAZA 3DOCA 2PGLA 4I5EA 1Z73A 4L9RA 3VTFA 5CDUA 4R1NA 3JD3A 3LU1A 3FR7A 3OHSX 1QYVA 3IQDB 3QRWA 2BI7A 3BMCB 4YJFB 5C7OO 1HWYA 1I3NA 3P2OA 2CFCA 1Z82A 5A03A 3DHNA 3DTYA 3WGIA 4GLLA 3LC1O 3TRIA 4E6PA 5HS4A 1H93A 1W4ZA 4C7JA 3VH4A 4YJGA 4B3JA 2WEKA 1XU7A 3C7AA 3T4EA 3E82A 1WXDA 1UAYA 1WLYA 1BTOA 3L4SO 3IUPA 5U1PA 3H3JA 4BNWA 4DBVO 3HE3A 2O7SA 3F1KA 3ZDFA 1VSUA 1O5IA 4IMPA 2VWHA 3MJSA 5DDIP 1M6HA 4DC0A 1Q1NA 2W4QA 4CUZA 3I6IA 3ST7A 1IPEA 2I6TA 4MKZA 4YR9A 1ZEMA 1Q7CA 1Y8RB 2D8AA 3DAFA 4KUHA 4BNFA 2R2GA 4WCDA 1U4SA 1ZK0A 1U28A 4B7CA 4EGFA 5B4UA 2X0IA 3DOJA 3HDYA 2P9EA 4F6CA 3C1AA 3X2EA 3GPIA 1ENPA 1W73A 3KEQA 2X9VA 3RC7A 1YQGA 3S2FA 1WP4A 2B0JA 2DBVO 2BFMA 3PJDA 1YQDA 2P4HX 2O2YA 4TRJA 4CLXA 1VJ0A 2I66A 3WYBA 4BHTA 1WAMA 4IJVA 2V6BA 3FNEA 3LC2O 4PLFA 1YBAA 1EQUA 1MXFA 1IZ9A 2DUWA 2X6TA 3N74A 4Q3BA 4WOKA 3PHIA 4XEHA 5F21A 3O9ZA 5L4NA 1PGJA 4TRMA 1K0UA 5DOZA 3O03A 3HNPA 5DBGA 4XYMA 4D0RA 3FN4A 1HDZA 2P5UA 1D3AA 4M86A 3LZ6A 2IZZA 1NQAO 3VPGA 3P5SA 4P4NA 5JDIA 2J5QA 3HWRA 2DC1A 4YBZA 4N5MA 4YRDA 3GC6A 3L0DA 2FN7A 1R4NB 2XOXA 3NYWA 1HLPA 5AYVA 1JKIA 4YYZA 1XG5A 2DM6A 1KIFA 4MKRA 3MOIA 3TZHA 3KB6A 3GMSA 3KHUA 2YYYA 2G82A 1CYDA 3DTTA 3NUGA 4MIYA 1BVUA 2ZTVA 4U0JA 3S2GA 5FI3A 4CM4B 2I67A 4GKVA 5JE8A 2JAHA 2H1SA 4FBGA 4YJFA 3WG9A 3KEOA 3ZW8A 3G1UA 1O95A 1YBMA 2TMGA 1XCBA 1YH3A 2O3RA 1U2GA 2PD3A 1I32A 4W9NA 3I9NA 3AY6A 1L7EA 2UYYA 1EDZA 4NH4A 3ZWYA 3RFTA 3I23A 1ZO8A 5CEEA 5G0WA 2EKLA 1M2WA 2VHZA 1SZJG 2VOEA 1PJLA 2OBNA 1ZK1A 2ZQYA 4LCJA 4ZQGA 1YGYA 1U8FO 5TJ9A 3WLEA 1P74A 1PZEA 1P1JA 3JQGA 3T7CA 1FK8A 3O4RA 1YBVA 4KMSA 2B36A 4LSWA 1IOLA 4MVJH 4DYDA 1PR3A 1YB4A 5ICSA 3JQFA 5L40A 2W98A 1JA9A 4TRRA 5IXSA 4TQGA 4WE3A 3WMXA 4EBFA 5BSEA 5KOIA 4CV0A 4FJ0A 4MINA 2HKIA 4P38A 4PLYA 1AN9A 1T2DA 1QLHA 3FF4A 5CAEA 3AI3A 4DQXA 3W4IA 2OXIA 3WFIA 4O1MA 1GPJA 1H9BA 5G2OA 3U9LA 2V65A 4L73A 4BNIA 1R6DA 1WVGA 3D3WA 3WGZA 4BV9A 4GSLA 1JWBB 3WWZA 5A06A 5AXDA 3OMLA 3ROKA 4FGSA 2NV6A 1UP7A 2UAGA 1Q7BA 1QR6A 1ULUA 4R9SA 5DCUA 3PWKA 2B35A 2VT2A 3GN2A 3UW3A 1QG6A 4MJLA 3JQ8B 3ANLA 3DFUA 3AUTA 3GVXA 3IJPA 4RPGA 4MVJE 4BO3A 5I7SA 3AOEA 4UEOA 2PWZA 4YAKA 1IZ0A 1R4NA 2VZ8A 4S1VA 1M67A 2A92A 1CJCA 1NNUA 1DLIA 3LSYA 2X86A 4BO7A 1BGVA 1MV8A 3ETDA 1N1EA 1E0DA 3H5RA 2XAAA 2YV1A 1YRLA 2Y0CA 1NPDA 1Y6JA 5CPFA 4CPDA 2VQ3A 4XB1A 3DB2A 1PGNA 4NJMB 5G4KB 4BS9A 2HAEA 4FB5A 5T8KC 1JDJA 2BRUA 5B37A 2DT5A 3BMQB 3D3EA 5ITVA 3JQ9C 5BNIA 4YAGA 2HMTA 4Q3AA 1XQ6A 4ESOA 1D8AA 3AM3A 3OA0A 4CV3A 1E3EA 1J5PA 5DULA 2HRZA 1B0AA 1E7YA 1ZJZA 2GN4A 2YHIB 1EVJA 4BGEA 2OOSA 1I2ZA 1M75A 4QECA 4BKOA 3UAGA 1LUAA 5A02A 2PKQP 5MGBA 1JVBA 3QP9A 1FJHA 5LCXA 3GG2A 3D4PA 3VVCA 5KVCA 4DYVA 3DZBA 3Q9NA 2A94A 2OUIA 4ZHSA 4WK6A 1KVTA 1ZEJA 3C24A 3ICCA 2H63A 3NAQA 5F5LA 3S55A 5B4VA 3RASA 4PGFA 3NTOA 1XDWA 3BHJA 1YJ8A 3H3FA 1DAOA 3E48A 2EERA 3JYPA 3OJ0A 3RUFA 2PH5A 4IDAA 2V6FA 1E6EA 4J90A 3L6EA 4D45A 4ROSA 2X0NA 4CLEA 3MEQA 4UUPA 3F1LA 2TMDA 5F1PA 4AG3A 5HM8A 1RJWA 4R5HA 2GYYA 3PIIA 3ZCXA 4NK4A 1JKFA 2IZ0A 3OJEA 5I7FA 5JAMA 4DLBA 1UP6A 1W6UA 4YEDA 4LVUA 1PJ4A 4UVGA 5IF3A 4L74A 5L4LA 1BW9B 3H9QA 3SJUA 1SC6A 2IODA 1CERA 2NLOA 2NQ8A 5I8ZA 1E7SA 1NR7A 1NWHA 2WD7A 4XDZA 3PFFA 1GUFA 3Q6IA 1LRLA 1PGQA 4P8RA 1JN0A 4Y6RA 3D7LA 3S2IA 3Q3CA 4GAEA 3JQCA 4HKTA 1CQIA 2VZ0A 4G81A 4ALNA 1KERA 3JQ8A 1GQYA 4TMFA 1K89A 5CDYA 2YJZA 4EDFA 3PDJA 4J4BA 1P9LA 1X7GA 4ALKA 1GZ6A 1BXZA 3E9MA 5T6BA 2DQ4A 5A05A 3V1UA 3BZUA 2UV8A 2CVQA 4NHEA 3GNSA 5DOVA 3SEFA 2FZEA 3ORFA 4F3YA 2Q1UA 4ZRNA 3JCZA 2VHXA 3A06A 3PHGA 5HWSA 3DZIA 1E3IA 1EBUA 2VRCD 3ONDA 4I9HA 4UVEA 4XCVA 1RM3A 4HV4A 4NJMA 5A5FA 4R41A 4BVAA 3UGKA 5DP2A 4XQ9A 4OYRA 3OQ1A 4AJIA 1BG6A 2FOIA 1NVGA 1ZFNA 2YDXA 3KLPX 2AE2A 4I9NA 2ZYAA 4BKQA 5IN4A 2ZYDA 2OFPA 3QW2A 1PWZA 5A04A 4DIOA 1AGNA 1LLDA 2B69A 3C7DB 1U9JA 1ISFA 2QZZA 4J1TA 1GCUA 2BI8A 4NMHA 4PLWA 4CMKA 3S1LA 1HDYA 3EYWA 2HRBA 4XKJA 1PS8A 1VC2A 2YHIA 1B14A 4JCOA 4PG4A 4CMJA 1GU7A 3KTDA 1HDOA 2ZB7A 4JROA 2BF7A 5TC4A 4N5LA 1GQQA 4DIBA 2ZKLA 5F3RA 1YE3A 4CJXA 3M6IA 5KVSA 1H6CA 2PZLA 2X9GA 7ADHA 1NFQA 4TVBA 4E2XA 1TEHA 1GCOA 3UHAA 1T4BA 2Q45A 2VYND 3H2SA 1ISJA 3NT5A 5JNLA 1NTOA 3DQPA 3UCXA 2Q4EA 2O3QA 1H9AA 2V6GA 4WLOA 3ULKA 4EJMA 5CFZA 3U3XA 3PJGA 1P77A 3K6JA 3GZNB 1V0JA 4RLSA 1Q0LA 5AQ1A 3AUUA 3UOGA 3W4JA 4K6FA 4EITA 5F5NA 1PSDA 3DR3A 2Y93A 5JMWA 4LK3A 1IYZA 1E1NA 1N1GA 4MP3A 3VH3A 3RCBA 1R0SA 3CMMA 3NX4A 3GEMA 3GT0A 1A9YA 2C5AA 2J3HA 2I9PA 4MVJP 3GOHA 1UXHA 1CIVA 4LGVA 3VZRA 3WYEA 4AL4A 1BDMA 5JDIC 2O48X 4WGGA 2PK3A 4IS3A 5CDTA 3LT2A 4AJ2A 4BB5A 4KUGA 2FMUA 3IKVA 4Y6SA 1JTVA 4YT4A 1W8DA 1E5LA 1MG5A 2VTEA 1NFFA 3MWEB 4ONEA 1NFRA 1HE5A 5I9MA 3PTZA 1I3LA 7MDHA 3L07A 1O89A 2GERA 2IXBA 4ALIA 4KZPA 3DAPA 4RGBA 3PJFA 5H82A 1JAXA 1LX6A 1N7HA 3DXFA 3D0OA 1RM5A 4OXKA 2AQIA 3U5TA 2DLDA 2ZQZA 3UXYA 5G0SA 4IIUA 5K6AA 4TKLA 3PQDA 3JQ7B 1U7TA 3UKOA 2GCGA 2Z1NA 5CDSA 4R01A 1DO8A 1ZSYA 3KYDA 4PZDA 2NU8A 5JS6A 4K9DA 4MVJF 2I99A 1LDNA 1GFSA 4OOEA 5G0UA 1I24A 4W9NC 1NPTO 1A9ZA 2BFOA 4EZBA 2Y0EA 4B7UA 1M6WA 2NADA 4K28A 1QV6A 4W6ZA 3WLFA 4EEXA 1IHYA 2IDZA 3DHEA 3FSRA 5ENDA 4IS2A 4Z9FA 4OIMA 4FS3A 3JSAA 5A9RA 3OQBA 4FGWA 5DZSA 4S3MA 1WPQA 1ZSVA 2GSDA 4XYEA 5JO0A 3ZU4A 1EVZA 2P9CA 2PKQO 4DPKA 4ALLA 1RPNA 4DC1A 4K26A 2CUKA 3HN7A 1XWFA 3BTSA 3LDHA 4L75A 4FC6A 3F46A 3JQFC 5JBIA 2FPPA 4YQZA 4OKNA 3RBXA 1N9GA 3QIVA 3H5AA 4YDRA 4BMSA 2P4QA 3ZWVA 1P0CA 1R4MB 3PHJA 4XD2A 4ZQEA 1BHSA 2F1KA 2HCTA 3NV9A 4BO6A 3TQHA 2WE8A 2HMUA 1I33A 4O6VA 4E5NA 4HADA 4F45A 3EW7A 4JBHA 1YL6A 4IMRA 4YWJA 3FR8A 4IQGA 1Y9EA 3K2BA 3ZNOA 3ZWMA 4B4UA 4DPMA 2YHUA 4J2HA 1T2AA 1C0PA 2ZB8A 3CXRA 4OO3A 4JJFA 1HLDA 1QYXA 4Q3NA 4MVJM 4XIJA 3TZCA 1ENOA 1ADCA 3AOEC 4EJ0A 4J9VA 4W7HA 1HE3A 4LRSB 2H6EA 3MOGA 2Q1WA 4F6LA 4AJ4A 1NQ5A 4LCEA 4NFSA 2FR1A 1AUPA 3ROMA 4DMLA 5TIIA 3HJAA 3A28A 2PNFA 1P45A 3L9XA 2C5EA 2FR8A 4TSKA 1MGOA 1DIRA 2D0IA 1V8BA 4BKUA 1G0NA 4RQUA 4M49A 3RKUA 3E8XA 4AJNA 3KSUA 4ND5A 3IP1A 5BSHA 1NQOA 2Z95A 3WTBA 5GY7A 3DZHA 3WGYA 4D0SA 2VOJA 4EUFA 3I9JA 4J1QA 3BYZA 1HYEA 3ZW9A 1R66A 4J91A 4M54A 2Q50A 5B4TA 4A0SA 3U4IA 4GKBA 3OEWA 1PQWA 1AXEA 1PTJA 2DBQA 4NU5A 1K5HA 3EK2A 3WGHA 5IAAA 5IDXA 1GL3A 3Q1LA 3OSUA 2OP1A 3TJRA 4N5NA 2AXQA 1U3VA 3CSDA 4II3A 2E37A 3B6ZA 5EN4A 2G0TA 1B2LA 4MKXA 1GUYA 3GK3A 1VLLA 1KVRA 3C7CB 3KLMX 3R3SA 4G5HA 1ADGA 4CV1A 1ISGA 3PZBA 3BMOA 5AXBA 2CVOA 5A9SB 4TKMA 4KP7A 4YCAA 3PPIA 1ISMA 2GN9A 2O4CA 2EF1A 3UVEA 3MWDB 3ZZNA 5JAIA 4LVCA 1GADO 1PL6A 3M2PA 4R54A 2WSBA 1DB3A 5JPIA 3TFOA 2OGUA 4WOJA 2FSSA 3GDOA 2CD9A 3TOZA 3WGTA 5TRTA 3ANNA 1UDBA 2NU9A 1D1TA 1KY5A 1WWKA 2BLLA 4L76A 4O0LA 1QSGA 1NX6A 3OIGA 3WFJA 1IUKA 3NGLA 2OHXA 1DOHA 1AXGA 5EMHA 3Q11A 1RKXA 2EP7A 3V1TC 4RPKA 3HB5X 4DQUA 1Y9AA 2Q4BA 3LF1A 1LRJA 5JAQA 4E4YA 1TXGA 4R51A 5JLAA 3MJCA 5KCZA 3WDSA 3BTOA 2ZTLA 3JQEA 3RWBA 5JCXA 2NVBA 3ASUA 3PJEA 3GEDA 1F0YA 4XYBA 1DJQA 3V1YA 2WDZA 3GEGA 4RF4A 4UVHA 3QWIA 1H6AA 1WNTA 5F1OA 3CUKA 2G76A 2PGJA 1I30A 2AQKA 4J7CA 4P4GA 1DEHA 1ZMOA 3IP3A 5I7EA 2FHSA 5KJEA 1A7AA 3KXDA 2JD1A 3VVBA 3I52A 3ZWNA 2AEJA 5G4LA 1ZSNA 3BHMA 2JCVA 2V6MA 4A5OA 3LT1A 4OSPA 4DREA 2IEBA 4XRGA 3ZWWA 3JQGB 1T24A 3VDRA 4HUJA 1MA0A 4BKRA 4WECA 2VRBA 2PTGA 2CDCA 3BMNA 4LMPA 1U5AA 5A9SA 2C2YA 2XPCA 2AHRA 4XQCA 3WQRA 4JQCA 4DBZA 4HX5A 4R4JA 3H6KA 2GZ3A 5J23A 4B4OA 4FFOA 3DZJA 3VPSA 2WYVA 4BNTA 4PG6A 4MO2A 4R68A 1Y8QB 5EL0A 1X7HA 4ZU3A 4B4VA 1C14A 3OBBA 3Q0EA 1B8UA 3GMDA 3JYNA 3I4FA 3GPDG 4WCFA 3NDIA 3PXXA 4W82A 3ZWAA 3ON5A 5B12A 2J3KA 3D3WB 1EFKA 1UR5A 5AOVA 1EMDA 1YONA 1E7MA 1PS0A 4TZTA 1XU9A 3DBHA 4E5MA 3W8EA 1U3WA 3OJFA 4CQMA 2ZCVA 4DL9A 5DP1A 3ZH2A 1A7KA 1G1AA 5T57A 3GVPA 2FY8A 4FFPA 2QRKA 2ZCUA 3KYCB 2EV9A 1F06A 2Q1SA 3L4BC 4OAQA 1DFIA 5K6AC 1SEVA 1FF9A 1KC1A 1I5RA 3O26A 2Q49A 3ZU5A 2V7PA 5FWNA 2IYPA 2X5OA 3BAZA 1P1RA 1DBVO 1LRKA 1P1HA 3QHAA 4KQXA 3IKTA 3R1IA 2CVZA 2OORA 1TLTA 1V35A 1I2CA 2NQTA 4JBGA 3PFWO 2GO1A 4BNXA 4TVOA 1D4FA 4R16A 1V9LA 4IDDA 5BNFA 4AFNA 4D42A 5ES3A 4ALMA 1VRWA 3UN1A 5LDHA 4NFYA 4NQZA 3U4CA 1QKIA 4E12A 5IJZA 4J1SA 1NPYA 2ZIZA 1MP0A 3LLSA 1YOVB 1X0XA 3W8DA 2Q1TA 3PK0A 5DN9A 3V2GA 1B3RA 1WDLA 1PQPA 3OF2A 2FSVA 4H15A 4WLFA 2Q2WA 1FDTA 4BL5A 3RFXA 4WLVA 4BNMA 3ZWPA 1EVYA 5ITWA 4CODB 1UJMA 1UXJA 3CEAA 4ITUA 4L8VA 1UDCA 1TT5A 4PCVA 4EUEA 2VT3A 1B3BA 4IDCA 3EZYA 5C7IO 1DHRA 4DIFA 5JO9A 4RL6A 4BV8A 4J4TA 1PIWA 3IUSA 2I76A 5HS6A 3O8QB 1MUUA 1X1TA 4DQVA 3D4OA 4Q9NA 4G2NA 4C4OA 1AE1A 1SNYA 2PFGA 1XHLA 3CTMA 3M1LA 4IZHA 2EGGA 3AFMA 3D1LA 4HWKA 5TS3A 3WGGA 1ZXBA 5GZ6A 3I9MA 3COSA 2IRWA 1BXKA 1UZMA 4Q3CA 1GYRA 1DFGA 3DO5A 1LTHR 1PL8A 1E7QA 1GDHA 1XIVA 3GNTA 2D4AA 3DBLB 5JCJA 5HTOA 1Y8QA 3GY0A 3KYBA 3W1VA 3TZKA 3TWOA 4L4XA 4YRAA 2O4UX 2HMVA 1ADFA 4AJHA 4WNCA 4PG7A 2DTXA 2DU8A 2QG4A 2WD7B 5FF9A 2GN6A 2H5LA 3EDMA 1T4DA 2HSDA 2R00A 3RBVA 2DKNA 4WUVA 1H94A 1F8GA 4BGUA 4GI2A 4RPLA 4A7PA 2LDBA 1U5CA 2YV3A 3ADPA 3PQFA 3RC9A 1MFZA 2SCUA 4GMGA 4MPDA 3W6UA 2JFHA 3JQAD 4U6QA 1WZEA 1E3LA 3CE6A 3PZRA 3KYCA 3VKVA 1JAYA 1LQTA 3V2HA 4J2OA 1I2BA 1ZK2A 3DZKA 1MC5A 3JD4A 4B8WA 1LDMA 4NBVA 2G1UA 4RCVA 3UICA 1R0KA 3ZV6A 4WASA 3H65A 2EHDA 1XQ1A 2NM0A 2BKAA 3AWDA 1KVUA 3G1TA 3RC2A 4J0EA 1BRMA 1WDKA 4H3VA 3KSZO 3PDUA 4ND3A 5F1KA 4INAA 4IQ0A 4DLLA 4F46A 1VJ1A 3TOXA 2J5RA 4BNUA 4Z0HO 3JYQA 4CM3A 3FPCA 2GZ1A 3IS3A 4EEZA 1CEQA 4RVUA 3RBZA 1Y1PA 3OETA 3WR5A 2I3GA 2D5AA 4JLWA 2X5KO 4Y67A 1YOVA 1O0SA 1Z74A 3DWFA 2RBEA 1SEPA 1SOVA 2OZPA 4EJ6A 2YUTA 2WM3A 1X15A 4NIMA 1NQTA 1BVRA 4WEOA 5AXCA 1MX3A 4CM1A 4H7PA 1MB4A 1NXQA 1SOWA 2W2KB 4BO9A 2E4AA 5EPOA 3M2TA 3OJLA 3DZFA 4LSMA 4BNYA 3GZ4A 4IDBA 4QUKA 2VN8A 3BTUA 4O5OA 3FWNA 2Q2VA 2VHYA 2UUPA 1OBFO 4YB8A 1XELA 3EY4A 5ILOA 1X1EA 3AFNA 2VYVD 4FN4A 2O50A 3E6AA 4Z0PA 3O8QA 2Y05A 1DHTA 3AOGA 3TZ6A 2P9GA 1WMBA 3K30A 4R5MA 5TT0A 4ZA2A 1SO8A 3GUYA 2Y1GA 1LSSA 1KEVA 3WXBA 1PJ3A 4FW8A 4RZHA 1Z45A 1LSUA 5TSDA 3VH2A 2JHGA 1E1KA 2UDPA 3DBLA 3TFQA 1LLCA 1KVQA 4Z6KA 1C1DA 2ZK7A 4G65A 3RQSA 4DXHA 4E32A 4PG8A 1FXSA 4W4TA 4OL9A 2EG9A 3B1JA 2YV2A 5ADHA 3UF0A 2B37A 3DONA 3JD2A 3GAFA 4M89A 2P91A 5HA5A 1R37A 2BGMA 2LDXA 1ZNQO 1SCUA 4PVDA 3GN1A 4HP8A 2EW8A 5T64A 4QO8A 3AM5A 3H2ZA 4I08A 1R0LA 1OC4A 1TA4A 4MIOA 4XJSA 4YT8A 2ZYGA 3OICA 5TF4A 2EJVA 4EW6A 4A03A 4DTIA 3HSKA 4RF2A 3GGOA 3RUHA 4B3IA 2Y0DA 4EI2A 3GA0A 3KYDB 1IY8A 3FRJA 5A3JA 1R16A 2BHLA 4XB2A 3PVZA 2J6IA 3JV7A 2JFGA 1U1IA 2OL4A 3CMCO 4OMUA 1D7OA 2RHCA 2GUGA 4JN6B 3JQBA 5LDGA 2C20A 4QXMA 1I3KA 4A26A 4CM9D 3GR6A 3E9QA 4QT0A 4HNHA 4IJUA 3ITKA 4J4HA 2Y66A 2DAPA 1HSOA 5AVOA 1HDXA 3JYOA 3K92A 3PHLA 3TL2A 2BFPA 4D43A 3KZVA 1GR0A 2VWPA 3AY7A 4BNKA 1NP3A 4IY1A 5THKA 1E6WA 2HK8A 1A72A 1C0IA 2Z1MA 2JD0A 1ONOA 3I6QA 2QYSA 3MCVA 3UCFA 1WDMA 4ZRMA 3VPFA 3PGJA 4BUCA 4CMIB 1ZBQA 4OQYA 1A4UA 2FPGA 3LK7A 3V5NA 1F12A 2W2KA 1UXGA 1IE3A 5HRUA 3IJRA 1N9GB 2DFVA 2QYTA 1NBOA 3DHYA 4HY3A 2JCYA 2IE0A 2JHFA 3QVOA 2GPTA 1VE9A 3SLGA 2AA3A 1HZJA 4Y8VA 4A10A 4CLRB 2YFHA 4KWIA 2RAFA 3GRKA 5JMPA 1ZZEA 2Y67A 3OP4A 4AJLA 3DZGA 2YY7A 4FDAA 4J9UE 4WCFC 3ZHBA 2D59A 1EEHA 5DBFA 3ETEA 2VNSA 5KJCA 1VM6A 4MP8A 1ZMTA 3WIEA 2DFDA 4CMHA 3KETA 2QQ5A 4XIYA 4GX1A 5ER9A 5CEJA 4FFMA 3E9NA 4I5DA 2Y1FA 4YPOA 1HF3A 4JNKA 3K2EA 3HFSA 3F4LA 1U8XX 4Z3KA 1EUCA 4HFJA 1NWCA 2EKQA 3V2UA 1N7GA 3W4KA 2E49A 3MZ0A 4LN1A 1BMDA 1HE4A 1ORRA 4XQEA 2YQ4A 3AY3A 3NTRA 4NBWA 1B8PA 4GX2A 2BGKA 2GLXA 4D3FA 4XGKA 4I5FA 4D44A 1UZNA 4AJEA 5DCYA 3HDQA 1HXHA 4JBIA 4IBOA 3KOUA 4YAEA 3GFBA 1ENZA 5H81A 3LT4A 2J3JA 4CM8A 1BWSA 1HKUA 1C1XA 3FTPA 3NRCA 1UXKA 4IIVA 3E5MA 5IFLA 3L4BA 3ZHZA 2B4RO 5L51A 2RHRA 4HFNA 2DBZA 2ILTA 2C59A 1MFPA 1Z7EA 1GEEA 5GZ1A 3WSVA 3TSCA 2JAPA 3D64A 1PZFA 3PP8A 4FFNA 4FPXA 3DMYA 6ADHA 2QRJA 1T2FA 2OBYA 1RWBA 3N7UA 5T5QA 3WBBA 2QZ9A 4DPLA 3GRPA 3OQ6A 4CLOB 2PV7A 1LU9A 1YL5A 5A9TA 3U4DA 3ZU3A 2CDAA 3GDGA 4BOYA 3WICA 4J1NA 5C37A 3VOSA 1B26A 4WLEA 1T2EA 1QYDA 1QYCA 1VSVA 4RDIA 2A9FA 3RD5A 1VKOA 3Q2KA 4CMIA 4JK3A 3KVOA 3GNQA 1A71A 3BMOB 1TT7A 5ER6A 5IDQA 3RU7A 5L3ZA 3BHIA 1BSVA 2AQHA 3I1JA 3QJ5A 3LLVA 4CMCA 3FNHA 1O6ZA 2VTDA 5JDCA 1Y5RA 3ANMA 3HN2A 4RV9A 2J8ZA 4PN3A 1EE9A 4O59O 1A27A 1N92A 2P5YA 5JW6A 4CLRA 4MIEA 1WW8A 2HMSA 3IL2A 4Y6PA 2IZ1A 3QVXA 2AE1A 1X13A 2Q3EA 1VKNA 2NWQA 3G3EA 1AHHA 1O94A 1EFLA 1K6IA 1V3VA 5THQA 2CNBA 1VJTA 3X2FA 3DBRB 2B5WA 4ZQHA 2GNAA 1E3JA 1N8KA 2EKPA 1C0LA 3ZWBA 1XA0A 1IB6A 1PJCA 2R00C 2W2LA 3R0IA 4BQRA 2JKVA 4GL4A 3VKUA 4E5KA 4YAIA 2HUNA 3NEPX 3GFGA 3ZNNA 1T26A 1PZHA 2NU6A 2VRCA 4GWKA 4RORA 1F8FA 3VAZA 1L1FA 5L7TA 1PEDA 1HETA 3GVIA 5BQFA 4WKGA 3CINA 2B4TO 1Y5MA 3RUDA 3IMFA 4J6FA 2XF8A 4IDGA 4R3WA 1CF2O 1G0OA 1Y81A 1I8TA 3F47A 1KBZA 1FDVA 1Q2XA 1Q7GA 1XSEA 3I4CA 4UEJA 3ZNPA 1NAIA 4BNZA 4JP2A 3IIEA 3LF2A 4XYLA 1I36A 1EZ4A 4L4RA 3NDJA 4LISA 4AVYA 4ND4A 1DPGA 1LDGA 1LBEA 3ETGA 4YT5A
chains in the Genus database with same CATH superfamily
4PCLA 1UWCA 2OV4A 4IDQA 2HFJA 5DK4A 1VG8A 2AFIA 4NOKA 5EZ6B 4EHNA 1OB2A 4B79A 5C34B 3SIXA 3K8ZA 4I6GA 2FZWA 1SVKA 1EAMA 1ST3A 3DVLA 3EIUA 2YXEA 2B8JA 4XA8A 3ERCA 1E2GA 3RAEC 3VYVA 3ZIDA 1T91A 1SAYA 2EIHA 1FVOA 3KSMA 4GP6A 4RPHA 1A4IA 1L5KA 3C0KA 1EGQA 3CN7A 5BYAA 1ZM4A 4US2R 5I9LA 3EFOB 4HD8A 1J25A 4WNAA 3T3NA 3MMPA 4AWBA 2B5OA 2JLQA 2KS6A 3OFJA 4I1VA 1MGPA 4POAA 4AAYA 1JMVA 1ORWA 3IPAA 1Y4SA 1E2EA 1SJ9A 1P4JA 2P62A 4V0OA 3PKZA 1NIPA 2QVBA 4FOTA 2JH8A 2WIAA 2AYYA 3L9WA 3U9TA 2BMJA 1DEAA 3W8RA 1OD6A 3CVXA 4Q1FA 4DLWA 4E13A 3H97A 4MSUA 3VRHA 2DETA 2F9LA 4LX8A 2VWQA 3K9WA 5ESWA 2NXNA 2YICA 2G6TA 5AQEA 2YIJA 5E1BA 1K8RA 3EIFA 3LQFA 1Z16A 4RL4A 5H70A 2IBTA 3NVKI 2IHYA 2QSUA 5EZYF 1ZRHA 2NZYA 4MHSA 4I2NA 1JHQA 3H05A 5D8DA 3EVFA 2FCRA 3EVCA 4BNHA 3N3BC 2QROA 1GTVA 3ER8A 2I5PO 1T9AA 1ZRNA 2QE6A 2DFTA 3LRTA 3ZV7A 1FS5A 4KX3A 3ITDA 2CHUA 3Q15C 3C8DA 4RD3A 3ZHQA 2D1YA 3C6XA 3VZPA 3E5HA 4Q3EA 3FJOA 4TL9A 2ZUVA 3INGA 4FXOA 4WCFB 8MHTA 4HCJA 1V6SA 5BUZA 1YKSA 3H2IA 5GP1A 2W6JA 3L1HA 4CKBA 3RAJA 1NQXA 3H3XA 3M81A 1PGOA 3PGMA 1Q0QA 3F7MA 3FPAA 3PLNA 3W9BA 3T9AA 3F5SA 3QVTA 2A3RA 3KWLA 3O95A 4G26A 5I5EA 3B7PA 3DBHB 4DUYB 1HGXA 2W83A 2WM2A 4U5QA 1RLIA 2HU8A 2HMYB 5AKEA 1AIPA 2HF7A 3PXEA 1L7NA 1F1BA 4LXXA 2ORYA 4H7EA 2VO1A 2WJVA 2Y92A 1BKYA 1DQZA 1ZXLA 2RGRA 5AD1A 1M6YA 3H9JA 1RLTA 4PHCA 4A1OA 1QH1A 2ENWA 2WUDA 1UPFA 1J5EB 4IXWA 4PFJA 2HIGA 3GA5A 4BECA 3ZDQA 2BZ0A 2KX7A 3MBKA 2HJSA 2RBGA 4GQBA 2H31A 3OA2A 1C30A 1W0CA 4FOPA 3DFZA 3DWIA 2FPIA 4DV7B 2YY6A 4O63O 3T7IA 4URYR 2BFFB 3KEGA 3NM5A 4MRMB 3R0ZA 3PIDA 4NV3A 3I76A 3UWDA 2AIRA 2QXUA 4WLNA 1CUSA 1KYIA 1X9IA 5GIPE 4BMCA 3SOPA 4OY3A 4YJHB 5BYBA 2Q99A 4KDEA 4DMFA 1AKNA 2BM1A 2RG1A 2FMXA 1IPFA 3F6CA 4N5DA 5C3UA 3AR7A 5JSZB 3DHWC 1DC5A 1EUYA 3A6KA 1TCUA 2Z57A 1JQBA 2WAXA 1MC8A 3U7FB 1WRBA 2YQ5A 2AKAB 3HVHA 2Q5OA 4Z51A 5IYZA 2PXAA 4JENA 4XGQA 2WD8A 4E5DA 4AICA 3M5DA 1IBLB 2X22A 4IMJB 4N65A 2VP9A 3R09A 1OAAA 2D5CA 1UBRS 1Z62A 2MOKA 3KTAA 4AZVA 3T0IA 3BJMA 3C41J 5EESA 1QGYA 1UMCA 2A3NA 3BK1A 4UU7A 1JKJA 3E58A 3A1FA 5TQVA 3VA7A 1TT5B 3L01A 3OJXA 4LJ4A 2RI0A 3H8JA 5AM4A 1FFBA 4OXXA 4PYMA 5JNVA 1WSBA 4B3MB 3I9V1 1SC4A 4D1YA 3AKZA 1N2JA 5A3VA 3G89A 4S0XA 1JHUA 4UUNA 5EXXA 3ZY2A 2ZSIA 4M0KA 4DVJA 2E4VA 1G9TA 2DEUA 2Z3WA 4WCVA 1P2BA 3W5SA 2DG2A 2QUIA 3EVEA 5DYTA 1JR3D 1VMEA 3OECA 3HKBB 5JFOA 1HYHA 1JHXA 1RM4A 3DAGA 2VDQB 2UUCB 2DHQA 4HGOA 3GLQA 2O1EA 1BD3A 2B5VA 1PSZA 2BEKA 2CJFA 3DL2A 1BXGB 1D2GA 1V37A 4OJMX 1FYWA 1GAEO 5DF1A 2PKRA 2FWNA 3HVIA 4PX3A 5A4KA 1ZVQA 1OZ0A 4BLVA 1G3MA 2J5XA 5GM1A 4Z4CA 2J4FA 1CUIA 2PDAA 5DYIA 4GGPA 4MUNA 1P4SA 3VZQA 1A9XA 4OF4A 2FE1A 4YRKA 1D2RA 2QTVA 1FS4A 1UBKS 3FNFA 3EWNA 3KT8A 3V48A 3ZCSA 3U1BA 2J5KA 2QIPA 4KJXA 4Y7DA 2JFYA 5DK6A 4GECA 2XVXA 1J1IA 1G4HA 4UCQA 3ODGA 3O9MA 4KTTE 3WX0A 3AHFA 3TTXA 5JRJA 2Q3LA 2ZIXA 4J3FA 5TPZD 4MGZR 1FC0A 2VRWA 3ROPA 5HOQA 1JG2A 1P1FA 3PDHA 3PGXA 4P5EA 2DECA 4LA4A 2I6UA 4IJ6A 3NG1A 4ZJUA 3T7EA 4WEQA 1J7KA 1HEYA 1VE6A 4Q24A 4XDHA 1Z5NA 3D81A 3TTWA 2HWUA 5JI3E 3V80A 1X9HA 4YQEA 5A6SB 3QE9Y 1H6DA 1O7JA 1MQAA 1PR6A 2AWOA 1Q0UA 4AURA 1EWYA 1PS9A 2YFQA 3HDTA 2F1HA 3V4OA 3S1SA 1FFGA 1MZPA 5CFRA 1T2CA 4DRXA 2XVMA 3R5KA 4X93A 1JFSA 2ZI6A 4M0EA 2WINI 4E1BA 3JQDA 4WW0A 4UUMA 4BIIA 3FUUA 3SC6A 2C7VA 2QNBA 2JPDA 2W6QA 3BWVA 4EX7A 2JCXA 3B78A 1E59A 2DFNA 3HFRA 3VO9A 1MV5A 2DMRA 2NUAA 2XLCA 1CP2A 2F7SA 3PDIB 1P33A 3I2YX 3IIIA 3NJ8A 1CR1A 2YCBA 5DI3B 1S9DA 1UBCA 4Q4AA 1T36A 2NVUB 4DLAA 3VZBA 4XJVA 2ZGVA 1L4HA 4JBLA 3ZVKA 4YMTA 4UASA 4EW2A 4MW6A 3E1KA 6GPBA 4M1QA 4L5YA 2HV9A 3EXIA 2HMWA 4U6SA 2J9ZB 5AK3A 3V97A 1P3DA 1IQRA 2VNJA 3MBOA 1I7SB 3EAGA 3ONFA 1GILA 3GEHA 1Q0TA 1RI1A 1L5YA 1PWYE 3MJVA 3IAXA 4H16A 2WPDA 2EJWA 4NHOA 2AMJA 4IIDA 1YB5A 3G2KA 2SBTA 2GCIA 2XX3A 1OOEA 3AONB 2NYUA 1ECBA 1UPAA 3JALA 3QE3A 3BMCA 4HX9A 5JROA 3KQSA 4LYDA 2C4TA 4C0QC 3F73A 2FEAA 1XVUA 2WG1A 3PQ7A 3U09A 5IDYA 2YVUA 3MFQA 4XM0A 1BS9A 2P27A 1QKJA 2RGNA 3B89A 3HKEB 5TPWB 3K73O 3EBOA 2VUUA 1SG9A 1Z5GA 4F2GA 1N2BA 5KWSA 3DEZA 5BPHA 1RAGA 4ATNA 4C0AC 2J3LA 4NR0A 3UCEA 2DZDA 3ETJA 5ALOA 2WWHA 4V38A 2ZRQA 4CMGA 3KT6A 4CKEB 2CLSA 2R7LA 3MRXA 1HTBA 1OW3B 2DUMA 3R5TA 1NVMB 4G5GA 4QQ8A 5AJTA 1O94C 3EFBA 3QBEA 4I50B 2JZNA 3B51X 5EAIA 4BMVA 4M6WA 5K8UA 4AKIA 2CJWA 4BGVA 4NEHB 3MYRA 3EUFA 5JYDA 1IHOA 3OEHA 2GPBA 3DVSX 4RY9A 1WUYA 2DVMA 3C6QA 4QHSA 5CYOA 3NOXA 1PN3A 2HHAA 3PCXA 4FT4A 3RUPA 5EXEA 4BPRA 4DA9A 4N6GA 3LBIA 4E07A 2BCGY 4M0FA 1OXTA 4DQDA 2VPTA 3ZQ6A 4X44A 1X8XA 4W63A 2JH9A 1I0LA 2JIDA 3BIWA 3H2BA 1T3ZA 4IKOA 5DRYA 5F9MA 3S8EA 3R9WA 3ABZA 1S3GA 3GCXA 3EPLA 3BRWD 3G49A 2C8VA 1W30A 1YDWA 3NKVA 4GUDA 4TS3A 3TMYA 5NULA 3X1WA 3A1DA 4D3SA 3HDJA 3G8YA 1SCUB 1UWKA 4YH1A 5FPHA 4W99A 4JHLA 4KR7A 4JI5B 4B2LA 2AVDA 1QF7A 4RFVA 3GG9A 5IFKA 3SZRA 1KI9A 4Z4IA 4N54A 1MTZA 4B73A 3REQB 1QFMA 3TPFA 5DNAA 4G0VA 8LDHA 3GLGE 5JJKA 1X14A 1EG7A 1ELOA 2YNMA 3CB2A 3EPPA 1LQUA 1E4EA 3CNOA 1BVHA 4CMEA 2JA1A 1AHIA 2AHOA 3DQQA 3OIWA 3QG5A 4JJ7A 3GYGA 4L02A 4U0KA 1YDEA 3PU6A 3JTMA 1ULBA 2BFBA 3PGLA 3DPSA 1GD1O 1OZFA 3UUWA 3MN1A 4OHVA 2J30A 3K2QA 1QQBA 3OCZA 4IDFA 1NNI1 3K0AB 5BW5A 2YJGA 1J8FA 1FLVA 1N1MA 2AF4C 3ES9A 4XZ3A 4YBRA 4JGGA 3O1JC 1IUPA 3O93A 1EP9A 4CM6A 2N9UA 3VJKA 3V8PA 1Z83A 2GFQA 3C7TA 4KDCA 3PICA 5JQWA 5I01A 1QV9A 4NFHA 5JS1A 2HLDA 2AW5A 1NHWA 2RIRA 4DDKA 2GDZA 3EMBA 5A5VA 1RZRD 3HADA 4Y1RA 5IJWA 2ECPA 4FNOA 3HBMA 1AKYA 3W6PA 3L4JA 3QUAA 4IFTA 1Z3CA 4GQAA 5I9BA 2VSFA 3EEBA 4IHQA 4P6VF 3LL7A 4UU0A 4HNGA 3WDLA 1QPGA 2GD1O 5BNZA 2XWJI 4KIWA 1MW9X 4CM4A 4YP9A 1R0RE 3A04A 4FE4A 2RD2A 1JB1A 2EP5A 5IK2A 2TRSB 2EZUA 1OJLA 4NDNE 5CXXA 1BEUB 3DYBA 3FPEA 1KEPA 2PEYA 4LAFA 3HO6A 3FSGA 1XZJA 3VHRA 1BO6A 2ZJBA 5FCDA 4D4IA 1IZ7A 1YB1A 4JGBA 3SEAA 4CR8A 5DN6D 4ZI5A 3O4VA 4KSCA 4REOA 5FUBA 3FDZB 5C3MA 2O8EA 2VPXA 4TTAA 3WIBA 4CQJA 3CJRA 1L5ZA 3KUXA 1JJVA 4NBTA 1J0XO 4Y2TA 4OX9B 3H4VA 3L8MA 3N2ZB 1EXWA 1R15A 2R6CA 3D5EA 3LY7A 4LC1A 3ELYA 4K1LA 4OLBA 1QGZA 1RKQA 3UGJA 3DO6A 2AQ8A 2EYQA 4F96A 3VAYA 5JXWA 3ADBA 4G9BA 1DC6A 3W5IA 4TYWA 5HKAA 3VXKA 2I2FA 4RVFA 3S4YA 3R7SA 1JDPA 3UIEA 2YTZA 1M1YE 4L72A 3SC2B 4A92A 4WBNA 1XALA 1VJCA 3AV3A 2XRYA 1V2GA 5KUTA 1R6VA 1XI2A 4W5TA 1JIUA 1BROA 1FFSA 1FNDA 1SMKA 3FMFA 4K9OA 4X24A 4G8JA 2PR2A 5FLKA 3CRMA 4RNDB 5K3CA 1SG6A 3RH0A 4TRNA 4KXYA 5B1YA 3GJTA 3MIZA 1O1YA 2FUEA 1VHDA 3RS4A 2P5TB 3GJ8A 1B2RA 4PRZA 4Q39A 4IWYA 1J0EA 1FDWA 4MOWA 3L1JA 1CY0A 5D01A 5AK0A 1Q92A 3AKEA 3L8EA 4ZQFA 2X3UA 1VKRA 2YDYA 2ZE8A 3EG9A 2R1VB 3E22B 4HDNB 2Z83A 4NZOA 3FBTA 4Q82A 3HU3A 2RGBA 5K8VA 4DDVA 3D6TB 3VNBA 2NP7A 3WV4A 3FGOA 1Y3IA 1CR6A 1KYYA 5HILA 2VQSA 4D4KA 5BV0A 1KBQA 1UBMS 3B6IA 1BCSA 2FW9A 2AZDA 5FTMA 2O3TA 3T15A 3UXMA 4KG7A 2P9YA 3DS8A 3U7GA 4A2CA 1G4UR 4KXNA 4PAQA 5BPFA 3L7IA 1Z08A 1LI7A 3DL4A 3C3WA 3FKSD 3M1AA 1W8IA 4LRTB 4DZTA 3RUEA 4U9IS 3DXZA 3RTDA 1ZMBA 2UZ1A 4DS3A 3DB1A 1BC5A 4R31A 4C4ZA 4UM9D 4DZZA 5KZMB 2DR3A 3HWSA 1AVTA 3AY0A 4IDNA 5A5DA 3N58A 1EP2B 3ZQJA 1CNFA 3FDIA 3LHFA 4N4AA 3ABIA 5C7LO 3UMBA 4FNAA 2OLJA 4QDUA 1LY1A 2Q4OA 1WVMA 3L0PA 1HRDA 3DTNA 5FOUA 3DEIA 2RC5A 1Z8DA 3ADOA 3HYSA 4H1TA 5LKRA 3I04M 5KDDA 1F7VA 1RTTA 4YHHB 3T5CA 1JLMA 1G7TA 3IUJA 3EHEA 4MYCA 1B0UA 1N3IA 1J0AA 3LL4A 4O4IB 3RYCB 1CEYA 1NHGA 4DCOA 4OB7A 2IXEA 3V7UA 5D6NA 4KN6A 1E7RA 4M1KA 4UJ3A 5U4QA 4CEIA 4A8HA 4N9WA 5FH9A 2C7GA 4PZPA 4X8OA 3QWFA 1ISSA 3A8TA 2O23A 2AFRA 5BQPA 4B7XA 5DTRA 1PF7E 2MIIA 1LF0A 5FDFA 2VH5R 2J09A 4YYEA 3AK4A 4KQHA 3CCCA 2IXDA 2FRXA 3E3AA 3QEMB 1AJEA 4HBGA 3UV7A 3E2PA 5AW7A 4BNDB 1PHRA 5LWHA 2WMDA 1DJPA 3O82A 4LOAA 4FKMA 5D5PA 3RFCA 3TRJA 5BRAA 2QT9A 1LDBA 4FMPA 2NGRA 2VF4X 2IDJA 2O0LA 3JQAA 4CNBA 3GDFA 1ADBA 1OX6A 1XDSA 1SQFA 1DAPA 2GASA 1TPYA 2Q6VA 3MRVA 5CDFE 1SD1A 3HHPA 4KV9A 1R3DA 2ATCA 1B43A 2ARKA 4IGAA 1VCMA 1PUXA 4H7IA 3VR4H 3TQOA 1P0PA 2WQZA 1K7XB 4ZTBA 1OIXA 3G0IA 3M6MD 4XR4A 5ESRA 3R5JA 5D5QA 5LBTA 5CH5A 3SJCA 1PJTA 4DY6A 2QZJA 2WTXA 3STTA 3D6MA 4EGJA 3IOCA 4ED9A 1THZA 2OCDA 4V0QA 2FFQA 4JR0A 5FJJA 4OAOA 1SRQA 3OVMA 1F17A 1S89A 1P81A 1QRRA 4EY3A 5EWMA 3TUIC 3ZHXA 1TZMA 4JUBA 4DIKA 1ONNA 3GJZA 2HSJA 2JH3A 1Y6QA 2VJAA 3QF4A 1JTFA 8ATCA 1NM5C 2FR0A 3KEMA 3HACA 1I10A 5CK4A 5BN3B 5ECGC 3R74A 5J5CA 3SMQA 1TJNA 1NI3A 2BMWA 2V3WA 3VX4A 1PR1A 3E4DA 3MINA 1R12A 4LJKA 5FFFA 5IN4A 2DX7A 1PW5A 1G18A 3HXLA 2FGJA 3IE1A 2AFIB 3L6OO 3LBAA 3HO8A 1KZ4A 1I6KA 3RJTA 4Q4HA 2IYLD 5HSGA 2OD2A 2VTKA 2NTVA 3WQQA 1XQWA 2MR6A 2OTCA 2VDMB 4KR6A 1HQKA 1BWRA 2O7VA 2VT6A 4MJXA 3TLCA 4QBFA 4YCSA 3KKQA 1Y7HA 1SKYB 4D46A 1XYGA 4G24A 4LZOA 4MWSA 3P9RA 3G88A 4O08A 1PG5A 1XYYA 5KNLA 2JAUA 2J9FA 4X1YA 2PQ2A 1PNOA 4QTUB 1DQSA 3TEJA 2Y1KA 1LJLA 4CDGA 4MI6A 4YIHA 3KAQA 1XP5A 3C15C 1V1JA 4DJDC 1SBYA 4QXPA 3H1BA 1UP4A 3CZPA 1O95C 2BEUB 3QU7A 3IURA 4H7KA 2W4IA 2Q2QA 1ID1A 4K9PA 5FYQA 3RKRA 2F1OA 3VU8A 2PUEA 5C4IA 3G5LA 2FQQA 5LA6A 3E9YA 3K32A 3IAUA 4RBNA 2A58A 4GT1A 1MJGA 4IHAA 2Q6IA 1JYFA 2QENA 2WUVA 3DE7X 2PT6A 3HEBA 3NPMA 4I1RA 4JIGA 4KMOA 4ASUD 2JC3A 4L8WB 3AIKA 4R05A 5IC6A 3DEYX 3KUCA 1CK4A 3G9TA 1GUBA 1W0JA 1RYMA 4QX6A 4XWGA 3BA1A 3TH5A 5LP6A 1VCHA 3PXCX 2UVDA 1P7PA 2EBUA 3ENNA 4HR7A 2VF8A 1USWA 1F6WA 4JUAA 2ROQA 5JAZA 1QHGA 2VSQA 2W22A 3LXUX 1XTVA 3V3KA 3T1YB 3EG5A 3CO5A 5EWLA 3I61A 1XRMA 2C54A 3GA7A 4E33A 4ID9A 3IDFA 4GRIA 4LYJA 4ZZ2A 2ZSHA 1WIWA 3AUAA 4CL8A 5I4BA 3HJFA 3KO8A 3AI1A 2XGGA 4RD0A 2NNLD 3G5TA 2R1ZA 2VUSA 5JZSA 2PD4A 1D1PA 1BNCA 1YS4A 2A5JA 1TE2A 2O3SA 4PGHA 3TIXB 4CKBB 1LDYA 2QGNA 1XFAA 3WYAA 1SQ6A 3K0BA 3ZX4A 3GF4A 1M2NA 4Q3DA 2NU7A 2CEAA 4HF7A 4PLTA 2GYUA 4O2LA 4DUPA 2JFNA 1YJBA 2CBGA 2GKOA 4A8JA 5GIOE 3OQOA 3DW1X 1NE2A 3UHJA 2Q4TA 3ZXSA 4F38A 4OFZA 1GAJA 4Y2HA 5E6RA 3GRRA 4TXHA 3U0VA 1QH1B 4HYQA 4PLZA 4N18A 3K71B 1I0ZA 3KXIA 4CM9A 5I8PA 4BO4A 1JPJA 1GA1A 1W0KA 2JVKA 5LQAA 4MDFA 3IOBA 2OHJA 4ENSA 5CITA 1C30B 3JYLA 4S24A 1OVGA 4BU0A 1L8OA 2FPIB 4QVGA 1NOIA 2E6UX 1RAAA 2VKTA 3B1KA 4BO8A 4XLTA 3A6PC 2PAFA 3EPRA 4B17A 2QRZA 5TMBA 1BYUA 4EVIA 2BEVB 1H2ZA 3QY0A 4GLFA 2NTNA 3CF4A 4L6AA 4D82A 2Y68A 4PN7A 3H86A 1N3BA 1V47A 2BMAA 4DEYA 3P2YA 2Y1WA 1QQ5A 4TLEA 5FPPA 1FP2A 4LKOA 4AQYB 1XAHA 2BGLA 5EMLA 2OGZA 3GFFA 4KO2S 5BSUA 5KYYA 2JBWA 4G86A 3WGOA 3QVMA 2PX2A 3VR6H 1ESMA 3BFVA 3LUHA 1TFRA 2EIXA 4QLAA 1PU2A 2PX0A 3B13B 3EZFA 1IN5A 4Z1OA 1Z4JA 3HJTA 3KQLA 3IDSA 4MCAA 1U0SY 1CX9B 2YQZA 3ELBA 1L4GA 4D9CA 5COAA 3C5EA 3FUXA 4R1UA 2XXBA 1UMCB 1FVFA 2AJTA 4WZAB 1JKJB 3HB7A 1A2QA 2HWYA 3MTBA 1HT0A 2CNWD 2FFHA 1XYVA 3OQMA 4K40A 1OFIA 2C4VA 1YSCA 3F6SA 2O2EA 3MXOA 4QTZA 3VR3A 4D6YA 2PA0A 5B58C 2ZJYA 4ZTUB 4QL3A 3AHHA 4MQ6A 4PZEA 1Y4UA 2WYWA 4FB4A 4C07A 2FZLA 2EEZA 2IXGA 4PICA 1M76A 1NP6A 1SK8A 1VXOA 2GA8A 2CW5A 2PUWA 3IILA 1LDEA 4KIJA 1CB7A 3O4HA 2IY9A 5FA8A 3RAGA 3W6ZA 4AJJA 2A1TS 1YR8A 4E2WA 1E1MA 1UOEA 3HKDA 2X76A 2OBMA 3BXZA 3AM4A 4PXYA 1V6AA 3BTVA 4Z4FA 2ZT8A 3C1OA 4MVWA 3ZNQA 2FPWA 1E2KA 3CLTD 1E79D 2OO5A 2C4NA 5G40A 5EHZA 2Z9BA 3I5XA 4C2AA 1ZWKA 4MDHA 1QCDA 3PQEA 3DBOB 5DHAA 4BNGA 3GLUA 2JLSA 3K2IA 4OGWA 1LA2A 1K5GA 1S6YA 4YAOA 1KOLA 1SHKA 3AJRA 1Z5OA 3GLFA 4G41A 1KH2A 1A9OA 1W4AA 1HSZA 1P5JA 3BA6A 3F98A 1EBFA 2X40A 3PC3A 1I3CA 4POOA 2C0PA 1Q22A 5HQTA 4YMUA 1V96A 2W2TA 3ILSA 4ALJA 2ZIXB 1GTMA 1DIGA 3A3YA 3FTQA 4QSHA 2ZT7A 3PF8A 3B8EA 3VR4D 1W5AA 1HZZC 3PXBA 4B6EA 4CCYA 2NW6A 2RCYA 3WYDA 1ILWA 3GFPA 3V55A 3KQHA 4MDEA 3ZVMA 4B3SB 1KYQA 1YB7A 3BHNA 1GWNA 4KGXA 4AMZA 2Q3MA 2XZPA 2F3RA 2ZU0C 3PX3A 5KX5F 2M6KA 2A9JA 1K2WA 2O9JA 3PFNA 2PZFA 1I7LA 4KU4A 4RZ3A 3KLOA 3BB4A 2R66A 4JHXA 4QQNA 1ZM9A 1GP2A 3CUUA 4X94A 3TRFA 3IT2A 3JZDA 4ZU6X 2JCGA 3AL0C 2B9VA 3RF6A 1YWGO 1EVLA 1EP3B 1OU4A 3IR6A 4ACAA 1EM8A 3TOVA 3JR3A 3N1UA 5PNTA 2ZBGA 3RJ9A 3ZGYA 3TB6A 3T6KA 1V3TA 4ZYZA 4ZCIA 3SR0A 1JE0A 2DLNA 2WJZB 3ED5A 4MR7B 1FBNA 3JWHA 4BN4A 1T9DA 5CLIA 5IKXA 4FFVA 1N5MA 4GKJB 2IP2A 3H9BA 3G23A 3Q4GA 2A1UA 4NV0A 1K3UB 2KYRA 3MTGA 4EJSC 4PNEA 2V1UA 2QD5A 4R3NA 4MW1A 1REQA 4ZVQA 4EUKA 3AR9A 1H0KA 4QUDA 3STUA 5ALIA 3EEOA 3DOCA 3DGEC 4TKZA 4M3NA 4IZOA 5HTKA 4RTLA 2ZXUA 4I5EA 3TW0A 1J2YA 4G36A 1Z73A 2PWPA 3OO0A 4F2HA 1R4AA 5LQRA 5CDUA 4R1NA 3AVQA 1L5WA 3KQPA 4N3BA 4F7DA 5FXMA 3JALB 3NRBA 2RGCA 3DDSA 3BMCB 2OXRA 1WKBA 2HJWA 3ZKAA 1M2KA 5CCEA 3WKDA 2I71A 3CVYA 3RTEA 1W25A 4UPVA 1QHSA 5CW1A 3EXG2 5AJZA 3DTYA 3A6FA 4GLLA 1A9QA 5HS4A 1W4ZA 3L79A 2C5BA 2WKWA 3PPWA 4MR8B 5E1OA 2O2JA 1QR2A 3T5GA 2HDOA 2H7VA 2WEKA 1EX9A 2PZGA 3HLKA 1GG9A 4R9VA 4KRYA 3I01A 5KTOA 5CB0A 3TLMA 1VHJA 5HQ3A 5CYPA 1G8MA 2QD3A 4Q1BA 3GPLA 2O05A 4OP3A 5EIAA 2F48A 1RIIA 1CVLA 1QZUA 2GEVA 4GU5A 5B2FA 1JHOA 4DBVO 4TWIA 4M6WB 5ADVA 6REQB 2CJWB 2VJMB 2FI1A 4K05A 1JIJA 1O5IA 3CX4A 2J32A 4BQIA 1CD5A 2VWHA 2HSEA 1Q12A 2C2MA 4XWAA 1Q1NA 1LV8A 2RGXA 4JYZA 1GTRA 4IOKA 2PE5A 4ZOEA 2XGMA 2D8AA 1Q7CA 2VLBA 1A77A 3DAFA 3MB5A 5AKKA 3W5HA 4BNFA 5HKBA 4WCDA 4EJFA 1ZK0A 1U28A 4JOQA 3C6BA 4EGFA 3BEOA 4DCNA 4RK4A 5B4UA 1LLFA 1L7AA 1E0JA 4DV1B 4F6CA 1JJBA 3DLIA 2FKAA 4U8HA 3X2EA 3FYCA 1DKUA 4LNHA 1D8TA 2XVYA 3T3IA 1JG7A 4BRUA 5EE3A 2R11A 2JEYA 3RC7A 5A2GA 3TLBA 1NJ6A 3MQ4A 2B0JA 3PJDA 2P4HX 2XNCA 1E3DA 2A8YA 3UKJA 5E9QA 2X3YA 3SWWA 1U6IA 2CJXA 2GARA 2PMBA 1ZNWA 2E1PA 1ZG3A 2V6BA 1W1UA 2GRJA 2Y8EA 4NCIA 4OHRA 3LPAA 4ND6A 3ZIUA 3ZHUA 1IZ9A 2Z04A 3PHIA 3O9ZA 1UJNA 4MVXA 2AW3A 1HMPA 4JFRA 5I4IA 3R40A 2BM8A 4XYMA 4KIGA 5H3CA 3FN4A 5LZ2A 2EQ5A 2OAEA 2P5UA 4KXFB 5KNDH 5AK6A 1NQVA 2VK8A 3D6NB 3LZ6A 1BCRA 3SF8A 4D8TA 2IYSA 7MHTA 1MIHA 3NHKA 4QOEA 5FQOA 3P5SA 1KDOA 1DTWA 1DC7A 4JI3B 1CZUA 3V8RA 2EX1A 3IV7A 3TD2A 3WZ2A 5IVKA 4R81A 3P9CA 2B98A 2DC1A 1SVIA 2IUFA 3PCRB 5EUBA 4N5MA 3SGLA 3LX6A 3X44A 2WLTA 5CCXA 1X80A 2JLAA 4OI2A 3VR6D 3ZCRA 5BR4A 4LRWA 1HLPA 5AVVA 1JKIA 3W04A 2DM6A 2C99A 2H59A 3IV6A 4MA0A 4Y1RB 4TL8A 3DEJA 4RHFA 3GJ5A 1H2WA 3KB6A 3UK1A 3W2IA 4JYCA 1M1NA 2FPKA 2J3EA 2LKDA 1G2OA 3NWPA 4MIYA 1BVUA 1TK3A 2EG5A 1FS6A 4LV6A 2ZYVX 2GRUA 3BF8A 4BFYA 4CM4B 3LQYA 4GKVA 4RIFA 1UBGA 2XGSA 2QQ0A 4BVLA 3MF4A 5BWBA 2V1XA 6NULA 3LKBA 3K5HA 4I7EA 5T4FA 4EMTA 2V7TA 2X8AA 3FY4A 4RIIA 3JYHA 4CW7A 5DGCA 1KK2A 2QUJA 5LFAA 4TKUB 5GVRA 1IN6A 1XCBA 2TMGA 1P80A 4DW8A 2UYOA 3FFBA 3SVZA 4JD5A 1ZQ9A 1SZPA 1XVLA 1H23A 1YH3A 1NC3A 1U2GA 1WHTA 4HK4A 1U1DA 4GO1A 4I19A 4P98A 1V8OA 5DXAA 4W9NA 3IA2A 4PC6A 1KAOA 4K88A 2YS6A 3QJGA 3UQZA 5K09A 1A2KC 4L5AA 2WP0A 1EDZA 4NH4A 2G71A 1P91A 1U94A 3AP3A 4C08A 1SCQA 3T1TA 4IHKA 3I23A 1KZYC 1X7XA 1G5PA 1GARA 5AI8A 2EKLA 3CR7A 1M2WA 1SZJG 2VOEA 5KTNA 3MAGA 2O8NA 4S0ZA 1RJGA 3TIFA 5AW3A 1ZRMA 4N0MA 3R9IA 3E0XA 1ESNA 1TZKA 1ZK1A 1QRAA 2EZ8A 3AW8A 5AFSA 1O58A 3N39C 1T4CA 2P9HA 4U02A 4Y0AA 4UHEA 1P1JA 1VI6A 1DDGA 2IPNA 4XLLA 1YBVA 2NZWA 5BXQC 1JLKA 3PSAA 4MUFA 1PR3A 2Z9DA 5FUMA 1Y6FA 4YUWA 1DDIA 1JA9A 1MX9A 2D1SA 2QTMA 2W98A 1M0EA 3TLYA 1E5VA 4DSTA 4LF5B 5KOIA 2XH8A 2MYNA 3GOQA 1MO2A 2QRGA 3AEKB 3BK2A 4MINA 1OLSA 4RGQA 3WLIA 4Q4CA 3KQKA 3QZUA 1FZTA 3EG9B 1QFSA 2HDNB 1J2JA 4QBHA 1IXRC 2I2BA 1E20A 2C9OA 1NBIA 2ON6A 5JQGF 3BD7A 3FF4A 3A2KA 2C1XA 4F8JA 3JVEA 1UZUA 4DQXA 5ALVA 5CM2Z 1UK9A 3A9TA 4ZVRA 3OTWA 4MW5A 1RXUA 4J07A 4I3HA 3WFIA 4PFQA 1GPJA 2XHZA 3UG7A 4GXTA 4M7WA 4QTTB 4PCUA 5I4CA 3TRDA 1Z6GA 3J81k 1N4AA 1OREA 3BGWA 4U9UA 1VCOA 3TDMA 4GMKA 5F51A 4E7OA 3L1VA 4KQ1A 1XPRA 3R23A 3UJ6A 3EB9A 3P9IA 3GLIE 4IZ6A 2NV6A 2HDWA 3O47A 4CXMA 4PYKA 3THXA 2H7XA 1Q7BA 3M4ZA 4R9SA 1E2QA 4FINA 3PWKA 2B35A 3W5CA 3Q7TA 3GN2A 1FX0A 5A2QA 3B3AA 1QG6A 1QO9A 4MJLA 3JQ8B 2IEIA 3VC3A 4BGDA 3IBYA 4DXAA 3O3OB 4P3XA 1EHIA 5LQCA 3R3YA 4P3NA 4MB2A 2GZMA 1NKTA 3DOHA 1TMGE 1M67A 3M7IA 4TYMA 1E5TA 1NNUA 1QG2A 2K2WA 3DVAA 3G5MA 1VFPA 1O8BA 2LVBA 2X86A 1BGVA 1MV8A 2ZBUA 3H5RA 5FWXA 3EQ2A 4JU8A 2XAAA 1X38A 3BXHA 1RYNA 3GEIA 3HBNA 4QYMA 4HUTA 5BN1A 2H0QA 1Y6JA 2QEQA 3A2NA 2XCQA 4MULA 1N0WA 4CEIB 1PGNA 4AK9A 2HAEA 3CTPA 3MGAA 1ZIXA 2A0WA 4YNBA 1YS9A 2HU7A 2XWBF 3D3EA 5LDDC 1JHVA 1L8AA 1B76A 2OK8A 5H4HA 1PNRA 4N39A 4BMPB 3VHXA 5BNIA 2Q7DA 2R7MA 3AG6A 1XTSA 4JJZA 4BJ1A 3AM3A 1P1CA 4K2AA 5KI6A 4H7JA 5EC8A 1J5PA 3FMVA 2OESA 4XQ0A 4OQXA 3AZOA 3DBIA 2VHUA 2UZ4A 1KKMA 1ZJZA 2I8LA 2GN4A 2HLHA 1EVJA 5F77A 1YMQA 1I2ZA 1RJFA 1EFVB 1WE2A 4QECA 4BN0A 5JAPA 1PV4A 1L9XA 1AKUA 1D2NA 5J2TA 4NCJA 3W5JA 3AL2A 4QRDA 5DM2A 3RVMA 5B6PA 3QP9A 2QX6A 4TUYF 5LCXA 1A82A 2AI1A 2YJ5A 2TECE 5K1ZA 1SUDA 1YRAA 1L5MA 3Q9NA 2C2OA 2NZ2A 2ZE7A 1ILEA 4OQEA 4QATA 2OUIA 1UF9A 3SC3A 1QTQA 4HXFB 4WK6A 4WWHA 4ZHSA 3ZWDA 2W2MA 3QHQA 1KVTA 2XCTB 4LF9B 2EJTA 4Q48A 4YXWD 2GXAA 3RASA 2B7LA 1WCV1 1XDWA 3AESB 2HYIC 3FSJX 1QG4A 1DAOA 3X1KA 3KCNA 1L2TA 1IUNA 1KKUA 2IHJA 4PGMA 4YDSA 3T7TA 2EERA 1RHRA 2H29A 3JYPA 5EWMB 4B5KA 2PH5A 3F7TA 3MCUA 2V6FA 3I1FA 3L6EA 4UFOA 3QF4B 3J80A 5F1PA 1XWWA 3KDSE 2Q1XA 2GPAA 3OJEA 3H6HA 1PJRA 2XVZA 2H1CA 4KH1A 4DLTA 3UC9A 1OROA 1KO7A 1XX6A 2XEDA 4LVUA 3CURA 1IJKA 3L43A 2H65A 3OLWA 3ADCA 3WDMA 5JQGA 1DXQA 1SC6A 2XB4A 3OZRA 4RJ2A 2IS4A 2IODA 4Q4HB 5KNDD 2NLOA 1WP9A 1NLUA 2NQ8A 3DNFA 5I8ZA 1E7SA 1NR7A 2G5GX 5AJVB 2XXAA 5J40A 3FFAA 2R6GA 2VAMA 1XNGA 3Q6IA 4B1FA 1UBLS 2L69A 1JN0A 2C3OA 3D7LA 5BOVA 2Q3FA 2WZCA 3IPYA 3LUPA 4RSRA 2XA9A 1DJMA 4X1YB 1NJFA 4GAEA 5AJUA 4WERA 4E4RA 1CQIA 4GR5A 4LXTA 5B57C 5EOVA 4KQ2A 4PHHA 1GQYA 4QAJA 5CVJA 1XZGA 3A4IA 3QU4A 2QG6A 2YJZA 4EDFA 5AHXA 4NOMA 4J4BA 2BGUA 3D54D 1SUIA 3A4YA 3QU5A 4KMMA 4TTIA 3TR5A 2AS0A 4IP0A 2UV8A 1K4KA 3FE2A 4V2UA 4MWGA 2GILA 3IUYA 3WXMA 3QEOA 3FCSB 1F9EA 3U3MA 1YKGA 2FZEA 5JARA 4RKQA 3JCZA 2VHXA 3AZPA 5HWSA 4O5AA 1E3IA 3LYHA 4MUJA 3RLIA 1OXSC 4PQYA 1DV2A 4A3SA 1UKCA 4GWLA 1SBZA 4FUQA 4KAAA 4NJMA 4HV4A 4YV1A 4KHPB 1SVOA 2PQ6A 1EGHA 2RHJA 3TX2A 5CA0F 4OYRA 1AF7A 4H27A 2D1TA 2YVQA 4I9NA 3RSGA 2D06A 3FJYA 5I9IA 2QM0A 3QW2A 2PX8A 1MHTA 1AGNA 3V4LA 2B69A 1H4QA 3OLQA 3OZSA 1ISFA 4DV5B 3MWGA 4J1TA 5HKKA 1D6NA 3BFJA 1HDYA 2NNWB 1EX1A 4RK6A 4G0XA 4XKJA 1PS8A 2DSNA 3TB4A 1B14A 4OXQA 3GGSA 4L0CA 1KIAA 4JROA 4TT3A 1Q15A 4KR0A 1GQQA 4DIBA 2C96A 2ZKLA 1YE3A 1JSZA 2OBFA 4G0QA 1F9AA 2ZSFA 3M6IA 3QKTA 4YFVA 1H6CA 3DD5A 1NFQA 4IXNA 2NU7B 2X19A 1GCOA 1N2OA 2X9LA 2CEKA 1TQHA 2XQVA 3G7UA 1ISJA 2E87A 3C16C 2OPHA 2P9ZA 2V6GA 1H9AA 4WLOA 5F7ZA 1N6PA 3ULKA 4EJMA 3QTBA 5CJ2A 1LTQA 3VUFA 5HMLA 1P77A 5SY4A 3IULA 1OX4A 2ODEA 3SEZA 2VSXA 5DJ5A 1BU8A 3W4JA 4AG6A 4YONB 1NW9B 4MUMA 1XZBA 2WPNA 3G6KA 3KJHA 3KZMA 3QUTA 4KRXA 2FSGA 5B7GA 1U7DA 5JS7A 1PCXA 2QE7A 3KOXA 4LK3A 4XXHA 3VH3A 1ZGCA 2WIBA 1JHPA 4R2IA 1R0SA 1M34B 3GEMA 1A9YA 2C5AA 4B47A 4CCSA 3A1SA 1U3GA 3IBTA 1EUQA 1DEXA 2I9PA 4ZCSA 3T52A 5ITSA 1HM5A 2GPWA 2GAFA 1UXHA 4LGVA 5JDIC 1QHYA 2ZSAA 2WP8J 1LPBB 1K88A 3UPTA 1SHLA 4IEEA 4CEHA 3IDOA 1SVWA 1T8TA 4RVOA 3UK2A 4BB5A 1VYVA 3AKCA 3ZDZB 5KYYB 4G5OA 4XPIA 3AFIA 1JTVA 1T6BY 4EAQA 4GI7A 3MWEB 4OQQA 1AA9A 4M7PA 2QM3A 3EZXA 1O89A 3G0BA 4FEYA 2RHGB 5ALLA 3U39A 1PZNA 4KZPA 2FEKA 1U90A 2AR0A 2IP1A 4E5UA 1HL7A 1PNQA 2W6JD 3MIIA 3PKJA 5HJ5A 5F5XA 1KMQA 4U2BA 2AQIA 5K0CA 1FL9A 2DLDA 2KBFA 1YFJA 2R97A 1XMXA 4HXEB 4MKGA 5AVUA 2Q9CA 4YASA 4JKOA 4LJ6A 1P60A 4Q16A 2GCGA 4R1OA 4ZDWA 4DZRA 5CDSA 4ER3A 3KYDA 1W34A 4PZDA 5TS2A 3VO8A 3CO0S 2BW0A 4DEVA 2E3JA 1U0JA 3M3DA 4MVJF 1YS6A 2C9BA 3Q0TA 3K20A 4G1VA 5CLJA 3EJ6A 1C1HA 2JA2A 3ZUGA 5CVTA 4OOEA 3MT9A 1H1LA 2D4HA 2VBFA 1XV5A 2WKRA 5BXYA 5JADA 3CSUA 2ZE6A 2NADA 3HKDB 5E2AA 3HU2A 1B00A 3DHEA 3N0XA 4ZEWA 4UCWA 2RBKA 4IS2A 3OCYA 4G1UC 2QTAA 1NMSA 1H3NA 4RU1A 1N5OX 3K4HA 1L4MA 1TM2A